1SW5A

Crystal structure of prox from archeoglobus fulgidus in the ligand free form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords osmoprotection protein (proX)
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
molecule tags Protein binding
total genus 97
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw5A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw5A02
5ICQA 4FAJA 5FHNA 4HCYA 5TP9A 3T22A 4YKJA 3KG2A 1I6BA 1EZPA 2B65A 5AA1A 3OO7A 1XT8A 1SW1A 2H25A 3KEIA 3U72A 4PFWA 3KGCA 3H6UA 1IXGA 1M5EA 4LONB 2HAUA 3FVNA 1FCKA 5CMKA 3HO7A 4H67A 3BFTA 2ZYKA 3THIA 1T0KA 1URSA 4NMYA 3FATA 3MVZA 3IJOB 3TEPA 3CI8A 1IXCA 5BWJA 3LUYA 4EXLA 3MVWA 4DCXA 1IUDA 1MM6A 3BFUA 1DTZA 2F8DA 5AA4A 3O66A 3PD8A 3PUXE 4R75A 5I57A 1MY1A 1II5A 3FXUA 3TCFA 4OFJA 1JEUA 2Q2AA 3G3GA 1MY3A 1PEBA 2RCAA 3PUYE 1LFGA 1JVXA 1UTBA 2VP1A 4XIGQ 2B3BA 3B7DA 2Q8JA 1QULA 3VLVA 3M8UA 2F6GA 3W15C 4ZDMA 1GTKA 4RYAA 1CB6A 4UA8A 2Z22A 1FQAA 3G3JA 2XX9A 2ZNSA 2ZXTA 3K1PA 5I56A 3FD3A 2HZKA 3K0VA 2BJJX 2DE3A 2FA7A 2ONRA 1ATGA 2I0BA 1N3XA 5B70A 3ZSFA 1M5DA 1H3DA 3C32A 3RUMA 3HCQA 5H8NB 2GRVA 4AB6A 3RT8A 3B6QA 3JV9A 3Q29A 3TQLA 5L9OA 3HHGA 4EF2A 1URDA 1I6AA 1B58A 3TDJA 4F1YA 3PPQA 2HEUA 1SI0A 4MLQA 3USDA 1VFEA 1MPBA 3MW0A 1PBPA 2OWSA 3UP9A 1D3KA 4OYVA 2V3TA 1SYHA 4EQBA 1DPEA 1VR5A 2YJPA 4FEBA 4M4GA 2HQ0A 3FVKA 2VD2A 1ZIUA 1B2HA 3ODBA 4NEDA 3MPKA 2XXHA 2Y84A 1F9BA 1Y1ZA 3SERA 1VE4A 1EU8A 1ZLQA 4H65A 4XKQA 4GRKA 4P11A 2XXQA 3CSBA 4ND9A 5JK4A 4NTLA 2F5XA 3TYHA 3K00A 2NUVA 1XS5A 2M8CA 4DXBA 2A5SA 2DOJA 2Y7WA 1MQHA 2ALUA 1ANFA 1MXYA 4ZZEA 4QFOA 3MP6A 4MFIA 4OTEA 3RTWB 2R71A 2R9JA 3WAEA 1B0LA 1P1WA 4I9DA 1LFIA 1POTA 2I4BA 1OLCA 4EXKA 5H8NA 2XXUA 2DP8A 3OSQA 2PX1A 2O51A 3N26A 4C1TA 4NF4A 2YPNA 4Q5TA 1NKXA 1Q1KA 1O64A 3TUSA 4LZ5A 3E9XA 4THIA 3M3KA 1TT1A 3C9HA 3T9XB 2OLBA 3FZVA 4R72A 4DCYA 3VE1B 3JYRA 1US5A 1B0HA 1JETA 1PDAA 1QUIA 1UTHB 4EUOA 5JTYA 2Q9TA 1MXUA 2I0CA 4HW8A 2XXWA 2QMXA 5L9SA 2A5TB 4EQ9A 5TU0A 4QSCA 3MP8A 4G68B 2UXAA 4NF5A 3T66A 2PYYA 2ABHA 1MDQA 4QSEA 2HXWA 4ZEFA 4ELOA 5CMMA 3T9HB 5I59A 1UIUA 4PE5B 4LQ2A 5EHMA 3KSJA 5AA2A 3FASA 4R9FA 4WKMA 3MQ9A 2ZYNA 3SEXA 1LAFE 4ZS9A 3CIJA 1I6QA 3FVOA 2UVGA 3IL1B 4QFLA 1D4NA 3SESA 3HSTA 1L5TA 2AL5A 3K6UA 3RPWA 4H8JA 1TWYA 2O6AA 1Y1MA 4F3BA 1N7WA 1A8EA 2THIA 3DLNA 3FJMA 5BUUA 4RY1A 2Y7IA 3P7IA 4F2OA 3SEYA 3MC2A 1B4ZA 1A7LA 3T9UA 3O9PA 2DQVA 2Q88A 3SEVA 1M5BA 1Q35A 2RC9A 3SEWA 3IB0A 4JSDA 3CSGA 4LZ7A 2O69A 3GBAA 3TZAA 1UTHA 5H8FB 4C1UA 2D21A 1NNFA 4IO3A 1MXVA 2E0SA 4LZ8A 4RNSA 4MH5A 2A5TA 3DELB 3TELA 4F3PA 4UACA 2I58A 2VOZA 4POXA 3LSFB 2YLNA 1P1OA 1HSLA 1Y3PA 4FJPA 4U22A 1ZU0A 4DZ1A 3N94A 1M5FA 4U21A 4ZEBA 1BTJA 2CMOA 4R73A 4I62A 3C31A 4QF9A 1XHYA 3Q27A 3S9NC 4XKRA 3GXAA 4OESA 1ZMGA 2NXOA 4KQPA 4K3FA 3U92A 4F19A 1D9VA 5I57B 2O1MA 4GXSB 2QS4A 1FTJA 2F35A 2F78A 2UYFA 3FXRA 4AQ4A 3FXQA 4E0WA 4OEVA 3E3KA 3FGSA 3QYTA 4XXUA 4H5FA 3C35A 1XC1A 3CFXA 2OJTA 1ZBMA 4H0WA 3FIRA 1S50A 3U93A 4DDDA 3Q26A 3RT6B 4M1VA 3EHUA 4X9TA 3TAJA 4POWA 3VVFA 1QVSA 3FV1A 1OVTA 3EQ1A 1CE2A 5EHSA 5EYFA 3IB2A 3WAFA 3OOAA 4RPNA 1MY4A 1NMUA 3ECRA 5I56B 2QS1A 3GLBA 2DWHA 2Y7KA 3S4UA 4F1UA 3QXMA 4R6HA 3CVGA 3OEKA 3I6VA 4KYEA 5H8FA 1KWHA 4MF3A 1IQ7A 1B52A 3I3VA 3K6WA 2PT1A 4RJZA 4GF8A 3OSRA 4PFYA 2Q89A 5IKBA 4KFQA 4GIZA 2ONSA 2CZLA 1DMBA 5B7DA 2F7AA 3O6HA 1GVCA 4JWXA 4NF8A 2QMWA 5FTHA 4KYSA 1MDP1 2O1LA 2H9BA 4F3GA 3UIFA 3V8XB 4EQ7A 4TLLB 4F39A 2PT2A 4P0IA 1UQWA 4G8MA 2F34A 4XKPA 1J1NA 1N76A 1QKBA 2O84X 1B1XA 2X7QA 3IB1A 4KCCA 1PB9A 4JB7A 3CRBA 2IA4A 3PMXA 3PPOA 4ELPA 4RA1A 3MZBA 4YKKA 3MVYA 1Y3QA 1XVXA 4QRZA 2DS9A 3FJ7A 1MM7A 4IO5A 4G77A 4R9GA 4OWDA 3QSLA 3H06B 1M5CA 5L9MA 3KOTA 1JW5A 3TTMA 2LAOA 4G8NA 3KJ7A 3G3HA 5AA2D 4YZZA 4U4SA 1LSTA 3U94A 2DVCA 1A54A 2H98A 4OENA 3E13X 5F1QA 3VLUA 3HV1A 2QPQA 4GWOA 4OETA 4RPOA 2DXRA 4R2BA 4EDPA 3FJGA 3RTFB 1H44A 4NF4B 3OELA 1DOTA 2VGQA 2NOOA 4I1DA 1OVBA 2OWTA 4OERA 3SKPA 3R6UA 1TXFA 5ELVA 1Z7ME 4ZEDA 2ZYMA 3UN6A 2RINA 3LSXA 3PU5A 5JTYB 3K4UA 4EF1A 1B1HA 1FQFA 4ESXA 1MXXA 4H8IA 2VHAA 1OLAA 2DE4A 4O3CA 1MG1A 4YICA 3KFMA 4OHNA 2FNCA 4JWOA 1IIWA 4I8CA 5I2NB 1A40A 3MJNA 2O7IA 1B3GA 4NF5B 4ZEIA 3A3UA 1O7TA 3PV0E 1D9YA 3T96B 5ITOA 4YKPA 3RGYA 3LSLA 2GHAA 3IOVA 3H6WA 5I59B 4OFOA 5AA2B 3L6GA 1DSNA 2XXRA 4FEDA 2XX8A 4IO7A 4L17A 4OFLA 1MQJA 2X7PA 4YU0A 2W7YA 3W9WA 2XXIA 2UYEA 1P1QA 3DP6A 3D4GA 1MH3A 1B6HA 3JZJA 3IO6A 4G2ZA 3ONMA 1Y9UA 2B3FA 5AA3A 1TFAA 1LB8A 3MBPA 3IK6B 1H45A 4R6YA 5DVFA 3M3FA 3OO6A 4C0RA 2RC8A 1ELJA 4GOTA 3SETA 1US4A 1B7HA 1MS7A 2Y7RA 1LB9A 2H5YA 1IEJA 4ISUA 1LAHE 4QSDA 2XX7A 5H8HA 3K6XA 1YCJA 3AXFA 2ZNTA 3U1OA 4IY6A 1MY2A 4OEUA 3ILUB 1R6ZA 3MUQA 4DE8A 1N0TA 4IO2A 2P2AA 1JVYA 3PMVA 4GL8A 3K6VA 1Y4TA 5I2NA 1OQHA 3PUVE 5LOMA 3E4RA 2DYXA 4GD5A 1MY0A 1P99A 5DEXB 3EN3A 3EHTA 1I69A 2H4IA 4JSOA 3MAMA 4U1OA 3RN8A 3K2DA 2I4CA 1XOCA 1H76A 3A09A 5L8DA 4ESWA 1Y20A 1B7ZA 4ZEKA 4F22A 3G7WA 1USYE 2G29A 3HN0A 3SDFA 1MPDA 1Y4CA 5FHOA 1JQFA 1AIVA 4JDFA 2I3WA 2V3QA 2XXVA 1URGA 4XTCQ 4LQ5A 4F1VA 2V84A 3R26A 4PQJA 1WODA 2I3VA 1SBPA 1FTOA 5CM6A 4OVJA 1B32A 2DVZA 5CBSA 5I58B 4HTGA 4H1XA 1PB7A 3BKIB 4LATA 4PETA 3K01A 3OMBA 2RCBA 4ONYA 1MXZA 3K1NA 3D4CA 2QL3A 3DM0A 3V5AA 5FHMA 1WVJA 4BLAA 3N6UA 2P0SA 3B6TA 3S2VA 1OMPA 1NNTA 2VD3A 1FQCA 1B3EA 1FQEA 4TQUQ 4JBZA 4N6PA 5IAIA 3LR1A 4G4PA 1NNKA 2XXXA 3IR1A 2XXYA 2F7BA 2Y7PA 4R74A 3PD9A 3IX1A 1QUJA 1NNPA 1MPCA 1MXWA 5DEXA 3C34A 3F11A 4NWCA 4AB5A 1LLSA 2PVUA 4NF8B 4X48A 2PMSA 4OZ9A 4H5GA 2G93A 2I49A 3T9VA 2HZLA 1HSJA 3KN8A 3VXCA 3UGWA 1LGBC 3HPIA 1DPPA 1AOVA 2E1SA 5J1DA 3O6IA 4WEPA 4FECA 2XXPA 5KDTA 2RKMA 4IY5A 5F7VA 4F29A 4YMAA 3V83A 2ANJA 3ILTB 5DTBA 1WDNA 5I58A 2DE2A 3G3KA 4Z7EA 3H6VA 1R1NA 3TODA 1RYXA 3VDFA 1TFDA 1MQGA 3IAZA 5K2YA 2ZYOA 1P1UA 1HSEA 5ISUA 2UVJA 2OZZA 3HHFA 3L6HA 1R9QA 4BDRA 3CR9A 1GV8A 1SQYA 2ONKE 4P0GA 3TTNA 1EH3A 4BDMA 4TOZA 2XHDA 3C36A 3KN7A 3LC8A 4G8HA 2F6PA 1A55A 1BKAA 3S9EA 3CFZA 3N6TA 4IGTA 2OCUA 3O6GA 3FVGA 5M2VA 4GQOA 3KBRA 2V93A 1Z7NE 2V3UA 2QSXA 4ZE9A 3PGFA 3PMWA 4IO6A 4KYDA 3O29A 1B4HA 1JW1A 3S9LC 3QUJA 1IITA 1B5IA 3TTLA 3PPPA 1OQGA 1IZ1A 1BP5A 1FTMA 3G3IA 3O97A 5DT6A 3OENA 4PFUA 5H8SA 4U1ZA 3ZS6A 1Y3NA 3TTKA 4LA9A 4RXLA 4O3BA 1N3WA 3LSWA 1LAGE 3MZ9A 4YB6A 2NWJA 2HFBA 4R6KA 4F31B 1QJMA 3R7XA 1MH4A 3TTRA 2AYSA 4HS7A 2OK2A 1QUKA 4GFRA 4QFKA 2I6EA 3H7MA 1FTLA 3VVEA 2UVIA 1NH8A 2F36A 1PB8A 4KCDA 3G3FA 5ITPA 4BDOA 3M3LA 2XD2A 1B9JA 2DSFA 3SEUA 1YTVA 1S9TA 4WXJA 1ZJLA 2Z8DA 4ZZAA 4KHZE 2O7UA 2KLFA 3UK4A 3RLFE 3IJXB 4DXUA 1B5HA 1UIVA 1B3HA 5HM4B 3GZGA 3A3CA 2X26A 3I5OA 3PPNA 1VSOA 3VXBA 4O3AA 5TPAB 3RNNA 1SYIA 3C4MA 3TKDA 4ELRA 3N5LA 1SW4A 2PBWA 3H03A 2D3IA 1ZTYA 3O28A 1FTKA 5H8HB 2H99A 3MPLA 4MLVA 4RK9A 2P1SA 4GLIA 3IORA 4MBPA 3O2AA 2GFEA 1EZ9A 3MWBA 4YKIA 2FYIA 5KCJB 5CI5A 2V25A 3KN3A 1N84A 1GGGA 4PP0A 4X1DA 3UA8A 5CBRA 3CG3A 4DIGA 5ICTA 3BBRA 2DXYA 3K1MA 2ZNUA 4IO4A 3MZ1A 4BDNA 4N13A 4YB7A 4NWDA 3TQWA 2DWJA 4QFPA 3IOWA 1A8FA 1AMFA 3H6TA 4TLMB 5FTIA 1YPNA 3QK6A 1POY1 5A5XB 4RK2A 1SDXA 4X1BA 3KJTA 4F2QA 5CMBA 1PBQA 1LBBA 1B51A 2XXTA 5H8QB 1LAXA 5I2KB 4F18A 3UORA 3OO8A 1LFHA 5DVIA 3S9MC 4IB2A 4N07A 3OXNA 2AL4A 2DWIA 3VLWA 4YMBA 3QAXA 2HAVA 5JEIA 2F97A 5TPAA 4GL0A 2Z8EA 1H43A 3CFLA 1VFDA 3RQTA 3H4ZA 5DVJA 1SVXB 4Q0CA 4LP2B 4KR5A 3EPEA 1FQBA 5CC2A 1AH5A 3T93B 3TFLA 1P1NA 3FUZA 4Q30B 5KCJA 3DP8A 3KSXA 3TCGA 1B7UA 5DYHA 4HCWA 2WKYA 4F3SA 5AE4A 4ZE8A 3U8QA 1R9LA 1LCTA 4NF6B 2REGA 4FORA 4QHQA 1LCFA 2GHBA 2QRYA 3CG1A 1SD3A 1S7YA 3PUZE 1JNFA 3Q25A 4H6DA 3TPAA 2F7CA 3EHSA 3QUFA 1XVYA 1YAEA 3Q28A 4ECFA 5KDTB 5A5XA 4ELQA 1FQDA 1NFTA 2ESNA 3LBSA 4LUBA 4LVQA 4U23A 5H8QA 5I2KA 5CMCA 4GVOA 4OXVA 3IOUA 1B3FA 4Z0IA 3RY3A 1USYH 3GBBA 3IO4A 4KPTA 1IXIA 2Z23A 3OEMA 4YB5A 2QS3A 4GXAA 4OMBA 4FATA 1B05A 2DWAA 3IOTA 1MRPA 3EF7A 4XKNA 2XD3A 4E0XA 4QFNA 2OBGA 1EZOA 3C33A 1N7XA 2GH9A 3B6WA 5I84A 3KZGA 3FV2A 3MP1A 1O63A 3TCHA 3DP4A 4BDLA 2QJEA 3PPRA 1QW0A 1LBCA 4IGRA 4JWYA 5TP9B 4BDQA 1B40A 5HBCA 4G68C 4KD5A 3W9VA 4NE4A 4FE8A 4NF6A 2UVHA 4KI0E 5CRYA 3ZKLA 3V89B 1ZKBA 4G68A 1BIYA 4DXCA 2Z8FA 2R6GE 4OQOA 2HCAA 1PC3A 3VVDA 1B5JA 3OO9A 1SW5A 1RKMA 3QIMA 4PFTA 3OD7A 3ZKKA 3VFJA 1N04A 2D5WA 1SI1A 2NVUB 4U4XA 1IXHA 2AIXA 4ZECA 3H3GA 2QS2A 2ZMBA 4FIMA 1B3LA 5HPQA 2Q2CA 1BLFA 5AA4B 1DTGA 2RF1A 1NH7A 1FW0A 4WEDA 1OIBA 1SW2A 3KOSA 4YAHX 1NL5A 1AL3A 3K02A 3MVXA 2RC7A 5KZTA 4Q8RA 4R2FA 1QKAA 1A99A 1MQDA 1UTBB 5K2XA 1JEVA 4DLDA 2REJA 3TMGA 4JXIA 3PUWE 1MQIA 4U2RA 3VV5A 2IEEA 2O68A 1RYOA 1B46A 1GR2A 1JW4A 2I48A
chains in the Genus database with same CATH superfamily
5ICQA 1DK4A 4FAJA 5FHNA 4HCYA 5TP9A 3T22A 4YKJA 3KG2A 1I6BA 4P3LA 1EZPA 4PFIA 2B65A 5AA1A 3OO7A 1XT8A 1SW1A 2H25A 3KEIA 3U72A 4PFWA 3KGCA 4OA4A 3H6UA 1IXGA 1IMBA 1M5EA 4LONB 2HAUA 3FVNA 1FCKA 5CMKA 3HO7A 4H67A 3BFTA 2ZYKA 3THIA 1T0KA 2L5VA 1URSA 4PFRA 2WEFA 4NMYA 3FATA 3MVZA 3IJOB 3TEPA 2WYKA 3CI8A 1IXCA 5BWJA 3LUYA 4EXLA 3MVWA 4DCXA 1FPGA 1IUDA 1MM6A 3BFUA 1DTZA 3RYDA 2F8DA 5AA4A 4MAGA 3O66A 3PD8A 3PUXE 4AS5A 4R75A 5I57A 1MY1A 2GQ1A 1II5A 3EKIA 4P9KA 3FXUA 3TCFA 4OFJA 1JEUA 3LV0A 1FBGA 2Q2AA 3G3GA 1MY3A 1PEBA 2RCAA 3PUYE 1LFGA 1JVXA 1UTBA 2VP1A 4XIGQ 2KQZA 2B3BA 3B7DA 2Q8JA 1QULA 3VLVA 3M8UA 2F6GA 3W15C 4ZDMA 1GTKA 4RYAA 1CB6A 4X8RA 4UA8A 2Z22A 1FQAA 3G3JA 2XX9A 1IMEA 2OX3A 2ZNSA 2ZXTA 3K1PA 5I56A 3FD3A 4GX3A 5EQ9A 2HZKA 3K0VA 2BJJX 2DE3A 2FA7A 4PF6A 2ONRA 1ATGA 2I0BA 1FPBA 1N3XA 5B70A 5T3JA 5ET6A 3ZSFA 1M5DA 1H3DA 3C32A 3RUMA 5DW8A 3HCQA 5H8NB 4NN3A 2GRVA 4AB6A 3RT8A 3B6QA 3JV9A 3Q29A 3TQLA 5ESYA 5L9OA 4AS4A 3HHGA 4EF2A 1LBZA 1URDA 1I6AA 4NX1A 1B58A 3TDJA 4F1YA 3PPQA 2HEUA 1SI0A 4MLQA 3USDA 1FBPA 1VFEA 1MPBA 3MW0A 2QVRA 1PBPA 3U65A 4PE3A 2OWSA 3UP9A 1D3KA 4OYVA 2V3TA 1SYHA 4EQBA 1DPEA 1VR5A 2YJPA 4FEBA 4M4GA 2HQ0A 3FVKA 2VD2A 1ZIUA 5EQ8A 2QFLA 1B2HA 4NEDA 3ODBA 3MPKA 2XXHA 2Y84A 1F9BA 1Y1ZA 3SERA 1VE4A 1NV7A 1FPKA 1EU8A 1ZLQA 4H65A 4XKQA 4GRKA 4P11A 2XXQA 3CSBA 4ND9A 5JK4A 4NTLA 2F5XA 3TYHA 3K00A 2NUVA 1XS5A 2M8CA 4DXBA 1IMDA 4NHBA 2A5SA 2DOJA 2Y7WA 1MQHA 2ALUA 1RDXA 1ANFA 1MXYA 4ZZEA 3ROJA 4QFOA 4X04A 3MP6A 4MFIA 4OTEA 3RTWB 2R71A 2R9JA 3WAEA 1B0LA 1P1WA 4I9DA 2CEXA 4P47A 1LFIA 1POTA 2I4BA 3QMFA 1OLCA 4EXKA 5H8NA 2XXUA 2DP8A 3OSQA 1FJ6A 2PX1A 2O51A 3N26A 4C1TA 4NF4A 2YPNA 4O8MA 4Q5TA 1NKXA 1Q1KA 1O64A 3TUSA 4I40A 4LZ5A 3E9XA 4THIA 1BK4A 3M3KA 1TT1A 4UABA 3C9HA 3T9XB 2OLBA 4N17A 3FZVA 4R72A 4DCYA 3VE1B 3JYRA 1US5A 1B0HA 1FBFA 1JETA 1PDAA 2WBDA 1QUIA 1UTHB 4EUOA 5JTYA 2Q9TA 1MXUA 2I0CA 4HW8A 4MJOA 2XXWA 2QMXA 5L9SA 1FTAA 4PBHA 2A5TB 4EQ9A 5TU0A 4QSCA 3MP8A 4G68B 2UXAA 4NF5A 3T66A 2PYYA 2ABHA 1MDQA 4QSEA 2HXWA 4ZEFA 4ELOA 5CMMA 3T9HB 5I59A 1UIUA 4PTKA 4MNPA 4PE5B 4LQ2A 4OANA 5EHMA 4OVTA 3KSJA 5AA2A 5A5LA 3FASA 4R9FA 4WKMA 2P3NA 2Q8MA 3MQ9A 2ZYNA 3SEXA 2CEYA 1LAFE 4ZS9A 3CIJA 1I6QA 1K9ZA 3FVOA 2UVGA 3IL1B 4QFLA 1D4NA 3SESA 1KA1A 4QBAA 3HSTA 1L5TA 2AL5A 3K6UA 3RPWA 4H8JA 1TWYA 2O6AA 1Y1MA 4F3BA 1N7WA 1A8EA 1G0HA 2THIA 3DLNA 3FJMA 4IR8A 5BUUA 4RY1A 4PC9A 2Y7IA 3P7IA 1FRPA 4F2OA 3SEYA 3MC2A 1B4ZA 1A7LA 3T9UA 3O9PA 2DQVA 2Q88A 3SEVA 1M5BA 1Q35A 2RC9A 3SEWA 3IB0A 4JSDA 3CSGA 4KXPA 4LZ7A 2O69A 3GBAA 3NOHA 4O94A 3TZAA 1UTHA 5H8FB 4C1UA 2D21A 3ISPA 1NNFA 3KC1A 4IO3A 1MXVA 2E0SA 4JVDA 4LZ8A 4N6KA 4RNSA 4MH5A 2A5TA 3DELB 3TELA 4F3PA 4UACA 2I58A 2VOZA 4POXA 2CZIA 3LSFB 1NV2A 3MYUA 2YLNA 4N4UA 1P1OA 1HSLA 1Y3PA 4FJPA 1IMAA 1ZU0A 4U22A 4DZ1A 3N94A 1M5FA 4U21A 4ZEBA 1BTJA 1YZ0A 2CMOA 4R73A 2KR0A 4I62A 3C31A 1RDZA 1FBEA 4QF9A 1FJ9A 1XHYA 3Q27A 3S9NC 4XKRA 3GXAA 4OESA 1ZMGA 2NXOA 4PFBA 4KQPA 4K3FA 3U92A 4F19A 1D9VA 4PAIA 5I57B 2O1MA 4GXSB 2QS4A 1FTJA 2F35A 2F78A 2UYFA 3FXRA 4AQ4A 3FXQA 2FBPA 4E0WA 4OEVA 3E3KA 3FGSA 3QYTA 4XXUA 4H5FA 3C35A 1XC1A 3CFXA 2B4LA 2OJTA 1ZBMA 4H0WA 3FIRA 1S50A 3U93A 4DDDA 3Q26A 3RT6B 4M1VA 3EHUA 4X9TA 3TAJA 4POWA 3VVFA 1QVSA 3FV1A 1OVTA 4O7IA 3EQ1A 1CE2A 4P8BA 5EHSA 5EYFA 3IB2A 3WAFA 3OOAA 4RPNA 4LN5A 1MY4A 1NMUA 3ECRA 2QVUA 5I56B 2QS1A 3GLBA 2DWHA 2Y5KA 2Y7KA 3S4UA 4F1UA 3QXMA 4R6HA 3CVGA 3OEKA 3I6VA 4KYEA 4PDDA 5H8FA 1KWHA 4MF3A 1IQ7A 1B52A 1YXIA 3I3VA 3K6WA 2PT1A 4RJZA 4GF8A 2R8TA 3OSRA 4PFYA 2Q89A 5IKBA 4NAPA 2CZHA 1IMFA 4KFQA 4GIZA 2ONSA 2CZLA 1LEVA 1DMBA 5B7DA 2F7AA 3O6HA 1GVCA 4JWXA 4NF8A 2QMWA 4MMPA 5FTHA 4KYSA 1MDP1 2O1LA 2H9BA 4F3GA 3UIFA 4P1EA 1G0IA 3V8XB 4EQ7A 4TLLB 4F39A 2PT2A 4P0IA 1UQWA 4G8MA 1FBCA 2F34A 4XKPA 1J1NA 1N76A 1QKBA 2O84X 1B1XA 2X7QA 3IB1A 4KCCA 1PB9A 4JB7A 3CRBA 2IA4A 3PMXA 3PPOA 4ELPA 4RA1A 3MZBA 4HE0A 4YKKA 3MVYA 1Y3QA 1XVXA 4QRZA 2DS9A 3FJ7A 1MM7A 4IO5A 4G77A 2QVVA 4R9GA 4OWDA 4OVSA 3QSLA 3H06B 1M5CA 5L9MA 3KOTA 1JW5A 3TTMA 2LAOA 4G8NA 3KJ7A 3G3HA 5AA2D 4YZZA 4U4SA 5I7IA 4PCDA 1LSTA 4O7MA 3U94A 2DVCA 1A54A 4DI4B 2H98A 4OENA 3E13X 5F1QA 3VLUA 1QGXA 3FBPA 3HV1A 2QPQA 4GWOA 2XWVA 1KA0A 4OETA 4I3YA 2XWKA 4RPOA 2DXRA 4R2BA 5LTCA 4EDPA 3FJGA 3RTFB 4PAKA 1H44A 4NF4B 3OELA 1DOTA 2VGQA 2NOOA 4I1DA 1OVBA 2OWTA 1Q9DA 4OERA 3SKPA 3MSTA 3R6UA 1TXFA 5ELVA 1Z7ME 4ZEDA 2ZYMA 3UN6A 2RINA 3LSXA 3PU5A 5JTYB 3K4UA 4PAFA 1FPEA 4EF1A 1EYKA 4OVPA 1B1HA 1FQFA 4ESXA 1MXXA 4H8IA 2WYPA 2VHAA 1OLAA 2DE4A 4O3CA 2HXRA 1MG1A 4YICA 3KFMA 4OHNA 2FNCA 5IZ3B 4JWOA 1IIWA 4I8CA 5I2NB 1A40A 3MJNA 2O7IA 1B3GA 4NF5B 4ZEIA 3A3UA 1O7TA 1DBZA 3PV0E 2VPNA 1D9YA 3T96B 5ITOA 4YKPA 3RGYA 3LSLA 2GHAA 3IOVA 3H6WA 5IM2A 5I59B 4MEVA 4N81A 4OFOA 3GYYA 5AA2B 3L6GA 1DSNA 2ZZXA 4PDHA 2XXRA 4FEDA 2XX8A 4IO7A 4L17A 4OFLA 1MQJA 2X7PA 4YU0A 2P3VA 2W7YA 1FBHA 5F24A 3W9WA 1YYZA 2XXIA 1DCUA 2UYEA 1NUWA 1P1QA 3DP6A 3D4GA 1MH3A 1B6HA 3JZJA 3IO6A 4G2ZA 3ONMA 1Y9UA 2B3FA 5AA3A 3KBZA 1TFAA 1LBVA 1LB8A 3MBPA 3IK6B 1H45A 4R6YA 5DVFA 3M3FA 3OO6A 4C0RA 2RC8A 1ELJA 2FHYA 4GOTA 3SETA 1US4A 1B7HA 1MS7A 2Y7RA 2BJIA 1LB9A 2H5YA 1IEJA 4ISUA 1LAHE 4MHFA 4QSDA 2XX7A 5H8HA 3K6XA 1YCJA 3AXFA 2ZNTA 4GX6A 3U1OA 4IY6A 5IGAA 4N8GA 1MY2A 4OEUA 3ILUB 1R6ZA 5ET7A 3MUQA 4DE8A 1N0TA 4IO2A 2P2AA 1FPLA 1JVYA 4GL8A 3PMVA 5IZ3A 3K6VA 1Y4TA 5I2NA 1OQHA 3PUVE 5LOMA 3E4RA 5I5PA 2DYXA 4MNIA 4GD5A 1MY0A 1P99A 5DEXB 3EN3A 3EHTA 1I69A 2H4IA 2F3DA 4MIJA 4JSOA 1FBDA 3MAMA 2XA5A 4U1OA 3RN8A 3K2DA 3CHGA 2I4CA 1XOCA 1H76A 3A09A 5L8DA 4MX6A 4ESWA 1Y20A 1B7ZA 4ZEKA 5IZ1A 4F22A 4GBWA 2DDKA 3G7WA 2FIXA 1USYE 4QXDA 2G29A 3HN0A 3SDFA 5ET5A 1MPDA 4N8YA 1Y4CA 5FHOA 5EYGA 1JQFA 1AIVA 4JDFA 1SPIA 2I3WA 2V3QA 2XXVA 1URGA 4XTCQ 4LQ5A 4F1VA 2V84A 3FXBA 3R26A 4PQJA 1WODA 2I3VA 1SBPA 1FTOA 5CM6A 4OVJA 5EQAA 2F3BA 1B32A 2DVZA 1IMCA 5CBSA 5I58B 4HTGA 4H1XA 1PB7A 3BKIB 4LATA 4PETA 3K01A 3OMBA 2RCBA 4PGPA 1NV4A 4ONYA 1MXZA 1INPA 3K1NA 3D4CA 2QL3A 3DM0A 4GWZA 5EQ7A 3V5AA 5FHMA 1WVJA 2VT5A 1FSAA 3KC0A 4BLAA 3N6UA 2P0SA 2ZZVA 3B6TA 3S2VA 1OMPA 2CZKA 1NNTA 2VD3A 1FQCA 1B3EA 1FQEA 4XFEA 4TQUQ 4JBZA 4N6PA 5IAIA 4DI3D 3LR1A 2FIEA 4G4PA 1NUZA 1NNKA 2XXKA 2XXXA 3IR1A 2XXYA 2F7BA 2Y7PA 4R74A 3PD9A 3IX1A 5FBPA 1QUJA 1NNPA 1MPCA 1MXWA 5DEXA 3C34A 3F11A 4NWCA 4AB5A 1LLSA 2PVUA 4NF8B 4X48A 4JVCA 2PMSA 4OZ9A 4H5GA 2G93A 2I49A 3T9VA 2HZLA 1HSJA 1NV0A 3KN8A 3VXCA 3UGWA 1LGBC 3HPIA 1DPPA 1AOVA 2E1SA 5J1DA 3O6IA 4WEPA 4FECA 2XXPA 5KDTA 1CNQA 2RKMA 1FPJA 4IY5A 5F7VA 4F29A 4YMAA 3V83A 2ANJA 3ILTB 5DTBA 1WDNA 5I58A 4NQ8A 2DE2A 3G3KA 1FPIA 4Z7EA 3H6VA 1R1NA 5EYHA 3TODA 1RYXA 3VDFA 1LBXA 1TFDA 1MQGA 3IAZA 5K2YA 4GWSA 2ZYOA 1P1UA 1HSEA 5ISUA 2UVJA 2OZZA 3HHFA 1NV5A 3L6HA 1R9QA 4BDRA 3CR9A 1GV8A 2Q74A 1SQYA 2ONKE 4P0GA 3TTNA 3BIHA 1EH3A 4BDMA 4G61A 4TOZA 2XHDA 3C36A 3RPLA 3KN7A 3LC8A 4G8HA 2F6PA 1K9YA 1A55A 1BKAA 3S9EA 3CFZA 3N6TA 4IGTA 2OCUA 3O6GA 3FVGA 5M2VA 3PTYA 4GQOA 3KBRA 2V93A 1Z7NE 2V3UA 1EYIA 2QSXA 4ZE9A 3PGFA 3PMWA 4IO6A 4KYDA 3O29A 1B4HA 4GWWA 1JW1A 3T0JA 4N6DA 3S9LC 3QUJA 1IITA 1B5IA 3TTLA 4NGUA 3PPPA 1OQGA 1IZ1A 2XWOA 1BP5A 1FTMA 3G3IA 3O97A 5DT6A 4MCOA 3OENA 2WBBA 3IFAA 4PFUA 5LDZA 4GWYA 5H8SA 4U1ZA 3ZS6A 1Y3NA 4GWXA 3TTKA 4LA9A 4RXLA 4O3BA 1N3WA 2ZZWA 3LSWA 4XF5A 1LAGE 3MZ9A 4YB6A 2NWJA 2HFBA 4PGNA 1NV3A 4R6KA 4F31B 1QJMA 3R7XA 1MH4A 3TTRA 2AYSA 4HS7A 2OK2A 1QUKA 4GFRA 4H45A 4QFKA 2I6EA 4I3EA 3H7MA 1FTLA 3BIGA 2UVIA 3VVEA 1NH8A 2F36A 1PB8A 4KCDA 3G3FA 5ITPA 4BDOA 3M3LA 2XD2A 1B9JA 2DSFA 3SEUA 1YTVA 1S9TA 4WXJA 1ZJLA 2Z8DA 4ZZAA 4KHZE 2O7UA 2KLFA 3UK4A 3RLFE 3IJXB 4DXUA 1B5HA 1UIVA 2HPGA 1B3HA 5HM4B 3GZGA 3A3CA 2X26A 3I5OA 3PPNA 1VSOA 3VXBA 4O3AA 5TPAB 3RNNA 1SYIA 3C4MA 3TKDA 4ELRA 3N5LA 1SW4A 2PBWA 3SZPA 3H03A 2D3IA 1ZTYA 3O28A 1FTKA 5H8HB 2H99A 3MPLA 4N91A 4MLVA 4RK9A 2P1SA 4GLIA 3IORA 4MBPA 3O2AA 2GFEA 1EZ9A 3MWBA 4YKIA 1NV1A 1FPDA 2FYIA 5KCJB 2V4CA 5CI5A 2V25A 3KN3A 1N84A 1GGGA 4PP0A 4X1DA 4HXVA 3UA8A 3D1RA 5CBRA 4OVRA 4HE2A 3CG3A 4DIGA 1NV6A 5ICTA 1FPFA 3BBRA 2DXYA 3K1MA 2ZNUA 4IO4A 4PF8A 3MZ1A 4BDNA 4N13A 2MKZA 4YB7A 4NWDA 3TQWA 2DWJA 4QFPA 3IOWA 1A8FA 1AMFA 3H6TA 4TLMB 5FTIA 1YPNA 3QK6A 4FBPA 1POY1 5A5XB 3E78A 4RK2A 1SDXA 1LBYA 4X1BA 3KJTA 4F2QA 5CMBA 1PBQA 1LBBA 1B51A 2HHMA 2XXTA 4GWUA 5H8QB 1LAXA 5I2KB 4F18A 3UORA 3OO8A 1LFHA 5DVIA 1VDWA 3T1BA 3S9MC 4MNCA 4IB2A 4N07A 3OXNA 2AL4A 2DWIA 3VLWA 4YMBA 3HFUA 3QAXA 2HAVA 5JEIA 2F97A 5TPAA 4GL0A 2Z8EA 1H43A 3CFLA 1VFDA 3RQTA 3H4ZA 5DVJA 1SVXB 4Q0CA 4LP2B 4KR5A 3EPEA 1FQBA 5CC2A 4N15A 1AH5A 3T93B 3TFLA 1P1NA 3FUZA 4Q30B 5KCJA 3DP8A 3KSXA 3TCGA 1B7UA 5DYHA 4HCWA 2WKYA 5ET8A 4F3SA 4ZE8A 5AE4A 3U8QA 1R9LA 1LCTA 1XI6A 4P56A 4NF6B 5J16A 2REGA 4FORA 4QHQA 4JVIA 1LCFA 2GHBA 2QRYA 3CG1A 1SD3A 1S7YA 3PUZE 1JNFA 3Q25A 4H6DA 3TPAA 2F7CA 3EHSA 3QUFA 1XVYA 1YAEA 3Q28A 2OWZA 4ECFA 5KDTB 4XEQA 5A5XA 4ELQA 1FQDA 1NFTA 2ESNA 3LBSA 4LUBA 4GX4A 2Y5LA 4LVQA 4U23A 5H8QA 2PFYA 5I2KA 5CMCA 4GVOA 4OXVA 3IOUA 1B3FA 1D9QA 4Z0IA 3RY3A 1USYH 3GBBA 3IO4A 4KPTA 1IXIA 2Z23A 3OEMA 4YB5A 2QS3A 1NUXA 2VPOA 4GXAA 4OMBA 4FATA 1B05A 2DWAA 5I3SA 3IOTA 1MRPA 3EF7A 4XKNA 2XD3A 4E0XA 1LBWA 4QFNA 2OBGA 1EZOA 3C33A 1EYJA 1N7XA 2GH9A 3B6WA 5I84A 3KZGA 1RDYA 2JJKA 3FV2A 3MP1A 1O63A 3TCHA 3DP4A 4BDLA 2QJEA 3PPRA 1QW0A 1LBCA 4IGRA 4JWYA 5TP9B 4BDQA 1B40A 5HBCA 2B4MA 4OVQA 3RPLB 1NUYA 4G68C 4KD5A 3W9VA 4P1LA 4NE4A 4FE8A 4PBQA 3B8BA 4NF6A 2UVHA 4KI0E 3B50A 5CRYA 3ZKLA 3V89B 1ZKBA 4G68A 1BIYA 2FVZA 3E79A 4DXCA 2Z8FA 2R6GE 4OQOA 2HCAA 1PC3A 3VVDA 1B5JA 3OO9A 1SW5A 1RKMA 3QIMA 1AWBA 4PFTA 3OD7A 3ZKKA 2PFZA 3VFJA 1N04A 2D5WA 1SI1A 2NVUB 4NG7A 4U4XA 1IXHA 2AIXA 4ZECA 3H3GA 2QS2A 1JP4A 2ZMBA 4FIMA 1B3LA 1KZ8A 5HPQA 2Q2CA 1BLFA 5AA4B 1DTGA 3LUZA 2RF1A 1NH7A 1FW0A 4WEDA 1OIBA 1SW2A 3KOSA 4H46A 4YAHX 1NL5A 2WX9A 1AL3A 3K02A 3MVXA 2RC7A 5KZTA 4Q8RA 4R2FA 1QKAA 1A99A 1MQDA 1UTBB 4HE1A 3IFCA 5K2XA 1JEVA 4GBVA 4DLDA 3A29A 2REJA 3TMGA 4JXIA 3PUWE 1MQIA 4U2RA 3VV5A 2IEEA 2O68A 1NI9A 1B46A 1RYOA 2XWIA 5IZZA 1GR2A 1JW4A 4NF0A 2I48A 2PCRA
chains in the Genus database with same CATH topology
5ICQA 4FAJA 5FHNA 4HCYA 5TP9A 3T22A 4YKJA 3KG2A 1I6BA 1EZPA 2B65A 5AA1A 3OO7A 1XT8A 1SW1A 2H25A 3KEIA 3U72A 4PFWA 3KGCA 3H6UA 1IXGA 1M5EA 4LONB 2HAUA 3FVNA 1FCKA 5CMKA 3HO7A 4H67A 3BFTA 2ZYKA 3THIA 1T0KA 1URSA 4NMYA 3FATA 3MVZA 3IJOB 3TEPA 3CI8A 1IXCA 5BWJA 3LUYA 4EXLA 3MVWA 4DCXA 1IUDA 1MM6A 3BFUA 1DTZA 2F8DA 5AA4A 3O66A 3PD8A 3PUXE 4R75A 5I57A 1MY1A 1II5A 3FXUA 3TCFA 4OFJA 1JEUA 2Q2AA 3G3GA 1MY3A 1PEBA 2RCAA 3PUYE 1LFGA 1JVXA 1UTBA 2VP1A 4XIGQ 2B3BA 3B7DA 2Q8JA 1QULA 3VLVA 3M8UA 2F6GA 3W15C 4ZDMA 1GTKA 4RYAA 1CB6A 4UA8A 2Z22A 1FQAA 3G3JA 2XX9A 2ZNSA 2ZXTA 3K1PA 5I56A 3FD3A 2HZKA 3K0VA 2BJJX 2DE3A 2FA7A 2ONRA 1ATGA 2I0BA 1N3XA 5B70A 3ZSFA 1M5DA 1H3DA 3C32A 3RUMA 3HCQA 5H8NB 2GRVA 4AB6A 3RT8A 3B6QA 3JV9A 3Q29A 3TQLA 5L9OA 3HHGA 4EF2A 1URDA 1I6AA 1B58A 3TDJA 4F1YA 3PPQA 2HEUA 1SI0A 4MLQA 3USDA 1VFEA 1MPBA 3MW0A 1PBPA 2OWSA 3UP9A 1D3KA 4OYVA 2V3TA 1SYHA 4EQBA 1DPEA 1VR5A 2YJPA 4FEBA 4M4GA 2HQ0A 3FVKA 2VD2A 1ZIUA 1B2HA 3ODBA 4NEDA 3MPKA 2XXHA 2Y84A 1F9BA 1Y1ZA 3SERA 1VE4A 1EU8A 1ZLQA 4H65A 4XKQA 4GRKA 4P11A 2XXQA 3CSBA 4ND9A 5JK4A 4NTLA 2F5XA 3TYHA 3K00A 2NUVA 1XS5A 2M8CA 4DXBA 2A5SA 2DOJA 2Y7WA 1MQHA 2ALUA 1ANFA 1MXYA 4ZZEA 4QFOA 3MP6A 4MFIA 4OTEA 3RTWB 2R71A 2R9JA 3WAEA 1B0LA 1P1WA 4I9DA 1LFIA 1POTA 2I4BA 1OLCA 4EXKA 5H8NA 2XXUA 2DP8A 3OSQA 2PX1A 2O51A 3N26A 4C1TA 4NF4A 2YPNA 4Q5TA 1NKXA 1Q1KA 1O64A 3TUSA 4LZ5A 3E9XA 4THIA 3M3KA 1TT1A 3C9HA 3T9XB 2OLBA 3FZVA 4R72A 4DCYA 3VE1B 3JYRA 1US5A 1B0HA 1JETA 1PDAA 1QUIA 1UTHB 4EUOA 5JTYA 2Q9TA 1MXUA 2I0CA 4HW8A 2XXWA 2QMXA 5L9SA 2A5TB 4EQ9A 5TU0A 4QSCA 3MP8A 4G68B 2UXAA 4NF5A 3T66A 2PYYA 2ABHA 1MDQA 4QSEA 2HXWA 4ZEFA 4ELOA 5CMMA 3T9HB 5I59A 1UIUA 4PE5B 4LQ2A 5EHMA 3KSJA 5AA2A 3FASA 4R9FA 4WKMA 3MQ9A 2ZYNA 3SEXA 1LAFE 4ZS9A 3CIJA 1I6QA 3FVOA 2UVGA 3IL1B 4QFLA 1D4NA 3SESA 3HSTA 1L5TA 2AL5A 3K6UA 3RPWA 4H8JA 1TWYA 2O6AA 1Y1MA 4F3BA 1N7WA 1A8EA 2THIA 3DLNA 3FJMA 5BUUA 4RY1A 2Y7IA 3P7IA 4F2OA 3SEYA 3MC2A 1B4ZA 1A7LA 3T9UA 3O9PA 2DQVA 2Q88A 3SEVA 1M5BA 1Q35A 2RC9A 3SEWA 3IB0A 4JSDA 3CSGA 4LZ7A 2O69A 3GBAA 3TZAA 1UTHA 5H8FB 4C1UA 2D21A 1NNFA 4IO3A 1MXVA 2E0SA 4LZ8A 4RNSA 4MH5A 2A5TA 3DELB 3TELA 4F3PA 4UACA 2I58A 2VOZA 4POXA 3LSFB 2YLNA 1P1OA 1HSLA 1Y3PA 4FJPA 4U22A 1ZU0A 4DZ1A 3N94A 1M5FA 4U21A 4ZEBA 1BTJA 2CMOA 4R73A 4I62A 3C31A 4QF9A 1XHYA 3Q27A 3S9NC 4XKRA 3GXAA 4OESA 1ZMGA 2NXOA 4KQPA 4K3FA 3U92A 4F19A 1D9VA 5I57B 2O1MA 4GXSB 2QS4A 1FTJA 2F35A 2F78A 2UYFA 3FXRA 4AQ4A 3FXQA 4E0WA 4OEVA 3E3KA 3FGSA 3QYTA 4XXUA 4H5FA 3C35A 1XC1A 3CFXA 2OJTA 1ZBMA 4H0WA 3FIRA 1S50A 3U93A 4DDDA 3Q26A 3RT6B 4M1VA 3EHUA 4X9TA 3TAJA 4POWA 3VVFA 1QVSA 3FV1A 1OVTA 3EQ1A 1CE2A 5EHSA 5EYFA 3IB2A 3WAFA 3OOAA 4RPNA 1MY4A 1NMUA 3ECRA 5I56B 2QS1A 3GLBA 2DWHA 2Y7KA 3S4UA 4F1UA 3QXMA 4R6HA 3CVGA 3OEKA 3I6VA 4KYEA 5H8FA 1KWHA 4MF3A 1IQ7A 1B52A 3I3VA 3K6WA 2PT1A 4RJZA 4GF8A 3OSRA 4PFYA 2Q89A 5IKBA 4KFQA 4GIZA 2ONSA 2CZLA 1DMBA 5B7DA 2F7AA 3O6HA 1GVCA 4JWXA 4NF8A 2QMWA 5FTHA 4KYSA 1MDP1 2O1LA 2H9BA 4F3GA 3UIFA 3V8XB 4EQ7A 4TLLB 4F39A 2PT2A 4P0IA 1UQWA 4G8MA 2F34A 4XKPA 1J1NA 1N76A 1QKBA 2O84X 1B1XA 2X7QA 3IB1A 4KCCA 1PB9A 4JB7A 3CRBA 2IA4A 3PMXA 3PPOA 4ELPA 4RA1A 3MZBA 4YKKA 3MVYA 1Y3QA 1XVXA 4QRZA 2DS9A 3FJ7A 1MM7A 4IO5A 4G77A 4R9GA 4OWDA 3QSLA 3H06B 1M5CA 5L9MA 3KOTA 1JW5A 3TTMA 2LAOA 4G8NA 3KJ7A 3G3HA 5AA2D 4YZZA 4U4SA 1LSTA 3U94A 2DVCA 1A54A 2H98A 4OENA 3E13X 5F1QA 3VLUA 3HV1A 2QPQA 4GWOA 4OETA 4RPOA 2DXRA 4R2BA 4EDPA 3FJGA 3RTFB 1H44A 4NF4B 3OELA 1DOTA 2VGQA 2NOOA 4I1DA 1OVBA 2OWTA 4OERA 3SKPA 3R6UA 1TXFA 5ELVA 1Z7ME 4ZEDA 2ZYMA 3UN6A 2RINA 3LSXA 3PU5A 5JTYB 3K4UA 4EF1A 1B1HA 1FQFA 4ESXA 1MXXA 4H8IA 2VHAA 1OLAA 2DE4A 4O3CA 1MG1A 4YICA 3KFMA 4OHNA 2FNCA 4JWOA 1IIWA 4I8CA 5I2NB 1A40A 3MJNA 2O7IA 1B3GA 4NF5B 4ZEIA 3A3UA 1O7TA 3PV0E 1D9YA 3T96B 5ITOA 4YKPA 3RGYA 3LSLA 2GHAA 3IOVA 3H6WA 5I59B 4OFOA 5AA2B 3L6GA 1DSNA 2XXRA 4FEDA 2XX8A 4IO7A 4L17A 4OFLA 1MQJA 2X7PA 4YU0A 2W7YA 3W9WA 2XXIA 2UYEA 1P1QA 3DP6A 3D4GA 1MH3A 1B6HA 3JZJA 3IO6A 4G2ZA 3ONMA 1Y9UA 2B3FA 5AA3A 1TFAA 1LB8A 3MBPA 3IK6B 1H45A 4R6YA 5DVFA 3M3FA 3OO6A 4C0RA 2RC8A 1ELJA 4GOTA 3SETA 1US4A 1B7HA 1MS7A 2Y7RA 1LB9A 2H5YA 1IEJA 4ISUA 1LAHE 4QSDA 2XX7A 5H8HA 3K6XA 1YCJA 3AXFA 2ZNTA 3U1OA 4IY6A 1MY2A 4OEUA 3ILUB 1R6ZA 3MUQA 4DE8A 1N0TA 4IO2A 2P2AA 1JVYA 3PMVA 4GL8A 3K6VA 1Y4TA 5I2NA 1OQHA 3PUVE 5LOMA 3E4RA 2DYXA 4GD5A 1MY0A 1P99A 5DEXB 3EN3A 3EHTA 1I69A 2H4IA 4JSOA 3MAMA 4U1OA 3RN8A 3K2DA 2I4CA 1XOCA 1H76A 3A09A 5L8DA 4ESWA 1Y20A 1B7ZA 4ZEKA 4F22A 3G7WA 1USYE 2G29A 3HN0A 3SDFA 1MPDA 1Y4CA 5FHOA 1JQFA 1AIVA 4JDFA 2I3WA 2V3QA 2XXVA 1URGA 4XTCQ 4LQ5A 4F1VA 2V84A 3R26A 4PQJA 1WODA 2I3VA 1SBPA 1FTOA 5CM6A 4OVJA 1B32A 2DVZA 5CBSA 5I58B 4HTGA 4H1XA 1PB7A 3BKIB 4LATA 4PETA 3K01A 3OMBA 2RCBA 4ONYA 1MXZA 3K1NA 3D4CA 2QL3A 3DM0A 3V5AA 5FHMA 1WVJA 4BLAA 3N6UA 2P0SA 3B6TA 3S2VA 1OMPA 1NNTA 2VD3A 1FQCA 1B3EA 1FQEA 4TQUQ 4JBZA 4N6PA 5IAIA 3LR1A 4G4PA 1NNKA 2XXXA 3IR1A 2XXYA 2F7BA 2Y7PA 4R74A 3PD9A 3IX1A 1QUJA 1NNPA 1MPCA 1MXWA 5DEXA 3C34A 3F11A 4NWCA 4AB5A 1LLSA 2PVUA 4NF8B 4X48A 2PMSA 4OZ9A 4H5GA 2G93A 2I49A 3T9VA 2HZLA 1HSJA 3KN8A 3VXCA 3UGWA 1LGBC 3HPIA 1DPPA 1AOVA 2E1SA 5J1DA 3O6IA 4WEPA 4FECA 2XXPA 5KDTA 2RKMA 4IY5A 5F7VA 4F29A 4YMAA 3V83A 2ANJA 3ILTB 5DTBA 1WDNA 5I58A 2DE2A 3G3KA 4Z7EA 3H6VA 1R1NA 3TODA 1RYXA 3VDFA 1TFDA 1MQGA 3IAZA 5K2YA 2ZYOA 1P1UA 1HSEA 5ISUA 2UVJA 2OZZA 3HHFA 3L6HA 1R9QA 4BDRA 3CR9A 1GV8A 1SQYA 2ONKE 4P0GA 3TTNA 1EH3A 4BDMA 4TOZA 2XHDA 3C36A 3KN7A 3LC8A 4G8HA 2F6PA 1A55A 1BKAA 3S9EA 3CFZA 3N6TA 4IGTA 2OCUA 3O6GA 3FVGA 5M2VA 4GQOA 3KBRA 2V93A 1Z7NE 2V3UA 2QSXA 4ZE9A 3PGFA 3PMWA 4IO6A 4KYDA 3O29A 1B4HA 1JW1A 3S9LC 3QUJA 1IITA 1B5IA 3TTLA 3PPPA 1OQGA 1IZ1A 1BP5A 1FTMA 3G3IA 3O97A 5DT6A 3OENA 4PFUA 5H8SA 4U1ZA 3ZS6A 1Y3NA 3TTKA 4LA9A 4RXLA 4O3BA 1N3WA 3LSWA 1LAGE 3MZ9A 4YB6A 2NWJA 2HFBA 4R6KA 4F31B 1QJMA 3R7XA 1MH4A 3TTRA 2AYSA 4HS7A 2OK2A 1QUKA 4GFRA 4QFKA 2I6EA 3H7MA 1FTLA 3VVEA 2UVIA 1NH8A 2F36A 1PB8A 4KCDA 3G3FA 5ITPA 4BDOA 3M3LA 2XD2A 1B9JA 2DSFA 3SEUA 1YTVA 1S9TA 4WXJA 1ZJLA 2Z8DA 4ZZAA 4KHZE 2O7UA 2KLFA 3UK4A 3RLFE 3IJXB 4DXUA 1B5HA 1UIVA 1B3HA 5HM4B 3GZGA 3A3CA 2X26A 3I5OA 3PPNA 1VSOA 3VXBA 4O3AA 5TPAB 3RNNA 1SYIA 3C4MA 3TKDA 4ELRA 3N5LA 1SW4A 2PBWA 3H03A 2D3IA 1ZTYA 3O28A 1FTKA 5H8HB 2H99A 3MPLA 4MLVA 4RK9A 2P1SA 4GLIA 3IORA 4MBPA 3O2AA 2GFEA 1EZ9A 3MWBA 4YKIA 2FYIA 5KCJB 5CI5A 2V25A 3KN3A 1N84A 1GGGA 4PP0A 4X1DA 3UA8A 5CBRA 3CG3A 4DIGA 5ICTA 3BBRA 2DXYA 3K1MA 2ZNUA 4IO4A 3MZ1A 4BDNA 4N13A 4YB7A 4NWDA 3TQWA 2DWJA 4QFPA 3IOWA 1A8FA 1AMFA 3H6TA 4TLMB 5FTIA 1YPNA 3QK6A 1POY1 5A5XB 4RK2A 1SDXA 4X1BA 3KJTA 4F2QA 5CMBA 1PBQA 1LBBA 1B51A 2XXTA 5H8QB 1LAXA 5I2KB 4F18A 3UORA 3OO8A 1LFHA 5DVIA 3S9MC 4IB2A 4N07A 3OXNA 2AL4A 2DWIA 3VLWA 4YMBA 3QAXA 2HAVA 5JEIA 2F97A 5TPAA 4GL0A 2Z8EA 1H43A 3CFLA 1VFDA 3RQTA 3H4ZA 5DVJA 1SVXB 4Q0CA 4LP2B 4KR5A 3EPEA 1FQBA 5CC2A 1AH5A 3T93B 3TFLA 1P1NA 3FUZA 4Q30B 5KCJA 3DP8A 3KSXA 3TCGA 1B7UA 5DYHA 4HCWA 2WKYA 4F3SA 5AE4A 4ZE8A 3U8QA 1R9LA 1LCTA 4NF6B 2REGA 4FORA 4QHQA 1LCFA 2GHBA 2QRYA 3CG1A 1SD3A 1S7YA 3PUZE 1JNFA 3Q25A 4H6DA 3TPAA 2F7CA 3EHSA 3QUFA 1XVYA 1YAEA 3Q28A 4ECFA 5KDTB 5A5XA 4ELQA 1FQDA 1NFTA 2ESNA 3LBSA 4LUBA 4LVQA 4U23A 5H8QA 5I2KA 5CMCA 4GVOA 4OXVA 3IOUA 1B3FA 4Z0IA 3RY3A 1USYH 3GBBA 3IO4A 4KPTA 1IXIA 2Z23A 3OEMA 4YB5A 2QS3A 4GXAA 4OMBA 4FATA 1B05A 2DWAA 3IOTA 1MRPA 3EF7A 4XKNA 2XD3A 4E0XA 4QFNA 2OBGA 1EZOA 3C33A 1N7XA 2GH9A 3B6WA 5I84A 3KZGA 3FV2A 3MP1A 1O63A 3TCHA 3DP4A 4BDLA 2QJEA 3PPRA 1QW0A 1LBCA 4IGRA 4JWYA 5TP9B 4BDQA 1B40A 5HBCA 4G68C 4KD5A 3W9VA 4NE4A 4FE8A 4NF6A 2UVHA 4KI0E 5CRYA 3ZKLA 3V89B 1ZKBA 4G68A 1BIYA 4DXCA 2Z8FA 2R6GE 4OQOA 2HCAA 1PC3A 3VVDA 1B5JA 3OO9A 1SW5A 1RKMA 3QIMA 4PFTA 3OD7A 3ZKKA 3VFJA 1N04A 2D5WA 1SI1A 2NVUB 4U4XA 1IXHA 2AIXA 4ZECA 3H3GA 2QS2A 2ZMBA 4FIMA 1B3LA 5HPQA 2Q2CA 1BLFA 5AA4B 1DTGA 2RF1A 1NH7A 1FW0A 4WEDA 1OIBA 1SW2A 3KOSA 4YAHX 1NL5A 1AL3A 3K02A 3MVXA 2RC7A 5KZTA 4Q8RA 4R2FA 1QKAA 1A99A 1MQDA 1UTBB 5K2XA 1JEVA 4DLDA 2REJA 3TMGA 4JXIA 3PUWE 1MQIA 4U2RA 3VV5A 2IEEA 2O68A 1RYOA 1B46A 1GR2A 1JW4A 2I48A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICQ A;  4FAJ A;  5FHN A;  4HCY A;  5TP9 A;  3T22 A;  4YKJ A;  3KG2 A;  1I6B A;  1EZP A;  2B65 A;  5AA1 A;  3OO7 A;  1XT8 A;  1SW1 A;  2H25 A;  3KEI A;  3U72 A;  4PFW A;  3KGC A;  3H6U A;  1IXG A;  1M5E A;  4LON B;  2HAU A;  3FVN A;  1FCK A;  5CMK A;  3HO7 A;  4H67 A;  3BFT A;  2ZYK A;  3THI A;  1T0K A;  1URS A;  4NMY A;  3FAT A;  3MVZ A;  3IJO B;  3TEP A;  3CI8 A;  1IXC A;  5BWJ A;  3LUY A;  4EXL A;  3MVW A;  4DCX A;  1IUD A;  1MM6 A;  3BFU A;  1DTZ A;  2F8D A;  5AA4 A;  3O66 A;  3PD8 A;  3PUX E;  4R75 A;  5I57 A;  1MY1 A;  1II5 A;  3FXU A;  3TCF A;  4OFJ A;  1JEU A;  2Q2A A;  3G3G A;  1MY3 A;  1PEB A;  2RCA A;  3PUY E;  1LFG A;  1JVX A;  1UTB A;  2VP1 A;  4XIG Q;  2B3B A;  3B7D A;  2Q8J A;  1QUL A;  3VLV A;  3M8U A;  2F6G A;  3W15 C;  4ZDM A;  1GTK A;  4RYA A;  1CB6 A;  4UA8 A;  2Z22 A;  1FQA A;  3G3J A;  2XX9 A;  2ZNS A;  2ZXT A;  3K1P A;  5I56 A;  3FD3 A;  2HZK A;  3K0V A;  2BJJ X;  2DE3 A;  2FA7 A;  2ONR A;  1ATG A;  2I0B A;  1N3X A;  5B70 A;  3ZSF A;  1M5D A;  1H3D A;  3C32 A;  3RUM A;  3HCQ A;  5H8N B;  2GRV A;  4AB6 A;  3RT8 A;  3B6Q A;  3JV9 A;  3Q29 A;  3TQL A;  5L9O A;  3HHG A;  4EF2 A;  1URD A;  1I6A A;  1B58 A;  3TDJ A;  4F1Y A;  3PPQ A;  2HEU A;  1SI0 A;  4MLQ A;  3USD A;  1VFE A;  1MPB A;  3MW0 A;  1PBP A;  2OWS A;  3UP9 A;  1D3K A;  4OYV A;  2V3T A;  1SYH A;  4EQB A;  1DPE A;  1VR5 A;  2YJP A;  4FEB A;  4M4G A;  2HQ0 A;  3FVK A;  2VD2 A;  1ZIU A;  1B2H A;  3ODB A;  4NED A;  3MPK A;  2XXH A;  2Y84 A;  1F9B A;  1Y1Z A;  3SER A;  1VE4 A;  1EU8 A;  1ZLQ A;  4H65 A;  4XKQ A;  4GRK A;  4P11 A;  2XXQ A;  3CSB A;  4ND9 A;  5JK4 A;  4NTL A;  2F5X A;  3TYH A;  3K00 A;  2NUV A;  1XS5 A;  2M8C A;  4DXB A;  2A5S A;  2DOJ A;  2Y7W A;  1MQH A;  2ALU A;  1ANF A;  1MXY A;  4ZZE A;  4QFO A;  3MP6 A;  4MFI A;  4OTE A;  3RTW B;  2R71 A;  2R9J A;  3WAE A;  1B0L A;  1P1W A;  4I9D A;  1LFI A;  1POT A;  2I4B A;  1OLC A;  4EXK A;  5H8N A;  2XXU A;  2DP8 A;  3OSQ A;  2PX1 A;  2O51 A;  3N26 A;  4C1T A;  4NF4 A;  2YPN A;  4Q5T A;  1NKX A;  1Q1K A;  1O64 A;  3TUS A;  4LZ5 A;  3E9X A;  4THI A;  3M3K A;  1TT1 A;  3C9H A;  3T9X B;  2OLB A;  3FZV A;  4R72 A;  4DCY A;  3VE1 B;  3JYR A;  1US5 A;  1B0H A;  1JET A;  1PDA A;  1QUI A;  1UTH B;  4EUO A;  5JTY A;  2Q9T A;  1MXU A;  2I0C A;  4HW8 A;  2XXW A;  2QMX A;  5L9S A;  2A5T B;  4EQ9 A;  5TU0 A;  4QSC A;  3MP8 A;  4G68 B;  2UXA A;  4NF5 A;  3T66 A;  2PYY A;  2ABH A;  1MDQ A;  4QSE A;  2HXW A;  4ZEF A;  4ELO A;  5CMM A;  3T9H B;  5I59 A;  1UIU A;  4PE5 B;  4LQ2 A;  5EHM A;  3KSJ A;  5AA2 A;  3FAS A;  4R9F A;  4WKM A;  3MQ9 A;  2ZYN A;  3SEX A;  1LAF E;  4ZS9 A;  3CIJ A;  1I6Q A;  3FVO A;  2UVG A;  3IL1 B;  4QFL A;  1D4N A;  3SES A;  3HST A;  1L5T A;  2AL5 A;  3K6U A;  3RPW A;  4H8J A;  1TWY A;  2O6A A;  1Y1M A;  4F3B A;  1N7W A;  1A8E A;  2THI A;  3DLN A;  3FJM A;  5BUU A;  4RY1 A;  2Y7I A;  3P7I A;  4F2O A;  3SEY A;  3MC2 A;  1B4Z A;  1A7L A;  3T9U A;  3O9P A;  2DQV A;  2Q88 A;  3SEV A;  1M5B A;  1Q35 A;  2RC9 A;  3SEW A;  3IB0 A;  4JSD A;  3CSG A;  4LZ7 A;  2O69 A;  3GBA A;  3TZA A;  1UTH A;  5H8F B;  4C1U A;  2D21 A;  1NNF A;  4IO3 A;  1MXV A;  2E0S A;  4LZ8 A;  4RNS A;  4MH5 A;  2A5T A;  3DEL B;  3TEL A;  4F3P A;  4UAC A;  2I58 A;  2VOZ A;  4POX A;  3LSF B;  2YLN A;  1P1O A;  1HSL A;  1Y3P A;  4FJP A;  4U22 A;  1ZU0 A;  4DZ1 A;  3N94 A;  1M5F A;  4U21 A;  4ZEB A;  1BTJ A;  2CMO A;  4R73 A;  4I62 A;  3C31 A;  4QF9 A;  1XHY A;  3Q27 A;  3S9N C;  4XKR A;  3GXA A;  4OES A;  1ZMG A;  2NXO A;  4KQP A;  4K3F A;  3U92 A;  4F19 A;  1D9V A;  5I57 B;  2O1M A;  4GXS B;  2QS4 A;  1FTJ A;  2F35 A;  2F78 A;  2UYF A;  3FXR A;  4AQ4 A;  3FXQ A;  4E0W A;  4OEV A;  3E3K A;  3FGS A;  3QYT A;  4XXU A;  4H5F A;  3C35 A;  1XC1 A;  3CFX A;  2OJT A;  1ZBM A;  4H0W A;  3FIR A;  1S50 A;  3U93 A;  4DDD A;  3Q26 A;  3RT6 B;  4M1V A;  3EHU A;  4X9T A;  3TAJ A;  4POW A;  3VVF A;  1QVS A;  3FV1 A;  1OVT A;  3EQ1 A;  1CE2 A;  5EHS A;  5EYF A;  3IB2 A;  3WAF A;  3OOA A;  4RPN A;  1MY4 A;  1NMU A;  3ECR A;  5I56 B;  2QS1 A;  3GLB A;  2DWH A;  2Y7K A;  3S4U A;  4F1U A;  3QXM A;  4R6H A;  3CVG A;  3OEK A;  3I6V A;  4KYE A;  5H8F A;  1KWH A;  4MF3 A;  1IQ7 A;  1B52 A;  3I3V A;  3K6W A;  2PT1 A;  4RJZ A;  4GF8 A;  3OSR A;  4PFY A;  2Q89 A;  5IKB A;  4KFQ A;  4GIZ A;  2ONS A;  2CZL A;  1DMB A;  5B7D A;  2F7A A;  3O6H A;  1GVC A;  4JWX A;  4NF8 A;  2QMW A;  5FTH A;  4KYS A;  1MDP 1;  2O1L A;  2H9B A;  4F3G A;  3UIF A;  3V8X B;  4EQ7 A;  4TLL B;  4F39 A;  2PT2 A;  4P0I A;  1UQW A;  4G8M A;  2F34 A;  4XKP A;  1J1N A;  1N76 A;  1QKB A;  2O84 X;  1B1X A;  2X7Q A;  3IB1 A;  4KCC A;  1PB9 A;  4JB7 A;  3CRB A;  2IA4 A;  3PMX A;  3PPO A;  4ELP A;  4RA1 A;  3MZB A;  4YKK A;  3MVY A;  1Y3Q A;  1XVX A;  4QRZ A;  2DS9 A;  3FJ7 A;  1MM7 A;  4IO5 A;  4G77 A;  4R9G A;  4OWD A;  3QSL A;  3H06 B;  1M5C A;  5L9M A;  3KOT A;  1JW5 A;  3TTM A;  2LAO A;  4G8N A;  3KJ7 A;  3G3H A;  5AA2 D;  4YZZ A;  4U4S A;  1LST A;  3U94 A;  2DVC A;  1A54 A;  2H98 A;  4OEN A;  3E13 X;  5F1Q A;  3VLU A;  3HV1 A;  2QPQ A;  4GWO A;  4OET A;  4RPO A;  2DXR A;  4R2B A;  4EDP A;  3FJG A;  3RTF B;  1H44 A;  4NF4 B;  3OEL A;  1DOT A;  2VGQ A;  2NOO A;  4I1D A;  1OVB A;  2OWT A;  4OER A;  3SKP A;  3R6U A;  1TXF A;  5ELV A;  1Z7M E;  4ZED A;  2ZYM A;  3UN6 A;  2RIN A;  3LSX A;  3PU5 A;  5JTY B;  3K4U A;  4EF1 A;  1B1H A;  1FQF A;  4ESX A;  1MXX A;  4H8I A;  2VHA A;  1OLA A;  2DE4 A;  4O3C A;  1MG1 A;  4YIC A;  3KFM A;  4OHN A;  2FNC A;  4JWO A;  1IIW A;  4I8C A;  5I2N B;  1A40 A;  3MJN A;  2O7I A;  1B3G A;  4NF5 B;  4ZEI A;  3A3U A;  1O7T A;  3PV0 E;  1D9Y A;  3T96 B;  5ITO A;  4YKP A;  3RGY A;  3LSL A;  2GHA A;  3IOV A;  3H6W A;  5I59 B;  4OFO A;  5AA2 B;  3L6G A;  1DSN A;  2XXR A;  4FED A;  2XX8 A;  4IO7 A;  4L17 A;  4OFL A;  1MQJ A;  2X7P A;  4YU0 A;  2W7Y A;  3W9W A;  2XXI A;  2UYE A;  1P1Q A;  3DP6 A;  3D4G A;  1MH3 A;  1B6H A;  3JZJ A;  3IO6 A;  4G2Z A;  3ONM A;  1Y9U A;  2B3F A;  5AA3 A;  1TFA A;  1LB8 A;  3MBP A;  3IK6 B;  1H45 A;  4R6Y A;  5DVF A;  3M3F A;  3OO6 A;  4C0R A;  2RC8 A;  1ELJ A;  4GOT A;  3SET A;  1US4 A;  1B7H A;  1MS7 A;  2Y7R A;  1LB9 A;  2H5Y A;  1IEJ A;  4ISU A;  1LAH E;  4QSD A;  2XX7 A;  5H8H A;  3K6X A;  1YCJ A;  3AXF A;  2ZNT A;  3U1O A;  4IY6 A;  1MY2 A;  4OEU A;  3ILU B;  1R6Z A;  3MUQ A;  4DE8 A;  1N0T A;  4IO2 A;  2P2A A;  1JVY A;  3PMV A;  4GL8 A;  3K6V A;  1Y4T A;  5I2N A;  1OQH A;  3PUV E;  5LOM A;  3E4R A;  2DYX A;  4GD5 A;  1MY0 A;  1P99 A;  5DEX B;  3EN3 A;  3EHT A;  1I69 A;  2H4I A;  4JSO A;  3MAM A;  4U1O A;  3RN8 A;  3K2D A;  2I4C A;  1XOC A;  1H76 A;  3A09 A;  5L8D A;  4ESW A;  1Y20 A;  1B7Z A;  4ZEK A;  4F22 A;  3G7W A;  1USY E;  2G29 A;  3HN0 A;  3SDF A;  1MPD A;  1Y4C A;  5FHO A;  1JQF A;  1AIV A;  4JDF A;  2I3W A;  2V3Q A;  2XXV A;  1URG A;  4XTC Q;  4LQ5 A;  4F1V A;  2V84 A;  3R26 A;  4PQJ A;  1WOD A;  2I3V A;  1SBP A;  1FTO A;  5CM6 A;  4OVJ A;  1B32 A;  2DVZ A;  5CBS A;  5I58 B;  4HTG A;  4H1X A;  1PB7 A;  3BKI B;  4LAT A;  4PET A;  3K01 A;  3OMB A;  2RCB A;  4ONY A;  1MXZ A;  3K1N A;  3D4C A;  2QL3 A;  3DM0 A;  3V5A A;  5FHM A;  1WVJ A;  4BLA A;  3N6U A;  2P0S A;  3B6T A;  3S2V A;  1OMP A;  1NNT A;  2VD3 A;  1FQC A;  1B3E A;  1FQE A;  4TQU Q;  4JBZ A;  4N6P A;  5IAI A;  3LR1 A;  4G4P A;  1NNK A;  2XXX A;  3IR1 A;  2XXY A;  2F7B A;  2Y7P A;  4R74 A;  3PD9 A;  3IX1 A;  1QUJ A;  1NNP A;  1MPC A;  1MXW A;  5DEX A;  3C34 A;  3F11 A;  4NWC A;  4AB5 A;  1LLS A;  2PVU A;  4NF8 B;  4X48 A;  2PMS A;  4OZ9 A;  4H5G A;  2G93 A;  2I49 A;  3T9V A;  2HZL A;  1HSJ A;  3KN8 A;  3VXC A;  3UGW A;  1LGB C;  3HPI A;  1DPP A;  1AOV A;  2E1S A;  5J1D A;  3O6I A;  4WEP A;  4FEC A;  2XXP A;  5KDT A;  2RKM A;  4IY5 A;  5F7V A;  4F29 A;  4YMA A;  3V83 A;  2ANJ A;  3ILT B;  5DTB A;  1WDN A;  5I58 A;  2DE2 A;  3G3K A;  4Z7E A;  3H6V A;  1R1N A;  3TOD A;  1RYX A;  3VDF A;  1TFD A;  1MQG A;  3IAZ A;  5K2Y A;  2ZYO A;  1P1U A;  1HSE A;  5ISU A;  2UVJ A;  2OZZ A;  3HHF A;  3L6H A;  1R9Q A;  4BDR A;  3CR9 A;  1GV8 A;  1SQY A;  2ONK E;  4P0G A;  3TTN A;  1EH3 A;  4BDM A;  4TOZ A;  2XHD A;  3C36 A;  3KN7 A;  3LC8 A;  4G8H A;  2F6P A;  1A55 A;  1BKA A;  3S9E A;  3CFZ A;  3N6T A;  4IGT A;  2OCU A;  3O6G A;  3FVG A;  5M2V A;  4GQO A;  3KBR A;  2V93 A;  1Z7N E;  2V3U A;  2QSX A;  4ZE9 A;  3PGF A;  3PMW A;  4IO6 A;  4KYD A;  3O29 A;  1B4H A;  1JW1 A;  3S9L C;  3QUJ A;  1IIT A;  1B5I A;  3TTL A;  3PPP A;  1OQG A;  1IZ1 A;  1BP5 A;  1FTM A;  3G3I A;  3O97 A;  5DT6 A;  3OEN A;  4PFU A;  5H8S A;  4U1Z A;  3ZS6 A;  1Y3N A;  3TTK A;  4LA9 A;  4RXL A;  4O3B A;  1N3W A;  3LSW A;  1LAG E;  3MZ9 A;  4YB6 A;  2NWJ A;  2HFB A;  4R6K A;  4F31 B;  1QJM A;  3R7X A;  1MH4 A;  3TTR A;  2AYS A;  4HS7 A;  2OK2 A;  1QUK A;  4GFR A;  4QFK A;  2I6E A;  3H7M A;  1FTL A;  3VVE A;  2UVI A;  1NH8 A;  2F36 A;  1PB8 A;  4KCD A;  3G3F A;  5ITP A;  4BDO A;  3M3L A;  2XD2 A;  1B9J A;  2DSF A;  3SEU A;  1YTV A;  1S9T A;  4WXJ A;  1ZJL A;  2Z8D A;  4ZZA A;  4KHZ E;  2O7U A;  2KLF A;  3UK4 A;  3RLF E;  3IJX B;  4DXU A;  1B5H A;  1UIV A;  1B3H A;  5HM4 B;  3GZG A;  3A3C A;  2X26 A;  3I5O A;  3PPN A;  1VSO A;  3VXB A;  4O3A A;  5TPA B;  3RNN A;  1SYI A;  3C4M A;  3TKD A;  4ELR A;  3N5L A;  1SW4 A;  2PBW A;  3H03 A;  2D3I A;  1ZTY A;  3O28 A;  1FTK A;  5H8H B;  2H99 A;  3MPL A;  4MLV A;  4RK9 A;  2P1S A;  4GLI A;  3IOR A;  4MBP A;  3O2A A;  2GFE A;  1EZ9 A;  3MWB A;  4YKI A;  2FYI A;  5KCJ B;  5CI5 A;  2V25 A;  3KN3 A;  1N84 A;  1GGG A;  4PP0 A;  4X1D A;  3UA8 A;  5CBR A;  3CG3 A;  4DIG A;  5ICT A;  3BBR A;  2DXY A;  3K1M A;  2ZNU A;  4IO4 A;  3MZ1 A;  4BDN A;  4N13 A;  4YB7 A;  4NWD A;  3TQW A;  2DWJ A;  4QFP A;  3IOW A;  1A8F A;  1AMF A;  3H6T A;  4TLM B;  5FTI A;  1YPN A;  3QK6 A;  1POY 1;  5A5X B;  4RK2 A;  1SDX A;  4X1B A;  3KJT A;  4F2Q A;  5CMB A;  1PBQ A;  1LBB A;  1B51 A;  2XXT A;  5H8Q B;  1LAX A;  5I2K B;  4F18 A;  3UOR A;  3OO8 A;  1LFH A;  5DVI A;  3S9M C;  4IB2 A;  4N07 A;  3OXN A;  2AL4 A;  2DWI A;  3VLW A;  4YMB A;  3QAX A;  2HAV A;  5JEI A;  2F97 A;  5TPA A;  4GL0 A;  2Z8E A;  1H43 A;  3CFL A;  1VFD A;  3RQT A;  3H4Z A;  5DVJ A;  1SVX B;  4Q0C A;  4LP2 B;  4KR5 A;  3EPE A;  1FQB A;  5CC2 A;  1AH5 A;  3T93 B;  3TFL A;  1P1N A;  3FUZ A;  4Q30 B;  5KCJ A;  3DP8 A;  3KSX A;  3TCG A;  1B7U A;  5DYH A;  4HCW A;  2WKY A;  4F3S A;  5AE4 A;  4ZE8 A;  3U8Q A;  1R9L A;  1LCT A;  4NF6 B;  2REG A;  4FOR A;  4QHQ A;  1LCF A;  2GHB A;  2QRY A;  3CG1 A;  1SD3 A;  1S7Y A;  3PUZ E;  1JNF A;  3Q25 A;  4H6D A;  3TPA A;  2F7C A;  3EHS A;  3QUF A;  1XVY A;  1YAE A;  3Q28 A;  4ECF A;  5KDT B;  5A5X A;  4ELQ A;  1FQD A;  1NFT A;  2ESN A;  3LBS A;  4LUB A;  4LVQ A;  4U23 A;  5H8Q A;  5I2K A;  5CMC A;  4GVO A;  4OXV A;  3IOU A;  1B3F A;  4Z0I A;  3RY3 A;  1USY H;  3GBB A;  3IO4 A;  4KPT A;  1IXI A;  2Z23 A;  3OEM A;  4YB5 A;  2QS3 A;  4GXA A;  4OMB A;  4FAT A;  1B05 A;  2DWA A;  3IOT A;  1MRP A;  3EF7 A;  4XKN A;  2XD3 A;  4E0X A;  4QFN A;  2OBG A;  1EZO A;  3C33 A;  1N7X A;  2GH9 A;  3B6W A;  5I84 A;  3KZG A;  3FV2 A;  3MP1 A;  1O63 A;  3TCH A;  3DP4 A;  4BDL A;  2QJE A;  3PPR A;  1QW0 A;  1LBC A;  4IGR A;  4JWY A;  5TP9 B;  4BDQ A;  1B40 A;  5HBC A;  4G68 C;  4KD5 A;  3W9V A;  4NE4 A;  4FE8 A;  4NF6 A;  2UVH A;  4KI0 E;  5CRY A;  3ZKL A;  3V89 B;  1ZKB A;  4G68 A;  1BIY A;  4DXC A;  2Z8F A;  2R6G E;  4OQO A;  2HCA A;  1PC3 A;  3VVD A;  1B5J A;  3OO9 A;  1SW5 A;  1RKM A;  3QIM A;  4PFT A;  3OD7 A;  3ZKK A;  3VFJ A;  1N04 A;  2D5W A;  1SI1 A;  2NVU B;  4U4X A;  1IXH A;  2AIX A;  4ZEC A;  3H3G A;  2QS2 A;  2ZMB A;  4FIM A;  1B3L A;  5HPQ A;  2Q2C A;  1BLF A;  5AA4 B;  1DTG A;  2RF1 A;  1NH7 A;  1FW0 A;  4WED A;  1OIB A;  1SW2 A;  3KOS A;  4YAH X;  1NL5 A;  1AL3 A;  3K02 A;  3MVX A;  2RC7 A;  5KZT A;  4Q8R A;  4R2F A;  1QKA A;  1A99 A;  1MQD A;  1UTB B;  5K2X A;  1JEV A;  4DLD A;  2REJ A;  3TMG A;  4JXI A;  3PUW E;  1MQI A;  4U2R A;  3VV5 A;  2IEE A;  2O68 A;  1RYO A;  1B46 A;  1GR2 A;  1JW4 A;  2I48 A; 
#chains in the Genus database with same CATH topology
 5ICQ A;  1DK4 A;  4FAJ A;  5FHN A;  4HCY A;  5TP9 A;  3T22 A;  4YKJ A;  3KG2 A;  1I6B A;  4P3L A;  1EZP A;  4PFI A;  2B65 A;  5AA1 A;  3OO7 A;  1XT8 A;  1SW1 A;  2H25 A;  3KEI A;  3U72 A;  4PFW A;  3KGC A;  4OA4 A;  3H6U A;  1IXG A;  1IMB A;  1M5E A;  4LON B;  2HAU A;  3FVN A;  1FCK A;  5CMK A;  3HO7 A;  4H67 A;  3BFT A;  2ZYK A;  3THI A;  1T0K A;  2L5V A;  1URS A;  4PFR A;  2WEF A;  4NMY A;  3FAT A;  3MVZ A;  3IJO B;  3TEP A;  2WYK A;  3CI8 A;  1IXC A;  5BWJ A;  3LUY A;  4EXL A;  3MVW A;  4DCX A;  1FPG A;  1IUD A;  1MM6 A;  3BFU A;  1DTZ A;  3RYD A;  2F8D A;  5AA4 A;  4MAG A;  3O66 A;  3PD8 A;  3PUX E;  4AS5 A;  4R75 A;  5I57 A;  1MY1 A;  2GQ1 A;  1II5 A;  3EKI A;  4P9K A;  3FXU A;  3TCF A;  4OFJ A;  1JEU A;  3LV0 A;  1FBG A;  2Q2A A;  3G3G A;  1MY3 A;  1PEB A;  2RCA A;  3PUY E;  1LFG A;  1JVX A;  1UTB A;  2VP1 A;  4XIG Q;  2KQZ A;  2B3B A;  3B7D A;  2Q8J A;  1QUL A;  3VLV A;  3M8U A;  2F6G A;  3W15 C;  4ZDM A;  1GTK A;  4RYA A;  1CB6 A;  4X8R A;  4UA8 A;  2Z22 A;  1FQA A;  3G3J A;  2XX9 A;  1IME A;  2OX3 A;  2ZNS A;  2ZXT A;  3K1P A;  5I56 A;  3FD3 A;  4GX3 A;  5EQ9 A;  2HZK A;  3K0V A;  2BJJ X;  2DE3 A;  2FA7 A;  4PF6 A;  2ONR A;  1ATG A;  2I0B A;  1FPB A;  1N3X A;  5B70 A;  5T3J A;  5ET6 A;  3ZSF A;  1M5D A;  1H3D A;  3C32 A;  3RUM A;  5DW8 A;  3HCQ A;  5H8N B;  4NN3 A;  2GRV A;  4AB6 A;  3RT8 A;  3B6Q A;  3JV9 A;  3Q29 A;  3TQL A;  5ESY A;  5L9O A;  4AS4 A;  3HHG A;  4EF2 A;  1LBZ A;  1URD A;  1I6A A;  4NX1 A;  1B58 A;  3TDJ A;  4F1Y A;  3PPQ A;  2HEU A;  1SI0 A;  4MLQ A;  3USD A;  1FBP A;  1VFE A;  1MPB A;  3MW0 A;  2QVR A;  1PBP A;  3U65 A;  4PE3 A;  2OWS A;  3UP9 A;  1D3K A;  4OYV A;  2V3T A;  1SYH A;  4EQB A;  1DPE A;  1VR5 A;  2YJP A;  4FEB A;  4M4G A;  2HQ0 A;  3FVK A;  2VD2 A;  1ZIU A;  5EQ8 A;  2QFL A;  1B2H A;  4NED A;  3ODB A;  3MPK A;  2XXH A;  2Y84 A;  1F9B A;  1Y1Z A;  3SER A;  1VE4 A;  1NV7 A;  1FPK A;  1EU8 A;  1ZLQ A;  4H65 A;  4XKQ A;  4GRK A;  4P11 A;  2XXQ A;  3CSB A;  4ND9 A;  5JK4 A;  4NTL A;  2F5X A;  3TYH A;  3K00 A;  2NUV A;  1XS5 A;  2M8C A;  4DXB A;  1IMD A;  4NHB A;  2A5S A;  2DOJ A;  2Y7W A;  1MQH A;  2ALU A;  1RDX A;  1ANF A;  1MXY A;  4ZZE A;  3ROJ A;  4QFO A;  4X04 A;  3MP6 A;  4MFI A;  4OTE A;  3RTW B;  2R71 A;  2R9J A;  3WAE A;  1B0L A;  1P1W A;  4I9D A;  2CEX A;  4P47 A;  1LFI A;  1POT A;  2I4B A;  3QMF A;  1OLC A;  4EXK A;  5H8N A;  2XXU A;  2DP8 A;  3OSQ A;  1FJ6 A;  2PX1 A;  2O51 A;  3N26 A;  4C1T A;  4NF4 A;  2YPN A;  4O8M A;  4Q5T A;  1NKX A;  1Q1K A;  1O64 A;  3TUS A;  4I40 A;  4LZ5 A;  3E9X A;  4THI A;  1BK4 A;  3M3K A;  1TT1 A;  4UAB A;  3C9H A;  3T9X B;  2OLB A;  4N17 A;  3FZV A;  4R72 A;  4DCY A;  3VE1 B;  3JYR A;  1US5 A;  1B0H A;  1FBF A;  1JET A;  1PDA A;  2WBD A;  1QUI A;  1UTH B;  4EUO A;  5JTY A;  2Q9T A;  1MXU A;  2I0C A;  4HW8 A;  4MJO A;  2XXW A;  2QMX A;  5L9S A;  1FTA A;  4PBH A;  2A5T B;  4EQ9 A;  5TU0 A;  4QSC A;  3MP8 A;  4G68 B;  2UXA A;  4NF5 A;  3T66 A;  2PYY A;  2ABH A;  1MDQ A;  4QSE A;  2HXW A;  4ZEF A;  4ELO A;  5CMM A;  3T9H B;  5I59 A;  1UIU A;  4PTK A;  4MNP A;  4PE5 B;  4LQ2 A;  4OAN A;  5EHM A;  4OVT A;  3KSJ A;  5AA2 A;  5A5L A;  3FAS A;  4R9F A;  4WKM A;  2P3N A;  2Q8M A;  3MQ9 A;  2ZYN A;  3SEX A;  2CEY A;  1LAF E;  4ZS9 A;  3CIJ A;  1I6Q A;  1K9Z A;  3FVO A;  2UVG A;  3IL1 B;  4QFL A;  1D4N A;  3SES A;  1KA1 A;  4QBA A;  3HST A;  1L5T A;  2AL5 A;  3K6U A;  3RPW A;  4H8J A;  1TWY A;  2O6A A;  1Y1M A;  4F3B A;  1N7W A;  1A8E A;  1G0H A;  2THI A;  3DLN A;  3FJM A;  4IR8 A;  5BUU A;  4RY1 A;  4PC9 A;  2Y7I A;  3P7I A;  1FRP A;  4F2O A;  3SEY A;  3MC2 A;  1B4Z A;  1A7L A;  3T9U A;  3O9P A;  2DQV A;  2Q88 A;  3SEV A;  1M5B A;  1Q35 A;  2RC9 A;  3SEW A;  3IB0 A;  4JSD A;  3CSG A;  4KXP A;  4LZ7 A;  2O69 A;  3GBA A;  3NOH A;  4O94 A;  3TZA A;  1UTH A;  5H8F B;  4C1U A;  2D21 A;  3ISP A;  1NNF A;  3KC1 A;  4IO3 A;  1MXV A;  2E0S A;  4JVD A;  4LZ8 A;  4N6K A;  4RNS A;  4MH5 A;  2A5T A;  3DEL B;  3TEL A;  4F3P A;  4UAC A;  2I58 A;  2VOZ A;  4POX A;  2CZI A;  3LSF B;  1NV2 A;  3MYU A;  2YLN A;  4N4U A;  1P1O A;  1HSL A;  1Y3P A;  4FJP A;  1IMA A;  1ZU0 A;  4U22 A;  4DZ1 A;  3N94 A;  1M5F A;  4U21 A;  4ZEB A;  1BTJ A;  1YZ0 A;  2CMO A;  4R73 A;  2KR0 A;  4I62 A;  3C31 A;  1RDZ A;  1FBE A;  4QF9 A;  1FJ9 A;  1XHY A;  3Q27 A;  3S9N C;  4XKR A;  3GXA A;  4OES A;  1ZMG A;  2NXO A;  4PFB A;  4KQP A;  4K3F A;  3U92 A;  4F19 A;  1D9V A;  4PAI A;  5I57 B;  2O1M A;  4GXS B;  2QS4 A;  1FTJ A;  2F35 A;  2F78 A;  2UYF A;  3FXR A;  4AQ4 A;  3FXQ A;  2FBP A;  4E0W A;  4OEV A;  3E3K A;  3FGS A;  3QYT A;  4XXU A;  4H5F A;  3C35 A;  1XC1 A;  3CFX A;  2B4L A;  2OJT A;  1ZBM A;  4H0W A;  3FIR A;  1S50 A;  3U93 A;  4DDD A;  3Q26 A;  3RT6 B;  4M1V A;  3EHU A;  4X9T A;  3TAJ A;  4POW A;  3VVF A;  1QVS A;  3FV1 A;  1OVT A;  4O7I A;  3EQ1 A;  1CE2 A;  4P8B A;  5EHS A;  5EYF A;  3IB2 A;  3WAF A;  3OOA A;  4RPN A;  4LN5 A;  1MY4 A;  1NMU A;  3ECR A;  2QVU A;  5I56 B;  2QS1 A;  3GLB A;  2DWH A;  2Y5K A;  2Y7K A;  3S4U A;  4F1U A;  3QXM A;  4R6H A;  3CVG A;  3OEK A;  3I6V A;  4KYE A;  4PDD A;  5H8F A;  1KWH A;  4MF3 A;  1IQ7 A;  1B52 A;  1YXI A;  3I3V A;  3K6W A;  2PT1 A;  4RJZ A;  4GF8 A;  2R8T A;  3OSR A;  4PFY A;  2Q89 A;  5IKB A;  4NAP A;  2CZH A;  1IMF A;  4KFQ A;  4GIZ A;  2ONS A;  2CZL A;  1LEV A;  1DMB A;  5B7D A;  2F7A A;  3O6H A;  1GVC A;  4JWX A;  4NF8 A;  2QMW A;  4MMP A;  5FTH A;  4KYS A;  1MDP 1;  2O1L A;  2H9B A;  4F3G A;  3UIF A;  4P1E A;  1G0I A;  3V8X B;  4EQ7 A;  4TLL B;  4F39 A;  2PT2 A;  4P0I A;  1UQW A;  4G8M A;  1FBC A;  2F34 A;  4XKP A;  1J1N A;  1N76 A;  1QKB A;  2O84 X;  1B1X A;  2X7Q A;  3IB1 A;  4KCC A;  1PB9 A;  4JB7 A;  3CRB A;  2IA4 A;  3PMX A;  3PPO A;  4ELP A;  4RA1 A;  3MZB A;  4HE0 A;  4YKK A;  3MVY A;  1Y3Q A;  1XVX A;  4QRZ A;  2DS9 A;  3FJ7 A;  1MM7 A;  4IO5 A;  4G77 A;  2QVV A;  4R9G A;  4OWD A;  4OVS A;  3QSL A;  3H06 B;  1M5C A;  5L9M A;  3KOT A;  1JW5 A;  3TTM A;  2LAO A;  4G8N A;  3KJ7 A;  3G3H A;  5AA2 D;  4YZZ A;  4U4S A;  5I7I A;  4PCD A;  1LST A;  4O7M A;  3U94 A;  2DVC A;  1A54 A;  4DI4 B;  2H98 A;  4OEN A;  3E13 X;  5F1Q A;  3VLU A;  1QGX A;  3FBP A;  3HV1 A;  2QPQ A;  4GWO A;  2XWV A;  1KA0 A;  4OET A;  4I3Y A;  2XWK A;  4RPO A;  2DXR A;  4R2B A;  5LTC A;  4EDP A;  3FJG A;  3RTF B;  4PAK A;  1H44 A;  4NF4 B;  3OEL A;  1DOT A;  2VGQ A;  2NOO A;  4I1D A;  1OVB A;  2OWT A;  1Q9D A;  4OER A;  3SKP A;  3MST A;  3R6U A;  1TXF A;  5ELV A;  1Z7M E;  4ZED A;  2ZYM A;  3UN6 A;  2RIN A;  3LSX A;  3PU5 A;  5JTY B;  3K4U A;  4PAF A;  1FPE A;  4EF1 A;  1EYK A;  4OVP A;  1B1H A;  1FQF A;  4ESX A;  1MXX A;  4H8I A;  2WYP A;  2VHA A;  1OLA A;  2DE4 A;  4O3C A;  2HXR A;  1MG1 A;  4YIC A;  3KFM A;  4OHN A;  2FNC A;  5IZ3 B;  4JWO A;  1IIW A;  4I8C A;  5I2N B;  1A40 A;  3MJN A;  2O7I A;  1B3G A;  4NF5 B;  4ZEI A;  3A3U A;  1O7T A;  1DBZ A;  3PV0 E;  2VPN A;  1D9Y A;  3T96 B;  5ITO A;  4YKP A;  3RGY A;  3LSL A;  2GHA A;  3IOV A;  3H6W A;  5IM2 A;  5I59 B;  4MEV A;  4N81 A;  4OFO A;  3GYY A;  5AA2 B;  3L6G A;  1DSN A;  2ZZX A;  4PDH A;  2XXR A;  4FED A;  2XX8 A;  4IO7 A;  4L17 A;  4OFL A;  1MQJ A;  2X7P A;  4YU0 A;  2P3V A;  2W7Y A;  1FBH A;  5F24 A;  3W9W A;  1YYZ A;  2XXI A;  1DCU A;  2UYE A;  1NUW A;  1P1Q A;  3DP6 A;  3D4G A;  1MH3 A;  1B6H A;  3JZJ A;  3IO6 A;  4G2Z A;  3ONM A;  1Y9U A;  2B3F A;  5AA3 A;  3KBZ A;  1TFA A;  1LBV A;  1LB8 A;  3MBP A;  3IK6 B;  1H45 A;  4R6Y A;  5DVF A;  3M3F A;  3OO6 A;  4C0R A;  2RC8 A;  1ELJ A;  2FHY A;  4GOT A;  3SET A;  1US4 A;  1B7H A;  1MS7 A;  2Y7R A;  2BJI A;  1LB9 A;  2H5Y A;  1IEJ A;  4ISU A;  1LAH E;  4MHF A;  4QSD A;  2XX7 A;  5H8H A;  3K6X A;  1YCJ A;  3AXF A;  2ZNT A;  4GX6 A;  3U1O A;  4IY6 A;  5IGA A;  4N8G A;  1MY2 A;  4OEU A;  3ILU B;  1R6Z A;  5ET7 A;  3MUQ A;  4DE8 A;  1N0T A;  4IO2 A;  2P2A A;  1FPL A;  1JVY A;  4GL8 A;  3PMV A;  5IZ3 A;  3K6V A;  1Y4T A;  5I2N A;  1OQH A;  3PUV E;  5LOM A;  3E4R A;  5I5P A;  2DYX A;  4MNI A;  4GD5 A;  1MY0 A;  1P99 A;  5DEX B;  3EN3 A;  3EHT A;  1I69 A;  2H4I A;  2F3D A;  4MIJ A;  4JSO A;  1FBD A;  3MAM A;  2XA5 A;  4U1O A;  3RN8 A;  3K2D A;  3CHG A;  2I4C A;  1XOC A;  1H76 A;  3A09 A;  5L8D A;  4MX6 A;  4ESW A;  1Y20 A;  1B7Z A;  4ZEK A;  5IZ1 A;  4F22 A;  4GBW A;  2DDK A;  3G7W A;  2FIX A;  1USY E;  4QXD A;  2G29 A;  3HN0 A;  3SDF A;  5ET5 A;  1MPD A;  4N8Y A;  1Y4C A;  5FHO A;  5EYG A;  1JQF A;  1AIV A;  4JDF A;  1SPI A;  2I3W A;  2V3Q A;  2XXV A;  1URG A;  4XTC Q;  4LQ5 A;  4F1V A;  2V84 A;  3FXB A;  3R26 A;  4PQJ A;  1WOD A;  2I3V A;  1SBP A;  1FTO A;  5CM6 A;  4OVJ A;  5EQA A;  2F3B A;  1B32 A;  2DVZ A;  1IMC A;  5CBS A;  5I58 B;  4HTG A;  4H1X A;  1PB7 A;  3BKI B;  4LAT A;  4PET A;  3K01 A;  3OMB A;  2RCB A;  4PGP A;  1NV4 A;  4ONY A;  1MXZ A;  1INP A;  3K1N A;  3D4C A;  2QL3 A;  3DM0 A;  4GWZ A;  5EQ7 A;  3V5A A;  5FHM A;  1WVJ A;  2VT5 A;  1FSA A;  3KC0 A;  4BLA A;  3N6U A;  2P0S A;  2ZZV A;  3B6T A;  3S2V A;  1OMP A;  2CZK A;  1NNT A;  2VD3 A;  1FQC A;  1B3E A;  1FQE A;  4XFE A;  4TQU Q;  4JBZ A;  4N6P A;  5IAI A;  4DI3 D;  3LR1 A;  2FIE A;  4G4P A;  1NUZ A;  1NNK A;  2XXK A;  2XXX A;  3IR1 A;  2XXY A;  2F7B A;  2Y7P A;  4R74 A;  3PD9 A;  3IX1 A;  5FBP A;  1QUJ A;  1NNP A;  1MPC A;  1MXW A;  5DEX A;  3C34 A;  3F11 A;  4NWC A;  4AB5 A;  1LLS A;  2PVU A;  4NF8 B;  4X48 A;  4JVC A;  2PMS A;  4OZ9 A;  4H5G A;  2G93 A;  2I49 A;  3T9V A;  2HZL A;  1HSJ A;  1NV0 A;  3KN8 A;  3VXC A;  3UGW A;  1LGB C;  3HPI A;  1DPP A;  1AOV A;  2E1S A;  5J1D A;  3O6I A;  4WEP A;  4FEC A;  2XXP A;  5KDT A;  1CNQ A;  2RKM A;  1FPJ A;  4IY5 A;  5F7V A;  4F29 A;  4YMA A;  3V83 A;  2ANJ A;  3ILT B;  5DTB A;  1WDN A;  5I58 A;  4NQ8 A;  2DE2 A;  3G3K A;  1FPI A;  4Z7E A;  3H6V A;  1R1N A;  5EYH A;  3TOD A;  1RYX A;  3VDF A;  1LBX A;  1TFD A;  1MQG A;  3IAZ A;  5K2Y A;  4GWS A;  2ZYO A;  1P1U A;  1HSE A;  5ISU A;  2UVJ A;  2OZZ A;  3HHF A;  1NV5 A;  3L6H A;  1R9Q A;  4BDR A;  3CR9 A;  1GV8 A;  2Q74 A;  1SQY A;  2ONK E;  4P0G A;  3TTN A;  3BIH A;  1EH3 A;  4BDM A;  4G61 A;  4TOZ A;  2XHD A;  3C36 A;  3RPL A;  3KN7 A;  3LC8 A;  4G8H A;  2F6P A;  1K9Y A;  1A55 A;  1BKA A;  3S9E A;  3CFZ A;  3N6T A;  4IGT A;  2OCU A;  3O6G A;  3FVG A;  5M2V A;  3PTY A;  4GQO A;  3KBR A;  2V93 A;  1Z7N E;  2V3U A;  1EYI A;  2QSX A;  4ZE9 A;  3PGF A;  3PMW A;  4IO6 A;  4KYD A;  3O29 A;  1B4H A;  4GWW A;  1JW1 A;  3T0J A;  4N6D A;  3S9L C;  3QUJ A;  1IIT A;  1B5I A;  3TTL A;  4NGU A;  3PPP A;  1OQG A;  1IZ1 A;  2XWO A;  1BP5 A;  1FTM A;  3G3I A;  3O97 A;  5DT6 A;  4MCO A;  3OEN A;  2WBB A;  3IFA A;  4PFU A;  5LDZ A;  4GWY A;  5H8S A;  4U1Z A;  3ZS6 A;  1Y3N A;  4GWX A;  3TTK A;  4LA9 A;  4RXL A;  4O3B A;  1N3W A;  2ZZW A;  3LSW A;  4XF5 A;  1LAG E;  3MZ9 A;  4YB6 A;  2NWJ A;  2HFB A;  4PGN A;  1NV3 A;  4R6K A;  4F31 B;  1QJM A;  3R7X A;  1MH4 A;  3TTR A;  2AYS A;  4HS7 A;  2OK2 A;  1QUK A;  4GFR A;  4H45 A;  4QFK A;  2I6E A;  4I3E A;  3H7M A;  1FTL A;  3BIG A;  2UVI A;  3VVE A;  1NH8 A;  2F36 A;  1PB8 A;  4KCD A;  3G3F A;  5ITP A;  4BDO A;  3M3L A;  2XD2 A;  1B9J A;  2DSF A;  3SEU A;  1YTV A;  1S9T A;  4WXJ A;  1ZJL A;  2Z8D A;  4ZZA A;  4KHZ E;  2O7U A;  2KLF A;  3UK4 A;  3RLF E;  3IJX B;  4DXU A;  1B5H A;  1UIV A;  2HPG A;  1B3H A;  5HM4 B;  3GZG A;  3A3C A;  2X26 A;  3I5O A;  3PPN A;  1VSO A;  3VXB A;  4O3A A;  5TPA B;  3RNN A;  1SYI A;  3C4M A;  3TKD A;  4ELR A;  3N5L A;  1SW4 A;  2PBW A;  3SZP A;  3H03 A;  2D3I A;  1ZTY A;  3O28 A;  1FTK A;  5H8H B;  2H99 A;  3MPL A;  4N91 A;  4MLV A;  4RK9 A;  2P1S A;  4GLI A;  3IOR A;  4MBP A;  3O2A A;  2GFE A;  1EZ9 A;  3MWB A;  4YKI A;  1NV1 A;  1FPD A;  2FYI A;  5KCJ B;  2V4C A;  5CI5 A;  2V25 A;  3KN3 A;  1N84 A;  1GGG A;  4PP0 A;  4X1D A;  4HXV A;  3UA8 A;  3D1R A;  5CBR A;  4OVR A;  4HE2 A;  3CG3 A;  4DIG A;  1NV6 A;  5ICT A;  1FPF A;  3BBR A;  2DXY A;  3K1M A;  2ZNU A;  4IO4 A;  4PF8 A;  3MZ1 A;  4BDN A;  4N13 A;  2MKZ A;  4YB7 A;  4NWD A;  3TQW A;  2DWJ A;  4QFP A;  3IOW A;  1A8F A;  1AMF A;  3H6T A;  4TLM B;  5FTI A;  1YPN A;  3QK6 A;  4FBP A;  1POY 1;  5A5X B;  3E78 A;  4RK2 A;  1SDX A;  1LBY A;  4X1B A;  3KJT A;  4F2Q A;  5CMB A;  1PBQ A;  1LBB A;  1B51 A;  2HHM A;  2XXT A;  4GWU A;  5H8Q B;  1LAX A;  5I2K B;  4F18 A;  3UOR A;  3OO8 A;  1LFH A;  5DVI A;  1VDW A;  3T1B A;  3S9M C;  4MNC A;  4IB2 A;  4N07 A;  3OXN A;  2AL4 A;  2DWI A;  3VLW A;  4YMB A;  3HFU A;  3QAX A;  2HAV A;  5JEI A;  2F97 A;  5TPA A;  4GL0 A;  2Z8E A;  1H43 A;  3CFL A;  1VFD A;  3RQT A;  3H4Z A;  5DVJ A;  1SVX B;  4Q0C A;  4LP2 B;  4KR5 A;  3EPE A;  1FQB A;  5CC2 A;  4N15 A;  1AH5 A;  3T93 B;  3TFL A;  1P1N A;  3FUZ A;  4Q30 B;  5KCJ A;  3DP8 A;  3KSX A;  3TCG A;  1B7U A;  5DYH A;  4HCW A;  2WKY A;  5ET8 A;  4F3S A;  4ZE8 A;  5AE4 A;  3U8Q A;  1R9L A;  1LCT A;  1XI6 A;  4P56 A;  4NF6 B;  5J16 A;  2REG A;  4FOR A;  4QHQ A;  4JVI A;  1LCF A;  2GHB A;  2QRY A;  3CG1 A;  1SD3 A;  1S7Y A;  3PUZ E;  1JNF A;  3Q25 A;  4H6D A;  3TPA A;  2F7C A;  3EHS A;  3QUF A;  1XVY A;  1YAE A;  3Q28 A;  2OWZ A;  4ECF A;  5KDT B;  4XEQ A;  5A5X A;  4ELQ A;  1FQD A;  1NFT A;  2ESN A;  3LBS A;  4LUB A;  4GX4 A;  2Y5L A;  4LVQ A;  4U23 A;  5H8Q A;  2PFY A;  5I2K A;  5CMC A;  4GVO A;  4OXV A;  3IOU A;  1B3F A;  1D9Q A;  4Z0I A;  3RY3 A;  1USY H;  3GBB A;  3IO4 A;  4KPT A;  1IXI A;  2Z23 A;  3OEM A;  4YB5 A;  2QS3 A;  1NUX A;  2VPO A;  4GXA A;  4OMB A;  4FAT A;  1B05 A;  2DWA A;  5I3S A;  3IOT A;  1MRP A;  3EF7 A;  4XKN A;  2XD3 A;  4E0X A;  1LBW A;  4QFN A;  2OBG A;  1EZO A;  3C33 A;  1EYJ A;  1N7X A;  2GH9 A;  3B6W A;  5I84 A;  3KZG A;  1RDY A;  2JJK A;  3FV2 A;  3MP1 A;  1O63 A;  3TCH A;  3DP4 A;  4BDL A;  2QJE A;  3PPR A;  1QW0 A;  1LBC A;  4IGR A;  4JWY A;  5TP9 B;  4BDQ A;  1B40 A;  5HBC A;  2B4M A;  4OVQ A;  3RPL B;  1NUY A;  4G68 C;  4KD5 A;  3W9V A;  4P1L A;  4NE4 A;  4FE8 A;  4PBQ A;  3B8B A;  4NF6 A;  2UVH A;  4KI0 E;  3B50 A;  5CRY A;  3ZKL A;  3V89 B;  1ZKB A;  4G68 A;  1BIY A;  2FVZ A;  3E79 A;  4DXC A;  2Z8F A;  2R6G E;  4OQO A;  2HCA A;  1PC3 A;  3VVD A;  1B5J A;  3OO9 A;  1SW5 A;  1RKM A;  3QIM A;  1AWB A;  4PFT A;  3OD7 A;  3ZKK A;  2PFZ A;  3VFJ A;  1N04 A;  2D5W A;  1SI1 A;  2NVU B;  4NG7 A;  4U4X A;  1IXH A;  2AIX A;  4ZEC A;  3H3G A;  2QS2 A;  1JP4 A;  2ZMB A;  4FIM A;  1B3L A;  1KZ8 A;  5HPQ A;  2Q2C A;  1BLF A;  5AA4 B;  1DTG A;  3LUZ A;  2RF1 A;  1NH7 A;  1FW0 A;  4WED A;  1OIB A;  1SW2 A;  3KOS A;  4H46 A;  4YAH X;  1NL5 A;  2WX9 A;  1AL3 A;  3K02 A;  3MVX A;  2RC7 A;  5KZT A;  4Q8R A;  4R2F A;  1QKA A;  1A99 A;  1MQD A;  1UTB B;  4HE1 A;  3IFC A;  5K2X A;  1JEV A;  4GBV A;  4DLD A;  3A29 A;  2REJ A;  3TMG A;  4JXI A;  3PUW E;  1MQI A;  4U2R A;  3VV5 A;  2IEE A;  2O68 A;  1NI9 A;  1B46 A;  1RYO A;  2XWI A;  5IZZ A;  1GR2 A;  1JW4 A;  4NF0 A;  2I48 A;  2PCR A; 
#chains in the Genus database with same CATH homology
 5ICQ A;  4FAJ A;  5FHN A;  4HCY A;  5TP9 A;  3T22 A;  4YKJ A;  3KG2 A;  1I6B A;  1EZP A;  2B65 A;  5AA1 A;  3OO7 A;  1XT8 A;  1SW1 A;  2H25 A;  3KEI A;  3U72 A;  4PFW A;  3KGC A;  3H6U A;  1IXG A;  1M5E A;  4LON B;  2HAU A;  3FVN A;  1FCK A;  5CMK A;  3HO7 A;  4H67 A;  3BFT A;  2ZYK A;  3THI A;  1T0K A;  1URS A;  4NMY A;  3FAT A;  3MVZ A;  3IJO B;  3TEP A;  3CI8 A;  1IXC A;  5BWJ A;  3LUY A;  4EXL A;  3MVW A;  4DCX A;  1IUD A;  1MM6 A;  3BFU A;  1DTZ A;  2F8D A;  5AA4 A;  3O66 A;  3PD8 A;  3PUX E;  4R75 A;  5I57 A;  1MY1 A;  1II5 A;  3FXU A;  3TCF A;  4OFJ A;  1JEU A;  2Q2A A;  3G3G A;  1MY3 A;  1PEB A;  2RCA A;  3PUY E;  1LFG A;  1JVX A;  1UTB A;  2VP1 A;  4XIG Q;  2B3B A;  3B7D A;  2Q8J A;  1QUL A;  3VLV A;  3M8U A;  2F6G A;  3W15 C;  4ZDM A;  1GTK A;  4RYA A;  1CB6 A;  4UA8 A;  2Z22 A;  1FQA A;  3G3J A;  2XX9 A;  2ZNS A;  2ZXT A;  3K1P A;  5I56 A;  3FD3 A;  2HZK A;  3K0V A;  2BJJ X;  2DE3 A;  2FA7 A;  2ONR A;  1ATG A;  2I0B A;  1N3X A;  5B70 A;  3ZSF A;  1M5D A;  1H3D A;  3C32 A;  3RUM A;  3HCQ A;  5H8N B;  2GRV A;  4AB6 A;  3RT8 A;  3B6Q A;  3JV9 A;  3Q29 A;  3TQL A;  5L9O A;  3HHG A;  4EF2 A;  1URD A;  1I6A A;  1B58 A;  3TDJ A;  4F1Y A;  3PPQ A;  2HEU A;  1SI0 A;  4MLQ A;  3USD A;  1VFE A;  1MPB A;  3MW0 A;  1PBP A;  2OWS A;  3UP9 A;  1D3K A;  4OYV A;  2V3T A;  1SYH A;  4EQB A;  1DPE A;  1VR5 A;  2YJP A;  4FEB A;  4M4G A;  2HQ0 A;  3FVK A;  2VD2 A;  1ZIU A;  1B2H A;  3ODB A;  4NED A;  3MPK A;  2XXH A;  2Y84 A;  1F9B A;  1Y1Z A;  3SER A;  1VE4 A;  1EU8 A;  1ZLQ A;  4H65 A;  4XKQ A;  4GRK A;  4P11 A;  2XXQ A;  3CSB A;  4ND9 A;  5JK4 A;  4NTL A;  2F5X A;  3TYH A;  3K00 A;  2NUV A;  1XS5 A;  2M8C A;  4DXB A;  2A5S A;  2DOJ A;  2Y7W A;  1MQH A;  2ALU A;  1ANF A;  1MXY A;  4ZZE A;  4QFO A;  3MP6 A;  4MFI A;  4OTE A;  3RTW B;  2R71 A;  2R9J A;  3WAE A;  1B0L A;  1P1W A;  4I9D A;  1LFI A;  1POT A;  2I4B A;  1OLC A;  4EXK A;  5H8N A;  2XXU A;  2DP8 A;  3OSQ A;  2PX1 A;  2O51 A;  3N26 A;  4C1T A;  4NF4 A;  2YPN A;  4Q5T A;  1NKX A;  1Q1K A;  1O64 A;  3TUS A;  4LZ5 A;  3E9X A;  4THI A;  3M3K A;  1TT1 A;  3C9H A;  3T9X B;  2OLB A;  3FZV A;  4R72 A;  4DCY A;  3VE1 B;  3JYR A;  1US5 A;  1B0H A;  1JET A;  1PDA A;  1QUI A;  1UTH B;  4EUO A;  5JTY A;  2Q9T A;  1MXU A;  2I0C A;  4HW8 A;  2XXW A;  2QMX A;  5L9S A;  2A5T B;  4EQ9 A;  5TU0 A;  4QSC A;  3MP8 A;  4G68 B;  2UXA A;  4NF5 A;  3T66 A;  2PYY A;  2ABH A;  1MDQ A;  4QSE A;  2HXW A;  4ZEF A;  4ELO A;  5CMM A;  3T9H B;  5I59 A;  1UIU A;  4PE5 B;  4LQ2 A;  5EHM A;  3KSJ A;  5AA2 A;  3FAS A;  4R9F A;  4WKM A;  3MQ9 A;  2ZYN A;  3SEX A;  1LAF E;  4ZS9 A;  3CIJ A;  1I6Q A;  3FVO A;  2UVG A;  3IL1 B;  4QFL A;  1D4N A;  3SES A;  3HST A;  1L5T A;  2AL5 A;  3K6U A;  3RPW A;  4H8J A;  1TWY A;  2O6A A;  1Y1M A;  4F3B A;  1N7W A;  1A8E A;  2THI A;  3DLN A;  3FJM A;  5BUU A;  4RY1 A;  2Y7I A;  3P7I A;  4F2O A;  3SEY A;  3MC2 A;  1B4Z A;  1A7L A;  3T9U A;  3O9P A;  2DQV A;  2Q88 A;  3SEV A;  1M5B A;  1Q35 A;  2RC9 A;  3SEW A;  3IB0 A;  4JSD A;  3CSG A;  4LZ7 A;  2O69 A;  3GBA A;  3TZA A;  1UTH A;  5H8F B;  4C1U A;  2D21 A;  1NNF A;  4IO3 A;  1MXV A;  2E0S A;  4LZ8 A;  4RNS A;  4MH5 A;  2A5T A;  3DEL B;  3TEL A;  4F3P A;  4UAC A;  2I58 A;  2VOZ A;  4POX A;  3LSF B;  2YLN A;  1P1O A;  1HSL A;  1Y3P A;  4FJP A;  4U22 A;  1ZU0 A;  4DZ1 A;  3N94 A;  1M5F A;  4U21 A;  4ZEB A;  1BTJ A;  2CMO A;  4R73 A;  4I62 A;  3C31 A;  4QF9 A;  1XHY A;  3Q27 A;  3S9N C;  4XKR A;  3GXA A;  4OES A;  1ZMG A;  2NXO A;  4KQP A;  4K3F A;  3U92 A;  4F19 A;  1D9V A;  5I57 B;  2O1M A;  4GXS B;  2QS4 A;  1FTJ A;  2F35 A;  2F78 A;  2UYF A;  3FXR A;  4AQ4 A;  3FXQ A;  4E0W A;  4OEV A;  3E3K A;  3FGS A;  3QYT A;  4XXU A;  4H5F A;  3C35 A;  1XC1 A;  3CFX A;  2OJT A;  1ZBM A;  4H0W A;  3FIR A;  1S50 A;  3U93 A;  4DDD A;  3Q26 A;  3RT6 B;  4M1V A;  3EHU A;  4X9T A;  3TAJ A;  4POW A;  3VVF A;  1QVS A;  3FV1 A;  1OVT A;  3EQ1 A;  1CE2 A;  5EHS A;  5EYF A;  3IB2 A;  3WAF A;  3OOA A;  4RPN A;  1MY4 A;  1NMU A;  3ECR A;  5I56 B;  2QS1 A;  3GLB A;  2DWH A;  2Y7K A;  3S4U A;  4F1U A;  3QXM A;  4R6H A;  3CVG A;  3OEK A;  3I6V A;  4KYE A;  5H8F A;  1KWH A;  4MF3 A;  1IQ7 A;  1B52 A;  3I3V A;  3K6W A;  2PT1 A;  4RJZ A;  4GF8 A;  3OSR A;  4PFY A;  2Q89 A;  5IKB A;  4KFQ A;  4GIZ A;  2ONS A;  2CZL A;  1DMB A;  5B7D A;  2F7A A;  3O6H A;  1GVC A;  4JWX A;  4NF8 A;  2QMW A;  5FTH A;  4KYS A;  1MDP 1;  2O1L A;  2H9B A;  4F3G A;  3UIF A;  3V8X B;  4EQ7 A;  4TLL B;  4F39 A;  2PT2 A;  4P0I A;  1UQW A;  4G8M A;  2F34 A;  4XKP A;  1J1N A;  1N76 A;  1QKB A;  2O84 X;  1B1X A;  2X7Q A;  3IB1 A;  4KCC A;  1PB9 A;  4JB7 A;  3CRB A;  2IA4 A;  3PMX A;  3PPO A;  4ELP A;  4RA1 A;  3MZB A;  4YKK A;  3MVY A;  1Y3Q A;  1XVX A;  4QRZ A;  2DS9 A;  3FJ7 A;  1MM7 A;  4IO5 A;  4G77 A;  4R9G A;  4OWD A;  3QSL A;  3H06 B;  1M5C A;  5L9M A;  3KOT A;  1JW5 A;  3TTM A;  2LAO A;  4G8N A;  3KJ7 A;  3G3H A;  5AA2 D;  4YZZ A;  4U4S A;  1LST A;  3U94 A;  2DVC A;  1A54 A;  2H98 A;  4OEN A;  3E13 X;  5F1Q A;  3VLU A;  3HV1 A;  2QPQ A;  4GWO A;  4OET A;  4RPO A;  2DXR A;  4R2B A;  4EDP A;  3FJG A;  3RTF B;  1H44 A;  4NF4 B;  3OEL A;  1DOT A;  2VGQ A;  2NOO A;  4I1D A;  1OVB A;  2OWT A;  4OER A;  3SKP A;  3R6U A;  1TXF A;  5ELV A;  1Z7M E;  4ZED A;  2ZYM A;  3UN6 A;  2RIN A;  3LSX A;  3PU5 A;  5JTY B;  3K4U A;  4EF1 A;  1B1H A;  1FQF A;  4ESX A;  1MXX A;  4H8I A;  2VHA A;  1OLA A;  2DE4 A;  4O3C A;  1MG1 A;  4YIC A;  3KFM A;  4OHN A;  2FNC A;  4JWO A;  1IIW A;  4I8C A;  5I2N B;  1A40 A;  3MJN A;  2O7I A;  1B3G A;  4NF5 B;  4ZEI A;  3A3U A;  1O7T A;  3PV0 E;  1D9Y A;  3T96 B;  5ITO A;  4YKP A;  3RGY A;  3LSL A;  2GHA A;  3IOV A;  3H6W A;  5I59 B;  4OFO A;  5AA2 B;  3L6G A;  1DSN A;  2XXR A;  4FED A;  2XX8 A;  4IO7 A;  4L17 A;  4OFL A;  1MQJ A;  2X7P A;  4YU0 A;  2W7Y A;  3W9W A;  2XXI A;  2UYE A;  1P1Q A;  3DP6 A;  3D4G A;  1MH3 A;  1B6H A;  3JZJ A;  3IO6 A;  4G2Z A;  3ONM A;  1Y9U A;  2B3F A;  5AA3 A;  1TFA A;  1LB8 A;  3MBP A;  3IK6 B;  1H45 A;  4R6Y A;  5DVF A;  3M3F A;  3OO6 A;  4C0R A;  2RC8 A;  1ELJ A;  4GOT A;  3SET A;  1US4 A;  1B7H A;  1MS7 A;  2Y7R A;  1LB9 A;  2H5Y A;  1IEJ A;  4ISU A;  1LAH E;  4QSD A;  2XX7 A;  5H8H A;  3K6X A;  1YCJ A;  3AXF A;  2ZNT A;  3U1O A;  4IY6 A;  1MY2 A;  4OEU A;  3ILU B;  1R6Z A;  3MUQ A;  4DE8 A;  1N0T A;  4IO2 A;  2P2A A;  1JVY A;  3PMV A;  4GL8 A;  3K6V A;  1Y4T A;  5I2N A;  1OQH A;  3PUV E;  5LOM A;  3E4R A;  2DYX A;  4GD5 A;  1MY0 A;  1P99 A;  5DEX B;  3EN3 A;  3EHT A;  1I69 A;  2H4I A;  4JSO A;  3MAM A;  4U1O A;  3RN8 A;  3K2D A;  2I4C A;  1XOC A;  1H76 A;  3A09 A;  5L8D A;  4ESW A;  1Y20 A;  1B7Z A;  4ZEK A;  4F22 A;  3G7W A;  1USY E;  2G29 A;  3HN0 A;  3SDF A;  1MPD A;  1Y4C A;  5FHO A;  1JQF A;  1AIV A;  4JDF A;  2I3W A;  2V3Q A;  2XXV A;  1URG A;  4XTC Q;  4LQ5 A;  4F1V A;  2V84 A;  3R26 A;  4PQJ A;  1WOD A;  2I3V A;  1SBP A;  1FTO A;  5CM6 A;  4OVJ A;  1B32 A;  2DVZ A;  5CBS A;  5I58 B;  4HTG A;  4H1X A;  1PB7 A;  3BKI B;  4LAT A;  4PET A;  3K01 A;  3OMB A;  2RCB A;  4ONY A;  1MXZ A;  3K1N A;  3D4C A;  2QL3 A;  3DM0 A;  3V5A A;  5FHM A;  1WVJ A;  4BLA A;  3N6U A;  2P0S A;  3B6T A;  3S2V A;  1OMP A;  1NNT A;  2VD3 A;  1FQC A;  1B3E A;  1FQE A;  4TQU Q;  4JBZ A;  4N6P A;  5IAI A;  3LR1 A;  4G4P A;  1NNK A;  2XXX A;  3IR1 A;  2XXY A;  2F7B A;  2Y7P A;  4R74 A;  3PD9 A;  3IX1 A;  1QUJ A;  1NNP A;  1MPC A;  1MXW A;  5DEX A;  3C34 A;  3F11 A;  4NWC A;  4AB5 A;  1LLS A;  2PVU A;  4NF8 B;  4X48 A;  2PMS A;  4OZ9 A;  4H5G A;  2G93 A;  2I49 A;  3T9V A;  2HZL A;  1HSJ A;  3KN8 A;  3VXC A;  3UGW A;  1LGB C;  3HPI A;  1DPP A;  1AOV A;  2E1S A;  5J1D A;  3O6I A;  4WEP A;  4FEC A;  2XXP A;  5KDT A;  2RKM A;  4IY5 A;  5F7V A;  4F29 A;  4YMA A;  3V83 A;  2ANJ A;  3ILT B;  5DTB A;  1WDN A;  5I58 A;  2DE2 A;  3G3K A;  4Z7E A;  3H6V A;  1R1N A;  3TOD A;  1RYX A;  3VDF A;  1TFD A;  1MQG A;  3IAZ A;  5K2Y A;  2ZYO A;  1P1U A;  1HSE A;  5ISU A;  2UVJ A;  2OZZ A;  3HHF A;  3L6H A;  1R9Q A;  4BDR A;  3CR9 A;  1GV8 A;  1SQY A;  2ONK E;  4P0G A;  3TTN A;  1EH3 A;  4BDM A;  4TOZ A;  2XHD A;  3C36 A;  3KN7 A;  3LC8 A;  4G8H A;  2F6P A;  1A55 A;  1BKA A;  3S9E A;  3CFZ A;  3N6T A;  4IGT A;  2OCU A;  3O6G A;  3FVG A;  5M2V A;  4GQO A;  3KBR A;  2V93 A;  1Z7N E;  2V3U A;  2QSX A;  4ZE9 A;  3PGF A;  3PMW A;  4IO6 A;  4KYD A;  3O29 A;  1B4H A;  1JW1 A;  3S9L C;  3QUJ A;  1IIT A;  1B5I A;  3TTL A;  3PPP A;  1OQG A;  1IZ1 A;  1BP5 A;  1FTM A;  3G3I A;  3O97 A;  5DT6 A;  3OEN A;  4PFU A;  5H8S A;  4U1Z A;  3ZS6 A;  1Y3N A;  3TTK A;  4LA9 A;  4RXL A;  4O3B A;  1N3W A;  3LSW A;  1LAG E;  3MZ9 A;  4YB6 A;  2NWJ A;  2HFB A;  4R6K A;  4F31 B;  1QJM A;  3R7X A;  1MH4 A;  3TTR A;  2AYS A;  4HS7 A;  2OK2 A;  1QUK A;  4GFR A;  4QFK A;  2I6E A;  3H7M A;  1FTL A;  3VVE A;  2UVI A;  1NH8 A;  2F36 A;  1PB8 A;  4KCD A;  3G3F A;  5ITP A;  4BDO A;  3M3L A;  2XD2 A;  1B9J A;  2DSF A;  3SEU A;  1YTV A;  1S9T A;  4WXJ A;  1ZJL A;  2Z8D A;  4ZZA A;  4KHZ E;  2O7U A;  2KLF A;  3UK4 A;  3RLF E;  3IJX B;  4DXU A;  1B5H A;  1UIV A;  1B3H A;  5HM4 B;  3GZG A;  3A3C A;  2X26 A;  3I5O A;  3PPN A;  1VSO A;  3VXB A;  4O3A A;  5TPA B;  3RNN A;  1SYI A;  3C4M A;  3TKD A;  4ELR A;  3N5L A;  1SW4 A;  2PBW A;  3H03 A;  2D3I A;  1ZTY A;  3O28 A;  1FTK A;  5H8H B;  2H99 A;  3MPL A;  4MLV A;  4RK9 A;  2P1S A;  4GLI A;  3IOR A;  4MBP A;  3O2A A;  2GFE A;  1EZ9 A;  3MWB A;  4YKI A;  2FYI A;  5KCJ B;  5CI5 A;  2V25 A;  3KN3 A;  1N84 A;  1GGG A;  4PP0 A;  4X1D A;  3UA8 A;  5CBR A;  3CG3 A;  4DIG A;  5ICT A;  3BBR A;  2DXY A;  3K1M A;  2ZNU A;  4IO4 A;  3MZ1 A;  4BDN A;  4N13 A;  4YB7 A;  4NWD A;  3TQW A;  2DWJ A;  4QFP A;  3IOW A;  1A8F A;  1AMF A;  3H6T A;  4TLM B;  5FTI A;  1YPN A;  3QK6 A;  1POY 1;  5A5X B;  4RK2 A;  1SDX A;  4X1B A;  3KJT A;  4F2Q A;  5CMB A;  1PBQ A;  1LBB A;  1B51 A;  2XXT A;  5H8Q B;  1LAX A;  5I2K B;  4F18 A;  3UOR A;  3OO8 A;  1LFH A;  5DVI A;  3S9M C;  4IB2 A;  4N07 A;  3OXN A;  2AL4 A;  2DWI A;  3VLW A;  4YMB A;  3QAX A;  2HAV A;  5JEI A;  2F97 A;  5TPA A;  4GL0 A;  2Z8E A;  1H43 A;  3CFL A;  1VFD A;  3RQT A;  3H4Z A;  5DVJ A;  1SVX B;  4Q0C A;  4LP2 B;  4KR5 A;  3EPE A;  1FQB A;  5CC2 A;  1AH5 A;  3T93 B;  3TFL A;  1P1N A;  3FUZ A;  4Q30 B;  5KCJ A;  3DP8 A;  3KSX A;  3TCG A;  1B7U A;  5DYH A;  4HCW A;  2WKY A;  4F3S A;  5AE4 A;  4ZE8 A;  3U8Q A;  1R9L A;  1LCT A;  4NF6 B;  2REG A;  4FOR A;  4QHQ A;  1LCF A;  2GHB A;  2QRY A;  3CG1 A;  1SD3 A;  1S7Y A;  3PUZ E;  1JNF A;  3Q25 A;  4H6D A;  3TPA A;  2F7C A;  3EHS A;  3QUF A;  1XVY A;  1YAE A;  3Q28 A;  4ECF A;  5KDT B;  5A5X A;  4ELQ A;  1FQD A;  1NFT A;  2ESN A;  3LBS A;  4LUB A;  4LVQ A;  4U23 A;  5H8Q A;  5I2K A;  5CMC A;  4GVO A;  4OXV A;  3IOU A;  1B3F A;  4Z0I A;  3RY3 A;  1USY H;  3GBB A;  3IO4 A;  4KPT A;  1IXI A;  2Z23 A;  3OEM A;  4YB5 A;  2QS3 A;  4GXA A;  4OMB A;  4FAT A;  1B05 A;  2DWA A;  3IOT A;  1MRP A;  3EF7 A;  4XKN A;  2XD3 A;  4E0X A;  4QFN A;  2OBG A;  1EZO A;  3C33 A;  1N7X A;  2GH9 A;  3B6W A;  5I84 A;  3KZG A;  3FV2 A;  3MP1 A;  1O63 A;  3TCH A;  3DP4 A;  4BDL A;  2QJE A;  3PPR A;  1QW0 A;  1LBC A;  4IGR A;  4JWY A;  5TP9 B;  4BDQ A;  1B40 A;  5HBC A;  4G68 C;  4KD5 A;  3W9V A;  4NE4 A;  4FE8 A;  4NF6 A;  2UVH A;  4KI0 E;  5CRY A;  3ZKL A;  3V89 B;  1ZKB A;  4G68 A;  1BIY A;  4DXC A;  2Z8F A;  2R6G E;  4OQO A;  2HCA A;  1PC3 A;  3VVD A;  1B5J A;  3OO9 A;  1SW5 A;  1RKM A;  3QIM A;  4PFT A;  3OD7 A;  3ZKK A;  3VFJ A;  1N04 A;  2D5W A;  1SI1 A;  2NVU B;  4U4X A;  1IXH A;  2AIX A;  4ZEC A;  3H3G A;  2QS2 A;  2ZMB A;  4FIM A;  1B3L A;  5HPQ A;  2Q2C A;  1BLF A;  5AA4 B;  1DTG A;  2RF1 A;  1NH7 A;  1FW0 A;  4WED A;  1OIB A;  1SW2 A;  3KOS A;  4YAH X;  1NL5 A;  1AL3 A;  3K02 A;  3MVX A;  2RC7 A;  5KZT A;  4Q8R A;  4R2F A;  1QKA A;  1A99 A;  1MQD A;  1UTB B;  5K2X A;  1JEV A;  4DLD A;  2REJ A;  3TMG A;  4JXI A;  3PUW E;  1MQI A;  4U2R A;  3VV5 A;  2IEE A;  2O68 A;  1RYO A;  1B46 A;  1GR2 A;  1JW4 A;  2I48 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...