2WYKA

Siap in complex with neu5gc
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNAGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Siap in Complex with Neu5Gc
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 122
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2009-11-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wykA00
2HPGA 4X04A 4OVRA 4NAPA 3B50A 4N17A 2XWKA 4PFRA 4NF0A 4XF5A 4MNPA 2WX9A 4NN3A 4PBQA 4DI4B 4MCOA 4N8YA 2PFYA 2VPNA 4P3LA 4PCDA 4UABA 4PFBA 4NQ8A 4MMPA 5IM2A 4OVQA 4N6KA 4MEVA 4MAGA 4NG7A 4P47A 4MIJA 2PFZA 4PETA 2ZZWA 4PDDA 4P1EA 2CEXA 4PAKA 3FXBA 4N8GA 4OANA 4OVSA 4XFEA 4LN5A 4P1LA 5I5PA 5LTCA 4NHBA 4PAFA 3GYYA 5IGAA 4PGPA 5CM6A 2ZZVA 4P8BA 4MHFA 4P9KA 5IZZA 4N4UA 2ZZXA 4O94A 5I7IA 4NGUA 4DI3D 2VPOA 4PF6A 4O8MA 4OVPA 2V4CA 2XWOA 2XWVA 4N91A 4N15A 4OVTA 4PFIA 4YZZA 4PBHA 4YICA 4O7MA 4P56A 4X8RA 2CEYA 4MNCA 4PGNA 2XXKA 2HZKA 2XWIA 4OA4A 4PF8A 4MX6A 4N6DA 4PAIA 2XA5A 4PE3A 4MNIA 2WYPA 2WYKA 4PDHA 4XEQA 4NX1A 2HZLA 3U65A 4PC9A
chains in the Genus database with same CATH superfamily
4OERA 1Z7ME 4IO2A 4EQ9A 1RDXA 3LC8A 5DTBA 1VSOA 3MZ1A 3HHGA 4QXDA 1Y3PA 1B05A 3W9VA 1N84A 1R9QA 3GBBA 1B4ZA 4H6DA 4ELRA 5IKBA 3H7MA 5H8NA 4NQ8A 5FHMA 1DMBA 5I56B 4KYSA 4POXA 3LSFB 4RPNA 3EN3A 4NF4A 1B7ZA 3N6TA 4PE5B 4H1XA 1LGBC 2DXRA 4FATA 4GRKA 3MQ9A 3TTNA 3VLWA 4IGRA 4ESWA 3FBPA 3THIA 3H06B 4O7IA 3RUMA 1AH5A 3O97A 3KZGA 3Q27A 1ZIUA 5IAIA 2ZZXA 4Q0CA 1LEVA 2P3NA 1QGXA 1B58A 3T96B 4I1DA 1XS5A 4F3GA 3BIHA 1N3WA 4GXSB 4QFOA 1B51A 4F19A 1Y20A 3N6UA 4H46A 2Y7KA 1HSEA 5J1DA 3OSQA 3B8BA 3OSRA 3BFTA 4GWYA 2I0BA 4GLIA 3O6HA 1AOVA 2ZXTA 2ANJA 4NE4A 2GQ1A 2XXTA 3TZAA 1BKAA 1KWHA 2HEUA 4XKRA 1EYJA 2Y7WA 3DLNA 3QUFA 4RXLA 4XEQA 2O68A 1USYH 5ET6A 1WVJA 2DVZA 3IJOB 4PC9A 2DDKA 1FJ9A 1FBPA 4LATA 2Q88A 4AS5A 4AQ4A 3SEVA 2HQ0A 4JVDA 4OFJA 1M5DA 4GWSA 3FJGA 1MY3A 2Q2AA 2B3BA 2OX3A 4RK2A 3O29A 1LAFE 5EHMA 3USDA 1SW4A 4QSEA 5TP9A 2REGA 4ZZEA 2I0CA 3S2VA 4F29A 3MZBA 3G3FA 4N8GA 3VVDA 4LN5A 4GL0A 1POY1 3T9VA 4ZEKA 4U1ZA 5ISUA 2Y84A 3KJ7A 3MPLA 2ZZVA 3PD8A 1Y3QA 1IQ7A 4F1UA 3SDFA 3CG3A 2XWOA 1B2HA 4THIA 4GWWA 1US4A 3SEWA 5I2KA 4IR8A 2UYFA 4IO6A 1SVXB 4P56A 3FASA 4E0XA 3KOSA 3FXRA 2XD2A 3FUZA 4WEDA 1S50A 4KYDA 5CMMA 5ET8A 2NXOA 1LCTA 3DP8A 4PFYA 4JXIA 2XA5A 2P0SA 1A7LA 1P99A 2G29A 3IB2A 3VXBA 2I3WA 3OXNA 2UVHA 3N5LA 3R6UA 4G68B 1JETA 2ZMBA 3ROJA 1F9BA 4GX4A 4DE8A 3K01A 2OZZA 2DXYA 2I49A 2QPQA 2Z22A 3EPEA 4O3BA 4NF0A 3LV0A 2OLBA 2PFYA 4PCDA 1NH8A 3G3IA 2E0SA 4KR5A 4ZEIA 5H8HB 3G3JA 4QFKA 3IOVA 4HE1A 4ISUA 1LBZA 2L5VA 1NKXA 4NF6B 1FPJA 1B0LA 4PP0A 2R8TA 1AMFA 3DP6A 1B3HA 2ZNUA 2V3TA 3N26A 1BP5A 4GL8A 1D9QA 1SD3A 3G3HA 2O1MA 4EDPA 1JVXA 2V4CA 2F36A 4DXBA 4R9GA 3PPPA 4N07A 4PTKA 3RPLA 1M5EA 3A3UA 1QUKA 3RTWB 4QFNA 3EF7A 5KCJB 2Y5KA 2XXRA 1RYXA 4QF9A 2VP1A 3BIGA 1LFIA 3KG2A 3SZPA 2QRYA 1A40A 4PF8A 3IORA 1LBCA 4M4GA 4YKJA 4EXKA 4MNIA 1JVYA 2B4MA 5TPAA 3MBPA 3H6VA 5H8NB 4H8JA 2DE2A 2F7AA 3U1OA 4I3EA 3LSXA 1B1HA 5L9SA 1ELJA 4MNPA 3B6TA 4G4PA 4MCOA 4F31B 4GX3A 1MM7A 2JJKA 3OEKA 3HHFA 1PEBA 3IO4A 3KSXA 1RDZA 4PETA 3V8XB 4GOTA 3EKIA 3UP9A 1OVTA 2DVCA 3FVKA 3RPWA 5F7VA 1OQGA 3PMVA 3Q25A 4F1YA 1FTMA 1I6QA 2RCBA 4X1BA 2FBPA 2Y5LA 4E0WA 1JW1A 1WODA 2IA4A 3OELA 1MY0A 2VT5A 4OZ9A 1PB8A 3VV5A 2CZHA 3PMXA 4FAJA 3T0JA 4RYAA 1B52A 2QS3A 3C32A 4JSOA 2Q9TA 2Q89A 2UYEA 5CI5A 2UVIA 3M3KA 3H6UA 3MVXA 2RC8A 4OVJA 4G8NA 1FPEA 1J1NA 4JVCA 3IOTA 4U22A 1OQHA 1XC1A 4PGNA 4OENA 1UQWA 3HPIA 1B7UA 2XXHA 3TCGA 2ESNA 4OA4A 4PE3A 1JW5A 2WYPA 2WYKA 2YPNA 1VR5A 3TPAA 3TCHA 3MJNA 4G61A 2OWSA 2LAOA 3S4UA 4FBPA 2HAUA 5H8HA 3KN3A 4JWXA 3MVYA 4HCWA 2I48A 4Q30B 4NN3A 4G77A 3DM0A 4POWA 1M5FA 4Q5TA 3N94A 2O1LA 1Y9UA 3K1MA 1P1QA 2ZZWA 2UXAA 1XT8A 4PDDA 3SEXA 4PFTA 5I84A 2F78A 4L17A 3RPLB 3B6WA 3UIFA 4IY5A 3C35A 1AL3A 1TFAA 5I59A 4NEDA 5LTCA 4FE8A 3RLFE 1NNFA 1UIVA 1FPBA 1NMUA 3G3KA 1OLCA 2B65A 1IXGA 4RA1A 5CMKA 5F1QA 4GWXA 4U4SA 4PF6A 3TTRA 3CG1A 5FHNA 1DK4A 1OLAA 2AL5A 4EQBA 4R6HA 5FTHA 1GGGA 3FXQA 2O84X 4F2OA 4X9TA 4IO3A 3RNNA 1EYIA 1O63A 2QS1A 1LB9A 2XXKA 3CIJA 4QFLA 1ZTYA 3O6GA 3S9LC 1FCKA 1FSAA 1FTAA 1L5TA 5A5LA 1MQHA 1XOCA 5DEXB 3UK4A 3T22A 4NF4B 3W9WA 5I58B 1QUIA 5L8DA 1A55A 1MXVA 1N7XA 4XKQA 4X04A 1MY1A 1SDXA 1N76A 3PU5A 4QRZA 1UTHB 3B50A 4ZZAA 2DWAA 2DWIA 1IIWA 3MP6A 1EZOA 1UIUA 1ATGA 3SKPA 3K4UA 3G7WA 4FIMA 4YMAA 2Z8EA 1OVBA 2Z23A 4RK9A 1I6AA 2PFZA 3LBSA 3MW0A 4JDFA 4F3BA 3A3CA 4R74A 1MH4A 1MXXA 1USYE 4KCCA 3FV1A 3RY3A 1GVCA 5AA4B 3VDFA 4HE2A 2D5WA 1PBQA 1O64A 4N81A 4U21A 1MY2A 3GYYA 4C1TA 1P1WA 3FD3A 4P8BA 1JEUA 3CR9A 4X48A 5AA2D 1UTBA 3ILTB 4H5FA 2RCAA 1DTGA 4RNSA 4OQOA 3K6VA 2VHAA 3MSTA 2M8CA 1TT1A 3OO8A 1SW5A 3FXUA 4GQOA 1CE2A 1NV0A 5I59B 2ZYKA 3KSJA 2HFBA 1NNKA 2F97A 3O6IA 5ET7A 1B46A 5ICQA 2YJPA 5ESYA 2WEFA 4LZ5A 1Y4CA 1N0TA 2O6AA 4G8MA 2P3VA 2F3DA 2FHYA 3K00A 2QVRA 4NX1A 4LUBA 1FTKA 4GBWA 3CSBA 1AWBA 1URDA 3PD9A 5DT6A 3LUYA 4YKKA 2FIXA 4KI0E 2Q74A 4OWDA 2ZYOA 2XWKA 3IB1A 3PPRA 4XF5A 4IO5A 1Q1KA 1NUWA 1WDNA 1A99A 4P3LA 3IJXB 3JV9A 3UORA 4KD5A 3PTYA 4F3SA 4X1DA 1FQCA 2Q8JA 4GF8A 1IMBA 5T3JA 4TLMB 1B3EA 1PBPA 4NWDA 4XFEA 2QS4A 4ESXA 3KN8A 1VDWA 4NMYA 1DPEA 2XXQA 3Q28A 4GIZA 4I40A 4PGPA 5CM6A 2V93A 1Y3NA 3O9PA 1SW1A 4DXUA 5CBSA 3FIRA 2UVGA 3MVWA 2DQVA 2BJIA 4NTLA 4ZEFA 1IXIA 5JK4A 3FGSA 3ZS6A 1QKBA 4N91A 3CI8A 3U72A 3C4MA 1INPA 3O28A 1FBCA 4EXLA 4JVIA 2VD3A 2A5SA 2DE4A 3E3KA 3QSLA 2A5TA 5CRYA 2H99A 3U94A 3MC2A 4ELOA 4PAIA 4LQ5A 5ITOA 3U65A 2KR0A 4OYVA 4KPTA 4QSCA 1SPIA 3T9HB 4U2RA 1RYOA 2ONSA 3IL1B 1NL5A 2PT2A 1B5IA 4R2FA 4BDNA 1NV4A 3VFJA 1D9VA 1MH3A 3IFCA 1BTJA 1FPGA 4IO7A 3NOHA 4FORA 3VVFA 1FPLA 1MXUA 1FW0A 3TODA 1ZU0A 3KOTA 3PMWA 5IZ1A 5AE4A 1O7TA 3QXMA 4GXAA 1B32A 3GXAA 1FQAA 4MHFA 1IZ1A 1NUZA 3TAJA 4O94A 3SEUA 5A5XA 2XXVA 4LVQA 1N3XA 2FIEA 4H65A 4BDRA 2O7IA 4YKPA 1XHYA 4BDMA 3S9MC 4F39A 2VOZA 2F8DA 2MKZA 1QVSA 1D4NA 4OVTA 1MXWA 5J16A 4R72A 2Z8FA 3KC1A 1HSLA 4PBHA 2YLNA 2Y7RA 3L6GA 1MDP1 4MBPA 2NUVA 5EQ7A 4X8RA 2FNCA 2X26A 2AIXA 4C1UA 2PBWA 4UA8A 4OESA 1R6ZA 3S9EA 3M3LA 3IAZA 3OO9A 4FEDA 3CFLA 3H6TA 1H44A 5IZ3A 2QMXA 5K2XA 2QFLA 2X7QA 4F3PA 3O66A 4QFPA 5HBCA 5L9MA 2F7BA 3BFUA 1P1OA 3SETA 3FVOA 4FECA 4UABA 1Y1MA 2I58A 5I58A 2THIA 2OWTA 4MEVA 1DBZA 4TOZA 1IUDA 1IMAA 4YB5A 2CEXA 4ELQA 1LAXA 3K6XA 3LSLA 4OANA 2KQZA 4FJPA 3C31A 3C36A 1LCFA 4QBAA 2AYSA 3L6HA 5FBPA 4AB6A 1EYKA 1LBWA 4N4UA 2DYXA 3KBRA 5I7IA 4XXUA 3WAEA 3E79A 4YKIA 3TUSA 1OMPA 4KFQA 5CC2A 4QHQA 1LAGE 1FTLA 3QYTA 4NWCA 3TCFA 1UTBB 1URGA 4MFIA 4DXCA 2HZKA 5TU0A 3FJMA 3H4ZA 4N6DA 5I2NB 1B1XA 3GZGA 1FBGA 3Q29A 1MXYA 1K9ZA 1NNPA 5F24A 3PPNA 3VLVA 1MDQA 2XHDA 4LZ8A 5LOMA 2O69A 2CMOA 3F11A 4TLLB 4R6KA 3TMGA 3R26A 1IMCA 3M3FA 1FBFA 1YXIA 4NAPA 2CZKA 2PX1A 2XD3A 1URSA 3FJ7A 3EHTA 1LB8A 2CZLA 4LZ7A 5EQ8A 5EYHA 1ZJLA 5H8FA 4G68A 2QSXA 2OCUA 1UTHA 3OEMA 1EU8A 1FTJA 2BJJX 5LDZA 1YCJA 2RINA 4H67A 1SW2A 4PAKA 4R6YA 4LA9A 1I69A 4OVSA 4P1LA 4RPOA 3G3GA 4LQ2A 3SEYA 1YAEA 1EZPA 2V3UA 5JEIA 1DCUA 4YB7A 2QVUA 4DZ1A 4KHZE 1H43A 5IZZA 3TQLA 4U4XA 2XXPA 2ABHA 1BIYA 5M2VA 5EQAA 1QJMA 2WKYA 4TQUQ 1NV6A 3ZSFA 1OIBA 3TYHA 4JSDA 1B6HA 3DP4A 5K2YA 1S9TA 4O7MA 3T66A 4NF8B 1SI0A 1MQIA 4MF3A 4KXPA 3OD7A 5AA2A 3TTMA 1Q35A 3D1RA 1B3FA 2HXWA 3B7DA 4MX6A 1IEJA 4XKNA 1RKMA 3K1NA 2F6GA 1LBBA 3K6UA 4YU0A 1MXZA 4F18A 2XXXA 2RF1A 3U93A 2DP8A 4HS7A 4YAHX 2DOJA 5DEXA 1NV3A 3C33A 1EZ9A 3E9XA 1QULA 1IXHA 5AA4A 3IK6B 4G2ZA 4OEUA 4DI4B 1GR2A 1ZMGA 4PFBA 1LLSA 2GHBA 1NUYA 5EYGA 1YTVA 3MVZA 3UA8A 3FZVA 1BLFA 1MQDA 4P47A 1PB7A 4GX6A 3HFUA 3OO7A 3QMFA 4WXJA 1TXFA 3OMBA 4GD5A 1POTA 3FXBA 3MWBA 4WKMA 4GWZA 3KBZA 3K1PA 3D4GA 3IX1A 5DYHA 1DOTA 4NF5A 4ZE9A 4ELPA 3QIMA 5I56A 3V83A 4ECFA 4EF2A 4P9KA 2V3QA 5KCJA 1PC3A 3UGWA 3R7XA 1XVXA 2XXYA 3S9NC 3EHSA 3U8QA 4OVPA 1DTZA 3I6VA 5CBRA 5DVJA 1NI9A 1YPNA 3MUQA 3BBRA 2FVZA 5KZTA 1ZKBA 4MNCA 1IMDA 1IXCA 1SYHA 1B5JA 1B4HA 4MH5A 3K6WA 3CFXA 1QUJA 4G8HA 2NVUB 1QKAA 1ANFA 2ZNTA 4IY6A 2RC9A 3Q26A 1IMEA 1TWYA 3PPQA 1LSTA 3E78A 3ZKLA 2XXUA 4ZS9A 4DDDA 1LBVA 2HPGA 2NOOA 2I4BA 3GLBA 3K2DA 4N17A 4Z0IA 2ZYMA 3VLUA 3RN8A 1CB6A 3TTKA 2VPNA 3ECRA 2P1SA 3RQTA 5B7DA 5IM2A 4OVQA 2F3BA 4MAGA 4HTGA 4R75A 3A09A 3CHGA 4P11A 2GHAA 5CMBA 3RGYA 3SERA 3TDJA 3KC0A 2HCAA 4I8CA 2NWJA 4H0WA 3T93B 3TTLA 2B3FA 4XTCQ 5HPQA 1NH7A 3ZKKA 2O7UA 3HSTA 4BLAA 5IGAA 1NV7A 4HE0A 1MG1A 4PFWA 1R9LA 1FQDA 5ITPA 3KGCA 5BUUA 4DI3D 2VPOA 4LP2B 4U1OA 4KYEA 3T1BA 1D3KA 3MZ9A 1H45A 2H25A 4EQ7A 3OOAA 1JW4A 2F35A 3AXFA 2PT1A 4H8IA 4OETA 1SBPA 4ZE8A 1MPCA 3TQWA 3IOUA 1KZ8A 3LUZA 2XWIA 4I3YA 5CMCA 1FPIA 2OK2A 1FPFA 5ICTA 4R2BA 3TFLA 2GFEA 4JWOA 1B0HA 1GTKA 1H3DA 3QAXA 3CSGA 1B9JA 2WBDA 3HO7A 3UN6A 3LR1A 3DELB 1MPBA 1KA1A 3EHUA 1XVYA 2DE3A 3PV0E 2HXRA 3PGFA 3FV2A 1G0HA 3CVGA 4Z7EA 4NG7A 1Y4TA 4F2QA 1VE4A 3CRBA 2XX9A 3FATA 3GBAA 5ELVA 2H98A 4JWYA 5I5PA 3ISPA 1IITA 2XX8A 1GV8A 5B70A 4PAFA 2DSFA 5H8QB 1LBXA 3E4RA 4LONB 3V89B 4FEBA 4MLVA 3PUZE 4BDOA 1S7YA 2WBBA 2XXWA 3FVNA 1B40A 4JB7A 3I5OA 1JEVA 3W15C 1MY4A 4F22A 1IMFA 1LAHE 2XX7A 4C0RA 1JNFA 3VVEA 4GBVA 5JTYB 3T9XB 4O3AA 3PUVE 4PDHA 5EQ9A 2P2AA 3EQ1A 2Y7IA 4U23A 1R1NA 3BKIB 4ZDMA 2HAVA 2D3IA 4XIGQ 3H6WA 2Z8DA 2ONRA 3H03A 3CFZA 1MS7A 2F34A 5DW8A 2G93A 5DVIA 5TP9B 4OEVA 3HN0A 1FJ6A 5IZ3B 3RT6B 4DCYA 2RKMA 2X7PA 2R6GE 4P0GA 3V5AA 4NF6A 4NF5B 1FTOA 2UVJA 1NFTA 4OMBA 2D21A 5I57B 5EHSA 4GWUA 2OWZA 1A54A 1ZBMA 4GFRA 5I3SA 1US5A 3PUWE 2F5XA 4P1EA 1II5A 1TFDA 1VFDA 4MJOA 1FPDA 2F6PA 3TEPA 5I2KB 2FYIA 3SESA 4OTEA 4BDQA 4KCDA 4O3CA 1EH3A 4PQJA 4H5GA 3TKDA 3D4CA 5AA3A 2GH9A 3RT8A 1T0KA 3OO6A 1MPDA 2Q2CA 2B4LA 2PCRA 3ODBA 4O8MA 2ALUA 1Y1ZA 3IOWA 2E1SA 2XWVA 4ZEBA 4QSDA 4EF1A 1SYIA 5HM4B 2Y7PA 4M1VA 4YICA 2QJEA 2V84A 1FBEA 1M5CA 1A8FA 3MP1A 4PFUA 2ONKE 1K9YA 1N7WA 1Z7NE 2I4CA 4RJZA 1SQYA 1P1UA 1M5BA 1QW0A 3TELA 3MAMA 4OFOA 1FQBA 4XKPA 2AL4A 3KJTA 4R9FA 3IFAA 3VE1B 4EUOA 2REJA 2R9JA 4OVRA 2ZYNA 2QL3A 3IR1A 1NV5A 4PFRA 4HW8A 3K02A 3HCQA 4PBQA 2WX9A 4N8YA 1FQFA 2RC7A 1DPPA 5A5XB 4MMPA 5H8QA 4K3FA 2F7CA 3A29A 3ONMA 2I3VA 3I3VA 3KEIA 1PB9A 1D9YA 4GVOA 2VGQA 2QS2A 3K0VA 3RTFB 2PVUA 2R71A 1MM6A 5ET5A 3ILUB 2H4IA 3C34A 2VD2A 2XXIA 5H8SA 1KA0A 4N13A 4NGUA 5JTYA 2QMWA 4NF8A 4F1VA 3MP8A 3IB0A 4GWOA 1JP4A 4PFIA 5I2NA 1B5HA 1N04A 3U92A 4IB2A 3B6QA 3LSWA 5FHOA 2CEYA 1NV1A 3KN7A 1YZ0A 2CZIA 1I6BA 1VFEA 4ONYA 1HSJA 4JBZA 5DVFA 1B7HA 1ZLQA 3FVGA 3T9UA 1JQFA 1LBYA 3IO6A 4G68C 3HV1A 3PUXE 1G0IA 1XI6A 5H8FB 1FBHA 1MQGA 4AS4A 3KFMA 2O51A 4AB5A 4RY1A 1LFHA 2H5YA 4HCYA 4Q8RA 2H9BA 3MYUA 1DSNA 1YYZA 1FRPA 3OENA 5KDTA 2DWHA 4ZEDA 4ZECA 1LFGA 1NV2A 4P0IA 1P1NA 4UACA 5FTIA 4ND9A 4KQPA 2I6EA 1PDAA 1FPKA 4N6KA 4MIJA 2KLFA 4MLQA 3PUYE 3QK6A 3M8UA 2PYYA 3QUJA 4IGTA 3JYRA 2FA7A 2V25A 4OHNA 4OXVA 4WEPA 3P7IA 5KDTB 4DIGA 3JZJA 4R73A 2PMSA 4NHBA 3E13X 4BDLA 4HXVA 4DLDA 4DCXA 1NUXA 2QVVA 3O2AA 2GRVA 2A5TB 4YB6A 4OFLA 5AA2B 1H76A 1RDYA 1MRPA 2W7YA 1B3LA 1AIVA 2HHMA 3RYDA 1BK4A 4IO4A 4N15A 2IEEA 1CNQA 1NNTA 5L9OA 4YZZA 3MPKA 3PPOA 4I9DA 1SI1A 5TPAB 4I62A 1FBDA 1FQEA 5AA1A 2Q8MA 2OJTA 1B3GA 3H3GA 5EYFA 2ZNSA 2DS9A 1A8EA 1Q9DA 3WAFA 2OBGA 5BWJA 4N6PA 3VXCA 4YMBA 4H45A 2HZLA 3C9HA 1MQJA 5I57A 2DWJA
chains in the Genus database with same CATH topology
1LBVA 1FBPA 2HPGA 4HCYA 1SPIA 2DE2A 5I7IA 5DW8A 1IMCA 4FBPA 1RDXA 4X04A 1FBFA 4I3EA 2FIXA 4OVRA 3MYUA 4AS5A 1YYZA 1FRPA 1YXIA 4GX4A 4NAPA 2WBDA 3B50A 1NV5A 2Q74A 4HCWA 4QXDA 1NV3A 2CZKA 4JVDA 1FJ6A 2XWKA 4N17A 5IZ3B 4PFRA 3W9VA 2QPQA 4NF0A 4GWSA 1KA1A 4XF5A 4MNPA 2WX9A 2DE3A 4NN3A 1NV2A 1NUWA 2HXRA 3LV0A 4PBQA 2OX3A 4DI4B 4MCOA 4N8YA 5EQ8A 2PFYA 2VPNA 4P3LA 4PCDA 5EYHA 1G0HA 4GX3A 4UABA 1NV4A 4PFBA 4NQ8A 4MMPA 5IM2A 2JJKA 1FPKA 1NUYA 3IFCA 5EYGA 4N6KA 3PTYA 1FPGA 2F3BA 4MEVA 4MAGA 1DBZA 4OVQA 4NG7A 4GX6A 4P47A 1RDZA 3HFUA 3NOHA 3QMFA 4GWUA 2OWZA 4MIJA 2PFZA 4PETA 1FPLA 5I3SA 5LDZA 1IMAA 1IMBA 3A29A 2ZZWA 3CHGA 5T3JA 2F5XA 4P1EA 4PDDA 3EKIA 2CEXA 4HE1A 1LBZA 4MJOA 1FPDA 4PAKA 3FXBA 2L5VA 4GWZA 3KBZA 3KC0A 4N8GA 4OANA 4OVSA 4XFEA 3RPLB 4LN5A 4P1LA 2KQZA 1FPJA 5IZ1A 3FBPA 1VDWA 5I5PA 3ISPA 4O7IA 5ET5A 4HE2A 1DCUA 4QBAA 5LTCA 2FBPA 2R8TA 2Y5LA 2QVUA 4NHBA 4N81A 4PAFA 3GYYA 4I40A 5FBPA 1FPBA 5IGAA 1LBWA 1EYKA 4PGPA 1NV7A 2ZZVA 4HXVA 4MHFA 4P8BA 4P9KA 2V3QA 1LBXA 5CM6A 5IZZA 4HE0A 4N4UA 1NUXA 1NUZA 2ZZXA 2QVVA 2VT5A 4O94A 2B4LA 2PCRA 1KA0A 1LEVA 1D9QA 2P3NA 2CZHA 4GWXA 4NGUA 2WBBA 1QGXA 2VPOA 3ROJA 3T0JA 4PF6A 4DI3D 4F1UA 4F1VA 2FIEA 4O8MA 4OVPA 3E79A 5EQAA 3BIHA 3T1BA 3MSTA 3W9WA 1RDYA 2V4CA 2BJIA 2XWOA 1DK4A 2Q9TA 2XWVA 1NV6A 2HHMA 1IMFA 3RYDA 5JK4A 1BK4A 2MKZA 4GWWA 4N91A 4N15A 1JP4A 4PTKA 3RPLA 1FPEA 1NI9A 4OVTA 5J16A 4IR8A 1CNQA 1INPA 4PFIA 1NV0A 1FBCA 2Y5KA 3KC1A 4M1VA 4PBHA 4YICA 4YZZA 4JVIA 4X9TA 4F19A 1FBEA 1FBDA 4O7MA 5ET7A 4H46A 4P56A 2FVZA 5EQ7A 1EYIA 2DE4A 3BIGA 4JVCA 4KXPA 4X8RA 2Q8MA 2CEYA 1NV1A 5ESYA 4MNCA 1IMDA 1YZ0A 4GBVA 2CZIA 5J1DA 4PGNA 3B8BA 2WEFA 1KZ8A 2HZKA 2XXKA 3SZPA 1K9YA 3D1RA 5ET8A 3LUZA 2XWIA 4I3YA 1Q9DA 4GWYA 2P3VA 4MX6A 4OA4A 4PF8A 2F3DA 4N6DA 1FTAA 1FSAA 4PAIA 2XA5A 2FHYA 4PE3A 2GQ1A 1LBYA 2QVRA 1FPIA 2WYPA 4MNIA 2WYKA 5A5LA 4PDHA 5EQ9A 1EYJA 2B4MA 4XEQA 4NX1A 1FBGA 4H45A 4GBWA 5ET6A 1K9ZA 1G0IA 1XI6A 1FBHA 1IMEA 5F24A 5IZ3A 1AWBA 4AS4A 2HZLA 3U65A 2DVZA 3E78A 1FPFA 4F18A 2KR0A 3IFAA 4G61A 4PC9A 2DDKA 2QFLA 1FJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HPG A;  4X04 A;  4OVR A;  4NAP A;  3B50 A;  4N17 A;  2XWK A;  4PFR A;  4NF0 A;  4XF5 A;  4MNP A;  2WX9 A;  4NN3 A;  4PBQ A;  4DI4 B;  4MCO A;  4N8Y A;  2PFY A;  2VPN A;  4P3L A;  4PCD A;  4UAB A;  4PFB A;  4NQ8 A;  4MMP A;  5IM2 A;  4OVQ A;  4N6K A;  4MEV A;  4MAG A;  4NG7 A;  4P47 A;  4MIJ A;  2PFZ A;  4PET A;  2ZZW A;  4PDD A;  4P1E A;  2CEX A;  4PAK A;  3FXB A;  4N8G A;  4OAN A;  4OVS A;  4XFE A;  4LN5 A;  4P1L A;  5I5P A;  5LTC A;  4NHB A;  4PAF A;  3GYY A;  5IGA A;  4PGP A;  5CM6 A;  2ZZV A;  4P8B A;  4MHF A;  4P9K A;  5IZZ A;  4N4U A;  2ZZX A;  4O94 A;  5I7I A;  4NGU A;  4DI3 D;  2VPO A;  4PF6 A;  4O8M A;  4OVP A;  2V4C A;  2XWO A;  2XWV A;  4N91 A;  4N15 A;  4OVT A;  4PFI A;  4YZZ A;  4PBH A;  4YIC A;  4O7M A;  4P56 A;  4X8R A;  2CEY A;  4MNC A;  4PGN A;  2XXK A;  2HZK A;  2XWI A;  4OA4 A;  4PF8 A;  4MX6 A;  4N6D A;  4PAI A;  2XA5 A;  4PE3 A;  4MNI A;  2WYP A;  2WYK A;  4PDH A;  4XEQ A;  4NX1 A;  2HZL A;  3U65 A;  4PC9 A; 
#chains in the Genus database with same CATH topology
 4OER A;  1Z7M E;  4IO2 A;  4EQ9 A;  1RDX A;  3LC8 A;  5DTB A;  1VSO A;  3MZ1 A;  3HHG A;  4QXD A;  1Y3P A;  1B05 A;  3W9V A;  1N84 A;  1R9Q A;  3GBB A;  1B4Z A;  4H6D A;  4ELR A;  5IKB A;  3H7M A;  5H8N A;  4NQ8 A;  5FHM A;  1DMB A;  5I56 B;  4KYS A;  4POX A;  3LSF B;  4RPN A;  3EN3 A;  4NF4 A;  1B7Z A;  3N6T A;  4PE5 B;  4H1X A;  1LGB C;  2DXR A;  4FAT A;  4GRK A;  3MQ9 A;  3TTN A;  3VLW A;  4IGR A;  4ESW A;  3FBP A;  3THI A;  3H06 B;  4O7I A;  3RUM A;  1AH5 A;  3O97 A;  3KZG A;  3Q27 A;  1ZIU A;  5IAI A;  2ZZX A;  4Q0C A;  1LEV A;  2P3N A;  1QGX A;  1B58 A;  3T96 B;  4I1D A;  1XS5 A;  4F3G A;  3BIH A;  1N3W A;  4GXS B;  4QFO A;  1B51 A;  4F19 A;  1Y20 A;  3N6U A;  4H46 A;  2Y7K A;  1HSE A;  5J1D A;  3OSQ A;  3B8B A;  3OSR A;  3BFT A;  4GWY A;  2I0B A;  4GLI A;  3O6H A;  1AOV A;  2ZXT A;  2ANJ A;  4NE4 A;  2GQ1 A;  2XXT A;  3TZA A;  1BKA A;  1KWH A;  2HEU A;  4XKR A;  1EYJ A;  2Y7W A;  3DLN A;  3QUF A;  4RXL A;  4XEQ A;  2O68 A;  1USY H;  5ET6 A;  1WVJ A;  2DVZ A;  3IJO B;  4PC9 A;  2DDK A;  1FJ9 A;  1FBP A;  4LAT A;  2Q88 A;  4AS5 A;  4AQ4 A;  3SEV A;  2HQ0 A;  4JVD A;  4OFJ A;  1M5D A;  4GWS A;  3FJG A;  1MY3 A;  2Q2A A;  2B3B A;  2OX3 A;  4RK2 A;  3O29 A;  1LAF E;  5EHM A;  3USD A;  1SW4 A;  4QSE A;  5TP9 A;  2REG A;  4ZZE A;  2I0C A;  3S2V A;  4F29 A;  3MZB A;  3G3F A;  4N8G A;  3VVD A;  4LN5 A;  4GL0 A;  1POY 1;  3T9V A;  4ZEK A;  4U1Z A;  5ISU A;  2Y84 A;  3KJ7 A;  3MPL A;  2ZZV A;  3PD8 A;  1Y3Q A;  1IQ7 A;  4F1U A;  3SDF A;  3CG3 A;  2XWO A;  1B2H A;  4THI A;  4GWW A;  1US4 A;  3SEW A;  5I2K A;  4IR8 A;  2UYF A;  4IO6 A;  1SVX B;  4P56 A;  3FAS A;  4E0X A;  3KOS A;  3FXR A;  2XD2 A;  3FUZ A;  4WED A;  1S50 A;  4KYD A;  5CMM A;  5ET8 A;  2NXO A;  1LCT A;  3DP8 A;  4PFY A;  4JXI A;  2XA5 A;  2P0S A;  1A7L A;  1P99 A;  2G29 A;  3IB2 A;  3VXB A;  2I3W A;  3OXN A;  2UVH A;  3N5L A;  3R6U A;  4G68 B;  1JET A;  2ZMB A;  3ROJ A;  1F9B A;  4GX4 A;  4DE8 A;  3K01 A;  2OZZ A;  2DXY A;  2I49 A;  2QPQ A;  2Z22 A;  3EPE A;  4O3B A;  4NF0 A;  3LV0 A;  2OLB A;  2PFY A;  4PCD A;  1NH8 A;  3G3I A;  2E0S A;  4KR5 A;  4ZEI A;  5H8H B;  3G3J A;  4QFK A;  3IOV A;  4HE1 A;  4ISU A;  1LBZ A;  2L5V A;  1NKX A;  4NF6 B;  1FPJ A;  1B0L A;  4PP0 A;  2R8T A;  1AMF A;  3DP6 A;  1B3H A;  2ZNU A;  2V3T A;  3N26 A;  1BP5 A;  4GL8 A;  1D9Q A;  1SD3 A;  3G3H A;  2O1M A;  4EDP A;  1JVX A;  2V4C A;  2F36 A;  4DXB A;  4R9G A;  3PPP A;  4N07 A;  4PTK A;  3RPL A;  1M5E A;  3A3U A;  1QUK A;  3RTW B;  4QFN A;  3EF7 A;  5KCJ B;  2Y5K A;  2XXR A;  1RYX A;  4QF9 A;  2VP1 A;  3BIG A;  1LFI A;  3KG2 A;  3SZP A;  2QRY A;  1A40 A;  4PF8 A;  3IOR A;  1LBC A;  4M4G A;  4YKJ A;  4EXK A;  4MNI A;  1JVY A;  2B4M A;  5TPA A;  3MBP A;  3H6V A;  5H8N B;  4H8J A;  2DE2 A;  2F7A A;  3U1O A;  4I3E A;  3LSX A;  1B1H A;  5L9S A;  1ELJ A;  4MNP A;  3B6T A;  4G4P A;  4MCO A;  4F31 B;  4GX3 A;  1MM7 A;  2JJK A;  3OEK A;  3HHF A;  1PEB A;  3IO4 A;  3KSX A;  1RDZ A;  4PET A;  3V8X B;  4GOT A;  3EKI A;  3UP9 A;  1OVT A;  2DVC A;  3FVK A;  3RPW A;  5F7V A;  1OQG A;  3PMV A;  3Q25 A;  4F1Y A;  1FTM A;  1I6Q A;  2RCB A;  4X1B A;  2FBP A;  2Y5L A;  4E0W A;  1JW1 A;  1WOD A;  2IA4 A;  3OEL A;  1MY0 A;  2VT5 A;  4OZ9 A;  1PB8 A;  3VV5 A;  2CZH A;  3PMX A;  4FAJ A;  3T0J A;  4RYA A;  1B52 A;  2QS3 A;  3C32 A;  4JSO A;  2Q9T A;  2Q89 A;  2UYE A;  5CI5 A;  2UVI A;  3M3K A;  3H6U A;  3MVX A;  2RC8 A;  4OVJ A;  4G8N A;  1FPE A;  1J1N A;  4JVC A;  3IOT A;  4U22 A;  1OQH A;  1XC1 A;  4PGN A;  4OEN A;  1UQW A;  3HPI A;  1B7U A;  2XXH A;  3TCG A;  2ESN A;  4OA4 A;  4PE3 A;  1JW5 A;  2WYP A;  2WYK A;  2YPN A;  1VR5 A;  3TPA A;  3TCH A;  3MJN A;  4G61 A;  2OWS A;  2LAO A;  3S4U A;  4FBP A;  2HAU A;  5H8H A;  3KN3 A;  4JWX A;  3MVY A;  4HCW A;  2I48 A;  4Q30 B;  4NN3 A;  4G77 A;  3DM0 A;  4POW A;  1M5F A;  4Q5T A;  3N94 A;  2O1L A;  1Y9U A;  3K1M A;  1P1Q A;  2ZZW A;  2UXA A;  1XT8 A;  4PDD A;  3SEX A;  4PFT A;  5I84 A;  2F78 A;  4L17 A;  3RPL B;  3B6W A;  3UIF A;  4IY5 A;  3C35 A;  1AL3 A;  1TFA A;  5I59 A;  4NED A;  5LTC A;  4FE8 A;  3RLF E;  1NNF A;  1UIV A;  1FPB A;  1NMU A;  3G3K A;  1OLC A;  2B65 A;  1IXG A;  4RA1 A;  5CMK A;  5F1Q A;  4GWX A;  4U4S A;  4PF6 A;  3TTR A;  3CG1 A;  5FHN A;  1DK4 A;  1OLA A;  2AL5 A;  4EQB A;  4R6H A;  5FTH A;  1GGG A;  3FXQ A;  2O84 X;  4F2O A;  4X9T A;  4IO3 A;  3RNN A;  1EYI A;  1O63 A;  2QS1 A;  1LB9 A;  2XXK A;  3CIJ A;  4QFL A;  1ZTY A;  3O6G A;  3S9L C;  1FCK A;  1FSA A;  1FTA A;  1L5T A;  5A5L A;  1MQH A;  1XOC A;  5DEX B;  3UK4 A;  3T22 A;  4NF4 B;  3W9W A;  5I58 B;  1QUI A;  5L8D A;  1A55 A;  1MXV A;  1N7X A;  4XKQ A;  4X04 A;  1MY1 A;  1SDX A;  1N76 A;  3PU5 A;  4QRZ A;  1UTH B;  3B50 A;  4ZZA A;  2DWA A;  2DWI A;  1IIW A;  3MP6 A;  1EZO A;  1UIU A;  1ATG A;  3SKP A;  3K4U A;  3G7W A;  4FIM A;  4YMA A;  2Z8E A;  1OVB A;  2Z23 A;  4RK9 A;  1I6A A;  2PFZ A;  3LBS A;  3MW0 A;  4JDF A;  4F3B A;  3A3C A;  4R74 A;  1MH4 A;  1MXX A;  1USY E;  4KCC A;  3FV1 A;  3RY3 A;  1GVC A;  5AA4 B;  3VDF A;  4HE2 A;  2D5W A;  1PBQ A;  1O64 A;  4N81 A;  4U21 A;  1MY2 A;  3GYY A;  4C1T A;  1P1W A;  3FD3 A;  4P8B A;  1JEU A;  3CR9 A;  4X48 A;  5AA2 D;  1UTB A;  3ILT B;  4H5F A;  2RCA A;  1DTG A;  4RNS A;  4OQO A;  3K6V A;  2VHA A;  3MST A;  2M8C A;  1TT1 A;  3OO8 A;  1SW5 A;  3FXU A;  4GQO A;  1CE2 A;  1NV0 A;  5I59 B;  2ZYK A;  3KSJ A;  2HFB A;  1NNK A;  2F97 A;  3O6I A;  5ET7 A;  1B46 A;  5ICQ A;  2YJP A;  5ESY A;  2WEF A;  4LZ5 A;  1Y4C A;  1N0T A;  2O6A A;  4G8M A;  2P3V A;  2F3D A;  2FHY A;  3K00 A;  2QVR A;  4NX1 A;  4LUB A;  1FTK A;  4GBW A;  3CSB A;  1AWB A;  1URD A;  3PD9 A;  5DT6 A;  3LUY A;  4YKK A;  2FIX A;  4KI0 E;  2Q74 A;  4OWD A;  2ZYO A;  2XWK A;  3IB1 A;  3PPR A;  4XF5 A;  4IO5 A;  1Q1K A;  1NUW A;  1WDN A;  1A99 A;  4P3L A;  3IJX B;  3JV9 A;  3UOR A;  4KD5 A;  3PTY A;  4F3S A;  4X1D A;  1FQC A;  2Q8J A;  4GF8 A;  1IMB A;  5T3J A;  4TLM B;  1B3E A;  1PBP A;  4NWD A;  4XFE A;  2QS4 A;  4ESX A;  3KN8 A;  1VDW A;  4NMY A;  1DPE A;  2XXQ A;  3Q28 A;  4GIZ A;  4I40 A;  4PGP A;  5CM6 A;  2V93 A;  1Y3N A;  3O9P A;  1SW1 A;  4DXU A;  5CBS A;  3FIR A;  2UVG A;  3MVW A;  2DQV A;  2BJI A;  4NTL A;  4ZEF A;  1IXI A;  5JK4 A;  3FGS A;  3ZS6 A;  1QKB A;  4N91 A;  3CI8 A;  3U72 A;  3C4M A;  1INP A;  3O28 A;  1FBC A;  4EXL A;  4JVI A;  2VD3 A;  2A5S A;  2DE4 A;  3E3K A;  3QSL A;  2A5T A;  5CRY A;  2H99 A;  3U94 A;  3MC2 A;  4ELO A;  4PAI A;  4LQ5 A;  5ITO A;  3U65 A;  2KR0 A;  4OYV A;  4KPT A;  4QSC A;  1SPI A;  3T9H B;  4U2R A;  1RYO A;  2ONS A;  3IL1 B;  1NL5 A;  2PT2 A;  1B5I A;  4R2F A;  4BDN A;  1NV4 A;  3VFJ A;  1D9V A;  1MH3 A;  3IFC A;  1BTJ A;  1FPG A;  4IO7 A;  3NOH A;  4FOR A;  3VVF A;  1FPL A;  1MXU A;  1FW0 A;  3TOD A;  1ZU0 A;  3KOT A;  3PMW A;  5IZ1 A;  5AE4 A;  1O7T A;  3QXM A;  4GXA A;  1B32 A;  3GXA A;  1FQA A;  4MHF A;  1IZ1 A;  1NUZ A;  3TAJ A;  4O94 A;  3SEU A;  5A5X A;  2XXV A;  4LVQ A;  1N3X A;  2FIE A;  4H65 A;  4BDR A;  2O7I A;  4YKP A;  1XHY A;  4BDM A;  3S9M C;  4F39 A;  2VOZ A;  2F8D A;  2MKZ A;  1QVS A;  1D4N A;  4OVT A;  1MXW A;  5J16 A;  4R72 A;  2Z8F A;  3KC1 A;  1HSL A;  4PBH A;  2YLN A;  2Y7R A;  3L6G A;  1MDP 1;  4MBP A;  2NUV A;  5EQ7 A;  4X8R A;  2FNC A;  2X26 A;  2AIX A;  4C1U A;  2PBW A;  4UA8 A;  4OES A;  1R6Z A;  3S9E A;  3M3L A;  3IAZ A;  3OO9 A;  4FED A;  3CFL A;  3H6T A;  1H44 A;  5IZ3 A;  2QMX A;  5K2X A;  2QFL A;  2X7Q A;  4F3P A;  3O66 A;  4QFP A;  5HBC A;  5L9M A;  2F7B A;  3BFU A;  1P1O A;  3SET A;  3FVO A;  4FEC A;  4UAB A;  1Y1M A;  2I58 A;  5I58 A;  2THI A;  2OWT A;  4MEV A;  1DBZ A;  4TOZ A;  1IUD A;  1IMA A;  4YB5 A;  2CEX A;  4ELQ A;  1LAX A;  3K6X A;  3LSL A;  4OAN A;  2KQZ A;  4FJP A;  3C31 A;  3C36 A;  1LCF A;  4QBA A;  2AYS A;  3L6H A;  5FBP A;  4AB6 A;  1EYK A;  1LBW A;  4N4U A;  2DYX A;  3KBR A;  5I7I A;  4XXU A;  3WAE A;  3E79 A;  4YKI A;  3TUS A;  1OMP A;  4KFQ A;  5CC2 A;  4QHQ A;  1LAG E;  1FTL A;  3QYT A;  4NWC A;  3TCF A;  1UTB B;  1URG A;  4MFI A;  4DXC A;  2HZK A;  5TU0 A;  3FJM A;  3H4Z A;  4N6D A;  5I2N B;  1B1X A;  3GZG A;  1FBG A;  3Q29 A;  1MXY A;  1K9Z A;  1NNP A;  5F24 A;  3PPN A;  3VLV A;  1MDQ A;  2XHD A;  4LZ8 A;  5LOM A;  2O69 A;  2CMO A;  3F11 A;  4TLL B;  4R6K A;  3TMG A;  3R26 A;  1IMC A;  3M3F A;  1FBF A;  1YXI A;  4NAP A;  2CZK A;  2PX1 A;  2XD3 A;  1URS A;  3FJ7 A;  3EHT A;  1LB8 A;  2CZL A;  4LZ7 A;  5EQ8 A;  5EYH A;  1ZJL A;  5H8F A;  4G68 A;  2QSX A;  2OCU A;  1UTH A;  3OEM A;  1EU8 A;  1FTJ A;  2BJJ X;  5LDZ A;  1YCJ A;  2RIN A;  4H67 A;  1SW2 A;  4PAK A;  4R6Y A;  4LA9 A;  1I69 A;  4OVS A;  4P1L A;  4RPO A;  3G3G A;  4LQ2 A;  3SEY A;  1YAE A;  1EZP A;  2V3U A;  5JEI A;  1DCU A;  4YB7 A;  2QVU A;  4DZ1 A;  4KHZ E;  1H43 A;  5IZZ A;  3TQL A;  4U4X A;  2XXP A;  2ABH A;  1BIY A;  5M2V A;  5EQA A;  1QJM A;  2WKY A;  4TQU Q;  1NV6 A;  3ZSF A;  1OIB A;  3TYH A;  4JSD A;  1B6H A;  3DP4 A;  5K2Y A;  1S9T A;  4O7M A;  3T66 A;  4NF8 B;  1SI0 A;  1MQI A;  4MF3 A;  4KXP A;  3OD7 A;  5AA2 A;  3TTM A;  1Q35 A;  3D1R A;  1B3F A;  2HXW A;  3B7D A;  4MX6 A;  1IEJ A;  4XKN A;  1RKM A;  3K1N A;  2F6G A;  1LBB A;  3K6U A;  4YU0 A;  1MXZ A;  4F18 A;  2XXX A;  2RF1 A;  3U93 A;  2DP8 A;  4HS7 A;  4YAH X;  2DOJ A;  5DEX A;  1NV3 A;  3C33 A;  1EZ9 A;  3E9X A;  1QUL A;  1IXH A;  5AA4 A;  3IK6 B;  4G2Z A;  4OEU A;  4DI4 B;  1GR2 A;  1ZMG A;  4PFB A;  1LLS A;  2GHB A;  1NUY A;  5EYG A;  1YTV A;  3MVZ A;  3UA8 A;  3FZV A;  1BLF A;  1MQD A;  4P47 A;  1PB7 A;  4GX6 A;  3HFU A;  3OO7 A;  3QMF A;  4WXJ A;  1TXF A;  3OMB A;  4GD5 A;  1POT A;  3FXB A;  3MWB A;  4WKM A;  4GWZ A;  3KBZ A;  3K1P A;  3D4G A;  3IX1 A;  5DYH A;  1DOT A;  4NF5 A;  4ZE9 A;  4ELP A;  3QIM A;  5I56 A;  3V83 A;  4ECF A;  4EF2 A;  4P9K A;  2V3Q A;  5KCJ A;  1PC3 A;  3UGW A;  3R7X A;  1XVX A;  2XXY A;  3S9N C;  3EHS A;  3U8Q A;  4OVP A;  1DTZ A;  3I6V A;  5CBR A;  5DVJ A;  1NI9 A;  1YPN A;  3MUQ A;  3BBR A;  2FVZ A;  5KZT A;  1ZKB A;  4MNC A;  1IMD A;  1IXC A;  1SYH A;  1B5J A;  1B4H A;  4MH5 A;  3K6W A;  3CFX A;  1QUJ A;  4G8H A;  2NVU B;  1QKA A;  1ANF A;  2ZNT A;  4IY6 A;  2RC9 A;  3Q26 A;  1IME A;  1TWY A;  3PPQ A;  1LST A;  3E78 A;  3ZKL A;  2XXU A;  4ZS9 A;  4DDD A;  1LBV A;  2HPG A;  2NOO A;  2I4B A;  3GLB A;  3K2D A;  4N17 A;  4Z0I A;  2ZYM A;  3VLU A;  3RN8 A;  1CB6 A;  3TTK A;  2VPN A;  3ECR A;  2P1S A;  3RQT A;  5B7D A;  5IM2 A;  4OVQ A;  2F3B A;  4MAG A;  4HTG A;  4R75 A;  3A09 A;  3CHG A;  4P11 A;  2GHA A;  5CMB A;  3RGY A;  3SER A;  3TDJ A;  3KC0 A;  2HCA A;  4I8C A;  2NWJ A;  4H0W A;  3T93 B;  3TTL A;  2B3F A;  4XTC Q;  5HPQ A;  1NH7 A;  3ZKK A;  2O7U A;  3HST A;  4BLA A;  5IGA A;  1NV7 A;  4HE0 A;  1MG1 A;  4PFW A;  1R9L A;  1FQD A;  5ITP A;  3KGC A;  5BUU A;  4DI3 D;  2VPO A;  4LP2 B;  4U1O A;  4KYE A;  3T1B A;  1D3K A;  3MZ9 A;  1H45 A;  2H25 A;  4EQ7 A;  3OOA A;  1JW4 A;  2F35 A;  3AXF A;  2PT1 A;  4H8I A;  4OET A;  1SBP A;  4ZE8 A;  1MPC A;  3TQW A;  3IOU A;  1KZ8 A;  3LUZ A;  2XWI A;  4I3Y A;  5CMC A;  1FPI A;  2OK2 A;  1FPF A;  5ICT A;  4R2B A;  3TFL A;  2GFE A;  4JWO A;  1B0H A;  1GTK A;  1H3D A;  3QAX A;  3CSG A;  1B9J A;  2WBD A;  3HO7 A;  3UN6 A;  3LR1 A;  3DEL B;  1MPB A;  1KA1 A;  3EHU A;  1XVY A;  2DE3 A;  3PV0 E;  2HXR A;  3PGF A;  3FV2 A;  1G0H A;  3CVG A;  4Z7E A;  4NG7 A;  1Y4T A;  4F2Q A;  1VE4 A;  3CRB A;  2XX9 A;  3FAT A;  3GBA A;  5ELV A;  2H98 A;  4JWY A;  5I5P A;  3ISP A;  1IIT A;  2XX8 A;  1GV8 A;  5B70 A;  4PAF A;  2DSF A;  5H8Q B;  1LBX A;  3E4R A;  4LON B;  3V89 B;  4FEB A;  4MLV A;  3PUZ E;  4BDO A;  1S7Y A;  2WBB A;  2XXW A;  3FVN A;  1B40 A;  4JB7 A;  3I5O A;  1JEV A;  3W15 C;  1MY4 A;  4F22 A;  1IMF A;  1LAH E;  2XX7 A;  4C0R A;  1JNF A;  3VVE A;  4GBV A;  5JTY B;  3T9X B;  4O3A A;  3PUV E;  4PDH A;  5EQ9 A;  2P2A A;  3EQ1 A;  2Y7I A;  4U23 A;  1R1N A;  3BKI B;  4ZDM A;  2HAV A;  2D3I A;  4XIG Q;  3H6W A;  2Z8D A;  2ONR A;  3H03 A;  3CFZ A;  1MS7 A;  2F34 A;  5DW8 A;  2G93 A;  5DVI A;  5TP9 B;  4OEV A;  3HN0 A;  1FJ6 A;  5IZ3 B;  3RT6 B;  4DCY A;  2RKM A;  2X7P A;  2R6G E;  4P0G A;  3V5A A;  4NF6 A;  4NF5 B;  1FTO A;  2UVJ A;  1NFT A;  4OMB A;  2D21 A;  5I57 B;  5EHS A;  4GWU A;  2OWZ A;  1A54 A;  1ZBM A;  4GFR A;  5I3S A;  1US5 A;  3PUW E;  2F5X A;  4P1E A;  1II5 A;  1TFD A;  1VFD A;  4MJO A;  1FPD A;  2F6P A;  3TEP A;  5I2K B;  2FYI A;  3SES A;  4OTE A;  4BDQ A;  4KCD A;  4O3C A;  1EH3 A;  4PQJ A;  4H5G A;  3TKD A;  3D4C A;  5AA3 A;  2GH9 A;  3RT8 A;  1T0K A;  3OO6 A;  1MPD A;  2Q2C A;  2B4L A;  2PCR A;  3ODB A;  4O8M A;  2ALU A;  1Y1Z A;  3IOW A;  2E1S A;  2XWV A;  4ZEB A;  4QSD A;  4EF1 A;  1SYI A;  5HM4 B;  2Y7P A;  4M1V A;  4YIC A;  2QJE A;  2V84 A;  1FBE A;  1M5C A;  1A8F A;  3MP1 A;  4PFU A;  2ONK E;  1K9Y A;  1N7W A;  1Z7N E;  2I4C A;  4RJZ A;  1SQY A;  1P1U A;  1M5B A;  1QW0 A;  3TEL A;  3MAM A;  4OFO A;  1FQB A;  4XKP A;  2AL4 A;  3KJT A;  4R9F A;  3IFA A;  3VE1 B;  4EUO A;  2REJ A;  2R9J A;  4OVR A;  2ZYN A;  2QL3 A;  3IR1 A;  1NV5 A;  4PFR A;  4HW8 A;  3K02 A;  3HCQ A;  4PBQ A;  2WX9 A;  4N8Y A;  1FQF A;  2RC7 A;  1DPP A;  5A5X B;  4MMP A;  5H8Q A;  4K3F A;  2F7C A;  3A29 A;  3ONM A;  2I3V A;  3I3V A;  3KEI A;  1PB9 A;  1D9Y A;  4GVO A;  2VGQ A;  2QS2 A;  3K0V A;  3RTF B;  2PVU A;  2R71 A;  1MM6 A;  5ET5 A;  3ILU B;  2H4I A;  3C34 A;  2VD2 A;  2XXI A;  5H8S A;  1KA0 A;  4N13 A;  4NGU A;  5JTY A;  2QMW A;  4NF8 A;  4F1V A;  3MP8 A;  3IB0 A;  4GWO A;  1JP4 A;  4PFI A;  5I2N A;  1B5H A;  1N04 A;  3U92 A;  4IB2 A;  3B6Q A;  3LSW A;  5FHO A;  2CEY A;  1NV1 A;  3KN7 A;  1YZ0 A;  2CZI A;  1I6B A;  1VFE A;  4ONY A;  1HSJ A;  4JBZ A;  5DVF A;  1B7H A;  1ZLQ A;  3FVG A;  3T9U A;  1JQF A;  1LBY A;  3IO6 A;  4G68 C;  3HV1 A;  3PUX E;  1G0I A;  1XI6 A;  5H8F B;  1FBH A;  1MQG A;  4AS4 A;  3KFM A;  2O51 A;  4AB5 A;  4RY1 A;  1LFH A;  2H5Y A;  4HCY A;  4Q8R A;  2H9B A;  3MYU A;  1DSN A;  1YYZ A;  1FRP A;  3OEN A;  5KDT A;  2DWH A;  4ZED A;  4ZEC A;  1LFG A;  1NV2 A;  4P0I A;  1P1N A;  4UAC A;  5FTI A;  4ND9 A;  4KQP A;  2I6E A;  1PDA A;  1FPK A;  4N6K A;  4MIJ A;  2KLF A;  4MLQ A;  3PUY E;  3QK6 A;  3M8U A;  2PYY A;  3QUJ A;  4IGT A;  3JYR A;  2FA7 A;  2V25 A;  4OHN A;  4OXV A;  4WEP A;  3P7I A;  5KDT B;  4DIG A;  3JZJ A;  4R73 A;  2PMS A;  4NHB A;  3E13 X;  4BDL A;  4HXV A;  4DLD A;  4DCX A;  1NUX A;  2QVV A;  3O2A A;  2GRV A;  2A5T B;  4YB6 A;  4OFL A;  5AA2 B;  1H76 A;  1RDY A;  1MRP A;  2W7Y A;  1B3L A;  1AIV A;  2HHM A;  3RYD A;  1BK4 A;  4IO4 A;  4N15 A;  2IEE A;  1CNQ A;  1NNT A;  5L9O A;  4YZZ A;  3MPK A;  3PPO A;  4I9D A;  1SI1 A;  5TPA B;  4I62 A;  1FBD A;  1FQE A;  5AA1 A;  2Q8M A;  2OJT A;  1B3G A;  3H3G A;  5EYF A;  2ZNS A;  2DS9 A;  1A8E A;  1Q9D A;  3WAF A;  2OBG A;  5BWJ A;  4N6P A;  3VXC A;  4YMB A;  4H45 A;  2HZL A;  3C9H A;  1MQJ A;  5I57 A;  2DWJ A; 
#chains in the Genus database with same CATH homology
 1LBV A;  1FBP A;  2HPG A;  4HCY A;  1SPI A;  2DE2 A;  5I7I A;  5DW8 A;  1IMC A;  4FBP A;  1RDX A;  4X04 A;  1FBF A;  4I3E A;  2FIX A;  4OVR A;  3MYU A;  4AS5 A;  1YYZ A;  1FRP A;  1YXI A;  4GX4 A;  4NAP A;  2WBD A;  3B50 A;  1NV5 A;  2Q74 A;  4HCW A;  4QXD A;  1NV3 A;  2CZK A;  4JVD A;  1FJ6 A;  2XWK A;  4N17 A;  5IZ3 B;  4PFR A;  3W9V A;  2QPQ A;  4NF0 A;  4GWS A;  1KA1 A;  4XF5 A;  4MNP A;  2WX9 A;  2DE3 A;  4NN3 A;  1NV2 A;  1NUW A;  2HXR A;  3LV0 A;  4PBQ A;  2OX3 A;  4DI4 B;  4MCO A;  4N8Y A;  5EQ8 A;  2PFY A;  2VPN A;  4P3L A;  4PCD A;  5EYH A;  1G0H A;  4GX3 A;  4UAB A;  1NV4 A;  4PFB A;  4NQ8 A;  4MMP A;  5IM2 A;  2JJK A;  1FPK A;  1NUY A;  3IFC A;  5EYG A;  4N6K A;  3PTY A;  1FPG A;  2F3B A;  4MEV A;  4MAG A;  1DBZ A;  4OVQ A;  4NG7 A;  4GX6 A;  4P47 A;  1RDZ A;  3HFU A;  3NOH A;  3QMF A;  4GWU A;  2OWZ A;  4MIJ A;  2PFZ A;  4PET A;  1FPL A;  5I3S A;  5LDZ A;  1IMA A;  1IMB A;  3A29 A;  2ZZW A;  3CHG A;  5T3J A;  2F5X A;  4P1E A;  4PDD A;  3EKI A;  2CEX A;  4HE1 A;  1LBZ A;  4MJO A;  1FPD A;  4PAK A;  3FXB A;  2L5V A;  4GWZ A;  3KBZ A;  3KC0 A;  4N8G A;  4OAN A;  4OVS A;  4XFE A;  3RPL B;  4LN5 A;  4P1L A;  2KQZ A;  1FPJ A;  5IZ1 A;  3FBP A;  1VDW A;  5I5P A;  3ISP A;  4O7I A;  5ET5 A;  4HE2 A;  1DCU A;  4QBA A;  5LTC A;  2FBP A;  2R8T A;  2Y5L A;  2QVU A;  4NHB A;  4N81 A;  4PAF A;  3GYY A;  4I40 A;  5FBP A;  1FPB A;  5IGA A;  1LBW A;  1EYK A;  4PGP A;  1NV7 A;  2ZZV A;  4HXV A;  4MHF A;  4P8B A;  4P9K A;  2V3Q A;  1LBX A;  5CM6 A;  5IZZ A;  4HE0 A;  4N4U A;  1NUX A;  1NUZ A;  2ZZX A;  2QVV A;  2VT5 A;  4O94 A;  2B4L A;  2PCR A;  1KA0 A;  1LEV A;  1D9Q A;  2P3N A;  2CZH A;  4GWX A;  4NGU A;  2WBB A;  1QGX A;  2VPO A;  3ROJ A;  3T0J A;  4PF6 A;  4DI3 D;  4F1U A;  4F1V A;  2FIE A;  4O8M A;  4OVP A;  3E79 A;  5EQA A;  3BIH A;  3T1B A;  3MST A;  3W9W A;  1RDY A;  2V4C A;  2BJI A;  2XWO A;  1DK4 A;  2Q9T A;  2XWV A;  1NV6 A;  2HHM A;  1IMF A;  3RYD A;  5JK4 A;  1BK4 A;  2MKZ A;  4GWW A;  4N91 A;  4N15 A;  1JP4 A;  4PTK A;  3RPL A;  1FPE A;  1NI9 A;  4OVT A;  5J16 A;  4IR8 A;  1CNQ A;  1INP A;  4PFI A;  1NV0 A;  1FBC A;  2Y5K A;  3KC1 A;  4M1V A;  4PBH A;  4YIC A;  4YZZ A;  4JVI A;  4X9T A;  4F19 A;  1FBE A;  1FBD A;  4O7M A;  5ET7 A;  4H46 A;  4P56 A;  2FVZ A;  5EQ7 A;  1EYI A;  2DE4 A;  3BIG A;  4JVC A;  4KXP A;  4X8R A;  2Q8M A;  2CEY A;  1NV1 A;  5ESY A;  4MNC A;  1IMD A;  1YZ0 A;  4GBV A;  2CZI A;  5J1D A;  4PGN A;  3B8B A;  2WEF A;  1KZ8 A;  2HZK A;  2XXK A;  3SZP A;  1K9Y A;  3D1R A;  5ET8 A;  3LUZ A;  2XWI A;  4I3Y A;  1Q9D A;  4GWY A;  2P3V A;  4MX6 A;  4OA4 A;  4PF8 A;  2F3D A;  4N6D A;  1FTA A;  1FSA A;  4PAI A;  2XA5 A;  2FHY A;  4PE3 A;  2GQ1 A;  1LBY A;  2QVR A;  1FPI A;  2WYP A;  4MNI A;  2WYK A;  5A5L A;  4PDH A;  5EQ9 A;  1EYJ A;  2B4M A;  4XEQ A;  4NX1 A;  1FBG A;  4H45 A;  4GBW A;  5ET6 A;  1K9Z A;  1G0I A;  1XI6 A;  1FBH A;  1IME A;  5F24 A;  5IZ3 A;  1AWB A;  4AS4 A;  2HZL A;  3U65 A;  2DVZ A;  3E78 A;  1FPF A;  4F18 A;  2KR0 A;  3IFA A;  4G61 A;  4PC9 A;  2DDK A;  2QFL A;  1FJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...