2WYKA

Siap in complex with neu5gc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siap in Complex with Neu5Gc
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 122
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wykA00
4PFBA 3GYYA 2WYPA 3U65A 4MNPA 4N8YA 5LTCA 4NGUA 4P8BA 4X8RA 4PAIA 4XFEA 3B50A 4PE3A 4YZZA 4P3LA 2XWOA 4O94A 4XF5A 2ZZVA 5IM2A 2XWVA 4NHBA 4OVSA 2WX9A 4N91A 2PFYA 4MIJA 4PCDA 2HZLA 4N4UA 4OANA 4P9KA 4PF6A 4NF0A 2XWKA 5IZZA 4NX1A 4PC9A 4PFRA 2VPNA 4YICA 4PFIA 2XWIA 4N8GA 4N15A 4MNCA 4DI4B 2HZKA 4PF8A 4NQ8A 4PDDA 4N6DA 4O8MA 4NN3A 2VPOA 4MMPA 4X04A 4UABA 4PETA 4MHFA 4PGPA 4MEVA 2XXKA 4NG7A 2ZZWA 4MAGA 2WYKA 4PAFA 4XEQA 4P56A 4PBHA 4PAKA 4PDHA 2V4CA 5CM6A 5I5PA 4PBQA 4N17A 4MCOA 4MX6A 4OVTA 4OVPA 5IGAA 4P1EA 5I7IA 2PFZA 4O7MA 4LN5A 2CEXA 4OA4A 2XA5A 4MNIA 2ZZXA 2HPGA 4P47A 4N6KA 2CEYA 4DI3D 4P1LA 4NAPA 4PGNA 3FXBA 4OVRA 4OVQA
chains in the Genus database with same CATH superfamily
3U65A 3QIMA 5ISUA 4U22A 4ECFA 5J1DA 4EQ9A 4O3BA 3H6WA 1LFHA 1OLCA 2DWAA 3TCHA 5M2VA 3MP8A 2XXRA 2CZKA 1FQEA 2GQ1A 2XWKA 3OEMA 2RC8A 3K1PA 3B6QA 3IOVA 4YICA 1OVBA 4X1DA 5I2KB 1LFIA 2HAUA 2B4LA 3MPKA 4QFNA 5TPAA 3R26A 1SYHA 4F31B 1IQ7A 2ZZWA 5I58A 5F24A 2QPQA 1FPIA 4JBZA 1FPFA 2A5SA 5EYGA 2VD2A 2CMOA 5I5PA 1FQDA 4PE5B 2JJKA 5IZ1A 1NNKA 1QJMA 1DPPA 4HS7A 1G0IA 2QFLA 4NF5A 2CEXA 3ODBA 4U1ZA 4QSDA 3CG1A 3F11A 2XD3A 3ILUB 2ZYKA 3G7WA 1YZ0A 5CMMA 4OQOA 4U23A 2Q2AA 4GX3A 3PV0E 1MPBA 1OQGA 3FZVA 1SVXB 4MNPA 1DTGA 4GOTA 1JP4A 4ZECA 5ELVA 4DXCA 4GWWA 3MSTA 1IXGA 1LGBC 4YB5A 3TODA 3FVKA 2ALUA 5LDZA 1Y4TA 4R9FA 3JZJA 4U1OA 2P0SA 3E9XA 4GWXA 4H6DA 2QS4A 2OX3A 2KR0A 3MJNA 3VDFA 2UVGA 4DCXA 5DVFA 2Z8FA 4GIZA 1YTVA 3PPNA 3ILTB 3HHFA 4FE8A 5EQ7A 2DOJA 1B32A 3C35A 3IOTA 1MQDA 2QL3A 2I0CA 5CMCA 4DXBA 5I57B 1PEBA 1NV1A 1UTHA 3I3VA 2UVIA 4N13A 3O97A 3HO7A 2WBDA 4JSOA 2DS9A 4H45A 3IOUA 4RNSA 3QUJA 1NH7A 4G68C 5JEIA 4F39A 4HCWA 1DTZA 2NWJA 3PUXE 1MPCA 2ONSA 4IY5A 3VXBA 5IZ3A 1FSAA 4OVRA 1K9ZA 3K02A 1D9QA 3VFJA 5CRYA 4XFEA 4PE3A 1DBZA 3BFTA 1NUZA 1M5DA 2ONKE 1N7WA 2QMXA 3QMFA 4IR8A 2LAOA 2XWVA 3E79A 1JNFA 1NUWA 2DXYA 4G77A 5AA4A 5IAIA 1YPNA 4DCYA 2XXXA 1Z7NE 1NUXA 3OD7A 4X48A 3JYRA 4NF5B 3K6WA 2HZKA 3LUZA 2Y7RA 2RC7A 4EQ7A 4MMPA 2D5WA 3TEPA 4QHQA 3P7IA 5H8NB 3TQLA 5H8QB 2DQVA 2Q8JA 3MVYA 2RKMA 4FAJA 1DMBA 2F7CA 5CMBA 4OFLA 1F9BA 4PBHA 3FXUA 4PAKA 4LP2B 4EUOA 3O66A 4K3FA 1TFDA 2OJTA 2REGA 3W9VA 4GXAA 4N17A 4RXLA 4XKPA 4NTLA 5AE4A 4OVPA 4EDPA 1VFDA 1BTJA 1JW4A 1SDXA 3QYTA 3RPLA 1FQFA 3U1OA 5DVJA 4NF4A 1IIWA 1N76A 3ISPA 1JVXA 5EYFA 1SPIA 4JSDA 2RC9A 3U8QA 4R2FA 5F1QA 1NV4A 4AS5A 3GYYA 1B51A 3OO8A 4GL0A 4JWXA 4GF8A 2V84A 4PFUA 1FTKA 4NGUA 4WEDA 2DE3A 1FTJA 5DT6A 4P3LA 4O94A 4PFWA 3R6UA 2IEEA 3SEWA 4ZEBA 2Z22A 2F5XA 5DEXA 1YYZA 3FD3A 4P9KA 3UK4A 4NF6B 4H0WA 1FPJA 3VV5A 2E1SA 3RLFE 3KEIA 5EQ9A 3TTMA 4DE8A 3QSLA 4I8CA 4PF8A 4F1VA 4YAHX 1VFEA 1FPLA 4FIMA 3V5AA 2MKZA 1USYE 1DPEA 3GBBA 3DELB 1ANFA 1BLFA 3FV2A 1O7TA 4LONB 4N07A 2FA7A 4F22A 2G93A 2Z23A 3H6UA 2KQZA 4UABA 5I57A 1R6ZA 2GHBA 2O6AA 4MEVA 3Q25A 3LUYA 3PPPA 3UORA 4KYDA 1NV7A 4RA1A 1ZTYA 3TCFA 3HV1A 2O51A 1B3GA 5FHOA 1JETA 3HSTA 4XXUA 1URSA 1USYH 3A3CA 3FJ7A 4OMBA 5I2NA 5IKBA 3IX1A 1NNPA 3M3FA 1NUYA 1Y3NA 5ICQA 1PBQA 3PMXA 3PU5A 2HCAA 2XA5A 3T1BA 1N7XA 3G3JA 4OESA 1MRPA 4YU0A 5FHNA 1US4A 4ND9A 1Z7ME 4P1LA 4PFBA 3BFUA 3K4UA 1I6AA 4KCDA 2PCRA 2GHAA 4NE4A 1OLAA 2ANJA 5JK4A 4P0GA 1TXFA 2QS3A 4X9TA 1FQAA 3PTYA 1IXCA 4FJPA 4BDQA 4HTGA 4R6YA 4POWA 1II5A 3V89B 4OXVA 3DP6A 2Q88A 3HN0A 4NF0A 5B7DA 2W7YA 4LQ5A 2E0SA 4N8GA 5EHMA 2HHMA 2AL5A 1LEVA 1B1XA 1B1HA 4ISUA 4G2ZA 4I1DA 2RF1A 3KJ7A 2P3VA 1Y20A 4EQBA 4PP0A 5CMKA 1R9QA 2B3BA 3MQ9A 4LVQA 3A09A 1DCUA 3K00A 3OEKA 3O9PA 1MXYA 2XXQA 1YCJA 5FTHA 3ROJA 2OWSA 4ZEKA 3O28A 5I58B 3FASA 1M5BA 2F3BA 2OBGA 4XEQA 1B6HA 2VD3A 3K1MA 2FIXA 1NH8A 2OZZA 4WXJA 3PGFA 1MXXA 1B40A 2KLFA 1PC3A 5KDTB 3D4GA 5IGAA 3TELA 3TQWA 3E78A 3MP1A 1P1UA 5EYHA 3MBPA 1B9JA 4OA4A 5AA3A 1YAEA 3S9EA 3ZS6A 4N6KA 4U4XA 1YXIA 3PPQA 5ICTA 4FEBA 2XX9A 1B2HA 4HE1A 5DVIA 1OIBA 3T9VA 2DSFA 3FBPA 1FTAA 5CI5A 1LBCA 1UIUA 3TUSA 5ET6A 4XKNA 4NMYA 4MBPA 2VP1A 4RK9A 3SETA 1KA1A 3LSFB 5HPQA 5TP9A 2Q2CA 2WX9A 1B7ZA 1LLSA 4RY1A 2F3DA 2O68A 4G8HA 3O29A 3MC2A 2AIXA 1IITA 2VPOA 3BBRA 2X7QA 3Q29A 3MZ1A 3T22A 2H98A 1EH3A 5KCJB 3K6UA 3O6HA 1MH4A 2F6GA 2I6EA 2YJPA 4JDFA 4POXA 2GFEA 1B4HA 1IMCA 1B7HA 2A5TA 2Y7WA 1LAGE 3CI8A 1SW4A 4IGRA 2RCAA 1I69A 1XS5A 5DEXB 3SERA 1MM6A 2Z8DA 2PT2A 3RUMA 4F1YA 1XT8A 4MCOA 4YMAA 1PB7A 4GBVA 1FBDA 2HEUA 4OVJA 2AL4A 4FATA 2I48A 3UN6A 1P99A 1IMBA 5I59A 2DWHA 2QSXA 4GXSB 4DDDA 3HHGA 2QVRA 4P47A 4QXDA 3VVDA 4G4PA 1FPGA 3VE1B 1Y4CA 4R6HA 4Q8RA 3IB1A 4YKPA 1NV5A 3FJMA 4H67A 1FRPA 3G3FA 1DK4A 1NV6A 3OO6A 3HPIA 5I59B 2I4BA 2H25A 3IORA 4YZZA 5L9OA 1P1OA 5EQ8A 3TFLA 5J16A 3PMWA 3KG2A 2F97A 4N4UA 3EHTA 4GWSA 4OETA 4QFOA 4PF6A 2QVUA 3MYUA 4MJOA 4PC9A 1N3XA 1N04A 2FHYA 4O3AA 4F29A 4NQ8A 2Y7KA 4N6DA 4JB7A 1B5JA 3E13X 4QFKA 4X04A 3S9LC 3H4ZA 3IO4A 3QK6A 3TZAA 1AOVA 4MHFA 3ZKKA 3FIRA 3T0JA 1FCKA 3Q26A 3MPLA 2WYKA 4ONYA 4GWZA 3IR1A 5JTYA 4QSCA 3MWBA 2H9BA 3UA8A 2FVZA 3G3KA 1ELJA 1SYIA 2H5YA 3SEVA 4QF9A 1LBXA 4MX6A 1B3HA 5TP9B 4LQ2A 3OOAA 2NOOA 2VGQA 3G3HA 1H45A 3K2DA 2XXIA 3L6HA 5I7IA 2REJA 3RN8A 1TWYA 2DE4A 2F35A 3LV0A 4TLMB 4NEDA 1AL3A 1O63A 4KQPA 3VVEA 3JV9A 5H8HB 3SEYA 4RYAA 4P11A 2R8TA 4ELPA 2I3VA 1H3DA 3EPEA 5BUUA 1RKMA 3SEXA 1P1NA 5ET8A 3KN8A 4LZ8A 4BDOA 1RDXA 1BKAA 3UP9A 3FXQA 2HAVA 1T0KA 1A7LA 1EZ9A 4HW8A 4KHZE 4PAIA 3CSBA 3FVNA 5A5XB 2P3NA 1S7YA 5CC2A 2DE2A 2DXRA 2XX8A 1LB8A 2VOZA 3HFUA 1P1WA 5IZZA 2X7PA 2YPNA 4IO2A 3FVOA 2XWIA 3IFAA 4XTCQ 3OMBA 2Y5KA 4GWUA 1UQWA 2I3WA 4FORA 4H8JA 3ZKLA 5IZ3B 3KZGA 2YLNA 1MXUA 2D21A 1CB6A 3T66A 1Y1ZA 1B0HA 3CFLA 3C33A 4DZ1A 3FGSA 4ZEDA 4QSEA 3KN3A 3E4RA 3T93B 4OERA 3C34A 2WKYA 3IB2A 3OSRA 1LCFA 1MXWA 2GH9A 3U72A 1B58A 5I56A 3QUFA 4PBQA 1B0LA 3MUQA 3VLWA 4MFIA 2O84X 3USDA 2F78A 2BJIA 4H5GA 3M8UA 4RJZA 1FJ9A 1MQJA 4JWYA 5AA2A 2F7AA 3C32A 5B70A 2OCUA 1FTMA 4GX6A 2HPGA 1FBPA 2ZNSA 3V83A 3TDJA 3I5OA 1FBFA 3DP4A 2OLBA 3NOHA 4ZS9A 4GD5A 4AB5A 3KC0A 1FPKA 4LZ5A 4OFJA 1SD3A 4BDMA 2XXPA 3IOWA 1S50A 1LAXA 3Q27A 1PDAA 3SDFA 4GQOA 4H8IA 1QUKA 1SI1A 2P1SA 4AQ4A 4BDLA 5I2NB 2B65A 2NXOA 2H4IA 2UVHA 2UVJA 2F36A 3H03A 2I0BA 4MNCA 1INPA 3FXRA 4JVDA 1MDP1 3CSGA 3T9UA 3KFMA 3V8XB 4IO3A 1B46A 3G3GA 4OENA 4IB2A 1FBCA 4F2OA 1ZJLA 4F18A 1NFTA 2Y7IA 1D3KA 4ELQA 5H8FB 2PMSA 3RT8A 1HSLA 3RGYA 3UIFA 3IJOB 4WKMA 5H8SA 1LB9A 1QULA 1ZU0A 4H1XA 3PPRA 3VVFA 2Q74A 1LSTA 1FPDA 4P1EA 3C31A 2O1MA 1EYKA 1MY3A 1Q35A 3E3KA 3GZGA 1O64A 5BWJA 1EU8A 4NAPA 2XXVA 4G8MA 1FTLA 3S2VA 1VR5A 5AA1A 3K01A 4LA9A 4NF4B 3S4UA 3RPLB 1FQBA 1URGA 5ESYA 4XF5A 2Z8EA 3IL1B 2PX1A 1US5A 3LSWA 2PYYA 5H8HA 3CHGA 4EF1A 3EF7A 3TMGA 4TQUQ 4OYVA 5ITOA 4IGTA 3RT6B 2WEFA 2XXWA 1XVXA 3M3KA 1MDQA 4KPTA 3LBSA 3KJTA 1GV8A 3D4CA 1SBPA 5ITPA 2DDKA 4GLIA 1OMPA 2ZMBA 1B7UA 4DXUA 1AMFA 1AH5A 4KR5A 3U93A 3UGWA 1Y9UA 1IXIA 3EQ1A 2VHAA 4TLLB 3CFZA 3HCQA 1B3EA 3PUWE 4OVTA 1PB9A 4WEPA 1Y1MA 4G68B 4IO4A 3TCGA 1R1NA 1IXHA 2V93A 4GVOA 4O7IA 1B4ZA 2RINA 5H8QA 2UXAA 1OVTA 4OZ9A 4HCYA 2Y7PA 2PT1A 3B6WA 4OWDA 3RYDA 1SW1A 1UTBB 1MPDA 4GWYA 3ECRA 4OFOA 1KWHA 2V3UA 2F8DA 4MF3A 4F19A 3CRBA 3SESA 1A8FA 2ZZVA 1MM7A 1L5TA 2H99A 3PPOA 4OVSA 1ZIUA 5AA4B 2HXWA 5T3JA 1JW5A 1GGGA 4C1TA 1A40A 1UTHB 1MY4A 1B52A 4DLDA 4N81A 1WODA 3LSXA 1IMEA 5KZTA 3IJXB 5DYHA 4PFIA 4THIA 5AA2B 2IA4A 4PQJA 1M5CA 4DI4B 3K6XA 4U21A 1VDWA 3A29A 4I3EA 3RPWA 1ZLQA 2OWTA 5DW8A 3FV1A 3TKDA 3N94A 4YKKA 1FW0A 1FPBA 3TTRA 2OWZA 3I6VA 2B3FA 3WAFA 2QMWA 5K2XA 2Q8MA 1QUJA 4DIGA 1MY0A 2PVUA 2NVUB 2I58A 5H8FA 2V3TA 5EQAA 1TFAA 2HQ0A 1LCTA 1CE2A 3RQTA 2O7IA 2ZYMA 4BDNA 4QFLA 3H06B 1IMFA 4IO5A 1XC1A 5L9MA 5CBRA 3IO6A 3SZPA 4F3GA 2ZZXA 2CEYA 1FBGA 4M1VA 1XVYA 1PB8A 2XX7A 2ZNTA 5ET5A 2G29A 5A5XA 2DWJA 1N0TA 1B5IA 4X8RA 4P0IA 1J1NA 3OENA 4G61A 4H5FA 3KOSA 4KI0E 4QRZA 2CZLA 4NF8A 4Q30B 4R2BA 4ESXA 4NWDA 3OXNA 4U4SA 2HZLA 1RYXA 1EYJA 1FPEA 1LAFE 3W9WA 1NMUA 1EZOA 1FTOA 3MVWA 1M5FA 3DP8A 2DVZA 1Q9DA 3KBRA 4MLQA 1PBPA 2B4MA 3IAZA 4HE0A 2D3IA 1MY1A 4EXLA 3RTFB 4F1UA 4E0XA 4O8MA 4H46A 5KDTA 1IEJA 4M4GA 4KD5A 5CBSA 3IFCA 3KOTA 2OK2A 5TPAB 1QKBA 2L5VA 4YMBA 2NUVA 1BIYA 5JTYB 4NG7A 1N84A 1B3LA 4JWOA 4MAGA 1FQCA 4PAFA 2DYXA 2XXTA 1IUDA 4F3BA 1Y3PA 2ZNUA 4UA8A 1QUIA 3LR1A 1B3FA 3OSQA 4R73A 3OO9A 1EZPA 2F34A 5TU0A 1OQHA 3QAXA 3BIGA 2ZXTA 1FJ6A 3THIA 4I62A 1GTKA 3CR9A 2DVCA 1Q1KA 1NI9A 2AYSA 1KA0A 3U94A 4AS4A 1H76A 1JVYA 3OELA 5HBCA 3KSJA 1NV3A 4IY6A 4ZZEA 1FBHA 1TT1A 4GX4A 5IM2A 1MQHA 4H65A 2P2AA 2I49A 1SW2A 4NHBA 4OHNA 4N91A 2PFYA 4MIJA 3Q28A 1RYOA 1MH3A 4FEDA 3A3UA 2VT5A 1B5HA 2HFBA 2BJJX 3O2AA 1MQGA 4NX1A 4R72A 5ET7A 4BDRA 2R71A 5A5LA 1LBZA 1D4NA 4F2QA 4PDDA 2GRVA 3VLVA 1NKXA 1NL5A 1SQYA 1NV2A 4PETA 3WAEA 4EXKA 2ZYOA 1IZ1A 1CNQA 2ESNA 1HSEA 4ZZAA 1AIVA 4GFRA 3VLUA 2A5TB 3GXAA 4EF2A 4PFTA 2UYFA 2UYEA 5KCJA 3TTKA 1ZKBA 2F6PA 4Z7EA 1ATGA 1A54A 4JVCA 1M5EA 5DTBA 2QS2A 3FJGA 3C36A 2PFZA 3TPAA 4LN5A 1LBBA 2F7BA 4Q5TA 3K6VA 5LOMA 4LUBA 3N6TA 4I9DA 1WDNA 4NF6A 4FECA 3IB0A 5F7VA 4PGNA 1IMAA 2ZYNA 4JXIA 2WYPA 4G8NA 1D9VA 3O6GA 3EN3A 4ZE8A 5HM4B 3MP6A 5LTCA 3B50A 1LFGA 4MH5A 2XWOA 2R6GE 3CIJA 3ZSFA 4LZ7A 1JEVA 1GR2A 1Y3QA 4I3YA 4IO6A 1P1QA 2VPNA 1BP5A 4R74A 3SKPA 1SI0A 3QXMA 4ELOA 3B6TA 4PFYA 3AXFA 3MVXA 3KSXA 1LBWA 5I56B 1K9YA 1MQIA 1QKAA 4JVIA 2R9JA 4NWCA 4O3CA 2O69A 4F3PA 3PUVE 4IO7A 2XXKA 2CZIA 3RTWB 1LAHE 3S9MC 3D1RA 1I6BA 3W15C 3TTNA 3H3GA 5H8NA 4UACA 2QS1A 2XHDA 3O6IA 2QVVA 1H44A 3TYHA 4R6KA 4R75A 4RPOA 4NF8B 4X1BA 3RNNA 1MG1A 1POTA 4ZE9A 1EYIA 1QVSA 1LBVA 3GLBA 4N6PA 3KN7A 3TTLA 4OVQA 2FYIA 4ESWA 1B05A 2WBBA 3DLNA 1AWBA 3IK6B 4HXVA 4N8YA 4ELRA 4Z0IA 1D9YA 2DP8A 4KCCA 3T9HB 4E0WA 2Y84A 1XI6A 1LBYA 3FVGA 3BKIB 4OTEA 3BIHA 3LSLA 4KXPA 3KBZA 3MVZA 1MXZA 3MZBA 4GRKA 4KYEA 2PBWA 5I3SA 1BK4A 3H6VA 3K0VA 4OANA 3N5LA 4BLAA 4YKIA 1IMDA 4PFRA 4YKJA 4F3SA 1UIVA 4QBAA 1SW5A 1NNFA 4N15A 3EHUA 1H43A 3C9HA 2XXYA 2QJEA 4LATA 4U2RA 3ONMA 3MAMA 4Q0CA 4C0RA 4KFQA 1NV0A 3PD9A 3VXCA 1VSOA 5K2YA 1MS7A 3B8BA 4PTKA 3G3IA 3C4MA 5FTIA 2HXRA 3EKIA 2XD2A 1ZMGA 1R9LA 3PUYE 4YB7A 4PDHA 3PMVA 4QFPA 5CM6A 4C1UA 5L8DA 1URDA 3GBAA 4ZEIA 3T96B 3OO7A 1POY1 5AA2D 3B7DA 3PD8A 3KGCA 2Q9TA 4OEVA 1RDYA 4O7MA 3CFXA 1I6QA 3LC8A 4MNIA 4AB6A 4L17A 3SEUA 3KC1A 2ONRA 3MW0A 1ZBMA 4XKQA 4DI3D 4ZEFA 1UTBA 4MLVA 2DWIA 2Q89A 3S9NC 2ABHA 5I84A 2QRYA 4RPNA 2X26A 1FBEA 1DOTA 1MXVA 4P8BA 3DM0A 2FIEA 1DSNA 3T9XB 4XIGQ 4OEUA 4GBWA 3MZ9A 2V3QA 4PCDA 3N6UA 1VE4A 1A99A 1JQFA 4R9GA 2RCBA 2M8CA 1JW1A 1N3WA 4I40A 2V25A 3CVGA 3R7XA 1GVCA 1JEUA 1NNTA 4NN3A 1QGXA 1KZ8A 4GL8A 3N26A 2THIA 1A8EA 4RK2A 1WVJA 2FBPA 4GWOA 3L6GA 3FUZA 2FNCA 4PGPA 3RY3A 5EHSA 2O7UA 3H7MA 4YB6A 5FBPA 1HSJA 1MY2A 5L9SA 4P56A 3CG3A 2I4CA 4G68A 1A55A 2V4CA 2O1LA 1XHYA 1RDZA 2Y5LA 4KYSA 2XXUA 3H6TA 1XOCA 4HE2A 4XKRA 3PUZE 1S9TA 5I2KA 3FATA 2XXHA 5FHMA 3EHSA 1QW0A 4FBPA 3TAJA 4ZDMA 2CZHA 3M3LA 1G0HA 3K1NA 4TOZA 3U92A 3FXBA
chains in the Genus database with same CATH topology
4HE1A 2WBBA 1NV4A 5ET5A 4PFBA 1NV5A 1RDXA 2WYPA 1NV3A 3GYYA 3KC0A 3U65A 4AS5A 1FRPA 1AWBA 3FBPA 1FTAA 1DK4A 1NV6A 4HXVA 1FPKA 4MNPA 4N8YA 2PCRA 5LTCA 5ET6A 4NGUA 1JP4A 1FBEA 1FBHA 4P8BA 4F19A 4X8RA 5J1DA 5JK4A 4PAIA 4XFEA 3B50A 2DE3A 4PE3A 1DBZA 1XI6A 3RPLB 1NUZA 4X9TA 3PTYA 5ESYA 4YZZA 1LBYA 2FIEA 1KA1A 2XWOA 4G61A 4O94A 3QMFA 2ZZVA 3BIHA 4IR8A 4P3LA 2P3NA 4GX4A 5IM2A 4GWWA 2XWVA 4KXPA 3MSTA 4NHBA 3E79A 4OVSA 4GBWA 1NUWA 2WX9A 5EQ8A 3KBZA 4N91A 2DE2A 2PFYA 2V3QA 4MIJA 4PCDA 5T3JA 5J16A 2CZKA 2HZLA 2F5XA 4N4UA 5I3SA 1EYJA 4GWSA 5LDZA 1FPEA 1BK4A 2VT5A 5ET8A 3W9WA 4OANA 1YYZA 4P9KA 2GQ1A 4PF6A 2QVUA 2F3DA 3HFUA 4I3YA 4NF0A 2XWKA 5IZZA 3MYUA 4MJOA 1FPJA 1NUXA 4N81A 4I40A 4NX1A 3CHGA 1IMDA 1IMEA 4PC9A 2DVZA 2VPNA 4PFRA 1Q9DA 4YICA 5ET7A 4PFIA 4QBAA 2XWIA 4N8GA 5A5LA 1LBZA 3IFAA 2B4MA 4MNCA 4N15A 2HHMA 5EQ9A 1INPA 1LEVA 2FHYA 2Y5KA 4OVQA 2HZKA 4JVDA 4DI4B 4GWUA 4PF8A 4F1VA 1VDWA 3A29A 3LUZA 1FPLA 4HE0A 4I3EA 2WEFA 2MKZA 4NQ8A 4PDDA 5DW8A 4GWXA 4N6DA 4F1UA 2P3VA 4O8MA 4H46A 4NN3A 2B4LA 2VPOA 1FPBA 1QGXA 1KZ8A 4XF5A 4MMPA 4X04A 1LBWA 1K9YA 5IZ3B 2OWZA 3IFCA 2KQZA 2OX3A 2FBPA 4UABA 2KR0A 4JVIA 1NV2A 4PETA 1DCUA 2Q8MA 2L5VA 2DDKA 1NV0A 4MHFA 4PGPA 4MEVA 3ROJA 2XXKA 1CNQA 1FBCA 2CZIA 4NG7A 1IMCA 2ZZWA 4F18A 3T0JA 5F24A 2QPQA 2F3BA 3B8BA 4MAGA 3D1RA 1NV7A 2WYKA 4PTKA 4GWZA 5EQ7A 5EQAA 1FPIA 5FBPA 4PAFA 4XEQA 4P56A 2FVZA 2HXRA 3EKIA 1FPFA 4PBHA 2FIXA 4PAKA 5EYGA 2QVVA 4PDHA 2V4CA 1NV1A 5CM6A 5I5PA 1RDZA 2Y5LA 1LBXA 4PBQA 3W9VA 4JVCA 2JJKA 4MCOA 4N17A 4MX6A 4OVTA 4GBVA 2WBDA 4OVPA 1NUYA 1FBDA 5IZ1A 2Q74A 3RPLA 5IGAA 1IMFA 1FPDA 4H45A 2BJIA 4HE2A 4P1EA 5I7IA 4O7IA 1EYKA 2Q9TA 1FJ9A 3BIGA 3E78A 1RDYA 2PFZA 1G0IA 1IMBA 2QFLA 4O7MA 2DE4A 2CEXA 3LV0A 4LN5A 5EYHA 4OA4A 1FJ6A 3SZPA 2XA5A 4MNIA 3T1BA 1EYIA 2ZZXA 3ISPA 4GX6A 2HPGA 2QVRA 1FBPA 4P47A 4N6KA 4QXDA 3KC1A 4HCWA 1NI9A 1KA0A 4FBPA 4HCYA 1YXIA 2CEYA 4AS4A 2CZHA 1SPIA 1G0HA 1FBFA 1LBVA 4DI3D 1FBGA 2R8TA 1FPGA 1YZ0A 4M1VA 4NAPA 4P1LA 4PGNA 5IZ3A 3RYDA 1IMAA 3FXBA 1FSAA 1K9ZA 3NOHA 4GWYA 4OVRA 4GX3A 1D9QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFB A;  3GYY A;  2WYP A;  3U65 A;  4MNP A;  4N8Y A;  5LTC A;  4NGU A;  4P8B A;  4X8R A;  4PAI A;  4XFE A;  3B50 A;  4PE3 A;  4YZZ A;  4P3L A;  2XWO A;  4O94 A;  4XF5 A;  2ZZV A;  5IM2 A;  2XWV A;  4NHB A;  4OVS A;  2WX9 A;  4N91 A;  2PFY A;  4MIJ A;  4PCD A;  2HZL A;  4N4U A;  4OAN A;  4P9K A;  4PF6 A;  4NF0 A;  2XWK A;  5IZZ A;  4NX1 A;  4PC9 A;  4PFR A;  2VPN A;  4YIC A;  4PFI A;  2XWI A;  4N8G A;  4N15 A;  4MNC A;  4DI4 B;  2HZK A;  4PF8 A;  4NQ8 A;  4PDD A;  4N6D A;  4O8M A;  4NN3 A;  2VPO A;  4MMP A;  4X04 A;  4UAB A;  4PET A;  4MHF A;  4PGP A;  4MEV A;  2XXK A;  4NG7 A;  2ZZW A;  4MAG A;  2WYK A;  4PAF A;  4XEQ A;  4P56 A;  4PBH A;  4PAK A;  4PDH A;  2V4C A;  5CM6 A;  5I5P A;  4PBQ A;  4N17 A;  4MCO A;  4MX6 A;  4OVT A;  4OVP A;  5IGA A;  4P1E A;  5I7I A;  2PFZ A;  4O7M A;  4LN5 A;  2CEX A;  4OA4 A;  2XA5 A;  4MNI A;  2ZZX A;  2HPG A;  4P47 A;  4N6K A;  2CEY A;  4DI3 D;  4P1L A;  4NAP A;  4PGN A;  3FXB A;  4OVR A;  4OVQ A; 
#chains in the Genus database with same CATH topology
 3U65 A;  3QIM A;  5ISU A;  4U22 A;  4ECF A;  5J1D A;  4EQ9 A;  4O3B A;  3H6W A;  1LFH A;  1OLC A;  2DWA A;  3TCH A;  5M2V A;  3MP8 A;  2XXR A;  2CZK A;  1FQE A;  2GQ1 A;  2XWK A;  3OEM A;  2RC8 A;  3K1P A;  3B6Q A;  3IOV A;  4YIC A;  1OVB A;  4X1D A;  5I2K B;  1LFI A;  2HAU A;  2B4L A;  3MPK A;  4QFN A;  5TPA A;  3R26 A;  1SYH A;  4F31 B;  1IQ7 A;  2ZZW A;  5I58 A;  5F24 A;  2QPQ A;  1FPI A;  4JBZ A;  1FPF A;  2A5S A;  5EYG A;  2VD2 A;  2CMO A;  5I5P A;  1FQD A;  4PE5 B;  2JJK A;  5IZ1 A;  1NNK A;  1QJM A;  1DPP A;  4HS7 A;  1G0I A;  2QFL A;  4NF5 A;  2CEX A;  3ODB A;  4U1Z A;  4QSD A;  3CG1 A;  3F11 A;  2XD3 A;  3ILU B;  2ZYK A;  3G7W A;  1YZ0 A;  5CMM A;  4OQO A;  4U23 A;  2Q2A A;  4GX3 A;  3PV0 E;  1MPB A;  1OQG A;  3FZV A;  1SVX B;  4MNP A;  1DTG A;  4GOT A;  1JP4 A;  4ZEC A;  5ELV A;  4DXC A;  4GWW A;  3MST A;  1IXG A;  1LGB C;  4YB5 A;  3TOD A;  3FVK A;  2ALU A;  5LDZ A;  1Y4T A;  4R9F A;  3JZJ A;  4U1O A;  2P0S A;  3E9X A;  4GWX A;  4H6D A;  2QS4 A;  2OX3 A;  2KR0 A;  3MJN A;  3VDF A;  2UVG A;  4DCX A;  5DVF A;  2Z8F A;  4GIZ A;  1YTV A;  3PPN A;  3ILT B;  3HHF A;  4FE8 A;  5EQ7 A;  2DOJ A;  1B32 A;  3C35 A;  3IOT A;  1MQD A;  2QL3 A;  2I0C A;  5CMC A;  4DXB A;  5I57 B;  1PEB A;  1NV1 A;  1UTH A;  3I3V A;  2UVI A;  4N13 A;  3O97 A;  3HO7 A;  2WBD A;  4JSO A;  2DS9 A;  4H45 A;  3IOU A;  4RNS A;  3QUJ A;  1NH7 A;  4G68 C;  5JEI A;  4F39 A;  4HCW A;  1DTZ A;  2NWJ A;  3PUX E;  1MPC A;  2ONS A;  4IY5 A;  3VXB A;  5IZ3 A;  1FSA A;  4OVR A;  1K9Z A;  3K02 A;  1D9Q A;  3VFJ A;  5CRY A;  4XFE A;  4PE3 A;  1DBZ A;  3BFT A;  1NUZ A;  1M5D A;  2ONK E;  1N7W A;  2QMX A;  3QMF A;  4IR8 A;  2LAO A;  2XWV A;  3E79 A;  1JNF A;  1NUW A;  2DXY A;  4G77 A;  5AA4 A;  5IAI A;  1YPN A;  4DCY A;  2XXX A;  1Z7N E;  1NUX A;  3OD7 A;  4X48 A;  3JYR A;  4NF5 B;  3K6W A;  2HZK A;  3LUZ A;  2Y7R A;  2RC7 A;  4EQ7 A;  4MMP A;  2D5W A;  3TEP A;  4QHQ A;  3P7I A;  5H8N B;  3TQL A;  5H8Q B;  2DQV A;  2Q8J A;  3MVY A;  2RKM A;  4FAJ A;  1DMB A;  2F7C A;  5CMB A;  4OFL A;  1F9B A;  4PBH A;  3FXU A;  4PAK A;  4LP2 B;  4EUO A;  3O66 A;  4K3F A;  1TFD A;  2OJT A;  2REG A;  3W9V A;  4GXA A;  4N17 A;  4RXL A;  4XKP A;  4NTL A;  5AE4 A;  4OVP A;  4EDP A;  1VFD A;  1BTJ A;  1JW4 A;  1SDX A;  3QYT A;  3RPL A;  1FQF A;  3U1O A;  5DVJ A;  4NF4 A;  1IIW A;  1N76 A;  3ISP A;  1JVX A;  5EYF A;  1SPI A;  4JSD A;  2RC9 A;  3U8Q A;  4R2F A;  5F1Q A;  1NV4 A;  4AS5 A;  3GYY A;  1B51 A;  3OO8 A;  4GL0 A;  4JWX A;  4GF8 A;  2V84 A;  4PFU A;  1FTK A;  4NGU A;  4WED A;  2DE3 A;  1FTJ A;  5DT6 A;  4P3L A;  4O94 A;  4PFW A;  3R6U A;  2IEE A;  3SEW A;  4ZEB A;  2Z22 A;  2F5X A;  5DEX A;  1YYZ A;  3FD3 A;  4P9K A;  3UK4 A;  4NF6 B;  4H0W A;  1FPJ A;  3VV5 A;  2E1S A;  3RLF E;  3KEI A;  5EQ9 A;  3TTM A;  4DE8 A;  3QSL A;  4I8C A;  4PF8 A;  4F1V A;  4YAH X;  1VFE A;  1FPL A;  4FIM A;  3V5A A;  2MKZ A;  1USY E;  1DPE A;  3GBB A;  3DEL B;  1ANF A;  1BLF A;  3FV2 A;  1O7T A;  4LON B;  4N07 A;  2FA7 A;  4F22 A;  2G93 A;  2Z23 A;  3H6U A;  2KQZ A;  4UAB A;  5I57 A;  1R6Z A;  2GHB A;  2O6A A;  4MEV A;  3Q25 A;  3LUY A;  3PPP A;  3UOR A;  4KYD A;  1NV7 A;  4RA1 A;  1ZTY A;  3TCF A;  3HV1 A;  2O51 A;  1B3G A;  5FHO A;  1JET A;  3HST A;  4XXU A;  1URS A;  1USY H;  3A3C A;  3FJ7 A;  4OMB A;  5I2N A;  5IKB A;  3IX1 A;  1NNP A;  3M3F A;  1NUY A;  1Y3N A;  5ICQ A;  1PBQ A;  3PMX A;  3PU5 A;  2HCA A;  2XA5 A;  3T1B A;  1N7X A;  3G3J A;  4OES A;  1MRP A;  4YU0 A;  5FHN A;  1US4 A;  4ND9 A;  1Z7M E;  4P1L A;  4PFB A;  3BFU A;  3K4U A;  1I6A A;  4KCD A;  2PCR A;  2GHA A;  4NE4 A;  1OLA A;  2ANJ A;  5JK4 A;  4P0G A;  1TXF A;  2QS3 A;  4X9T A;  1FQA A;  3PTY A;  1IXC A;  4FJP A;  4BDQ A;  4HTG A;  4R6Y A;  4POW A;  1II5 A;  3V89 B;  4OXV A;  3DP6 A;  2Q88 A;  3HN0 A;  4NF0 A;  5B7D A;  2W7Y A;  4LQ5 A;  2E0S A;  4N8G A;  5EHM A;  2HHM A;  2AL5 A;  1LEV A;  1B1X A;  1B1H A;  4ISU A;  4G2Z A;  4I1D A;  2RF1 A;  3KJ7 A;  2P3V A;  1Y20 A;  4EQB A;  4PP0 A;  5CMK A;  1R9Q A;  2B3B A;  3MQ9 A;  4LVQ A;  3A09 A;  1DCU A;  3K00 A;  3OEK A;  3O9P A;  1MXY A;  2XXQ A;  1YCJ A;  5FTH A;  3ROJ A;  2OWS A;  4ZEK A;  3O28 A;  5I58 B;  3FAS A;  1M5B A;  2F3B A;  2OBG A;  4XEQ A;  1B6H A;  2VD3 A;  3K1M A;  2FIX A;  1NH8 A;  2OZZ A;  4WXJ A;  3PGF A;  1MXX A;  1B40 A;  2KLF A;  1PC3 A;  5KDT B;  3D4G A;  5IGA A;  3TEL A;  3TQW A;  3E78 A;  3MP1 A;  1P1U A;  5EYH A;  3MBP A;  1B9J A;  4OA4 A;  5AA3 A;  1YAE A;  3S9E A;  3ZS6 A;  4N6K A;  4U4X A;  1YXI A;  3PPQ A;  5ICT A;  4FEB A;  2XX9 A;  1B2H A;  4HE1 A;  5DVI A;  1OIB A;  3T9V A;  2DSF A;  3FBP A;  1FTA A;  5CI5 A;  1LBC A;  1UIU A;  3TUS A;  5ET6 A;  4XKN A;  4NMY A;  4MBP A;  2VP1 A;  4RK9 A;  3SET A;  1KA1 A;  3LSF B;  5HPQ A;  5TP9 A;  2Q2C A;  2WX9 A;  1B7Z A;  1LLS A;  4RY1 A;  2F3D A;  2O68 A;  4G8H A;  3O29 A;  3MC2 A;  2AIX A;  1IIT A;  2VPO A;  3BBR A;  2X7Q A;  3Q29 A;  3MZ1 A;  3T22 A;  2H98 A;  1EH3 A;  5KCJ B;  3K6U A;  3O6H A;  1MH4 A;  2F6G A;  2I6E A;  2YJP A;  4JDF A;  4POX A;  2GFE A;  1B4H A;  1IMC A;  1B7H A;  2A5T A;  2Y7W A;  1LAG E;  3CI8 A;  1SW4 A;  4IGR A;  2RCA A;  1I69 A;  1XS5 A;  5DEX B;  3SER A;  1MM6 A;  2Z8D A;  2PT2 A;  3RUM A;  4F1Y A;  1XT8 A;  4MCO A;  4YMA A;  1PB7 A;  4GBV A;  1FBD A;  2HEU A;  4OVJ A;  2AL4 A;  4FAT A;  2I48 A;  3UN6 A;  1P99 A;  1IMB A;  5I59 A;  2DWH A;  2QSX A;  4GXS B;  4DDD A;  3HHG A;  2QVR A;  4P47 A;  4QXD A;  3VVD A;  4G4P A;  1FPG A;  3VE1 B;  1Y4C A;  4R6H A;  4Q8R A;  3IB1 A;  4YKP A;  1NV5 A;  3FJM A;  4H67 A;  1FRP A;  3G3F A;  1DK4 A;  1NV6 A;  3OO6 A;  3HPI A;  5I59 B;  2I4B A;  2H25 A;  3IOR A;  4YZZ A;  5L9O A;  1P1O A;  5EQ8 A;  3TFL A;  5J16 A;  3PMW A;  3KG2 A;  2F97 A;  4N4U A;  3EHT A;  4GWS A;  4OET A;  4QFO A;  4PF6 A;  2QVU A;  3MYU A;  4MJO A;  4PC9 A;  1N3X A;  1N04 A;  2FHY A;  4O3A A;  4F29 A;  4NQ8 A;  2Y7K A;  4N6D A;  4JB7 A;  1B5J A;  3E13 X;  4QFK A;  4X04 A;  3S9L C;  3H4Z A;  3IO4 A;  3QK6 A;  3TZA A;  1AOV A;  4MHF A;  3ZKK A;  3FIR A;  3T0J A;  1FCK A;  3Q26 A;  3MPL A;  2WYK A;  4ONY A;  4GWZ A;  3IR1 A;  5JTY A;  4QSC A;  3MWB A;  2H9B A;  3UA8 A;  2FVZ A;  3G3K A;  1ELJ A;  1SYI A;  2H5Y A;  3SEV A;  4QF9 A;  1LBX A;  4MX6 A;  1B3H A;  5TP9 B;  4LQ2 A;  3OOA A;  2NOO A;  2VGQ A;  3G3H A;  1H45 A;  3K2D A;  2XXI A;  3L6H A;  5I7I A;  2REJ A;  3RN8 A;  1TWY A;  2DE4 A;  2F35 A;  3LV0 A;  4TLM B;  4NED A;  1AL3 A;  1O63 A;  4KQP A;  3VVE A;  3JV9 A;  5H8H B;  3SEY A;  4RYA A;  4P11 A;  2R8T A;  4ELP A;  2I3V A;  1H3D A;  3EPE A;  5BUU A;  1RKM A;  3SEX A;  1P1N A;  5ET8 A;  3KN8 A;  4LZ8 A;  4BDO A;  1RDX A;  1BKA A;  3UP9 A;  3FXQ A;  2HAV A;  1T0K A;  1A7L A;  1EZ9 A;  4HW8 A;  4KHZ E;  4PAI A;  3CSB A;  3FVN A;  5A5X B;  2P3N A;  1S7Y A;  5CC2 A;  2DE2 A;  2DXR A;  2XX8 A;  1LB8 A;  2VOZ A;  3HFU A;  1P1W A;  5IZZ A;  2X7P A;  2YPN A;  4IO2 A;  3FVO A;  2XWI A;  3IFA A;  4XTC Q;  3OMB A;  2Y5K A;  4GWU A;  1UQW A;  2I3W A;  4FOR A;  4H8J A;  3ZKL A;  5IZ3 B;  3KZG A;  2YLN A;  1MXU A;  2D21 A;  1CB6 A;  3T66 A;  1Y1Z A;  1B0H A;  3CFL A;  3C33 A;  4DZ1 A;  3FGS A;  4ZED A;  4QSE A;  3KN3 A;  3E4R A;  3T93 B;  4OER A;  3C34 A;  2WKY A;  3IB2 A;  3OSR A;  1LCF A;  1MXW A;  2GH9 A;  3U72 A;  1B58 A;  5I56 A;  3QUF A;  4PBQ A;  1B0L A;  3MUQ A;  3VLW A;  4MFI A;  2O84 X;  3USD A;  2F78 A;  2BJI A;  4H5G A;  3M8U A;  4RJZ A;  1FJ9 A;  1MQJ A;  4JWY A;  5AA2 A;  2F7A A;  3C32 A;  5B70 A;  2OCU A;  1FTM A;  4GX6 A;  2HPG A;  1FBP A;  2ZNS A;  3V83 A;  3TDJ A;  3I5O A;  1FBF A;  3DP4 A;  2OLB A;  3NOH A;  4ZS9 A;  4GD5 A;  4AB5 A;  3KC0 A;  1FPK A;  4LZ5 A;  4OFJ A;  1SD3 A;  4BDM A;  2XXP A;  3IOW A;  1S50 A;  1LAX A;  3Q27 A;  1PDA A;  3SDF A;  4GQO A;  4H8I A;  1QUK A;  1SI1 A;  2P1S A;  4AQ4 A;  4BDL A;  5I2N B;  2B65 A;  2NXO A;  2H4I A;  2UVH A;  2UVJ A;  2F36 A;  3H03 A;  2I0B A;  4MNC A;  1INP A;  3FXR A;  4JVD A;  1MDP 1;  3CSG A;  3T9U A;  3KFM A;  3V8X B;  4IO3 A;  1B46 A;  3G3G A;  4OEN A;  4IB2 A;  1FBC A;  4F2O A;  1ZJL A;  4F18 A;  1NFT A;  2Y7I A;  1D3K A;  4ELQ A;  5H8F B;  2PMS A;  3RT8 A;  1HSL A;  3RGY A;  3UIF A;  3IJO B;  4WKM A;  5H8S A;  1LB9 A;  1QUL A;  1ZU0 A;  4H1X A;  3PPR A;  3VVF A;  2Q74 A;  1LST A;  1FPD A;  4P1E A;  3C31 A;  2O1M A;  1EYK A;  1MY3 A;  1Q35 A;  3E3K A;  3GZG A;  1O64 A;  5BWJ A;  1EU8 A;  4NAP A;  2XXV A;  4G8M A;  1FTL A;  3S2V A;  1VR5 A;  5AA1 A;  3K01 A;  4LA9 A;  4NF4 B;  3S4U A;  3RPL B;  1FQB A;  1URG A;  5ESY A;  4XF5 A;  2Z8E A;  3IL1 B;  2PX1 A;  1US5 A;  3LSW A;  2PYY A;  5H8H A;  3CHG A;  4EF1 A;  3EF7 A;  3TMG A;  4TQU Q;  4OYV A;  5ITO A;  4IGT A;  3RT6 B;  2WEF A;  2XXW A;  1XVX A;  3M3K A;  1MDQ A;  4KPT A;  3LBS A;  3KJT A;  1GV8 A;  3D4C A;  1SBP A;  5ITP A;  2DDK A;  4GLI A;  1OMP A;  2ZMB A;  1B7U A;  4DXU A;  1AMF A;  1AH5 A;  4KR5 A;  3U93 A;  3UGW A;  1Y9U A;  1IXI A;  3EQ1 A;  2VHA A;  4TLL B;  3CFZ A;  3HCQ A;  1B3E A;  3PUW E;  4OVT A;  1PB9 A;  4WEP A;  1Y1M A;  4G68 B;  4IO4 A;  3TCG A;  1R1N A;  1IXH A;  2V93 A;  4GVO A;  4O7I A;  1B4Z A;  2RIN A;  5H8Q A;  2UXA A;  1OVT A;  4OZ9 A;  4HCY A;  2Y7P A;  2PT1 A;  3B6W A;  4OWD A;  3RYD A;  1SW1 A;  1UTB B;  1MPD A;  4GWY A;  3ECR A;  4OFO A;  1KWH A;  2V3U A;  2F8D A;  4MF3 A;  4F19 A;  3CRB A;  3SES A;  1A8F A;  2ZZV A;  1MM7 A;  1L5T A;  2H99 A;  3PPO A;  4OVS A;  1ZIU A;  5AA4 B;  2HXW A;  5T3J A;  1JW5 A;  1GGG A;  4C1T A;  1A40 A;  1UTH B;  1MY4 A;  1B52 A;  4DLD A;  4N81 A;  1WOD A;  3LSX A;  1IME A;  5KZT A;  3IJX B;  5DYH A;  4PFI A;  4THI A;  5AA2 B;  2IA4 A;  4PQJ A;  1M5C A;  4DI4 B;  3K6X A;  4U21 A;  1VDW A;  3A29 A;  4I3E A;  3RPW A;  1ZLQ A;  2OWT A;  5DW8 A;  3FV1 A;  3TKD A;  3N94 A;  4YKK A;  1FW0 A;  1FPB A;  3TTR A;  2OWZ A;  3I6V A;  2B3F A;  3WAF A;  2QMW A;  5K2X A;  2Q8M A;  1QUJ A;  4DIG A;  1MY0 A;  2PVU A;  2NVU B;  2I58 A;  5H8F A;  2V3T A;  5EQA A;  1TFA A;  2HQ0 A;  1LCT A;  1CE2 A;  3RQT A;  2O7I A;  2ZYM A;  4BDN A;  4QFL A;  3H06 B;  1IMF A;  4IO5 A;  1XC1 A;  5L9M A;  5CBR A;  3IO6 A;  3SZP A;  4F3G A;  2ZZX A;  2CEY A;  1FBG A;  4M1V A;  1XVY A;  1PB8 A;  2XX7 A;  2ZNT A;  5ET5 A;  2G29 A;  5A5X A;  2DWJ A;  1N0T A;  1B5I A;  4X8R A;  4P0I A;  1J1N A;  3OEN A;  4G61 A;  4H5F A;  3KOS A;  4KI0 E;  4QRZ A;  2CZL A;  4NF8 A;  4Q30 B;  4R2B A;  4ESX A;  4NWD A;  3OXN A;  4U4S A;  2HZL A;  1RYX A;  1EYJ A;  1FPE A;  1LAF E;  3W9W A;  1NMU A;  1EZO A;  1FTO A;  3MVW A;  1M5F A;  3DP8 A;  2DVZ A;  1Q9D A;  3KBR A;  4MLQ A;  1PBP A;  2B4M A;  3IAZ A;  4HE0 A;  2D3I A;  1MY1 A;  4EXL A;  3RTF B;  4F1U A;  4E0X A;  4O8M A;  4H46 A;  5KDT A;  1IEJ A;  4M4G A;  4KD5 A;  5CBS A;  3IFC A;  3KOT A;  2OK2 A;  5TPA B;  1QKB A;  2L5V A;  4YMB A;  2NUV A;  1BIY A;  5JTY B;  4NG7 A;  1N84 A;  1B3L A;  4JWO A;  4MAG A;  1FQC A;  4PAF A;  2DYX A;  2XXT A;  1IUD A;  4F3B A;  1Y3P A;  2ZNU A;  4UA8 A;  1QUI A;  3LR1 A;  1B3F A;  3OSQ A;  4R73 A;  3OO9 A;  1EZP A;  2F34 A;  5TU0 A;  1OQH A;  3QAX A;  3BIG A;  2ZXT A;  1FJ6 A;  3THI A;  4I62 A;  1GTK A;  3CR9 A;  2DVC A;  1Q1K A;  1NI9 A;  2AYS A;  1KA0 A;  3U94 A;  4AS4 A;  1H76 A;  1JVY A;  3OEL A;  5HBC A;  3KSJ A;  1NV3 A;  4IY6 A;  4ZZE A;  1FBH A;  1TT1 A;  4GX4 A;  5IM2 A;  1MQH A;  4H65 A;  2P2A A;  2I49 A;  1SW2 A;  4NHB A;  4OHN A;  4N91 A;  2PFY A;  4MIJ A;  3Q28 A;  1RYO A;  1MH3 A;  4FED A;  3A3U A;  2VT5 A;  1B5H A;  2HFB A;  2BJJ X;  3O2A A;  1MQG A;  4NX1 A;  4R72 A;  5ET7 A;  4BDR A;  2R71 A;  5A5L A;  1LBZ A;  1D4N A;  4F2Q A;  4PDD A;  2GRV A;  3VLV A;  1NKX A;  1NL5 A;  1SQY A;  1NV2 A;  4PET A;  3WAE A;  4EXK A;  2ZYO A;  1IZ1 A;  1CNQ A;  2ESN A;  1HSE A;  4ZZA A;  1AIV A;  4GFR A;  3VLU A;  2A5T B;  3GXA A;  4EF2 A;  4PFT A;  2UYF A;  2UYE A;  5KCJ A;  3TTK A;  1ZKB A;  2F6P A;  4Z7E A;  1ATG A;  1A54 A;  4JVC A;  1M5E A;  5DTB A;  2QS2 A;  3FJG A;  3C36 A;  2PFZ A;  3TPA A;  4LN5 A;  1LBB A;  2F7B A;  4Q5T A;  3K6V A;  5LOM A;  4LUB A;  3N6T A;  4I9D A;  1WDN A;  4NF6 A;  4FEC A;  3IB0 A;  5F7V A;  4PGN A;  1IMA A;  2ZYN A;  4JXI A;  2WYP A;  4G8N A;  1D9V A;  3O6G A;  3EN3 A;  4ZE8 A;  5HM4 B;  3MP6 A;  5LTC A;  3B50 A;  1LFG A;  4MH5 A;  2XWO A;  2R6G E;  3CIJ A;  3ZSF A;  4LZ7 A;  1JEV A;  1GR2 A;  1Y3Q A;  4I3Y A;  4IO6 A;  1P1Q A;  2VPN A;  1BP5 A;  4R74 A;  3SKP A;  1SI0 A;  3QXM A;  4ELO A;  3B6T A;  4PFY A;  3AXF A;  3MVX A;  3KSX A;  1LBW A;  5I56 B;  1K9Y A;  1MQI A;  1QKA A;  4JVI A;  2R9J A;  4NWC A;  4O3C A;  2O69 A;  4F3P A;  3PUV E;  4IO7 A;  2XXK A;  2CZI A;  3RTW B;  1LAH E;  3S9M C;  3D1R A;  1I6B A;  3W15 C;  3TTN A;  3H3G A;  5H8N A;  4UAC A;  2QS1 A;  2XHD A;  3O6I A;  2QVV A;  1H44 A;  3TYH A;  4R6K A;  4R75 A;  4RPO A;  4NF8 B;  4X1B A;  3RNN A;  1MG1 A;  1POT A;  4ZE9 A;  1EYI A;  1QVS A;  1LBV A;  3GLB A;  4N6P A;  3KN7 A;  3TTL A;  4OVQ A;  2FYI A;  4ESW A;  1B05 A;  2WBB A;  3DLN A;  1AWB A;  3IK6 B;  4HXV A;  4N8Y A;  4ELR A;  4Z0I A;  1D9Y A;  2DP8 A;  4KCC A;  3T9H B;  4E0W A;  2Y84 A;  1XI6 A;  1LBY A;  3FVG A;  3BKI B;  4OTE A;  3BIH A;  3LSL A;  4KXP A;  3KBZ A;  3MVZ A;  1MXZ A;  3MZB A;  4GRK A;  4KYE A;  2PBW A;  5I3S A;  1BK4 A;  3H6V A;  3K0V A;  4OAN A;  3N5L A;  4BLA A;  4YKI A;  1IMD A;  4PFR A;  4YKJ A;  4F3S A;  1UIV A;  4QBA A;  1SW5 A;  1NNF A;  4N15 A;  3EHU A;  1H43 A;  3C9H A;  2XXY A;  2QJE A;  4LAT A;  4U2R A;  3ONM A;  3MAM A;  4Q0C A;  4C0R A;  4KFQ A;  1NV0 A;  3PD9 A;  3VXC A;  1VSO A;  5K2Y A;  1MS7 A;  3B8B A;  4PTK A;  3G3I A;  3C4M A;  5FTI A;  2HXR A;  3EKI A;  2XD2 A;  1ZMG A;  1R9L A;  3PUY E;  4YB7 A;  4PDH A;  3PMV A;  4QFP A;  5CM6 A;  4C1U A;  5L8D A;  1URD A;  3GBA A;  4ZEI A;  3T96 B;  3OO7 A;  1POY 1;  5AA2 D;  3B7D A;  3PD8 A;  3KGC A;  2Q9T A;  4OEV A;  1RDY A;  4O7M A;  3CFX A;  1I6Q A;  3LC8 A;  4MNI A;  4AB6 A;  4L17 A;  3SEU A;  3KC1 A;  2ONR A;  3MW0 A;  1ZBM A;  4XKQ A;  4DI3 D;  4ZEF A;  1UTB A;  4MLV A;  2DWI A;  2Q89 A;  3S9N C;  2ABH A;  5I84 A;  2QRY A;  4RPN A;  2X26 A;  1FBE A;  1DOT A;  1MXV A;  4P8B A;  3DM0 A;  2FIE A;  1DSN A;  3T9X B;  4XIG Q;  4OEU A;  4GBW A;  3MZ9 A;  2V3Q A;  4PCD A;  3N6U A;  1VE4 A;  1A99 A;  1JQF A;  4R9G A;  2RCB A;  2M8C A;  1JW1 A;  1N3W A;  4I40 A;  2V25 A;  3CVG A;  3R7X A;  1GVC A;  1JEU A;  1NNT A;  4NN3 A;  1QGX A;  1KZ8 A;  4GL8 A;  3N26 A;  2THI A;  1A8E A;  4RK2 A;  1WVJ A;  2FBP A;  4GWO A;  3L6G A;  3FUZ A;  2FNC A;  4PGP A;  3RY3 A;  5EHS A;  2O7U A;  3H7M A;  4YB6 A;  5FBP A;  1HSJ A;  1MY2 A;  5L9S A;  4P56 A;  3CG3 A;  2I4C A;  4G68 A;  1A55 A;  2V4C A;  2O1L A;  1XHY A;  1RDZ A;  2Y5L A;  4KYS A;  2XXU A;  3H6T A;  1XOC A;  4HE2 A;  4XKR A;  3PUZ E;  1S9T A;  5I2K A;  3FAT A;  2XXH A;  5FHM A;  3EHS A;  1QW0 A;  4FBP A;  3TAJ A;  4ZDM A;  2CZH A;  3M3L A;  1G0H A;  3K1N A;  4TOZ A;  3U92 A;  3FXB A; 
#chains in the Genus database with same CATH homology
 4HE1 A;  2WBB A;  1NV4 A;  5ET5 A;  4PFB A;  1NV5 A;  1RDX A;  2WYP A;  1NV3 A;  3GYY A;  3KC0 A;  3U65 A;  4AS5 A;  1FRP A;  1AWB A;  3FBP A;  1FTA A;  1DK4 A;  1NV6 A;  4HXV A;  1FPK A;  4MNP A;  4N8Y A;  2PCR A;  5LTC A;  5ET6 A;  4NGU A;  1JP4 A;  1FBE A;  1FBH A;  4P8B A;  4F19 A;  4X8R A;  5J1D A;  5JK4 A;  4PAI A;  4XFE A;  3B50 A;  2DE3 A;  4PE3 A;  1DBZ A;  1XI6 A;  3RPL B;  1NUZ A;  4X9T A;  3PTY A;  5ESY A;  4YZZ A;  1LBY A;  2FIE A;  1KA1 A;  2XWO A;  4G61 A;  4O94 A;  3QMF A;  2ZZV A;  3BIH A;  4IR8 A;  4P3L A;  2P3N A;  4GX4 A;  5IM2 A;  4GWW A;  2XWV A;  4KXP A;  3MST A;  4NHB A;  3E79 A;  4OVS A;  4GBW A;  1NUW A;  2WX9 A;  5EQ8 A;  3KBZ A;  4N91 A;  2DE2 A;  2PFY A;  2V3Q A;  4MIJ A;  4PCD A;  5T3J A;  5J16 A;  2CZK A;  2HZL A;  2F5X A;  4N4U A;  5I3S A;  1EYJ A;  4GWS A;  5LDZ A;  1FPE A;  1BK4 A;  2VT5 A;  5ET8 A;  3W9W A;  4OAN A;  1YYZ A;  4P9K A;  2GQ1 A;  4PF6 A;  2QVU A;  2F3D A;  3HFU A;  4I3Y A;  4NF0 A;  2XWK A;  5IZZ A;  3MYU A;  4MJO A;  1FPJ A;  1NUX A;  4N81 A;  4I40 A;  4NX1 A;  3CHG A;  1IMD A;  1IME A;  4PC9 A;  2DVZ A;  2VPN A;  4PFR A;  1Q9D A;  4YIC A;  5ET7 A;  4PFI A;  4QBA A;  2XWI A;  4N8G A;  5A5L A;  1LBZ A;  3IFA A;  2B4M A;  4MNC A;  4N15 A;  2HHM A;  5EQ9 A;  1INP A;  1LEV A;  2FHY A;  2Y5K A;  4OVQ A;  2HZK A;  4JVD A;  4DI4 B;  4GWU A;  4PF8 A;  4F1V A;  1VDW A;  3A29 A;  3LUZ A;  1FPL A;  4HE0 A;  4I3E A;  2WEF A;  2MKZ A;  4NQ8 A;  4PDD A;  5DW8 A;  4GWX A;  4N6D A;  4F1U A;  2P3V A;  4O8M A;  4H46 A;  4NN3 A;  2B4L A;  2VPO A;  1FPB A;  1QGX A;  1KZ8 A;  4XF5 A;  4MMP A;  4X04 A;  1LBW A;  1K9Y A;  5IZ3 B;  2OWZ A;  3IFC A;  2KQZ A;  2OX3 A;  2FBP A;  4UAB A;  2KR0 A;  4JVI A;  1NV2 A;  4PET A;  1DCU A;  2Q8M A;  2L5V A;  2DDK A;  1NV0 A;  4MHF A;  4PGP A;  4MEV A;  3ROJ A;  2XXK A;  1CNQ A;  1FBC A;  2CZI A;  4NG7 A;  1IMC A;  2ZZW A;  4F18 A;  3T0J A;  5F24 A;  2QPQ A;  2F3B A;  3B8B A;  4MAG A;  3D1R A;  1NV7 A;  2WYK A;  4PTK A;  4GWZ A;  5EQ7 A;  5EQA A;  1FPI A;  5FBP A;  4PAF A;  4XEQ A;  4P56 A;  2FVZ A;  2HXR A;  3EKI A;  1FPF A;  4PBH A;  2FIX A;  4PAK A;  5EYG A;  2QVV A;  4PDH A;  2V4C A;  1NV1 A;  5CM6 A;  5I5P A;  1RDZ A;  2Y5L A;  1LBX A;  4PBQ A;  3W9V A;  4JVC A;  2JJK A;  4MCO A;  4N17 A;  4MX6 A;  4OVT A;  4GBV A;  2WBD A;  4OVP A;  1NUY A;  1FBD A;  5IZ1 A;  2Q74 A;  3RPL A;  5IGA A;  1IMF A;  1FPD A;  4H45 A;  2BJI A;  4HE2 A;  4P1E A;  5I7I A;  4O7I A;  1EYK A;  2Q9T A;  1FJ9 A;  3BIG A;  3E78 A;  1RDY A;  2PFZ A;  1G0I A;  1IMB A;  2QFL A;  4O7M A;  2DE4 A;  2CEX A;  3LV0 A;  4LN5 A;  5EYH A;  4OA4 A;  1FJ6 A;  3SZP A;  2XA5 A;  4MNI A;  3T1B A;  1EYI A;  2ZZX A;  3ISP A;  4GX6 A;  2HPG A;  2QVR A;  1FBP A;  4P47 A;  4N6K A;  4QXD A;  3KC1 A;  4HCW A;  1NI9 A;  1KA0 A;  4FBP A;  4HCY A;  1YXI A;  2CEY A;  4AS4 A;  2CZH A;  1SPI A;  1G0H A;  1FBF A;  1LBV A;  4DI3 D;  1FBG A;  2R8T A;  1FPG A;  1YZ0 A;  4M1V A;  4NAP A;  4P1L A;  4PGN A;  5IZ3 A;  3RYD A;  1IMA A;  3FXB A;  1FSA A;  1K9Z A;  3NOH A;  4GWY A;  4OVR A;  4GX3 A;  1D9Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...