1SW5A

Crystal structure of prox from archeoglobus fulgidus in the ligand free form
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
270
structure length
270
Chain Sequence
ERVVIGSKPFNEQYILANMIAILLEENGYKAEVKEGLGGTLVNYEALKRNDIQLYVEYTGTAYNVILRKQPPELWDQQYIFDEVKKGLLEADGVVVAAKLGFRDDYALAVRADWAEENGVEKISDLAEFADQLVFGSDPEFASRPDGLPQIKKVYGFEFKEVKQMEPTLMYEAIKNKQVDVIPAYTTDSRVDLFNLKILEDDKGALPPYDAIIIVNGNTAKDEKLISVLKLLEDRIDTDTMRALNYQYDVEKKDAREIAMSFLKEQGLVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords osmoprotection protein (proX)
publication title Structural basis for the binding of compatible solutes by ProX from the hyperthermophilic archaeon Archaeoglobus fulgidus.
pubmed doi rcsb
source organism Archaeoglobus fulgidus
total genus 97
structure length 270
sequence length 270
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2004-03-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1sw5A01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 1sw5A02
3OENA 4H8IA 3TPAA 3GLBA 3E9XA 1QVSA 3QIMA 5I57B 3KZGA 1MQGA 5H8SA 3TUSA 1N76A 5DT6A 3IX1A 1JW5A 4MH5A 3K01A 2B3FA 2Q89A 1R1NA 3PV0E 3E4RA 3N26A 4DE8A 5KCJB 4POXA 4GL0A 1MY2A 1POY1 5JTYB 3OXNA 1OQHA 4UA8A 4R74A 2XHDA 2O6AA 2LAOA 1DPPA 3OOAA 2RC8A 2QS2A 1DSNA 2OZZA 3DM0A 4OEUA 3O2AA 2M8CA 3QAXA 4MBPA 5CM6A 3TCGA 3IK6B 4KPTA 1UIUA 2OJTA 4WEDA 3T22A 1MY4A 4JWOA 3MC2A 2IEEA 3Q29A 1EZOA 1PB9A 3PPQA 4RK9A 1II5A 1FTOA 5CI5A 4F31B 4BDNA 1CE2A 1F9BA 3PGFA 4ZZAA 4L17A 1IZ1A 3KN7A 1UTBB 3Q25A 2XXIA 4QFKA 4NE4A 1PB8A 1I6QA 1NNFA 3IO6A 3OMBA 4KYEA 2I4CA 3PUZE 1MQDA 4WXJA 4PFUA 4O3AA 4QSEA 5DEXB 3CFLA 2RKMA 3SEUA 3MZ1A 4F18A 1LAGE 2I0CA 1N3WA 3KJTA 2Z8DA 3A3CA 1IXCA 1DMBA 3SEYA 1ZJLA 4DCYA 4DXUA 4Q5TA 1MY1A 4GXSB 3MAMA 4QFPA 5FTHA 2REGA 3RY3A 5L9SA 4HS7A 4TQUQ 4EDPA 2Q2AA 3DP6A 3SEWA 4KHZE 1OLCA 1N3XA 3PMWA 1NNPA 4EXLA 2PVUA 3VLUA 1IITA 5KDTA 4IO7A 4N13A 1A40A 1MDP1 3FVNA 1JVXA 1QUIA 2R9JA 5I56B 3MJNA 4F1UA 3OSQA 5A5XA 3QYTA 1N84A 3UGWA 5CC2A 1B52A 2QS3A 1PB7A 5M2VA 5IAIA 3T66A 4IGTA 5BUUA 3MVWA 1NH8A 1MS7A 4FJPA 1BIYA 2OK2A 4IO6A 3LC8A 2F97A 3Q27A 4Q8RA 1IIWA 3VFJA 1VFDA 2F6GA 3FV1A 1ZMGA 5CMCA 3TTNA 5AA2A 1P1NA 3KOSA 3LBSA 1EZPA 1D3KA 1SI1A 3U72A 4HCYA 4U1ZA 2DS9A 5BWJA 4H65A 4ZS9A 2XXXA 1R9QA 2I3WA 1M5FA 5ICTA 3EHTA 4I8CA 1JW4A 3OEKA 3S9LC 2OCUA 1XT8A 4F2QA 1H44A 1JETA 4GWOA 3IJOB 3RGYA 1B32A 4H6DA 4OHNA 2B3BA 1JEUA 1I6AA 2F36A 1P1UA 4PETA 1N04A 1JEVA 2DXRA 4O3CA 3RPWA 3IB2A 4EQ7A 4U22A 2Y7IA 1POTA 2HZKA 1BKAA 3K6VA 3VXBA 1US4A 4R9GA 2XXVA 2DYXA 4QRZA 4X48A 4POWA 1BTJA 2PT2A 2DE2A 1R6ZA 3H3GA 1H45A 5TP9A 2Q88A 4ELQA 1QUJA 4IY6A 3M8UA 2I4BA 4DCXA 3PPPA 4R75A 2O7IA 1NNKA 3K4UA 3F11A 4LQ5A 2NVUB 2H98A 2VGQA 4PP0A 3G3HA 3HV1A 3T9XB 3MP8A 5I59B 1OMPA 3MPKA 3HHGA 5CMMA 3WAEA 1H43A 5HPQA 4EXKA 1OQGA 3TCHA 4ZEDA 4X9TA 5AA4A 3TTLA 3PPNA 1OIBA 5H8FA 5H8NA 4IY5A 3P7IA 3TYHA 4ZE9A 3FVKA 4U4SA 5TU0A 3R7XA 1B5IA 2IA4A 5DTBA 4GQOA 3C35A 2GH9A 1XHYA 1B7HA 4HW8A 4KYSA 2QL3A 1SDXA 2HFBA 4MLVA 1YPNA 2E0SA 1SW4A 4QFOA 1IXHA 3U94A 4NF5B 2VP1A 2WKYA 5JK4A 2XXQA 2DP8A 3CR9A 5AE4A 4H5GA 4UACA 3IO4A 1DPEA 3K2DA 1I69A 3TTKA 1B3FA 1VR5A 3LSFB 3OSRA 4FIMA 2BJJX 4GD5A 4FAJA 4KYDA 1FTKA 2DSFA 3K0VA 4IO2A 5H8QA 3HPIA 3RQTA 3LSXA 3IOWA 1B4ZA 4JSOA 2ZNSA 3RT8A 5A5XB 1HSLA 4YU0A 1LSTA 4N6PA 4WKMA 1O64A 4ELRA 3FASA 1Y1MA 4AB5A 1PEBA 3VLVA 2YPNA 3E13X 3QXMA 5CBRA 1Y3PA 4BDOA 2OLBA 1B7ZA 3OELA 2QPQA 1LLSA 4BDMA 2ZXTA 3M3FA 4BLAA 3JZJA 2Y7WA 3D4CA 3CI8A 5AA2B 4K3FA 3G3GA 4LZ5A 2NOOA 1LFHA 1ZLQA 2XXRA 3G3IA 4MLQA 2DE3A 2Z23A 3K00A 1O63A 4JB7A 2A5TA 1B46A 3KN8A 1ZTYA 1YTVA 5FHOA 1A7LA 3H6UA 3VVEA 3TQWA 1P99A 2B65A 2F78A 3ZSFA 3SEVA 3IB1A 2D3IA 1B5HA 2Z8FA 4F29A 1LFGA 3OEMA 2D5WA 2DVCA 1R9LA 1GV8A 3TKDA 5CMBA 2RINA 4P0IA 3H03A 1B2HA 4GRKA 3SERA 1RKMA 2I6EA 1P1OA 3BFUA 1PBPA 4OVJA 2RF1A 5TP9B 1SYIA 4YKJA 3UK4A 4YAHX 4OFLA 5H8HA 3TZAA 2VOZA 4R6YA 1SVXB 4ND9A 2DQVA 1MPCA 3IAZA 4RXLA 1XVXA 3W15C 2ABHA 2THIA 2O84X 4OFJA 2Z8EA 3TFLA 3PUYE 3RTWB 1A8FA 3OD7A 3FXUA 4XKNA 2XXPA 1SW5A 3KG2A 5EHMA 3ILUB 2F5XA 5KZTA 3T96B 1WVJA 4THIA 2DWIA 3IOTA 1MM6A 1URGA 4OETA 5H8FB 1NKXA 3G3KA 2F34A 4NF4A 3THIA 3H6VA 5DVJA 1NL5A 4BDLA 5AA2D 4F3SA 1PDAA 1S7YA 2UVIA 5CMKA 1B6HA 1J1NA 1MG1A 3IOVA 2Y7PA 1FQDA 2HAUA 2NXOA 2DWAA 1IXIA 2QRYA 3C4MA 1VSOA 4G68C 4ELOA 1PC3A 3L6HA 4OQOA 3V89B 4PFTA 5I2KA 2I3VA 4C1TA 3PMXA 3U1OA 2P1SA 2I58A 1QJMA 3FV2A 2ALUA 5H8QB 4LATA 4TOZA 2AIXA 3VVDA 2F7BA 2QMXA 3AXFA 5F1QA 4M4GA 3UP9A 1MH3A 3PMVA 1LFIA 3GBAA 3GZGA 1JW1A 1MQIA 1L5TA 3MBPA 4YKPA 4ZECA 4R2FA 1XS5A 3PUVE 2NWJA 1MXWA 3B6TA 3CSGA 2O69A 3S4UA 2PX1A 4LP2B 1DTGA 4OWDA 3T93B 3C32A 1Y9UA 2Y7KA 4RY1A 2XX9A 3FATA 1H76A 3TAJA 2QMWA 5DVIA 3RN8A 2F6PA 1B1XA 5FHMA 1TFAA 5ITPA 1T0KA 4BDRA 2H4IA 2AL5A 4IGRA 3C33A 4DIGA 4IO5A 4G8MA 4O3BA 4NF8A 4R6HA 5FTIA 3UORA 3CVGA 5I58A 4C0RA 2YJPA 1XOCA 1JQFA 1B7UA 3D4GA 2V25A 3O66A 3PUXE 4G8HA 3OO8A 4OYVA 3DP4A 3MUQA 3LSWA 3KEIA 1B4HA 4KQPA 1M5BA 2HQ0A 3SETA 1S9TA 3FIRA 1B05A 1Y4TA 1SW1A 2VD3A 2OBGA 3JYRA 1IQ7A 4LA9A 1OVTA 1ZKBA 4H5FA 3MPLA 2HXWA 5TPAA 1AH5A 4ESWA 4OEVA 3S9EA 2H9BA 4P0GA 4XKRA 1GGGA 1JVYA 2QS4A 5I84A 3U93A 2GHAA 1MXVA 4OMBA 3A3UA 3T9UA 2E1SA 3V83A 3PU5A 2D21A 5ITOA 4OERA 1O7TA 3H06B 4R73A 5KCJA 4EF2A 1SYHA 4OFOA 3H6TA 1FTLA 4R6KA 1MPDA 5JTYA 2XXWA 3RNNA 4GFRA 3OO9A 3K6WA 1MY0A 3K6XA 3SKPA 1TT1A 2RC7A 3ZKLA 4JSDA 1URDA 4Z0IA 2DOJA 3T9VA 2FYIA 4NMYA 2X26A 4RA1A 4NF4B 2HZLA 2V93A 1AL3A 3BBRA 4XXUA 2AL4A 3Q26A 1B40A 3KSXA 1Z7NE 5I2NA 1KWHA 2I48A 3FJGA 2GHBA 1LAHE 1TFDA 3KSJA 3CG3A 1MQHA 1FQAA 4YMAA 1A8EA 3EPEA 2Q8JA 1B51A 3K1MA 4YKIA 4NF6A 2R71A 1MXXA 1UTBA 4LUBA 4QF9A 3W9VA 1USYE 2CZLA 4AB6A 2ZYMA 1LAFE 3PD9A 2ZMBA 3S9NC 5I2KB 5IKBA 3O6IA 1DTZA 3K02A 3B6WA 4HTGA 3FUZA 2P2AA 1Y20A 1WDNA 4LQ2A 2GFEA 4GIZA 5DEXA 3A09A 1SBPA 4LVQA 3V8XB 4QSCA 1H3DA 2ESNA 4XIGQ 2VHAA 2PT1A 1LBBA 1SD3A 5KDTB 3T9HB 4FEDA 2AYSA 1MPBA 4OESA 1ANFA 3FGSA 2G29A 3HCQA 4OENA 4MF3A 3OO7A 2V3UA 1IEJA 1HSEA 4E0WA 4HCWA 3MZBA 3O28A 3KN3A 1QKAA 4GLIA 1I6BA 1EH3A 3BKIB 1UTHA 2Q2CA 4NEDA 5B7DA 3FXQA 3USDA 3TQLA 4KD5A 3PUWE 2GRVA 4IO3A 1AIVA 4U1OA 1FTMA 3DP8A 3FXRA 3GBBA 4F22A 4Q0CA 4ZEBA 5AA3A 4RJZA 1LCTA 4NF8B 5K2YA 3MWBA 4I62A 4JXIA 5ELVA 2DWHA 1Q1KA 2ONKE 1MH4A 4YKKA 3MVZA 4QFLA 3FVGA 1ZIUA 2XX7A 4U21A 2XXHA 2F8DA 1FQEA 4YB7A 4QSDA 3VLWA 1LB8A 3M3LA 3FVOA 2UVHA 3N94A 4GF8A 3RUMA 3LSLA 1JNFA 3FJ7A 3VE1B 2FA7A 4ISUA 4RNSA 1QULA 5TPAB 4GXAA 1IXGA 4FEBA 3FZVA 4MFIA 4X1BA 2I49A 3O97A 3IJXB 5K2XA 1D9VA 4RPOA 4ELPA 3QSLA 4GOTA 3ODBA 1A54A 4U4XA 3SDFA 3HSTA 1ATGA 1MM7A 1Y3NA 2XXYA 1D4NA 2XXUA 5DYHA 1Q35A 2VD2A 3MVYA 4G68A 4OXVA 1SI0A 3UIFA 4EUOA 3TDJA 3H7MA 3CIJA 4I1DA 4R9FA 4TLLB 3QK6A 3WAFA 4PFYA 2X7PA 4YB5A 3U92A 4R2BA 1RYXA 3I3VA 4FECA 4KR5A 1VFEA 4PQJA 4Z7EA 2ZYNA 3G7WA 3PPOA 5AA4B 2RCBA 3V5AA 1YCJA 2V84A 2Z22A 3KJ7A 3VDFA 3EHUA 3I5OA 1B5JA 5H8NB 5I59A 2V3TA 3ILTB 3RTFB 3C34A 3RLFE 5F7VA 2RC9A 1N7XA 5I2NB 2PMSA 4RK2A 1B3EA 3IL1B 3Q28A 3C31A 3SEXA 1GTKA 1HSJA 1XC1A 3DELB 4NF6B 1MQJA 3CRBA 1BLFA 2CMOA 4LZ8A 1NMUA 4AQ4A 3TEPA 4ESXA 5HM4B 4EQBA 1MXZA 4QFNA 4F3PA 5EHSA 4N07A 1NH7A 1M5CA 1MRPA 3LR1A 4E0XA 3K1NA 4OTEA 4H67A 5ICQA 4JWXA 3W9WA 3TELA 5FHNA 3HHFA 3R26A 3KGCA 4NF5A 4RYAA 2G93A 1Z7ME 2V3QA 5J1DA 3FJMA 1M5EA 1GVCA 4C1UA 1BP5A 1QUKA 1URSA 4YB6A 3UA8A 4JWYA 3EQ1A 4R72A 2QJEA 4FE8A 3KFMA 2UVJA 2UYFA 3BFTA 3N6UA 4IB2A 1PBQA 4XKQA 2ZNUA 3VXCA 1SW2A 3H4ZA 2DXYA 3B6QA 1UTHB 1B9JA 1QKBA 2UVGA 4ZE8A 3MP6A 3IORA 2YLNA 4F1YA 4YICA 3EHSA 3O6GA 1Y4CA 4LZ7A 1LAXA 2A5TB 2ZNTA 4X1DA 1UIVA 2F7AA 1CB6A 4ZEKA 1LCFA 2QSXA 2H99A 2FNCA 3H6WA 4KCDA 3PD8A 4M1VA 2HEUA 2P0SA 1QW0A 4JDFA 3TCFA 5L9MA 3QUFA 3CSBA 4F39A 2HCAA 4JBZA 4DXBA 2HAVA 3C9HA 1TXFA 2ZYOA 2XXTA 2ZYKA 4QHQA 3O29A 4H8JA 1ELJA 4BDQA 3SESA 3O9PA 1LGBC 4LONB 4F2OA 4YMBA 4GVOA 1RYOA 3CFXA 5I57A 3M3KA 2XD3A 1B3LA 5H8HB 3MW0A 3S9MC 1ZBMA 3ZKKA 4DXCA 4GL8A 4TLMB 2REJA 4I9DA 1NNTA 4P11A 5L8DA 1TWYA 3ECRA 1AOVA 2XD2A 3N6TA 3IR1A 1XVYA 4G68B 1A99A 2W7YA 4ECFA 2KLFA 1MDQA 4YZZA 4ZDMA 1VE4A 2QS1A 2UYEA 2O1LA 3IB0A 4ZEFA 3S2VA 4G2ZA 4OZ9A 2O51A 3CG1A 2O68A 4FATA 4U23A 2XX8A 2DWJA 4U2RA 4H1XA 3G3FA 5B70A 1P1WA 3UN6A 1B0HA 2OWSA 1LBCA 1B3HA 2PYYA 3C36A 1UQWA 5AA1A 3EN3A 3EF7A 2Y84A 3GXAA 4F3BA 2ONSA 3KOTA 1N7WA 1GR2A 5ISUA 4KFQA 1B0LA 1SQYA 4NWDA 3MVXA 1Y3QA 5CRYA 1IUDA 2NUVA 3E3KA 1D9YA 3R6UA 1S50A 3G3JA 1FQFA 2H25A 4DLDA 3LUYA 4F1VA 3TTMA 3MP1A 1A55A 4FORA 1FQCA 5CBSA 2RCAA 3TODA 5EYFA 1B3GA 2O7UA 3O6HA 4ZZEA 1B1HA 1FTJA 1M5DA 2R6GE 3L6GA 4F19A 4IO4A 4WEPA 1USYH 4KCCA 1WODA 3B7DA 2A5SA 4NWCA 1MXUA 3N5LA 1MY3A 1B58A 4DZ1A 5L9OA 2ANJA 3KBRA 1LB9A 2H5YA 2PBWA 5I56A 2O1MA 4H0WA 3MZ9A 2Y7RA 1NFTA 3MQ9A 4ONYA 2OWTA 5DVFA 4EQ9A 2I0BA 4EF1A 4G8NA 3VV5A 3CFZA 3PPRA 1Y1ZA 5LOMA 4DDDA 3RT6B 3QUJA 3HO7A 4F3GA 2Q9TA 3VVFA 3K1PA 3OO6A 1AMFA 3DLNA 3K6UA 4KI0E 1OVBA 4RPNA 4NTLA 1MXYA 4PE5B 3ZS6A 5JEIA 5HBCA 4G77A 1EZ9A 3I6VA 2ONRA 3HN0A 1EU8A 4XKPA 1N0TA 1YAEA 3IOUA 1FCKA 5I58B 1DOTA 2DVZA 3FD3A 3TMGA 3ONMA 3TTRA 2F35A 3JV9A 2F7CA 4G4PA 4ZEIA 1P1QA 1US5A 2UXAA 1FQBA 4PFWA 1ZU0A 1OLAA 4XTCQ 1FW0A 3U8QA 2X7QA 4Q30B 2DE4A
chains in the Genus database with same CATH superfamily
5ET6A 3OENA 4HE2A 4H8IA 3TPAA 3GLBA 4G61A 3E9XA 4PTKA 1QVSA 3QIMA 5I57B 3KZGA 1MQGA 3RPLA 5H8SA 3TUSA 1N76A 5DT6A 3IX1A 1JW5A 4MH5A 3K01A 2B3FA 2Q89A 2MKZA 1R1NA 1LBWA 1FBCA 3PV0E 3E4RA 3N26A 4DE8A 5KCJB 4POXA 4GL0A 1MY2A 1POY1 5JTYB 3OXNA 2CZHA 4GWSA 1OQHA 4UA8A 4MHFA 2XHDA 4R74A 2O6AA 2LAOA 4XF5A 1DPPA 4PF6A 3OOAA 2RC8A 2QS2A 4OANA 1DSNA 2OZZA 3DM0A 4OEUA 3O2AA 2M8CA 3QAXA 4MBPA 5CM6A 3TCGA 3IK6B 1FPGA 4KPTA 1UIUA 2OJTA 4PAFA 4WEDA 4PBHA 1MY4A 3T22A 4JWOA 2L5VA 3MC2A 2IEEA 3Q29A 4PBQA 1EZOA 1PB9A 3PPQA 4RK9A 1II5A 2FIXA 4PFRA 2QFLA 1FTOA 5CI5A 4F31B 4BDNA 1CE2A 1F9BA 3PGFA 5LDZA 3BIGA 4GX3A 4ZZAA 4L17A 1IZ1A 3KN7A 1UTBB 3Q25A 2XXIA 5IM2A 4QFKA 5J16A 4NE4A 1PB8A 1D9QA 1I6QA 1NNFA 3IO6A 3OMBA 4KYEA 2I4CA 3PUZE 4I3EA 1MQDA 5FBPA 4WXJA 4PFUA 4O3AA 2WBDA 4QSEA 5DEXB 1BK4A 3CFLA 2RKMA 3SEUA 3MZ1A 4F18A 1LAGE 2I0CA 1N3WA 3KJTA 1SPIA 2Z8DA 4GWZA 2B4LA 3A3CA 1IXCA 1DMBA 3SEYA 1ZJLA 4DCYA 4DXUA 4Q5TA 1MY1A 4GXSB 1INPA 3MAMA 4QFPA 5IGAA 5FTHA 2REGA 3RY3A 5L9SA 4HS7A 4TQUQ 4EDPA 2Q2AA 3DP6A 3SEWA 4KHZE 1OLCA 1N3XA 3PMWA 1NNPA 4EXLA 2PVUA 3VLUA 1FPLA 1IITA 5KDTA 4IO7A 4N13A 1A40A 1MDP1 3FVNA 1JVXA 1QUIA 2R9JA 5I56B 3MJNA 4F1UA 3OSQA 5A5XA 3QYTA 1N84A 3UGWA 5CC2A 1B52A 2QS3A 5I3SA 1PB7A 5M2VA 5IAIA 3T66A 4IGTA 4JVCA 3MVWA 5BUUA 3FXBA 1NH8A 1MS7A 4FJPA 2P3VA 1BIYA 2OK2A 4IO6A 3LC8A 2F97A 3Q27A 4Q8RA 1IIWA 3VFJA 1VFDA 2F6GA 1KZ8A 1G0IA 3IFCA 3FV1A 1NUYA 1ZMGA 5CMCA 3TTNA 5AA2A 1P1NA 3KOSA 3LBSA 1EZPA 1D3KA 1SI1A 3U72A 4HCYA 4PFIA 4U1ZA 2DS9A 1EYIA 5BWJA 4H65A 4ZS9A 2XXXA 1R9QA 2I3WA 1M5FA 5ICTA 3EHTA 4I8CA 1JW4A 3OEKA 4PAIA 3S9LC 2OCUA 1XT8A 4F2QA 1H44A 5I7IA 1JETA 4GWOA 3IJOB 3RGYA 1B32A 4H6DA 4OHNA 1K9ZA 2B3BA 4P3LA 3RYDA 1JEUA 1I6AA 2F36A 4O7IA 5EQ7A 1LEVA 1P1UA 4PETA 1EYJA 4H45A 1N04A 1JEVA 2DXRA 4O3CA 3RPWA 3IB2A 4PAKA 1NUWA 4EQ7A 4U22A 2Y7IA 1POTA 2HZKA 1BKAA 3K6VA 3VXBA 1US4A 4R9GA 4OVTA 5EYGA 2XXVA 2DYXA 4QRZA 4X48A 4POWA 1BTJA 2PT2A 2DE2A 2PFZA 1R6ZA 1FRPA 2DDKA 1H45A 3H3GA 5TP9A 2Q88A 4ELQA 1QUJA 4IY6A 3M8UA 3GYYA 2I4BA 4DCXA 4O8MA 3PPPA 4R75A 2O7IA 1NNKA 3K4UA 3F11A 4LQ5A 2NVUB 2H98A 2VGQA 4NF0A 4PP0A 3G3HA 4N15A 1NUZA 1FBEA 3HV1A 3T9XB 3MP8A 4GX4A 5I59B 1YYZA 1OMPA 3MPKA 3HHGA 5CMMA 3WAEA 1H43A 2FBPA 4UABA 4OVQA 5HPQA 2KQZA 4EXKA 1OQGA 3TCHA 4ZEDA 4X9TA 5AA4A 3TTLA 2ZZVA 3PPNA 1OIBA 5H8FA 5H8NA 4IY5A 3P7IA 3FBPA 3TYHA 4ZE9A 3FVKA 4U4SA 5TU0A 3R7XA 1B5IA 2IA4A 5DTBA 4GQOA 3C35A 2GH9A 1XHYA 1B7HA 4HW8A 4KYSA 2QL3A 1SDXA 2HFBA 4MLVA 1YPNA 2E0SA 1SW4A 4QFOA 1IXHA 3U94A 5A5LA 1FBPA 4NF5B 2VP1A 2WKYA 5JK4A 1FTAA 4X8RA 2XXQA 2DP8A 3CR9A 5AE4A 4H5GA 4UACA 3IO4A 1DPEA 3K2DA 1I69A 3TTKA 1B3FA 1VR5A 3LSFB 3OSRA 4PGNA 4FIMA 2BJJX 1FBDA 4GD5A 4FAJA 4KYDA 4N91A 1FTKA 2XWOA 2DSFA 3K0VA 4IO2A 5H8QA 3HPIA 1IMCA 3RQTA 3LSXA 3IOWA 1B4ZA 4IR8A 4JSOA 2ZNSA 3RT8A 5A5XB 1HSLA 4YU0A 1LSTA 4N6PA 4WKMA 1O64A 4ELRA 3NOHA 2B4MA 3FASA 1Y1MA 4AB5A 1PEBA 3VLVA 2YPNA 3E13X 4NHBA 2VPOA 4MCOA 1FJ9A 3QXMA 5CBRA 1Y3PA 4BDOA 2OLBA 1B7ZA 3OELA 2QPQA 1LLSA 4BDMA 4N4UA 2ZXTA 1FPFA 3M3FA 4BLAA 3JZJA 2Y7WA 3D4CA 3CI8A 1LBZA 5AA2B 4K3FA 3G3GA 1RDXA 4LZ5A 2NOOA 1LFHA 1ZLQA 2XXRA 4I3YA 3G3IA 4MLQA 5ET8A 2DE3A 2Z23A 3K00A 1O63A 2PFYA 4JB7A 2A5TA 1B46A 3KN8A 1ZTYA 1XI6A 3U65A 1YTVA 5FHOA 1A7LA 3H6UA 3VVEA 3BIHA 3TQWA 1P99A 2B65A 2F78A 3ZSFA 3SEVA 3IB1A 1DK4A 2D3IA 3ISPA 1B5HA 2Z8FA 4F29A 1LFGA 3OEMA 2D5WA 2DVCA 5IZ1A 1R9LA 1GV8A 3TKDA 5CMBA 2RINA 4P0IA 1FPIA 5ET5A 3H03A 1B2HA 4GRKA 3SERA 1RKMA 2I6EA 1P1OA 3BFUA 1PBPA 4OVJA 4HXVA 2RF1A 5TP9B 1SYIA 4YKJA 3UK4A 4YAHX 4OFLA 1DBZA 5H8HA 3TZAA 2VOZA 4R6YA 1SVXB 4P1LA 4PFBA 4ND9A 1YZ0A 2DQVA 2QVVA 2VT5A 1MPCA 3IAZA 4RXLA 1XVXA 3W15C 2ABHA 2THIA 2O84X 4OFJA 2Z8EA 1IMAA 4NGUA 5ET7A 3TFLA 3PUYE 3RTWB 1A8FA 3OD7A 3FXUA 1FJ6A 4XKNA 2XXPA 1SW5A 3KG2A 5EHMA 3ILUB 2F5XA 5KZTA 3T96B 4MX6A 4P56A 1WVJA 4MNIA 4THIA 4MJOA 5I5PA 2DWIA 4N17A 3IOTA 4X04A 1MM6A 1CNQA 1URGA 4OETA 5H8FB 1NKXA 3G3KA 3LV0A 2F34A 4NF4A 2Q8MA 3THIA 3H6VA 4NAPA 5DVJA 1NL5A 4BDLA 5AA2D 4F3SA 1PDAA 1S7YA 2UVIA 5CMKA 1B6HA 1J1NA 3B8BA 1MG1A 3IOVA 2Y7PA 5DW8A 1FQDA 2HAUA 2OX3A 4P1EA 2NXOA 2DWAA 1IXIA 2QRYA 3C4MA 4GBVA 1VSOA 4G68C 4ELOA 1PC3A 3L6HA 4OQOA 4O94A 3V89B 4PFTA 5I2KA 2I3VA 4C1TA 3PMXA 1FPDA 3IFAA 1DCUA 3U1OA 2P1SA 1LBVA 4MNCA 1NV1A 2I58A 4DI3D 1QJMA 3FV2A 2ALUA 5H8QB 4LATA 4TOZA 2AIXA 2P3NA 4N6KA 3VVDA 2F7BA 2QMXA 3AXFA 5F1QA 4M4GA 3UP9A 1MH3A 3PMVA 1LFIA 3GBAA 3GZGA 1JW1A 1MQIA 1L5TA 3MBPA 4YKPA 4P47A 4ZECA 4R2FA 1XS5A 3PUVE 2NWJA 3HFUA 1MXWA 3B6TA 3CSGA 2O69A 3S4UA 2PX1A 4LP2B 4OWDA 1DTGA 3T93B 3C32A 1Y9UA 2Y7KA 4RY1A 2XX9A 3FATA 1H76A 3A29A 3TAJA 2QMWA 5DVIA 3RN8A 2F6PA 1B1XA 1FPEA 5FHMA 2HXRA 1TFAA 5ITPA 1T0KA 2WEFA 4BDRA 4N8GA 2H4IA 2AL5A 4IGRA 2GQ1A 3C33A 4DIGA 4IO5A 4G8MA 4O3BA 4NF8A 4R6HA 5FTIA 3UORA 2ZZXA 3CVGA 5IZ3A 1NV2A 5I58A 4C0RA 4DI4B 4MMPA 2YJPA 4PDHA 1XOCA 1JQFA 1B7UA 3D4GA 3RPLB 2V25A 3O66A 3PUXE 4G8HA 3OO8A 4OYVA 3DP4A 3MUQA 3LSWA 2R8TA 3KEIA 4I40A 1B4HA 4KQPA 1M5BA 2HQ0A 3SETA 1S9TA 3FIRA 1AWBA 4N81A 1B05A 1Y4TA 1SW1A 2VD3A 2OBGA 3JYRA 1IQ7A 4LA9A 1OVTA 1ZKBA 4H5FA 3MPLA 1NV7A 2VPNA 4JVIA 2HXWA 5TPAA 1AH5A 4ESWA 4OEVA 3S9EA 2H9BA 4P0GA 4XKRA 1GGGA 1JVYA 2QS4A 1K9YA 5I84A 3U93A 2GHAA 1MXVA 3EKIA 4OMBA 3A3UA 2FVZA 3T9UA 2E1SA 3V83A 3PU5A 2D21A 3MSTA 4PCDA 5ITOA 4OERA 1O7TA 3H06B 4R73A 5KCJA 4EF2A 1SYHA 4OFOA 3H6TA 1FTLA 4R6KA 1MPDA 1LBYA 5JTYA 2XXWA 2F3BA 3RNNA 4GFRA 2F3DA 3OO9A 4HE1A 3K6WA 1MY0A 5F24A 3K6XA 3SKPA 1TT1A 2RC7A 3ZKLA 4JSDA 1URDA 1JP4A 4Z0IA 4OVSA 1RDZA 2DOJA 3T9VA 2FYIA 4NMYA 2X26A 4RA1A 4NF4B 2HZLA 2V93A 1AL3A 1FPKA 3BBRA 4XXUA 2AL4A 1RDYA 3E79A 3Q26A 1B40A 3KSXA 1Z7NE 5I2NA 1KWHA 2I48A 1VDWA 3FJGA 2GHBA 1LAHE 4H46A 1TFDA 4MEVA 3KSJA 3CG3A 1MQHA 1FQAA 4YMAA 1A8EA 3EPEA 3D1RA 2Q8JA 1B51A 3K1MA 4YKIA 4NF6A 4P9KA 2R71A 1MXXA 1UTBA 4LUBA 4QF9A 3W9VA 4PC9A 1USYE 2CZLA 4AB6A 2ZYMA 1LAFE 3PD9A 2ZMBA 3S9NC 5I2KB 5IKBA 3O6IA 1DTZA 3K02A 3B6WA 4HTGA 3FUZA 2P2AA 1Y20A 1WDNA 4LQ2A 2GFEA 4GIZA 5DEXA 5T3JA 3A09A 2ZZWA 1SBPA 1YXIA 4LVQA 3V8XB 4QSCA 4MIJA 1H3DA 2ESNA 4XIGQ 2VHAA 2PT1A 1LBBA 1SD3A 5KDTB 3T1BA 3T9HB 4FEDA 2AYSA 1MPBA 4OESA 1ANFA 2OWZA 3FGSA 2G29A 3HCQA 4OENA 4MF3A 3OO7A 2V3UA 4PF8A 1FPBA 1IEJA 2QVRA 1HSEA 3ROJA 4E0WA 4HCWA 1NV3A 3MZBA 3O28A 3KN3A 1QKAA 4GLIA 1I6BA 1EH3A 3BKIB 1UTHA 2Q2CA 4NEDA 5B7DA 3FXQA 3USDA 3TQLA 4PE3A 4KD5A 3PUWE 2GRVA 4IO3A 1AIVA 4U1OA 1FTMA 3DP8A 3FXRA 3GBBA 4F22A 2CEYA 4Q0CA 4ZEBA 5AA3A 4RJZA 1LCTA 4FBPA 4NF8B 5K2YA 3MWBA 4I62A 4JXIA 5ELVA 2DWHA 1Q1KA 2ONKE 1MH4A 4OVPA 4YKKA 3MVZA 4QFLA 3FVGA 1ZIUA 5IZ3B 2XX7A 4U21A 2XXHA 2F8DA 2Y5KA 2CZKA 1FQEA 4JVDA 4YB7A 4QSDA 3VLWA 1LB8A 3M3LA 3FVOA 2UVHA 3N94A 4GF8A 3RUMA 2BJIA 3LSLA 1JNFA 2XWVA 3FJ7A 3VE1B 2FA7A 4LN5A 2V4CA 4ISUA 4RNSA 3PTYA 1QULA 5TPAB 4GXAA 1IXGA 4FEBA 3E78A 3FZVA 4MFIA 1IMBA 4X1BA 2I49A 3O97A 4N6DA 3IJXB 5K2XA 1D9VA 4RPOA 4ELPA 3QSLA 4GOTA 3ODBA 1A54A 4U4XA 3SDFA 4MAGA 2XWIA 3HSTA 2QVUA 1ATGA 2FIEA 1MM7A 1Y3NA 2XXYA 1D4NA 2XXUA 5DYHA 1Q35A 2WYKA 2VD2A 3MVYA 4G68A 4OXVA 1SI0A 3UIFA 4EUOA 3TDJA 3H7MA 3CIJA 4I1DA 4R9FA 4TLLB 3QK6A 3WAFA 4PFYA 2X7PA 4YB5A 3U92A 4R2BA 1RYXA 3I3VA 4FECA 4KR5A 1IMEA 1VFEA 4PQJA 4Z7EA 2ZYNA 3G7WA 3PPOA 5AA4B 2RCBA 3V5AA 1YCJA 2V84A 2Z22A 3KJ7A 3VDFA 3EHUA 3I5OA 1B5JA 5H8NB 5I59A 2V3TA 3ILTB 3RTFB 3C34A 3RLFE 5F7VA 2RC9A 1N7XA 5I2NB 2PMSA 4RK2A 1B3EA 3IL1B 3Q28A 3C31A 3SEXA 1GTKA 1HSJA 1XC1A 3DELB 4NF6B 3QMFA 1MQJA 3CRBA 1BLFA 2CMOA 4LZ8A 1NMUA 5EQ9A 4AQ4A 2CZIA 3TEPA 4ESXA 5HM4B 1NV5A 4EQBA 1MXZA 2CEXA 4QFNA 4F3PA 5EHSA 4N07A 1NH7A 1M5CA 1MRPA 3LR1A 4E0XA 3K1NA 4KXPA 4OTEA 4H67A 5ICQA 4JWXA 3W9WA 3TELA 5FHNA 3HHFA 3R26A 3KGCA 2HPGA 4NF5A 4RYAA 2G93A 1Q9DA 1Z7ME 2V3QA 5J1DA 1NUXA 4PGPA 3FJMA 1M5EA 1GVCA 4C1UA 1BP5A 1QUKA 1URSA 4GWXA 4YB6A 4XEQA 3UA8A 4JWYA 3EQ1A 4N8YA 4R72A 2QJEA 4FE8A 3KFMA 2UVJA 2UYFA 3BFTA 3N6UA 4IB2A 1PBQA 4XKQA 2ZNUA 1KA0A 4XFEA 3VXCA 1SW2A 3H4ZA 4GWUA 2XWKA 2WYPA 2DXYA 3B6QA 1UTHB 1B9JA 1QKBA 2UVGA 4ZE8A 3MP6A 3IORA 2YLNA 4F1YA 4YICA 3EHSA 4QBAA 3O6GA 4OVRA 1Y4CA 4LZ7A 1LAXA 2A5TB 2ZNTA 4X1DA 1UIVA 5ESYA 2F7AA 1CB6A 1NV6A 4ZEKA 5LTCA 1LCFA 2QSXA 2KR0A 2H99A 2XXKA 2FNCA 3H6WA 4KCDA 3PD8A 4M1VA 2HEUA 2P0SA 1QW0A 4JDFA 3TCFA 3KBZA 5L9MA 3QUFA 1G0HA 2HCAA 3CSBA 4JBZA 4F39A 4DXBA 2HAVA 3C9HA 1LBXA 1TXFA 2ZYOA 2XXTA 2ZYKA 4QHQA 3O29A 4H8JA 1ELJA 2WBBA 4BDQA 1NI9A 3SESA 3O9PA 1LGBC 2XA5A 4LONB 3KC1A 1NV4A 3MYUA 4F2OA 4YMBA 4GVOA 1RYOA 1KA1A 3CFXA 5I57A 3M3KA 2XD3A 4GWYA 4OA4A 1B3LA 5H8HB 3MW0A 3S9MC 1ZBMA 2PCRA 3ZKKA 4DXCA 4GL8A 4TLMB 1EYKA 2REJA 4I9DA 1NNTA 4NQ8A 4P11A 2Y5LA 5L8DA 1TWYA 3ECRA 1AOVA 2XD2A 3N6TA 3IR1A 4O7MA 1XVYA 4G68B 1A99A 2W7YA 4QXDA 4ECFA 2KLFA 1MDQA 4YZZA 4ZDMA 1VE4A 2QS1A 2UYEA 2O1LA 3IB0A 4ZEFA 4GX6A 3S2VA 4G2ZA 4OZ9A 2O51A 3CG1A 2O68A 4FATA 4U23A 2XX8A 2FHYA 2DWJA 4U2RA 4H1XA 3G3FA 5B70A 1P1WA 4GBWA 3UN6A 1IMDA 4HE0A 1B0HA 2OWSA 1LBCA 4NN3A 1B3HA 2PYYA 3C36A 1UQWA 5AA1A 3EN3A 3EF7A 2Y84A 1FBFA 3GXAA 4F3BA 2ONSA 3KOTA 1N7WA 1GR2A 5ISUA 3T0JA 4MNPA 4KFQA 1B0LA 1SQYA 4NWDA 3MVXA 1Y3QA 5CRYA 3SZPA 1IUDA 2NUVA 3E3KA 1D9YA 4P8BA 3R6UA 4PDDA 1S50A 3G3JA 1FBHA 3LUZA 1FQFA 2H25A 4DLDA 3LUYA 5EQAA 4NX1A 2JJKA 4F1VA 5EYHA 3TTMA 4NG7A 3MP1A 1A55A 4FORA 1FQCA 5CBSA 1FPJA 2RCAA 3TODA 5EYFA 1B3GA 2O7UA 3O6HA 4ZZEA 1B1HA 1FTJA 1M5DA 2R6GE 3L6GA 4F19A 4IO4A 5EQ8A 4WEPA 4AS4A 4AS5A 1USYH 4KCCA 1WODA 3B7DA 2A5SA 4NWCA 1MXUA 3N5LA 1MY3A 1B58A 5IZZA 4DZ1A 1NV0A 5L9OA 2ANJA 3KBRA 1LB9A 2H5YA 2PBWA 3KC0A 5I56A 2O1MA 1FBGA 4H0WA 3MZ9A 2Y7RA 1NFTA 3MQ9A 4ONYA 2OWTA 5DVFA 4EQ9A 2I0BA 4EF1A 4G8NA 1QGXA 3VV5A 3CFZA 3PPRA 1Y1ZA 5LOMA 4DDDA 3RT6B 2Q74A 3CHGA 3QUJA 3HO7A 4F3GA 1FSAA 2Q9TA 3VVFA 4GWWA 3K1PA 3OO6A 1AMFA 3DLNA 3K6UA 4KI0E 1OVBA 4RPNA 4NTLA 1MXYA 2WX9A 4PE5B 3ZS6A 5JEIA 5HBCA 4G77A 1EZ9A 3I6VA 2ONRA 3HN0A 1EU8A 1N0TA 1YAEA 4XKPA 3IOUA 2HHMA 1FCKA 5I58B 1DOTA 2DVZA 3FD3A 3TMGA 3ONMA 3TTRA 2F35A 3JV9A 2F7CA 4G4PA 1IMFA 4ZEIA 1P1QA 1US5A 2UXAA 1FQBA 4PFWA 1ZU0A 1OLAA 4XTCQ 1FW0A 3U8QA 3B50A 2X7QA 4Q30B 2DE4A
chains in the Genus database with same CATH topology
3OENA 4H8IA 3TPAA 3GLBA 3E9XA 1QVSA 3QIMA 5I57B 3KZGA 1MQGA 5H8SA 3TUSA 1N76A 5DT6A 3IX1A 1JW5A 4MH5A 3K01A 2B3FA 2Q89A 1R1NA 3PV0E 3E4RA 3N26A 4DE8A 5KCJB 4POXA 4GL0A 1MY2A 1POY1 5JTYB 3OXNA 1OQHA 4UA8A 4R74A 2XHDA 2O6AA 2LAOA 1DPPA 3OOAA 2RC8A 2QS2A 1DSNA 2OZZA 3DM0A 4OEUA 3O2AA 2M8CA 3QAXA 4MBPA 5CM6A 3TCGA 3IK6B 4KPTA 1UIUA 2OJTA 4WEDA 3T22A 1MY4A 4JWOA 3MC2A 2IEEA 3Q29A 1EZOA 1PB9A 3PPQA 4RK9A 1II5A 1FTOA 5CI5A 4F31B 4BDNA 1CE2A 1F9BA 3PGFA 4ZZAA 4L17A 1IZ1A 3KN7A 1UTBB 3Q25A 2XXIA 4QFKA 4NE4A 1PB8A 1I6QA 1NNFA 3IO6A 3OMBA 4KYEA 2I4CA 3PUZE 1MQDA 4WXJA 4PFUA 4O3AA 4QSEA 5DEXB 3CFLA 2RKMA 3SEUA 3MZ1A 4F18A 1LAGE 2I0CA 1N3WA 3KJTA 2Z8DA 3A3CA 1IXCA 1DMBA 3SEYA 1ZJLA 4DCYA 4DXUA 4Q5TA 1MY1A 4GXSB 3MAMA 4QFPA 5FTHA 2REGA 3RY3A 5L9SA 4HS7A 4TQUQ 4EDPA 2Q2AA 3DP6A 3SEWA 4KHZE 1OLCA 1N3XA 3PMWA 1NNPA 4EXLA 2PVUA 3VLUA 1IITA 5KDTA 4IO7A 4N13A 1A40A 1MDP1 3FVNA 1JVXA 1QUIA 2R9JA 5I56B 3MJNA 4F1UA 3OSQA 5A5XA 3QYTA 1N84A 3UGWA 5CC2A 1B52A 2QS3A 1PB7A 5M2VA 5IAIA 3T66A 4IGTA 5BUUA 3MVWA 1NH8A 1MS7A 4FJPA 1BIYA 2OK2A 4IO6A 3LC8A 2F97A 3Q27A 4Q8RA 1IIWA 3VFJA 1VFDA 2F6GA 3FV1A 1ZMGA 5CMCA 3TTNA 5AA2A 1P1NA 3KOSA 3LBSA 1EZPA 1D3KA 1SI1A 3U72A 4HCYA 4U1ZA 2DS9A 5BWJA 4H65A 4ZS9A 2XXXA 1R9QA 2I3WA 1M5FA 5ICTA 3EHTA 4I8CA 1JW4A 3OEKA 3S9LC 2OCUA 1XT8A 4F2QA 1H44A 1JETA 4GWOA 3IJOB 3RGYA 1B32A 4H6DA 4OHNA 2B3BA 1JEUA 1I6AA 2F36A 1P1UA 4PETA 1N04A 1JEVA 2DXRA 4O3CA 3RPWA 3IB2A 4EQ7A 4U22A 2Y7IA 1POTA 2HZKA 1BKAA 3K6VA 3VXBA 1US4A 4R9GA 2XXVA 2DYXA 4QRZA 4X48A 4POWA 1BTJA 2PT2A 2DE2A 1R6ZA 3H3GA 1H45A 5TP9A 2Q88A 4ELQA 1QUJA 4IY6A 3M8UA 2I4BA 4DCXA 3PPPA 4R75A 2O7IA 1NNKA 3K4UA 3F11A 4LQ5A 2NVUB 2H98A 2VGQA 4PP0A 3G3HA 3HV1A 3T9XB 3MP8A 5I59B 1OMPA 3MPKA 3HHGA 5CMMA 3WAEA 1H43A 5HPQA 4EXKA 1OQGA 3TCHA 4ZEDA 4X9TA 5AA4A 3TTLA 3PPNA 1OIBA 5H8FA 5H8NA 4IY5A 3P7IA 3TYHA 4ZE9A 3FVKA 4U4SA 5TU0A 3R7XA 1B5IA 2IA4A 5DTBA 4GQOA 3C35A 2GH9A 1XHYA 1B7HA 4HW8A 4KYSA 2QL3A 1SDXA 2HFBA 4MLVA 1YPNA 2E0SA 1SW4A 4QFOA 1IXHA 3U94A 4NF5B 2VP1A 2WKYA 5JK4A 2XXQA 2DP8A 3CR9A 5AE4A 4H5GA 4UACA 3IO4A 1DPEA 3K2DA 1I69A 3TTKA 1B3FA 1VR5A 3LSFB 3OSRA 4FIMA 2BJJX 4GD5A 4FAJA 4KYDA 1FTKA 2DSFA 3K0VA 4IO2A 5H8QA 3HPIA 3RQTA 3LSXA 3IOWA 1B4ZA 4JSOA 2ZNSA 3RT8A 5A5XB 1HSLA 4YU0A 1LSTA 4N6PA 4WKMA 1O64A 4ELRA 3FASA 1Y1MA 4AB5A 1PEBA 3VLVA 2YPNA 3E13X 3QXMA 5CBRA 1Y3PA 4BDOA 2OLBA 1B7ZA 3OELA 2QPQA 1LLSA 4BDMA 2ZXTA 3M3FA 4BLAA 3JZJA 2Y7WA 3D4CA 3CI8A 5AA2B 4K3FA 3G3GA 4LZ5A 2NOOA 1LFHA 1ZLQA 2XXRA 3G3IA 4MLQA 2DE3A 2Z23A 3K00A 1O63A 4JB7A 2A5TA 1B46A 3KN8A 1ZTYA 1YTVA 5FHOA 1A7LA 3H6UA 3VVEA 3TQWA 1P99A 2B65A 2F78A 3ZSFA 3SEVA 3IB1A 2D3IA 1B5HA 2Z8FA 4F29A 1LFGA 3OEMA 2D5WA 2DVCA 1R9LA 1GV8A 3TKDA 5CMBA 2RINA 4P0IA 3H03A 1B2HA 4GRKA 3SERA 1RKMA 2I6EA 1P1OA 3BFUA 1PBPA 4OVJA 2RF1A 5TP9B 1SYIA 4YKJA 3UK4A 4YAHX 4OFLA 5H8HA 3TZAA 2VOZA 4R6YA 1SVXB 4ND9A 2DQVA 1MPCA 3IAZA 4RXLA 1XVXA 3W15C 2ABHA 2THIA 2O84X 4OFJA 2Z8EA 3TFLA 3PUYE 3RTWB 1A8FA 3OD7A 3FXUA 4XKNA 2XXPA 1SW5A 3KG2A 5EHMA 3ILUB 2F5XA 5KZTA 3T96B 1WVJA 4THIA 2DWIA 3IOTA 1MM6A 1URGA 4OETA 5H8FB 1NKXA 3G3KA 2F34A 4NF4A 3THIA 3H6VA 5DVJA 1NL5A 4BDLA 5AA2D 4F3SA 1PDAA 1S7YA 2UVIA 5CMKA 1B6HA 1J1NA 1MG1A 3IOVA 2Y7PA 1FQDA 2HAUA 2NXOA 2DWAA 1IXIA 2QRYA 3C4MA 1VSOA 4G68C 4ELOA 1PC3A 3L6HA 4OQOA 3V89B 4PFTA 5I2KA 2I3VA 4C1TA 3PMXA 3U1OA 2P1SA 2I58A 1QJMA 3FV2A 2ALUA 5H8QB 4LATA 4TOZA 2AIXA 3VVDA 2F7BA 2QMXA 3AXFA 5F1QA 4M4GA 3UP9A 1MH3A 3PMVA 1LFIA 3GBAA 3GZGA 1JW1A 1MQIA 1L5TA 3MBPA 4YKPA 4ZECA 4R2FA 1XS5A 3PUVE 2NWJA 1MXWA 3B6TA 3CSGA 2O69A 3S4UA 2PX1A 4LP2B 1DTGA 4OWDA 3T93B 3C32A 1Y9UA 2Y7KA 4RY1A 2XX9A 3FATA 1H76A 3TAJA 2QMWA 5DVIA 3RN8A 2F6PA 1B1XA 5FHMA 1TFAA 5ITPA 1T0KA 4BDRA 2H4IA 2AL5A 4IGRA 3C33A 4DIGA 4IO5A 4G8MA 4O3BA 4NF8A 4R6HA 5FTIA 3UORA 3CVGA 5I58A 4C0RA 2YJPA 1XOCA 1JQFA 1B7UA 3D4GA 2V25A 3O66A 3PUXE 4G8HA 3OO8A 4OYVA 3DP4A 3MUQA 3LSWA 3KEIA 1B4HA 4KQPA 1M5BA 2HQ0A 3SETA 1S9TA 3FIRA 1B05A 1Y4TA 1SW1A 2VD3A 2OBGA 3JYRA 1IQ7A 4LA9A 1OVTA 1ZKBA 4H5FA 3MPLA 2HXWA 5TPAA 1AH5A 4ESWA 4OEVA 3S9EA 2H9BA 4P0GA 4XKRA 1GGGA 1JVYA 2QS4A 5I84A 3U93A 2GHAA 1MXVA 4OMBA 3A3UA 3T9UA 2E1SA 3V83A 3PU5A 2D21A 5ITOA 4OERA 1O7TA 3H06B 4R73A 5KCJA 4EF2A 1SYHA 4OFOA 3H6TA 1FTLA 4R6KA 1MPDA 5JTYA 2XXWA 3RNNA 4GFRA 3OO9A 3K6WA 1MY0A 3K6XA 3SKPA 1TT1A 2RC7A 3ZKLA 4JSDA 1URDA 4Z0IA 2DOJA 3T9VA 2FYIA 4NMYA 2X26A 4RA1A 4NF4B 2HZLA 2V93A 1AL3A 3BBRA 4XXUA 2AL4A 3Q26A 1B40A 3KSXA 1Z7NE 5I2NA 1KWHA 2I48A 3FJGA 2GHBA 1LAHE 1TFDA 3KSJA 3CG3A 1MQHA 1FQAA 4YMAA 1A8EA 3EPEA 2Q8JA 1B51A 3K1MA 4YKIA 4NF6A 2R71A 1MXXA 1UTBA 4LUBA 4QF9A 3W9VA 1USYE 2CZLA 4AB6A 2ZYMA 1LAFE 3PD9A 2ZMBA 3S9NC 5I2KB 5IKBA 3O6IA 1DTZA 3K02A 3B6WA 4HTGA 3FUZA 2P2AA 1Y20A 1WDNA 4LQ2A 2GFEA 4GIZA 5DEXA 3A09A 1SBPA 4LVQA 3V8XB 4QSCA 1H3DA 2ESNA 4XIGQ 2VHAA 2PT1A 1LBBA 1SD3A 5KDTB 3T9HB 4FEDA 2AYSA 1MPBA 4OESA 1ANFA 3FGSA 2G29A 3HCQA 4OENA 4MF3A 3OO7A 2V3UA 1IEJA 1HSEA 4E0WA 4HCWA 3MZBA 3O28A 3KN3A 1QKAA 4GLIA 1I6BA 1EH3A 3BKIB 1UTHA 2Q2CA 4NEDA 5B7DA 3FXQA 3USDA 3TQLA 4KD5A 3PUWE 2GRVA 4IO3A 1AIVA 4U1OA 1FTMA 3DP8A 3FXRA 3GBBA 4F22A 4Q0CA 4ZEBA 5AA3A 4RJZA 1LCTA 4NF8B 5K2YA 3MWBA 4I62A 4JXIA 5ELVA 2DWHA 1Q1KA 2ONKE 1MH4A 4YKKA 3MVZA 4QFLA 3FVGA 1ZIUA 2XX7A 4U21A 2XXHA 2F8DA 1FQEA 4YB7A 4QSDA 3VLWA 1LB8A 3M3LA 3FVOA 2UVHA 3N94A 4GF8A 3RUMA 3LSLA 1JNFA 3FJ7A 3VE1B 2FA7A 4ISUA 4RNSA 1QULA 5TPAB 4GXAA 1IXGA 4FEBA 3FZVA 4MFIA 4X1BA 2I49A 3O97A 3IJXB 5K2XA 1D9VA 4RPOA 4ELPA 3QSLA 4GOTA 3ODBA 1A54A 4U4XA 3SDFA 3HSTA 1ATGA 1MM7A 1Y3NA 2XXYA 1D4NA 2XXUA 5DYHA 1Q35A 2VD2A 3MVYA 4G68A 4OXVA 1SI0A 3UIFA 4EUOA 3TDJA 3H7MA 3CIJA 4I1DA 4R9FA 4TLLB 3QK6A 3WAFA 4PFYA 2X7PA 4YB5A 3U92A 4R2BA 1RYXA 3I3VA 4FECA 4KR5A 1VFEA 4PQJA 4Z7EA 2ZYNA 3G7WA 3PPOA 5AA4B 2RCBA 3V5AA 1YCJA 2V84A 2Z22A 3KJ7A 3VDFA 3EHUA 3I5OA 1B5JA 5H8NB 5I59A 2V3TA 3ILTB 3RTFB 3C34A 3RLFE 5F7VA 2RC9A 1N7XA 5I2NB 2PMSA 4RK2A 1B3EA 3IL1B 3Q28A 3C31A 3SEXA 1GTKA 1HSJA 1XC1A 3DELB 4NF6B 1MQJA 3CRBA 1BLFA 2CMOA 4LZ8A 1NMUA 4AQ4A 3TEPA 4ESXA 5HM4B 4EQBA 1MXZA 4QFNA 4F3PA 5EHSA 4N07A 1NH7A 1M5CA 1MRPA 3LR1A 4E0XA 3K1NA 4OTEA 4H67A 5ICQA 4JWXA 3W9WA 3TELA 5FHNA 3HHFA 3R26A 3KGCA 4NF5A 4RYAA 2G93A 1Z7ME 2V3QA 5J1DA 3FJMA 1M5EA 1GVCA 4C1UA 1BP5A 1QUKA 1URSA 4YB6A 3UA8A 4JWYA 3EQ1A 4R72A 2QJEA 4FE8A 3KFMA 2UVJA 2UYFA 3BFTA 3N6UA 4IB2A 1PBQA 4XKQA 2ZNUA 3VXCA 1SW2A 3H4ZA 2DXYA 3B6QA 1UTHB 1B9JA 1QKBA 2UVGA 4ZE8A 3MP6A 3IORA 2YLNA 4F1YA 4YICA 3EHSA 3O6GA 1Y4CA 4LZ7A 1LAXA 2A5TB 2ZNTA 4X1DA 1UIVA 2F7AA 1CB6A 4ZEKA 1LCFA 2QSXA 2H99A 2FNCA 3H6WA 4KCDA 3PD8A 4M1VA 2HEUA 2P0SA 1QW0A 4JDFA 3TCFA 5L9MA 3QUFA 3CSBA 4F39A 2HCAA 4JBZA 4DXBA 2HAVA 3C9HA 1TXFA 2ZYOA 2XXTA 2ZYKA 4QHQA 3O29A 4H8JA 1ELJA 4BDQA 3SESA 3O9PA 1LGBC 4LONB 4F2OA 4YMBA 4GVOA 1RYOA 3CFXA 5I57A 3M3KA 2XD3A 1B3LA 5H8HB 3MW0A 3S9MC 1ZBMA 3ZKKA 4DXCA 4GL8A 4TLMB 2REJA 4I9DA 1NNTA 4P11A 5L8DA 1TWYA 3ECRA 1AOVA 2XD2A 3N6TA 3IR1A 1XVYA 4G68B 1A99A 2W7YA 4ECFA 2KLFA 1MDQA 4YZZA 4ZDMA 1VE4A 2QS1A 2UYEA 2O1LA 3IB0A 4ZEFA 3S2VA 4G2ZA 4OZ9A 2O51A 3CG1A 2O68A 4FATA 4U23A 2XX8A 2DWJA 4U2RA 4H1XA 3G3FA 5B70A 1P1WA 3UN6A 1B0HA 2OWSA 1LBCA 1B3HA 2PYYA 3C36A 1UQWA 5AA1A 3EN3A 3EF7A 2Y84A 3GXAA 4F3BA 2ONSA 3KOTA 1N7WA 1GR2A 5ISUA 4KFQA 1B0LA 1SQYA 4NWDA 3MVXA 1Y3QA 5CRYA 1IUDA 2NUVA 3E3KA 1D9YA 3R6UA 1S50A 3G3JA 1FQFA 2H25A 4DLDA 3LUYA 4F1VA 3TTMA 3MP1A 1A55A 4FORA 1FQCA 5CBSA 2RCAA 3TODA 5EYFA 1B3GA 2O7UA 3O6HA 4ZZEA 1B1HA 1FTJA 1M5DA 2R6GE 3L6GA 4F19A 4IO4A 4WEPA 1USYH 4KCCA 1WODA 3B7DA 2A5SA 4NWCA 1MXUA 3N5LA 1MY3A 1B58A 4DZ1A 5L9OA 2ANJA 3KBRA 1LB9A 2H5YA 2PBWA 5I56A 2O1MA 4H0WA 3MZ9A 2Y7RA 1NFTA 3MQ9A 4ONYA 2OWTA 5DVFA 4EQ9A 2I0BA 4EF1A 4G8NA 3VV5A 3CFZA 3PPRA 1Y1ZA 5LOMA 4DDDA 3RT6B 3QUJA 3HO7A 4F3GA 2Q9TA 3VVFA 3K1PA 3OO6A 1AMFA 3DLNA 3K6UA 4KI0E 1OVBA 4RPNA 4NTLA 1MXYA 4PE5B 3ZS6A 5JEIA 5HBCA 4G77A 1EZ9A 3I6VA 2ONRA 3HN0A 1EU8A 4XKPA 1N0TA 1YAEA 3IOUA 1FCKA 5I58B 1DOTA 2DVZA 3FD3A 3TMGA 3ONMA 3TTRA 2F35A 3JV9A 2F7CA 4G4PA 4ZEIA 1P1QA 1US5A 2UXAA 1FQBA 4PFWA 1ZU0A 1OLAA 4XTCQ 1FW0A 3U8QA 2X7QA 4Q30B 2DE4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OEN A;  4H8I A;  3TPA A;  3GLB A;  3E9X A;  1QVS A;  3QIM A;  5I57 B;  3KZG A;  1MQG A;  5H8S A;  3TUS A;  1N76 A;  5DT6 A;  3IX1 A;  1JW5 A;  4MH5 A;  3K01 A;  2B3F A;  2Q89 A;  1R1N A;  3PV0 E;  3E4R A;  3N26 A;  4DE8 A;  5KCJ B;  4POX A;  4GL0 A;  1MY2 A;  1POY 1;  5JTY B;  3OXN A;  1OQH A;  4UA8 A;  4R74 A;  2XHD A;  2O6A A;  2LAO A;  1DPP A;  3OOA A;  2RC8 A;  2QS2 A;  1DSN A;  2OZZ A;  3DM0 A;  4OEU A;  3O2A A;  2M8C A;  3QAX A;  4MBP A;  5CM6 A;  3TCG A;  3IK6 B;  4KPT A;  1UIU A;  2OJT A;  4WED A;  3T22 A;  1MY4 A;  4JWO A;  3MC2 A;  2IEE A;  3Q29 A;  1EZO A;  1PB9 A;  3PPQ A;  4RK9 A;  1II5 A;  1FTO A;  5CI5 A;  4F31 B;  4BDN A;  1CE2 A;  1F9B A;  3PGF A;  4ZZA A;  4L17 A;  1IZ1 A;  3KN7 A;  1UTB B;  3Q25 A;  2XXI A;  4QFK A;  4NE4 A;  1PB8 A;  1I6Q A;  1NNF A;  3IO6 A;  3OMB A;  4KYE A;  2I4C A;  3PUZ E;  1MQD A;  4WXJ A;  4PFU A;  4O3A A;  4QSE A;  5DEX B;  3CFL A;  2RKM A;  3SEU A;  3MZ1 A;  4F18 A;  1LAG E;  2I0C A;  1N3W A;  3KJT A;  2Z8D A;  3A3C A;  1IXC A;  1DMB A;  3SEY A;  1ZJL A;  4DCY A;  4DXU A;  4Q5T A;  1MY1 A;  4GXS B;  3MAM A;  4QFP A;  5FTH A;  2REG A;  3RY3 A;  5L9S A;  4HS7 A;  4TQU Q;  4EDP A;  2Q2A A;  3DP6 A;  3SEW A;  4KHZ E;  1OLC A;  1N3X A;  3PMW A;  1NNP A;  4EXL A;  2PVU A;  3VLU A;  1IIT A;  5KDT A;  4IO7 A;  4N13 A;  1A40 A;  1MDP 1;  3FVN A;  1JVX A;  1QUI A;  2R9J A;  5I56 B;  3MJN A;  4F1U A;  3OSQ A;  5A5X A;  3QYT A;  1N84 A;  3UGW A;  5CC2 A;  1B52 A;  2QS3 A;  1PB7 A;  5M2V A;  5IAI A;  3T66 A;  4IGT A;  5BUU A;  3MVW A;  1NH8 A;  1MS7 A;  4FJP A;  1BIY A;  2OK2 A;  4IO6 A;  3LC8 A;  2F97 A;  3Q27 A;  4Q8R A;  1IIW A;  3VFJ A;  1VFD A;  2F6G A;  3FV1 A;  1ZMG A;  5CMC A;  3TTN A;  5AA2 A;  1P1N A;  3KOS A;  3LBS A;  1EZP A;  1D3K A;  1SI1 A;  3U72 A;  4HCY A;  4U1Z A;  2DS9 A;  5BWJ A;  4H65 A;  4ZS9 A;  2XXX A;  1R9Q A;  2I3W A;  1M5F A;  5ICT A;  3EHT A;  4I8C A;  1JW4 A;  3OEK A;  3S9L C;  2OCU A;  1XT8 A;  4F2Q A;  1H44 A;  1JET A;  4GWO A;  3IJO B;  3RGY A;  1B32 A;  4H6D A;  4OHN A;  2B3B A;  1JEU A;  1I6A A;  2F36 A;  1P1U A;  4PET A;  1N04 A;  1JEV A;  2DXR A;  4O3C A;  3RPW A;  3IB2 A;  4EQ7 A;  4U22 A;  2Y7I A;  1POT A;  2HZK A;  1BKA A;  3K6V A;  3VXB A;  1US4 A;  4R9G A;  2XXV A;  2DYX A;  4QRZ A;  4X48 A;  4POW A;  1BTJ A;  2PT2 A;  2DE2 A;  1R6Z A;  3H3G A;  1H45 A;  5TP9 A;  2Q88 A;  4ELQ A;  1QUJ A;  4IY6 A;  3M8U A;  2I4B A;  4DCX A;  3PPP A;  4R75 A;  2O7I A;  1NNK A;  3K4U A;  3F11 A;  4LQ5 A;  2NVU B;  2H98 A;  2VGQ A;  4PP0 A;  3G3H A;  3HV1 A;  3T9X B;  3MP8 A;  5I59 B;  1OMP A;  3MPK A;  3HHG A;  5CMM A;  3WAE A;  1H43 A;  5HPQ A;  4EXK A;  1OQG A;  3TCH A;  4ZED A;  4X9T A;  5AA4 A;  3TTL A;  3PPN A;  1OIB A;  5H8F A;  5H8N A;  4IY5 A;  3P7I A;  3TYH A;  4ZE9 A;  3FVK A;  4U4S A;  5TU0 A;  3R7X A;  1B5I A;  2IA4 A;  5DTB A;  4GQO A;  3C35 A;  2GH9 A;  1XHY A;  1B7H A;  4HW8 A;  4KYS A;  2QL3 A;  1SDX A;  2HFB A;  4MLV A;  1YPN A;  2E0S A;  1SW4 A;  4QFO A;  1IXH A;  3U94 A;  4NF5 B;  2VP1 A;  2WKY A;  5JK4 A;  2XXQ A;  2DP8 A;  3CR9 A;  5AE4 A;  4H5G A;  4UAC A;  3IO4 A;  1DPE A;  3K2D A;  1I69 A;  3TTK A;  1B3F A;  1VR5 A;  3LSF B;  3OSR A;  4FIM A;  2BJJ X;  4GD5 A;  4FAJ A;  4KYD A;  1FTK A;  2DSF A;  3K0V A;  4IO2 A;  5H8Q A;  3HPI A;  3RQT A;  3LSX A;  3IOW A;  1B4Z A;  4JSO A;  2ZNS A;  3RT8 A;  5A5X B;  1HSL A;  4YU0 A;  1LST A;  4N6P A;  4WKM A;  1O64 A;  4ELR A;  3FAS A;  1Y1M A;  4AB5 A;  1PEB A;  3VLV A;  2YPN A;  3E13 X;  3QXM A;  5CBR A;  1Y3P A;  4BDO A;  2OLB A;  1B7Z A;  3OEL A;  2QPQ A;  1LLS A;  4BDM A;  2ZXT A;  3M3F A;  4BLA A;  3JZJ A;  2Y7W A;  3D4C A;  3CI8 A;  5AA2 B;  4K3F A;  3G3G A;  4LZ5 A;  2NOO A;  1LFH A;  1ZLQ A;  2XXR A;  3G3I A;  4MLQ A;  2DE3 A;  2Z23 A;  3K00 A;  1O63 A;  4JB7 A;  2A5T A;  1B46 A;  3KN8 A;  1ZTY A;  1YTV A;  5FHO A;  1A7L A;  3H6U A;  3VVE A;  3TQW A;  1P99 A;  2B65 A;  2F78 A;  3ZSF A;  3SEV A;  3IB1 A;  2D3I A;  1B5H A;  2Z8F A;  4F29 A;  1LFG A;  3OEM A;  2D5W A;  2DVC A;  1R9L A;  1GV8 A;  3TKD A;  5CMB A;  2RIN A;  4P0I A;  3H03 A;  1B2H A;  4GRK A;  3SER A;  1RKM A;  2I6E A;  1P1O A;  3BFU A;  1PBP A;  4OVJ A;  2RF1 A;  5TP9 B;  1SYI A;  4YKJ A;  3UK4 A;  4YAH X;  4OFL A;  5H8H A;  3TZA A;  2VOZ A;  4R6Y A;  1SVX B;  4ND9 A;  2DQV A;  1MPC A;  3IAZ A;  4RXL A;  1XVX A;  3W15 C;  2ABH A;  2THI A;  2O84 X;  4OFJ A;  2Z8E A;  3TFL A;  3PUY E;  3RTW B;  1A8F A;  3OD7 A;  3FXU A;  4XKN A;  2XXP A;  1SW5 A;  3KG2 A;  5EHM A;  3ILU B;  2F5X A;  5KZT A;  3T96 B;  1WVJ A;  4THI A;  2DWI A;  3IOT A;  1MM6 A;  1URG A;  4OET A;  5H8F B;  1NKX A;  3G3K A;  2F34 A;  4NF4 A;  3THI A;  3H6V A;  5DVJ A;  1NL5 A;  4BDL A;  5AA2 D;  4F3S A;  1PDA A;  1S7Y A;  2UVI A;  5CMK A;  1B6H A;  1J1N A;  1MG1 A;  3IOV A;  2Y7P A;  1FQD A;  2HAU A;  2NXO A;  2DWA A;  1IXI A;  2QRY A;  3C4M A;  1VSO A;  4G68 C;  4ELO A;  1PC3 A;  3L6H A;  4OQO A;  3V89 B;  4PFT A;  5I2K A;  2I3V A;  4C1T A;  3PMX A;  3U1O A;  2P1S A;  2I58 A;  1QJM A;  3FV2 A;  2ALU A;  5H8Q B;  4LAT A;  4TOZ A;  2AIX A;  3VVD A;  2F7B A;  2QMX A;  3AXF A;  5F1Q A;  4M4G A;  3UP9 A;  1MH3 A;  3PMV A;  1LFI A;  3GBA A;  3GZG A;  1JW1 A;  1MQI A;  1L5T A;  3MBP A;  4YKP A;  4ZEC A;  4R2F A;  1XS5 A;  3PUV E;  2NWJ A;  1MXW A;  3B6T A;  3CSG A;  2O69 A;  3S4U A;  2PX1 A;  4LP2 B;  1DTG A;  4OWD A;  3T93 B;  3C32 A;  1Y9U A;  2Y7K A;  4RY1 A;  2XX9 A;  3FAT A;  1H76 A;  3TAJ A;  2QMW A;  5DVI A;  3RN8 A;  2F6P A;  1B1X A;  5FHM A;  1TFA A;  5ITP A;  1T0K A;  4BDR A;  2H4I A;  2AL5 A;  4IGR A;  3C33 A;  4DIG A;  4IO5 A;  4G8M A;  4O3B A;  4NF8 A;  4R6H A;  5FTI A;  3UOR A;  3CVG A;  5I58 A;  4C0R A;  2YJP A;  1XOC A;  1JQF A;  1B7U A;  3D4G A;  2V25 A;  3O66 A;  3PUX E;  4G8H A;  3OO8 A;  4OYV A;  3DP4 A;  3MUQ A;  3LSW A;  3KEI A;  1B4H A;  4KQP A;  1M5B A;  2HQ0 A;  3SET A;  1S9T A;  3FIR A;  1B05 A;  1Y4T A;  1SW1 A;  2VD3 A;  2OBG A;  3JYR A;  1IQ7 A;  4LA9 A;  1OVT A;  1ZKB A;  4H5F A;  3MPL A;  2HXW A;  5TPA A;  1AH5 A;  4ESW A;  4OEV A;  3S9E A;  2H9B A;  4P0G A;  4XKR A;  1GGG A;  1JVY A;  2QS4 A;  5I84 A;  3U93 A;  2GHA A;  1MXV A;  4OMB A;  3A3U A;  3T9U A;  2E1S A;  3V83 A;  3PU5 A;  2D21 A;  5ITO A;  4OER A;  1O7T A;  3H06 B;  4R73 A;  5KCJ A;  4EF2 A;  1SYH A;  4OFO A;  3H6T A;  1FTL A;  4R6K A;  1MPD A;  5JTY A;  2XXW A;  3RNN A;  4GFR A;  3OO9 A;  3K6W A;  1MY0 A;  3K6X A;  3SKP A;  1TT1 A;  2RC7 A;  3ZKL A;  4JSD A;  1URD A;  4Z0I A;  2DOJ A;  3T9V A;  2FYI A;  4NMY A;  2X26 A;  4RA1 A;  4NF4 B;  2HZL A;  2V93 A;  1AL3 A;  3BBR A;  4XXU A;  2AL4 A;  3Q26 A;  1B40 A;  3KSX A;  1Z7N E;  5I2N A;  1KWH A;  2I48 A;  3FJG A;  2GHB A;  1LAH E;  1TFD A;  3KSJ A;  3CG3 A;  1MQH A;  1FQA A;  4YMA A;  1A8E A;  3EPE A;  2Q8J A;  1B51 A;  3K1M A;  4YKI A;  4NF6 A;  2R71 A;  1MXX A;  1UTB A;  4LUB A;  4QF9 A;  3W9V A;  1USY E;  2CZL A;  4AB6 A;  2ZYM A;  1LAF E;  3PD9 A;  2ZMB A;  3S9N C;  5I2K B;  5IKB A;  3O6I A;  1DTZ A;  3K02 A;  3B6W A;  4HTG A;  3FUZ A;  2P2A A;  1Y20 A;  1WDN A;  4LQ2 A;  2GFE A;  4GIZ A;  5DEX A;  3A09 A;  1SBP A;  4LVQ A;  3V8X B;  4QSC A;  1H3D A;  2ESN A;  4XIG Q;  2VHA A;  2PT1 A;  1LBB A;  1SD3 A;  5KDT B;  3T9H B;  4FED A;  2AYS A;  1MPB A;  4OES A;  1ANF A;  3FGS A;  2G29 A;  3HCQ A;  4OEN A;  4MF3 A;  3OO7 A;  2V3U A;  1IEJ A;  1HSE A;  4E0W A;  4HCW A;  3MZB A;  3O28 A;  3KN3 A;  1QKA A;  4GLI A;  1I6B A;  1EH3 A;  3BKI B;  1UTH A;  2Q2C A;  4NED A;  5B7D A;  3FXQ A;  3USD A;  3TQL A;  4KD5 A;  3PUW E;  2GRV A;  4IO3 A;  1AIV A;  4U1O A;  1FTM A;  3DP8 A;  3FXR A;  3GBB A;  4F22 A;  4Q0C A;  4ZEB A;  5AA3 A;  4RJZ A;  1LCT A;  4NF8 B;  5K2Y A;  3MWB A;  4I62 A;  4JXI A;  5ELV A;  2DWH A;  1Q1K A;  2ONK E;  1MH4 A;  4YKK A;  3MVZ A;  4QFL A;  3FVG A;  1ZIU A;  2XX7 A;  4U21 A;  2XXH A;  2F8D A;  1FQE A;  4YB7 A;  4QSD A;  3VLW A;  1LB8 A;  3M3L A;  3FVO A;  2UVH A;  3N94 A;  4GF8 A;  3RUM A;  3LSL A;  1JNF A;  3FJ7 A;  3VE1 B;  2FA7 A;  4ISU A;  4RNS A;  1QUL A;  5TPA B;  4GXA A;  1IXG A;  4FEB A;  3FZV A;  4MFI A;  4X1B A;  2I49 A;  3O97 A;  3IJX B;  5K2X A;  1D9V A;  4RPO A;  4ELP A;  3QSL A;  4GOT A;  3ODB A;  1A54 A;  4U4X A;  3SDF A;  3HST A;  1ATG A;  1MM7 A;  1Y3N A;  2XXY A;  1D4N A;  2XXU A;  5DYH A;  1Q35 A;  2VD2 A;  3MVY A;  4G68 A;  4OXV A;  1SI0 A;  3UIF A;  4EUO A;  3TDJ A;  3H7M A;  3CIJ A;  4I1D A;  4R9F A;  4TLL B;  3QK6 A;  3WAF A;  4PFY A;  2X7P A;  4YB5 A;  3U92 A;  4R2B A;  1RYX A;  3I3V A;  4FEC A;  4KR5 A;  1VFE A;  4PQJ A;  4Z7E A;  2ZYN A;  3G7W A;  3PPO A;  5AA4 B;  2RCB A;  3V5A A;  1YCJ A;  2V84 A;  2Z22 A;  3KJ7 A;  3VDF A;  3EHU A;  3I5O A;  1B5J A;  5H8N B;  5I59 A;  2V3T A;  3ILT B;  3RTF B;  3C34 A;  3RLF E;  5F7V A;  2RC9 A;  1N7X A;  5I2N B;  2PMS A;  4RK2 A;  1B3E A;  3IL1 B;  3Q28 A;  3C31 A;  3SEX A;  1GTK A;  1HSJ A;  1XC1 A;  3DEL B;  4NF6 B;  1MQJ A;  3CRB A;  1BLF A;  2CMO A;  4LZ8 A;  1NMU A;  4AQ4 A;  3TEP A;  4ESX A;  5HM4 B;  4EQB A;  1MXZ A;  4QFN A;  4F3P A;  5EHS A;  4N07 A;  1NH7 A;  1M5C A;  1MRP A;  3LR1 A;  4E0X A;  3K1N A;  4OTE A;  4H67 A;  5ICQ A;  4JWX A;  3W9W A;  3TEL A;  5FHN A;  3HHF A;  3R26 A;  3KGC A;  4NF5 A;  4RYA A;  2G93 A;  1Z7M E;  2V3Q A;  5J1D A;  3FJM A;  1M5E A;  1GVC A;  4C1U A;  1BP5 A;  1QUK A;  1URS A;  4YB6 A;  3UA8 A;  4JWY A;  3EQ1 A;  4R72 A;  2QJE A;  4FE8 A;  3KFM A;  2UVJ A;  2UYF A;  3BFT A;  3N6U A;  4IB2 A;  1PBQ A;  4XKQ A;  2ZNU A;  3VXC A;  1SW2 A;  3H4Z A;  2DXY A;  3B6Q A;  1UTH B;  1B9J A;  1QKB A;  2UVG A;  4ZE8 A;  3MP6 A;  3IOR A;  2YLN A;  4F1Y A;  4YIC A;  3EHS A;  3O6G A;  1Y4C A;  4LZ7 A;  1LAX A;  2A5T B;  2ZNT A;  4X1D A;  1UIV A;  2F7A A;  1CB6 A;  4ZEK A;  1LCF A;  2QSX A;  2H99 A;  2FNC A;  3H6W A;  4KCD A;  3PD8 A;  4M1V A;  2HEU A;  2P0S A;  1QW0 A;  4JDF A;  3TCF A;  5L9M A;  3QUF A;  3CSB A;  4F39 A;  2HCA A;  4JBZ A;  4DXB A;  2HAV A;  3C9H A;  1TXF A;  2ZYO A;  2XXT A;  2ZYK A;  4QHQ A;  3O29 A;  4H8J A;  1ELJ A;  4BDQ A;  3SES A;  3O9P A;  1LGB C;  4LON B;  4F2O A;  4YMB A;  4GVO A;  1RYO A;  3CFX A;  5I57 A;  3M3K A;  2XD3 A;  1B3L A;  5H8H B;  3MW0 A;  3S9M C;  1ZBM A;  3ZKK A;  4DXC A;  4GL8 A;  4TLM B;  2REJ A;  4I9D A;  1NNT A;  4P11 A;  5L8D A;  1TWY A;  3ECR A;  1AOV A;  2XD2 A;  3N6T A;  3IR1 A;  1XVY A;  4G68 B;  1A99 A;  2W7Y A;  4ECF A;  2KLF A;  1MDQ A;  4YZZ A;  4ZDM A;  1VE4 A;  2QS1 A;  2UYE A;  2O1L A;  3IB0 A;  4ZEF A;  3S2V A;  4G2Z A;  4OZ9 A;  2O51 A;  3CG1 A;  2O68 A;  4FAT A;  4U23 A;  2XX8 A;  2DWJ A;  4U2R A;  4H1X A;  3G3F A;  5B70 A;  1P1W A;  3UN6 A;  1B0H A;  2OWS A;  1LBC A;  1B3H A;  2PYY A;  3C36 A;  1UQW A;  5AA1 A;  3EN3 A;  3EF7 A;  2Y84 A;  3GXA A;  4F3B A;  2ONS A;  3KOT A;  1N7W A;  1GR2 A;  5ISU A;  4KFQ A;  1B0L A;  1SQY A;  4NWD A;  3MVX A;  1Y3Q A;  5CRY A;  1IUD A;  2NUV A;  3E3K A;  1D9Y A;  3R6U A;  1S50 A;  3G3J A;  1FQF A;  2H25 A;  4DLD A;  3LUY A;  4F1V A;  3TTM A;  3MP1 A;  1A55 A;  4FOR A;  1FQC A;  5CBS A;  2RCA A;  3TOD A;  5EYF A;  1B3G A;  2O7U A;  3O6H A;  4ZZE A;  1B1H A;  1FTJ A;  1M5D A;  2R6G E;  3L6G A;  4F19 A;  4IO4 A;  4WEP A;  1USY H;  4KCC A;  1WOD A;  3B7D A;  2A5S A;  4NWC A;  1MXU A;  3N5L A;  1MY3 A;  1B58 A;  4DZ1 A;  5L9O A;  2ANJ A;  3KBR A;  1LB9 A;  2H5Y A;  2PBW A;  5I56 A;  2O1M A;  4H0W A;  3MZ9 A;  2Y7R A;  1NFT A;  3MQ9 A;  4ONY A;  2OWT A;  5DVF A;  4EQ9 A;  2I0B A;  4EF1 A;  4G8N A;  3VV5 A;  3CFZ A;  3PPR A;  1Y1Z A;  5LOM A;  4DDD A;  3RT6 B;  3QUJ A;  3HO7 A;  4F3G A;  2Q9T A;  3VVF A;  3K1P A;  3OO6 A;  1AMF A;  3DLN A;  3K6U A;  4KI0 E;  1OVB A;  4RPN A;  4NTL A;  1MXY A;  4PE5 B;  3ZS6 A;  5JEI A;  5HBC A;  4G77 A;  1EZ9 A;  3I6V A;  2ONR A;  3HN0 A;  1EU8 A;  4XKP A;  1N0T A;  1YAE A;  3IOU A;  1FCK A;  5I58 B;  1DOT A;  2DVZ A;  3FD3 A;  3TMG A;  3ONM A;  3TTR A;  2F35 A;  3JV9 A;  2F7C A;  4G4P A;  4ZEI A;  1P1Q A;  1US5 A;  2UXA A;  1FQB A;  4PFW A;  1ZU0 A;  1OLA A;  4XTC Q;  1FW0 A;  3U8Q A;  2X7Q A;  4Q30 B;  2DE4 A; 
#chains in the Genus database with same CATH topology
 5ET6 A;  3OEN A;  4HE2 A;  4H8I A;  3TPA A;  3GLB A;  4G61 A;  3E9X A;  4PTK A;  1QVS A;  3QIM A;  5I57 B;  3KZG A;  1MQG A;  3RPL A;  5H8S A;  3TUS A;  1N76 A;  5DT6 A;  3IX1 A;  1JW5 A;  4MH5 A;  3K01 A;  2B3F A;  2Q89 A;  2MKZ A;  1R1N A;  1LBW A;  1FBC A;  3PV0 E;  3E4R A;  3N26 A;  4DE8 A;  5KCJ B;  4POX A;  4GL0 A;  1MY2 A;  1POY 1;  5JTY B;  3OXN A;  2CZH A;  4GWS A;  1OQH A;  4UA8 A;  4MHF A;  2XHD A;  4R74 A;  2O6A A;  2LAO A;  4XF5 A;  1DPP A;  4PF6 A;  3OOA A;  2RC8 A;  2QS2 A;  4OAN A;  1DSN A;  2OZZ A;  3DM0 A;  4OEU A;  3O2A A;  2M8C A;  3QAX A;  4MBP A;  5CM6 A;  3TCG A;  3IK6 B;  1FPG A;  4KPT A;  1UIU A;  2OJT A;  4PAF A;  4WED A;  4PBH A;  1MY4 A;  3T22 A;  4JWO A;  2L5V A;  3MC2 A;  2IEE A;  3Q29 A;  4PBQ A;  1EZO A;  1PB9 A;  3PPQ A;  4RK9 A;  1II5 A;  2FIX A;  4PFR A;  2QFL A;  1FTO A;  5CI5 A;  4F31 B;  4BDN A;  1CE2 A;  1F9B A;  3PGF A;  5LDZ A;  3BIG A;  4GX3 A;  4ZZA A;  4L17 A;  1IZ1 A;  3KN7 A;  1UTB B;  3Q25 A;  2XXI A;  5IM2 A;  4QFK A;  5J16 A;  4NE4 A;  1PB8 A;  1D9Q A;  1I6Q A;  1NNF A;  3IO6 A;  3OMB A;  4KYE A;  2I4C A;  3PUZ E;  4I3E A;  1MQD A;  5FBP A;  4WXJ A;  4PFU A;  4O3A A;  2WBD A;  4QSE A;  5DEX B;  1BK4 A;  3CFL A;  2RKM A;  3SEU A;  3MZ1 A;  4F18 A;  1LAG E;  2I0C A;  1N3W A;  3KJT A;  1SPI A;  2Z8D A;  4GWZ A;  2B4L A;  3A3C A;  1IXC A;  1DMB A;  3SEY A;  1ZJL A;  4DCY A;  4DXU A;  4Q5T A;  1MY1 A;  4GXS B;  1INP A;  3MAM A;  4QFP A;  5IGA A;  5FTH A;  2REG A;  3RY3 A;  5L9S A;  4HS7 A;  4TQU Q;  4EDP A;  2Q2A A;  3DP6 A;  3SEW A;  4KHZ E;  1OLC A;  1N3X A;  3PMW A;  1NNP A;  4EXL A;  2PVU A;  3VLU A;  1FPL A;  1IIT A;  5KDT A;  4IO7 A;  4N13 A;  1A40 A;  1MDP 1;  3FVN A;  1JVX A;  1QUI A;  2R9J A;  5I56 B;  3MJN A;  4F1U A;  3OSQ A;  5A5X A;  3QYT A;  1N84 A;  3UGW A;  5CC2 A;  1B52 A;  2QS3 A;  5I3S A;  1PB7 A;  5M2V A;  5IAI A;  3T66 A;  4IGT A;  4JVC A;  3MVW A;  5BUU A;  3FXB A;  1NH8 A;  1MS7 A;  4FJP A;  2P3V A;  1BIY A;  2OK2 A;  4IO6 A;  3LC8 A;  2F97 A;  3Q27 A;  4Q8R A;  1IIW A;  3VFJ A;  1VFD A;  2F6G A;  1KZ8 A;  1G0I A;  3IFC A;  3FV1 A;  1NUY A;  1ZMG A;  5CMC A;  3TTN A;  5AA2 A;  1P1N A;  3KOS A;  3LBS A;  1EZP A;  1D3K A;  1SI1 A;  3U72 A;  4HCY A;  4PFI A;  4U1Z A;  2DS9 A;  1EYI A;  5BWJ A;  4H65 A;  4ZS9 A;  2XXX A;  1R9Q A;  2I3W A;  1M5F A;  5ICT A;  3EHT A;  4I8C A;  1JW4 A;  3OEK A;  4PAI A;  3S9L C;  2OCU A;  1XT8 A;  4F2Q A;  1H44 A;  5I7I A;  1JET A;  4GWO A;  3IJO B;  3RGY A;  1B32 A;  4H6D A;  4OHN A;  1K9Z A;  2B3B A;  4P3L A;  3RYD A;  1JEU A;  1I6A A;  2F36 A;  4O7I A;  5EQ7 A;  1LEV A;  1P1U A;  4PET A;  1EYJ A;  4H45 A;  1N04 A;  1JEV A;  2DXR A;  4O3C A;  3RPW A;  3IB2 A;  4PAK A;  1NUW A;  4EQ7 A;  4U22 A;  2Y7I A;  1POT A;  2HZK A;  1BKA A;  3K6V A;  3VXB A;  1US4 A;  4R9G A;  4OVT A;  5EYG A;  2XXV A;  2DYX A;  4QRZ A;  4X48 A;  4POW A;  1BTJ A;  2PT2 A;  2DE2 A;  2PFZ A;  1R6Z A;  1FRP A;  2DDK A;  1H45 A;  3H3G A;  5TP9 A;  2Q88 A;  4ELQ A;  1QUJ A;  4IY6 A;  3M8U A;  3GYY A;  2I4B A;  4DCX A;  4O8M A;  3PPP A;  4R75 A;  2O7I A;  1NNK A;  3K4U A;  3F11 A;  4LQ5 A;  2NVU B;  2H98 A;  2VGQ A;  4NF0 A;  4PP0 A;  3G3H A;  4N15 A;  1NUZ A;  1FBE A;  3HV1 A;  3T9X B;  3MP8 A;  4GX4 A;  5I59 B;  1YYZ A;  1OMP A;  3MPK A;  3HHG A;  5CMM A;  3WAE A;  1H43 A;  2FBP A;  4UAB A;  4OVQ A;  5HPQ A;  2KQZ A;  4EXK A;  1OQG A;  3TCH A;  4ZED A;  4X9T A;  5AA4 A;  3TTL A;  2ZZV A;  3PPN A;  1OIB A;  5H8F A;  5H8N A;  4IY5 A;  3P7I A;  3FBP A;  3TYH A;  4ZE9 A;  3FVK A;  4U4S A;  5TU0 A;  3R7X A;  1B5I A;  2IA4 A;  5DTB A;  4GQO A;  3C35 A;  2GH9 A;  1XHY A;  1B7H A;  4HW8 A;  4KYS A;  2QL3 A;  1SDX A;  2HFB A;  4MLV A;  1YPN A;  2E0S A;  1SW4 A;  4QFO A;  1IXH A;  3U94 A;  5A5L A;  1FBP A;  4NF5 B;  2VP1 A;  2WKY A;  5JK4 A;  1FTA A;  4X8R A;  2XXQ A;  2DP8 A;  3CR9 A;  5AE4 A;  4H5G A;  4UAC A;  3IO4 A;  1DPE A;  3K2D A;  1I69 A;  3TTK A;  1B3F A;  1VR5 A;  3LSF B;  3OSR A;  4PGN A;  4FIM A;  2BJJ X;  1FBD A;  4GD5 A;  4FAJ A;  4KYD A;  4N91 A;  1FTK A;  2XWO A;  2DSF A;  3K0V A;  4IO2 A;  5H8Q A;  3HPI A;  1IMC A;  3RQT A;  3LSX A;  3IOW A;  1B4Z A;  4IR8 A;  4JSO A;  2ZNS A;  3RT8 A;  5A5X B;  1HSL A;  4YU0 A;  1LST A;  4N6P A;  4WKM A;  1O64 A;  4ELR A;  3NOH A;  2B4M A;  3FAS A;  1Y1M A;  4AB5 A;  1PEB A;  3VLV A;  2YPN A;  3E13 X;  4NHB A;  2VPO A;  4MCO A;  1FJ9 A;  3QXM A;  5CBR A;  1Y3P A;  4BDO A;  2OLB A;  1B7Z A;  3OEL A;  2QPQ A;  1LLS A;  4BDM A;  4N4U A;  2ZXT A;  1FPF A;  3M3F A;  4BLA A;  3JZJ A;  2Y7W A;  3D4C A;  3CI8 A;  1LBZ A;  5AA2 B;  4K3F A;  3G3G A;  1RDX A;  4LZ5 A;  2NOO A;  1LFH A;  1ZLQ A;  2XXR A;  4I3Y A;  3G3I A;  4MLQ A;  5ET8 A;  2DE3 A;  2Z23 A;  3K00 A;  1O63 A;  2PFY A;  4JB7 A;  2A5T A;  1B46 A;  3KN8 A;  1ZTY A;  1XI6 A;  3U65 A;  1YTV A;  5FHO A;  1A7L A;  3H6U A;  3VVE A;  3BIH A;  3TQW A;  1P99 A;  2B65 A;  2F78 A;  3ZSF A;  3SEV A;  3IB1 A;  1DK4 A;  2D3I A;  3ISP A;  1B5H A;  2Z8F A;  4F29 A;  1LFG A;  3OEM A;  2D5W A;  2DVC A;  5IZ1 A;  1R9L A;  1GV8 A;  3TKD A;  5CMB A;  2RIN A;  4P0I A;  1FPI A;  5ET5 A;  3H03 A;  1B2H A;  4GRK A;  3SER A;  1RKM A;  2I6E A;  1P1O A;  3BFU A;  1PBP A;  4OVJ A;  4HXV A;  2RF1 A;  5TP9 B;  1SYI A;  4YKJ A;  3UK4 A;  4YAH X;  4OFL A;  1DBZ A;  5H8H A;  3TZA A;  2VOZ A;  4R6Y A;  1SVX B;  4P1L A;  4PFB A;  4ND9 A;  1YZ0 A;  2DQV A;  2QVV A;  2VT5 A;  1MPC A;  3IAZ A;  4RXL A;  1XVX A;  3W15 C;  2ABH A;  2THI A;  2O84 X;  4OFJ A;  2Z8E A;  1IMA A;  4NGU A;  5ET7 A;  3TFL A;  3PUY E;  3RTW B;  1A8F A;  3OD7 A;  3FXU A;  1FJ6 A;  4XKN A;  2XXP A;  1SW5 A;  3KG2 A;  5EHM A;  3ILU B;  2F5X A;  5KZT A;  3T96 B;  4MX6 A;  4P56 A;  1WVJ A;  4MNI A;  4THI A;  4MJO A;  5I5P A;  2DWI A;  4N17 A;  3IOT A;  4X04 A;  1MM6 A;  1CNQ A;  1URG A;  4OET A;  5H8F B;  1NKX A;  3G3K A;  3LV0 A;  2F34 A;  4NF4 A;  2Q8M A;  3THI A;  3H6V A;  4NAP A;  5DVJ A;  1NL5 A;  4BDL A;  5AA2 D;  4F3S A;  1PDA A;  1S7Y A;  2UVI A;  5CMK A;  1B6H A;  1J1N A;  3B8B A;  1MG1 A;  3IOV A;  2Y7P A;  5DW8 A;  1FQD A;  2HAU A;  2OX3 A;  4P1E A;  2NXO A;  2DWA A;  1IXI A;  2QRY A;  3C4M A;  4GBV A;  1VSO A;  4G68 C;  4ELO A;  1PC3 A;  3L6H A;  4OQO A;  4O94 A;  3V89 B;  4PFT A;  5I2K A;  2I3V A;  4C1T A;  3PMX A;  1FPD A;  3IFA A;  1DCU A;  3U1O A;  2P1S A;  1LBV A;  4MNC A;  1NV1 A;  2I58 A;  4DI3 D;  1QJM A;  3FV2 A;  2ALU A;  5H8Q B;  4LAT A;  4TOZ A;  2AIX A;  2P3N A;  4N6K A;  3VVD A;  2F7B A;  2QMX A;  3AXF A;  5F1Q A;  4M4G A;  3UP9 A;  1MH3 A;  3PMV A;  1LFI A;  3GBA A;  3GZG A;  1JW1 A;  1MQI A;  1L5T A;  3MBP A;  4YKP A;  4P47 A;  4ZEC A;  4R2F A;  1XS5 A;  3PUV E;  2NWJ A;  3HFU A;  1MXW A;  3B6T A;  3CSG A;  2O69 A;  3S4U A;  2PX1 A;  4LP2 B;  4OWD A;  1DTG A;  3T93 B;  3C32 A;  1Y9U A;  2Y7K A;  4RY1 A;  2XX9 A;  3FAT A;  1H76 A;  3A29 A;  3TAJ A;  2QMW A;  5DVI A;  3RN8 A;  2F6P A;  1B1X A;  1FPE A;  5FHM A;  2HXR A;  1TFA A;  5ITP A;  1T0K A;  2WEF A;  4BDR A;  4N8G A;  2H4I A;  2AL5 A;  4IGR A;  2GQ1 A;  3C33 A;  4DIG A;  4IO5 A;  4G8M A;  4O3B A;  4NF8 A;  4R6H A;  5FTI A;  3UOR A;  2ZZX A;  3CVG A;  5IZ3 A;  1NV2 A;  5I58 A;  4C0R A;  4DI4 B;  4MMP A;  2YJP A;  4PDH A;  1XOC A;  1JQF A;  1B7U A;  3D4G A;  3RPL B;  2V25 A;  3O66 A;  3PUX E;  4G8H A;  3OO8 A;  4OYV A;  3DP4 A;  3MUQ A;  3LSW A;  2R8T A;  3KEI A;  4I40 A;  1B4H A;  4KQP A;  1M5B A;  2HQ0 A;  3SET A;  1S9T A;  3FIR A;  1AWB A;  4N81 A;  1B05 A;  1Y4T A;  1SW1 A;  2VD3 A;  2OBG A;  3JYR A;  1IQ7 A;  4LA9 A;  1OVT A;  1ZKB A;  4H5F A;  3MPL A;  1NV7 A;  2VPN A;  4JVI A;  2HXW A;  5TPA A;  1AH5 A;  4ESW A;  4OEV A;  3S9E A;  2H9B A;  4P0G A;  4XKR A;  1GGG A;  1JVY A;  2QS4 A;  1K9Y A;  5I84 A;  3U93 A;  2GHA A;  1MXV A;  3EKI A;  4OMB A;  3A3U A;  2FVZ A;  3T9U A;  2E1S A;  3V83 A;  3PU5 A;  2D21 A;  3MST A;  4PCD A;  5ITO A;  4OER A;  1O7T A;  3H06 B;  4R73 A;  5KCJ A;  4EF2 A;  1SYH A;  4OFO A;  3H6T A;  1FTL A;  4R6K A;  1MPD A;  1LBY A;  5JTY A;  2XXW A;  2F3B A;  3RNN A;  4GFR A;  2F3D A;  3OO9 A;  4HE1 A;  3K6W A;  1MY0 A;  5F24 A;  3K6X A;  3SKP A;  1TT1 A;  2RC7 A;  3ZKL A;  4JSD A;  1URD A;  1JP4 A;  4Z0I A;  4OVS A;  1RDZ A;  2DOJ A;  3T9V A;  2FYI A;  4NMY A;  2X26 A;  4RA1 A;  4NF4 B;  2HZL A;  2V93 A;  1AL3 A;  1FPK A;  3BBR A;  4XXU A;  2AL4 A;  1RDY A;  3E79 A;  3Q26 A;  1B40 A;  3KSX A;  1Z7N E;  5I2N A;  1KWH A;  2I48 A;  1VDW A;  3FJG A;  2GHB A;  1LAH E;  4H46 A;  1TFD A;  4MEV A;  3KSJ A;  3CG3 A;  1MQH A;  1FQA A;  4YMA A;  1A8E A;  3EPE A;  3D1R A;  2Q8J A;  1B51 A;  3K1M A;  4YKI A;  4NF6 A;  4P9K A;  2R71 A;  1MXX A;  1UTB A;  4LUB A;  4QF9 A;  3W9V A;  4PC9 A;  1USY E;  2CZL A;  4AB6 A;  2ZYM A;  1LAF E;  3PD9 A;  2ZMB A;  3S9N C;  5I2K B;  5IKB A;  3O6I A;  1DTZ A;  3K02 A;  3B6W A;  4HTG A;  3FUZ A;  2P2A A;  1Y20 A;  1WDN A;  4LQ2 A;  2GFE A;  4GIZ A;  5DEX A;  5T3J A;  3A09 A;  2ZZW A;  1SBP A;  1YXI A;  4LVQ A;  3V8X B;  4QSC A;  4MIJ A;  1H3D A;  2ESN A;  4XIG Q;  2VHA A;  2PT1 A;  1LBB A;  1SD3 A;  5KDT B;  3T1B A;  3T9H B;  4FED A;  2AYS A;  1MPB A;  4OES A;  1ANF A;  2OWZ A;  3FGS A;  2G29 A;  3HCQ A;  4OEN A;  4MF3 A;  3OO7 A;  2V3U A;  4PF8 A;  1FPB A;  1IEJ A;  2QVR A;  1HSE A;  3ROJ A;  4E0W A;  4HCW A;  1NV3 A;  3MZB A;  3O28 A;  3KN3 A;  1QKA A;  4GLI A;  1I6B A;  1EH3 A;  3BKI B;  1UTH A;  2Q2C A;  4NED A;  5B7D A;  3FXQ A;  3USD A;  3TQL A;  4PE3 A;  4KD5 A;  3PUW E;  2GRV A;  4IO3 A;  1AIV A;  4U1O A;  1FTM A;  3DP8 A;  3FXR A;  3GBB A;  4F22 A;  2CEY A;  4Q0C A;  4ZEB A;  5AA3 A;  4RJZ A;  1LCT A;  4FBP A;  4NF8 B;  5K2Y A;  3MWB A;  4I62 A;  4JXI A;  5ELV A;  2DWH A;  1Q1K A;  2ONK E;  1MH4 A;  4OVP A;  4YKK A;  3MVZ A;  4QFL A;  3FVG A;  1ZIU A;  5IZ3 B;  2XX7 A;  4U21 A;  2XXH A;  2F8D A;  2Y5K A;  2CZK A;  1FQE A;  4JVD A;  4YB7 A;  4QSD A;  3VLW A;  1LB8 A;  3M3L A;  3FVO A;  2UVH A;  3N94 A;  4GF8 A;  3RUM A;  2BJI A;  3LSL A;  1JNF A;  2XWV A;  3FJ7 A;  3VE1 B;  2FA7 A;  4LN5 A;  2V4C A;  4ISU A;  4RNS A;  3PTY A;  1QUL A;  5TPA B;  4GXA A;  1IXG A;  4FEB A;  3E78 A;  3FZV A;  4MFI A;  1IMB A;  4X1B A;  2I49 A;  3O97 A;  4N6D A;  3IJX B;  5K2X A;  1D9V A;  4RPO A;  4ELP A;  3QSL A;  4GOT A;  3ODB A;  1A54 A;  4U4X A;  3SDF A;  4MAG A;  2XWI A;  3HST A;  2QVU A;  1ATG A;  2FIE A;  1MM7 A;  1Y3N A;  2XXY A;  1D4N A;  2XXU A;  5DYH A;  1Q35 A;  2WYK A;  2VD2 A;  3MVY A;  4G68 A;  4OXV A;  1SI0 A;  3UIF A;  4EUO A;  3TDJ A;  3H7M A;  3CIJ A;  4I1D A;  4R9F A;  4TLL B;  3QK6 A;  3WAF A;  4PFY A;  2X7P A;  4YB5 A;  3U92 A;  4R2B A;  1RYX A;  3I3V A;  4FEC A;  4KR5 A;  1IME A;  1VFE A;  4PQJ A;  4Z7E A;  2ZYN A;  3G7W A;  3PPO A;  5AA4 B;  2RCB A;  3V5A A;  1YCJ A;  2V84 A;  2Z22 A;  3KJ7 A;  3VDF A;  3EHU A;  3I5O A;  1B5J A;  5H8N B;  5I59 A;  2V3T A;  3ILT B;  3RTF B;  3C34 A;  3RLF E;  5F7V A;  2RC9 A;  1N7X A;  5I2N B;  2PMS A;  4RK2 A;  1B3E A;  3IL1 B;  3Q28 A;  3C31 A;  3SEX A;  1GTK A;  1HSJ A;  1XC1 A;  3DEL B;  4NF6 B;  3QMF A;  1MQJ A;  3CRB A;  1BLF A;  2CMO A;  4LZ8 A;  1NMU A;  5EQ9 A;  4AQ4 A;  2CZI A;  3TEP A;  4ESX A;  5HM4 B;  1NV5 A;  4EQB A;  1MXZ A;  2CEX A;  4QFN A;  4F3P A;  5EHS A;  4N07 A;  1NH7 A;  1M5C A;  1MRP A;  3LR1 A;  4E0X A;  3K1N A;  4KXP A;  4OTE A;  4H67 A;  5ICQ A;  4JWX A;  3W9W A;  3TEL A;  5FHN A;  3HHF A;  3R26 A;  3KGC A;  2HPG A;  4NF5 A;  4RYA A;  2G93 A;  1Q9D A;  1Z7M E;  2V3Q A;  5J1D A;  1NUX A;  4PGP A;  3FJM A;  1M5E A;  1GVC A;  4C1U A;  1BP5 A;  1QUK A;  1URS A;  4GWX A;  4YB6 A;  4XEQ A;  3UA8 A;  4JWY A;  3EQ1 A;  4N8Y A;  4R72 A;  2QJE A;  4FE8 A;  3KFM A;  2UVJ A;  2UYF A;  3BFT A;  3N6U A;  4IB2 A;  1PBQ A;  4XKQ A;  2ZNU A;  1KA0 A;  4XFE A;  3VXC A;  1SW2 A;  3H4Z A;  4GWU A;  2XWK A;  2WYP A;  2DXY A;  3B6Q A;  1UTH B;  1B9J A;  1QKB A;  2UVG A;  4ZE8 A;  3MP6 A;  3IOR A;  2YLN A;  4F1Y A;  4YIC A;  3EHS A;  4QBA A;  3O6G A;  4OVR A;  1Y4C A;  4LZ7 A;  1LAX A;  2A5T B;  2ZNT A;  4X1D A;  1UIV A;  5ESY A;  2F7A A;  1CB6 A;  1NV6 A;  4ZEK A;  5LTC A;  1LCF A;  2QSX A;  2KR0 A;  2H99 A;  2XXK A;  2FNC A;  3H6W A;  4KCD A;  3PD8 A;  4M1V A;  2HEU A;  2P0S A;  1QW0 A;  4JDF A;  3TCF A;  3KBZ A;  5L9M A;  3QUF A;  1G0H A;  2HCA A;  3CSB A;  4JBZ A;  4F39 A;  4DXB A;  2HAV A;  3C9H A;  1LBX A;  1TXF A;  2ZYO A;  2XXT A;  2ZYK A;  4QHQ A;  3O29 A;  4H8J A;  1ELJ A;  2WBB A;  4BDQ A;  1NI9 A;  3SES A;  3O9P A;  1LGB C;  2XA5 A;  4LON B;  3KC1 A;  1NV4 A;  3MYU A;  4F2O A;  4YMB A;  4GVO A;  1RYO A;  1KA1 A;  3CFX A;  5I57 A;  3M3K A;  2XD3 A;  4GWY A;  4OA4 A;  1B3L A;  5H8H B;  3MW0 A;  3S9M C;  1ZBM A;  2PCR A;  3ZKK A;  4DXC A;  4GL8 A;  4TLM B;  1EYK A;  2REJ A;  4I9D A;  1NNT A;  4NQ8 A;  4P11 A;  2Y5L A;  5L8D A;  1TWY A;  3ECR A;  1AOV A;  2XD2 A;  3N6T A;  3IR1 A;  4O7M A;  1XVY A;  4G68 B;  1A99 A;  2W7Y A;  4QXD A;  4ECF A;  2KLF A;  1MDQ A;  4YZZ A;  4ZDM A;  1VE4 A;  2QS1 A;  2UYE A;  2O1L A;  3IB0 A;  4ZEF A;  4GX6 A;  3S2V A;  4G2Z A;  4OZ9 A;  2O51 A;  3CG1 A;  2O68 A;  4FAT A;  4U23 A;  2XX8 A;  2FHY A;  2DWJ A;  4U2R A;  4H1X A;  3G3F A;  5B70 A;  1P1W A;  4GBW A;  3UN6 A;  1IMD A;  4HE0 A;  1B0H A;  2OWS A;  1LBC A;  4NN3 A;  1B3H A;  2PYY A;  3C36 A;  1UQW A;  5AA1 A;  3EN3 A;  3EF7 A;  2Y84 A;  1FBF A;  3GXA A;  4F3B A;  2ONS A;  3KOT A;  1N7W A;  1GR2 A;  5ISU A;  3T0J A;  4MNP A;  4KFQ A;  1B0L A;  1SQY A;  4NWD A;  3MVX A;  1Y3Q A;  5CRY A;  3SZP A;  1IUD A;  2NUV A;  3E3K A;  1D9Y A;  4P8B A;  3R6U A;  4PDD A;  1S50 A;  3G3J A;  1FBH A;  3LUZ A;  1FQF A;  2H25 A;  4DLD A;  3LUY A;  5EQA A;  4NX1 A;  2JJK A;  4F1V A;  5EYH A;  3TTM A;  4NG7 A;  3MP1 A;  1A55 A;  4FOR A;  1FQC A;  5CBS A;  1FPJ A;  2RCA A;  3TOD A;  5EYF A;  1B3G A;  2O7U A;  3O6H A;  4ZZE A;  1B1H A;  1FTJ A;  1M5D A;  2R6G E;  3L6G A;  4F19 A;  4IO4 A;  5EQ8 A;  4WEP A;  4AS4 A;  4AS5 A;  1USY H;  4KCC A;  1WOD A;  3B7D A;  2A5S A;  4NWC A;  1MXU A;  3N5L A;  1MY3 A;  1B58 A;  5IZZ A;  4DZ1 A;  1NV0 A;  5L9O A;  2ANJ A;  3KBR A;  1LB9 A;  2H5Y A;  2PBW A;  3KC0 A;  5I56 A;  2O1M A;  1FBG A;  4H0W A;  3MZ9 A;  2Y7R A;  1NFT A;  3MQ9 A;  4ONY A;  2OWT A;  5DVF A;  4EQ9 A;  2I0B A;  4EF1 A;  4G8N A;  1QGX A;  3VV5 A;  3CFZ A;  3PPR A;  1Y1Z A;  5LOM A;  4DDD A;  3RT6 B;  2Q74 A;  3CHG A;  3QUJ A;  3HO7 A;  4F3G A;  1FSA A;  2Q9T A;  3VVF A;  4GWW A;  3K1P A;  3OO6 A;  1AMF A;  3DLN A;  3K6U A;  4KI0 E;  1OVB A;  4RPN A;  4NTL A;  1MXY A;  2WX9 A;  4PE5 B;  3ZS6 A;  5JEI A;  5HBC A;  4G77 A;  1EZ9 A;  3I6V A;  2ONR A;  3HN0 A;  1EU8 A;  1N0T A;  1YAE A;  4XKP A;  3IOU A;  2HHM A;  1FCK A;  5I58 B;  1DOT A;  2DVZ A;  3FD3 A;  3TMG A;  3ONM A;  3TTR A;  2F35 A;  3JV9 A;  2F7C A;  4G4P A;  1IMF A;  4ZEI A;  1P1Q A;  1US5 A;  2UXA A;  1FQB A;  4PFW A;  1ZU0 A;  1OLA A;  4XTC Q;  1FW0 A;  3U8Q A;  3B50 A;  2X7Q A;  4Q30 B;  2DE4 A; 
#chains in the Genus database with same CATH homology
 3OEN A;  4H8I A;  3TPA A;  3GLB A;  3E9X A;  1QVS A;  3QIM A;  5I57 B;  3KZG A;  1MQG A;  5H8S A;  3TUS A;  1N76 A;  5DT6 A;  3IX1 A;  1JW5 A;  4MH5 A;  3K01 A;  2B3F A;  2Q89 A;  1R1N A;  3PV0 E;  3E4R A;  3N26 A;  4DE8 A;  5KCJ B;  4POX A;  4GL0 A;  1MY2 A;  1POY 1;  5JTY B;  3OXN A;  1OQH A;  4UA8 A;  4R74 A;  2XHD A;  2O6A A;  2LAO A;  1DPP A;  3OOA A;  2RC8 A;  2QS2 A;  1DSN A;  2OZZ A;  3DM0 A;  4OEU A;  3O2A A;  2M8C A;  3QAX A;  4MBP A;  5CM6 A;  3TCG A;  3IK6 B;  4KPT A;  1UIU A;  2OJT A;  4WED A;  3T22 A;  1MY4 A;  4JWO A;  3MC2 A;  2IEE A;  3Q29 A;  1EZO A;  1PB9 A;  3PPQ A;  4RK9 A;  1II5 A;  1FTO A;  5CI5 A;  4F31 B;  4BDN A;  1CE2 A;  1F9B A;  3PGF A;  4ZZA A;  4L17 A;  1IZ1 A;  3KN7 A;  1UTB B;  3Q25 A;  2XXI A;  4QFK A;  4NE4 A;  1PB8 A;  1I6Q A;  1NNF A;  3IO6 A;  3OMB A;  4KYE A;  2I4C A;  3PUZ E;  1MQD A;  4WXJ A;  4PFU A;  4O3A A;  4QSE A;  5DEX B;  3CFL A;  2RKM A;  3SEU A;  3MZ1 A;  4F18 A;  1LAG E;  2I0C A;  1N3W A;  3KJT A;  2Z8D A;  3A3C A;  1IXC A;  1DMB A;  3SEY A;  1ZJL A;  4DCY A;  4DXU A;  4Q5T A;  1MY1 A;  4GXS B;  3MAM A;  4QFP A;  5FTH A;  2REG A;  3RY3 A;  5L9S A;  4HS7 A;  4TQU Q;  4EDP A;  2Q2A A;  3DP6 A;  3SEW A;  4KHZ E;  1OLC A;  1N3X A;  3PMW A;  1NNP A;  4EXL A;  2PVU A;  3VLU A;  1IIT A;  5KDT A;  4IO7 A;  4N13 A;  1A40 A;  1MDP 1;  3FVN A;  1JVX A;  1QUI A;  2R9J A;  5I56 B;  3MJN A;  4F1U A;  3OSQ A;  5A5X A;  3QYT A;  1N84 A;  3UGW A;  5CC2 A;  1B52 A;  2QS3 A;  1PB7 A;  5M2V A;  5IAI A;  3T66 A;  4IGT A;  5BUU A;  3MVW A;  1NH8 A;  1MS7 A;  4FJP A;  1BIY A;  2OK2 A;  4IO6 A;  3LC8 A;  2F97 A;  3Q27 A;  4Q8R A;  1IIW A;  3VFJ A;  1VFD A;  2F6G A;  3FV1 A;  1ZMG A;  5CMC A;  3TTN A;  5AA2 A;  1P1N A;  3KOS A;  3LBS A;  1EZP A;  1D3K A;  1SI1 A;  3U72 A;  4HCY A;  4U1Z A;  2DS9 A;  5BWJ A;  4H65 A;  4ZS9 A;  2XXX A;  1R9Q A;  2I3W A;  1M5F A;  5ICT A;  3EHT A;  4I8C A;  1JW4 A;  3OEK A;  3S9L C;  2OCU A;  1XT8 A;  4F2Q A;  1H44 A;  1JET A;  4GWO A;  3IJO B;  3RGY A;  1B32 A;  4H6D A;  4OHN A;  2B3B A;  1JEU A;  1I6A A;  2F36 A;  1P1U A;  4PET A;  1N04 A;  1JEV A;  2DXR A;  4O3C A;  3RPW A;  3IB2 A;  4EQ7 A;  4U22 A;  2Y7I A;  1POT A;  2HZK A;  1BKA A;  3K6V A;  3VXB A;  1US4 A;  4R9G A;  2XXV A;  2DYX A;  4QRZ A;  4X48 A;  4POW A;  1BTJ A;  2PT2 A;  2DE2 A;  1R6Z A;  3H3G A;  1H45 A;  5TP9 A;  2Q88 A;  4ELQ A;  1QUJ A;  4IY6 A;  3M8U A;  2I4B A;  4DCX A;  3PPP A;  4R75 A;  2O7I A;  1NNK A;  3K4U A;  3F11 A;  4LQ5 A;  2NVU B;  2H98 A;  2VGQ A;  4PP0 A;  3G3H A;  3HV1 A;  3T9X B;  3MP8 A;  5I59 B;  1OMP A;  3MPK A;  3HHG A;  5CMM A;  3WAE A;  1H43 A;  5HPQ A;  4EXK A;  1OQG A;  3TCH A;  4ZED A;  4X9T A;  5AA4 A;  3TTL A;  3PPN A;  1OIB A;  5H8F A;  5H8N A;  4IY5 A;  3P7I A;  3TYH A;  4ZE9 A;  3FVK A;  4U4S A;  5TU0 A;  3R7X A;  1B5I A;  2IA4 A;  5DTB A;  4GQO A;  3C35 A;  2GH9 A;  1XHY A;  1B7H A;  4HW8 A;  4KYS A;  2QL3 A;  1SDX A;  2HFB A;  4MLV A;  1YPN A;  2E0S A;  1SW4 A;  4QFO A;  1IXH A;  3U94 A;  4NF5 B;  2VP1 A;  2WKY A;  5JK4 A;  2XXQ A;  2DP8 A;  3CR9 A;  5AE4 A;  4H5G A;  4UAC A;  3IO4 A;  1DPE A;  3K2D A;  1I69 A;  3TTK A;  1B3F A;  1VR5 A;  3LSF B;  3OSR A;  4FIM A;  2BJJ X;  4GD5 A;  4FAJ A;  4KYD A;  1FTK A;  2DSF A;  3K0V A;  4IO2 A;  5H8Q A;  3HPI A;  3RQT A;  3LSX A;  3IOW A;  1B4Z A;  4JSO A;  2ZNS A;  3RT8 A;  5A5X B;  1HSL A;  4YU0 A;  1LST A;  4N6P A;  4WKM A;  1O64 A;  4ELR A;  3FAS A;  1Y1M A;  4AB5 A;  1PEB A;  3VLV A;  2YPN A;  3E13 X;  3QXM A;  5CBR A;  1Y3P A;  4BDO A;  2OLB A;  1B7Z A;  3OEL A;  2QPQ A;  1LLS A;  4BDM A;  2ZXT A;  3M3F A;  4BLA A;  3JZJ A;  2Y7W A;  3D4C A;  3CI8 A;  5AA2 B;  4K3F A;  3G3G A;  4LZ5 A;  2NOO A;  1LFH A;  1ZLQ A;  2XXR A;  3G3I A;  4MLQ A;  2DE3 A;  2Z23 A;  3K00 A;  1O63 A;  4JB7 A;  2A5T A;  1B46 A;  3KN8 A;  1ZTY A;  1YTV A;  5FHO A;  1A7L A;  3H6U A;  3VVE A;  3TQW A;  1P99 A;  2B65 A;  2F78 A;  3ZSF A;  3SEV A;  3IB1 A;  2D3I A;  1B5H A;  2Z8F A;  4F29 A;  1LFG A;  3OEM A;  2D5W A;  2DVC A;  1R9L A;  1GV8 A;  3TKD A;  5CMB A;  2RIN A;  4P0I A;  3H03 A;  1B2H A;  4GRK A;  3SER A;  1RKM A;  2I6E A;  1P1O A;  3BFU A;  1PBP A;  4OVJ A;  2RF1 A;  5TP9 B;  1SYI A;  4YKJ A;  3UK4 A;  4YAH X;  4OFL A;  5H8H A;  3TZA A;  2VOZ A;  4R6Y A;  1SVX B;  4ND9 A;  2DQV A;  1MPC A;  3IAZ A;  4RXL A;  1XVX A;  3W15 C;  2ABH A;  2THI A;  2O84 X;  4OFJ A;  2Z8E A;  3TFL A;  3PUY E;  3RTW B;  1A8F A;  3OD7 A;  3FXU A;  4XKN A;  2XXP A;  1SW5 A;  3KG2 A;  5EHM A;  3ILU B;  2F5X A;  5KZT A;  3T96 B;  1WVJ A;  4THI A;  2DWI A;  3IOT A;  1MM6 A;  1URG A;  4OET A;  5H8F B;  1NKX A;  3G3K A;  2F34 A;  4NF4 A;  3THI A;  3H6V A;  5DVJ A;  1NL5 A;  4BDL A;  5AA2 D;  4F3S A;  1PDA A;  1S7Y A;  2UVI A;  5CMK A;  1B6H A;  1J1N A;  1MG1 A;  3IOV A;  2Y7P A;  1FQD A;  2HAU A;  2NXO A;  2DWA A;  1IXI A;  2QRY A;  3C4M A;  1VSO A;  4G68 C;  4ELO A;  1PC3 A;  3L6H A;  4OQO A;  3V89 B;  4PFT A;  5I2K A;  2I3V A;  4C1T A;  3PMX A;  3U1O A;  2P1S A;  2I58 A;  1QJM A;  3FV2 A;  2ALU A;  5H8Q B;  4LAT A;  4TOZ A;  2AIX A;  3VVD A;  2F7B A;  2QMX A;  3AXF A;  5F1Q A;  4M4G A;  3UP9 A;  1MH3 A;  3PMV A;  1LFI A;  3GBA A;  3GZG A;  1JW1 A;  1MQI A;  1L5T A;  3MBP A;  4YKP A;  4ZEC A;  4R2F A;  1XS5 A;  3PUV E;  2NWJ A;  1MXW A;  3B6T A;  3CSG A;  2O69 A;  3S4U A;  2PX1 A;  4LP2 B;  1DTG A;  4OWD A;  3T93 B;  3C32 A;  1Y9U A;  2Y7K A;  4RY1 A;  2XX9 A;  3FAT A;  1H76 A;  3TAJ A;  2QMW A;  5DVI A;  3RN8 A;  2F6P A;  1B1X A;  5FHM A;  1TFA A;  5ITP A;  1T0K A;  4BDR A;  2H4I A;  2AL5 A;  4IGR A;  3C33 A;  4DIG A;  4IO5 A;  4G8M A;  4O3B A;  4NF8 A;  4R6H A;  5FTI A;  3UOR A;  3CVG A;  5I58 A;  4C0R A;  2YJP A;  1XOC A;  1JQF A;  1B7U A;  3D4G A;  2V25 A;  3O66 A;  3PUX E;  4G8H A;  3OO8 A;  4OYV A;  3DP4 A;  3MUQ A;  3LSW A;  3KEI A;  1B4H A;  4KQP A;  1M5B A;  2HQ0 A;  3SET A;  1S9T A;  3FIR A;  1B05 A;  1Y4T A;  1SW1 A;  2VD3 A;  2OBG A;  3JYR A;  1IQ7 A;  4LA9 A;  1OVT A;  1ZKB A;  4H5F A;  3MPL A;  2HXW A;  5TPA A;  1AH5 A;  4ESW A;  4OEV A;  3S9E A;  2H9B A;  4P0G A;  4XKR A;  1GGG A;  1JVY A;  2QS4 A;  5I84 A;  3U93 A;  2GHA A;  1MXV A;  4OMB A;  3A3U A;  3T9U A;  2E1S A;  3V83 A;  3PU5 A;  2D21 A;  5ITO A;  4OER A;  1O7T A;  3H06 B;  4R73 A;  5KCJ A;  4EF2 A;  1SYH A;  4OFO A;  3H6T A;  1FTL A;  4R6K A;  1MPD A;  5JTY A;  2XXW A;  3RNN A;  4GFR A;  3OO9 A;  3K6W A;  1MY0 A;  3K6X A;  3SKP A;  1TT1 A;  2RC7 A;  3ZKL A;  4JSD A;  1URD A;  4Z0I A;  2DOJ A;  3T9V A;  2FYI A;  4NMY A;  2X26 A;  4RA1 A;  4NF4 B;  2HZL A;  2V93 A;  1AL3 A;  3BBR A;  4XXU A;  2AL4 A;  3Q26 A;  1B40 A;  3KSX A;  1Z7N E;  5I2N A;  1KWH A;  2I48 A;  3FJG A;  2GHB A;  1LAH E;  1TFD A;  3KSJ A;  3CG3 A;  1MQH A;  1FQA A;  4YMA A;  1A8E A;  3EPE A;  2Q8J A;  1B51 A;  3K1M A;  4YKI A;  4NF6 A;  2R71 A;  1MXX A;  1UTB A;  4LUB A;  4QF9 A;  3W9V A;  1USY E;  2CZL A;  4AB6 A;  2ZYM A;  1LAF E;  3PD9 A;  2ZMB A;  3S9N C;  5I2K B;  5IKB A;  3O6I A;  1DTZ A;  3K02 A;  3B6W A;  4HTG A;  3FUZ A;  2P2A A;  1Y20 A;  1WDN A;  4LQ2 A;  2GFE A;  4GIZ A;  5DEX A;  3A09 A;  1SBP A;  4LVQ A;  3V8X B;  4QSC A;  1H3D A;  2ESN A;  4XIG Q;  2VHA A;  2PT1 A;  1LBB A;  1SD3 A;  5KDT B;  3T9H B;  4FED A;  2AYS A;  1MPB A;  4OES A;  1ANF A;  3FGS A;  2G29 A;  3HCQ A;  4OEN A;  4MF3 A;  3OO7 A;  2V3U A;  1IEJ A;  1HSE A;  4E0W A;  4HCW A;  3MZB A;  3O28 A;  3KN3 A;  1QKA A;  4GLI A;  1I6B A;  1EH3 A;  3BKI B;  1UTH A;  2Q2C A;  4NED A;  5B7D A;  3FXQ A;  3USD A;  3TQL A;  4KD5 A;  3PUW E;  2GRV A;  4IO3 A;  1AIV A;  4U1O A;  1FTM A;  3DP8 A;  3FXR A;  3GBB A;  4F22 A;  4Q0C A;  4ZEB A;  5AA3 A;  4RJZ A;  1LCT A;  4NF8 B;  5K2Y A;  3MWB A;  4I62 A;  4JXI A;  5ELV A;  2DWH A;  1Q1K A;  2ONK E;  1MH4 A;  4YKK A;  3MVZ A;  4QFL A;  3FVG A;  1ZIU A;  2XX7 A;  4U21 A;  2XXH A;  2F8D A;  1FQE A;  4YB7 A;  4QSD A;  3VLW A;  1LB8 A;  3M3L A;  3FVO A;  2UVH A;  3N94 A;  4GF8 A;  3RUM A;  3LSL A;  1JNF A;  3FJ7 A;  3VE1 B;  2FA7 A;  4ISU A;  4RNS A;  1QUL A;  5TPA B;  4GXA A;  1IXG A;  4FEB A;  3FZV A;  4MFI A;  4X1B A;  2I49 A;  3O97 A;  3IJX B;  5K2X A;  1D9V A;  4RPO A;  4ELP A;  3QSL A;  4GOT A;  3ODB A;  1A54 A;  4U4X A;  3SDF A;  3HST A;  1ATG A;  1MM7 A;  1Y3N A;  2XXY A;  1D4N A;  2XXU A;  5DYH A;  1Q35 A;  2VD2 A;  3MVY A;  4G68 A;  4OXV A;  1SI0 A;  3UIF A;  4EUO A;  3TDJ A;  3H7M A;  3CIJ A;  4I1D A;  4R9F A;  4TLL B;  3QK6 A;  3WAF A;  4PFY A;  2X7P A;  4YB5 A;  3U92 A;  4R2B A;  1RYX A;  3I3V A;  4FEC A;  4KR5 A;  1VFE A;  4PQJ A;  4Z7E A;  2ZYN A;  3G7W A;  3PPO A;  5AA4 B;  2RCB A;  3V5A A;  1YCJ A;  2V84 A;  2Z22 A;  3KJ7 A;  3VDF A;  3EHU A;  3I5O A;  1B5J A;  5H8N B;  5I59 A;  2V3T A;  3ILT B;  3RTF B;  3C34 A;  3RLF E;  5F7V A;  2RC9 A;  1N7X A;  5I2N B;  2PMS A;  4RK2 A;  1B3E A;  3IL1 B;  3Q28 A;  3C31 A;  3SEX A;  1GTK A;  1HSJ A;  1XC1 A;  3DEL B;  4NF6 B;  1MQJ A;  3CRB A;  1BLF A;  2CMO A;  4LZ8 A;  1NMU A;  4AQ4 A;  3TEP A;  4ESX A;  5HM4 B;  4EQB A;  1MXZ A;  4QFN A;  4F3P A;  5EHS A;  4N07 A;  1NH7 A;  1M5C A;  1MRP A;  3LR1 A;  4E0X A;  3K1N A;  4OTE A;  4H67 A;  5ICQ A;  4JWX A;  3W9W A;  3TEL A;  5FHN A;  3HHF A;  3R26 A;  3KGC A;  4NF5 A;  4RYA A;  2G93 A;  1Z7M E;  2V3Q A;  5J1D A;  3FJM A;  1M5E A;  1GVC A;  4C1U A;  1BP5 A;  1QUK A;  1URS A;  4YB6 A;  3UA8 A;  4JWY A;  3EQ1 A;  4R72 A;  2QJE A;  4FE8 A;  3KFM A;  2UVJ A;  2UYF A;  3BFT A;  3N6U A;  4IB2 A;  1PBQ A;  4XKQ A;  2ZNU A;  3VXC A;  1SW2 A;  3H4Z A;  2DXY A;  3B6Q A;  1UTH B;  1B9J A;  1QKB A;  2UVG A;  4ZE8 A;  3MP6 A;  3IOR A;  2YLN A;  4F1Y A;  4YIC A;  3EHS A;  3O6G A;  1Y4C A;  4LZ7 A;  1LAX A;  2A5T B;  2ZNT A;  4X1D A;  1UIV A;  2F7A A;  1CB6 A;  4ZEK A;  1LCF A;  2QSX A;  2H99 A;  2FNC A;  3H6W A;  4KCD A;  3PD8 A;  4M1V A;  2HEU A;  2P0S A;  1QW0 A;  4JDF A;  3TCF A;  5L9M A;  3QUF A;  3CSB A;  4F39 A;  2HCA A;  4JBZ A;  4DXB A;  2HAV A;  3C9H A;  1TXF A;  2ZYO A;  2XXT A;  2ZYK A;  4QHQ A;  3O29 A;  4H8J A;  1ELJ A;  4BDQ A;  3SES A;  3O9P A;  1LGB C;  4LON B;  4F2O A;  4YMB A;  4GVO A;  1RYO A;  3CFX A;  5I57 A;  3M3K A;  2XD3 A;  1B3L A;  5H8H B;  3MW0 A;  3S9M C;  1ZBM A;  3ZKK A;  4DXC A;  4GL8 A;  4TLM B;  2REJ A;  4I9D A;  1NNT A;  4P11 A;  5L8D A;  1TWY A;  3ECR A;  1AOV A;  2XD2 A;  3N6T A;  3IR1 A;  1XVY A;  4G68 B;  1A99 A;  2W7Y A;  4ECF A;  2KLF A;  1MDQ A;  4YZZ A;  4ZDM A;  1VE4 A;  2QS1 A;  2UYE A;  2O1L A;  3IB0 A;  4ZEF A;  3S2V A;  4G2Z A;  4OZ9 A;  2O51 A;  3CG1 A;  2O68 A;  4FAT A;  4U23 A;  2XX8 A;  2DWJ A;  4U2R A;  4H1X A;  3G3F A;  5B70 A;  1P1W A;  3UN6 A;  1B0H A;  2OWS A;  1LBC A;  1B3H A;  2PYY A;  3C36 A;  1UQW A;  5AA1 A;  3EN3 A;  3EF7 A;  2Y84 A;  3GXA A;  4F3B A;  2ONS A;  3KOT A;  1N7W A;  1GR2 A;  5ISU A;  4KFQ A;  1B0L A;  1SQY A;  4NWD A;  3MVX A;  1Y3Q A;  5CRY A;  1IUD A;  2NUV A;  3E3K A;  1D9Y A;  3R6U A;  1S50 A;  3G3J A;  1FQF A;  2H25 A;  4DLD A;  3LUY A;  4F1V A;  3TTM A;  3MP1 A;  1A55 A;  4FOR A;  1FQC A;  5CBS A;  2RCA A;  3TOD A;  5EYF A;  1B3G A;  2O7U A;  3O6H A;  4ZZE A;  1B1H A;  1FTJ A;  1M5D A;  2R6G E;  3L6G A;  4F19 A;  4IO4 A;  4WEP A;  1USY H;  4KCC A;  1WOD A;  3B7D A;  2A5S A;  4NWC A;  1MXU A;  3N5L A;  1MY3 A;  1B58 A;  4DZ1 A;  5L9O A;  2ANJ A;  3KBR A;  1LB9 A;  2H5Y A;  2PBW A;  5I56 A;  2O1M A;  4H0W A;  3MZ9 A;  2Y7R A;  1NFT A;  3MQ9 A;  4ONY A;  2OWT A;  5DVF A;  4EQ9 A;  2I0B A;  4EF1 A;  4G8N A;  3VV5 A;  3CFZ A;  3PPR A;  1Y1Z A;  5LOM A;  4DDD A;  3RT6 B;  3QUJ A;  3HO7 A;  4F3G A;  2Q9T A;  3VVF A;  3K1P A;  3OO6 A;  1AMF A;  3DLN A;  3K6U A;  4KI0 E;  1OVB A;  4RPN A;  4NTL A;  1MXY A;  4PE5 B;  3ZS6 A;  5JEI A;  5HBC A;  4G77 A;  1EZ9 A;  3I6V A;  2ONR A;  3HN0 A;  1EU8 A;  4XKP A;  1N0T A;  1YAE A;  3IOU A;  1FCK A;  5I58 B;  1DOT A;  2DVZ A;  3FD3 A;  3TMG A;  3ONM A;  3TTR A;  2F35 A;  3JV9 A;  2F7C A;  4G4P A;  4ZEI A;  1P1Q A;  1US5 A;  2UXA A;  1FQB A;  4PFW A;  1ZU0 A;  1OLA A;  4XTC Q;  1FW0 A;  3U8Q A;  2X7Q A;  4Q30 B;  2DE4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...