2WYKA

Siap in complex with neu5gc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Siap in Complex with Neu5Gc
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
total genus 122
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wykA00
4MX6A 4PC9A 4OA4A 3B50A 4MEVA 4MAGA 4MNCA 4MCOA 4MIJA 5IGAA 4PGPA 4N6KA 4P9KA 2WYKA 4DI4B 4NX1A 4X8RA 3GYYA 5I7IA 4PAFA 2PFZA 2XWOA 4P3LA 2CEYA 4NQ8A 4XF5A 4N4UA 2XXKA 5LTCA 4P56A 4OANA 5I5PA 4MHFA 4MNIA 4MNPA 2HZLA 4O8MA 4YICA 4P47A 4MMPA 2HZKA 4PE3A 5IZZA 2CEXA 4DI3D 4NN3A 4NHBA 2WYPA 4OVQA 3FXBA 4NGUA 2WX9A 4PETA 4PCDA 4OVPA 4P8BA 4OVTA 5IM2A 4PFBA 2XA5A 4N15A 4N91A 2XWIA 2XWVA 4O94A 4XEQA 4N8YA 4NF0A 2ZZVA 4PDHA 4PFIA 4UABA 4PGNA 4PBQA 4NG7A 4PFRA 4N17A 4O7MA 5CM6A 4PAIA 4PF6A 4X04A 4YZZA 4PBHA 2VPOA 4NAPA 4N6DA 4N8GA 4PDDA 4XFEA 2VPNA 4OVSA 2HPGA 4LN5A 2XWKA 4PF8A 2ZZWA 2PFYA 3U65A 4PAKA 2ZZXA 4P1LA 4P1EA 4OVRA 2V4CA
chains in the Genus database with same CATH superfamily
4JWYA 3PD9A 4FJPA 3OO7A 4MEVA 3DELB 4MAGA 4MIJA 1ZJLA 4N6KA 1XI6A 3FVGA 1JETA 4XTCQ 4X8RA 3V83A 1VFDA 3LBSA 1ANFA 4NTLA 4EXKA 3CHGA 4EF1A 2B3FA 4WEDA 3B6TA 4ISUA 4U4XA 1MXWA 3K2DA 1USYH 3C35A 1BK4A 1NV1A 4MHFA 5I5PA 3K1PA 3U8QA 3C36A 2Y5KA 3ILTB 4X9TA 1WDNA 2H98A 2HHMA 2ZYNA 1A8EA 2IA4A 4P47A 3KC1A 3N5LA 1NH7A 4DI3D 2VHAA 2WYPA 1AL3A 4U1OA 4BDLA 5B70A 4BDNA 4AS5A 4R74A 5I3SA 2WEFA 1ZBMA 1QJMA 2ZYKA 1NV0A 3PUYE 4OZ9A 1LFHA 4RPOA 1IMBA 3VLVA 4GQOA 4KD5A 1DBZA 4R6HA 4G77A 4QFLA 1N76A 2QFLA 1QKAA 3UP9A 4PDDA 1P1WA 4XFEA 5JTYB 1Y3NA 3O29A 1LGBC 1QUJA 4DXBA 3KGCA 3R7XA 4OA4A 2V3UA 5FHMA 1Y4CA 4GIZA 1FJ6A 3TUSA 2QVVA 1NKXA 3TKDA 1SD3A 4F2QA 4E0WA 1A55A 4GWSA 1JVXA 5DW8A 1FPBA 1H43A 4LP2B 4QBAA 3LV0A 2XXHA 3SEXA 4OVJA 1KA0A 3TTLA 4NF5A 1SBPA 4P3LA 2I4BA 2CEYA 1JEUA 2PT1A 2QVUA 4JWXA 1B0HA 4R9FA 1UQWA 5CMMA 4F3SA 1NNKA 2X7QA 4YICA 1T0KA 1FBPA 1B7ZA 1TT1A 3LSLA 4LQ2A 5AA2A 1ZU0A 2QMWA 1ZLQA 2UVGA 3N26A 3IB0A 4RA1A 3T9UA 1MH3A 3C33A 2E1SA 1B3GA 3K6WA 1SYHA 4LONB 1P1UA 5H8FA 5AA2D 1JQFA 4XEQA 3TTRA 1K9ZA 4XKQA 1H76A 3PPPA 4PBQA 4ECFA 4C1UA 4N17A 3I5OA 3ISPA 1MY3A 4AB5A 5IZ1A 4F29A 1LFIA 4NWCA 1FTOA 3IOWA 5EYGA 4NF6B 5DVFA 3QIMA 4OETA 1IXHA 4F3GA 3PMWA 4O3CA 2Q2AA 2HXRA 3SKPA 3V5AA 1LLSA 4DZ1A 4WEPA 3I6VA 4RXLA 1N04A 2Y7WA 1HSLA 4Q0CA 3U72A 5BUUA 2ONKE 4GD5A 2KLFA 4KR5A 2ABHA 1WODA 3S4UA 3PUZE 1XT8A 1NUZA 2F7AA 2PFZA 1INPA 4IGTA 4GBVA 1A54A 2NOOA 2QJEA 1SI0A 4C0RA 4XKNA 3BFUA 3RUMA 1N7XA 3TQWA 4MMPA 2HXWA 2Y84A 5KDTB 2CEXA 5DEXB 4P11A 3OSQA 3ZKKA 5M2VA 5IZ3A 5IAIA 4PCDA 2Q8JA 2GFEA 4F2OA 4ZZAA 3IX1A 4JBZA 3HFUA 4XKRA 2O1MA 4YMAA 1FTLA 1FCKA 3O6IA 1JNFA 3HHFA 4OTEA 3RNNA 2ZZVA 1RKMA 4GX4A 4O7IA 4NE4A 2I0CA 3TODA 4MF3A 1B7HA 4PFIA 2RCBA 3U92A 4GWZA 5I2NA 3Q26A 3MYUA 1PC3A 4PBHA 2UVHA 3OOAA 4IY5A 3OELA 1TFDA 1Y3PA 2PVUA 5AA4A 4OERA 2DOJA 3BKIB 5DVIA 1DPEA 4U22A 1UTHA 4FIMA 4NMYA 3DLNA 4ZZEA 4KCCA 4G8NA 4JWOA 1LSTA 3MBPA 2UVIA 1FJ9A 4PC9A 5EQ8A 1R9QA 3SESA 3MW0A 3H4ZA 3R6UA 5HBCA 2P3VA 3OO6A 1B5HA 4PFYA 1YTVA 2RINA 2DS9A 4GWYA 4KYSA 1B0LA 1BLFA 3IO4A 2VGQA 1GR2A 4N4UA 5K2YA 3BBRA 2XXIA 5ESYA 2Q89A 4F31B 1B1XA 4O3AA 3HO7A 3EHSA 1FQFA 4IR8A 3G3IA 4ZEBA 2FIXA 3RTFB 1LAFE 3HCQA 4ZEFA 2I48A 4N91A 2PBWA 3TDJA 3PMXA 4QFKA 5JK4A 1MG1A 1N3WA 2XD2A 2DE3A 3DP4A 2H9BA 3JV9A 4ELRA 2DSFA 3GZGA 2F35A 1ELJA 4MH5A 3TELA 1FBDA 4U2RA 3H3GA 4PFUA 1QGXA 4GX3A 2PT2A 1FQCA 1POTA 1GGGA 4R6YA 1L5TA 2Y7KA 4P0GA 1G0IA 4YKPA 2XXWA 3M3KA 3VVEA 4GRKA 4H65A 4HE1A 3LUZA 4DXCA 3C34A 4I8CA 3GBAA 4I1DA 1MPDA 3QUJA 3GYYA 5TPAA 3FVKA 3IO6A 3U94A 3CSBA 2XHDA 2ALUA 4OFOA 1FBHA 4KPTA 4X1DA 3PD8A 4G8HA 1FBFA 1EH3A 4MNIA 1MXXA 2F6GA 2HZLA 2WKYA 3IOTA 1LEVA 4RK9A 2HZKA 3GXAA 1YYZA 2Y5LA 2DWAA 2RC7A 4FEDA 4ZEKA 5H8FB 3FXBA 5EQ7A 4GL8A 1PDAA 4ZE8A 4EUOA 3KN7A 4MLVA 4OVTA 5CBRA 2Y7IA 1IMEA 1Y1MA 4NF0A 1LBBA 4Z7EA 4GF8A 2B4MA 3S2VA 1B6HA 3UN6A 4UABA 1MXYA 3MSTA 4GWOA 1ATGA 3IR1A 1MM6A 3ODBA 3IFAA 4GL0A 2LAOA 3M3LA 1MS7A 3MZ1A 3OXNA 4YB6A 2I3WA 4KFQA 1SDXA 2QPQA 1FQAA 1R9LA 1MY4A 3OO8A 2PFYA 2QSXA 3U65A 3QUFA 1FPIA 5I59A 4PAKA 2ZZXA 1MY0A 4WXJA 4KCDA 1IMCA 1XVYA 3IB1A 2XXYA 1B40A 3RT8A 4OHNA 4ZDMA 4BDQA 2QRYA 1YXIA 5I2KA 1M5CA 2DXYA 1Q9DA 3KBRA 1Z7ME 3TAJA 2F97A 4ESWA 4OQOA 3SEWA 1LBYA 1YPNA 5H8SA 2DWJA 1KZ8A 1FTKA 2F34A 3TCHA 4H45A 1SI1A 3L6GA 5IZ3B 4IO2A 4OEVA 1JVYA 3PPNA 4IO6A 4PQJA 3O97A 4KYDA 3FV2A 2V25A 1NV3A 3MWBA 5F1QA 3IL1B 1LB9A 2XXQA 3H6VA 3C4MA 4GWWA 1USYE 3IB2A 2VD2A 2R9JA 4QFPA 4ZECA 2Q2CA 3VVDA 4PFBA 2REJA 2VOZA 5I2NB 1NV4A 3OD7A 3C31A 5AA4B 3A3CA 1B7UA 1S9TA 4GBWA 4PGNA 4PFRA 2P1SA 2X26A 1ZKBA 3O6GA 4ELQA 3SEYA 1UTHB 4YZZA 4BLAA 5L9SA 3MJNA 4IO3A 1FBCA 3SEUA 5H8HA 1Q1KA 1XS5A 4R2FA 4PTKA 4WKMA 4OVSA 5EQ9A 3LSWA 4OESA 3HHGA 1LBCA 4JVDA 4PE5B 4HXVA 5ET8A 3HPIA 4OFLA 1FTJA 4I40A 3FXRA 3KOTA 5KZTA 1K9YA 4O3BA 4G68A 2Y7RA 3KBZA 2RKMA 3MP8A 1UTBA 1ZIUA 1JW4A 3SZPA 4GXSB 1MQHA 3EQ1A 1B3EA 2YJPA 3KZGA 3SDFA 4F1UA 2B4LA 2P0SA 2XD3A 4DLDA 3BIHA 3E4RA 1QULA 4FATA 2ONRA 1NFTA 2O1LA 1MH4A 1YZ0A 4F22A 1URSA 3O66A 5T3JA 4E0XA 3EPEA 4PP0A 2GRVA 4RYAA 1NV5A 4NHBA 2DQVA 2QS3A 4LZ7A 3TCFA 3TCGA 3ZSFA 3FD3A 3G7WA 4ZEDA 1ZMGA 4KYEA 3UA8A 4N15A 1PEBA 3KJ7A 3E78A 3T9XB 3CFLA 4EQBA 1Y3QA 4EF2A 3W15C 4IGRA 2OWTA 4ZEIA 3VFJA 4GLIA 5L9OA 1FPLA 3KFMA 3KSJA 1Z7NE 2VP1A 1CB6A 4Z0IA 2DDKA 1SW4A 2NUVA 1N0TA 2QS1A 3K02A 4QXDA 4MFIA 2KR0A 4DE8A 4F1YA 2ZZWA 1MRPA 1EZ9A 4BDOA 1H45A 3PPRA 4H8IA 4U1ZA 2Y7PA 3EF7A 3K6XA 4G8MA 4MX6A 3WAEA 1GTKA 2UVJA 5TPAB 4XKPA 4HE2A 4MNCA 3KC0A 3IOUA 5EHSA 4OENA 2F6PA 4G4PA 3M8UA 3IORA 4DCYA 4EQ7A 4MLQA 5I7IA 3MZBA 3RTWB 1B9JA 2DYXA 3F11A 1NV7A 2XWOA 4NQ8A 2L5VA 1FQEA 4G68C 2AL5A 1IEJA 2V93A 2F3BA 4KHZE 1GV8A 2KQZA 3UGWA 3L6HA 4DCXA 1SW1A 3K1MA 2VT5A 1DSNA 5TP9A 2H5YA 1O64A 4JSOA 1PB8A 2GH9A 5IZZA 4I9DA 1URGA 3S9EA 4HTGA 3RN8A 4NF8A 5L9MA 3CIJA 3E9XA 3K6UA 4EQ9A 1MY2A 2F36A 4R2BA 3W9WA 4I3YA 4R9GA 1SW2A 3K6VA 1LBWA 5HM4B 2ONSA 2CZHA 1NUXA 2Z23A 1TFAA 2REGA 5I59B 4YKIA 1NUYA 1FTMA 5FTHA 2VPNA 1AMFA 2JJKA 3VLUA 2ZNUA 5CBSA 1QW0A 3TQLA 2FHYA 3QXMA 5I2KB 4P1EA 2RCAA 4F39A 4ONYA 1NH8A 4GX6A 5F7VA 3IJXB 1IUDA 5IGAA 1B3HA 1FPFA 2P2AA 2FVZA 1JW5A 4RJZA 4Q8RA 3H03A 3HN0A 2ZMBA 2D21A 2GQ1A 5LTCA 5EQAA 2NWJA 1Y1ZA 1LBZA 4QF9A 3MVYA 1LBXA 1OQHA 1LAGE 3KEIA 1AWBA 2HQ0A 5CMBA 1D9VA 2YLNA 1URDA 4HCYA 1A7LA 1SQYA 3FJGA 2ZNTA 3IJOB 1HSJA 2CZKA 4ELOA 3H7MA 2ZXTA 2Z22A 1JEVA 1JW1A 1Y9UA 4JXIA 4I3EA 5H8HB 3CVGA 2FIEA 5CM6A 1J1NA 5TU0A 4LQ5A 4X1BA 3H6UA 4G68B 4PF8A 3PU5A 2H4IA 4KXPA 5ET5A 1UTBB 4H5GA 1US5A 4N6PA 1RYXA 2OJTA 1FW0A 1KWHA 2XXRA 3RGYA 4IY6A 1CE2A 2FBPA 2QL3A 4MCOA 2AL4A 3G3FA 3C9HA 4AB6A 1IITA 4NEDA 4PFTA 3A29A 1FSAA 1I6BA 2I58A 4JVCA 4P9KA 4BDMA 5B7DA 1B52A 4UA8A 5KCJA 3FUZA 2OK2A 5CC2A 3R26A 3VLWA 2RC9A 1D9QA 2HAVA 4NWDA 1EZOA 4YU0A 4G61A 5FHNA 5DVJA 2V3TA 2HCAA 1RDXA 1XOCA 1POY1 2WX9A 4YB7A 1EZPA 4RY1A 3PTYA 2BJIA 3EHUA 1OQGA 2XWVA 4I62A 1SVXB 4F3BA 3KOSA 2R8TA 5CMCA 1B32A 3LSFB 3RQTA 1MDP1 2O7IA 3VV5A 2OX3A 4NG7A 3LR1A 5ITOA 3MPKA 3MVXA 3V89B 4H46A 2HEUA 3D4CA 1DTZA 4MJOA 3K4UA 3FASA 1MPBA 3PUXE 4OMBA 1S7YA 3FXUA 2ZYOA 4BDRA 4KQPA 1NV6A 4R6KA 4LN5A 4OFJA 3KN3A 3TZAA 4OEUA 4P0IA 4IB2A 2XX9A 4P1LA 1FBEA 2F78A 5J1DA 3B6WA 4LVQA 3T9HB 4LZ5A 2OLBA 3KJTA 3IFCA 4FBPA 3G3KA 3FVOA 1QUIA 3IOVA 4PAFA 3OEMA 1EU8A 3N94A 4GFRA 4HE0A 5TP9B 3Q25A 4NF4A 4HW8A 2AIXA 1UIVA 1PBQA 3TEPA 5I56A 1SPIA 2I0BA 2H25A 1MM7A 1MXUA 2UXAA 3RPWA 4NF8B 4TLMB 3SERA 1BTJA 1XC1A 3TFLA 4YAHX 3CFZA 3T93B 5CMKA 1B05A 4ND9A 2V3QA 4PETA 4FE8A 1P99A 4N81A 3ILUB 3PV0E 1B3LA 5AA3A 1FPDA 2F7BA 2XA5A 2PCRA 4FEBA 3E13X 1R6ZA 3MPLA 1MDQA 1IQ7A 1DK4A 3VE1B 3G3GA 1A8FA 3DP8A 4QFOA 3PMVA 4OXVA 4LA9A 2NVUB 2XXVA 1OVBA 1B1HA 1MXVA 2DVZA 2Z8FA 1RDYA 1FTAA 1LCTA 4QSCA 3MVZA 4N8GA 4N13A 1M5BA 1MQDA 4KI0E 2F8DA 2ZNSA 2X7PA 4U4SA 1BKAA 2DWHA 3K01A 2XXTA 1N7WA 3FBPA 1B3FA 1VSOA 5CRYA 3OMBA 4F1VA 1IMDA 2UYFA 5CI5A 3Q28A 3ECRA 3RT6B 1BP5A 4H0WA 3LUYA 1IMFA 4YMBA 1B46A 4NX1A 2WBBA 1I6QA 1YAEA 3TTMA 1B4HA 3JZJA 4RNSA 1F9BA 1I69A 2M8CA 3D1RA 4YKJA 3TPAA 2VD3A 4P56A 4GOTA 2CMOA 4ZS9A 4RK2A 1HSEA 4MNPA 1OLAA 5A5XA 2GHAA 4POWA 5F24A 2AYSA 3AXFA 5ICTA 3E3KA 2ESNA 1EYJA 2Z8EA 3RLFE 3SETA 3CSGA 3G3HA 2R6GE 1D3KA 4QSDA 1D9YA 1UIUA 2DWIA 1MQJA 2DP8A 1VFEA 1GVCA 1IXGA 5ET6A 1A40A 2DE4A 5I57A 3PGFA 3T22A 1XVXA 4QFNA 1IIWA 3K1NA 1OLCA 4L17A 3MQ9A 2DE2A 3THIA 5FTIA 4K3FA 2VPOA 1O63A 1VDWA 4NAPA 5EYFA 3U1OA 4FAJA 1YCJA 2HPGA 2NXOA 3FJMA 4C1TA 1JP4A 2FYIA 3LC8A 1VE4A 3MVWA 2DXRA 2THIA 2O7UA 2A5TA 4AS4A 5EHMA 3Q27A 1OMPA 3OO9A 4HS7A 4HCWA 1PBPA 4IO7A 3T96B 1D4NA 4XIGQ 4QSEA 5KCJB 2QMXA 5BWJA 4DIGA 1DTGA 3U93A 3TYHA 2WYKA 4XXUA 3K0VA 5I58A 3N6UA 1AOVA 5LDZA 1CNQA 2DVCA 1NUWA 1MQGA 4XF5A 3FV1A 4OANA 4U21A 4MBPA 4R73A 5H8QA 3BFTA 3RPLA 3KN8A 3T0JA 1FRPA 1N84A 1WVJA 3O28A 3RY3A 1FPGA 3DM0A 4H67A 4NN3A 2A5SA 4YB5A 4OVQA 2OBGA 5ISUA 3MAMA 1MXZA 1Y20A 3FVNA 3DP6A 1P1QA 3MC2A 5IM2A 3EHTA 3NOHA 1LAXA 2P3NA 1FQDA 1DPPA 4PFWA 1FPKA 1G0HA 1QKBA 3FIRA 2H99A 4R72A 3QYTA 4LATA 1M5FA 2XXUA 4POXA 2E0SA 5LOMA 4LUBA 3H06B 3JYRA 3FZVA 2F3DA 4G2ZA 1FPEA 4ESXA 2BJJX 3QMFA 3WAFA 1II5A 5A5LA 3QSLA 1M5EA 1PB9A 5AA1A 2FA7A 4GXAA 3K00A 3T1BA 3P7IA 4FORA 1B5IA 3S9LC 2RF1A 2B65A 3A3UA 4H6DA 1B5JA 2RC8A 3CRBA 5H8NA 4NF4B 1S50A 4DI4B 1H44A 1I6AA 4F18A 4LZ8A 5I56B 4AQ4A 2Z8DA 1DOTA 1LB8A 2XXPA 1LAHE 1QUKA 2PMSA 3H6TA 4M4GA 1NNPA 1FPJA 3S9MC 4N07A 1IZ1A 1NI9A 1M5DA 1A99A 1H3DA 3TTNA 3CFXA 3IK6B 3PPQA 4OVPA 5EYHA 4GVOA 1IXCA 4IO5A 3VXCA 3CR9A 4O94A 3HV1A 3RYDA 1B2HA 3B6QA 1FQBA 2Q88A 3O6HA 3FJ7A 2D5WA 1SW5A 3CG3A 1R1NA 1OIBA 2XX8A 1AIVA 3T66A 4RPNA 3O9PA 5DTBA 2PX1A 3CG1A 3LSXA 3B8BA 2CZIA 1XHYA 4JDFA 3OEKA 4N6DA 3ROJA 1EYIA 1LFGA 3FATA 1BIYA 4TQUQ 3MP6A 1EYKA 4DDDA 5ELVA 3MP1A 1MY1A 1P1NA 2I6EA 1AH5A 4OVRA 4X48A 2V4CA 5JTYA 2QS4A 3ONMA 4M1VA 4UACA 3B50A 1ZTYA 4JSDA 3VDFA 1SYIA 4DXUA 4PGPA 5JEIA 1TWYA 4H8JA 2FNCA 5DT6A 1FBGA 2HAUA 1B58A 2OWSA 5A5XB 1NNTA 4EXLA 3EN3A 3GBBA 5ITPA 1NNFA 2XXXA 4JB7A 3G3JA 3M3FA 2CZLA 2O68A 4PE3A 4R75A 3H6WA 1LCFA 4NGUA 2G29A 1P1OA 5I57B 2D3IA 2F7CA 2ZYMA 4ELPA 5AE4A 1IXIA 3O2AA 4F19A 3SEVA 1NMUA 3D4GA 2OCUA 4N8YA 3EKIA 2O6AA 5K2XA 3OSRA 2O51A 2F5XA 3IAZA 4Q5TA 1TXFA 2PYYA 2B3BA 2OZZA 3PPOA 4O7MA 2I3VA 2O84X 4PF6A 4JVIA 3UORA 2MKZA 2W7YA 3GLBA 4NF5B 1B51A 1Q35A 2A5TB 3QK6A 5I84A 1B4ZA 5ICQA 2IEEA 3UK4A 2R71A 4NF6A 5I58B 5AA2B 3Q29A 1VR5A 4ZE9A 2G93A 1NL5A 5FHOA 2O69A 3KG2A 1Y4TA 5ET7A 2QVRA 5H8QB 3I3VA 3RPLB 3W9VA 3QAXA 2I4CA 2XXKA 4YKKA 1RYOA 1RDZA 4TLLB 3UIFA 1KA1A 3A09A 4O8MA 3KSXA 4U23A 4EDPA 3USDA 3VVFA 4Q30B 5DYHA 3PUVE 3PUWE 3FGSA 2ANJA 1MQIA 4IO4A 5FBPA 3TTKA 3V8XB 3ZKLA 3N6TA 2OWZA 2UYEA 4QRZA 5KDTA 4P8BA 4TOZA 3FXQA 2Q74A 2XX7A 4F3PA 5DEXA 2XWIA 2GHBA 5J16A 2Q8MA 4H5FA 1LBVA 3S9NC 3T9VA 3MUQA 4OWDA 3B7DA 4PDHA 3OENA 1MPCA 4GWUA 2WBDA 5IKBA 1DCUA 4PAIA 3TMGA 4X04A 4THIA 1O7TA 3ZS6A 2V84A 1US4A 1PB7A 3VXBA 3C32A 5L8DA 3E79A 1IMAA 4OYVA 1OVTA 3HSTA 2YPNA 3MZ9A 2XWKA 4H1XA 4QHQA 4GWXA 2Q9TA 2QS2A 1DMBA 3CI8A 1NV2A 5HPQA 3BIGA 4FECA 2I49A 5H8NB 1QVSA 1N3XA 2HFBA
chains in the Genus database with same CATH topology
1G0IA 4HCWA 4MEVA 4MAGA 4MIJA 4GX6A 4HE1A 3LUZA 5IGAA 4N6KA 1XI6A 1FPFA 2WYKA 4X8RA 3GYYA 2FVZA 5LDZA 1CNQA 1NUWA 3CHGA 4XF5A 1FBHA 2GQ1A 5LTCA 1BK4A 1FBFA 5EQAA 4OANA 1NV1A 4MHFA 5I5PA 4MNIA 2HZLA 2Y5KA 4X9TA 2HHMA 1LBZA 1LBXA 3RPLA 3T0JA 1FRPA 4P47A 1LEVA 1AWBA 2HZKA 1YYZA 2Y5LA 3KC1A 1FPGA 4DI3D 4NN3A 2WYPA 4OVQA 3FXBA 5EQ7A 4HCYA 2CZKA 4AS5A 4OVTA 5I3SA 2WEFA 5IM2A 3NOHA 1NV0A 2P3NA 1IMEA 4NF0A 1FPKA 2B4MA 1G0HA 4UABA 3MSTA 4I3EA 1IMBA 2FIEA 5CM6A 3IFAA 1DBZA 2QFLA 4PDDA 4XFEA 2QPQA 4PF8A 2F3DA 2PFYA 3U65A 1FPEA 4KXPA 1FPIA 5ET5A 3QMFA 4PAKA 2ZZXA 5A5LA 1IMCA 4OA4A 3T1BA 2FBPA 1FJ6A 4MCOA 2QVVA 1YXIA 3A29A 1FSAA 4GWSA 4P9KA 4JVCA 5DW8A 1FPBA 1Q9DA 4QBAA 4DI4B 3LV0A 4F18A 1LBYA 1KA0A 4P3LA 2CEYA 2QVUA 1KZ8A 4H45A 1D9QA 5IZ3B 4YICA 1FBPA 1FPJA 4G61A 1NV3A 1RDXA 1NI9A 2WX9A 3PTYA 4GWWA 2BJIA 4OVPA 5EYHA 4PFBA 2XWVA 4O94A 4XEQA 2R8TA 3RYDA 1NV4A 1K9ZA 4GBWA 4PGNA 4PBQA 2OX3A 4NG7A 4PFRA 4N17A 4H46A 3ISPA 4YZZA 4MJOA 3B8BA 2CZIA 5IZ1A 4N6DA 3ROJA 1EYIA 1FBCA 4PTKA 1NV6A 4OVSA 1EYKA 4LN5A 5EYGA 5EQ9A 4JVDA 4HXVA 2HXRA 5ET8A 4P1LA 1FBEA 4I40A 5J1DA 4OVRA 2V4CA 1K9YA 4M1VA 3B50A 3KBZA 4PGPA 3SZPA 3IFCA 4FBPA 1FBGA 4F1UA 1NUZA 2B4LA 2PFZA 4PAFA 1INPA 3BIHA 4HE0A 4GBVA 1YZ0A 1SPIA 5T3JA 4MMPA 4PE3A 1NV5A 2CEXA 4NHBA 4NGUA 2V3QA 4PETA 5IZ3A 4PCDA 4N81A 3HFUA 1FPDA 2XA5A 4N15A 4F19A 4N8YA 3E78A 3EKIA 2PCRA 2ZZVA 4O7IA 4GX4A 2F5XA 1DK4A 4PFIA 4GWZA 1FPLA 4O7MA 3MYUA 4PF6A 4JVIA 4PBHA 2MKZA 2DVZA 1RDYA 1FTAA 4N8GA 2DDKA 4QXDA 2KR0A 2ZZWA 1FJ9A 4MX6A 4PC9A 3FBPA 5EQ8A 4F1VA 1IMDA 4HE2A 4MNCA 3KC0A 2P3VA 1IMFA 4NX1A 4GWYA 2WBBA 5ET7A 5I7IA 1NV7A 2QVRA 2XWOA 4NQ8A 3RPLB 3W9VA 3D1RA 2L5VA 4N4UA 2XXKA 2F3BA 4P56A 1RDZA 2KQZA 1KA1A 5ESYA 4MNPA 4O8MA 2VT5A 5F24A 5IZZA 4IR8A 1EYJA 5FBPA 2OWZA 2FIXA 4P8BA 2Q74A 4N91A 2XWIA 5J16A 2Q8MA 1LBVA 5ET6A 5JK4A 2DE4A 3W9WA 4PDHA 4I3YA 4GWUA 2DE3A 2WBDA 1DCUA 1LBWA 4PAIA 4X04A 2CZHA 1NUXA 2DE2A 2VPOA 1VDWA 4NAPA 1NUYA 3E79A 1IMAA 1FBDA 2VPNA 2HPGA 2XWKA 1JP4A 2JJKA 1QGXA 4GX3A 4GWXA 2Q9TA 1NV2A 3BIGA 2FHYA 4AS4A 4P1EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MX6 A;  4PC9 A;  4OA4 A;  3B50 A;  4MEV A;  4MAG A;  4MNC A;  4MCO A;  4MIJ A;  5IGA A;  4PGP A;  4N6K A;  4P9K A;  2WYK A;  4DI4 B;  4NX1 A;  4X8R A;  3GYY A;  5I7I A;  4PAF A;  2PFZ A;  2XWO A;  4P3L A;  2CEY A;  4NQ8 A;  4XF5 A;  4N4U A;  2XXK A;  5LTC A;  4P56 A;  4OAN A;  5I5P A;  4MHF A;  4MNI A;  4MNP A;  2HZL A;  4O8M A;  4YIC A;  4P47 A;  4MMP A;  2HZK A;  4PE3 A;  5IZZ A;  2CEX A;  4DI3 D;  4NN3 A;  4NHB A;  2WYP A;  4OVQ A;  3FXB A;  4NGU A;  2WX9 A;  4PET A;  4PCD A;  4OVP A;  4P8B A;  4OVT A;  5IM2 A;  4PFB A;  2XA5 A;  4N15 A;  4N91 A;  2XWI A;  2XWV A;  4O94 A;  4XEQ A;  4N8Y A;  4NF0 A;  2ZZV A;  4PDH A;  4PFI A;  4UAB A;  4PGN A;  4PBQ A;  4NG7 A;  4PFR A;  4N17 A;  4O7M A;  5CM6 A;  4PAI A;  4PF6 A;  4X04 A;  4YZZ A;  4PBH A;  2VPO A;  4NAP A;  4N6D A;  4N8G A;  4PDD A;  4XFE A;  2VPN A;  4OVS A;  2HPG A;  4LN5 A;  2XWK A;  4PF8 A;  2ZZW A;  2PFY A;  3U65 A;  4PAK A;  2ZZX A;  4P1L A;  4P1E A;  4OVR A;  2V4C A; 
#chains in the Genus database with same CATH topology
 4JWY A;  3PD9 A;  4FJP A;  3OO7 A;  4MEV A;  3DEL B;  4MAG A;  4MIJ A;  1ZJL A;  4N6K A;  1XI6 A;  3FVG A;  1JET A;  4XTC Q;  4X8R A;  3V83 A;  1VFD A;  3LBS A;  1ANF A;  4NTL A;  4EXK A;  3CHG A;  4EF1 A;  2B3F A;  4WED A;  3B6T A;  4ISU A;  4U4X A;  1MXW A;  3K2D A;  1USY H;  3C35 A;  1BK4 A;  1NV1 A;  4MHF A;  5I5P A;  3K1P A;  3U8Q A;  3C36 A;  2Y5K A;  3ILT B;  4X9T A;  1WDN A;  2H98 A;  2HHM A;  2ZYN A;  1A8E A;  2IA4 A;  4P47 A;  3KC1 A;  3N5L A;  1NH7 A;  4DI3 D;  2VHA A;  2WYP A;  1AL3 A;  4U1O A;  4BDL A;  5B70 A;  4BDN A;  4AS5 A;  4R74 A;  5I3S A;  2WEF A;  1ZBM A;  1QJM A;  2ZYK A;  1NV0 A;  3PUY E;  4OZ9 A;  1LFH A;  4RPO A;  1IMB A;  3VLV A;  4GQO A;  4KD5 A;  1DBZ A;  4R6H A;  4G77 A;  4QFL A;  1N76 A;  2QFL A;  1QKA A;  3UP9 A;  4PDD A;  1P1W A;  4XFE A;  5JTY B;  1Y3N A;  3O29 A;  1LGB C;  1QUJ A;  4DXB A;  3KGC A;  3R7X A;  4OA4 A;  2V3U A;  5FHM A;  1Y4C A;  4GIZ A;  1FJ6 A;  3TUS A;  2QVV A;  1NKX A;  3TKD A;  1SD3 A;  4F2Q A;  4E0W A;  1A55 A;  4GWS A;  1JVX A;  5DW8 A;  1FPB A;  1H43 A;  4LP2 B;  4QBA A;  3LV0 A;  2XXH A;  3SEX A;  4OVJ A;  1KA0 A;  3TTL A;  4NF5 A;  1SBP A;  4P3L A;  2I4B A;  2CEY A;  1JEU A;  2PT1 A;  2QVU A;  4JWX A;  1B0H A;  4R9F A;  1UQW A;  5CMM A;  4F3S A;  1NNK A;  2X7Q A;  4YIC A;  1T0K A;  1FBP A;  1B7Z A;  1TT1 A;  3LSL A;  4LQ2 A;  5AA2 A;  1ZU0 A;  2QMW A;  1ZLQ A;  2UVG A;  3N26 A;  3IB0 A;  4RA1 A;  3T9U A;  1MH3 A;  3C33 A;  2E1S A;  1B3G A;  3K6W A;  1SYH A;  4LON B;  1P1U A;  5H8F A;  5AA2 D;  1JQF A;  4XEQ A;  3TTR A;  1K9Z A;  4XKQ A;  1H76 A;  3PPP A;  4PBQ A;  4ECF A;  4C1U A;  4N17 A;  3I5O A;  3ISP A;  1MY3 A;  4AB5 A;  5IZ1 A;  4F29 A;  1LFI A;  4NWC A;  1FTO A;  3IOW A;  5EYG A;  4NF6 B;  5DVF A;  3QIM A;  4OET A;  1IXH A;  4F3G A;  3PMW A;  4O3C A;  2Q2A A;  2HXR A;  3SKP A;  3V5A A;  1LLS A;  4DZ1 A;  4WEP A;  3I6V A;  4RXL A;  1N04 A;  2Y7W A;  1HSL A;  4Q0C A;  3U72 A;  5BUU A;  2ONK E;  4GD5 A;  2KLF A;  4KR5 A;  2ABH A;  1WOD A;  3S4U A;  3PUZ E;  1XT8 A;  1NUZ A;  2F7A A;  2PFZ A;  1INP A;  4IGT A;  4GBV A;  1A54 A;  2NOO A;  2QJE A;  1SI0 A;  4C0R A;  4XKN A;  3BFU A;  3RUM A;  1N7X A;  3TQW A;  4MMP A;  2HXW A;  2Y84 A;  5KDT B;  2CEX A;  5DEX B;  4P11 A;  3OSQ A;  3ZKK A;  5M2V A;  5IZ3 A;  5IAI A;  4PCD A;  2Q8J A;  2GFE A;  4F2O A;  4ZZA A;  3IX1 A;  4JBZ A;  3HFU A;  4XKR A;  2O1M A;  4YMA A;  1FTL A;  1FCK A;  3O6I A;  1JNF A;  3HHF A;  4OTE A;  3RNN A;  2ZZV A;  1RKM A;  4GX4 A;  4O7I A;  4NE4 A;  2I0C A;  3TOD A;  4MF3 A;  1B7H A;  4PFI A;  2RCB A;  3U92 A;  4GWZ A;  5I2N A;  3Q26 A;  3MYU A;  1PC3 A;  4PBH A;  2UVH A;  3OOA A;  4IY5 A;  3OEL A;  1TFD A;  1Y3P A;  2PVU A;  5AA4 A;  4OER A;  2DOJ A;  3BKI B;  5DVI A;  1DPE A;  4U22 A;  1UTH A;  4FIM A;  4NMY A;  3DLN A;  4ZZE A;  4KCC A;  4G8N A;  4JWO A;  1LST A;  3MBP A;  2UVI A;  1FJ9 A;  4PC9 A;  5EQ8 A;  1R9Q A;  3SES A;  3MW0 A;  3H4Z A;  3R6U A;  5HBC A;  2P3V A;  3OO6 A;  1B5H A;  4PFY A;  1YTV A;  2RIN A;  2DS9 A;  4GWY A;  4KYS A;  1B0L A;  1BLF A;  3IO4 A;  2VGQ A;  1GR2 A;  4N4U A;  5K2Y A;  3BBR A;  2XXI A;  5ESY A;  2Q89 A;  4F31 B;  1B1X A;  4O3A A;  3HO7 A;  3EHS A;  1FQF A;  4IR8 A;  3G3I A;  4ZEB A;  2FIX A;  3RTF B;  1LAF E;  3HCQ A;  4ZEF A;  2I48 A;  4N91 A;  2PBW A;  3TDJ A;  3PMX A;  4QFK A;  5JK4 A;  1MG1 A;  1N3W A;  2XD2 A;  2DE3 A;  3DP4 A;  2H9B A;  3JV9 A;  4ELR A;  2DSF A;  3GZG A;  2F35 A;  1ELJ A;  4MH5 A;  3TEL A;  1FBD A;  4U2R A;  3H3G A;  4PFU A;  1QGX A;  4GX3 A;  2PT2 A;  1FQC A;  1POT A;  1GGG A;  4R6Y A;  1L5T A;  2Y7K A;  4P0G A;  1G0I A;  4YKP A;  2XXW A;  3M3K A;  3VVE A;  4GRK A;  4H65 A;  4HE1 A;  3LUZ A;  4DXC A;  3C34 A;  4I8C A;  3GBA A;  4I1D A;  1MPD A;  3QUJ A;  3GYY A;  5TPA A;  3FVK A;  3IO6 A;  3U94 A;  3CSB A;  2XHD A;  2ALU A;  4OFO A;  1FBH A;  4KPT A;  4X1D A;  3PD8 A;  4G8H A;  1FBF A;  1EH3 A;  4MNI A;  1MXX A;  2F6G A;  2HZL A;  2WKY A;  3IOT A;  1LEV A;  4RK9 A;  2HZK A;  3GXA A;  1YYZ A;  2Y5L A;  2DWA A;  2RC7 A;  4FED A;  4ZEK A;  5H8F B;  3FXB A;  5EQ7 A;  4GL8 A;  1PDA A;  4ZE8 A;  4EUO A;  3KN7 A;  4MLV A;  4OVT A;  5CBR A;  2Y7I A;  1IME A;  1Y1M A;  4NF0 A;  1LBB A;  4Z7E A;  4GF8 A;  2B4M A;  3S2V A;  1B6H A;  3UN6 A;  4UAB A;  1MXY A;  3MST A;  4GWO A;  1ATG A;  3IR1 A;  1MM6 A;  3ODB A;  3IFA A;  4GL0 A;  2LAO A;  3M3L A;  1MS7 A;  3MZ1 A;  3OXN A;  4YB6 A;  2I3W A;  4KFQ A;  1SDX A;  2QPQ A;  1FQA A;  1R9L A;  1MY4 A;  3OO8 A;  2PFY A;  2QSX A;  3U65 A;  3QUF A;  1FPI A;  5I59 A;  4PAK A;  2ZZX A;  1MY0 A;  4WXJ A;  4KCD A;  1IMC A;  1XVY A;  3IB1 A;  2XXY A;  1B40 A;  3RT8 A;  4OHN A;  4ZDM A;  4BDQ A;  2QRY A;  1YXI A;  5I2K A;  1M5C A;  2DXY A;  1Q9D A;  3KBR A;  1Z7M E;  3TAJ A;  2F97 A;  4ESW A;  4OQO A;  3SEW A;  1LBY A;  1YPN A;  5H8S A;  2DWJ A;  1KZ8 A;  1FTK A;  2F34 A;  3TCH A;  4H45 A;  1SI1 A;  3L6G A;  5IZ3 B;  4IO2 A;  4OEV A;  1JVY A;  3PPN A;  4IO6 A;  4PQJ A;  3O97 A;  4KYD A;  3FV2 A;  2V25 A;  1NV3 A;  3MWB A;  5F1Q A;  3IL1 B;  1LB9 A;  2XXQ A;  3H6V A;  3C4M A;  4GWW A;  1USY E;  3IB2 A;  2VD2 A;  2R9J A;  4QFP A;  4ZEC A;  2Q2C A;  3VVD A;  4PFB A;  2REJ A;  2VOZ A;  5I2N B;  1NV4 A;  3OD7 A;  3C31 A;  5AA4 B;  3A3C A;  1B7U A;  1S9T A;  4GBW A;  4PGN A;  4PFR A;  2P1S A;  2X26 A;  1ZKB A;  3O6G A;  4ELQ A;  3SEY A;  1UTH B;  4YZZ A;  4BLA A;  5L9S A;  3MJN A;  4IO3 A;  1FBC A;  3SEU A;  5H8H A;  1Q1K A;  1XS5 A;  4R2F A;  4PTK A;  4WKM A;  4OVS A;  5EQ9 A;  3LSW A;  4OES A;  3HHG A;  1LBC A;  4JVD A;  4PE5 B;  4HXV A;  5ET8 A;  3HPI A;  4OFL A;  1FTJ A;  4I40 A;  3FXR A;  3KOT A;  5KZT A;  1K9Y A;  4O3B A;  4G68 A;  2Y7R A;  3KBZ A;  2RKM A;  3MP8 A;  1UTB A;  1ZIU A;  1JW4 A;  3SZP A;  4GXS B;  1MQH A;  3EQ1 A;  1B3E A;  2YJP A;  3KZG A;  3SDF A;  4F1U A;  2B4L A;  2P0S A;  2XD3 A;  4DLD A;  3BIH A;  3E4R A;  1QUL A;  4FAT A;  2ONR A;  1NFT A;  2O1L A;  1MH4 A;  1YZ0 A;  4F22 A;  1URS A;  3O66 A;  5T3J A;  4E0X A;  3EPE A;  4PP0 A;  2GRV A;  4RYA A;  1NV5 A;  4NHB A;  2DQV A;  2QS3 A;  4LZ7 A;  3TCF A;  3TCG A;  3ZSF A;  3FD3 A;  3G7W A;  4ZED A;  1ZMG A;  4KYE A;  3UA8 A;  4N15 A;  1PEB A;  3KJ7 A;  3E78 A;  3T9X B;  3CFL A;  4EQB A;  1Y3Q A;  4EF2 A;  3W15 C;  4IGR A;  2OWT A;  4ZEI A;  3VFJ A;  4GLI A;  5L9O A;  1FPL A;  3KFM A;  3KSJ A;  1Z7N E;  2VP1 A;  1CB6 A;  4Z0I A;  2DDK A;  1SW4 A;  2NUV A;  1N0T A;  2QS1 A;  3K02 A;  4QXD A;  4MFI A;  2KR0 A;  4DE8 A;  4F1Y A;  2ZZW A;  1MRP A;  1EZ9 A;  4BDO A;  1H45 A;  3PPR A;  4H8I A;  4U1Z A;  2Y7P A;  3EF7 A;  3K6X A;  4G8M A;  4MX6 A;  3WAE A;  1GTK A;  2UVJ A;  5TPA B;  4XKP A;  4HE2 A;  4MNC A;  3KC0 A;  3IOU A;  5EHS A;  4OEN A;  2F6P A;  4G4P A;  3M8U A;  3IOR A;  4DCY A;  4EQ7 A;  4MLQ A;  5I7I A;  3MZB A;  3RTW B;  1B9J A;  2DYX A;  3F11 A;  1NV7 A;  2XWO A;  4NQ8 A;  2L5V A;  1FQE A;  4G68 C;  2AL5 A;  1IEJ A;  2V93 A;  2F3B A;  4KHZ E;  1GV8 A;  2KQZ A;  3UGW A;  3L6H A;  4DCX A;  1SW1 A;  3K1M A;  2VT5 A;  1DSN A;  5TP9 A;  2H5Y A;  1O64 A;  4JSO A;  1PB8 A;  2GH9 A;  5IZZ A;  4I9D A;  1URG A;  3S9E A;  4HTG A;  3RN8 A;  4NF8 A;  5L9M A;  3CIJ A;  3E9X A;  3K6U A;  4EQ9 A;  1MY2 A;  2F36 A;  4R2B A;  3W9W A;  4I3Y A;  4R9G A;  1SW2 A;  3K6V A;  1LBW A;  5HM4 B;  2ONS A;  2CZH A;  1NUX A;  2Z23 A;  1TFA A;  2REG A;  5I59 B;  4YKI A;  1NUY A;  1FTM A;  5FTH A;  2VPN A;  1AMF A;  2JJK A;  3VLU A;  2ZNU A;  5CBS A;  1QW0 A;  3TQL A;  2FHY A;  3QXM A;  5I2K B;  4P1E A;  2RCA A;  4F39 A;  4ONY A;  1NH8 A;  4GX6 A;  5F7V A;  3IJX B;  1IUD A;  5IGA A;  1B3H A;  1FPF A;  2P2A A;  2FVZ A;  1JW5 A;  4RJZ A;  4Q8R A;  3H03 A;  3HN0 A;  2ZMB A;  2D21 A;  2GQ1 A;  5LTC A;  5EQA A;  2NWJ A;  1Y1Z A;  1LBZ A;  4QF9 A;  3MVY A;  1LBX A;  1OQH A;  1LAG E;  3KEI A;  1AWB A;  2HQ0 A;  5CMB A;  1D9V A;  2YLN A;  1URD A;  4HCY A;  1A7L A;  1SQY A;  3FJG A;  2ZNT A;  3IJO B;  1HSJ A;  2CZK A;  4ELO A;  3H7M A;  2ZXT A;  2Z22 A;  1JEV A;  1JW1 A;  1Y9U A;  4JXI A;  4I3E A;  5H8H B;  3CVG A;  2FIE A;  5CM6 A;  1J1N A;  5TU0 A;  4LQ5 A;  4X1B A;  3H6U A;  4G68 B;  4PF8 A;  3PU5 A;  2H4I A;  4KXP A;  5ET5 A;  1UTB B;  4H5G A;  1US5 A;  4N6P A;  1RYX A;  2OJT A;  1FW0 A;  1KWH A;  2XXR A;  3RGY A;  4IY6 A;  1CE2 A;  2FBP A;  2QL3 A;  4MCO A;  2AL4 A;  3G3F A;  3C9H A;  4AB6 A;  1IIT A;  4NED A;  4PFT A;  3A29 A;  1FSA A;  1I6B A;  2I58 A;  4JVC A;  4P9K A;  4BDM A;  5B7D A;  1B52 A;  4UA8 A;  5KCJ A;  3FUZ A;  2OK2 A;  5CC2 A;  3R26 A;  3VLW A;  2RC9 A;  1D9Q A;  2HAV A;  4NWD A;  1EZO A;  4YU0 A;  4G61 A;  5FHN A;  5DVJ A;  2V3T A;  2HCA A;  1RDX A;  1XOC A;  1POY 1;  2WX9 A;  4YB7 A;  1EZP A;  4RY1 A;  3PTY A;  2BJI A;  3EHU A;  1OQG A;  2XWV A;  4I62 A;  1SVX B;  4F3B A;  3KOS A;  2R8T A;  5CMC A;  1B32 A;  3LSF B;  3RQT A;  1MDP 1;  2O7I A;  3VV5 A;  2OX3 A;  4NG7 A;  3LR1 A;  5ITO A;  3MPK A;  3MVX A;  3V89 B;  4H46 A;  2HEU A;  3D4C A;  1DTZ A;  4MJO A;  3K4U A;  3FAS A;  1MPB A;  3PUX E;  4OMB A;  1S7Y A;  3FXU A;  2ZYO A;  4BDR A;  4KQP A;  1NV6 A;  4R6K A;  4LN5 A;  4OFJ A;  3KN3 A;  3TZA A;  4OEU A;  4P0I A;  4IB2 A;  2XX9 A;  4P1L A;  1FBE A;  2F78 A;  5J1D A;  3B6W A;  4LVQ A;  3T9H B;  4LZ5 A;  2OLB A;  3KJT A;  3IFC A;  4FBP A;  3G3K A;  3FVO A;  1QUI A;  3IOV A;  4PAF A;  3OEM A;  1EU8 A;  3N94 A;  4GFR A;  4HE0 A;  5TP9 B;  3Q25 A;  4NF4 A;  4HW8 A;  2AIX A;  1UIV A;  1PBQ A;  3TEP A;  5I56 A;  1SPI A;  2I0B A;  2H25 A;  1MM7 A;  1MXU A;  2UXA A;  3RPW A;  4NF8 B;  4TLM B;  3SER A;  1BTJ A;  1XC1 A;  3TFL A;  4YAH X;  3CFZ A;  3T93 B;  5CMK A;  1B05 A;  4ND9 A;  2V3Q A;  4PET A;  4FE8 A;  1P99 A;  4N81 A;  3ILU B;  3PV0 E;  1B3L A;  5AA3 A;  1FPD A;  2F7B A;  2XA5 A;  2PCR A;  4FEB A;  3E13 X;  1R6Z A;  3MPL A;  1MDQ A;  1IQ7 A;  1DK4 A;  3VE1 B;  3G3G A;  1A8F A;  3DP8 A;  4QFO A;  3PMV A;  4OXV A;  4LA9 A;  2NVU B;  2XXV A;  1OVB A;  1B1H A;  1MXV A;  2DVZ A;  2Z8F A;  1RDY A;  1FTA A;  1LCT A;  4QSC A;  3MVZ A;  4N8G A;  4N13 A;  1M5B A;  1MQD A;  4KI0 E;  2F8D A;  2ZNS A;  2X7P A;  4U4S A;  1BKA A;  2DWH A;  3K01 A;  2XXT A;  1N7W A;  3FBP A;  1B3F A;  1VSO A;  5CRY A;  3OMB A;  4F1V A;  1IMD A;  2UYF A;  5CI5 A;  3Q28 A;  3ECR A;  3RT6 B;  1BP5 A;  4H0W A;  3LUY A;  1IMF A;  4YMB A;  1B46 A;  4NX1 A;  2WBB A;  1I6Q A;  1YAE A;  3TTM A;  1B4H A;  3JZJ A;  4RNS A;  1F9B A;  1I69 A;  2M8C A;  3D1R A;  4YKJ A;  3TPA A;  2VD3 A;  4P56 A;  4GOT A;  2CMO A;  4ZS9 A;  4RK2 A;  1HSE A;  4MNP A;  1OLA A;  5A5X A;  2GHA A;  4POW A;  5F24 A;  2AYS A;  3AXF A;  5ICT A;  3E3K A;  2ESN A;  1EYJ A;  2Z8E A;  3RLF E;  3SET A;  3CSG A;  3G3H A;  2R6G E;  1D3K A;  4QSD A;  1D9Y A;  1UIU A;  2DWI A;  1MQJ A;  2DP8 A;  1VFE A;  1GVC A;  1IXG A;  5ET6 A;  1A40 A;  2DE4 A;  5I57 A;  3PGF A;  3T22 A;  1XVX A;  4QFN A;  1IIW A;  3K1N A;  1OLC A;  4L17 A;  3MQ9 A;  2DE2 A;  3THI A;  5FTI A;  4K3F A;  2VPO A;  1O63 A;  1VDW A;  4NAP A;  5EYF A;  3U1O A;  4FAJ A;  1YCJ A;  2HPG A;  2NXO A;  3FJM A;  4C1T A;  1JP4 A;  2FYI A;  3LC8 A;  1VE4 A;  3MVW A;  2DXR A;  2THI A;  2O7U A;  2A5T A;  4AS4 A;  5EHM A;  3Q27 A;  1OMP A;  3OO9 A;  4HS7 A;  4HCW A;  1PBP A;  4IO7 A;  3T96 B;  1D4N A;  4XIG Q;  4QSE A;  5KCJ B;  2QMX A;  5BWJ A;  4DIG A;  1DTG A;  3U93 A;  3TYH A;  2WYK A;  4XXU A;  3K0V A;  5I58 A;  3N6U A;  1AOV A;  5LDZ A;  1CNQ A;  2DVC A;  1NUW A;  1MQG A;  4XF5 A;  3FV1 A;  4OAN A;  4U21 A;  4MBP A;  4R73 A;  5H8Q A;  3BFT A;  3RPL A;  3KN8 A;  3T0J A;  1FRP A;  1N84 A;  1WVJ A;  3O28 A;  3RY3 A;  1FPG A;  3DM0 A;  4H67 A;  4NN3 A;  2A5S A;  4YB5 A;  4OVQ A;  2OBG A;  5ISU A;  3MAM A;  1MXZ A;  1Y20 A;  3FVN A;  3DP6 A;  1P1Q A;  3MC2 A;  5IM2 A;  3EHT A;  3NOH A;  1LAX A;  2P3N A;  1FQD A;  1DPP A;  4PFW A;  1FPK A;  1G0H A;  1QKB A;  3FIR A;  2H99 A;  4R72 A;  3QYT A;  4LAT A;  1M5F A;  2XXU A;  4POX A;  2E0S A;  5LOM A;  4LUB A;  3H06 B;  3JYR A;  3FZV A;  2F3D A;  4G2Z A;  1FPE A;  4ESX A;  2BJJ X;  3QMF A;  3WAF A;  1II5 A;  5A5L A;  3QSL A;  1M5E A;  1PB9 A;  5AA1 A;  2FA7 A;  4GXA A;  3K00 A;  3T1B A;  3P7I A;  4FOR A;  1B5I A;  3S9L C;  2RF1 A;  2B65 A;  3A3U A;  4H6D A;  1B5J A;  2RC8 A;  3CRB A;  5H8N A;  4NF4 B;  1S50 A;  4DI4 B;  1H44 A;  1I6A A;  4F18 A;  4LZ8 A;  5I56 B;  4AQ4 A;  2Z8D A;  1DOT A;  1LB8 A;  2XXP A;  1LAH E;  1QUK A;  2PMS A;  3H6T A;  4M4G A;  1NNP A;  1FPJ A;  3S9M C;  4N07 A;  1IZ1 A;  1NI9 A;  1M5D A;  1A99 A;  1H3D A;  3TTN A;  3CFX A;  3IK6 B;  3PPQ A;  4OVP A;  5EYH A;  4GVO A;  1IXC A;  4IO5 A;  3VXC A;  3CR9 A;  4O94 A;  3HV1 A;  3RYD A;  1B2H A;  3B6Q A;  1FQB A;  2Q88 A;  3O6H A;  3FJ7 A;  2D5W A;  1SW5 A;  3CG3 A;  1R1N A;  1OIB A;  2XX8 A;  1AIV A;  3T66 A;  4RPN A;  3O9P A;  5DTB A;  2PX1 A;  3CG1 A;  3LSX A;  3B8B A;  2CZI A;  1XHY A;  4JDF A;  3OEK A;  4N6D A;  3ROJ A;  1EYI A;  1LFG A;  3FAT A;  1BIY A;  4TQU Q;  3MP6 A;  1EYK A;  4DDD A;  5ELV A;  3MP1 A;  1MY1 A;  1P1N A;  2I6E A;  1AH5 A;  4OVR A;  4X48 A;  2V4C A;  5JTY A;  2QS4 A;  3ONM A;  4M1V A;  4UAC A;  3B50 A;  1ZTY A;  4JSD A;  3VDF A;  1SYI A;  4DXU A;  4PGP A;  5JEI A;  1TWY A;  4H8J A;  2FNC A;  5DT6 A;  1FBG A;  2HAU A;  1B58 A;  2OWS A;  5A5X B;  1NNT A;  4EXL A;  3EN3 A;  3GBB A;  5ITP A;  1NNF A;  2XXX A;  4JB7 A;  3G3J A;  3M3F A;  2CZL A;  2O68 A;  4PE3 A;  4R75 A;  3H6W A;  1LCF A;  4NGU A;  2G29 A;  1P1O A;  5I57 B;  2D3I A;  2F7C A;  2ZYM A;  4ELP A;  5AE4 A;  1IXI A;  3O2A A;  4F19 A;  3SEV A;  1NMU A;  3D4G A;  2OCU A;  4N8Y A;  3EKI A;  2O6A A;  5K2X A;  3OSR A;  2O51 A;  2F5X A;  3IAZ A;  4Q5T A;  1TXF A;  2PYY A;  2B3B A;  2OZZ A;  3PPO A;  4O7M A;  2I3V A;  2O84 X;  4PF6 A;  4JVI A;  3UOR A;  2MKZ A;  2W7Y A;  3GLB A;  4NF5 B;  1B51 A;  1Q35 A;  2A5T B;  3QK6 A;  5I84 A;  1B4Z A;  5ICQ A;  2IEE A;  3UK4 A;  2R71 A;  4NF6 A;  5I58 B;  5AA2 B;  3Q29 A;  1VR5 A;  4ZE9 A;  2G93 A;  1NL5 A;  5FHO A;  2O69 A;  3KG2 A;  1Y4T A;  5ET7 A;  2QVR A;  5H8Q B;  3I3V A;  3RPL B;  3W9V A;  3QAX A;  2I4C A;  2XXK A;  4YKK A;  1RYO A;  1RDZ A;  4TLL B;  3UIF A;  1KA1 A;  3A09 A;  4O8M A;  3KSX A;  4U23 A;  4EDP A;  3USD A;  3VVF A;  4Q30 B;  5DYH A;  3PUV E;  3PUW E;  3FGS A;  2ANJ A;  1MQI A;  4IO4 A;  5FBP A;  3TTK A;  3V8X B;  3ZKL A;  3N6T A;  2OWZ A;  2UYE A;  4QRZ A;  5KDT A;  4P8B A;  4TOZ A;  3FXQ A;  2Q74 A;  2XX7 A;  4F3P A;  5DEX A;  2XWI A;  2GHB A;  5J16 A;  2Q8M A;  4H5F A;  1LBV A;  3S9N C;  3T9V A;  3MUQ A;  4OWD A;  3B7D A;  4PDH A;  3OEN A;  1MPC A;  4GWU A;  2WBD A;  5IKB A;  1DCU A;  4PAI A;  3TMG A;  4X04 A;  4THI A;  1O7T A;  3ZS6 A;  2V84 A;  1US4 A;  1PB7 A;  3VXB A;  3C32 A;  5L8D A;  3E79 A;  1IMA A;  4OYV A;  1OVT A;  3HST A;  2YPN A;  3MZ9 A;  2XWK A;  4H1X A;  4QHQ A;  4GWX A;  2Q9T A;  2QS2 A;  1DMB A;  3CI8 A;  1NV2 A;  5HPQ A;  3BIG A;  4FEC A;  2I49 A;  5H8N B;  1QVS A;  1N3X A;  2HFB A; 
#chains in the Genus database with same CATH homology
 1G0I A;  4HCW A;  4MEV A;  4MAG A;  4MIJ A;  4GX6 A;  4HE1 A;  3LUZ A;  5IGA A;  4N6K A;  1XI6 A;  1FPF A;  2WYK A;  4X8R A;  3GYY A;  2FVZ A;  5LDZ A;  1CNQ A;  1NUW A;  3CHG A;  4XF5 A;  1FBH A;  2GQ1 A;  5LTC A;  1BK4 A;  1FBF A;  5EQA A;  4OAN A;  1NV1 A;  4MHF A;  5I5P A;  4MNI A;  2HZL A;  2Y5K A;  4X9T A;  2HHM A;  1LBZ A;  1LBX A;  3RPL A;  3T0J A;  1FRP A;  4P47 A;  1LEV A;  1AWB A;  2HZK A;  1YYZ A;  2Y5L A;  3KC1 A;  1FPG A;  4DI3 D;  4NN3 A;  2WYP A;  4OVQ A;  3FXB A;  5EQ7 A;  4HCY A;  2CZK A;  4AS5 A;  4OVT A;  5I3S A;  2WEF A;  5IM2 A;  3NOH A;  1NV0 A;  2P3N A;  1IME A;  4NF0 A;  1FPK A;  2B4M A;  1G0H A;  4UAB A;  3MST A;  4I3E A;  1IMB A;  2FIE A;  5CM6 A;  3IFA A;  1DBZ A;  2QFL A;  4PDD A;  4XFE A;  2QPQ A;  4PF8 A;  2F3D A;  2PFY A;  3U65 A;  1FPE A;  4KXP A;  1FPI A;  5ET5 A;  3QMF A;  4PAK A;  2ZZX A;  5A5L A;  1IMC A;  4OA4 A;  3T1B A;  2FBP A;  1FJ6 A;  4MCO A;  2QVV A;  1YXI A;  3A29 A;  1FSA A;  4GWS A;  4P9K A;  4JVC A;  5DW8 A;  1FPB A;  1Q9D A;  4QBA A;  4DI4 B;  3LV0 A;  4F18 A;  1LBY A;  1KA0 A;  4P3L A;  2CEY A;  2QVU A;  1KZ8 A;  4H45 A;  1D9Q A;  5IZ3 B;  4YIC A;  1FBP A;  1FPJ A;  4G61 A;  1NV3 A;  1RDX A;  1NI9 A;  2WX9 A;  3PTY A;  4GWW A;  2BJI A;  4OVP A;  5EYH A;  4PFB A;  2XWV A;  4O94 A;  4XEQ A;  2R8T A;  3RYD A;  1NV4 A;  1K9Z A;  4GBW A;  4PGN A;  4PBQ A;  2OX3 A;  4NG7 A;  4PFR A;  4N17 A;  4H46 A;  3ISP A;  4YZZ A;  4MJO A;  3B8B A;  2CZI A;  5IZ1 A;  4N6D A;  3ROJ A;  1EYI A;  1FBC A;  4PTK A;  1NV6 A;  4OVS A;  1EYK A;  4LN5 A;  5EYG A;  5EQ9 A;  4JVD A;  4HXV A;  2HXR A;  5ET8 A;  4P1L A;  1FBE A;  4I40 A;  5J1D A;  4OVR A;  2V4C A;  1K9Y A;  4M1V A;  3B50 A;  3KBZ A;  4PGP A;  3SZP A;  3IFC A;  4FBP A;  1FBG A;  4F1U A;  1NUZ A;  2B4L A;  2PFZ A;  4PAF A;  1INP A;  3BIH A;  4HE0 A;  4GBV A;  1YZ0 A;  1SPI A;  5T3J A;  4MMP A;  4PE3 A;  1NV5 A;  2CEX A;  4NHB A;  4NGU A;  2V3Q A;  4PET A;  5IZ3 A;  4PCD A;  4N81 A;  3HFU A;  1FPD A;  2XA5 A;  4N15 A;  4F19 A;  4N8Y A;  3E78 A;  3EKI A;  2PCR A;  2ZZV A;  4O7I A;  4GX4 A;  2F5X A;  1DK4 A;  4PFI A;  4GWZ A;  1FPL A;  4O7M A;  3MYU A;  4PF6 A;  4JVI A;  4PBH A;  2MKZ A;  2DVZ A;  1RDY A;  1FTA A;  4N8G A;  2DDK A;  4QXD A;  2KR0 A;  2ZZW A;  1FJ9 A;  4MX6 A;  4PC9 A;  3FBP A;  5EQ8 A;  4F1V A;  1IMD A;  4HE2 A;  4MNC A;  3KC0 A;  2P3V A;  1IMF A;  4NX1 A;  4GWY A;  2WBB A;  5ET7 A;  5I7I A;  1NV7 A;  2QVR A;  2XWO A;  4NQ8 A;  3RPL B;  3W9V A;  3D1R A;  2L5V A;  4N4U A;  2XXK A;  2F3B A;  4P56 A;  1RDZ A;  2KQZ A;  1KA1 A;  5ESY A;  4MNP A;  4O8M A;  2VT5 A;  5F24 A;  5IZZ A;  4IR8 A;  1EYJ A;  5FBP A;  2OWZ A;  2FIX A;  4P8B A;  2Q74 A;  4N91 A;  2XWI A;  5J16 A;  2Q8M A;  1LBV A;  5ET6 A;  5JK4 A;  2DE4 A;  3W9W A;  4PDH A;  4I3Y A;  4GWU A;  2DE3 A;  2WBD A;  1DCU A;  1LBW A;  4PAI A;  4X04 A;  2CZH A;  1NUX A;  2DE2 A;  2VPO A;  1VDW A;  4NAP A;  1NUY A;  3E79 A;  1IMA A;  1FBD A;  2VPN A;  2HPG A;  2XWK A;  1JP4 A;  2JJK A;  1QGX A;  4GX3 A;  4GWX A;  2Q9T A;  1NV2 A;  3BIG A;  2FHY A;  4AS4 A;  4P1E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...