2HPGA

The crystal structure of a thermophilic trap periplasmic binding protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
318
Chain Sequence
VFGAKYTLRFGHVLAPGEPYHQAFLKWAKAVEEKTNGDVRIEVFPSSQLGVEEDIIEQIRMGAPVGWNTDSARLGMYVKDIGVMNLAYFIDFMGAKTPEEAIEVLKKIKQSPTMQKWLKELEQRFGIKVLSFYWVQGYRHFVTNKPIRKPEDLNGLRIRTPGAPAWQESIRSLGAIPVAVNFGEIYTAVQTRAVDGAELTYANVYNGGLYEVLKYMSETGHFLLINFEIVSADWFNSLPKEYQKIIEEEMDKAGIEVSLKIMKELEEEYKQKCIEKGMAVIPASEIDKEAFMEKAKQAYKNLGLENALNQLIKEVKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords ABC transporter, periplasmic substrate-binding protein
publication title Structural analysis of a periplasmic binding protein in the tripartite ATP-independent transporter family reveals a tetrameric assembly that may have a role in ligand transport.
pubmed doi rcsb
source organism Thermotoga maritima
total genus 112
structure length 318
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hpgA00
4PBQA 4NN3A 4PF8A 2XA5A 4NX1A 2WYPA 2ZZVA 4OVPA 4PDDA 5I7IA 4OANA 4OVTA 5IZZA 4PE3A 5CM6A 4UABA 5IM2A 4N6KA 4MAGA 4MCOA 4OVRA 4NHBA 2PFYA 4PAFA 3GYYA 4P8BA 2V4CA 4P47A 4PBHA 4DI3D 4O8MA 4PCDA 4PGNA 4DI4B 4O7MA 4P9KA 4N6DA 4XF5A 4PC9A 4MNCA 3FXBA 4PF6A 4YICA 2XWVA 4PFBA 3B50A 2WX9A 4XFEA 4PETA 4X8RA 3U65A 2CEXA 4OA4A 4NF0A 4PAKA 4OVQA 4PFRA 4NGUA 2XWOA 4O94A 4XEQA 4N17A 2XWKA 4N15A 4MNPA 4NG7A 4MHFA 4N8YA 4MEVA 4P56A 4N8GA 4MX6A 4YZZA 5LTCA 4N4UA 2CEYA 4MNIA 4N91A 4P3LA 4P1LA 4PDHA 2HZKA 4NQ8A 2XXKA 4PGPA 5IGAA 2VPOA 2ZZXA 4NAPA 4P1EA 4X04A 2XWIA 2PFZA 2VPNA 4MIJA 4PFIA 4OVSA 5I5PA 2HZLA 2WYKA 2ZZWA 2HPGA 4LN5A 4MMPA 4PAIA
chains in the Genus database with same CATH superfamily
3TMGA 3TTNA 4NN3A 1FPLA 2XXPA 4PF8A 4KYDA 4NX1A 4ONYA 4PDDA 1O64A 2ZYNA 2Z23A 1B58A 1LEVA 2MKZA 1D9VA 5ICTA 3K2DA 3EF7A 3FBPA 4LONB 2OWTA 4YKJA 3H6WA 4MAGA 5ELVA 3TFLA 4P8BA 1Y9UA 1D9QA 3CHGA 3MVZA 5DT6A 1Y4TA 5IZ3B 1J1NA 1DPEA 1VFEA 2M8CA 1SYIA 3P7IA 3OSQA 4F1UA 2FNCA 2X26A 4O3BA 1OMPA 3R6UA 3EHSA 4QFPA 1QUIA 3Q28A 2CZKA 4GX6A 2VGQA 4YKPA 2R71A 2Z22A 3HSTA 4PQJA 4DLDA 4FEBA 5KZTA 1MY3A 4F1VA 1B3HA 4F1YA 2QVRA 2XWKA 2RCBA 3FXUA 3IR1A 4OERA 4TQUQ 2ZYMA 3KN3A 4R6KA 2CEYA 3H06B 1MXUA 4AS5A 2UXAA 1N04A 4NQ8A 1MXWA 2O1LA 5IGAA 1B0HA 1K9ZA 4DCYA 4R9FA 1OLCA 4EUOA 3HHGA 3L6GA 1QKBA 5H8HB 4XKRA 3R26A 4FAJA 3LSWA 4M1VA 3AXFA 1IMCA 3JV9A 5AA2B 3SEWA 1YZ0A 2GQ1A 1LFHA 1YAEA 1MDP1 2XXQA 4HXVA 5IM2A 3KC1A 1MPCA 3RT8A 2QVVA 3GYYA 4X9TA 3EHTA 3K1PA 1DPPA 3HPIA 1FPIA 4PCDA 1BK4A 1OVTA 4XKPA 3RPLA 1D9YA 3PMXA 4M4GA 4KR5A 2XWVA 3K00A 1IMFA 4POWA 1HSJA 5H8QB 1MQDA 3KC0A 1IXIA 4NF0A 3N26A 4IO4A 1B2HA 1MS7A 1R1NA 2Z8EA 4ESXA 1B4ZA 1ZKBA 3FVKA 2B3BA 1UQWA 3I3VA 3JZJA 1IMDA 2I4BA 3M3KA 5I58B 5ICQA 2VOZA 2QS3A 3GXAA 4BDQA 4AS4A 1IZ1A 3KSJA 4N07A 1IEJA 4R72A 1B0LA 3FV2A 1ZBMA 2UVIA 2XXVA 4R2FA 1MY2A 3U8QA 3K6VA 1FPJA 2B65A 1FPKA 3LSFB 2Q9TA 3MP1A 1NI9A 1A8FA 5ITPA 3CG3A 1N3XA 4RPNA 4NF8B 1VSOA 2H4IA 1NUWA 2F34A 3TELA 1I6AA 1FTAA 1FJ9A 4JVCA 4LA9A 4JWXA 4ZZAA 4JVDA 1XVXA 1MXVA 3QK6A 4N6PA 1B5IA 2OK2A 4OHNA 4P0GA 5I3SA 3S9EA 2AIXA 3G3IA 4GD5A 2HEUA 4G4PA 4EQBA 3C32A 3FXBA 1FTOA 1YPNA 5AA3A 3EN3A 1KWHA 2F7BA 4LVQA 1MQIA 3ZKLA 1DBZA 4GF8A 4IO6A 5KCJA 4C1TA 3DM0A 1Q35A 5B70A 5DVFA 2D3IA 3G3GA 4PFYA 1O63A 3TTKA 1KA1A 3PPPA 2IEEA 3UORA 1ZLQA 1JEUA 1MM6A 4I8CA 4YKKA 3WAFA 1SI1A 2I58A 3K4UA 3MP6A 2ESNA 1IQ7A 1YYZA 2DWAA 3LC8A 5ISUA 1Y4CA 4MLQA 3MW0A 2F8DA 5CI5A 2GHBA 3CFLA 4NAPA 4LUBA 1B7ZA 3IB1A 3RGYA 3TCHA 3ILTB 3CRBA 5TPAB 3WAEA 4GBVA 2CZIA 1MG1A 4PBQA 4ZE8A 1FBCA 1TFAA 3Q27A 5DEXB 3MQ9A 2O7UA 1DOTA 2XX7A 3T9XB 3ZS6A 4QBAA 4DXUA 3MPKA 3RY3A 3G3JA 1A7LA 3B7DA 3SEVA 4OWDA 1B3EA 1QKAA 5DTBA 2Y5LA 4YB5A 5IZ1A 4NMYA 4X48A 4U22A 1D3KA 1M5FA 3LV0A 1POY1 1VE4A 3W9VA 1B4HA 4I3EA 3VDFA 4R75A 1ZTYA 3FV1A 1EYIA 4XKNA 5FBPA 1Y1ZA 4O94A 4F22A 4XEQA 3DP4A 3PPNA 1LAXA 4JWYA 4KI0E 2P0SA 2NWJA 4ZE9A 1A8EA 1XOCA 4R74A 1MY0A 1LBBA 1PB9A 5AA4A 3E4RA 5I2KB 1URSA 5HPQA 1WODA 1SBPA 2Q2CA 2QS2A 1JP4A 1LCFA 2ZZXA 3V5AA 4MIJA 5JTYB 1G0IA 4HTGA 3TTRA 1FSAA 2REGA 5I59B 2QFLA 4I9DA 5I2NB 2GFEA 1B3LA 1FW0A 4OVPA 1DSNA 1TWYA 2B4MA 3IORA 3O6IA 1FBEA 1CB6A 3DLNA 5IZZA 5EYFA 4UABA 5CRYA 1RDZA 2P3NA 3GBAA 2DVCA 2OBGA 2ONKE 1I69A 3PMVA 4GBWA 1Y3PA 4MCOA 4EQ9A 5EYGA 2JJKA 2OX3A 1JETA 4XKQA 4R9GA 2Q8MA 2DDKA 3H4ZA 1DK4A 4DI4B 2PX1A 2O6AA 4KFQA 3F11A 4XF5A 3T93B 4GXSB 4PC9A 1OVBA 5DW8A 3U72A 3H6TA 3D4GA 4O3AA 3ECRA 1LLSA 3O6HA 1B32A 3QYTA 4FATA 2G29A 2Z8DA 3SKPA 3L6HA 3UIFA 1LBCA 4G8NA 3FIRA 3DELB 1G0HA 3H3GA 4DE8A 2XD2A 4OMBA 1PB8A 1NV5A 1LB8A 2I4CA 2Z8FA 5DYHA 4NF4A 2DE2A 3C9HA 2HXWA 1LCTA 2HZKA 4PGPA 5I84A 1FTKA 4YMBA 1YXIA 2X7QA 3TCGA 3CSGA 3KSXA 1NH7A 2XWIA 3K01A 3MUQA 3B6TA 5I5PA 3LBSA 1PBPA 1B5JA 2ZZWA 4MMPA 3KJ7A 1BTJA 3JYRA 1K9YA 4RYAA 1GV8A 2RC7A 4PAIA 4F29A 2XA5A 2YPNA 1SYHA 4OFOA 3QUFA 4RK2A 2ZZVA 5TP9B 2VP1A 3T0JA 3LSXA 4IO7A 3FGSA 1NUZA 3SEXA 2Y7IA 3PUYE 4OESA 4LZ8A 1T0KA 4QRZA 1FTJA 2F7AA 4JDFA 5HBCA 4ELOA 1FBHA 4PFUA 3THIA 3S2VA 2YLNA 4UACA 2ABHA 1PDAA 1B7UA 2HAUA 1XT8A 1N7WA 4PP0A 3NOHA 4F19A 1TT1A 4ZEFA 4F3PA 1UTHB 4LATA 4YICA 2V3TA 3BBRA 4HW8A 4IO5A 1IITA 1LFGA 3KG2A 4QFOA 4OVQA 1S9TA 4H5GA 1QJMA 2F36A 2L5VA 2CMOA 5KDTA 1LBYA 1UIVA 3TCFA 4QF9A 1SVXB 4YZZA 1II5A 4RY1A 1LSTA 4H8IA 4P11A 1MPBA 3PD9A 2O1MA 4KYEA 4EXLA 5TPAA 4WEDA 1BLFA 1UTBB 2DE3A 4OETA 2P1SA 4GWUA 1M5BA 3FUZA 4F3GA 1FPBA 2H9BA 3KN8A 3K0VA 2OWZA 4WXJA 2Q2AA 2A5TA 2F35A 3KZGA 4ZEIA 1Q9DA 1NKXA 3A09A 1QUJA 1Y20A 4NF5A 5H8FA 1R9LA 2FBPA 4Q5TA 3MSTA 1RYOA 2DE4A 3KFMA 3MZ9A 2DS9A 5EQAA 4RPOA 4GFRA 4QFLA 3UP9A 1MXXA 1MQJA 2Y7PA 4NHBA 4GWSA 1SPIA 3RLFE 1SW2A 5A5XB 3SEUA 3RT6B 2O7IA 1JVYA 4PGNA 4I3YA 4YB6A 4O7MA 4P9KA 3FVGA 5F7VA 3PGFA 4ECFA 1M5CA 3IFAA 4N81A 3RUMA 4PE5B 3OO9A 1JW4A 3TQLA 2HXRA 3O97A 4PETA 2G93A 3HHFA 4JSOA 5JK4A 1FBDA 4LP2B 5I57A 1S7YA 1Y3NA 1US5A 2O84X 2Y7RA 3B6WA 5CMKA 4MNPA 2KR0A 1I6BA 1IXCA 4N8GA 3M3LA 3CG1A 2GHAA 1PB7A 2OJTA 2Q8JA 1H43A 1URGA 2HAVA 4NE4A 2AYSA 3IJXB 1MH4A 3TDJA 1NNFA 3PMWA 4OVSA 4GX4A 1FPFA 1P1QA 1NMUA 4G68C 3C36A 4KCDA 1LAFE 1CNQA 3O66A 3KGCA 4LN5A 3OD7A 1FBGA 3FD3A 3U92A 2RKMA 3PPRA 3OO8A 2PT1A 2OCUA 4QSDA 4U2RA 3BIHA 3TKDA 3W15C 5CBSA 1IMEA 1N7XA 5EHMA 4U1OA 3CR9A 4AB6A 3CIJA 4G68A 1BIYA 4IR8A 4GWWA 1MXZA 5AA1A 2I3WA 3LUZA 2P3VA 4OEUA 4NF6A 4OFLA 1ELJA 1FJ6A 2XD3A 4EQ7A 2B4LA 1EZ9A 2ZNSA 2A5SA 1JQFA 3IK6B 3UA8A 4H1XA 4K3FA 5H8NB 3QUJA 3K6WA 3E13X 3IX1A 3Q25A 4GLIA 4H46A 1EYKA 5I56B 3G3HA 4ZZEA 4GWZA 3RPWA 3H03A 4U21A 1MXYA 2UVJA 1FTMA 3CFXA 3PD8A 2FIEA 2X7PA 1IMBA 2R8TA 1B6HA 4GL8A 4FIMA 3PV0E 2ZYOA 1SW4A 3MZ1A 2UYFA 1GTKA 5EQ9A 4EF2A 4TLMB 3U94A 5EQ8A 2RC9A 4R6YA 3ILUB 3VVEA 3Q29A 1EH3A 1IIWA 3IOTA 2PT2A 3U1OA 1B1XA 3OEMA 3RNNA 2FIXA 2QRYA 4DDDA 2AL4A 2Y7KA 1JW5A 3MAMA 5CM6A 4F2QA 4BLAA 4Q8RA 2NOOA 5J1DA 4JXIA 2ANJA 4KCCA 3V8XB 3IAZA 3QSLA 3RQTA 4NWDA 1B05A 4OEVA 3BFUA 1LBVA 1NFTA 1PEBA 1RDYA 4JSDA 5CMBA 5EHSA 1XI6A 1JVXA 5IZ3A 3EPEA 5EYHA 1Y1MA 4IY5A 2KQZA 2QSXA 3B50A 4YMAA 1N0TA 2I0CA 4XFEA 1IXHA 4PAKA 1B5HA 3B6QA 3CVGA 4Q30B 2DP8A 2UVGA 4IO3A 1MH3A 2R9JA 4MBPA 1QW0A 5AE4A 2WBBA 4R73A 2BJJX 4OQOA 4EF1A 4DZ1A 3G7WA 4OTEA 3IOWA 1NNKA 5LOMA 4FJPA 3ONMA 1BP5A 1TXFA 3Q26A 4P1EA 3E78A 3FXRA 1FTLA 2PFZA 1USYH 3OO6A 1XVYA 1AIVA 1LFIA 3OELA 3IO4A 3FATA 2HHMA 4YU0A 1M5EA 1US4A 4RNSA 2I6EA 3K6UA 2ALUA 3PUVE 5H8HA 1Z7NE 4F3BA 1DCUA 2H98A 5A5XA 3V83A 1B3GA 1NH8A 1RKMA 1MPDA 3LUYA 5AA2A 1B7HA 3T9HB 4N6KA 4FEDA 1MQGA 4E0WA 1MRPA 3TTLA 3IOUA 1RYXA 2V4CA 4F39A 3DP6A 2DWHA 4O8MA 3MYUA 3RPLB 1XS5A 4QSEA 4DIGA 2I48A 1VFDA 4GOTA 3B8BA 1FQDA 2UYEA 1FQAA 3FJGA 3MVXA 2P2AA 4QFKA 5ET5A 4DCXA 4FBPA 5F24A 2QS1A 5FHMA 1B51A 2FA7A 3QXMA 4H8JA 1JW1A 4DXCA 4QFNA 5H8QA 3MPLA 1SW1A 3BKIB 3ZSFA 5CC2A 4R6HA 2F6PA 1N3WA 4I1DA 4JVIA 4KYSA 1IMAA 4JBZA 3GBBA 2Q89A 3ROJA 2V84A 1AWBA 4MEVA 1AL3A 4MX6A 5I58A 1URDA 1EZPA 2HQ0A 4MFIA 4GXAA 1A99A 1B3FA 2XXXA 4GIZA 1YCJA 1KA0A 3TYHA 2I3VA 5H8SA 4Q0CA 2DSFA 2WEFA 4MF3A 1SI0A 2DQVA 3E3KA 4U4SA 4F2OA 1KZ8A 4ZDMA 4ZEDA 1OQGA 3EQ1A 2XXHA 1L5TA 4H6DA 2B3FA 4MH5A 2BJIA 3ISPA 3M8UA 1P1UA 4XTCQ 5ET8A 4BDOA 5I7IA 4PTKA 4NF8A 1P1WA 3V89B 4IO2A 1LBZA 1FRPA 5M2VA 4H0WA 1O7TA 2DWIA 4PBHA 2PMSA 4QXDA 1PC3A 1ANFA 3VLWA 4XXUA 1H76A 4N6DA 4XIGQ 2Y84A 3TPAA 4RK9A 5FHNA 4X1BA 1FCKA 3EKIA 5ET7A 3O29A 5BWJA 2HFBA 2F6GA 4U1ZA 5KCJB 3I6VA 2R6GE 3U65A 1SDXA 4P0IA 2REJA 4BDNA 5B7DA 3CSBA 3UGWA 4NGUA 3IL1B 4BDRA 2XXUA 3A3CA 1ZMGA 4N17A 4N15A 3FVOA 2Q74A 4HCWA 3PUWE 4NG7A 4Z7EA 4JB7A 1POTA 4P56A 2ZYKA 1MY1A 4P1LA 5F1QA 4ZEBA 1FBFA 3MVYA 2QL3A 2DXYA 1SD3A 3OSRA 2XXKA 3QIMA 1ZU0A 5IKBA 1A40A 2QMXA 4GVOA 3M3FA 3USDA 3KBRA 1MDQA 3TTMA 3TAJA 4F31B 3RTFB 2F3BA 1NV0A 2HZLA 2WYKA 2KLFA 1HSEA 2HPGA 1EU8A 4QSCA 3SETA 2XXIA 1VDWA 5ET6A 1FBPA 4ELRA 4PE3A 4G61A 1S50A 3N6UA 5DEXA 4IGRA 2PFYA 1RDXA 4YKIA 4P47A 4JWOA 3OXNA 3VE1B 4DI3D 4ESWA 1NUXA 4OVJA 2VD3A 3OEKA 1D4NA 3I5OA 5L9SA 4MNCA 3C35A 1XHYA 1R9QA 1B52A 2WKYA 3H6UA 3BIGA 4PFRA 2XWOA 5A5LA 3O9PA 1NNTA 3PUZE 4N13A 2LAOA 1NV4A 3O6GA 5AA4B 1LAGE 5TU0A 4ISUA 3SESA 3TZAA 4E0XA 3FZVA 4ZEKA 3SEYA 1P99A 1NV6A 2IA4A 3PU5A 2F7CA 1LGBC 5J16A 4OXVA 5L9MA 2VPOA 4KXPA 5ESYA 1AOVA 5I2KA 3U93A 5JEIA 3T96B 3N6TA 2VPNA 4TOZA 1OLAA 1IUDA 3UK4A 1Y3QA 5FTHA 3MWBA 4H67A 1LB9A 1N76A 5JTYA 4FECA 2RF1A 3A3UA 3KBZA 3K1NA 4F18A 3HCQA 2UVHA 1LBWA 4UA8A 3IJOB 3DP8A 5I59A 3TEPA 4WEPA 4OVTA 3VVDA 5I2NA 3IO6A 4BDMA 3TUSA 1N84A 4AB5A 4U23A 3KOSA 2ZNUA 1Q1KA 4G8MA 3VXBA 4PAFA 4GQOA 4THIA 3VVFA 2PYYA 2F78A 3UN6A 1WDNA 5ITOA 3TODA 3EHUA 2F5XA 2D21A 1F9BA 4MJOA 2DWJA 3SERA 1NV3A 2ZMBA 2OLBA 2QVUA 3IB0A 5CMCA 3VXCA 1TFDA 2DVZA 4ELPA 4X1DA 5BUUA 2D5WA 3SZPA 3G3KA 2FYIA 3C33A 1GVCA 2XXTA 1AMFA 5HM4B 5EQ7A 5DVJA 2QPQA 1DTGA 2ONSA 4NF4B 1QUKA 4MHFA 1I6QA 2DXRA 4OYVA 3G3FA 2ZXTA 3TQWA 1ZJLA 2XXRA 2E1SA 1A54A 3MBPA 1MM7A 2NVUB 1OQHA 3S9LC 4H5FA 4G2ZA 4R2BA 3K6XA 4GRKA 2XXYA 2VHAA 4I40A 2V93A 4C1UA 4PFTA 2XX8A 4IB2A 2VT5A 3VFJA 2V3UA 1QVSA 5IAIA 2OWSA 4H45A 1AH5A 5TP9A 3VV5A 1NV2A 4ELQA 3H7MA 4EDPA 2F3DA 2E0SA 1NV1A 4RXLA 2QMWA 3MZBA 2H99A 4GL0A 2O69A 3RYDA 3KN7A 4KQPA 4IGTA 2WX9A 4X8RA 2YJPA 4OA4A 1UTHA 2Y7WA 3T22A 4OENA 1OIBA 2GH9A 5KDTB 2V25A 3OO7A 1FQFA 2F97A 2HCAA 3IFCA 3C31A 2Q88A 5K2YA 5T3JA 1MY4A 4N8YA 2THIA 5LTCA 1USYE 2PVUA 4MNIA 4P3LA 4POXA 3MC2A 2FHYA 1NUYA 1B1HA 2GRVA 4RJZA 1NL5A 4HE2A 3C34A 2RC8A 4GWYA 3ODBA 4GWXA 2A5TB 4HE1A 1UTBA 1QULA 4TLLB 4HS7A 3SDFA 1YTVA 3S9MC 2NXOA 1FPEA 4FE8A 3LR1A 4NF5B 3MVWA 4KPTA 1B9JA 5H8FB 2QJEA 4HE0A 3T66A 1INPA 1CE2A 3R7XA 4YAHX 3C4MA 4G77A 1NNPA 1MQHA 4OVRA 5CBRA 2FVZA 3FJMA 3BFTA 3FXQA 3FASA 1R6ZA 3RN8A 4H65A 2XXWA 3S9NC 3PTYA 1FPGA 4ND9A 4KHZE 3VLVA 1PBQA 3PUXE 4L17A 1WVJA 3A29A 2I0BA 5LDZA 1FPDA 4WKMA 1HSLA 2CEXA 4IY6A 5I57B 4OZ9A 3D4CA 4NWCA 2PBWA 4NEDA 3FJ7A 1DTZA 3MJNA 1GR2A 1UIUA 3O2AA 4FORA 4C0RA 1ATGA 5L8DA 4DXBA 2W7YA 5FHOA 4G8HA 3OMBA 1DMBA 4MLVA 4N4UA 3HFUA 3QAXA 2RINA 3PPQA 4Z0IA 2XX9A 3IB2A 4LZ5A 1Z7ME 3CI8A 5K2XA 3W9WA 1IXGA 1VR5A 4F3SA 1EZOA 3KJTA 4BDLA 3HN0A 1EYJA 3S4UA 2AL5A 2V3QA 1LBXA 2WYPA 5CMMA 1SQYA 5L9OA 2OZZA 2O51A 4OANA 2CZLA 1NV7A 3K1MA 4QHQA 4G68B 3HO7A 1H44A 4PFWA 3HV1A 1H3DA 3PPOA 2WBDA 5FTIA 3ZKKA 2H25A 4I62A 2NUVA 1P1NA 3K02A 4NF6B 1SW5A 4HCYA 3VLUA 3O28A 3T9VA 5AA2D 4NTLA 3E9XA 1XC1A 3N94A 4GX3A 4O3CA 3KOTA 3T1BA 2O68A 3E79A 1A55A 1GGGA 3MP8A 3FVNA 4GWOA 2Y5KA 4PF6A 3GLBA 1LAHE 4EXKA 4PFBA 1BKAA 1FQEA 3KEIA 3OENA 4LZ7A 3D1RA 2I49A 2ONRA 1B46A 3IOVA 3LSLA 2QS4A 5H8NA 1P1OA 2DOJA 2DYXA 1FQCA 3H6VA 3OOAA 4KD5A 1QGXA 1M5DA 1FQBA 2VD2A 1JEVA 5I56A 3CFZA 4AQ4A 3N5LA 2RCAA 4RA1A 4O7IA 2H5YA 3RTWB 4YB7A 1JNFA 1B40A 4N91A 5DVIA 4PDHA 3T9UA 3QMFA 4LQ5A 4OFJA 4U4XA 2PCRA 4ZECA 4X04A 4LQ2A 2CZHA 4ZS9A 2ZNTA 4PFIA 1H45A 2XHDA 1ZIUA 3GZGA
chains in the Genus database with same CATH topology
2FIXA 4NN3A 1FPLA 4PF8A 3KBZA 4NX1A 4PDDA 4OVPA 4F18A 1LBWA 1LEVA 2B4MA 2MKZA 4OVTA 1FBEA 5IZZA 5CM6A 4UABA 1RDZA 2P3NA 3FBPA 5J1DA 4MAGA 4GBWA 4MCOA 5EYGA 2JJKA 4PAFA 4P8BA 2OX3A 1D9QA 3CHGA 2Q8MA 2DDKA 5IZ3B 1DK4A 4DI4B 2F5XA 1LBVA 1RDYA 4MJOA 1XI6A 4XF5A 1NV3A 4PC9A 4F1UA 5IZ3A 5EYHA 2QVUA 5DW8A 2DVZA 2KQZA 3B50A 4XFEA 2CZKA 4GX6A 4PAKA 3SZPA 1G0HA 4F1VA 2QVRA 2WBBA 2XWKA 5EQ7A 1NV5A 2QPQA 4MHFA 2CEYA 2DE2A 4AS5A 2HZKA 4NQ8A 4PGPA 5IGAA 1K9ZA 1YXIA 4P1EA 3E78A 2XWIA 2PFZA 5I5PA 2HHMA 4I40A 2ZZWA 4MMPA 1K9YA 4M1VA 4PAIA 1IMCA 2VT5A 2XA5A 1YZ0A 2ZZVA 1DCUA 2GQ1A 3T0JA 4H45A 1NUZA 4HXVA 5IM2A 3KC1A 4N6KA 2QVVA 1NV2A 3GYYA 1FBHA 2V4CA 4X9TA 4O8MA 3MYUA 2F3DA 4PCDA 1FPIA 3RPLB 1BK4A 1NV1A 3B8BA 3NOHA 4F19A 3RPLA 3RYDA 5ET5A 4YICA 2XWVA 4FBPA 1IMFA 2WX9A 5F24A 4X8RA 3KC0A 4OA4A 4NF0A 4OVQA 1IMDA 4JVIA 2L5VA 1IMAA 3IFCA 4AS4A 1LBYA 3ROJA 5T3JA 1AWBA 4N8YA 4MEVA 4MX6A 4YZZA 5LTCA 4MNIA 4P3LA 2FHYA 1NUYA 4HE2A 2DE3A 1KA0A 1FPJA 4GWYA 4GWUA 2WEFA 4GWXA 4HE1A 1FPBA 1FPKA 2Q9TA 2OWZA 1KZ8A 1NI9A 1FPEA 2BJIA 3ISPA 1Q9DA 5ET8A 4HE0A 5I7IA 1NUWA 1INPA 4PTKA 1FTAA 2FBPA 3MSTA 1LBZA 2DE4A 1FRPA 5EQAA 4OVRA 4NHBA 1FJ9A 2FVZA 4JVCA 4GWSA 1SPIA 4PBHA 4JVDA 4QXDA 4PGNA 4I3YA 4O7MA 4P9KA 4N6DA 5I3SA 3PTYA 1FPGA 3IFAA 4N81A 3FXBA 3EKIA 5ET7A 3A29A 2HXRA 5LDZA 1FPDA 4PETA 3U65A 2CEXA 5JK4A 1FBDA 4NGUA 1DBZA 4N17A 4N15A 4MNPA 2Q74A 4HCWA 4NG7A 2KR0A 4P56A 1KA1A 4N8GA 4N4UA 3HFUA 4P1LA 1FBFA 1YYZA 2XXKA 4NAPA 3W9WA 4OVSA 4GX4A 1FPFA 2F3BA 1NV0A 1CNQA 2HZLA 2WYKA 4GBVA 2HPGA 1EYJA 2CZIA 4LN5A 1FBGA 2V3QA 4PBQA 1LBXA 1FBCA 2WYPA 1VDWA 5ET6A 1FBPA 4OANA 4PE3A 4G61A 1NV7A 3BIHA 4QBAA 2PFYA 1RDXA 1IMEA 2WBDA 4P47A 4DI3D 4IR8A 4HCYA 4GWWA 1NUXA 3LUZA 2P3VA 4GX3A 3T1BA 1FJ6A 3E79A 2Y5LA 2B4LA 2Y5KA 4MNCA 5IZ1A 4PF6A 4PFBA 3LV0A 3D1RA 3W9VA 4H46A 4I3EA 3BIGA 1EYKA 4PFRA 2XWOA 5A5LA 1EYIA 1QGXA 5FBPA 4O94A 1NV4A 4GWZA 4XEQA 2FIEA 4O7IA 1NV6A 4N91A 1IMBA 2R8TA 4PDHA 5J16A 3QMFA 2VPOA 1JP4A 2PCRA 2ZZXA 4KXPA 5ESYA 4X04A 2CZHA 5EQ9A 2VPNA 4MIJA 4PFIA 1G0IA 5EQ8A 1FSAA 2QFLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PBQ A;  4NN3 A;  4PF8 A;  2XA5 A;  4NX1 A;  2WYP A;  2ZZV A;  4OVP A;  4PDD A;  5I7I A;  4OAN A;  4OVT A;  5IZZ A;  4PE3 A;  5CM6 A;  4UAB A;  5IM2 A;  4N6K A;  4MAG A;  4MCO A;  4OVR A;  4NHB A;  2PFY A;  4PAF A;  3GYY A;  4P8B A;  2V4C A;  4P47 A;  4PBH A;  4DI3 D;  4O8M A;  4PCD A;  4PGN A;  4DI4 B;  4O7M A;  4P9K A;  4N6D A;  4XF5 A;  4PC9 A;  4MNC A;  3FXB A;  4PF6 A;  4YIC A;  2XWV A;  4PFB A;  3B50 A;  2WX9 A;  4XFE A;  4PET A;  4X8R A;  3U65 A;  2CEX A;  4OA4 A;  4NF0 A;  4PAK A;  4OVQ A;  4PFR A;  4NGU A;  2XWO A;  4O94 A;  4XEQ A;  4N17 A;  2XWK A;  4N15 A;  4MNP A;  4NG7 A;  4MHF A;  4N8Y A;  4MEV A;  4P56 A;  4N8G A;  4MX6 A;  4YZZ A;  5LTC A;  4N4U A;  2CEY A;  4MNI A;  4N91 A;  4P3L A;  4P1L A;  4PDH A;  2HZK A;  4NQ8 A;  2XXK A;  4PGP A;  5IGA A;  2VPO A;  2ZZX A;  4NAP A;  4P1E A;  4X04 A;  2XWI A;  2PFZ A;  2VPN A;  4MIJ A;  4PFI A;  4OVS A;  5I5P A;  2HZL A;  2WYK A;  2ZZW A;  2HPG A;  4LN5 A;  4MMP A;  4PAI A; 
#chains in the Genus database with same CATH topology
 3TMG A;  3TTN A;  4NN3 A;  1FPL A;  2XXP A;  4PF8 A;  4KYD A;  4NX1 A;  4ONY A;  4PDD A;  1O64 A;  2ZYN A;  2Z23 A;  1B58 A;  1LEV A;  2MKZ A;  1D9V A;  5ICT A;  3K2D A;  3EF7 A;  3FBP A;  4LON B;  2OWT A;  4YKJ A;  3H6W A;  4MAG A;  5ELV A;  3TFL A;  4P8B A;  1Y9U A;  1D9Q A;  3CHG A;  3MVZ A;  5DT6 A;  1Y4T A;  5IZ3 B;  1J1N A;  1DPE A;  1VFE A;  2M8C A;  1SYI A;  3P7I A;  3OSQ A;  4F1U A;  2FNC A;  2X26 A;  4O3B A;  1OMP A;  3R6U A;  3EHS A;  4QFP A;  1QUI A;  3Q28 A;  2CZK A;  4GX6 A;  2VGQ A;  4YKP A;  2R71 A;  2Z22 A;  3HST A;  4PQJ A;  4DLD A;  4FEB A;  5KZT A;  1MY3 A;  4F1V A;  1B3H A;  4F1Y A;  2QVR A;  2XWK A;  2RCB A;  3FXU A;  3IR1 A;  4OER A;  4TQU Q;  2ZYM A;  3KN3 A;  4R6K A;  2CEY A;  3H06 B;  1MXU A;  4AS5 A;  2UXA A;  1N04 A;  4NQ8 A;  1MXW A;  2O1L A;  5IGA A;  1B0H A;  1K9Z A;  4DCY A;  4R9F A;  1OLC A;  4EUO A;  3HHG A;  3L6G A;  1QKB A;  5H8H B;  4XKR A;  3R26 A;  4FAJ A;  3LSW A;  4M1V A;  3AXF A;  1IMC A;  3JV9 A;  5AA2 B;  3SEW A;  1YZ0 A;  2GQ1 A;  1LFH A;  1YAE A;  1MDP 1;  2XXQ A;  4HXV A;  5IM2 A;  3KC1 A;  1MPC A;  3RT8 A;  2QVV A;  3GYY A;  4X9T A;  3EHT A;  3K1P A;  1DPP A;  3HPI A;  1FPI A;  4PCD A;  1BK4 A;  1OVT A;  4XKP A;  3RPL A;  1D9Y A;  3PMX A;  4M4G A;  4KR5 A;  2XWV A;  3K00 A;  1IMF A;  4POW A;  1HSJ A;  5H8Q B;  1MQD A;  3KC0 A;  1IXI A;  4NF0 A;  3N26 A;  4IO4 A;  1B2H A;  1MS7 A;  1R1N A;  2Z8E A;  4ESX A;  1B4Z A;  1ZKB A;  3FVK A;  2B3B A;  1UQW A;  3I3V A;  3JZJ A;  1IMD A;  2I4B A;  3M3K A;  5I58 B;  5ICQ A;  2VOZ A;  2QS3 A;  3GXA A;  4BDQ A;  4AS4 A;  1IZ1 A;  3KSJ A;  4N07 A;  1IEJ A;  4R72 A;  1B0L A;  3FV2 A;  1ZBM A;  2UVI A;  2XXV A;  4R2F A;  1MY2 A;  3U8Q A;  3K6V A;  1FPJ A;  2B65 A;  1FPK A;  3LSF B;  2Q9T A;  3MP1 A;  1NI9 A;  1A8F A;  5ITP A;  3CG3 A;  1N3X A;  4RPN A;  4NF8 B;  1VSO A;  2H4I A;  1NUW A;  2F34 A;  3TEL A;  1I6A A;  1FTA A;  1FJ9 A;  4JVC A;  4LA9 A;  4JWX A;  4ZZA A;  4JVD A;  1XVX A;  1MXV A;  3QK6 A;  4N6P A;  1B5I A;  2OK2 A;  4OHN A;  4P0G A;  5I3S A;  3S9E A;  2AIX A;  3G3I A;  4GD5 A;  2HEU A;  4G4P A;  4EQB A;  3C32 A;  3FXB A;  1FTO A;  1YPN A;  5AA3 A;  3EN3 A;  1KWH A;  2F7B A;  4LVQ A;  1MQI A;  3ZKL A;  1DBZ A;  4GF8 A;  4IO6 A;  5KCJ A;  4C1T A;  3DM0 A;  1Q35 A;  5B70 A;  5DVF A;  2D3I A;  3G3G A;  4PFY A;  1O63 A;  3TTK A;  1KA1 A;  3PPP A;  2IEE A;  3UOR A;  1ZLQ A;  1JEU A;  1MM6 A;  4I8C A;  4YKK A;  3WAF A;  1SI1 A;  2I58 A;  3K4U A;  3MP6 A;  2ESN A;  1IQ7 A;  1YYZ A;  2DWA A;  3LC8 A;  5ISU A;  1Y4C A;  4MLQ A;  3MW0 A;  2F8D A;  5CI5 A;  2GHB A;  3CFL A;  4NAP A;  4LUB A;  1B7Z A;  3IB1 A;  3RGY A;  3TCH A;  3ILT B;  3CRB A;  5TPA B;  3WAE A;  4GBV A;  2CZI A;  1MG1 A;  4PBQ A;  4ZE8 A;  1FBC A;  1TFA A;  3Q27 A;  5DEX B;  3MQ9 A;  2O7U A;  1DOT A;  2XX7 A;  3T9X B;  3ZS6 A;  4QBA A;  4DXU A;  3MPK A;  3RY3 A;  3G3J A;  1A7L A;  3B7D A;  3SEV A;  4OWD A;  1B3E A;  1QKA A;  5DTB A;  2Y5L A;  4YB5 A;  5IZ1 A;  4NMY A;  4X48 A;  4U22 A;  1D3K A;  1M5F A;  3LV0 A;  1POY 1;  1VE4 A;  3W9V A;  1B4H A;  4I3E A;  3VDF A;  4R75 A;  1ZTY A;  3FV1 A;  1EYI A;  4XKN A;  5FBP A;  1Y1Z A;  4O94 A;  4F22 A;  4XEQ A;  3DP4 A;  3PPN A;  1LAX A;  4JWY A;  4KI0 E;  2P0S A;  2NWJ A;  4ZE9 A;  1A8E A;  1XOC A;  4R74 A;  1MY0 A;  1LBB A;  1PB9 A;  5AA4 A;  3E4R A;  5I2K B;  1URS A;  5HPQ A;  1WOD A;  1SBP A;  2Q2C A;  2QS2 A;  1JP4 A;  1LCF A;  2ZZX A;  3V5A A;  4MIJ A;  5JTY B;  1G0I A;  4HTG A;  3TTR A;  1FSA A;  2REG A;  5I59 B;  2QFL A;  4I9D A;  5I2N B;  2GFE A;  1B3L A;  1FW0 A;  4OVP A;  1DSN A;  1TWY A;  2B4M A;  3IOR A;  3O6I A;  1FBE A;  1CB6 A;  3DLN A;  5IZZ A;  5EYF A;  4UAB A;  5CRY A;  1RDZ A;  2P3N A;  3GBA A;  2DVC A;  2OBG A;  2ONK E;  1I69 A;  3PMV A;  4GBW A;  1Y3P A;  4MCO A;  4EQ9 A;  5EYG A;  2JJK A;  2OX3 A;  1JET A;  4XKQ A;  4R9G A;  2Q8M A;  2DDK A;  3H4Z A;  1DK4 A;  4DI4 B;  2PX1 A;  2O6A A;  4KFQ A;  3F11 A;  4XF5 A;  3T93 B;  4GXS B;  4PC9 A;  1OVB A;  5DW8 A;  3U72 A;  3H6T A;  3D4G A;  4O3A A;  3ECR A;  1LLS A;  3O6H A;  1B32 A;  3QYT A;  4FAT A;  2G29 A;  2Z8D A;  3SKP A;  3L6H A;  3UIF A;  1LBC A;  4G8N A;  3FIR A;  3DEL B;  1G0H A;  3H3G A;  4DE8 A;  2XD2 A;  4OMB A;  1PB8 A;  1NV5 A;  1LB8 A;  2I4C A;  2Z8F A;  5DYH A;  4NF4 A;  2DE2 A;  3C9H A;  2HXW A;  1LCT A;  2HZK A;  4PGP A;  5I84 A;  1FTK A;  4YMB A;  1YXI A;  2X7Q A;  3TCG A;  3CSG A;  3KSX A;  1NH7 A;  2XWI A;  3K01 A;  3MUQ A;  3B6T A;  5I5P A;  3LBS A;  1PBP A;  1B5J A;  2ZZW A;  4MMP A;  3KJ7 A;  1BTJ A;  3JYR A;  1K9Y A;  4RYA A;  1GV8 A;  2RC7 A;  4PAI A;  4F29 A;  2XA5 A;  2YPN A;  1SYH A;  4OFO A;  3QUF A;  4RK2 A;  2ZZV A;  5TP9 B;  2VP1 A;  3T0J A;  3LSX A;  4IO7 A;  3FGS A;  1NUZ A;  3SEX A;  2Y7I A;  3PUY E;  4OES A;  4LZ8 A;  1T0K A;  4QRZ A;  1FTJ A;  2F7A A;  4JDF A;  5HBC A;  4ELO A;  1FBH A;  4PFU A;  3THI A;  3S2V A;  2YLN A;  4UAC A;  2ABH A;  1PDA A;  1B7U A;  2HAU A;  1XT8 A;  1N7W A;  4PP0 A;  3NOH A;  4F19 A;  1TT1 A;  4ZEF A;  4F3P A;  1UTH B;  4LAT A;  4YIC A;  2V3T A;  3BBR A;  4HW8 A;  4IO5 A;  1IIT A;  1LFG A;  3KG2 A;  4QFO A;  4OVQ A;  1S9T A;  4H5G A;  1QJM A;  2F36 A;  2L5V A;  2CMO A;  5KDT A;  1LBY A;  1UIV A;  3TCF A;  4QF9 A;  1SVX B;  4YZZ A;  1II5 A;  4RY1 A;  1LST A;  4H8I A;  4P11 A;  1MPB A;  3PD9 A;  2O1M A;  4KYE A;  4EXL A;  5TPA A;  4WED A;  1BLF A;  1UTB B;  2DE3 A;  4OET A;  2P1S A;  4GWU A;  1M5B A;  3FUZ A;  4F3G A;  1FPB A;  2H9B A;  3KN8 A;  3K0V A;  2OWZ A;  4WXJ A;  2Q2A A;  2A5T A;  2F35 A;  3KZG A;  4ZEI A;  1Q9D A;  1NKX A;  3A09 A;  1QUJ A;  1Y20 A;  4NF5 A;  5H8F A;  1R9L A;  2FBP A;  4Q5T A;  3MST A;  1RYO A;  2DE4 A;  3KFM A;  3MZ9 A;  2DS9 A;  5EQA A;  4RPO A;  4GFR A;  4QFL A;  3UP9 A;  1MXX A;  1MQJ A;  2Y7P A;  4NHB A;  4GWS A;  1SPI A;  3RLF E;  1SW2 A;  5A5X B;  3SEU A;  3RT6 B;  2O7I A;  1JVY A;  4PGN A;  4I3Y A;  4YB6 A;  4O7M A;  4P9K A;  3FVG A;  5F7V A;  3PGF A;  4ECF A;  1M5C A;  3IFA A;  4N81 A;  3RUM A;  4PE5 B;  3OO9 A;  1JW4 A;  3TQL A;  2HXR A;  3O97 A;  4PET A;  2G93 A;  3HHF A;  4JSO A;  5JK4 A;  1FBD A;  4LP2 B;  5I57 A;  1S7Y A;  1Y3N A;  1US5 A;  2O84 X;  2Y7R A;  3B6W A;  5CMK A;  4MNP A;  2KR0 A;  1I6B A;  1IXC A;  4N8G A;  3M3L A;  3CG1 A;  2GHA A;  1PB7 A;  2OJT A;  2Q8J A;  1H43 A;  1URG A;  2HAV A;  4NE4 A;  2AYS A;  3IJX B;  1MH4 A;  3TDJ A;  1NNF A;  3PMW A;  4OVS A;  4GX4 A;  1FPF A;  1P1Q A;  1NMU A;  4G68 C;  3C36 A;  4KCD A;  1LAF E;  1CNQ A;  3O66 A;  3KGC A;  4LN5 A;  3OD7 A;  1FBG A;  3FD3 A;  3U92 A;  2RKM A;  3PPR A;  3OO8 A;  2PT1 A;  2OCU A;  4QSD A;  4U2R A;  3BIH A;  3TKD A;  3W15 C;  5CBS A;  1IME A;  1N7X A;  5EHM A;  4U1O A;  3CR9 A;  4AB6 A;  3CIJ A;  4G68 A;  1BIY A;  4IR8 A;  4GWW A;  1MXZ A;  5AA1 A;  2I3W A;  3LUZ A;  2P3V A;  4OEU A;  4NF6 A;  4OFL A;  1ELJ A;  1FJ6 A;  2XD3 A;  4EQ7 A;  2B4L A;  1EZ9 A;  2ZNS A;  2A5S A;  1JQF A;  3IK6 B;  3UA8 A;  4H1X A;  4K3F A;  5H8N B;  3QUJ A;  3K6W A;  3E13 X;  3IX1 A;  3Q25 A;  4GLI A;  4H46 A;  1EYK A;  5I56 B;  3G3H A;  4ZZE A;  4GWZ A;  3RPW A;  3H03 A;  4U21 A;  1MXY A;  2UVJ A;  1FTM A;  3CFX A;  3PD8 A;  2FIE A;  2X7P A;  1IMB A;  2R8T A;  1B6H A;  4GL8 A;  4FIM A;  3PV0 E;  2ZYO A;  1SW4 A;  3MZ1 A;  2UYF A;  1GTK A;  5EQ9 A;  4EF2 A;  4TLM B;  3U94 A;  5EQ8 A;  2RC9 A;  4R6Y A;  3ILU B;  3VVE A;  3Q29 A;  1EH3 A;  1IIW A;  3IOT A;  2PT2 A;  3U1O A;  1B1X A;  3OEM A;  3RNN A;  2FIX A;  2QRY A;  4DDD A;  2AL4 A;  2Y7K A;  1JW5 A;  3MAM A;  5CM6 A;  4F2Q A;  4BLA A;  4Q8R A;  2NOO A;  5J1D A;  4JXI A;  2ANJ A;  4KCC A;  3V8X B;  3IAZ A;  3QSL A;  3RQT A;  4NWD A;  1B05 A;  4OEV A;  3BFU A;  1LBV A;  1NFT A;  1PEB A;  1RDY A;  4JSD A;  5CMB A;  5EHS A;  1XI6 A;  1JVX A;  5IZ3 A;  3EPE A;  5EYH A;  1Y1M A;  4IY5 A;  2KQZ A;  2QSX A;  3B50 A;  4YMA A;  1N0T A;  2I0C A;  4XFE A;  1IXH A;  4PAK A;  1B5H A;  3B6Q A;  3CVG A;  4Q30 B;  2DP8 A;  2UVG A;  4IO3 A;  1MH3 A;  2R9J A;  4MBP A;  1QW0 A;  5AE4 A;  2WBB A;  4R73 A;  2BJJ X;  4OQO A;  4EF1 A;  4DZ1 A;  3G7W A;  4OTE A;  3IOW A;  1NNK A;  5LOM A;  4FJP A;  3ONM A;  1BP5 A;  1TXF A;  3Q26 A;  4P1E A;  3E78 A;  3FXR A;  1FTL A;  2PFZ A;  1USY H;  3OO6 A;  1XVY A;  1AIV A;  1LFI A;  3OEL A;  3IO4 A;  3FAT A;  2HHM A;  4YU0 A;  1M5E A;  1US4 A;  4RNS A;  2I6E A;  3K6U A;  2ALU A;  3PUV E;  5H8H A;  1Z7N E;  4F3B A;  1DCU A;  2H98 A;  5A5X A;  3V83 A;  1B3G A;  1NH8 A;  1RKM A;  1MPD A;  3LUY A;  5AA2 A;  1B7H A;  3T9H B;  4N6K A;  4FED A;  1MQG A;  4E0W A;  1MRP A;  3TTL A;  3IOU A;  1RYX A;  2V4C A;  4F39 A;  3DP6 A;  2DWH A;  4O8M A;  3MYU A;  3RPL B;  1XS5 A;  4QSE A;  4DIG A;  2I48 A;  1VFD A;  4GOT A;  3B8B A;  1FQD A;  2UYE A;  1FQA A;  3FJG A;  3MVX A;  2P2A A;  4QFK A;  5ET5 A;  4DCX A;  4FBP A;  5F24 A;  2QS1 A;  5FHM A;  1B51 A;  2FA7 A;  3QXM A;  4H8J A;  1JW1 A;  4DXC A;  4QFN A;  5H8Q A;  3MPL A;  1SW1 A;  3BKI B;  3ZSF A;  5CC2 A;  4R6H A;  2F6P A;  1N3W A;  4I1D A;  4JVI A;  4KYS A;  1IMA A;  4JBZ A;  3GBB A;  2Q89 A;  3ROJ A;  2V84 A;  1AWB A;  4MEV A;  1AL3 A;  4MX6 A;  5I58 A;  1URD A;  1EZP A;  2HQ0 A;  4MFI A;  4GXA A;  1A99 A;  1B3F A;  2XXX A;  4GIZ A;  1YCJ A;  1KA0 A;  3TYH A;  2I3V A;  5H8S A;  4Q0C A;  2DSF A;  2WEF A;  4MF3 A;  1SI0 A;  2DQV A;  3E3K A;  4U4S A;  4F2O A;  1KZ8 A;  4ZDM A;  4ZED A;  1OQG A;  3EQ1 A;  2XXH A;  1L5T A;  4H6D A;  2B3F A;  4MH5 A;  2BJI A;  3ISP A;  3M8U A;  1P1U A;  4XTC Q;  5ET8 A;  4BDO A;  5I7I A;  4PTK A;  4NF8 A;  1P1W A;  3V89 B;  4IO2 A;  1LBZ A;  1FRP A;  5M2V A;  4H0W A;  1O7T A;  2DWI A;  4PBH A;  2PMS A;  4QXD A;  1PC3 A;  1ANF A;  3VLW A;  4XXU A;  1H76 A;  4N6D A;  4XIG Q;  2Y84 A;  3TPA A;  4RK9 A;  5FHN A;  4X1B A;  1FCK A;  3EKI A;  5ET7 A;  3O29 A;  5BWJ A;  2HFB A;  2F6G A;  4U1Z A;  5KCJ B;  3I6V A;  2R6G E;  3U65 A;  1SDX A;  4P0I A;  2REJ A;  4BDN A;  5B7D A;  3CSB A;  3UGW A;  4NGU A;  3IL1 B;  4BDR A;  2XXU A;  3A3C A;  1ZMG A;  4N17 A;  4N15 A;  3FVO A;  2Q74 A;  4HCW A;  3PUW E;  4NG7 A;  4Z7E A;  4JB7 A;  1POT A;  4P56 A;  2ZYK A;  1MY1 A;  4P1L A;  5F1Q A;  4ZEB A;  1FBF A;  3MVY A;  2QL3 A;  2DXY A;  1SD3 A;  3OSR A;  2XXK A;  3QIM A;  1ZU0 A;  5IKB A;  1A40 A;  2QMX A;  4GVO A;  3M3F A;  3USD A;  3KBR A;  1MDQ A;  3TTM A;  3TAJ A;  4F31 B;  3RTF B;  2F3B A;  1NV0 A;  2HZL A;  2WYK A;  2KLF A;  1HSE A;  2HPG A;  1EU8 A;  4QSC A;  3SET A;  2XXI A;  1VDW A;  5ET6 A;  1FBP A;  4ELR A;  4PE3 A;  4G61 A;  1S50 A;  3N6U A;  5DEX A;  4IGR A;  2PFY A;  1RDX A;  4YKI A;  4P47 A;  4JWO A;  3OXN A;  3VE1 B;  4DI3 D;  4ESW A;  1NUX A;  4OVJ A;  2VD3 A;  3OEK A;  1D4N A;  3I5O A;  5L9S A;  4MNC A;  3C35 A;  1XHY A;  1R9Q A;  1B52 A;  2WKY A;  3H6U A;  3BIG A;  4PFR A;  2XWO A;  5A5L A;  3O9P A;  1NNT A;  3PUZ E;  4N13 A;  2LAO A;  1NV4 A;  3O6G A;  5AA4 B;  1LAG E;  5TU0 A;  4ISU A;  3SES A;  3TZA A;  4E0X A;  3FZV A;  4ZEK A;  3SEY A;  1P99 A;  1NV6 A;  2IA4 A;  3PU5 A;  2F7C A;  1LGB C;  5J16 A;  4OXV A;  5L9M A;  2VPO A;  4KXP A;  5ESY A;  1AOV A;  5I2K A;  3U93 A;  5JEI A;  3T96 B;  3N6T A;  2VPN A;  4TOZ A;  1OLA A;  1IUD A;  3UK4 A;  1Y3Q A;  5FTH A;  3MWB A;  4H67 A;  1LB9 A;  1N76 A;  5JTY A;  4FEC A;  2RF1 A;  3A3U A;  3KBZ A;  3K1N A;  4F18 A;  3HCQ A;  2UVH A;  1LBW A;  4UA8 A;  3IJO B;  3DP8 A;  5I59 A;  3TEP A;  4WEP A;  4OVT A;  3VVD A;  5I2N A;  3IO6 A;  4BDM A;  3TUS A;  1N84 A;  4AB5 A;  4U23 A;  3KOS A;  2ZNU A;  1Q1K A;  4G8M A;  3VXB A;  4PAF A;  4GQO A;  4THI A;  3VVF A;  2PYY A;  2F78 A;  3UN6 A;  1WDN A;  5ITO A;  3TOD A;  3EHU A;  2F5X A;  2D21 A;  1F9B A;  4MJO A;  2DWJ A;  3SER A;  1NV3 A;  2ZMB A;  2OLB A;  2QVU A;  3IB0 A;  5CMC A;  3VXC A;  1TFD A;  2DVZ A;  4ELP A;  4X1D A;  5BUU A;  2D5W A;  3SZP A;  3G3K A;  2FYI A;  3C33 A;  1GVC A;  2XXT A;  1AMF A;  5HM4 B;  5EQ7 A;  5DVJ A;  2QPQ A;  1DTG A;  2ONS A;  4NF4 B;  1QUK A;  4MHF A;  1I6Q A;  2DXR A;  4OYV A;  3G3F A;  2ZXT A;  3TQW A;  1ZJL A;  2XXR A;  2E1S A;  1A54 A;  3MBP A;  1MM7 A;  2NVU B;  1OQH A;  3S9L C;  4H5F A;  4G2Z A;  4R2B A;  3K6X A;  4GRK A;  2XXY A;  2VHA A;  4I40 A;  2V93 A;  4C1U A;  4PFT A;  2XX8 A;  4IB2 A;  2VT5 A;  3VFJ A;  2V3U A;  1QVS A;  5IAI A;  2OWS A;  4H45 A;  1AH5 A;  5TP9 A;  3VV5 A;  1NV2 A;  4ELQ A;  3H7M A;  4EDP A;  2F3D A;  2E0S A;  1NV1 A;  4RXL A;  2QMW A;  3MZB A;  2H99 A;  4GL0 A;  2O69 A;  3RYD A;  3KN7 A;  4KQP A;  4IGT A;  2WX9 A;  4X8R A;  2YJP A;  4OA4 A;  1UTH A;  2Y7W A;  3T22 A;  4OEN A;  1OIB A;  2GH9 A;  5KDT B;  2V25 A;  3OO7 A;  1FQF A;  2F97 A;  2HCA A;  3IFC A;  3C31 A;  2Q88 A;  5K2Y A;  5T3J A;  1MY4 A;  4N8Y A;  2THI A;  5LTC A;  1USY E;  2PVU A;  4MNI A;  4P3L A;  4POX A;  3MC2 A;  2FHY A;  1NUY A;  1B1H A;  2GRV A;  4RJZ A;  1NL5 A;  4HE2 A;  3C34 A;  2RC8 A;  4GWY A;  3ODB A;  4GWX A;  2A5T B;  4HE1 A;  1UTB A;  1QUL A;  4TLL B;  4HS7 A;  3SDF A;  1YTV A;  3S9M C;  2NXO A;  1FPE A;  4FE8 A;  3LR1 A;  4NF5 B;  3MVW A;  4KPT A;  1B9J A;  5H8F B;  2QJE A;  4HE0 A;  3T66 A;  1INP A;  1CE2 A;  3R7X A;  4YAH X;  3C4M A;  4G77 A;  1NNP A;  1MQH A;  4OVR A;  5CBR A;  2FVZ A;  3FJM A;  3BFT A;  3FXQ A;  3FAS A;  1R6Z A;  3RN8 A;  4H65 A;  2XXW A;  3S9N C;  3PTY A;  1FPG A;  4ND9 A;  4KHZ E;  3VLV A;  1PBQ A;  3PUX E;  4L17 A;  1WVJ A;  3A29 A;  2I0B A;  5LDZ A;  1FPD A;  4WKM A;  1HSL A;  2CEX A;  4IY6 A;  5I57 B;  4OZ9 A;  3D4C A;  4NWC A;  2PBW A;  4NED A;  3FJ7 A;  1DTZ A;  3MJN A;  1GR2 A;  1UIU A;  3O2A A;  4FOR A;  4C0R A;  1ATG A;  5L8D A;  4DXB A;  2W7Y A;  5FHO A;  4G8H A;  3OMB A;  1DMB A;  4MLV A;  4N4U A;  3HFU A;  3QAX A;  2RIN A;  3PPQ A;  4Z0I A;  2XX9 A;  3IB2 A;  4LZ5 A;  1Z7M E;  3CI8 A;  5K2X A;  3W9W A;  1IXG A;  1VR5 A;  4F3S A;  1EZO A;  3KJT A;  4BDL A;  3HN0 A;  1EYJ A;  3S4U A;  2AL5 A;  2V3Q A;  1LBX A;  2WYP A;  5CMM A;  1SQY A;  5L9O A;  2OZZ A;  2O51 A;  4OAN A;  2CZL A;  1NV7 A;  3K1M A;  4QHQ A;  4G68 B;  3HO7 A;  1H44 A;  4PFW A;  3HV1 A;  1H3D A;  3PPO A;  2WBD A;  5FTI A;  3ZKK A;  2H25 A;  4I62 A;  2NUV A;  1P1N A;  3K02 A;  4NF6 B;  1SW5 A;  4HCY A;  3VLU A;  3O28 A;  3T9V A;  5AA2 D;  4NTL A;  3E9X A;  1XC1 A;  3N94 A;  4GX3 A;  4O3C A;  3KOT A;  3T1B A;  2O68 A;  3E79 A;  1A55 A;  1GGG A;  3MP8 A;  3FVN A;  4GWO A;  2Y5K A;  4PF6 A;  3GLB A;  1LAH E;  4EXK A;  4PFB A;  1BKA A;  1FQE A;  3KEI A;  3OEN A;  4LZ7 A;  3D1R A;  2I49 A;  2ONR A;  1B46 A;  3IOV A;  3LSL A;  2QS4 A;  5H8N A;  1P1O A;  2DOJ A;  2DYX A;  1FQC A;  3H6V A;  3OOA A;  4KD5 A;  1QGX A;  1M5D A;  1FQB A;  2VD2 A;  1JEV A;  5I56 A;  3CFZ A;  4AQ4 A;  3N5L A;  2RCA A;  4RA1 A;  4O7I A;  2H5Y A;  3RTW B;  4YB7 A;  1JNF A;  1B40 A;  4N91 A;  5DVI A;  4PDH A;  3T9U A;  3QMF A;  4LQ5 A;  4OFJ A;  4U4X A;  2PCR A;  4ZEC A;  4X04 A;  4LQ2 A;  2CZH A;  4ZS9 A;  2ZNT A;  4PFI A;  1H45 A;  2XHD A;  1ZIU A;  3GZG A; 
#chains in the Genus database with same CATH homology
 2FIX A;  4NN3 A;  1FPL A;  4PF8 A;  3KBZ A;  4NX1 A;  4PDD A;  4OVP A;  4F18 A;  1LBW A;  1LEV A;  2B4M A;  2MKZ A;  4OVT A;  1FBE A;  5IZZ A;  5CM6 A;  4UAB A;  1RDZ A;  2P3N A;  3FBP A;  5J1D A;  4MAG A;  4GBW A;  4MCO A;  5EYG A;  2JJK A;  4PAF A;  4P8B A;  2OX3 A;  1D9Q A;  3CHG A;  2Q8M A;  2DDK A;  5IZ3 B;  1DK4 A;  4DI4 B;  2F5X A;  1LBV A;  1RDY A;  4MJO A;  1XI6 A;  4XF5 A;  1NV3 A;  4PC9 A;  4F1U A;  5IZ3 A;  5EYH A;  2QVU A;  5DW8 A;  2DVZ A;  2KQZ A;  3B50 A;  4XFE A;  2CZK A;  4GX6 A;  4PAK A;  3SZP A;  1G0H A;  4F1V A;  2QVR A;  2WBB A;  2XWK A;  5EQ7 A;  1NV5 A;  2QPQ A;  4MHF A;  2CEY A;  2DE2 A;  4AS5 A;  2HZK A;  4NQ8 A;  4PGP A;  5IGA A;  1K9Z A;  1YXI A;  4P1E A;  3E78 A;  2XWI A;  2PFZ A;  5I5P A;  2HHM A;  4I40 A;  2ZZW A;  4MMP A;  1K9Y A;  4M1V A;  4PAI A;  1IMC A;  2VT5 A;  2XA5 A;  1YZ0 A;  2ZZV A;  1DCU A;  2GQ1 A;  3T0J A;  4H45 A;  1NUZ A;  4HXV A;  5IM2 A;  3KC1 A;  4N6K A;  2QVV A;  1NV2 A;  3GYY A;  1FBH A;  2V4C A;  4X9T A;  4O8M A;  3MYU A;  2F3D A;  4PCD A;  1FPI A;  3RPL B;  1BK4 A;  1NV1 A;  3B8B A;  3NOH A;  4F19 A;  3RPL A;  3RYD A;  5ET5 A;  4YIC A;  2XWV A;  4FBP A;  1IMF A;  2WX9 A;  5F24 A;  4X8R A;  3KC0 A;  4OA4 A;  4NF0 A;  4OVQ A;  1IMD A;  4JVI A;  2L5V A;  1IMA A;  3IFC A;  4AS4 A;  1LBY A;  3ROJ A;  5T3J A;  1AWB A;  4N8Y A;  4MEV A;  4MX6 A;  4YZZ A;  5LTC A;  4MNI A;  4P3L A;  2FHY A;  1NUY A;  4HE2 A;  2DE3 A;  1KA0 A;  1FPJ A;  4GWY A;  4GWU A;  2WEF A;  4GWX A;  4HE1 A;  1FPB A;  1FPK A;  2Q9T A;  2OWZ A;  1KZ8 A;  1NI9 A;  1FPE A;  2BJI A;  3ISP A;  1Q9D A;  5ET8 A;  4HE0 A;  5I7I A;  1NUW A;  1INP A;  4PTK A;  1FTA A;  2FBP A;  3MST A;  1LBZ A;  2DE4 A;  1FRP A;  5EQA A;  4OVR A;  4NHB A;  1FJ9 A;  2FVZ A;  4JVC A;  4GWS A;  1SPI A;  4PBH A;  4JVD A;  4QXD A;  4PGN A;  4I3Y A;  4O7M A;  4P9K A;  4N6D A;  5I3S A;  3PTY A;  1FPG A;  3IFA A;  4N81 A;  3FXB A;  3EKI A;  5ET7 A;  3A29 A;  2HXR A;  5LDZ A;  1FPD A;  4PET A;  3U65 A;  2CEX A;  5JK4 A;  1FBD A;  4NGU A;  1DBZ A;  4N17 A;  4N15 A;  4MNP A;  2Q74 A;  4HCW A;  4NG7 A;  2KR0 A;  4P56 A;  1KA1 A;  4N8G A;  4N4U A;  3HFU A;  4P1L A;  1FBF A;  1YYZ A;  2XXK A;  4NAP A;  3W9W A;  4OVS A;  4GX4 A;  1FPF A;  2F3B A;  1NV0 A;  1CNQ A;  2HZL A;  2WYK A;  4GBV A;  2HPG A;  1EYJ A;  2CZI A;  4LN5 A;  1FBG A;  2V3Q A;  4PBQ A;  1LBX A;  1FBC A;  2WYP A;  1VDW A;  5ET6 A;  1FBP A;  4OAN A;  4PE3 A;  4G61 A;  1NV7 A;  3BIH A;  4QBA A;  2PFY A;  1RDX A;  1IME A;  2WBD A;  4P47 A;  4DI3 D;  4IR8 A;  4HCY A;  4GWW A;  1NUX A;  3LUZ A;  2P3V A;  4GX3 A;  3T1B A;  1FJ6 A;  3E79 A;  2Y5L A;  2B4L A;  2Y5K A;  4MNC A;  5IZ1 A;  4PF6 A;  4PFB A;  3LV0 A;  3D1R A;  3W9V A;  4H46 A;  4I3E A;  3BIG A;  1EYK A;  4PFR A;  2XWO A;  5A5L A;  1EYI A;  1QGX A;  5FBP A;  4O94 A;  1NV4 A;  4GWZ A;  4XEQ A;  2FIE A;  4O7I A;  1NV6 A;  4N91 A;  1IMB A;  2R8T A;  4PDH A;  5J16 A;  3QMF A;  2VPO A;  1JP4 A;  2PCR A;  2ZZX A;  4KXP A;  5ESY A;  4X04 A;  2CZH A;  5EQ9 A;  2VPN A;  4MIJ A;  4PFI A;  1G0I A;  5EQ8 A;  1FSA A;  2QFL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...