2WYKA

Siap in complex with neu5gc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Siap in Complex with Neu5Gc
rcsb
source organism Haemophilus influenzae
total genus 122
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wykA00
4PDDA 2ZZVA 2WYKA 4PGPA 4NHBA 4UABA 4LN5A 4PGNA 2CEYA 2PFYA 3FXBA 4NG7A 2ZZXA 4PCDA 3U65A 4P1LA 3B50A 2XWOA 4N15A 4XFEA 4P9KA 4P8BA 4N8GA 4N91A 2VPNA 4N6DA 4PC9A 4NF0A 4MX6A 4O8MA 4MMPA 4DI3D 2WYPA 4PAIA 4OANA 5I5PA 4O94A 4NGUA 2CEXA 4PFRA 4MNCA 2XWVA 4NAPA 4OVPA 4MIJA 4X8RA 2VPOA 4PF6A 2XXKA 4MCOA 4OA4A 4YZZA 2PFZA 4PE3A 4N4UA 2ZZWA 4NN3A 4NQ8A 4OVQA 4P47A 4P56A 4PFIA 2XWIA 2XA5A 4XF5A 3GYYA 4N6KA 4P3LA 2WX9A 4PFBA 4OVRA 2XWKA 4O7MA 2V4CA 4XEQA 4OVSA 5IZZA 4N8YA 4MHFA 4X04A 5CM6A 4OVTA 4PETA 4PAFA 4P1EA 4PF8A 4MNPA 4MEVA 5LTCA 4N17A 2HPGA 4PDHA 2HZKA 5IGAA 2HZLA 4DI4B 4PBQA 4MNIA 4MAGA 5I7IA 4PAKA 4PBHA 5IM2A 4YICA 4NX1A
chains in the Genus database with same CATH superfamily
5TPAA 3GBBA 1B5HA 1EYKA 3OD7A 4G68A 4H46A 3LSLA 3OO9A 4QFPA 1NV5A 1FW0A 1JEVA 1USYE 3N94A 2I3WA 2CZLA 5I3SA 4HE1A 3RN8A 1RDYA 4ISUA 3B6TA 1B0HA 3H06B 1Q9DA 1LAFE 4G68B 1HSJA 4NF4B 3T22A 5L9OA 2XXXA 4JXIA 1N3WA 3OO8A 1SQYA 1XI6A 1LBVA 1BLFA 1AH5A 1US4A 1NV4A 3TYHA 4MCOA 1OLAA 4ZE8A 1LCTA 1YZ0A 4POXA 1B40A 1CE2A 2ANJA 4OHNA 5ISUA 3KBZA 5DEXA 2GFEA 1I69A 4N6KA 5EQ7A 5I59A 1KZ8A 3K6VA 1Z7NE 4XKNA 3OEKA 4O7MA 4F31B 4PTKA 5CRYA 3KOTA 1FPDA 2F5XA 1US5A 5DEXB 2I3VA 4RK2A 1II5A 3KN3A 3CFLA 4XKPA 4IGRA 4PAFA 5I59B 4Z0IA 2IA4A 1MXVA 2H25A 1MXYA 3QIMA 4LUBA 4TLMB 4PDHA 2Z22A 3KN8A 3U93A 1I6QA 4PBQA 4DI4B 3FV2A 3O66A 3N6UA 1LBBA 2FVZA 5ET6A 5H8FB 4YICA 1N0TA 3M3KA 1SVXB 4FIMA 4FORA 4F2OA 3O2AA 4GBVA 1O63A 1SI1A 2UYFA 3ZSFA 4LZ8A 5F24A 3RTFB 3HPIA 4EQ7A 3FXBA 2H99A 1B1XA 1P1WA 5I2KA 4U4XA 1NV1A 3TEPA 3HFUA 1NV0A 1SYHA 3H03A 3Q25A 4I3EA 3I5OA 4ZEIA 4N07A 2PBWA 3RYDA 4PAIA 3G3KA 1S9TA 1BKAA 3CSGA 4AB5A 4ZECA 4OYVA 3RPLB 1N7WA 3SEVA 4O94A 5I2KB 1B05A 2V25A 2Y5KA 2XX9A 1FTLA 2CZKA 3UIFA 2ESNA 3PD9A 1LB9A 2AL5A 4OTEA 2R9JA 2YJPA 3I6VA 2R6GE 2DSFA 1MRPA 4GWOA 3MSTA 1A55A 1N84A 3L6GA 3O28A 3W9VA 1TXFA 4GFRA 4YKIA 3HV1A 1YYZA 1DMBA 1S50A 1NNTA 3Q29A 4JSOA 1F9BA 3ODBA 4F2QA 4HCYA 1B4ZA 5HPQA 5IGAA 3H6TA 4LVQA 1AWBA 1AOVA 2DDKA 1A8EA 2QS4A 4OXVA 3CVGA 2Z8EA 3FXQA 4NF8A 4NHBA 1XS5A 3CI8A 1FJ9A 3IOUA 1IMEA 3D1RA 1MH4A 4EF2A 1MY2A 2XXIA 3A3CA 3SEUA 2HAVA 3FD3A 4NF8B 3THIA 1HSLA 1DK4A 3CR9A 3ECRA 4ELQA 2F6GA 3MWBA 2QS3A 4F3PA 5I58A 4NAPA 4KYSA 3SKPA 4PF6A 4ELOA 3PPRA 2F7CA 3LSFB 2UVJA 4AQ4A 3G7WA 3IO4A 3SESA 3OEMA 5ELVA 4FJPA 4GX3A 3C35A 5DTBA 3LUYA 3DP6A 4PFWA 1KA1A 1JP4A 2A5SA 4GL8A 1TT1A 4M4GA 3SEXA 1TFDA 5FHMA 4R2FA 3K0VA 3KC1A 3HN0A 1D3KA 5I2NA 1JW4A 5L9MA 4GX6A 4PQJA 3H6UA 1JETA 5LTCA 5CMCA 3T66A 2HZKA 1IMFA 4MLQA 5H8SA 5IM2A 5LOMA 3GLBA 2B3FA 3MUQA 1PB9A 1Y4CA 5I2NB 2OZZA 2ZZVA 1LFGA 3GZGA 4TLLB 3DELB 3O9PA 1ZLQA 1D9YA 4P1LA 1EZPA 1N7XA 1DBZA 3FATA 5CC2A 4RJZA 4XKRA 1P1QA 1MXXA 5KDTA 4PC9A 4RPOA 3CIJA 5CMBA 3VV5A 3MP8A 4P0IA 1GV8A 4GL0A 1NNKA 4WXJA 3JV9A 1N76A 2XHDA 1Z7ME 4OVPA 1IZ1A 1IXHA 3S9EA 2Q2AA 3T0JA 5KDTB 2F3DA 4P0GA 1SBPA 1Y1ZA 2FNCA 1B0LA 4NN3A 1XVXA 3CRBA 4FEDA 3IFAA 1GTKA 1PBQA 4PFIA 1FTMA 4TQUQ 4IO2A 4KQPA 4ONYA 3MW0A 3FZVA 3K6XA 2ABHA 3G3IA 3NOHA 4GWZA 1NH8A 2VT5A 2XXRA 1MQIA 4MF3A 2P3VA 1EYJA 1LGBC 4XEQA 2P0SA 2QRYA 4Q8RA 4IO4A 4N8YA 4LATA 1B3FA 4PETA 1B46A 3IFCA 4P1EA 4ESWA 3FJMA 4PF8A 1LAXA 3QUJA 2H5YA 3S4UA 3KJTA 3SDFA 3T96B 2GRVA 3HSTA 5I7IA 3MZ1A 3PPPA 2UYEA 4KI0E 3BKIB 1R1NA 3KFMA 4ESXA 4DDDA 5TU0A 4PGPA 3PUXE 5H8HA 4Z7EA 4P11A 3PUWE 1QKAA 3UN6A 4GWXA 2I48A 2DP8A 1RKMA 3TELA 5IZ3B 1UTBB 2QSXA 2XWOA 3BIHA 1D9VA 2G93A 4P8BA 3USDA 3PPOA 3SEYA 1SW1A 2QS2A 4MX6A 4O8MA 1Q1KA 4BDMA 3LR1A 1IIWA 4QSDA 3LV0A 1LFIA 3C32A 1B5JA 4YAHX 1USYH 2V93A 3EHTA 2Y5LA 2PX1A 5I84A 4U23A 5EYGA 2UVGA 1PEBA 4H65A 2O84X 2FIXA 2OCUA 1ATGA 2DWJA 1DTZA 2ZXTA 3MP6A 3T9HB 4KYEA 4NE4A 5HBCA 4O7IA 1JQFA 3QMFA 4WEPA 3V8XB 1GGGA 1OIBA 4YKJA 1FSAA 4N6PA 3LUZA 4PFBA 3SZPA 2HXRA 3DLNA 2DWHA 3MVZA 3O6GA 2I49A 3JZJA 2ONRA 4DCYA 3KN7A 2R71A 4ELRA 4JWXA 1QVSA 5EQ9A 4H45A 1CB6A 2XXHA 1H44A 4AS5A 3OSRA 3OENA 4GD5A 4DZ1A 2ZNSA 2ONKE 1ZBMA 3QYTA 4I62A 2HCAA 2RINA 2O7UA 1AIVA 4UACA 2HAUA 2P3NA 1JW1A 4QSEA 1B51A 1QKBA 2I6EA 1SW4A 1O7TA 1FQEA 3KC0A 1NL5A 1URDA 2QVUA 3FJ7A 4LP2B 2V3QA 4HS7A 4QBAA 4N6DA 4LQ5A 4U4SA 3MVYA 4IO7A 3U72A 2D5WA 3TODA 4NF4A 3IB1A 1P99A 3E78A 4WKMA 2XWVA 2Y7PA 4X8RA 4MFIA 3KOSA 2VP1A 3V5AA 5EYFA 1MDP1 1SPIA 1M5CA 2LAOA 2F7AA 1MG1A 1Y9UA 4BDQA 3T1BA 1R6ZA 1B3HA 4JB7A 4OMBA 2E1SA 1N3XA 1NUYA 4I9DA 2RCBA 1B1HA 3P7IA 2KR0A 3ILUB 3S9NC 2F8DA 4G61A 1IMCA 3OMBA 2X7PA 2X7QA 3RT6B 1XC1A 1LBXA 5CI5A 3SERA 3PTYA 4IGTA 1SW2A 1MQGA 4KHZE 2ZYOA 2P2AA 4R2BA 1B5IA 1FBCA 3BIGA 4JVDA 1FRPA 4PBHA 4F3SA 3O29A 1B3GA 3IAZA 5H8FA 2Q9TA 2XD2A 4KCDA 4TOZA 4C1UA 2UVIA 4ND9A 4PGNA 1MXUA 2H9BA 4G4PA 4ZZEA 3H6VA 3TQWA 4EQBA 3TTRA 4MBPA 4XFEA 2ZNUA 4IR8A 1LSTA 3BFTA 4YMBA 4YB7A 2I0BA 3FVKA 4EF1A 3PGFA 1BP5A 2A5TB 2DXYA 1FQCA 3HCQA 2F3BA 3MJNA 1MPBA 3RPLA 2DVZA 1BTJA 3B7DA 4G68C 1SYIA 4E0WA 1VFEA 1OQHA 4JVCA 4P56A 3E9XA 2Y7RA 3FJGA 4X1BA 2RCAA 3KSJA 2FBPA 2XWKA 4OEVA 4DCXA 2YLNA 5AA2B 3C36A 1WODA 3LBSA 5CM6A 4UA8A 2OLBA 3TKDA 5IKBA 1NV6A 5M2VA 4IY5A 4MAGA 3MZBA 4PAKA 4NEDA 1FTOA 1MH3A 3LC8A 1LFHA 2OBGA 2I0CA 4NX1A 1NUXA 4LA9A 4OVJA 4GOTA 1IMDA 4NF5A 1B2HA 2VHAA 5ITPA 1A99A 2RKMA 3RGYA 1HSEA 4JBZA 3PV0E 1WDNA 1Q35A 2CEYA 2RF1A 3MVWA 5ITOA 5B70A 3QK6A 2ONSA 3U8QA 5A5XA 4R9GA 2AL4A 3K2DA 1ZJLA 4X48A 3B6QA 4NF5B 2PT2A 1JW5A 4GXAA 4PE5B 2KLFA 4ZEKA 1MQJA 4G8MA 1OMPA 2P1SA 2ZMBA 4OENA 5HM4B 5A5XB 2CEXA 3MP1A 3RUMA 3K00A 3IK6B 1NH7A 2Q88A 4GVOA 3KG2A 4NMYA 2W7YA 5BUUA 1IMBA 2XXUA 4F3BA 4YZZA 2GHAA 4PE3A 4F3GA 1A7LA 2I58A 3EKIA 5EHMA 3MVXA 1MXZA 4HTGA 5L8DA 2XWIA 3U92A 4KPTA 1VR5A 4HE2A 1NKXA 3UK4A 1FPIA 2UXAA 3PUYE 4GWYA 1NI9A 3E3KA 4OVRA 1QW0A 2O51A 1FBDA 1OQGA 2Y84A 1NNPA 3HHGA 3SEWA 2FYIA 4RA1A 1FPGA 1AL3A 1XHYA 3PPQA 4OVTA 2V3UA 2O1LA 3ISPA 4N17A 1UIUA 4GRKA 1P1OA 4DE8A 3N5LA 1D9QA 1LBWA 3TMGA 1UIVA 2V84A 2Y7WA 1LCFA 3VFJA 2OWZA 2YPNA 3A29A 4EQ9A 4QFLA 4AB6A 5DYHA 3R26A 4RNSA 1EH3A 3K02A 3O6IA 2R8TA 1TWYA 2ZZXA 4PCDA 3U65A 1DOTA 1YPNA 5EYHA 1DPEA 1POY1 3MAMA 3PMXA 2HXWA 4H67A 4XXUA 1LB8A 4RPNA 3S2VA 4OERA 2ZYMA 4DI3D 2QL3A 1FQBA 3K1PA 1IQ7A 3ILTB 2WBBA 2NUVA 4HXVA 3PUVE 1B7ZA 4GQOA 4YB5A 4THIA 2PFZA 1QULA 2GQ1A 1MQHA 2AYSA 3OELA 1LAGE 1H43A 5EHSA 4NWCA 3RT8A 1GR2A 2QS1A 4BDNA 2B3BA 1FBFA 3C9HA 1POTA 2XA5A 1MY1A 3U94A 5KZTA 3RQTA 1S7YA 2QMXA 1KA0A 5DVJA 2FA7A 1NUWA 2PT1A 3IOWA 4JSDA 4ZDMA 4I3YA 3OXNA 1K9ZA 1MM7A 1FPFA 4H8JA 5DVFA 1M5DA 4EDPA 3GBAA 4OFLA 2WKYA 5FTIA 2HPGA 2DE2A 2HZLA 1FPJA 3IB0A 3EN3A 2Y7KA 5ICQA 1SI0A 4IO6A 1CNQA 1H45A 3TUSA 1B9JA 3PUZE 3VDFA 3M3FA 3LSXA 2XXQA 2F97A 2OWSA 3DM0A 3FVGA 2O7IA 3JYRA 2F78A 4MLVA 2QMWA 2M8CA 1H3DA 2DE3A 1YCJA 1LAHE 1SW5A 2XX8A 5L9SA 3QSLA 4E0XA 1XVYA 5IZ3A 1UTBA 4HE0A 2QFLA 1EZOA 1Y20A 1BK4A 4MMPA 1EYIA 3MPLA 5KCJA 4BDOA 1FCKA 5ESYA 3AXFA 4F1UA 3KJ7A 4R75A 2D21A 4F19A 4YU0A 3QXMA 3FXUA 5AA1A 1QUJA 2VD2A 4QF9A 1NNFA 2XXPA 2BJJX 3K01A 1IXIA 5KCJB 2OX3A 5CMKA 4XF5A 3VVFA 3DP4A 1B3LA 1UTHA 1FQFA 1RDXA 2WX9A 1A40A 4N81A 5JTYB 5ICTA 2Z8DA 1IITA 5I56A 3IR1A 1URSA 1MPDA 1N04A 4H5FA 2DOJA 1ZIUA 3FXRA 1ANFA 3CFZA 1UTHB 3K6WA 5B7DA 5LDZA 2Q8MA 2ZYNA 2RC9A 5I56B 2F34A 1DTGA 3OO6A 2Y7IA 1MY4A 4H6DA 1I6BA 3O97A 3KZGA 4K3FA 4LONB 1B7HA 4QFKA 1QGXA 1QUKA 1MM6A 2NOOA 3M3LA 2O6AA 5JEIA 4H8IA 5CBRA 3H3GA 3MZ9A 4P9KA 3C4MA 4N91A 3ZKLA 4QXDA 2Q89A 3EPEA 3RPWA 2Q74A 3PU5A 1R9QA 3OO7A 1NV2A 4PP0A 5T3JA 4X1DA 1B52A 3QAXA 2PVUA 4NWDA 4F29A 2XXKA 4HW8A 2MKZA 2NVUB 4H5GA 3HO7A 5H8QB 5I57A 4IY6A 3N26A 2NWJA 5AA2D 2CZHA 4PFUA 3C34A 3EHSA 3LSWA 3FUZA 1DSNA 4KCCA 3WAFA 5I57B 2CMOA 4ZEFA 2JJKA 3U1OA 2Z8FA 4R73A 1T0KA 4F22A 4X04A 5IAIA 2ZNTA 3D4GA 4NF6B 2NXOA 1P1UA 2DQVA 4EXLA 2PMSA 3A3UA 2IEEA 3CHGA 3IJOB 4U21A 5TPAB 4GWSA 1YTVA 2H4IA 3E13X 5FHNA 2HFBA 3IOVA 5CBSA 4LZ7A 1J1NA 3EHUA 2PCRA 1WVJA 2HEUA 3H6WA 3ONMA 3C33A 3MYUA 2REGA 4UABA 4R74A 4DXCA 4C1TA 1IXCA 2Q2CA 2AIXA 4N15A 4RYAA 3V83A 1VFDA 1FPLA 2REJA 3G3FA 4RXLA 1P1NA 4RY1A 4OFOA 3KEIA 1NMUA 1B7UA 1PC3A 1Y3PA 3Q27A 4YB6A 1UQWA 4GLIA 4YMAA 5I5PA 1R9LA 2WEFA 4KD5A 2B4MA 4Q30B 4KR5A 2A5TA 3K1NA 4ZEDA 4FATA 1A8FA 2VPOA 3FBPA 4OQOA 3H7MA 1EZ9A 5H8NA 1B3EA 1G0HA 1Y3QA 1RYXA 4IO3A 1TFAA 4DXBA 5AE4A 5ET8A 3MPKA 4P3LA 4JDFA 2F36A 1ZTYA 1YAEA 5H8NB 4MH5A 1SDXA 3FVNA 5TP9A 4OWDA 1ZKBA 2DS9A 3QUFA 4OFJA 4OVSA 2DWAA 3SETA 5AA2A 1MS7A 1IXGA 3EF7A 1QUIA 5TP9B 2QJEA 1RYOA 3ROJA 3E4RA 4U1OA 4ZEBA 4EUOA 3TCFA 1LBZA 1KWHA 4R6KA 4BDRA 5FTHA 2PFYA 1FJ6A 2E0SA 4F1VA 2QPQA 2FIEA 3V89B 4LQ2A 1NV3A 2QVRA 5F1QA 2XD3A 4G8NA 1OLCA 1SD3A 4O3AA 4GX4A 4PFTA 3VXCA 4R6HA 4DIGA 5DW8A 3N6TA 3TAJA 4GIZA 1Y4TA 1ZU0A 2F6PA 4YKKA 1FBPA 1PBPA 4I1DA 3TTKA 4GWWA 1B6HA 3CG1A 5EQ8A 2OK2A 4MJOA 1B32A 2ALUA 3KBRA 1FPBA 4ZS9A 5F7VA 4YKPA 4Q5TA 3MQ9A 4NQ8A 4HCWA 2VD3A 3IX1A 4XIGQ 2DYXA 1K9YA 3T9UA 4R72A 2XXWA 4FECA 3TFLA 4KXPA 2GH9A 3K4UA 4G77A 3M8UA 3ZKKA 4GWUA 4RK9A 3W15C 3O6HA 5FHOA 4U2RA 5IZ1A 4MHFA 4QHQA 2XXYA 4I8CA 5EQAA 4C0RA 4MEVA 2OJTA 3IORA 3K6UA 1ZMGA 1PB8A 5ET7A 4XKQA 3TCHA 4PFYA 1XT8A 3K1MA 4ZE9A 1VSOA 2VGQA 4POWA 3TPAA 1DCUA 4PDDA 1MY3A 3MC2A 3VXBA 1URGA 2CZIA 4LN5A 4ZZAA 1DPPA 5J16A 3G3HA 1MPCA 1Y3NA 3VLVA 3VLUA 3B50A 1B4HA 1IEJA 3PD8A 3CFXA 2VPNA 3E79A 3HHFA 2DXRA 3TQLA 3L6HA 2D3IA 1MY0A 4H1XA 3MBPA 4L17A 2WYPA 3PPNA 5I58B 2ZYKA 1M5EA 5FBPA 4EXKA 1XOCA 1L5TA 3UA8A 3R7XA 1JEUA 3GXAA 1B58A 4N4UA 2B65A 5BWJA 3IO6A 1FPKA 2XXTA 3VLWA 2G29A 1M5FA 2F35A 2PYYA 1NFTA 3CG3A 2V4CA 3DP8A 3UGWA 4H0WA 4O3CA 5DT6A 4GF8A 3IL1B 2F7BA 3OSQA 3TTLA 2OWTA 1O64A 4JWOA 2RC7A 1BIYA 3H4ZA 4MNIA 4U22A 3Q28A 1JVYA 4Q0CA 2QVVA 4FE8A 1IMAA 2X26A 4ECFA 4I40A 2WYKA 1QJMA 1YXIA 3G3JA 1A54A 3TDJA 3BFUA 3RNNA 4NG7A 3VE1B 1FPEA 4GXSB 4JWYA 4N8GA 4DLDA 2I4BA 4NF0A 2WBDA 4F39A 5ET5A 3UP9A 4X9TA 4N13A 2H98A 3EQ1A 1LLSA 1MQDA 4NGUA 5AA3A 5DVIA 4QFOA 3A09A 4R6YA 4IB2A 3TCGA 5K2YA 2O69A 1FTKA 4QFNA 1Y1MA 1H76A 4KYDA 3FGSA 1VE4A 3BBRA 3RTWB 2XXVA 4QSCA 1FTJA 4XTCQ 3ZS6A 3GYYA 1MDQA 2O68A 2HHMA 2I4CA 3UORA 2DWIA 3RLFE 2GHBA 4BDLA 1NUZA 1FQDA 5CMMA 5JTYA 4JVIA 4O3BA 5IZZA 4KFQA 3G3GA 2BJIA 1G0IA 3PMVA 3FVOA 4U1ZA 1MXWA 2HQ0A 3IB2A 2DE4A 4G2ZA 2V3TA 2UVHA 3W9WA 5H8HB 1ELJA 3FV1A 3IOTA 3KSXA 2Q8JA 3D4CA 3TZAA 1FBGA 1JVXA 1LEVA 1OVBA 4OZ9A 3KGCA 4AS4A 3RY3A 3WAEA 2THIA 1JNFA 3T9XB 4OEUA 4OETA 4FEBA 4IO5A 1LBYA 4GBWA 4DXUA 4OANA 3IJXB 5A5LA 1I6AA 2XX7A 1INPA 3Q26A 4PFRA 4F18A 5JK4A 4MNCA 3VVEA 3B6WA 3OOAA 5AA4A 4NTLA 2FHYA 4MIJA 3B8BA 3VVDA 4FBPA 4OA4A 1PDAA 4LZ5A 2ZZWA 3CSBA 4OVQA 4P47A 3S9LC 4R9FA 1RDZA 1VDWA 3T93B 5H8QA 1NV7A 3FIRA 4QRZA 4ELPA 3TTMA 2DVCA 3T9VA 5AA4B 4BLAA 2B4LA 3F11A 1AMFA 2RC8A 3PMWA 4WEDA 4FAJA 3C31A 1FQAA 4F1YA 1EU8A 3FASA 1D4NA 3R6UA 1M5BA 4M1VA 5K2XA 5J1DA 2VOZA 1IUDA 1GVCA 3I3VA 1OVTA 2O1MA 1LBCA 4MNPA 3S9MC 4NF6A 1FBHA 1FBEA 2KQZA 4OESA 3TTNA 2L5VA 2Z23A 1FTAA 1PB7A 4G8HA
chains in the Genus database with same CATH topology
1LBZA 3A29A 1EYKA 4PGPA 4H46A 1NV5A 2PFYA 1FJ6A 2R8TA 4F1VA 2QPQA 2FIEA 4GWXA 2ZZXA 4PCDA 3U65A 5I3SA 5IZ3B 2XWOA 1NV3A 2QVRA 3BIHA 5EYHA 4HE1A 1RDYA 4P8BA 4GX4A 4MX6A 1Q9DA 4O8MA 5DW8A 4DI3D 3LV0A 2WBBA 1FBPA 4HXVA 1XI6A 1LBVA 4GWWA 2Y5LA 5EQ8A 5EYGA 4MJOA 1NV4A 2FIXA 4MCOA 2PFZA 2GQ1A 1FPBA 1YZ0A 4NQ8A 4HCWA 4O7IA 3QMFA 1K9YA 1FBFA 2XA5A 3KBZA 1FSAA 4N6KA 5EQ7A 3LUZA 1KZ8A 4KXPA 4PFBA 3SZPA 2HXRA 1KA0A 1NUWA 4O7MA 4I3YA 4GWUA 4PTKA 1FPDA 1K9ZA 5IZ1A 1FPFA 4MHFA 5EQ9A 2F5XA 5EQAA 4H45A 4PAFA 4AS5A 4MEVA 2HPGA 4PDHA 2DE2A 2HZLA 4DI4B 4PBQA 5ET7A 1FPJA 5ET6A 2FVZA 4YICA 1CNQA 4GBVA 1DCUA 4PDDA 2P3NA 2CZIA 4LN5A 5F24A 3FXBA 5J16A 3KC0A 2QVUA 2V3QA 3B50A 1NV1A 3HFUA 2DE3A 1NV0A 2VPNA 4QBAA 3E79A 4N6DA 5IZ3A 4HE0A 2QFLA 4I3EA 1BK4A 4MMPA 3RYDA 2WYPA 4PAIA 3RPLB 1EYIA 4O94A 5FBPA 3E78A 2XWVA 5ESYA 4F1UA 2Y5KA 4X8RA 2CZKA 4F19A 4N4UA 1SPIA 1FPKA 3T1BA 2OX3A 4XF5A 3MSTA 1NUYA 1RDXA 2WX9A 2KR0A 4N81A 3W9VA 4G61A 1IMCA 2V4CA 1LBXA 1YYZA 3PTYA 4HCYA 5LDZA 1FBCA 3BIGA 4JVDA 5IGAA 4MNIA 1AWBA 2Q8MA 1FRPA 2DDKA 4PBHA 2QVVA 1IMAA 2Q9TA 4I40A 2WYKA 1YXIA 4NHBA 1QGXA 4PGNA 1FJ9A 4NG7A 1IMEA 1FPEA 3D1RA 4XFEA 4P9KA 4IR8A 4N8GA 4N91A 4QXDA 4NF0A 2WBDA 5ET5A 4X9TA 1DK4A 2Q74A 1NV2A 4NGUA 2F3BA 5T3JA 3RPLA 4NAPA 2DVZA 4PF6A 2XXKA 2MKZA 4JVCA 4P56A 2CZHA 4GX3A 1KA1A 3GYYA 2HHMA 1JP4A 2FBPA 2XWKA 1NUZA 2JJKA 4JVIA 3KC1A 5IZZA 4X04A 5CM6A 2BJIA 1G0IA 4GX6A 1NV6A 5LTCA 2HZKA 1IMFA 3CHGA 4MAGA 2DE4A 4PAKA 5IM2A 4GWSA 4NX1A 1NUXA 3W9WA 2PCRA 2ZZVA 1IMDA 3MYUA 4UABA 2CEYA 1FBGA 1LEVA 4AS4A 4P1LA 1DBZA 4N15A 1FPLA 1LBYA 4PC9A 4GBWA 4OANA 5A5LA 5I5PA 1INPA 4F18A 4PFRA 2CEXA 5JK4A 4MNCA 2WEFA 2B4MA 4OVPA 2FHYA 4MIJA 3B8BA 3T0JA 4FBPA 1IMBA 2F3DA 2VPOA 3FBPA 4OA4A 4YZZA 4PE3A 1G0HA 2ZZWA 3EKIA 4NN3A 4OVQA 4P47A 3IFAA 4PFIA 1RDZA 1VDWA 1NV7A 2XWIA 4HE2A 2B4LA 1FPIA 4GWYA 5ET8A 1NI9A 4P3LA 3NOHA 4OVRA 4GWZA 2VT5A 1FBDA 2P3VA 1EYJA 4M1VA 5J1DA 4XEQA 4OVSA 1FPGA 4N8YA 4OVTA 4PETA 3IFCA 4P1EA 4PF8A 4MNPA 3ISPA 4N17A 1FBHA 1FBEA 2KQZA 5I7IA 1D9QA 1LBWA 2L5VA 1FTAA 3ROJA 2OWZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PDD A;  2ZZV A;  2WYK A;  4PGP A;  4NHB A;  4UAB A;  4LN5 A;  4PGN A;  2CEY A;  2PFY A;  3FXB A;  4NG7 A;  2ZZX A;  4PCD A;  3U65 A;  4P1L A;  3B50 A;  2XWO A;  4N15 A;  4XFE A;  4P9K A;  4P8B A;  4N8G A;  4N91 A;  2VPN A;  4N6D A;  4PC9 A;  4NF0 A;  4MX6 A;  4O8M A;  4MMP A;  4DI3 D;  2WYP A;  4PAI A;  4OAN A;  5I5P A;  4O94 A;  4NGU A;  2CEX A;  4PFR A;  4MNC A;  2XWV A;  4NAP A;  4OVP A;  4MIJ A;  4X8R A;  2VPO A;  4PF6 A;  2XXK A;  4MCO A;  4OA4 A;  4YZZ A;  2PFZ A;  4PE3 A;  4N4U A;  2ZZW A;  4NN3 A;  4NQ8 A;  4OVQ A;  4P47 A;  4P56 A;  4PFI A;  2XWI A;  2XA5 A;  4XF5 A;  3GYY A;  4N6K A;  4P3L A;  2WX9 A;  4PFB A;  4OVR A;  2XWK A;  4O7M A;  2V4C A;  4XEQ A;  4OVS A;  5IZZ A;  4N8Y A;  4MHF A;  4X04 A;  5CM6 A;  4OVT A;  4PET A;  4PAF A;  4P1E A;  4PF8 A;  4MNP A;  4MEV A;  5LTC A;  4N17 A;  2HPG A;  4PDH A;  2HZK A;  5IGA A;  2HZL A;  4DI4 B;  4PBQ A;  4MNI A;  4MAG A;  5I7I A;  4PAK A;  4PBH A;  5IM2 A;  4YIC A;  4NX1 A; 
#chains in the Genus database with same CATH topology
 5TPA A;  3GBB A;  1B5H A;  1EYK A;  3OD7 A;  4G68 A;  4H46 A;  3LSL A;  3OO9 A;  4QFP A;  1NV5 A;  1FW0 A;  1JEV A;  1USY E;  3N94 A;  2I3W A;  2CZL A;  5I3S A;  4HE1 A;  3RN8 A;  1RDY A;  4ISU A;  3B6T A;  1B0H A;  3H06 B;  1Q9D A;  1LAF E;  4G68 B;  1HSJ A;  4NF4 B;  3T22 A;  5L9O A;  2XXX A;  4JXI A;  1N3W A;  3OO8 A;  1SQY A;  1XI6 A;  1LBV A;  1BLF A;  1AH5 A;  1US4 A;  1NV4 A;  3TYH A;  4MCO A;  1OLA A;  4ZE8 A;  1LCT A;  1YZ0 A;  4POX A;  1B40 A;  1CE2 A;  2ANJ A;  4OHN A;  5ISU A;  3KBZ A;  5DEX A;  2GFE A;  1I69 A;  4N6K A;  5EQ7 A;  5I59 A;  1KZ8 A;  3K6V A;  1Z7N E;  4XKN A;  3OEK A;  4O7M A;  4F31 B;  4PTK A;  5CRY A;  3KOT A;  1FPD A;  2F5X A;  1US5 A;  5DEX B;  2I3V A;  4RK2 A;  1II5 A;  3KN3 A;  3CFL A;  4XKP A;  4IGR A;  4PAF A;  5I59 B;  4Z0I A;  2IA4 A;  1MXV A;  2H25 A;  1MXY A;  3QIM A;  4LUB A;  4TLM B;  4PDH A;  2Z22 A;  3KN8 A;  3U93 A;  1I6Q A;  4PBQ A;  4DI4 B;  3FV2 A;  3O66 A;  3N6U A;  1LBB A;  2FVZ A;  5ET6 A;  5H8F B;  4YIC A;  1N0T A;  3M3K A;  1SVX B;  4FIM A;  4FOR A;  4F2O A;  3O2A A;  4GBV A;  1O63 A;  1SI1 A;  2UYF A;  3ZSF A;  4LZ8 A;  5F24 A;  3RTF B;  3HPI A;  4EQ7 A;  3FXB A;  2H99 A;  1B1X A;  1P1W A;  5I2K A;  4U4X A;  1NV1 A;  3TEP A;  3HFU A;  1NV0 A;  1SYH A;  3H03 A;  3Q25 A;  4I3E A;  3I5O A;  4ZEI A;  4N07 A;  2PBW A;  3RYD A;  4PAI A;  3G3K A;  1S9T A;  1BKA A;  3CSG A;  4AB5 A;  4ZEC A;  4OYV A;  3RPL B;  1N7W A;  3SEV A;  4O94 A;  5I2K B;  1B05 A;  2V25 A;  2Y5K A;  2XX9 A;  1FTL A;  2CZK A;  3UIF A;  2ESN A;  3PD9 A;  1LB9 A;  2AL5 A;  4OTE A;  2R9J A;  2YJP A;  3I6V A;  2R6G E;  2DSF A;  1MRP A;  4GWO A;  3MST A;  1A55 A;  1N84 A;  3L6G A;  3O28 A;  3W9V A;  1TXF A;  4GFR A;  4YKI A;  3HV1 A;  1YYZ A;  1DMB A;  1S50 A;  1NNT A;  3Q29 A;  4JSO A;  1F9B A;  3ODB A;  4F2Q A;  4HCY A;  1B4Z A;  5HPQ A;  5IGA A;  3H6T A;  4LVQ A;  1AWB A;  1AOV A;  2DDK A;  1A8E A;  2QS4 A;  4OXV A;  3CVG A;  2Z8E A;  3FXQ A;  4NF8 A;  4NHB A;  1XS5 A;  3CI8 A;  1FJ9 A;  3IOU A;  1IME A;  3D1R A;  1MH4 A;  4EF2 A;  1MY2 A;  2XXI A;  3A3C A;  3SEU A;  2HAV A;  3FD3 A;  4NF8 B;  3THI A;  1HSL A;  1DK4 A;  3CR9 A;  3ECR A;  4ELQ A;  2F6G A;  3MWB A;  2QS3 A;  4F3P A;  5I58 A;  4NAP A;  4KYS A;  3SKP A;  4PF6 A;  4ELO A;  3PPR A;  2F7C A;  3LSF B;  2UVJ A;  4AQ4 A;  3G7W A;  3IO4 A;  3SES A;  3OEM A;  5ELV A;  4FJP A;  4GX3 A;  3C35 A;  5DTB A;  3LUY A;  3DP6 A;  4PFW A;  1KA1 A;  1JP4 A;  2A5S A;  4GL8 A;  1TT1 A;  4M4G A;  3SEX A;  1TFD A;  5FHM A;  4R2F A;  3K0V A;  3KC1 A;  3HN0 A;  1D3K A;  5I2N A;  1JW4 A;  5L9M A;  4GX6 A;  4PQJ A;  3H6U A;  1JET A;  5LTC A;  5CMC A;  3T66 A;  2HZK A;  1IMF A;  4MLQ A;  5H8S A;  5IM2 A;  5LOM A;  3GLB A;  2B3F A;  3MUQ A;  1PB9 A;  1Y4C A;  5I2N B;  2OZZ A;  2ZZV A;  1LFG A;  3GZG A;  4TLL B;  3DEL B;  3O9P A;  1ZLQ A;  1D9Y A;  4P1L A;  1EZP A;  1N7X A;  1DBZ A;  3FAT A;  5CC2 A;  4RJZ A;  4XKR A;  1P1Q A;  1MXX A;  5KDT A;  4PC9 A;  4RPO A;  3CIJ A;  5CMB A;  3VV5 A;  3MP8 A;  4P0I A;  1GV8 A;  4GL0 A;  1NNK A;  4WXJ A;  3JV9 A;  1N76 A;  2XHD A;  1Z7M E;  4OVP A;  1IZ1 A;  1IXH A;  3S9E A;  2Q2A A;  3T0J A;  5KDT B;  2F3D A;  4P0G A;  1SBP A;  1Y1Z A;  2FNC A;  1B0L A;  4NN3 A;  1XVX A;  3CRB A;  4FED A;  3IFA A;  1GTK A;  1PBQ A;  4PFI A;  1FTM A;  4TQU Q;  4IO2 A;  4KQP A;  4ONY A;  3MW0 A;  3FZV A;  3K6X A;  2ABH A;  3G3I A;  3NOH A;  4GWZ A;  1NH8 A;  2VT5 A;  2XXR A;  1MQI A;  4MF3 A;  2P3V A;  1EYJ A;  1LGB C;  4XEQ A;  2P0S A;  2QRY A;  4Q8R A;  4IO4 A;  4N8Y A;  4LAT A;  1B3F A;  4PET A;  1B46 A;  3IFC A;  4P1E A;  4ESW A;  3FJM A;  4PF8 A;  1LAX A;  3QUJ A;  2H5Y A;  3S4U A;  3KJT A;  3SDF A;  3T96 B;  2GRV A;  3HST A;  5I7I A;  3MZ1 A;  3PPP A;  2UYE A;  4KI0 E;  3BKI B;  1R1N A;  3KFM A;  4ESX A;  4DDD A;  5TU0 A;  4PGP A;  3PUX E;  5H8H A;  4Z7E A;  4P11 A;  3PUW E;  1QKA A;  3UN6 A;  4GWX A;  2I48 A;  2DP8 A;  1RKM A;  3TEL A;  5IZ3 B;  1UTB B;  2QSX A;  2XWO A;  3BIH A;  1D9V A;  2G93 A;  4P8B A;  3USD A;  3PPO A;  3SEY A;  1SW1 A;  2QS2 A;  4MX6 A;  4O8M A;  1Q1K A;  4BDM A;  3LR1 A;  1IIW A;  4QSD A;  3LV0 A;  1LFI A;  3C32 A;  1B5J A;  4YAH X;  1USY H;  2V93 A;  3EHT A;  2Y5L A;  2PX1 A;  5I84 A;  4U23 A;  5EYG A;  2UVG A;  1PEB A;  4H65 A;  2O84 X;  2FIX A;  2OCU A;  1ATG A;  2DWJ A;  1DTZ A;  2ZXT A;  3MP6 A;  3T9H B;  4KYE A;  4NE4 A;  5HBC A;  4O7I A;  1JQF A;  3QMF A;  4WEP A;  3V8X B;  1GGG A;  1OIB A;  4YKJ A;  1FSA A;  4N6P A;  3LUZ A;  4PFB A;  3SZP A;  2HXR A;  3DLN A;  2DWH A;  3MVZ A;  3O6G A;  2I49 A;  3JZJ A;  2ONR A;  4DCY A;  3KN7 A;  2R71 A;  4ELR A;  4JWX A;  1QVS A;  5EQ9 A;  4H45 A;  1CB6 A;  2XXH A;  1H44 A;  4AS5 A;  3OSR A;  3OEN A;  4GD5 A;  4DZ1 A;  2ZNS A;  2ONK E;  1ZBM A;  3QYT A;  4I62 A;  2HCA A;  2RIN A;  2O7U A;  1AIV A;  4UAC A;  2HAU A;  2P3N A;  1JW1 A;  4QSE A;  1B51 A;  1QKB A;  2I6E A;  1SW4 A;  1O7T A;  1FQE A;  3KC0 A;  1NL5 A;  1URD A;  2QVU A;  3FJ7 A;  4LP2 B;  2V3Q A;  4HS7 A;  4QBA A;  4N6D A;  4LQ5 A;  4U4S A;  3MVY A;  4IO7 A;  3U72 A;  2D5W A;  3TOD A;  4NF4 A;  3IB1 A;  1P99 A;  3E78 A;  4WKM A;  2XWV A;  2Y7P A;  4X8R A;  4MFI A;  3KOS A;  2VP1 A;  3V5A A;  5EYF A;  1MDP 1;  1SPI A;  1M5C A;  2LAO A;  2F7A A;  1MG1 A;  1Y9U A;  4BDQ A;  3T1B A;  1R6Z A;  1B3H A;  4JB7 A;  4OMB A;  2E1S A;  1N3X A;  1NUY A;  4I9D A;  2RCB A;  1B1H A;  3P7I A;  2KR0 A;  3ILU B;  3S9N C;  2F8D A;  4G61 A;  1IMC A;  3OMB A;  2X7P A;  2X7Q A;  3RT6 B;  1XC1 A;  1LBX A;  5CI5 A;  3SER A;  3PTY A;  4IGT A;  1SW2 A;  1MQG A;  4KHZ E;  2ZYO A;  2P2A A;  4R2B A;  1B5I A;  1FBC A;  3BIG A;  4JVD A;  1FRP A;  4PBH A;  4F3S A;  3O29 A;  1B3G A;  3IAZ A;  5H8F A;  2Q9T A;  2XD2 A;  4KCD A;  4TOZ A;  4C1U A;  2UVI A;  4ND9 A;  4PGN A;  1MXU A;  2H9B A;  4G4P A;  4ZZE A;  3H6V A;  3TQW A;  4EQB A;  3TTR A;  4MBP A;  4XFE A;  2ZNU A;  4IR8 A;  1LST A;  3BFT A;  4YMB A;  4YB7 A;  2I0B A;  3FVK A;  4EF1 A;  3PGF A;  1BP5 A;  2A5T B;  2DXY A;  1FQC A;  3HCQ A;  2F3B A;  3MJN A;  1MPB A;  3RPL A;  2DVZ A;  1BTJ A;  3B7D A;  4G68 C;  1SYI A;  4E0W A;  1VFE A;  1OQH A;  4JVC A;  4P56 A;  3E9X A;  2Y7R A;  3FJG A;  4X1B A;  2RCA A;  3KSJ A;  2FBP A;  2XWK A;  4OEV A;  4DCX A;  2YLN A;  5AA2 B;  3C36 A;  1WOD A;  3LBS A;  5CM6 A;  4UA8 A;  2OLB A;  3TKD A;  5IKB A;  1NV6 A;  5M2V A;  4IY5 A;  4MAG A;  3MZB A;  4PAK A;  4NED A;  1FTO A;  1MH3 A;  3LC8 A;  1LFH A;  2OBG A;  2I0C A;  4NX1 A;  1NUX A;  4LA9 A;  4OVJ A;  4GOT A;  1IMD A;  4NF5 A;  1B2H A;  2VHA A;  5ITP A;  1A99 A;  2RKM A;  3RGY A;  1HSE A;  4JBZ A;  3PV0 E;  1WDN A;  1Q35 A;  2CEY A;  2RF1 A;  3MVW A;  5ITO A;  5B70 A;  3QK6 A;  2ONS A;  3U8Q A;  5A5X A;  4R9G A;  2AL4 A;  3K2D A;  1ZJL A;  4X48 A;  3B6Q A;  4NF5 B;  2PT2 A;  1JW5 A;  4GXA A;  4PE5 B;  2KLF A;  4ZEK A;  1MQJ A;  4G8M A;  1OMP A;  2P1S A;  2ZMB A;  4OEN A;  5HM4 B;  5A5X B;  2CEX A;  3MP1 A;  3RUM A;  3K00 A;  3IK6 B;  1NH7 A;  2Q88 A;  4GVO A;  3KG2 A;  4NMY A;  2W7Y A;  5BUU A;  1IMB A;  2XXU A;  4F3B A;  4YZZ A;  2GHA A;  4PE3 A;  4F3G A;  1A7L A;  2I58 A;  3EKI A;  5EHM A;  3MVX A;  1MXZ A;  4HTG A;  5L8D A;  2XWI A;  3U92 A;  4KPT A;  1VR5 A;  4HE2 A;  1NKX A;  3UK4 A;  1FPI A;  2UXA A;  3PUY E;  4GWY A;  1NI9 A;  3E3K A;  4OVR A;  1QW0 A;  2O51 A;  1FBD A;  1OQG A;  2Y84 A;  1NNP A;  3HHG A;  3SEW A;  2FYI A;  4RA1 A;  1FPG A;  1AL3 A;  1XHY A;  3PPQ A;  4OVT A;  2V3U A;  2O1L A;  3ISP A;  4N17 A;  1UIU A;  4GRK A;  1P1O A;  4DE8 A;  3N5L A;  1D9Q A;  1LBW A;  3TMG A;  1UIV A;  2V84 A;  2Y7W A;  1LCF A;  3VFJ A;  2OWZ A;  2YPN A;  3A29 A;  4EQ9 A;  4QFL A;  4AB6 A;  5DYH A;  3R26 A;  4RNS A;  1EH3 A;  3K02 A;  3O6I A;  2R8T A;  1TWY A;  2ZZX A;  4PCD A;  3U65 A;  1DOT A;  1YPN A;  5EYH A;  1DPE A;  1POY 1;  3MAM A;  3PMX A;  2HXW A;  4H67 A;  4XXU A;  1LB8 A;  4RPN A;  3S2V A;  4OER A;  2ZYM A;  4DI3 D;  2QL3 A;  1FQB A;  3K1P A;  1IQ7 A;  3ILT B;  2WBB A;  2NUV A;  4HXV A;  3PUV E;  1B7Z A;  4GQO A;  4YB5 A;  4THI A;  2PFZ A;  1QUL A;  2GQ1 A;  1MQH A;  2AYS A;  3OEL A;  1LAG E;  1H43 A;  5EHS A;  4NWC A;  3RT8 A;  1GR2 A;  2QS1 A;  4BDN A;  2B3B A;  1FBF A;  3C9H A;  1POT A;  2XA5 A;  1MY1 A;  3U94 A;  5KZT A;  3RQT A;  1S7Y A;  2QMX A;  1KA0 A;  5DVJ A;  2FA7 A;  1NUW A;  2PT1 A;  3IOW A;  4JSD A;  4ZDM A;  4I3Y A;  3OXN A;  1K9Z A;  1MM7 A;  1FPF A;  4H8J A;  5DVF A;  1M5D A;  4EDP A;  3GBA A;  4OFL A;  2WKY A;  5FTI A;  2HPG A;  2DE2 A;  2HZL A;  1FPJ A;  3IB0 A;  3EN3 A;  2Y7K A;  5ICQ A;  1SI0 A;  4IO6 A;  1CNQ A;  1H45 A;  3TUS A;  1B9J A;  3PUZ E;  3VDF A;  3M3F A;  3LSX A;  2XXQ A;  2F97 A;  2OWS A;  3DM0 A;  3FVG A;  2O7I A;  3JYR A;  2F78 A;  4MLV A;  2QMW A;  2M8C A;  1H3D A;  2DE3 A;  1YCJ A;  1LAH E;  1SW5 A;  2XX8 A;  5L9S A;  3QSL A;  4E0X A;  1XVY A;  5IZ3 A;  1UTB A;  4HE0 A;  2QFL A;  1EZO A;  1Y20 A;  1BK4 A;  4MMP A;  1EYI A;  3MPL A;  5KCJ A;  4BDO A;  1FCK A;  5ESY A;  3AXF A;  4F1U A;  3KJ7 A;  4R75 A;  2D21 A;  4F19 A;  4YU0 A;  3QXM A;  3FXU A;  5AA1 A;  1QUJ A;  2VD2 A;  4QF9 A;  1NNF A;  2XXP A;  2BJJ X;  3K01 A;  1IXI A;  5KCJ B;  2OX3 A;  5CMK A;  4XF5 A;  3VVF A;  3DP4 A;  1B3L A;  1UTH A;  1FQF A;  1RDX A;  2WX9 A;  1A40 A;  4N81 A;  5JTY B;  5ICT A;  2Z8D A;  1IIT A;  5I56 A;  3IR1 A;  1URS A;  1MPD A;  1N04 A;  4H5F A;  2DOJ A;  1ZIU A;  3FXR A;  1ANF A;  3CFZ A;  1UTH B;  3K6W A;  5B7D A;  5LDZ A;  2Q8M A;  2ZYN A;  2RC9 A;  5I56 B;  2F34 A;  1DTG A;  3OO6 A;  2Y7I A;  1MY4 A;  4H6D A;  1I6B A;  3O97 A;  3KZG A;  4K3F A;  4LON B;  1B7H A;  4QFK A;  1QGX A;  1QUK A;  1MM6 A;  2NOO A;  3M3L A;  2O6A A;  5JEI A;  4H8I A;  5CBR A;  3H3G A;  3MZ9 A;  4P9K A;  3C4M A;  4N91 A;  3ZKL A;  4QXD A;  2Q89 A;  3EPE A;  3RPW A;  2Q74 A;  3PU5 A;  1R9Q A;  3OO7 A;  1NV2 A;  4PP0 A;  5T3J A;  4X1D A;  1B52 A;  3QAX A;  2PVU A;  4NWD A;  4F29 A;  2XXK A;  4HW8 A;  2MKZ A;  2NVU B;  4H5G A;  3HO7 A;  5H8Q B;  5I57 A;  4IY6 A;  3N26 A;  2NWJ A;  5AA2 D;  2CZH A;  4PFU A;  3C34 A;  3EHS A;  3LSW A;  3FUZ A;  1DSN A;  4KCC A;  3WAF A;  5I57 B;  2CMO A;  4ZEF A;  2JJK A;  3U1O A;  2Z8F A;  4R73 A;  1T0K A;  4F22 A;  4X04 A;  5IAI A;  2ZNT A;  3D4G A;  4NF6 B;  2NXO A;  1P1U A;  2DQV A;  4EXL A;  2PMS A;  3A3U A;  2IEE A;  3CHG A;  3IJO B;  4U21 A;  5TPA B;  4GWS A;  1YTV A;  2H4I A;  3E13 X;  5FHN A;  2HFB A;  3IOV A;  5CBS A;  4LZ7 A;  1J1N A;  3EHU A;  2PCR A;  1WVJ A;  2HEU A;  3H6W A;  3ONM A;  3C33 A;  3MYU A;  2REG A;  4UAB A;  4R74 A;  4DXC A;  4C1T A;  1IXC A;  2Q2C A;  2AIX A;  4N15 A;  4RYA A;  3V83 A;  1VFD A;  1FPL A;  2REJ A;  3G3F A;  4RXL A;  1P1N A;  4RY1 A;  4OFO A;  3KEI A;  1NMU A;  1B7U A;  1PC3 A;  1Y3P A;  3Q27 A;  4YB6 A;  1UQW A;  4GLI A;  4YMA A;  5I5P A;  1R9L A;  2WEF A;  4KD5 A;  2B4M A;  4Q30 B;  4KR5 A;  2A5T A;  3K1N A;  4ZED A;  4FAT A;  1A8F A;  2VPO A;  3FBP A;  4OQO A;  3H7M A;  1EZ9 A;  5H8N A;  1B3E A;  1G0H A;  1Y3Q A;  1RYX A;  4IO3 A;  1TFA A;  4DXB A;  5AE4 A;  5ET8 A;  3MPK A;  4P3L A;  4JDF A;  2F36 A;  1ZTY A;  1YAE A;  5H8N B;  4MH5 A;  1SDX A;  3FVN A;  5TP9 A;  4OWD A;  1ZKB A;  2DS9 A;  3QUF A;  4OFJ A;  4OVS A;  2DWA A;  3SET A;  5AA2 A;  1MS7 A;  1IXG A;  3EF7 A;  1QUI A;  5TP9 B;  2QJE A;  1RYO A;  3ROJ A;  3E4R A;  4U1O A;  4ZEB A;  4EUO A;  3TCF A;  1LBZ A;  1KWH A;  4R6K A;  4BDR A;  5FTH A;  2PFY A;  1FJ6 A;  2E0S A;  4F1V A;  2QPQ A;  2FIE A;  3V89 B;  4LQ2 A;  1NV3 A;  2QVR A;  5F1Q A;  2XD3 A;  4G8N A;  1OLC A;  1SD3 A;  4O3A A;  4GX4 A;  4PFT A;  3VXC A;  4R6H A;  4DIG A;  5DW8 A;  3N6T A;  3TAJ A;  4GIZ A;  1Y4T A;  1ZU0 A;  2F6P A;  4YKK A;  1FBP A;  1PBP A;  4I1D A;  3TTK A;  4GWW A;  1B6H A;  3CG1 A;  5EQ8 A;  2OK2 A;  4MJO A;  1B32 A;  2ALU A;  3KBR A;  1FPB A;  4ZS9 A;  5F7V A;  4YKP A;  4Q5T A;  3MQ9 A;  4NQ8 A;  4HCW A;  2VD3 A;  3IX1 A;  4XIG Q;  2DYX A;  1K9Y A;  3T9U A;  4R72 A;  2XXW A;  4FEC A;  3TFL A;  4KXP A;  2GH9 A;  3K4U A;  4G77 A;  3M8U A;  3ZKK A;  4GWU A;  4RK9 A;  3W15 C;  3O6H A;  5FHO A;  4U2R A;  5IZ1 A;  4MHF A;  4QHQ A;  2XXY A;  4I8C A;  5EQA A;  4C0R A;  4MEV A;  2OJT A;  3IOR A;  3K6U A;  1ZMG A;  1PB8 A;  5ET7 A;  4XKQ A;  3TCH A;  4PFY A;  1XT8 A;  3K1M A;  4ZE9 A;  1VSO A;  2VGQ A;  4POW A;  3TPA A;  1DCU A;  4PDD A;  1MY3 A;  3MC2 A;  3VXB A;  1URG A;  2CZI A;  4LN5 A;  4ZZA A;  1DPP A;  5J16 A;  3G3H A;  1MPC A;  1Y3N A;  3VLV A;  3VLU A;  3B50 A;  1B4H A;  1IEJ A;  3PD8 A;  3CFX A;  2VPN A;  3E79 A;  3HHF A;  2DXR A;  3TQL A;  3L6H A;  2D3I A;  1MY0 A;  4H1X A;  3MBP A;  4L17 A;  2WYP A;  3PPN A;  5I58 B;  2ZYK A;  1M5E A;  5FBP A;  4EXK A;  1XOC A;  1L5T A;  3UA8 A;  3R7X A;  1JEU A;  3GXA A;  1B58 A;  4N4U A;  2B65 A;  5BWJ A;  3IO6 A;  1FPK A;  2XXT A;  3VLW A;  2G29 A;  1M5F A;  2F35 A;  2PYY A;  1NFT A;  3CG3 A;  2V4C A;  3DP8 A;  3UGW A;  4H0W A;  4O3C A;  5DT6 A;  4GF8 A;  3IL1 B;  2F7B A;  3OSQ A;  3TTL A;  2OWT A;  1O64 A;  4JWO A;  2RC7 A;  1BIY A;  3H4Z A;  4MNI A;  4U22 A;  3Q28 A;  1JVY A;  4Q0C A;  2QVV A;  4FE8 A;  1IMA A;  2X26 A;  4ECF A;  4I40 A;  2WYK A;  1QJM A;  1YXI A;  3G3J A;  1A54 A;  3TDJ A;  3BFU A;  3RNN A;  4NG7 A;  3VE1 B;  1FPE A;  4GXS B;  4JWY A;  4N8G A;  4DLD A;  2I4B A;  4NF0 A;  2WBD A;  4F39 A;  5ET5 A;  3UP9 A;  4X9T A;  4N13 A;  2H98 A;  3EQ1 A;  1LLS A;  1MQD A;  4NGU A;  5AA3 A;  5DVI A;  4QFO A;  3A09 A;  4R6Y A;  4IB2 A;  3TCG A;  5K2Y A;  2O69 A;  1FTK A;  4QFN A;  1Y1M A;  1H76 A;  4KYD A;  3FGS A;  1VE4 A;  3BBR A;  3RTW B;  2XXV A;  4QSC A;  1FTJ A;  4XTC Q;  3ZS6 A;  3GYY A;  1MDQ A;  2O68 A;  2HHM A;  2I4C A;  3UOR A;  2DWI A;  3RLF E;  2GHB A;  4BDL A;  1NUZ A;  1FQD A;  5CMM A;  5JTY A;  4JVI A;  4O3B A;  5IZZ A;  4KFQ A;  3G3G A;  2BJI A;  1G0I A;  3PMV A;  3FVO A;  4U1Z A;  1MXW A;  2HQ0 A;  3IB2 A;  2DE4 A;  4G2Z A;  2V3T A;  2UVH A;  3W9W A;  5H8H B;  1ELJ A;  3FV1 A;  3IOT A;  3KSX A;  2Q8J A;  3D4C A;  3TZA A;  1FBG A;  1JVX A;  1LEV A;  1OVB A;  4OZ9 A;  3KGC A;  4AS4 A;  3RY3 A;  3WAE A;  2THI A;  1JNF A;  3T9X B;  4OEU A;  4OET A;  4FEB A;  4IO5 A;  1LBY A;  4GBW A;  4DXU A;  4OAN A;  3IJX B;  5A5L A;  1I6A A;  2XX7 A;  1INP A;  3Q26 A;  4PFR A;  4F18 A;  5JK4 A;  4MNC A;  3VVE A;  3B6W A;  3OOA A;  5AA4 A;  4NTL A;  2FHY A;  4MIJ A;  3B8B A;  3VVD A;  4FBP A;  4OA4 A;  1PDA A;  4LZ5 A;  2ZZW A;  3CSB A;  4OVQ A;  4P47 A;  3S9L C;  4R9F A;  1RDZ A;  1VDW A;  3T93 B;  5H8Q A;  1NV7 A;  3FIR A;  4QRZ A;  4ELP A;  3TTM A;  2DVC A;  3T9V A;  5AA4 B;  4BLA A;  2B4L A;  3F11 A;  1AMF A;  2RC8 A;  3PMW A;  4WED A;  4FAJ A;  3C31 A;  1FQA A;  4F1Y A;  1EU8 A;  3FAS A;  1D4N A;  3R6U A;  1M5B A;  4M1V A;  5K2X A;  5J1D A;  2VOZ A;  1IUD A;  1GVC A;  3I3V A;  1OVT A;  2O1M A;  1LBC A;  4MNP A;  3S9M C;  4NF6 A;  1FBH A;  1FBE A;  2KQZ A;  4OES A;  3TTN A;  2L5V A;  2Z23 A;  1FTA A;  1PB7 A;  4G8H A; 
#chains in the Genus database with same CATH homology
 1LBZ A;  3A29 A;  1EYK A;  4PGP A;  4H46 A;  1NV5 A;  2PFY A;  1FJ6 A;  2R8T A;  4F1V A;  2QPQ A;  2FIE A;  4GWX A;  2ZZX A;  4PCD A;  3U65 A;  5I3S A;  5IZ3 B;  2XWO A;  1NV3 A;  2QVR A;  3BIH A;  5EYH A;  4HE1 A;  1RDY A;  4P8B A;  4GX4 A;  4MX6 A;  1Q9D A;  4O8M A;  5DW8 A;  4DI3 D;  3LV0 A;  2WBB A;  1FBP A;  4HXV A;  1XI6 A;  1LBV A;  4GWW A;  2Y5L A;  5EQ8 A;  5EYG A;  4MJO A;  1NV4 A;  2FIX A;  4MCO A;  2PFZ A;  2GQ1 A;  1FPB A;  1YZ0 A;  4NQ8 A;  4HCW A;  4O7I A;  3QMF A;  1K9Y A;  1FBF A;  2XA5 A;  3KBZ A;  1FSA A;  4N6K A;  5EQ7 A;  3LUZ A;  1KZ8 A;  4KXP A;  4PFB A;  3SZP A;  2HXR A;  1KA0 A;  1NUW A;  4O7M A;  4I3Y A;  4GWU A;  4PTK A;  1FPD A;  1K9Z A;  5IZ1 A;  1FPF A;  4MHF A;  5EQ9 A;  2F5X A;  5EQA A;  4H45 A;  4PAF A;  4AS5 A;  4MEV A;  2HPG A;  4PDH A;  2DE2 A;  2HZL A;  4DI4 B;  4PBQ A;  5ET7 A;  1FPJ A;  5ET6 A;  2FVZ A;  4YIC A;  1CNQ A;  4GBV A;  1DCU A;  4PDD A;  2P3N A;  2CZI A;  4LN5 A;  5F24 A;  3FXB A;  5J16 A;  3KC0 A;  2QVU A;  2V3Q A;  3B50 A;  1NV1 A;  3HFU A;  2DE3 A;  1NV0 A;  2VPN A;  4QBA A;  3E79 A;  4N6D A;  5IZ3 A;  4HE0 A;  2QFL A;  4I3E A;  1BK4 A;  4MMP A;  3RYD A;  2WYP A;  4PAI A;  3RPL B;  1EYI A;  4O94 A;  5FBP A;  3E78 A;  2XWV A;  5ESY A;  4F1U A;  2Y5K A;  4X8R A;  2CZK A;  4F19 A;  4N4U A;  1SPI A;  1FPK A;  3T1B A;  2OX3 A;  4XF5 A;  3MST A;  1NUY A;  1RDX A;  2WX9 A;  2KR0 A;  4N81 A;  3W9V A;  4G61 A;  1IMC A;  2V4C A;  1LBX A;  1YYZ A;  3PTY A;  4HCY A;  5LDZ A;  1FBC A;  3BIG A;  4JVD A;  5IGA A;  4MNI A;  1AWB A;  2Q8M A;  1FRP A;  2DDK A;  4PBH A;  2QVV A;  1IMA A;  2Q9T A;  4I40 A;  2WYK A;  1YXI A;  4NHB A;  1QGX A;  4PGN A;  1FJ9 A;  4NG7 A;  1IME A;  1FPE A;  3D1R A;  4XFE A;  4P9K A;  4IR8 A;  4N8G A;  4N91 A;  4QXD A;  4NF0 A;  2WBD A;  5ET5 A;  4X9T A;  1DK4 A;  2Q74 A;  1NV2 A;  4NGU A;  2F3B A;  5T3J A;  3RPL A;  4NAP A;  2DVZ A;  4PF6 A;  2XXK A;  2MKZ A;  4JVC A;  4P56 A;  2CZH A;  4GX3 A;  1KA1 A;  3GYY A;  2HHM A;  1JP4 A;  2FBP A;  2XWK A;  1NUZ A;  2JJK A;  4JVI A;  3KC1 A;  5IZZ A;  4X04 A;  5CM6 A;  2BJI A;  1G0I A;  4GX6 A;  1NV6 A;  5LTC A;  2HZK A;  1IMF A;  3CHG A;  4MAG A;  2DE4 A;  4PAK A;  5IM2 A;  4GWS A;  4NX1 A;  1NUX A;  3W9W A;  2PCR A;  2ZZV A;  1IMD A;  3MYU A;  4UAB A;  2CEY A;  1FBG A;  1LEV A;  4AS4 A;  4P1L A;  1DBZ A;  4N15 A;  1FPL A;  1LBY A;  4PC9 A;  4GBW A;  4OAN A;  5A5L A;  5I5P A;  1INP A;  4F18 A;  4PFR A;  2CEX A;  5JK4 A;  4MNC A;  2WEF A;  2B4M A;  4OVP A;  2FHY A;  4MIJ A;  3B8B A;  3T0J A;  4FBP A;  1IMB A;  2F3D A;  2VPO A;  3FBP A;  4OA4 A;  4YZZ A;  4PE3 A;  1G0H A;  2ZZW A;  3EKI A;  4NN3 A;  4OVQ A;  4P47 A;  3IFA A;  4PFI A;  1RDZ A;  1VDW A;  1NV7 A;  2XWI A;  4HE2 A;  2B4L A;  1FPI A;  4GWY A;  5ET8 A;  1NI9 A;  4P3L A;  3NOH A;  4OVR A;  4GWZ A;  2VT5 A;  1FBD A;  2P3V A;  1EYJ A;  4M1V A;  5J1D A;  4XEQ A;  4OVS A;  1FPG A;  4N8Y A;  4OVT A;  4PET A;  3IFC A;  4P1E A;  4PF8 A;  4MNP A;  3ISP A;  4N17 A;  1FBH A;  1FBE A;  2KQZ A;  5I7I A;  1D9Q A;  1LBW A;  2L5V A;  1FTA A;  3ROJ A;  2OWZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...