2HPGA

The crystal structure of a thermophilic trap periplasmic binding protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
318
Chain Sequence
VFGAKYTLRFGHVLAPGEPYHQAFLKWAKAVEEKTNGDVRIEVFPSSQLGVEEDIIEQIRMGAPVGWNTDSARLGMYVKDIGVMNLAYFIDFMGAKTPEEAIEVLKKIKQSPTMQKWLKELEQRFGIKVLSFYWVQGYRHFVTNKPIRKPEDLNGLRIRTPGAPAWQESIRSLGAIPVAVNFGEIYTAVQTRAVDGAELTYANVYNGGLYEVLKYMSETGHFLLINFEIVSADWFNSLPKEYQKIIEEEMDKAGIEVSLKIMKELEEEYKQKCIEKGMAVIPASEIDKEAFMEKAKQAYKNLGLENALNQLIKEVKGE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural analysis of a periplasmic binding protein in the tripartite ATP-independent transporter family reveals a tetrameric assembly that may have a role in ligand transport.
pubmed doi rcsb
source organism Thermotoga maritima
molecule tags Ligand binding protein
molecule keywords ABC transporter, periplasmic substrate-binding protein
total genus 112
structure length 318
sequence length 318
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2hpgA00
4OVSA 4PAKA 4OVTA 4UABA 4O94A 4NGUA 4PGNA 4PE3A 4P1LA 4P47A 4LN5A 4PBQA 4PAFA 4PBHA 4MNIA 2PFYA 4XF5A 4PCDA 2XXKA 4OVPA 5IM2A 2HZLA 4N6KA 4MEVA 2HPGA 4N8GA 4MAGA 4NQ8A 4MHFA 4PC9A 4OVRA 4NX1A 2HZKA 4N91A 4NHBA 4NAPA 4MCOA 4PDDA 4OANA 4NN3A 4O7MA 4MNCA 4X8RA 2VPNA 4DI4B 4OVQA 2ZZVA 2V4CA 2XWOA 4N4UA 4PGPA 2WYPA 4N6DA 5I5PA 2WYKA 3U65A 5IGAA 4P9KA 2XWKA 4MX6A 4MMPA 4XEQA 4PFIA 2XA5A 2CEYA 2XWIA 4P8BA 4NF0A 4PDHA 4PAIA 4PF8A 5IZZA 4MIJA 4OA4A 4P3LA 4O8MA 4N17A 5CM6A 2XWVA 5LTCA 3GYYA 4PETA 4N15A 2PFZA 4PFBA 3FXBA 4P56A 4XFEA 4PFRA 2WX9A 4X04A 4N8YA 4P1EA 2ZZXA 4NG7A 4MNPA 4PF6A 4YICA 5I7IA 2VPOA 2CEXA 2ZZWA 4YZZA 3B50A 4DI3D
chains in the Genus database with same CATH superfamily
3UIFA 2I58A 4IGTA 3MP6A 4ZEBA 2Y5KA 5F24A 3P7IA 4GWXA 4PGNA 4JB7A 3TTLA 1D3KA 2AYSA 1NUZA 5CI5A 1DOTA 3V5AA 1URGA 2BJJX 1FTKA 1FPKA 3IOTA 3EHUA 1UTBA 3IFCA 3LC8A 1Y9UA 2CZKA 1L5TA 2XXRA 2FVZA 4QFKA 4ELRA 4YU0A 5ELVA 5KCJA 4BDMA 3SDFA 1BIYA 4H8IA 3CHGA 4KHZE 2THIA 5IGAA 3E79A 4P9KA 3VVEA 1IEJA 2DS9A 1EYIA 4GX3A 4YB6A 2F35A 4PDHA 2XXXA 3SZPA 2Y7KA 4C1TA 4QF9A 3O6HA 4MIJA 4P3LA 3RYDA 1LBVA 1H43A 3GYYA 4PQJA 1FJ9A 2XXHA 3OO7A 5ET5A 3TTKA 3OXNA 2A5TA 5AE4A 1URSA 3ZKLA 1PB9A 4QRZA 1B3GA 2FA7A 2DVCA 4UA8A 2O1LA 4MNPA 5FTHA 3JYRA 3IX1A 4JVIA 4R6YA 4FAJA 1ATGA 1XOCA 4Z7EA 4YZZA 5A5XB 3E3KA 2F3DA 3CFZA 4OERA 3EHSA 3Q25A 4NWCA 2QMXA 5I57A 4KCDA 1ZKBA 3E9XA 5L9MA 3CG1A 1XI6A 4ZDMA 4LN5A 4R73A 2O51A 2O84X 4GWYA 5IZ3A 2ZYMA 4EQ7A 3TTNA 4YMBA 2HAVA 3TEPA 1N04A 4NWDA 2OBGA 3HPIA 3FJMA 1CE2A 1PB7A 4F29A 1OQGA 3V89B 4NQ8A 2DXYA 1SQYA 1XVXA 3PPOA 1US4A 1ZBMA 1USYE 4YAHX 1B58A 4OVQA 3U1OA 3I6VA 3S4UA 3C31A 2F3BA 3RTWB 2WYPA 1IMCA 3F11A 2R71A 4DLDA 3IK6B 4MLQA 4BLAA 4AS4A 4EUOA 5IKBA 1EH3A 3MZBA 3D4CA 3N94A 4N13A 1FTLA 3T96B 1IXHA 4EF2A 3MZ1A 2I3WA 1FPDA 1DTGA 2BJIA 5EYHA 2P2AA 1G0IA 2I0CA 4GWWA 3KBRA 1BTJA 3CSBA 4KXPA 1NH8A 3PD9A 1LLSA 3S9EA 4PFYA 1P1WA 2X7QA 1TWYA 4XIGQ 1VFEA 1B52A 5T3JA 4POWA 4GL8A 3H4ZA 4N07A 3KFMA 3KN7A 3D4GA 4NF5A 4GVOA 5L9OA 4R72A 5LOMA 4P47A 3MZ9A 4Q30B 2FBPA 3PPNA 1NV1A 1XHYA 1LGBC 4GXAA 1INPA 1DTZA 1JVYA 2PFYA 3PPRA 4OVPA 4R9FA 4R6KA 1B1HA 3SEUA 4QSCA 2F34A 2G29A 4GBWA 3KBZA 1QGXA 4OVRA 2L5VA 4HE1A 2Y7RA 4Q0CA 3O2AA 1FBPA 1FPFA 5DVJA 1FCKA 3UA8A 4PDDA 1MH4A 2NOOA 4F2QA 1JVXA 5DVFA 4DI4B 1MY0A 2WBDA 4EF1A 4PGPA 4TOZA 1DBZA 3ILTB 4GFRA 2I4BA 1P99A 2DQVA 3V8XB 3IFAA 1MXVA 2RC8A 4ELQA 3CIJA 3M3LA 4XTCQ 1Y1ZA 1GV8A 3LV0A 2E1SA 1S50A 2Z22A 4TQUQ 4JDFA 4DCXA 4I62A 1HSLA 3KN3A 3C32A 4OYVA 1FJ6A 1MPDA 5JEIA 3GZGA 3R7XA 3K4UA 3MW0A 1NFTA 5I57B 4DXCA 2JJKA 3Q26A 3S9LC 1POY1 2R9JA 5I7IA 2XXQA 1FQBA 4LA9A 5TPAB 3HSTA 3L6HA 2CZHA 4FJPA 4ZE8A 4DI3D 1DSNA 1FTAA 1LBWA 4HW8A 3B6WA 3FVNA 4DXUA 4U4XA 1NNPA 4RY1A 3K6XA 3HCQA 4PBHA 4ZS9A 2Z8EA 4U2RA 5DT6A 4LONB 2XXPA 1N0TA 4TLMB 4XKQA 5AA1A 2F8DA 4I3YA 1SD3A 1UTHA 5K2YA 1LCFA 4GX4A 4N8GA 4RPNA 5FBPA 4MFIA 1JW1A 4QFLA 3W9VA 1JW5A 1R6ZA 4E0WA 2UXAA 4LVQA 4IY6A 4U4SA 4MCOA 4F31B 4LATA 2YLNA 2XX7A 2XXVA 3VXCA 3IB2A 3RPWA 1J1NA 5H8SA 3W9WA 4MLVA 4LZ8A 5I5PA 1QW0A 1MQJA 4QSEA 3FZVA 5H8HA 1ZU0A 1LFIA 1PB8A 4PFIA 4BDOA 2Q74A 2HFBA 3HV1A 4LQ5A 4FIMA 3T9HB 3IO4A 1IZ1A 4OA4A 1MQDA 4RJZA 1OIBA 2XWVA 3UGWA 1Y3NA 5FHMA 1RKMA 2XXYA 1B6HA 2DE4A 1SI1A 5F1QA 1YPNA 4LQ2A 1IMDA 3ECRA 3CR9A 1QVSA 4O7IA 4U1OA 1FPJA 5ET8A 2REGA 1ZTYA 2VPOA 5DTBA 5TP9B 2XD3A 3B6TA 1NUWA 3RUMA 3TELA 2F78A 2Q9TA 1N3WA 4PAKA 1NMUA 4G8HA 4F1UA 4C1UA 1XS5A 1EZ9A 2DWAA 4PAFA 1LAXA 2DVZA 1NI9A 1OLAA 3QK6A 2Z8FA 4BDRA 3CFXA 3WAEA 2UVHA 2I48A 1FQCA 4N6KA 3KJTA 3M3FA 1PEBA 2Q89A 1N76A 1MM7A 5CBSA 4X9TA 2PYYA 5KCJB 1FTMA 3T1BA 4U22A 2ZXTA 3ZS6A 3MVXA 5H8HB 2ZYNA 1GGGA 1H76A 4IO3A 5AA4A 2V3TA 4Z0IA 3SESA 4N4UA 3U93A 4GQOA 3O66A 3TTMA 2G93A 3IOVA 1KA0A 2WBBA 3FGSA 1FW0A 2X26A 4YKIA 2XWKA 1IMFA 3MVWA 4ZEIA 3C35A 3O29A 4PFTA 1B3EA 3G3HA 4JBZA 4IB2A 2AIXA 5IZZA 1MXYA 1LAHE 3LUZA 5EYGA 2UVJA 2PFZA 1JW4A 1I6QA 3HN0A 1NV7A 2XXUA 1POTA 4NF8B 2UYEA 4BDLA 4Q5TA 4U23A 2PX1A 1ANFA 3SETA 2QS1A 4H6DA 1S7YA 3K1NA 4YKKA 4F1VA 1M5EA 1Y4CA 4AB6A 2ABHA 3K6VA 2XHDA 5HPQA 4KYSA 3H06B 2V3UA 2UYFA 2KR0A 3PTYA 3K6UA 3MPLA 1QJMA 3USDA 2YPNA 5I56A 2FIEA 3KOTA 3RTFB 4XF5A 4PCDA 2XXKA 1T0KA 1MXWA 4GWSA 1BK4A 3TCGA 3VXBA 4R2BA 3PUVE 4DZ1A 2HPGA 4OESA 2Y5LA 3TODA 4O7MA 5M2VA 3T66A 4ZEDA 1A55A 1ZJLA 1Y1MA 4OENA 4NF8A 4GWOA 3A09A 4AS5A 4QHQA 4ZEFA 3KSXA 3U8QA 1PC3A 3FD3A 4M1VA 2DWIA 2DWJA 1FBDA 1FPLA 4QXDA 4ONYA 5EHMA 2XA5A 4OEUA 4P8BA 4PE5B 1TFDA 3CSGA 3MWBA 1N84A 2FNCA 5LTCA 5TP9A 5JTYA 1P1NA 4GWZA 2HXRA 1AOVA 4YKPA 4FEDA 1Q1KA 3SEVA 2ZZXA 4G77A 4KPTA 3RLFE 3PGFA 3ILUB 4RK2A 2ZMBA 1B0HA 5KZTA 4OMBA 3H6UA 4MF3A 3Q28A 2B3BA 3UORA 2F36A 3GLBA 5DEXA 1G0HA 3IL1B 1A8EA 2V84A 2O1MA 4PTKA 1ZMGA 4ECFA 2ZNSA 5H8FB 5IM2A 3QYTA 1B7HA 3RPLB 3TQLA 1K9ZA 1MXXA 2NVUB 2FIXA 3LSLA 2H25A 4THIA 2D21A 1AWBA 2CMOA 1WDNA 1R1NA 4PP0A 2F7AA 4F18A 1B3HA 1PBPA 2QJEA 2R8TA 4MNCA 1FBGA 2ZZVA 5I58A 3TAJA 1MY4A 3MVZA 4EDPA 2WEFA 4JXIA 3OENA 2Q8JA 5IZ3B 4NF4B 3E4RA 1EZPA 2B65A 1LFHA 3E78A 1MQHA 1K9YA 3HFUA 2O7IA 1B9JA 3DELB 4O3AA 1VSOA 1FQEA 2F97A 2LAOA 3MVYA 2VHAA 4X04A 1P1QA 3D1RA 1D9VA 4O3CA 3T9UA 2XXWA 4NG7A 2ESNA 3TTRA 4P0GA 3KOSA 1O63A 2DYXA 3DM0A 1GR2A 1B4ZA 1NKXA 3E13X 2DWHA 1S9TA 4HCWA 4I8CA 3LSFB 4KD5A 2PT2A 1IITA 1XVYA 4KFQA 2VOZA 4G68C 2NUVA 4MNIA 4R9GA 1NL5A 2RC7A 3CG3A 4F39A 3M3KA 4OQOA 1YCJA 1A40A 1AIVA 1US5A 3QUJA 2DP8A 2O68A 4HS7A 4ZZEA 1IXIA 4NF6B 3BFTA 1B32A 2OX3A 4FECA 1D9QA 5I84A 1TXFA 5EQ8A 3OELA 3A3UA 1FQDA 3GBAA 3H7MA 4R2FA 3KEIA 2NXOA 4H45A 1B5HA 3K6WA 1RDZA 2H5YA 3H6WA 1MXZA 4RA1A 2HHMA 1MY3A 3VE1B 2B4LA 5BWJA 5I59A 4F3BA 5J16A 3FVOA 3FVGA 1MH3A 4ELOA 4MH5A 1IQ7A 3S9NC 1LEVA 3K00A 2OWZA 4P56A 3IAZA 1OQHA 1SPIA 3B6QA 2NWJA 4P1EA 1B2HA 1DK4A 1LBCA 2P0SA 1MY1A 1H45A 5DYHA 2P1SA 1JP4A 5AA2B 4H46A 3HO7A 1FQAA 1O7TA 1Q9DA 1D9YA 2QL3A 1UIVA 3QSLA 1A54A 5J1DA 5KDTA 1VR5A 1MQGA 3EPEA 3OEKA 2HEUA 2W7YA 3H6VA 4ZZAA 1BLFA 2VGQA 1SDXA 4IO5A 4ZECA 1DCUA 3GBBA 2O6AA 4MHFA 3BIGA 3H6TA 2HZKA 1B4HA 5ITOA 3OSQA 4YB7A 2I4CA 4ZE9A 5TPAA 1KZ8A 1FPBA 1EYJA 3Q27A 1M5DA 2PCRA 3C33A 1B40A 2MKZA 1M5BA 5DEXB 4H5FA 3QIMA 3PV0E 2WYKA 4FBPA 4RXLA 2KQZA 3THIA 2OWSA 1EZOA 3DP4A 4E0XA 3PD8A 4LZ7A 1ZLQA 4OWDA 3FIRA 4JWYA 4EQBA 3HHGA 4O8MA 3C34A 3VLWA 1MQIA 5ESYA 3C36A 3K02A 3ROJA 2O69A 4NMYA 1RDXA 1ELJA 1TFAA 3U94A 1FPEA 3ODBA 2Y84A 2AL4A 4PF6A 2A5TB 4G4PA 3SKPA 3OO8A 3SERA 1HSJA 3UP9A 2CEXA 1YTVA 4RPOA 5EYFA 3RGYA 3TUSA 5B70A 1N7XA 3WAFA 5A5XA 1MPCA 1MDQA 4PE3A 2QFLA 3EF7A 2I6EA 3PUZE 4ESWA 3TPAA 4GXSB 1ZIUA 2DDKA 2P3VA 1A7LA 4H8JA 4HXVA 2HZLA 1SVXB 1BP5A 1M5FA 3RQTA 4JWXA 4WEPA 1DMBA 1Q35A 3EHTA 4H67A 1QUKA 1FPIA 2Q2AA 2H98A 3R26A 4N81A 4NN3A 5CC2A 4H0WA 5ITPA 3CFLA 1SBPA 4G61A 3IO6A 2ZNUA 4PFWA 3OOAA 1KWHA 4F3GA 5I2NA 4H65A 4IO6A 4QFPA 1P1OA 2I49A 1CB6A 1URDA 4XEQA 1NNFA 2YJPA 1TT1A 2PVUA 3PMWA 2GRVA 3KJ7A 4PF8A 4N6PA 3MUQA 3ZKKA 2F7BA 2Y7IA 2RINA 4OFJA 3QXMA 4HE2A 4GBVA 4PETA 2H4IA 1RYXA 1GVCA 3RT6B 4WXJA 3MP1A 3G3IA 2RCAA 3FXRA 3FV2A 5KDTB 3U72A 1NV5A 3IB0A 2M8CA 3RT8A 3OMBA 5I2KB 3B50A 3KC0A 3FXUA 3T22A 2HAUA 5EHSA 2FHYA 3FATA 3SEXA 5CMCA 3VV5A 4KR5A 4UABA 1LCTA 1N7WA 3TYHA 3EN3A 2QVVA 5BUUA 3K2DA 4C0RA 4F3PA 1LSTA 4MJOA 1FBHA 3DP8A 3EKIA 2Q88A 2F6PA 4MEVA 1WVJA 3MBPA 4GRKA 1NUYA 4P0IA 4NX1A 3LSXA 5FTIA 1IIWA 4NHBA 4FATA 1SW2A 1YXIA 1DPPA 3K01A 3T0JA 2B3FA 1EYKA 1IMAA 2VPNA 2ONKE 1NH7A 4I9DA 4NF4A 1Y20A 1SYIA 2ZYKA 4GOTA 3TCHA 5I2KA 4YKJA 5ET6A 1UIUA 1P1UA 1USYH 1MPBA 1FTJA 3TKDA 4N15A 2IA4A 2F5XA 3B7DA 4ESXA 4YMAA 3VLUA 2WX9A 5HM4B 1B5JA 1SYHA 1FPGA 3K1MA 4QFNA 1FTOA 1Y3PA 4EXLA 1Z7NE 1B3LA 1B1XA 3MP8A 4IR8A 3MSTA 2HCAA 5AA3A 4OVSA 3M8UA 2V3QA 5LDZA 4IO4A 4PBQA 4LUBA 5IAIA 1QULA 2GQ1A 2HXWA 1UTHB 4L17A 4ELPA 1MDP1 1LAGE 4WKMA 4OHNA 4HCYA 4F22A 5I58B 3PPPA 5ICQA 4HE0A 1CNQA 5L8DA 4DE8A 1I6BA 4NE4A 4OANA 2F6GA 5AA4B 2Q2CA 1PDAA 4X8RA 2XWOA 2QSXA 3BKIB 5CBRA 2RKMA 1XT8A 1LB8A 3N6TA 4N6DA 4OFOA 2ANJA 3SEWA 5FHNA 4KQPA 2VD3A 3U65A 4I3EA 3O6IA 2XD2A 4AB5A 3PMXA 3MQ9A 4M4GA 1B5IA 1JEVA 1F9BA 3KG2A 1LFGA 1FQFA 3C4MA 3AXFA 3V83A 2Z8DA 5HBCA 4PFBA 4PFRA 3R6UA 3BBRA 2FYIA 1IXCA 2GH9A 3VFJA 4IO7A 1R9QA 4F19A 4YICA 1SW5A 4F1YA 4OETA 2XX8A 2QS2A 2ZZWA 3K0VA 3FASA 5CMBA 5I2NB 4U21A 4YB5A 4BDQA 5AA2D 5F7VA 1DPEA 1YAEA 2VD2A 1D4NA 1FBEA 3T93B 3T9VA 4XKPA 4OXVA 3QAXA 4DIGA 3HHFA 1IMEA 3FXQA 3JV9A 4DCYA 3VVDA 2IEEA 4G68A 3PUWE 2X7PA 3MC2A 4MAGA 1B51A 1IXGA 4JVDA 4NAPA 4OTEA 2DE3A 1LBBA 2Q8MA 3O6GA 1FBCA 4KI0E 3G3GA 3VDFA 2GHAA 1QUJA 3TMGA 1KA1A 3FUZA 3G3FA 3G3KA 4RYAA 4MX6A 3H3GA 1OLCA 5H8FA 2KLFA 4XKRA 4OEVA 1MXUA 2I3VA 4R6HA 4PAIA 3KSJA 5CMKA 2RC9A 3IB1A 5JTYB 2DXRA 3TDJA 2ZNTA 3MJNA 1NV0A 2OJTA 5H8QA 2O7UA 3ONMA 2ALUA 5DW8A 4U1ZA 2CZIA 4GIZA 3TZAA 4JSDA 2XX9A 4OZ9A 2E0SA 2H9BA 4NEDA 4R75A 3OO9A 4RNSA 1R9LA 2UVGA 2OZZA 4XKNA 1VFDA 3IJXB 3LBSA 3S9MC 1WODA 1I6AA 1NNKA 3BFUA 3CRBA 4P1LA 4ZEKA 4JVCA 2V93A 1RDYA 4KCCA 1IMBA 3JZJA 1O64A 1A8FA 2V25A 1SI0A 4LZ5A 5TU0A 1RYOA 4I1DA 1LBZA 3IJOB 4AQ4A 1B7ZA 3OO6A 4QBAA 1NNTA 4IGRA 2QRYA 2XXTA 4PC9A 1QKBA 1UQWA 1Y4TA 1NV6A 3U92A 4N91A 5K2XA 3KC1A 4TLLB 2H99A 2AL5A 5ICTA 1NV2A 2DE2A 4F3SA 1LBYA 2REJA 3N6UA 4F2OA 4KYDA 3ZSFA 3B8BA 3O9PA 4I40A 1FBFA 3IOUA 4EQ9A 3NOHA 3G7WA 1N3XA 4NF0A 5L9SA 2GHBA 1QUIA 4G2ZA 3FJGA 1AMFA 3I3VA 5JK4A 1NV3A 4LP2B 2RF1A 4NF6A 5FHOA 4PFUA 4FE8A 5EQ7A 1B05A 2QS3A 4ISUA 1SW1A 1UTBB 1OVTA 3S2VA 3TCFA 1OVBA 3K1PA 2R6GE 4UACA 3VLVA 4NTLA 3T9XB 5ET7A 4EXKA 1QKAA 1XC1A 4G8MA 2F7CA 2CZLA 1Y3QA 4OFLA 3O28A 2QS4A 4NGUA 1LB9A 3ISPA 3A3CA 4POXA 1H44A 4GWUA 5CMMA 5ISUA 5I59B 1GTKA 3G3JA 1SW4A 4KYEA 2UVIA 5DVIA 4JWOA 2Y7PA 5EQAA 4GLIA 4X48A 3I5OA 5H8NB 1M5CA 2ONSA 1NV4A 3A29A 2PMSA 3UK4A 3KZGA 3N26A 3LR1A 2Y7WA 3IORA 3LUYA 4FORA 3W15C 2PT1A 2QVUA 3RN8A 2QVRA 4X1BA 3PPQA 4P11A 1IUDA 3O97A 3PUYE 4DDDA 3MYUA 4GD5A 4JSOA 3SEYA 1JNFA 1MY2A 4XXUA 4MMPA 3QMFA 2CEYA 2XWIA 1JQFA 4X1DA 1FRPA 2QPQA 2WKYA 3RNNA 1PBQA 4R74A 3IR1A 3MPKA 1AH5A 3CI8A 1YYZA 4N17A 3TFLA 5I56B 2RCBA 3TQWA 3MAMA 4GF8A 2B4MA 2Z23A 3FVKA 4GX6A 4MBPA 5CRYA 3KGCA 3LSWA 5I3SA 3QUFA 2OCUA 2ONRA 4HTGA 1LAFE 2I0BA 1MM6A 4OVJA 1MRPA 1B46A 3C9HA 5H8QB 5AA2A 4G8NA 5B7DA 3GXAA 5IZ1A 5H8NA 3N5LA 3FV1A 1JEUA 3EQ1A 4OVTA 3FBPA 4O94A 4ND9A 1YZ0A 2DOJA 3UN6A 4QFOA 4K3FA 1A99A 4BDNA 2A5SA 4H1XA 3RPLA 4IY5A 2P3NA 1VDWA 4Q8RA 1B3FA 1I69A 1LBXA 1BKAA 2XXIA 2QMWA 4RK9A 3L6GA 1H3DA 3H03A 2V4CA 1FSAA 1OMPA 1B0LA 1NUXA 4WEDA 2GFEA 4NF5B 2OWTA 3IOWA 2OK2A 1MG1A 3OSRA 1EU8A 4G68B 1II5A 1B7UA 1AL3A 4DXBA 4GL0A 3Q29A 3DLNA 2VT5A 2OLBA 3DP6A 1HSEA 1MS7A 5CM6A 3OD7A 3OEMA 2HQ0A 3CVGA 2VP1A 2DSFA 5EQ9A 1JETA 4O3BA 3PMVA 4FEBA 3FXBA 4XFEA 2D3IA 3FJ7A 1VE4A 2D5WA 2PBWA 2ZYOA 4N8YA 4IO2A 3RY3A 3BIHA 3KN8A 3PUXE 4H5GA 3VVFA 5A5LA 1Z7ME 3PU5A 4QSDA
chains in the Genus database with same CATH topology
4OVSA 1FTAA 1LBWA 4H46A 4PAKA 4OVTA 4UABA 1Q9DA 3FBPA 2Y5KA 4O94A 5F24A 4NGUA 4F1UA 1FBEA 1YZ0A 3ISPA 4GWXA 4PE3A 1XI6A 2QVVA 4P1LA 4P47A 2KR0A 2V3QA 3PTYA 2QFLA 2FBPA 4JVCA 4LN5A 1RDYA 5J1DA 5LDZA 4PBQA 1NUZA 4PAFA 1IMBA 1NV1A 4GWYA 4PBHA 5IZ3A 1G0HA 4MJOA 2DVZA 2FIEA 1NI9A 1FPKA 2GQ1A 1INPA 1FBHA 2DDKA 4MNIA 2PFYA 3EKIA 2P3VA 2XXKA 4GWUA 4PCDA 4PTKA 4XF5A 4OVPA 4HXVA 1IMEA 5IM2A 4HCYA 3RPLB 4GWSA 1BK4A 4I3YA 2HZLA 4N6KA 1K9ZA 1LBZA 1DCUA 3IFCA 2FIXA 3RPLA 4MEVA 4QBAA 4GX4A 2HPGA 4N8GA 4MAGA 4GBWA 4NQ8A 1NUYA 4HE0A 3KBZA 1QGXA 4MHFA 2Y5LA 4PC9A 4OVRA 5EQAA 4NX1A 2L5VA 1NV6A 3BIGA 3W9VA 4HE1A 1AWBA 2HZKA 4JVDA 4X9TA 2CZKA 4N91A 1CNQA 1NV4A 3KC1A 2FVZA 4NHBA 1FBPA 3A29A 4NAPA 1FPFA 1FPIA 1VDWA 1YXIA 2DE3A 2P3NA 4MCOA 4PDDA 4OANA 4PGNA 1LBXA 2OX3A 3T0JA 3T1BA 1KZ8A 4N81A 2R8TA 1NV2A 4MNCA 1D9QA 1EYKA 4NN3A 4O7MA 4X8RA 1IMAA 2VPNA 2DE2A 1FPBA 5EQ8A 1LBYA 1EYJA 4OVQA 1FBGA 2PCRA 2ZZVA 2V4CA 2XWOA 2Q8MA 4DI4B 1FSAA 1FBCA 2QVUA 2QVRA 2WBDA 4G61A 4N4UA 2F3BA 4AS5A 2MKZA 4PGPA 1NUXA 2WYPA 3CHGA 3B8BA 4N6DA 4H45A 1DBZA 1IMCA 3W9WA 5I5PA 5JK4A 4I40A 3MYUA 1RDZA 4F18A 3U65A 1KA0A 1KA1A 2WBBA 2WYKA 2KQZA 2WEFA 3E79A 1FBDA 4FBPA 4I3EA 1FBFA 4M1VA 4P9KA 1FPLA 4QXDA 3IFAA 2XWKA 4MX6A 5IZ3B 4MMPA 3NOHA 4XEQA 2HHMA 3QMFA 4PFIA 1EYIA 2CEYA 1IMFA 2XA5A 2Q74A 2XWIA 4GX3A 4P8BA 4AS4A 4NF0A 5FBPA 2B4LA 5ET6A 1FRPA 2QPQA 4PDHA 3LV0A 3SZPA 4PAIA 4PF8A 5J16A 3E78A 5IZZA 2VT5A 4MIJA 4OA4A 4P3LA 1K9YA 1YYZA 3HFUA 3LUZA 4O8MA 4N17A 5CM6A 5IGAA 2XWVA 5LTCA 3RYDA 1LBVA 1FPDA 4HE2A 5EYGA 4GBVA 3GYYA 5ET5A 1FJ9A 1FJ6A 5EQ9A 5ESYA 2BJIA 2B4MA 4N15A 4PETA 1NV3A 5EYHA 3ROJA 2PFZA 1LEVA 1NV0A 1G0IA 4PFBA 3FXBA 2OWZA 2F5XA 4P56A 4GX6A 4GWWA 1NV7A 1SPIA 4XFEA 4PFRA 2DE4A 4KXPA 4GWZA 2HXRA 2WX9A 1RDXA 5EQ7A 5DW8A 1FPGA 2JJKA 4X04A 5I3SA 1IMDA 1FPEA 2CZIA 3D1RA 5T3JA 4F19A 4N8YA 4P1EA 2ZZXA 4NG7A 1DK4A 4MNPA 4PF6A 4YICA 4O7IA 5I7IA 4JVIA 5ET7A 1FPJA 5ET8A 2VPOA 2CEXA 3BIHA 1NV5A 2ZZWA 1NUWA 4IR8A 3B50A 4YZZA 3MSTA 2CZHA 3KC0A 5A5LA 2F3DA 1JP4A 4F1VA 4DI3D 2FHYA 5IZ1A 4HCWA 2Q9TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OVS A;  4PAK A;  4OVT A;  4UAB A;  4O94 A;  4NGU A;  4PGN A;  4PE3 A;  4P1L A;  4P47 A;  4LN5 A;  4PBQ A;  4PAF A;  4PBH A;  4MNI A;  2PFY A;  4XF5 A;  4PCD A;  2XXK A;  4OVP A;  5IM2 A;  2HZL A;  4N6K A;  4MEV A;  2HPG A;  4N8G A;  4MAG A;  4NQ8 A;  4MHF A;  4PC9 A;  4OVR A;  4NX1 A;  2HZK A;  4N91 A;  4NHB A;  4NAP A;  4MCO A;  4PDD A;  4OAN A;  4NN3 A;  4O7M A;  4MNC A;  4X8R A;  2VPN A;  4DI4 B;  4OVQ A;  2ZZV A;  2V4C A;  2XWO A;  4N4U A;  4PGP A;  2WYP A;  4N6D A;  5I5P A;  2WYK A;  3U65 A;  5IGA A;  4P9K A;  2XWK A;  4MX6 A;  4MMP A;  4XEQ A;  4PFI A;  2XA5 A;  2CEY A;  2XWI A;  4P8B A;  4NF0 A;  4PDH A;  4PAI A;  4PF8 A;  5IZZ A;  4MIJ A;  4OA4 A;  4P3L A;  4O8M A;  4N17 A;  5CM6 A;  2XWV A;  5LTC A;  3GYY A;  4PET A;  4N15 A;  2PFZ A;  4PFB A;  3FXB A;  4P56 A;  4XFE A;  4PFR A;  2WX9 A;  4X04 A;  4N8Y A;  4P1E A;  2ZZX A;  4NG7 A;  4MNP A;  4PF6 A;  4YIC A;  5I7I A;  2VPO A;  2CEX A;  2ZZW A;  4YZZ A;  3B50 A;  4DI3 D; 
#chains in the Genus database with same CATH topology
 3UIF A;  2I58 A;  4IGT A;  3MP6 A;  4ZEB A;  2Y5K A;  5F24 A;  3P7I A;  4GWX A;  4PGN A;  4JB7 A;  3TTL A;  1D3K A;  2AYS A;  1NUZ A;  5CI5 A;  1DOT A;  3V5A A;  1URG A;  2BJJ X;  1FTK A;  1FPK A;  3IOT A;  3EHU A;  1UTB A;  3IFC A;  3LC8 A;  1Y9U A;  2CZK A;  1L5T A;  2XXR A;  2FVZ A;  4QFK A;  4ELR A;  4YU0 A;  5ELV A;  5KCJ A;  4BDM A;  3SDF A;  1BIY A;  4H8I A;  3CHG A;  4KHZ E;  2THI A;  5IGA A;  3E79 A;  4P9K A;  3VVE A;  1IEJ A;  2DS9 A;  1EYI A;  4GX3 A;  4YB6 A;  2F35 A;  4PDH A;  2XXX A;  3SZP A;  2Y7K A;  4C1T A;  4QF9 A;  3O6H A;  4MIJ A;  4P3L A;  3RYD A;  1LBV A;  1H43 A;  3GYY A;  4PQJ A;  1FJ9 A;  2XXH A;  3OO7 A;  5ET5 A;  3TTK A;  3OXN A;  2A5T A;  5AE4 A;  1URS A;  3ZKL A;  1PB9 A;  4QRZ A;  1B3G A;  2FA7 A;  2DVC A;  4UA8 A;  2O1L A;  4MNP A;  5FTH A;  3JYR A;  3IX1 A;  4JVI A;  4R6Y A;  4FAJ A;  1ATG A;  1XOC A;  4Z7E A;  4YZZ A;  5A5X B;  3E3K A;  2F3D A;  3CFZ A;  4OER A;  3EHS A;  3Q25 A;  4NWC A;  2QMX A;  5I57 A;  4KCD A;  1ZKB A;  3E9X A;  5L9M A;  3CG1 A;  1XI6 A;  4ZDM A;  4LN5 A;  4R73 A;  2O51 A;  2O84 X;  4GWY A;  5IZ3 A;  2ZYM A;  4EQ7 A;  3TTN A;  4YMB A;  2HAV A;  3TEP A;  1N04 A;  4NWD A;  2OBG A;  3HPI A;  3FJM A;  1CE2 A;  1PB7 A;  4F29 A;  1OQG A;  3V89 B;  4NQ8 A;  2DXY A;  1SQY A;  1XVX A;  3PPO A;  1US4 A;  1ZBM A;  1USY E;  4YAH X;  1B58 A;  4OVQ A;  3U1O A;  3I6V A;  3S4U A;  3C31 A;  2F3B A;  3RTW B;  2WYP A;  1IMC A;  3F11 A;  2R71 A;  4DLD A;  3IK6 B;  4MLQ A;  4BLA A;  4AS4 A;  4EUO A;  5IKB A;  1EH3 A;  3MZB A;  3D4C A;  3N94 A;  4N13 A;  1FTL A;  3T96 B;  1IXH A;  4EF2 A;  3MZ1 A;  2I3W A;  1FPD A;  1DTG A;  2BJI A;  5EYH A;  2P2A A;  1G0I A;  2I0C A;  4GWW A;  3KBR A;  1BTJ A;  3CSB A;  4KXP A;  1NH8 A;  3PD9 A;  1LLS A;  3S9E A;  4PFY A;  1P1W A;  2X7Q A;  1TWY A;  4XIG Q;  1VFE A;  1B52 A;  5T3J A;  4POW A;  4GL8 A;  3H4Z A;  4N07 A;  3KFM A;  3KN7 A;  3D4G A;  4NF5 A;  4GVO A;  5L9O A;  4R72 A;  5LOM A;  4P47 A;  3MZ9 A;  4Q30 B;  2FBP A;  3PPN A;  1NV1 A;  1XHY A;  1LGB C;  4GXA A;  1INP A;  1DTZ A;  1JVY A;  2PFY A;  3PPR A;  4OVP A;  4R9F A;  4R6K A;  1B1H A;  3SEU A;  4QSC A;  2F34 A;  2G29 A;  4GBW A;  3KBZ A;  1QGX A;  4OVR A;  2L5V A;  4HE1 A;  2Y7R A;  4Q0C A;  3O2A A;  1FBP A;  1FPF A;  5DVJ A;  1FCK A;  3UA8 A;  4PDD A;  1MH4 A;  2NOO A;  4F2Q A;  1JVX A;  5DVF A;  4DI4 B;  1MY0 A;  2WBD A;  4EF1 A;  4PGP A;  4TOZ A;  1DBZ A;  3ILT B;  4GFR A;  2I4B A;  1P99 A;  2DQV A;  3V8X B;  3IFA A;  1MXV A;  2RC8 A;  4ELQ A;  3CIJ A;  3M3L A;  4XTC Q;  1Y1Z A;  1GV8 A;  3LV0 A;  2E1S A;  1S50 A;  2Z22 A;  4TQU Q;  4JDF A;  4DCX A;  4I62 A;  1HSL A;  3KN3 A;  3C32 A;  4OYV A;  1FJ6 A;  1MPD A;  5JEI A;  3GZG A;  3R7X A;  3K4U A;  3MW0 A;  1NFT A;  5I57 B;  4DXC A;  2JJK A;  3Q26 A;  3S9L C;  1POY 1;  2R9J A;  5I7I A;  2XXQ A;  1FQB A;  4LA9 A;  5TPA B;  3HST A;  3L6H A;  2CZH A;  4FJP A;  4ZE8 A;  4DI3 D;  1DSN A;  1FTA A;  1LBW A;  4HW8 A;  3B6W A;  3FVN A;  4DXU A;  4U4X A;  1NNP A;  4RY1 A;  3K6X A;  3HCQ A;  4PBH A;  4ZS9 A;  2Z8E A;  4U2R A;  5DT6 A;  4LON B;  2XXP A;  1N0T A;  4TLM B;  4XKQ A;  5AA1 A;  2F8D A;  4I3Y A;  1SD3 A;  1UTH A;  5K2Y A;  1LCF A;  4GX4 A;  4N8G A;  4RPN A;  5FBP A;  4MFI A;  1JW1 A;  4QFL A;  3W9V A;  1JW5 A;  1R6Z A;  4E0W A;  2UXA A;  4LVQ A;  4IY6 A;  4U4S A;  4MCO A;  4F31 B;  4LAT A;  2YLN A;  2XX7 A;  2XXV A;  3VXC A;  3IB2 A;  3RPW A;  1J1N A;  5H8S A;  3W9W A;  4MLV A;  4LZ8 A;  5I5P A;  1QW0 A;  1MQJ A;  4QSE A;  3FZV A;  5H8H A;  1ZU0 A;  1LFI A;  1PB8 A;  4PFI A;  4BDO A;  2Q74 A;  2HFB A;  3HV1 A;  4LQ5 A;  4FIM A;  3T9H B;  3IO4 A;  1IZ1 A;  4OA4 A;  1MQD A;  4RJZ A;  1OIB A;  2XWV A;  3UGW A;  1Y3N A;  5FHM A;  1RKM A;  2XXY A;  1B6H A;  2DE4 A;  1SI1 A;  5F1Q A;  1YPN A;  4LQ2 A;  1IMD A;  3ECR A;  3CR9 A;  1QVS A;  4O7I A;  4U1O A;  1FPJ A;  5ET8 A;  2REG A;  1ZTY A;  2VPO A;  5DTB A;  5TP9 B;  2XD3 A;  3B6T A;  1NUW A;  3RUM A;  3TEL A;  2F78 A;  2Q9T A;  1N3W A;  4PAK A;  1NMU A;  4G8H A;  4F1U A;  4C1U A;  1XS5 A;  1EZ9 A;  2DWA A;  4PAF A;  1LAX A;  2DVZ A;  1NI9 A;  1OLA A;  3QK6 A;  2Z8F A;  4BDR A;  3CFX A;  3WAE A;  2UVH A;  2I48 A;  1FQC A;  4N6K A;  3KJT A;  3M3F A;  1PEB A;  2Q89 A;  1N76 A;  1MM7 A;  5CBS A;  4X9T A;  2PYY A;  5KCJ B;  1FTM A;  3T1B A;  4U22 A;  2ZXT A;  3ZS6 A;  3MVX A;  5H8H B;  2ZYN A;  1GGG A;  1H76 A;  4IO3 A;  5AA4 A;  2V3T A;  4Z0I A;  3SES A;  4N4U A;  3U93 A;  4GQO A;  3O66 A;  3TTM A;  2G93 A;  3IOV A;  1KA0 A;  2WBB A;  3FGS A;  1FW0 A;  2X26 A;  4YKI A;  2XWK A;  1IMF A;  3MVW A;  4ZEI A;  3C35 A;  3O29 A;  4PFT A;  1B3E A;  3G3H A;  4JBZ A;  4IB2 A;  2AIX A;  5IZZ A;  1MXY A;  1LAH E;  3LUZ A;  5EYG A;  2UVJ A;  2PFZ A;  1JW4 A;  1I6Q A;  3HN0 A;  1NV7 A;  2XXU A;  1POT A;  4NF8 B;  2UYE A;  4BDL A;  4Q5T A;  4U23 A;  2PX1 A;  1ANF A;  3SET A;  2QS1 A;  4H6D A;  1S7Y A;  3K1N A;  4YKK A;  4F1V A;  1M5E A;  1Y4C A;  4AB6 A;  2ABH A;  3K6V A;  2XHD A;  5HPQ A;  4KYS A;  3H06 B;  2V3U A;  2UYF A;  2KR0 A;  3PTY A;  3K6U A;  3MPL A;  1QJM A;  3USD A;  2YPN A;  5I56 A;  2FIE A;  3KOT A;  3RTF B;  4XF5 A;  4PCD A;  2XXK A;  1T0K A;  1MXW A;  4GWS A;  1BK4 A;  3TCG A;  3VXB A;  4R2B A;  3PUV E;  4DZ1 A;  2HPG A;  4OES A;  2Y5L A;  3TOD A;  4O7M A;  5M2V A;  3T66 A;  4ZED A;  1A55 A;  1ZJL A;  1Y1M A;  4OEN A;  4NF8 A;  4GWO A;  3A09 A;  4AS5 A;  4QHQ A;  4ZEF A;  3KSX A;  3U8Q A;  1PC3 A;  3FD3 A;  4M1V A;  2DWI A;  2DWJ A;  1FBD A;  1FPL A;  4QXD A;  4ONY A;  5EHM A;  2XA5 A;  4OEU A;  4P8B A;  4PE5 B;  1TFD A;  3CSG A;  3MWB A;  1N84 A;  2FNC A;  5LTC A;  5TP9 A;  5JTY A;  1P1N A;  4GWZ A;  2HXR A;  1AOV A;  4YKP A;  4FED A;  1Q1K A;  3SEV A;  2ZZX A;  4G77 A;  4KPT A;  3RLF E;  3PGF A;  3ILU B;  4RK2 A;  2ZMB A;  1B0H A;  5KZT A;  4OMB A;  3H6U A;  4MF3 A;  3Q28 A;  2B3B A;  3UOR A;  2F36 A;  3GLB A;  5DEX A;  1G0H A;  3IL1 B;  1A8E A;  2V84 A;  2O1M A;  4PTK A;  1ZMG A;  4ECF A;  2ZNS A;  5H8F B;  5IM2 A;  3QYT A;  1B7H A;  3RPL B;  3TQL A;  1K9Z A;  1MXX A;  2NVU B;  2FIX A;  3LSL A;  2H25 A;  4THI A;  2D21 A;  1AWB A;  2CMO A;  1WDN A;  1R1N A;  4PP0 A;  2F7A A;  4F18 A;  1B3H A;  1PBP A;  2QJE A;  2R8T A;  4MNC A;  1FBG A;  2ZZV A;  5I58 A;  3TAJ A;  1MY4 A;  3MVZ A;  4EDP A;  2WEF A;  4JXI A;  3OEN A;  2Q8J A;  5IZ3 B;  4NF4 B;  3E4R A;  1EZP A;  2B65 A;  1LFH A;  3E78 A;  1MQH A;  1K9Y A;  3HFU A;  2O7I A;  1B9J A;  3DEL B;  4O3A A;  1VSO A;  1FQE A;  2F97 A;  2LAO A;  3MVY A;  2VHA A;  4X04 A;  1P1Q A;  3D1R A;  1D9V A;  4O3C A;  3T9U A;  2XXW A;  4NG7 A;  2ESN A;  3TTR A;  4P0G A;  3KOS A;  1O63 A;  2DYX A;  3DM0 A;  1GR2 A;  1B4Z A;  1NKX A;  3E13 X;  2DWH A;  1S9T A;  4HCW A;  4I8C A;  3LSF B;  4KD5 A;  2PT2 A;  1IIT A;  1XVY A;  4KFQ A;  2VOZ A;  4G68 C;  2NUV A;  4MNI A;  4R9G A;  1NL5 A;  2RC7 A;  3CG3 A;  4F39 A;  3M3K A;  4OQO A;  1YCJ A;  1A40 A;  1AIV A;  1US5 A;  3QUJ A;  2DP8 A;  2O68 A;  4HS7 A;  4ZZE A;  1IXI A;  4NF6 B;  3BFT A;  1B32 A;  2OX3 A;  4FEC A;  1D9Q A;  5I84 A;  1TXF A;  5EQ8 A;  3OEL A;  3A3U A;  1FQD A;  3GBA A;  3H7M A;  4R2F A;  3KEI A;  2NXO A;  4H45 A;  1B5H A;  3K6W A;  1RDZ A;  2H5Y A;  3H6W A;  1MXZ A;  4RA1 A;  2HHM A;  1MY3 A;  3VE1 B;  2B4L A;  5BWJ A;  5I59 A;  4F3B A;  5J16 A;  3FVO A;  3FVG A;  1MH3 A;  4ELO A;  4MH5 A;  1IQ7 A;  3S9N C;  1LEV A;  3K00 A;  2OWZ A;  4P56 A;  3IAZ A;  1OQH A;  1SPI A;  3B6Q A;  2NWJ A;  4P1E A;  1B2H A;  1DK4 A;  1LBC A;  2P0S A;  1MY1 A;  1H45 A;  5DYH A;  2P1S A;  1JP4 A;  5AA2 B;  4H46 A;  3HO7 A;  1FQA A;  1O7T A;  1Q9D A;  1D9Y A;  2QL3 A;  1UIV A;  3QSL A;  1A54 A;  5J1D A;  5KDT A;  1VR5 A;  1MQG A;  3EPE A;  3OEK A;  2HEU A;  2W7Y A;  3H6V A;  4ZZA A;  1BLF A;  2VGQ A;  1SDX A;  4IO5 A;  4ZEC A;  1DCU A;  3GBB A;  2O6A A;  4MHF A;  3BIG A;  3H6T A;  2HZK A;  1B4H A;  5ITO A;  3OSQ A;  4YB7 A;  2I4C A;  4ZE9 A;  5TPA A;  1KZ8 A;  1FPB A;  1EYJ A;  3Q27 A;  1M5D A;  2PCR A;  3C33 A;  1B40 A;  2MKZ A;  1M5B A;  5DEX B;  4H5F A;  3QIM A;  3PV0 E;  2WYK A;  4FBP A;  4RXL A;  2KQZ A;  3THI A;  2OWS A;  1EZO A;  3DP4 A;  4E0X A;  3PD8 A;  4LZ7 A;  1ZLQ A;  4OWD A;  3FIR A;  4JWY A;  4EQB A;  3HHG A;  4O8M A;  3C34 A;  3VLW A;  1MQI A;  5ESY A;  3C36 A;  3K02 A;  3ROJ A;  2O69 A;  4NMY A;  1RDX A;  1ELJ A;  1TFA A;  3U94 A;  1FPE A;  3ODB A;  2Y84 A;  2AL4 A;  4PF6 A;  2A5T B;  4G4P A;  3SKP A;  3OO8 A;  3SER A;  1HSJ A;  3UP9 A;  2CEX A;  1YTV A;  4RPO A;  5EYF A;  3RGY A;  3TUS A;  5B70 A;  1N7X A;  3WAF A;  5A5X A;  1MPC A;  1MDQ A;  4PE3 A;  2QFL A;  3EF7 A;  2I6E A;  3PUZ E;  4ESW A;  3TPA A;  4GXS B;  1ZIU A;  2DDK A;  2P3V A;  1A7L A;  4H8J A;  4HXV A;  2HZL A;  1SVX B;  1BP5 A;  1M5F A;  3RQT A;  4JWX A;  4WEP A;  1DMB A;  1Q35 A;  3EHT A;  4H67 A;  1QUK A;  1FPI A;  2Q2A A;  2H98 A;  3R26 A;  4N81 A;  4NN3 A;  5CC2 A;  4H0W A;  5ITP A;  3CFL A;  1SBP A;  4G61 A;  3IO6 A;  2ZNU A;  4PFW A;  3OOA A;  1KWH A;  4F3G A;  5I2N A;  4H65 A;  4IO6 A;  4QFP A;  1P1O A;  2I49 A;  1CB6 A;  1URD A;  4XEQ A;  1NNF A;  2YJP A;  1TT1 A;  2PVU A;  3PMW A;  2GRV A;  3KJ7 A;  4PF8 A;  4N6P A;  3MUQ A;  3ZKK A;  2F7B A;  2Y7I A;  2RIN A;  4OFJ A;  3QXM A;  4HE2 A;  4GBV A;  4PET A;  2H4I A;  1RYX A;  1GVC A;  3RT6 B;  4WXJ A;  3MP1 A;  3G3I A;  2RCA A;  3FXR A;  3FV2 A;  5KDT B;  3U72 A;  1NV5 A;  3IB0 A;  2M8C A;  3RT8 A;  3OMB A;  5I2K B;  3B50 A;  3KC0 A;  3FXU A;  3T22 A;  2HAU A;  5EHS A;  2FHY A;  3FAT A;  3SEX A;  5CMC A;  3VV5 A;  4KR5 A;  4UAB A;  1LCT A;  1N7W A;  3TYH A;  3EN3 A;  2QVV A;  5BUU A;  3K2D A;  4C0R A;  4F3P A;  1LST A;  4MJO A;  1FBH A;  3DP8 A;  3EKI A;  2Q88 A;  2F6P A;  4MEV A;  1WVJ A;  3MBP A;  4GRK A;  1NUY A;  4P0I A;  4NX1 A;  3LSX A;  5FTI A;  1IIW A;  4NHB A;  4FAT A;  1SW2 A;  1YXI A;  1DPP A;  3K01 A;  3T0J A;  2B3F A;  1EYK A;  1IMA A;  2VPN A;  2ONK E;  1NH7 A;  4I9D A;  4NF4 A;  1Y20 A;  1SYI A;  2ZYK A;  4GOT A;  3TCH A;  5I2K A;  4YKJ A;  5ET6 A;  1UIU A;  1P1U A;  1USY H;  1MPB A;  1FTJ A;  3TKD A;  4N15 A;  2IA4 A;  2F5X A;  3B7D A;  4ESX A;  4YMA A;  3VLU A;  2WX9 A;  5HM4 B;  1B5J A;  1SYH A;  1FPG A;  3K1M A;  4QFN A;  1FTO A;  1Y3P A;  4EXL A;  1Z7N E;  1B3L A;  1B1X A;  3MP8 A;  4IR8 A;  3MST A;  2HCA A;  5AA3 A;  4OVS A;  3M8U A;  2V3Q A;  5LDZ A;  4IO4 A;  4PBQ A;  4LUB A;  5IAI A;  1QUL A;  2GQ1 A;  2HXW A;  1UTH B;  4L17 A;  4ELP A;  1MDP 1;  1LAG E;  4WKM A;  4OHN A;  4HCY A;  4F22 A;  5I58 B;  3PPP A;  5ICQ A;  4HE0 A;  1CNQ A;  5L8D A;  4DE8 A;  1I6B A;  4NE4 A;  4OAN A;  2F6G A;  5AA4 B;  2Q2C A;  1PDA A;  4X8R A;  2XWO A;  2QSX A;  3BKI B;  5CBR A;  2RKM A;  1XT8 A;  1LB8 A;  3N6T A;  4N6D A;  4OFO A;  2ANJ A;  3SEW A;  5FHN A;  4KQP A;  2VD3 A;  3U65 A;  4I3E A;  3O6I A;  2XD2 A;  4AB5 A;  3PMX A;  3MQ9 A;  4M4G A;  1B5I A;  1JEV A;  1F9B A;  3KG2 A;  1LFG A;  1FQF A;  3C4M A;  3AXF A;  3V83 A;  2Z8D A;  5HBC A;  4PFB A;  4PFR A;  3R6U A;  3BBR A;  2FYI A;  1IXC A;  2GH9 A;  3VFJ A;  4IO7 A;  1R9Q A;  4F19 A;  4YIC A;  1SW5 A;  4F1Y A;  4OET A;  2XX8 A;  2QS2 A;  2ZZW A;  3K0V A;  3FAS A;  5CMB A;  5I2N B;  4U21 A;  4YB5 A;  4BDQ A;  5AA2 D;  5F7V A;  1DPE A;  1YAE A;  2VD2 A;  1D4N A;  1FBE A;  3T93 B;  3T9V A;  4XKP A;  4OXV A;  3QAX A;  4DIG A;  3HHF A;  1IME A;  3FXQ A;  3JV9 A;  4DCY A;  3VVD A;  2IEE A;  4G68 A;  3PUW E;  2X7P A;  3MC2 A;  4MAG A;  1B51 A;  1IXG A;  4JVD A;  4NAP A;  4OTE A;  2DE3 A;  1LBB A;  2Q8M A;  3O6G A;  1FBC A;  4KI0 E;  3G3G A;  3VDF A;  2GHA A;  1QUJ A;  3TMG A;  1KA1 A;  3FUZ A;  3G3F A;  3G3K A;  4RYA A;  4MX6 A;  3H3G A;  1OLC A;  5H8F A;  2KLF A;  4XKR A;  4OEV A;  1MXU A;  2I3V A;  4R6H A;  4PAI A;  3KSJ A;  5CMK A;  2RC9 A;  3IB1 A;  5JTY B;  2DXR A;  3TDJ A;  2ZNT A;  3MJN A;  1NV0 A;  2OJT A;  5H8Q A;  2O7U A;  3ONM A;  2ALU A;  5DW8 A;  4U1Z A;  2CZI A;  4GIZ A;  3TZA A;  4JSD A;  2XX9 A;  4OZ9 A;  2E0S A;  2H9B A;  4NED A;  4R75 A;  3OO9 A;  4RNS A;  1R9L A;  2UVG A;  2OZZ A;  4XKN A;  1VFD A;  3IJX B;  3LBS A;  3S9M C;  1WOD A;  1I6A A;  1NNK A;  3BFU A;  3CRB A;  4P1L A;  4ZEK A;  4JVC A;  2V93 A;  1RDY A;  4KCC A;  1IMB A;  3JZJ A;  1O64 A;  1A8F A;  2V25 A;  1SI0 A;  4LZ5 A;  5TU0 A;  1RYO A;  4I1D A;  1LBZ A;  3IJO B;  4AQ4 A;  1B7Z A;  3OO6 A;  4QBA A;  1NNT A;  4IGR A;  2QRY A;  2XXT A;  4PC9 A;  1QKB A;  1UQW A;  1Y4T A;  1NV6 A;  3U92 A;  4N91 A;  5K2X A;  3KC1 A;  4TLL B;  2H99 A;  2AL5 A;  5ICT A;  1NV2 A;  2DE2 A;  4F3S A;  1LBY A;  2REJ A;  3N6U A;  4F2O A;  4KYD A;  3ZSF A;  3B8B A;  3O9P A;  4I40 A;  1FBF A;  3IOU A;  4EQ9 A;  3NOH A;  3G7W A;  1N3X A;  4NF0 A;  5L9S A;  2GHB A;  1QUI A;  4G2Z A;  3FJG A;  1AMF A;  3I3V A;  5JK4 A;  1NV3 A;  4LP2 B;  2RF1 A;  4NF6 A;  5FHO A;  4PFU A;  4FE8 A;  5EQ7 A;  1B05 A;  2QS3 A;  4ISU A;  1SW1 A;  1UTB B;  1OVT A;  3S2V A;  3TCF A;  1OVB A;  3K1P A;  2R6G E;  4UAC A;  3VLV A;  4NTL A;  3T9X B;  5ET7 A;  4EXK A;  1QKA A;  1XC1 A;  4G8M A;  2F7C A;  2CZL A;  1Y3Q A;  4OFL A;  3O28 A;  2QS4 A;  4NGU A;  1LB9 A;  3ISP A;  3A3C A;  4POX A;  1H44 A;  4GWU A;  5CMM A;  5ISU A;  5I59 B;  1GTK A;  3G3J A;  1SW4 A;  4KYE A;  2UVI A;  5DVI A;  4JWO A;  2Y7P A;  5EQA A;  4GLI A;  4X48 A;  3I5O A;  5H8N B;  1M5C A;  2ONS A;  1NV4 A;  3A29 A;  2PMS A;  3UK4 A;  3KZG A;  3N26 A;  3LR1 A;  2Y7W A;  3IOR A;  3LUY A;  4FOR A;  3W15 C;  2PT1 A;  2QVU A;  3RN8 A;  2QVR A;  4X1B A;  3PPQ A;  4P11 A;  1IUD A;  3O97 A;  3PUY E;  4DDD A;  3MYU A;  4GD5 A;  4JSO A;  3SEY A;  1JNF A;  1MY2 A;  4XXU A;  4MMP A;  3QMF A;  2CEY A;  2XWI A;  1JQF A;  4X1D A;  1FRP A;  2QPQ A;  2WKY A;  3RNN A;  1PBQ A;  4R74 A;  3IR1 A;  3MPK A;  1AH5 A;  3CI8 A;  1YYZ A;  4N17 A;  3TFL A;  5I56 B;  2RCB A;  3TQW A;  3MAM A;  4GF8 A;  2B4M A;  2Z23 A;  3FVK A;  4GX6 A;  4MBP A;  5CRY A;  3KGC A;  3LSW A;  5I3S A;  3QUF A;  2OCU A;  2ONR A;  4HTG A;  1LAF E;  2I0B A;  1MM6 A;  4OVJ A;  1MRP A;  1B46 A;  3C9H A;  5H8Q B;  5AA2 A;  4G8N A;  5B7D A;  3GXA A;  5IZ1 A;  5H8N A;  3N5L A;  3FV1 A;  1JEU A;  3EQ1 A;  4OVT A;  3FBP A;  4O94 A;  4ND9 A;  1YZ0 A;  2DOJ A;  3UN6 A;  4QFO A;  4K3F A;  1A99 A;  4BDN A;  2A5S A;  4H1X A;  3RPL A;  4IY5 A;  2P3N A;  1VDW A;  4Q8R A;  1B3F A;  1I69 A;  1LBX A;  1BKA A;  2XXI A;  2QMW A;  4RK9 A;  3L6G A;  1H3D A;  3H03 A;  2V4C A;  1FSA A;  1OMP A;  1B0L A;  1NUX A;  4WED A;  2GFE A;  4NF5 B;  2OWT A;  3IOW A;  2OK2 A;  1MG1 A;  3OSR A;  1EU8 A;  4G68 B;  1II5 A;  1B7U A;  1AL3 A;  4DXB A;  4GL0 A;  3Q29 A;  3DLN A;  2VT5 A;  2OLB A;  3DP6 A;  1HSE A;  1MS7 A;  5CM6 A;  3OD7 A;  3OEM A;  2HQ0 A;  3CVG A;  2VP1 A;  2DSF A;  5EQ9 A;  1JET A;  4O3B A;  3PMV A;  4FEB A;  3FXB A;  4XFE A;  2D3I A;  3FJ7 A;  1VE4 A;  2D5W A;  2PBW A;  2ZYO A;  4N8Y A;  4IO2 A;  3RY3 A;  3BIH A;  3KN8 A;  3PUX E;  4H5G A;  3VVF A;  5A5L A;  1Z7M E;  3PU5 A;  4QSD A; 
#chains in the Genus database with same CATH homology
 4OVS A;  1FTA A;  1LBW A;  4H46 A;  4PAK A;  4OVT A;  4UAB A;  1Q9D A;  3FBP A;  2Y5K A;  4O94 A;  5F24 A;  4NGU A;  4F1U A;  1FBE A;  1YZ0 A;  3ISP A;  4GWX A;  4PE3 A;  1XI6 A;  2QVV A;  4P1L A;  4P47 A;  2KR0 A;  2V3Q A;  3PTY A;  2QFL A;  2FBP A;  4JVC A;  4LN5 A;  1RDY A;  5J1D A;  5LDZ A;  4PBQ A;  1NUZ A;  4PAF A;  1IMB A;  1NV1 A;  4GWY A;  4PBH A;  5IZ3 A;  1G0H A;  4MJO A;  2DVZ A;  2FIE A;  1NI9 A;  1FPK A;  2GQ1 A;  1INP A;  1FBH A;  2DDK A;  4MNI A;  2PFY A;  3EKI A;  2P3V A;  2XXK A;  4GWU A;  4PCD A;  4PTK A;  4XF5 A;  4OVP A;  4HXV A;  1IME A;  5IM2 A;  4HCY A;  3RPL B;  4GWS A;  1BK4 A;  4I3Y A;  2HZL A;  4N6K A;  1K9Z A;  1LBZ A;  1DCU A;  3IFC A;  2FIX A;  3RPL A;  4MEV A;  4QBA A;  4GX4 A;  2HPG A;  4N8G A;  4MAG A;  4GBW A;  4NQ8 A;  1NUY A;  4HE0 A;  3KBZ A;  1QGX A;  4MHF A;  2Y5L A;  4PC9 A;  4OVR A;  5EQA A;  4NX1 A;  2L5V A;  1NV6 A;  3BIG A;  3W9V A;  4HE1 A;  1AWB A;  2HZK A;  4JVD A;  4X9T A;  2CZK A;  4N91 A;  1CNQ A;  1NV4 A;  3KC1 A;  2FVZ A;  4NHB A;  1FBP A;  3A29 A;  4NAP A;  1FPF A;  1FPI A;  1VDW A;  1YXI A;  2DE3 A;  2P3N A;  4MCO A;  4PDD A;  4OAN A;  4PGN A;  1LBX A;  2OX3 A;  3T0J A;  3T1B A;  1KZ8 A;  4N81 A;  2R8T A;  1NV2 A;  4MNC A;  1D9Q A;  1EYK A;  4NN3 A;  4O7M A;  4X8R A;  1IMA A;  2VPN A;  2DE2 A;  1FPB A;  5EQ8 A;  1LBY A;  1EYJ A;  4OVQ A;  1FBG A;  2PCR A;  2ZZV A;  2V4C A;  2XWO A;  2Q8M A;  4DI4 B;  1FSA A;  1FBC A;  2QVU A;  2QVR A;  2WBD A;  4G61 A;  4N4U A;  2F3B A;  4AS5 A;  2MKZ A;  4PGP A;  1NUX A;  2WYP A;  3CHG A;  3B8B A;  4N6D A;  4H45 A;  1DBZ A;  1IMC A;  3W9W A;  5I5P A;  5JK4 A;  4I40 A;  3MYU A;  1RDZ A;  4F18 A;  3U65 A;  1KA0 A;  1KA1 A;  2WBB A;  2WYK A;  2KQZ A;  2WEF A;  3E79 A;  1FBD A;  4FBP A;  4I3E A;  1FBF A;  4M1V A;  4P9K A;  1FPL A;  4QXD A;  3IFA A;  2XWK A;  4MX6 A;  5IZ3 B;  4MMP A;  3NOH A;  4XEQ A;  2HHM A;  3QMF A;  4PFI A;  1EYI A;  2CEY A;  1IMF A;  2XA5 A;  2Q74 A;  2XWI A;  4GX3 A;  4P8B A;  4AS4 A;  4NF0 A;  5FBP A;  2B4L A;  5ET6 A;  1FRP A;  2QPQ A;  4PDH A;  3LV0 A;  3SZP A;  4PAI A;  4PF8 A;  5J16 A;  3E78 A;  5IZZ A;  2VT5 A;  4MIJ A;  4OA4 A;  4P3L A;  1K9Y A;  1YYZ A;  3HFU A;  3LUZ A;  4O8M A;  4N17 A;  5CM6 A;  5IGA A;  2XWV A;  5LTC A;  3RYD A;  1LBV A;  1FPD A;  4HE2 A;  5EYG A;  4GBV A;  3GYY A;  5ET5 A;  1FJ9 A;  1FJ6 A;  5EQ9 A;  5ESY A;  2BJI A;  2B4M A;  4N15 A;  4PET A;  1NV3 A;  5EYH A;  3ROJ A;  2PFZ A;  1LEV A;  1NV0 A;  1G0I A;  4PFB A;  3FXB A;  2OWZ A;  2F5X A;  4P56 A;  4GX6 A;  4GWW A;  1NV7 A;  1SPI A;  4XFE A;  4PFR A;  2DE4 A;  4KXP A;  4GWZ A;  2HXR A;  2WX9 A;  1RDX A;  5EQ7 A;  5DW8 A;  1FPG A;  2JJK A;  4X04 A;  5I3S A;  1IMD A;  1FPE A;  2CZI A;  3D1R A;  5T3J A;  4F19 A;  4N8Y A;  4P1E A;  2ZZX A;  4NG7 A;  1DK4 A;  4MNP A;  4PF6 A;  4YIC A;  4O7I A;  5I7I A;  4JVI A;  5ET7 A;  1FPJ A;  5ET8 A;  2VPO A;  2CEX A;  3BIH A;  1NV5 A;  2ZZW A;  1NUW A;  4IR8 A;  3B50 A;  4YZZ A;  3MST A;  2CZH A;  3KC0 A;  5A5L A;  2F3D A;  1JP4 A;  4F1V A;  4DI3 D;  2FHY A;  5IZ1 A;  4HCW A;  2Q9T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...