3G3GA

Crystal structure of the glur6 ligand binding domain dimer k665r mutant with glutamate and nacl at 1.3 angstrom resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
256
structure length
253
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 84
structure length 253
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3gA02
5EHMA 3VLUA 2Y7IA 4XTCQ 1FQEA 3QUJA 2QS2A 3T9HB 4IO4A 2Z8DA 2Y84A 4C1TA 2ABHA 3PPPA 4DCYA 3B6TA 2REJA 2O51A 3TFLA 5KCJA 3V5AA 3SEYA 3TQWA 1EH3A 4F2OA 3MVYA 4NMYA 2I48A 3USDA 3CI8A 1OLAA 3Q27A 3HSTA 4G8HA 4Q0CA 4C1UA 4AB6A 4LA9A 1UQWA 1B3FA 1PC3A 4F1UA 4ZE8A 5DVFA 3S9EA 4AB5A 1N84A 1Z7NE 1Q1KA 5ICQA 3ZKLA 2I58A 4ZE9A 5HM4B 3TMGA 1A8FA 2I3VA 3CRBA 4IO5A 4KPTA 4KYSA 5FTHA 5DYHA 1P1NA 3TCFA 3H3GA 1J1NA 2M8CA 1UTBA 2DS9A 1XS5A 2RKMA 5TU0A 5I58A 4RY1A 2OLBA 1BKAA 4U4SA 4FORA 1N0TA 4JBZA 4ZZAA 4THIA 3H03A 2I49A 1FQBA 5A5XB 1QKAA 2Q8JA 3GBAA 3C9HA 3ECRA 2QMXA 3V89B 2RCAA 1B05A 4IY6A 4UACA 1MXYA 3MPKA 1Y20A 3QSLA 4XKQA 4R9GA 1O7TA 3OEKA 3KN3A 3LSFB 1LSTA 1GGGA 2E1SA 3TQLA 5AA4A 4XKPA 3T22A 5DVJA 4G68B 4JWYA 2XX9A 1YAEA 3UIFA 3C4MA 3TPAA 1KWHA 5LOMA 4NEDA 4I1DA 4GF8A 3OMBA 1A40A 3PUVE 3UK4A 5FHOA 2P1SA 5M2VA 3O9PA 4PP0A 4OFJA 1DSNA 4F39A 4EQBA 1A55A 1YPNA 2Q2AA 3VFJA 3TTRA 4YB6A 4U21A 2VP1A 3KN7A 4X1BA 1I6BA 2UXAA 4ZDMA 3C33A 3O6GA 4I62A 5I2NA 3FXRA 1WDNA 2F7AA 4XKNA 1M5CA 1MQIA 2YPNA 2H5YA 3IAZA 4FEDA 4PFUA 3VDFA 1R9LA 3MP1A 3TKDA 4QSDA 1P1UA 1B7ZA 5JTYA 3PPRA 1A99A 1MM7A 4NF4A 3EHUA 5L8DA 4RJZA 3FVGA 3DM0A 1JVXA 5ICTA 1B40A 1FQDA 5CMKA 2F97A 2DWAA 3KZGA 4X1DA 3R26A 1MPDA 2VD3A 3U94A 5I2KB 3KJTA 3PMXA 1QKBA 5H8NA 3D4CA 1NH7A 4IO7A 2AYSA 4PETA 2OBGA 1JW1A 4LONB 3I6VA 1JVYA 4LZ8A 3UN6A 3PU5A 5CBRA 5H8FA 3IJOB 2QPQA 1CB6A 1LCFA 1JNFA 1H44A 2O1MA 1B6HA 2GHAA 4ZEIA 5I56A 1LBBA 3VLWA 2F5XA 3LSWA 4N07A 3H6WA 2H98A 1MY1A 3F11A 3VXCA 2ZXTA 2I0CA 4YU0A 3MVWA 3G3FA 3ZSFA 5AA2D 2RF1A 3VV5A 1XHYA 1B9JA 4IO6A 1YTVA 3IOTA 4G2ZA 3K1PA 3OO8A 3PMWA 3C32A 3JV9A 2X7PA 5F1QA 1TFAA 1TT1A 1XVXA 3VXBA 2R6GE 4DZ1A 4TLMB 4G77A 2REGA 5TP9A 1B0LA 2O7IA 3K6UA 4F3BA 2QMWA 4U1ZA 4X48A 1XVYA 3IK6B 4WEDA 1H76A 3IB0A 2AL4A 3EF7A 3H7MA 4NF6A 4HW8A 1UIUA 1MH3A 3CFZA 2GHBA 1VSOA 4RA1A 1MY0A 1H3DA 3MQ9A 3CVGA 4U2RA 4BDMA 4EF1A 2W7YA 4OQOA 3RT8A 3A3CA 3KSXA 3GZGA 4R2BA 2DXRA 1SYHA 3IORA 1L5TA 4LQ5A 5B70A 3H4ZA 5B7DA 4GIZA 3RTWB 4ZEFA 4AQ4A 3K2DA 2YLNA 2DE2A 3OSQA 2DXYA 4HS7A 1MPBA 4JB7A 3T9XB 4POXA 1MXXA 3W15C 4I9DA 4ZECA 3KJ7A 2H99A 3MZBA 1N7XA 3SDFA 3S9LC 2QS4A 1FQCA 3FD3A 3PV0E 3T66A 4G68C 4GD5A 2ALUA 3HN0A 3MW0A 1JETA 3K1NA 1OIBA 5L9SA 4QHQA 3M3KA 3RTFB 1SD3A 1SW4A 2G29A 1US4A 4ELOA 5KDTA 2HZLA 4QFOA 3FGSA 4GRKA 4HCWA 3K1MA 4WXJA 4H6DA 3ONMA 3PUXE 5DEXB 3IJXB 5IKBA 1D3KA 3KG2A 1ZBMA 4OFOA 1N7WA 1FW0A 5HPQA 4R6KA 4JWOA 1M5BA 4MH5A 4ZEBA 3M3LA 3N94A 3LR1A 4KFQA 1NNKA 3MJNA 2NXOA 1MQHA 3C36A 3WAFA 1B3GA 4MLQA 3IB2A 4ELQA 4OESA 3OSRA 2F78A 3K6WA 4DE8A 1S9TA 4FIMA 2Y7WA 4N13A 4OMBA 1AIVA 3DP8A 3FVOA 2Q9TA 4KYDA 3VE1B 2UVGA 3V83A 1R9QA 5CMCA 4G8NA 4FATA 2F8DA 1D4NA 1MXUA 2CZLA 4BDRA 1AH5A 3SEXA 4LATA 2RC8A 3P7IA 3SEWA 3FVKA 4ZZEA 2DVCA 1SI1A 4NWDA 3HCQA 2QL3A 4XIGQ 2XX7A 4BDOA 1ZJLA 4KQPA 4MLVA 3E13X 4P11A 1IIWA 2V25A 1POY1 3QXMA 2XXXA 4GXAA 4GFRA 4JSDA 3SERA 4F18A 1MXVA 1P1OA 1QUKA 1N3WA 4EDPA 4DXBA 2QRYA 2A5TA 4P0GA 5CBSA 1QJMA 2A5SA 3O6HA 4X9TA 2DVZA 3THIA 5CM6A 5FHMA 4H5GA 1JEVA 2F7CA 3DP4A 4EXKA 2RC7A 3KFMA 2Q88A 2HCAA 1USYH 1B46A 2O1LA 4N6PA 3T93B 1B1XA 1D9YA 1LB9A 1B0HA 1A54A 2DE3A 1DMBA 4ELPA 4ZS9A 4KCDA 1NL5A 3GLBA 1LB8A 1IXGA 4NF8B 4EUOA 2ONSA 4G8MA 1Y4CA 1LAHE 1B5JA 4OYVA 2Z22A 3N6UA 3TTNA 1II5A 3LUYA 4E0WA 4YKPA 1MRPA 5TPAB 1B4HA 2NVUB 5KCJB 3KEIA 5K2YA 2X26A 1B3EA 4U1OA 5I2KA 1B58A 3FVNA 4MFIA 2O6AA 1LBCA 3KOTA 2H25A 2ZNTA 2HXWA 4DXCA 1FQFA 4DXUA 2O68A 3MUQA 5DTBA 4OXVA 2VGQA 3O29A 1MY3A 2DYXA 4R6YA 1A7LA 2KLFA 3MVZA 4OEVA 5L9MA 1JQFA 4GXSB 3VLVA 1I6QA 2THIA 4F3GA 4IO2A 2H4IA 1B2HA 3HHGA 1BP5A 3KGCA 3MBPA 4KD5A 4YZZA 3FUZA 4F3PA 1WVJA 4R75A 3IOWA 4R6HA 2IA4A 3S4UA 3QK6A 4RK2A 4NWCA 2RC9A 2ONKE 3HV1A 3G3IA 3UGWA 1I69A 5AA2B 4QRZA 1LAFE 1EZOA 3O28A 1DPPA 2I6EA 1BLFA 1URGA 4FE8A 1B32A 3A09A 4P0IA 1LFHA 2UVHA 3TELA 1QUIA 3B7DA 1SYIA 3G3JA 3QIMA 3MP8A 1FTMA 1S50A 3PPOA 3E4RA 1O63A 1RKMA 1QVSA 4DIGA 2PVUA 1B3HA 1OMPA 3U72A 4GL8A 2XXPA 2HAVA 4EQ9A 1BTJA 3PUWE 4FJPA 4M4GA 3JZJA 2QJEA 1O64A 3R7XA 2HEUA 4POWA 3MAMA 3FXUA 1P99A 3MVXA 3IR1A 2GRVA 1HSEA 1QULA 1MDP1 1LCTA 1P1WA 4OVJA 2Y7RA 4RK9A 2D3IA 2NUVA 3S9NC 4GQOA 3W9WA 1QW0A 2UYEA 4BDLA 1DOTA 4H65A 2ZYMA 5ITPA 1N76A 2XXYA 3RT6B 5EHSA 4ONYA 2YJPA 3U1OA 3OELA 4F1VA 3K01A 4EQ7A 5CMMA 5AE4A 2DSFA 1VE4A 4F2QA 1XT8A 2P0SA 1GR2A 1UIVA 3G7WA 5I2NB 3EN3A 1FQAA 4YKKA 2XX8A 2CMOA 1POTA 4K3FA 2ESNA 4PFWA 4DDDA 3C35A 4OHNA 3GBBA 5F7VA 1XC1A 4PFTA 3PMVA 4NF4B 4PE5B 3H6TA 1FCKA 3W9VA 1Z7ME 4O3BA 1SW2A 1B7UA 4ZEDA 4R74A 4NF5A 1LFIA 1AMFA 1NFTA 1B1HA 1B7HA 3FZVA 1MXZA 3K6XA 5BUUA 2WKYA 4FEBA 5H8HB 4F22A 3T9UA 1B51A 2I4BA 1UTHA 4ESWA 5H8NB 1F9BA 3HPIA 3TYHA 3CG1A 1Y1ZA 3TCHA 4FAJA 1TWYA 3CR9A 3MWBA 2D21A 1B4ZA 4C0RA 1AOVA 1NNPA 1IQ7A 3I5OA 5DVIA 2XHDA 4ELRA 2Z23A 5H8FB 1Y3QA 1A8EA 4QFPA 4JSOA 3OO7A 3PPQA 1RYOA 2Z8EA 3PD9A 5I59B 1WODA 4ZEKA 4IGRA 5AA3A 2AIXA 4EF2A 3RN8A 4ECFA 5CMBA 4YB7A 4YMBA 4GL0A 4IO3A 1Q35A 3FV1A 4LZ5A 2PX1A 3G3KA 1ZIUA 2PMSA 3PUYE 3RUMA 2I3WA 4YAHX 1VFDA 2XXHA 2GFEA 3M3FA 5L9OA 3OD7A 2H9BA 2F6PA 5H8QB 2B65A 3C34A 4R72A 2DP8A 1ZU0A 3ILUB 4IB2A 1DTZA 1JW4A 4F29A 3IOUA 1P1QA 3IO6A 2NOOA 4KCCA 1FTKA 1EZ9A 3B6WA 3BFTA 3IB1A 2ANJA 5I57B 4XKRA 1Y1MA 2OK2A 4GWOA 3TDJA 4BDQA 1PDAA 2QSXA 3KOSA 1SW1A 5AA1A 3OO9A 4HCYA 3I3VA 4GLIA 4Q30B 4NF6B 1R6ZA 3B6QA 3LSXA 3U8QA 1IXIA 4RXLA 3VVEA 3R6UA 4PQJA 2UYFA 3RY3A 2FA7A 1M5DA 4RYAA 1EU8A 1LGBC 1IXHA 3JYRA 1ELJA 1R1NA 2B3BA 5A5XA 3Q26A 4DCXA 3OOAA 4LP2B 3S2VA 2ZYNA 3ODBA 3N5LA 4NF8A 1GV8A 4U22A 3TTKA 5ITOA 1DTGA 3KBRA 4YMAA 3VVDA 1I6AA 3TEPA 5TPAA 2X7QA 3RPWA 1USYE 3CSBA 4G68A 2Y7KA 4GOTA 4QFLA 2R71A 3L6GA 3QUFA 2PT2A 2RINA 3CFXA 3RQTA 3SEVA 2QS1A 2LAOA 4XXUA 1SDXA 3FATA 1NNFA 3IO4A 5BWJA 3M8UA 3MPLA 4UA8A 2F34A 3O2AA 4TLLB 3G3HA 4LZ7A 5HBCA 4H0WA 1IEJA 1B5HA 2P2AA 4F1YA 3N6TA 4OERA 1M5EA 2VD2A 5KDTB 2DWIA 5J1DA 4ESXA 4HTGA 2XXTA 1MQJA 1ZTYA 2AL5A 4YKIA 4RPOA 2BJJX 3H06B 3SEUA 1LAXA 4H8IA 5DT6A 3E9XA 2DWJA 1T0KA 2DE4A 3TCGA 3PGFA 2G93A 3CG3A 4ISUA 2XXVA 3ZKKA 5AA2A 1TFDA 4KI0E 1OLCA 2PBWA 4R73A 2PYYA 3EQ1A 1GTKA 1URSA 5JEIA 4BDNA 2QS3A 1BIYA 1LAGE 4O3CA 3SETA 1PBQA 3SKPA 4OTEA 1H45A 3A3UA 1N3XA 1ZMGA 2O7UA 1PB7A 3O97A 3H6VA 3GXAA 3HHFA 3EHTA 1LLSA 4I8CA 2OZZA 2V3TA 2ZMBA 1HSJA 2ZYOA 3OENA 2UVIA 1PB8A 3CSGA 3RGYA 3K0VA 2VHAA 4OEUA 3OXNA 3FJMA 2XD3A 1B52A 2HQ0A 3FV2A 4WKMA 4QSEA 4FECA 1ANFA 5H8SA 2I4CA 1QUJA 4YKJA 4QFNA 2O69A 5JK4A 3PD8A 3VVFA 4H1XA 1SW5A 4NE4A 3MZ9A 2V84A 3K6VA 1MQGA 1EZPA 5K2XA 1B5IA 1UTBB 2A5TB 3FXQA 2XXQA 3K02A 3Q29A 5I58B 2Q89A 1MXWA 2F7BA 3TZAA 1FTOA 1MH4A 3RLFE 3BBRA 3C31A 2HAUA 2Y7PA 5CC2A 3HO7A 4LQ2A 1Y9UA 2UVJA 2Q2CA 3LSLA 4DLDA 2Z8FA 3MZ1A 3FASA 2PT1A 2XXIA 3BKIB 4H8JA 3UP9A 4OENA 3PUZE 1B3LA 5FTIA 4YB5A 3H6UA 1Y4TA 3MC2A 1YCJA 1M5FA 3N26A 4U23A 1VFEA 1ATGA 3PPNA 5AA4B 5H8HA 3IL1B 2O84X 2V3QA 2OCUA 1DPEA 4Q5TA 2HFBA 1MS7A 4JDFA 4JWXA 4QFKA 1NH8A 1MM6A 1SVXB 3L6HA 1TXFA 3EPEA 3EHSA 1IZ1A 4MF3A 4YICA 4QF9A 2OJTA 2B3FA 2FNCA 2ZYKA 2V93A 4H67A 2DWHA 4Q8RA 3DELB 4OFLA 1OQHA 3ZS6A 4IY5A 5I59A 2FYIA 3KSJA 3K4UA 4RPNA 4PFYA 2IEEA 1OVTA 3WAEA 3FIRA 3Q25A 1SI0A 1RYXA 1MQDA 4L17A 2F36A 1FTLA 1MPCA 1SQYA 5IAIA 3LC8A 3Q28A 4RNSA 1CE2A 2V3UA 2XXRA 1SBPA 5H8QA 5JTYB 2RCBA 5CI5A 2DOJA 3FJ7A 5ISUA 4F31B 2XXWA 4LVQA 2XXUA 1PEBA 1IUDA 1S7YA 3TODA 1H43A 5I57A 1D9VA 3QYTA 4OETA 2D5WA 3G3GA 2ZNUA 5ELVA 1OQGA 5DEXA 2F6GA 3U93A 3UORA 2OWTA 3V8XB 1OVBA 1PB9A 1IITA 2F35A 5KZTA 2R9JA 4EXLA 2ONRA 4ND9A 1JW5A 1IXCA 3MP6A 1PBPA 1AL3A 1MG1A 2OWSA 4IGTA 1ZLQA 1URDA 4M1VA 3OO6A 1NMUA 3IX1A 3O6IA 3IOVA 3QAXA 3TTLA 4MBPA 3UA8A 4H5FA 4BLAA 1GVCA 5I56B 3TUSA 4R9FA 2E0SA 3AXFA 1VR5A 3OEMA 4TQUQ 5EYFA 4F3SA 3FJGA 1US5A 3TAJA 1JEUA 4E0XA 2HZKA 5CRYA 2XD2A 3CIJA 4Z0IA 2ZNSA 3SESA 4R2FA 3RNNA 4KR5A 3E3KA 4KYEA 4NTLA 3BFUA 1NKXA 2GH9A 1MDQA 3TTMA 1FTJA 3K00A 4KHZE 4QSCA 3T96B 1XOCA 5TP9B 1HSLA 5FHNA 3O66A 4GVOA 4JXIA 4OZ9A 1ZKBA 3D4GA 1MY4A 2NWJA 2I0BA 1NNTA 4OWDA 4NF5B 2VOZA 5I84A 3DP6A 3LBSA 3S9MC 2DQVA 4Z7EA 1N04A 1Y3NA 4O3AA 3U92A 3DLNA 1LFGA 4TOZA 4WEPA 1MY2A 3CFLA 1UTHB 3T9VA 3KN8A 3ILTB 4F19A 4LUBA 1Y3PA 4G4PA 4U4XA
chains in the Genus database with same CATH superfamily
2HHMA 5EHMA 4N8GA 3VLUA 2Y7IA 4XTCQ 1FQEA 3QUJA 2QS2A 3CHGA 3T9HB 4IO4A 2Z8DA 2Y84A 4C1TA 2ABHA 3PPPA 4DCYA 3B6TA 2Q8MA 2REJA 2O51A 4GWZA 3TFLA 5KCJA 3V5AA 3SEYA 1FPFA 4AS5A 1NV6A 3TQWA 1EH3A 4F2OA 1SPIA 4N6DA 3MVYA 4NMYA 2I48A 3USDA 3CI8A 1OLAA 3Q27A 3HSTA 4G8HA 4Q0CA 4C1UA 4AB6A 4LA9A 1UQWA 1B3FA 1PC3A 4F1UA 4ZE8A 5DVFA 2HXRA 3S9EA 4N17A 4AB5A 1N84A 1Z7NE 1Q1KA 5ICQA 3ZKLA 2I58A 4ZE9A 2VPNA 5IM2A 5HM4B 3TMGA 1A8FA 2I3VA 3CRBA 4IO5A 4KPTA 4KYSA 5FTHA 5DYHA 1P1NA 3TCFA 3H3GA 1J1NA 2M8CA 1UTBA 2DS9A 1XS5A 2RKMA 5TU0A 5I58A 4PAKA 4RY1A 2OLBA 4GBVA 4MEVA 1BKAA 4PGPA 4HXVA 4U4SA 4FORA 4MNPA 1N0TA 4P3LA 4JBZA 4ZZAA 1D9QA 2WBDA 4THIA 3H03A 2I49A 1FQBA 5A5XB 1QKAA 2Q8JA 3GBAA 3C9HA 3ECRA 2QMXA 3V89B 2RCAA 1B05A 4IY6A 1INPA 1NV4A 4UACA 1LEVA 4MJOA 1MXYA 3MPKA 1Y20A 3QSLA 4XKQA 4R9GA 1O7TA 4XFEA 3OEKA 3KN3A 3LSFB 1NI9A 1LSTA 1GGGA 2E1SA 2P3NA 3TQLA 1IMEA 5AA4A 4XKPA 2P3VA 3T22A 4N15A 4MNIA 4PAFA 5DVJA 4G68B 2BJIA 4JWYA 4PFIA 2XX9A 1YAEA 3UIFA 3C4MA 3TPAA 1KWHA 5LOMA 4NEDA 4I1DA 4GF8A 3OMBA 1A40A 3PUVE 3UK4A 5FHOA 2P1SA 5M2VA 2MKZA 3O9PA 3PTYA 1EYKA 4O8MA 3GYYA 4PP0A 4OFJA 1DSNA 4F39A 4EQBA 1A55A 4KXPA 1YPNA 1RDYA 2Q2AA 3VFJA 2FVZA 3TTRA 4YB6A 4U21A 2VP1A 4HE2A 3KN7A 4X1BA 1I6BA 2UXAA 4ZDMA 3C33A 3O6GA 4I62A 5I2NA 1YYZA 3FXRA 1WDNA 2F7AA 4XKNA 1M5CA 1MQIA 2YPNA 2H5YA 3IAZA 4FEDA 2XWKA 3EKIA 4PFUA 3VDFA 1R9LA 3MP1A 4QSDA 1P1UA 3TKDA 1B7ZA 5JTYA 3PPRA 1RDZA 1A99A 4I3EA 1MM7A 4NF4A 3EHUA 5L8DA 4RJZA 3FVGA 2VPOA 2Q74A 3DM0A 1JVXA 5ICTA 1B40A 1FQDA 5CMKA 2F97A 2DWAA 3KZGA 4X1DA 3R26A 1MPDA 2VD3A 3U94A 5I2KB 3KJTA 1LBXA 3PMXA 1QKBA 5H8NA 2XWIA 3D4CA 1NH7A 4PC9A 4IO7A 5F24A 2AYSA 4PETA 2OBGA 1JW1A 4LONB 3I6VA 1JVYA 4LZ8A 2KQZA 3UN6A 4JVCA 2WBBA 3PU5A 5CBRA 5H8FA 3IJOB 2QPQA 1CB6A 1LCFA 1JNFA 1H44A 2O1MA 1B6HA 2GHAA 4ZEIA 5I56A 1LBBA 3VLWA 2F5XA 3LSWA 4N07A 2PFYA 3H6WA 2H98A 1MY1A 3F11A 3VXCA 2ZXTA 2I0CA 4YU0A 3MVWA 3G3FA 3ZSFA 5AA2D 4OA4A 2RF1A 2PCRA 1XHYA 3VV5A 1B9JA 4IO6A 1YTVA 3IOTA 3KC1A 4G2ZA 3K1PA 3OO8A 3PMWA 4H46A 3C32A 3JV9A 2X7PA 5F1QA 1TFAA 1TT1A 2OWZA 1XVXA 3VXBA 2R6GE 3HFUA 4DZ1A 4TLMB 3FXBA 4G77A 3KBZA 2REGA 5TP9A 1B0LA 1LBVA 2O7IA 3K6UA 4F3BA 4GWUA 2QMWA 4U1ZA 4X48A 1XVYA 2HPGA 3IK6B 1H76A 3IB0A 4NX1A 4WEDA 1KA0A 2AL4A 3EF7A 3H7MA 4GX3A 4NF6A 4HW8A 5I7IA 1UIUA 1MH3A 3CFZA 5IGAA 2GHBA 1VSOA 4RA1A 1MY0A 1H3DA 3MQ9A 3CVGA 4U2RA 4BDMA 4EF1A 2W7YA 4OQOA 4PTKA 3RT8A 3A3CA 3KSXA 3GZGA 4R2BA 1IMDA 2DXRA 1SYHA 3IORA 1L5TA 1NV3A 1FJ9A 4LQ5A 4GX6A 5B70A 4IR8A 3H4ZA 5B7DA 4GIZA 3RTWB 4ZEFA 4AQ4A 3K2DA 2YLNA 2DE2A 3OSQA 2DXYA 4HS7A 1MPBA 4JB7A 3T9XB 4POXA 1MXXA 1VDWA 3W15C 4I9DA 4ZECA 3KJ7A 2H99A 1LBWA 4MCOA 1DBZA 3MZBA 1N7XA 4GBWA 3SDFA 2CEXA 1IMBA 3S9LC 2QS4A 3RPLA 1FQCA 3FD3A 3PV0E 1KZ8A 3T66A 2WYPA 4G68C 4GD5A 2ALUA 3HN0A 3MW0A 1NV7A 1JETA 3K1NA 1Q9DA 1OIBA 5L9SA 4QHQA 3M3KA 3RTFB 4PAIA 1SD3A 1SW4A 2G29A 1YZ0A 1US4A 4ELOA 5KDTA 2HZLA 4QBAA 4QFOA 3FGSA 4GRKA 4HCWA 1FPLA 3K1MA 4WXJA 4H6DA 3ONMA 3PUXE 5DEXB 5IZZA 3IJXB 2JJKA 1D3KA 5IKBA 3LUZA 3KG2A 1ZBMA 4OFOA 1N7WA 1FW0A 5HPQA 4O94A 1FPGA 4R6KA 4JWOA 1M5BA 4MH5A 4ZEBA 3M3LA 3N94A 3ROJA 3LR1A 5I5PA 1NUYA 4KFQA 4N8YA 4FBPA 1NNKA 1FBDA 1QGXA 2NXOA 3MJNA 4JVDA 1MQHA 2DDKA 3C36A 3WAFA 1B3GA 4MLQA 3IB2A 4ELQA 4OESA 3OSRA 2F78A 3K6WA 4DE8A 1S9TA 4FIMA 4NQ8A 2Y7WA 4N13A 4OMBA 1AIVA 3DP8A 5ET6A 3FVOA 2F3DA 2Q9TA 4KYDA 4NG7A 3VE1B 2UVGA 3T0JA 3V83A 1R9QA 5IZ1A 5CMCA 4G8NA 4FATA 2F8DA 2XXKA 1D4NA 2ZZXA 1MXUA 2CZLA 4BDRA 1AH5A 3SEXA 4LATA 2RC8A 3P7IA 3SEWA 3FVKA 4I40A 4ZZEA 2DVCA 4GWYA 1DCUA 1SI1A 4NWDA 3HCQA 5ET7A 2QL3A 4XIGQ 2XX7A 4BDOA 1ZJLA 4DI4B 2QVRA 1FBGA 4KQPA 4MLVA 4OVTA 4P1EA 3E13X 4P11A 4PDHA 1IIWA 2V25A 5EQAA 1POY1 3QXMA 2XXXA 4GXAA 4MX6A 4GFRA 4JSDA 3SERA 4F18A 1MXVA 1P1OA 2V4CA 1FPBA 1QUKA 1N3WA 5IZ3B 4EDPA 4DXBA 2QRYA 2A5TA 4P0GA 5CBSA 3U65A 4MIJA 1QJMA 2A5SA 3O6HA 4X9TA 2DVZA 3THIA 5CM6A 5FHMA 4H5GA 1JEVA 2F7CA 3DP4A 4EXKA 2RC7A 3KFMA 2Q88A 2HCAA 1USYH 1B46A 2O1LA 4N6PA 3T93B 1B1XA 1D9YA 1LB9A 1B0HA 1A54A 4P1LA 2DE3A 1DMBA 4ELPA 4O7IA 4ZS9A 4KCDA 1NL5A 3GLBA 1LB8A 1IXGA 4NF8B 4EUOA 2ONSA 4G8MA 1Y4CA 1LAHE 1B5JA 1FPIA 4OYVA 2Z22A 3N6UA 3TTNA 1II5A 3LUYA 4E0WA 4YKPA 5FBPA 1MRPA 5TPAB 1B4HA 2NVUB 5KCJB 3KEIA 5K2YA 2X26A 1B3EA 4U1OA 2PFZA 5I2KA 5ESYA 1XI6A 1B58A 3FVNA 4MFIA 2O6AA 1LBCA 3D1RA 3KOTA 2H25A 2ZNTA 4HE0A 3KC0A 2HXWA 2FIXA 4DXCA 1FQFA 2O68A 5DTBA 3MUQA 4DXUA 4OXVA 4XEQA 2VGQA 3O29A 1NUXA 1MY3A 1DK4A 2DYXA 4R6YA 1A7LA 2KLFA 3MVZA 4OEVA 1FPJA 5L9MA 1JQFA 4GXSB 3VLVA 1I6QA 2THIA 4F3GA 4IO2A 4O7MA 2H4IA 1B2HA 3HHGA 1BP5A 3KGCA 3MBPA 4KD5A 4OVSA 4YZZA 3FUZA 4F3PA 1WVJA 4R75A 3IOWA 4R6HA 2IA4A 3S4UA 3QK6A 4RK2A 1G0HA 4NWCA 2RC9A 2WYKA 4PDDA 2ONKE 3HV1A 3SZPA 3G3IA 3UGWA 1I69A 5AA2B 5EYHA 4QRZA 1LAFE 1EZOA 3O28A 1DPPA 2I6EA 1BLFA 3B50A 2CZHA 1URGA 4FE8A 1B32A 3A09A 4P0IA 1LFHA 2UVHA 3TELA 1QUIA 3B7DA 1SYIA 3G3JA 3T1BA 3QIMA 4JVIA 3MP8A 1FTMA 1S50A 3PPOA 3E4RA 1O63A 1KA1A 4N91A 4X04A 1RKMA 1QVSA 4DIGA 2PVUA 2Y5LA 5T3JA 1B3HA 1OMPA 3U72A 4GL8A 2XXPA 2HAVA 4EQ9A 1BTJA 3PUWE 4FJPA 4M4GA 3JZJA 2QJEA 1O64A 3R7XA 3A29A 2HEUA 4POWA 3MAMA 3FXUA 1P99A 3MVXA 3IR1A 2GRVA 4DI3D 1HSEA 1QULA 1MDP1 1LCTA 1P1WA 4OVJA 2Y7RA 4RK9A 2D3IA 1IMFA 2NUVA 3S9NC 3E79A 4GQOA 4MAGA 3W9WA 1QW0A 4AS4A 2UYEA 4BDLA 1DOTA 4MHFA 4H65A 2ZYMA 5ITPA 1N76A 2XXYA 1FPDA 3RT6B 4OVRA 5EHSA 4MMPA 4ONYA 1LBZA 2YJPA 3U1OA 3OELA 4F1VA 3IFAA 3K01A 4EQ7A 5CMMA 5AE4A 2DSFA 1VE4A 4F2QA 1XT8A 2P0SA 1GR2A 1UIVA 3G7WA 5I2NB 3EN3A 1FQAA 2GQ1A 4P8BA 4YKKA 2XX8A 2CMOA 1POTA 4K3FA 2ESNA 4PFWA 2F3BA 4DDDA 3C35A 4OHNA 3GBBA 5F7VA 1XC1A 2B4LA 4HE1A 5EQ7A 4PFTA 1AWBA 3PMVA 3BIHA 1G0IA 4NF4B 4PE5B 1JP4A 3H6TA 1FCKA 3W9VA 4PFBA 1Z7ME 4O3BA 1SW2A 1B7UA 4ZEDA 2CEYA 4R74A 4NF5A 1LFIA 1AMFA 1NFTA 4QXDA 1B1HA 1NUWA 1B7HA 3FZVA 1MXZA 3K6XA 5BUUA 2WKYA 4FEBA 5H8HB 4F22A 3T9UA 1B51A 2I4BA 1UTHA 4ESWA 5H8NB 1F9BA 2CZIA 3HPIA 3TYHA 3CG1A 1Y1ZA 3TCHA 4FAJA 1TWYA 3CR9A 3MWBA 2D21A 1B4ZA 4C0RA 4GX4A 1AOVA 1NNPA 2QFLA 1IQ7A 3I5OA 5DVIA 2XHDA 4ELRA 2Z23A 5H8FB 1Y3QA 1A8EA 4QFPA 4JSOA 3OO7A 3PPQA 1RYOA 2Z8EA 3PD9A 5I59B 1WODA 4ZEKA 4IGRA 5AA3A 2AIXA 4EF2A 3E78A 3RN8A 4ECFA 5CMBA 4YB7A 4YMBA 4GL0A 4IO3A 1Q35A 3FV1A 4LZ5A 2PX1A 3G3KA 1ZIUA 2PMSA 3PUYE 4NHBA 3RUMA 2I3WA 4YAHX 1VFDA 2XXHA 2GFEA 4LN5A 3M3FA 5L9OA 3FBPA 3OD7A 2H9BA 3RYDA 4UABA 2F6PA 5H8QB 2B65A 3C34A 4R72A 1LBYA 2DP8A 1ZU0A 3ILUB 4IB2A 1DTZA 1JW4A 4F29A 3IOUA 1P1QA 3IO6A 2NOOA 4KCCA 1FTKA 1EZ9A 3B6WA 3BFTA 3IB1A 2ANJA 5I57B 4XKRA 5LTCA 1Y1MA 2OK2A 4GWOA 3TDJA 4BDQA 1PDAA 2QSXA 3KOSA 1SW1A 5AA1A 3OO9A 4HCYA 3I3VA 5EQ8A 4GLIA 1K9YA 5IZ3A 2R8TA 2FBPA 1NUZA 4Q30B 4NF6B 1R6ZA 3B6QA 4PCDA 3LSXA 3U8QA 1IXIA 4RXLA 3VVEA 5DW8A 3R6UA 4PQJA 2UYFA 3RY3A 2L5VA 2FA7A 3QMFA 4PBHA 1M5DA 4RYAA 1EU8A 1LGBC 1IXHA 3JYRA 1ELJA 4MNCA 1R1NA 2B3BA 5A5XA 3Q26A 4DCXA 3OOAA 4LP2B 3S2VA 2ZYNA 3ODBA 3N5LA 4NF8A 1GV8A 4U22A 3TTKA 5ITOA 1DTGA 1FJ6A 3KBRA 4YMAA 3VVDA 1I6AA 3TEPA 5TPAA 2X7QA 3RPWA 5ET8A 1USYE 3CSBA 4G68A 2Y7KA 4GOTA 4QFLA 2R71A 3L6GA 3QUFA 2PT2A 2RINA 3CFXA 3RQTA 3SEVA 2QS1A 2LAOA 3RPLB 4XXUA 1SDXA 1FSAA 3FATA 1NNFA 3IO4A 5BWJA 3M8UA 4UA8A 3MPLA 2F34A 3O2AA 4TLLB 3G3HA 4LZ7A 5HBCA 4H0WA 1IEJA 1B5HA 1FBFA 2P2AA 5EQ9A 4F1YA 3N6TA 4OERA 4XF5A 1M5EA 2VD2A 5KDTB 2DWIA 5J1DA 1NV0A 4ESXA 4HTGA 2XXTA 1MQJA 1ZTYA 2AL5A 4YKIA 4NGUA 4RPOA 4NF0A 2BJJX 3H06B 3SEUA 1LAXA 4H8IA 2ZZVA 5DT6A 3E9XA 2DWJA 1T0KA 2DE4A 3TCGA 1FBCA 3PGFA 2G93A 3CG3A 4ISUA 2XXVA 3ZKKA 5AA2A 1TFDA 4KI0E 1OLCA 2PBWA 4R73A 2PYYA 1EYJA 3EQ1A 1GTKA 1URSA 5JEIA 4BDNA 2QS3A 1BIYA 1LAGE 4O3CA 4P9KA 3SETA 5EYGA 1PBQA 2WEFA 3SKPA 4OTEA 1H45A 3A3UA 5I3SA 1N3XA 1ZMGA 2O7UA 1PB7A 3O97A 3H6VA 4OANA 3GXAA 3HHFA 3EHTA 1LLSA 1FBHA 4I8CA 2OZZA 2V3TA 2ZMBA 1HSJA 2ZYOA 3OENA 2UVIA 1PB8A 3CSGA 3RGYA 3K0VA 2VHAA 4OEUA 3OXNA 1FPKA 3FJMA 2XD3A 1B52A 2HQ0A 2B4MA 3FV2A 4WKMA 4QSEA 4FECA 4GWSA 1ANFA 5H8SA 2I4CA 1QUJA 4YKJA 4QFNA 2O69A 5JK4A 3PD8A 3VVFA 4H1XA 1SW5A 4NE4A 3MZ9A 2V84A 3K6VA 1MQGA 1EZPA 5K2XA 1B5IA 2FHYA 1UTBB 2A5TB 3FXQA 2XXQA 3K02A 3Q29A 5I58B 2Q89A 1MXWA 2XA5A 2F7BA 3IFCA 3TZAA 1FTOA 1MH4A 3RLFE 1YXIA 3BBRA 3C31A 4N6KA 2HAUA 2Y7PA 5CC2A 4PE3A 3HO7A 4LQ2A 1Y9UA 2UVJA 2Q2CA 3LSLA 4DLDA 2Z8FA 3MZ1A 3FASA 2PT1A 2XXIA 3BKIB 4H8JA 3UP9A 4OENA 3PUZE 1B3LA 5FTIA 4PF8A 4YB5A 3H6UA 1FPEA 1Y4TA 3MC2A 1YCJA 1M5FA 3N26A 4U23A 1VFEA 1ATGA 1FTAA 3PPNA 2CZKA 5AA4B 4X8RA 5H8HA 3IL1B 2O84X 2V3QA 2OCUA 3LV0A 4Q5TA 1DPEA 2HFBA 1CNQA 1MS7A 4JDFA 4JWXA 4QFKA 1NH8A 1MM6A 1SVXB 4NAPA 4I3YA 3L6HA 1TXFA 3EPEA 3EHSA 1IZ1A 2QVUA 4MF3A 4YICA 2QVVA 4QF9A 2OJTA 2B3FA 2FNCA 2ZYKA 2V93A 1EYIA 4H67A 2DWHA 4Q8RA 3DELB 4OFLA 1OQHA 3ZS6A 4IY5A 5I59A 2FYIA 3KSJA 3K4UA 4RPNA 4PGNA 2ZZWA 4PFYA 2IEEA 1OVTA 2Y5KA 3WAEA 3FIRA 3Q25A 1SI0A 1RYXA 1MQDA 4L17A 4OVPA 2F36A 1FTLA 1MPCA 1SQYA 5IAIA 3LC8A 3Q28A 5A5LA 4RNSA 1CE2A 2V3UA 4PBQA 2XXRA 1SBPA 5H8QA 5JTYB 2RCBA 1NV5A 4G61A 5CI5A 2DOJA 3FJ7A 5ISUA 4F31B 2XXWA 4LVQA 1IMAA 2XXUA 1PEBA 1IUDA 2XWVA 1S7YA 3TODA 4GWWA 1H43A 4GWXA 5I57A 1D9VA 3QYTA 3NOHA 1IMCA 4OETA 2D5WA 3G3GA 2ZNUA 4P47A 5ELVA 2FIEA 1OQGA 5DEXA 2F6GA 3U93A 3UORA 2OWTA 2WX9A 3V8XB 1OVBA 4N4UA 1PB9A 1IITA 1FBPA 2F35A 4P56A 2OX3A 5KZTA 2R9JA 4EXLA 5J16A 2ONRA 4ND9A 1JW5A 1IXCA 1NV2A 3MP6A 1PBPA 2XWOA 1AL3A 1MG1A 3ISPA 2OWSA 4IGTA 1URDA 1ZLQA 3MYUA 4M1VA 3OO6A 1NMUA 3IX1A 2VT5A 4PF6A 3O6IA 3IOVA 3QAXA 3BIGA 3TTLA 4MBPA 3UA8A 4H5FA 4BLAA 1GVCA 5ET5A 5I56B 5LDZA 3TUSA 4R9FA 2E0SA 3AXFA 1VR5A 3OEMA 4OVQA 4N81A 4TQUQ 1BK4A 2KR0A 5EYFA 4F3SA 3FJGA 1US5A 3TAJA 1JEUA 4E0XA 2HZKA 5CRYA 2XD2A 3CIJA 4NN3A 1FBEA 4Z0IA 2ZNSA 3SESA 1FRPA 4R2FA 3RNNA 4KR5A 3E3KA 4PFRA 4KYEA 4NTLA 3BFUA 1NKXA 2GH9A 1MDQA 3TTMA 1FTJA 4H45A 3K00A 4KHZE 4QSCA 3T96B 1XOCA 5TP9B 1HSLA 5FHNA 3O66A 4GVOA 4JXIA 1RDXA 4OZ9A 1ZKBA 3D4GA 1K9ZA 1MY4A 2NWJA 2I0BA 1NNTA 4OWDA 4NF5B 2VOZA 5I84A 3DP6A 3LBSA 3S9MC 2DQVA 4Z7EA 1N04A 1Y3NA 4O3AA 3U92A 3DLNA 4TOZA 4WEPA 1LFGA 1MY2A 3CFLA 1UTHB 3T9VA 3KN8A 1NV1A 3ILTB 4F19A 4LUBA 1Y3PA 3B8BA 3MSTA 4G4PA 4U4XA
chains in the Genus database with same CATH topology
5EHMA 3VLUA 2Y7IA 4XTCQ 1FQEA 3QUJA 2QS2A 3T9HB 4IO4A 2Z8DA 2Y84A 4C1TA 2ABHA 3PPPA 4DCYA 3B6TA 2REJA 2O51A 3TFLA 5KCJA 3V5AA 3SEYA 3TQWA 1EH3A 4F2OA 3MVYA 4NMYA 2I48A 3USDA 3CI8A 1OLAA 3Q27A 3HSTA 4G8HA 4Q0CA 4C1UA 4AB6A 4LA9A 1UQWA 1B3FA 1PC3A 4F1UA 4ZE8A 5DVFA 3S9EA 4AB5A 1N84A 1Z7NE 1Q1KA 5ICQA 3ZKLA 2I58A 4ZE9A 5HM4B 3TMGA 1A8FA 2I3VA 3CRBA 4IO5A 4KPTA 4KYSA 5FTHA 5DYHA 1P1NA 3TCFA 3H3GA 1J1NA 2M8CA 1UTBA 2DS9A 1XS5A 2RKMA 5TU0A 5I58A 4RY1A 2OLBA 1BKAA 4U4SA 4FORA 1N0TA 4JBZA 4ZZAA 4THIA 3H03A 2I49A 1FQBA 5A5XB 1QKAA 2Q8JA 3GBAA 3C9HA 3ECRA 2QMXA 3V89B 2RCAA 1B05A 4IY6A 4UACA 1MXYA 3MPKA 1Y20A 3QSLA 4XKQA 4R9GA 1O7TA 3OEKA 3KN3A 3LSFB 1LSTA 1GGGA 2E1SA 3TQLA 5AA4A 4XKPA 3T22A 5DVJA 4G68B 4JWYA 2XX9A 1YAEA 3UIFA 3C4MA 3TPAA 1KWHA 5LOMA 4NEDA 4I1DA 4GF8A 3OMBA 1A40A 3PUVE 3UK4A 5FHOA 2P1SA 5M2VA 3O9PA 4PP0A 4OFJA 1DSNA 4F39A 4EQBA 1A55A 1YPNA 2Q2AA 3VFJA 3TTRA 4YB6A 4U21A 2VP1A 3KN7A 4X1BA 1I6BA 2UXAA 4ZDMA 3C33A 3O6GA 4I62A 5I2NA 3FXRA 1WDNA 2F7AA 4XKNA 1M5CA 1MQIA 2YPNA 2H5YA 3IAZA 4FEDA 4PFUA 3VDFA 1R9LA 3MP1A 3TKDA 4QSDA 1P1UA 1B7ZA 5JTYA 3PPRA 1A99A 1MM7A 4NF4A 3EHUA 5L8DA 4RJZA 3FVGA 3DM0A 1JVXA 5ICTA 1B40A 1FQDA 5CMKA 2F97A 2DWAA 3KZGA 4X1DA 3R26A 1MPDA 2VD3A 3U94A 5I2KB 3KJTA 3PMXA 1QKBA 5H8NA 3D4CA 1NH7A 4IO7A 2AYSA 4PETA 2OBGA 1JW1A 4LONB 3I6VA 1JVYA 4LZ8A 3UN6A 3PU5A 5CBRA 5H8FA 3IJOB 2QPQA 1CB6A 1LCFA 1JNFA 1H44A 2O1MA 1B6HA 2GHAA 4ZEIA 5I56A 1LBBA 3VLWA 2F5XA 3LSWA 4N07A 3H6WA 2H98A 1MY1A 3F11A 3VXCA 2ZXTA 2I0CA 4YU0A 3MVWA 3G3FA 3ZSFA 5AA2D 2RF1A 3VV5A 1XHYA 1B9JA 4IO6A 1YTVA 3IOTA 4G2ZA 3K1PA 3OO8A 3PMWA 3C32A 3JV9A 2X7PA 5F1QA 1TFAA 1TT1A 1XVXA 3VXBA 2R6GE 4DZ1A 4TLMB 4G77A 2REGA 5TP9A 1B0LA 2O7IA 3K6UA 4F3BA 2QMWA 4U1ZA 4X48A 1XVYA 3IK6B 4WEDA 1H76A 3IB0A 2AL4A 3EF7A 3H7MA 4NF6A 4HW8A 1UIUA 1MH3A 3CFZA 2GHBA 1VSOA 4RA1A 1MY0A 1H3DA 3MQ9A 3CVGA 4U2RA 4BDMA 4EF1A 2W7YA 4OQOA 3RT8A 3A3CA 3KSXA 3GZGA 4R2BA 2DXRA 1SYHA 3IORA 1L5TA 4LQ5A 5B70A 3H4ZA 5B7DA 4GIZA 3RTWB 4ZEFA 4AQ4A 3K2DA 2YLNA 2DE2A 3OSQA 2DXYA 4HS7A 1MPBA 4JB7A 3T9XB 4POXA 1MXXA 3W15C 4I9DA 4ZECA 3KJ7A 2H99A 3MZBA 1N7XA 3SDFA 3S9LC 2QS4A 1FQCA 3FD3A 3PV0E 3T66A 4G68C 4GD5A 2ALUA 3HN0A 3MW0A 1JETA 3K1NA 1OIBA 5L9SA 4QHQA 3M3KA 3RTFB 1SD3A 1SW4A 2G29A 1US4A 4ELOA 5KDTA 2HZLA 4QFOA 3FGSA 4GRKA 4HCWA 3K1MA 4WXJA 4H6DA 3ONMA 3PUXE 5DEXB 3IJXB 5IKBA 1D3KA 3KG2A 1ZBMA 4OFOA 1N7WA 1FW0A 5HPQA 4R6KA 4JWOA 1M5BA 4MH5A 4ZEBA 3M3LA 3N94A 3LR1A 4KFQA 1NNKA 3MJNA 2NXOA 1MQHA 3C36A 3WAFA 1B3GA 4MLQA 3IB2A 4ELQA 4OESA 3OSRA 2F78A 3K6WA 4DE8A 1S9TA 4FIMA 2Y7WA 4N13A 4OMBA 1AIVA 3DP8A 3FVOA 2Q9TA 4KYDA 3VE1B 2UVGA 3V83A 1R9QA 5CMCA 4G8NA 4FATA 2F8DA 1D4NA 1MXUA 2CZLA 4BDRA 1AH5A 3SEXA 4LATA 2RC8A 3P7IA 3SEWA 3FVKA 4ZZEA 2DVCA 1SI1A 4NWDA 3HCQA 2QL3A 4XIGQ 2XX7A 4BDOA 1ZJLA 4KQPA 4MLVA 3E13X 4P11A 1IIWA 2V25A 1POY1 3QXMA 2XXXA 4GXAA 4GFRA 4JSDA 3SERA 4F18A 1MXVA 1P1OA 1QUKA 1N3WA 4EDPA 4DXBA 2QRYA 2A5TA 4P0GA 5CBSA 1QJMA 2A5SA 3O6HA 4X9TA 2DVZA 3THIA 5CM6A 5FHMA 4H5GA 1JEVA 2F7CA 3DP4A 4EXKA 2RC7A 3KFMA 2Q88A 2HCAA 1USYH 1B46A 2O1LA 4N6PA 3T93B 1B1XA 1D9YA 1LB9A 1B0HA 1A54A 2DE3A 1DMBA 4ELPA 4ZS9A 4KCDA 1NL5A 3GLBA 1LB8A 1IXGA 4NF8B 4EUOA 2ONSA 4G8MA 1Y4CA 1LAHE 1B5JA 4OYVA 2Z22A 3N6UA 3TTNA 1II5A 3LUYA 4E0WA 4YKPA 1MRPA 5TPAB 1B4HA 2NVUB 5KCJB 3KEIA 5K2YA 2X26A 1B3EA 4U1OA 5I2KA 1B58A 3FVNA 4MFIA 2O6AA 1LBCA 3KOTA 2H25A 2ZNTA 2HXWA 4DXCA 1FQFA 4DXUA 2O68A 3MUQA 5DTBA 4OXVA 2VGQA 3O29A 1MY3A 2DYXA 4R6YA 1A7LA 2KLFA 3MVZA 4OEVA 5L9MA 1JQFA 4GXSB 3VLVA 1I6QA 2THIA 4F3GA 4IO2A 2H4IA 1B2HA 3HHGA 1BP5A 3KGCA 3MBPA 4KD5A 4YZZA 3FUZA 4F3PA 1WVJA 4R75A 3IOWA 4R6HA 2IA4A 3S4UA 3QK6A 4RK2A 4NWCA 2RC9A 2ONKE 3HV1A 3G3IA 3UGWA 1I69A 5AA2B 4QRZA 1LAFE 1EZOA 3O28A 1DPPA 2I6EA 1BLFA 1URGA 4FE8A 1B32A 3A09A 4P0IA 1LFHA 2UVHA 3TELA 1QUIA 3B7DA 1SYIA 3G3JA 3QIMA 3MP8A 1FTMA 1S50A 3PPOA 3E4RA 1O63A 1RKMA 1QVSA 4DIGA 2PVUA 1B3HA 1OMPA 3U72A 4GL8A 2XXPA 2HAVA 4EQ9A 1BTJA 3PUWE 4FJPA 4M4GA 3JZJA 2QJEA 1O64A 3R7XA 2HEUA 4POWA 3MAMA 3FXUA 1P99A 3MVXA 3IR1A 2GRVA 1HSEA 1QULA 1MDP1 1LCTA 1P1WA 4OVJA 2Y7RA 4RK9A 2D3IA 2NUVA 3S9NC 4GQOA 3W9WA 1QW0A 2UYEA 4BDLA 1DOTA 4H65A 2ZYMA 5ITPA 1N76A 2XXYA 3RT6B 5EHSA 4ONYA 2YJPA 3U1OA 3OELA 4F1VA 3K01A 4EQ7A 5CMMA 5AE4A 2DSFA 1VE4A 4F2QA 1XT8A 2P0SA 1GR2A 1UIVA 3G7WA 5I2NB 3EN3A 1FQAA 4YKKA 2XX8A 2CMOA 1POTA 4K3FA 2ESNA 4PFWA 4DDDA 3C35A 4OHNA 3GBBA 5F7VA 1XC1A 4PFTA 3PMVA 4NF4B 4PE5B 3H6TA 1FCKA 3W9VA 1Z7ME 4O3BA 1SW2A 1B7UA 4ZEDA 4R74A 4NF5A 1LFIA 1AMFA 1NFTA 1B1HA 1B7HA 3FZVA 1MXZA 3K6XA 5BUUA 2WKYA 4FEBA 5H8HB 4F22A 3T9UA 1B51A 2I4BA 1UTHA 4ESWA 5H8NB 1F9BA 3HPIA 3TYHA 3CG1A 1Y1ZA 3TCHA 4FAJA 1TWYA 3CR9A 3MWBA 2D21A 1B4ZA 4C0RA 1AOVA 1NNPA 1IQ7A 3I5OA 5DVIA 2XHDA 4ELRA 2Z23A 5H8FB 1Y3QA 1A8EA 4QFPA 4JSOA 3OO7A 3PPQA 1RYOA 2Z8EA 3PD9A 5I59B 1WODA 4ZEKA 4IGRA 5AA3A 2AIXA 4EF2A 3RN8A 4ECFA 5CMBA 4YB7A 4YMBA 4GL0A 4IO3A 1Q35A 3FV1A 4LZ5A 2PX1A 3G3KA 1ZIUA 2PMSA 3PUYE 3RUMA 2I3WA 4YAHX 1VFDA 2XXHA 2GFEA 3M3FA 5L9OA 3OD7A 2H9BA 2F6PA 5H8QB 2B65A 3C34A 4R72A 2DP8A 1ZU0A 3ILUB 4IB2A 1DTZA 1JW4A 4F29A 3IOUA 1P1QA 3IO6A 2NOOA 4KCCA 1FTKA 1EZ9A 3B6WA 3BFTA 3IB1A 2ANJA 5I57B 4XKRA 1Y1MA 2OK2A 4GWOA 3TDJA 4BDQA 1PDAA 2QSXA 3KOSA 1SW1A 5AA1A 3OO9A 4HCYA 3I3VA 4GLIA 4Q30B 4NF6B 1R6ZA 3B6QA 3LSXA 3U8QA 1IXIA 4RXLA 3VVEA 3R6UA 4PQJA 2UYFA 3RY3A 2FA7A 1M5DA 4RYAA 1EU8A 1LGBC 1IXHA 3JYRA 1ELJA 1R1NA 2B3BA 5A5XA 3Q26A 4DCXA 3OOAA 4LP2B 3S2VA 2ZYNA 3ODBA 3N5LA 4NF8A 1GV8A 4U22A 3TTKA 5ITOA 1DTGA 3KBRA 4YMAA 3VVDA 1I6AA 3TEPA 5TPAA 2X7QA 3RPWA 1USYE 3CSBA 4G68A 2Y7KA 4GOTA 4QFLA 2R71A 3L6GA 3QUFA 2PT2A 2RINA 3CFXA 3RQTA 3SEVA 2QS1A 2LAOA 4XXUA 1SDXA 3FATA 1NNFA 3IO4A 5BWJA 3M8UA 3MPLA 4UA8A 2F34A 3O2AA 4TLLB 3G3HA 4LZ7A 5HBCA 4H0WA 1IEJA 1B5HA 2P2AA 4F1YA 3N6TA 4OERA 1M5EA 2VD2A 5KDTB 2DWIA 5J1DA 4ESXA 4HTGA 2XXTA 1MQJA 1ZTYA 2AL5A 4YKIA 4RPOA 2BJJX 3H06B 3SEUA 1LAXA 4H8IA 5DT6A 3E9XA 2DWJA 1T0KA 2DE4A 3TCGA 3PGFA 2G93A 3CG3A 4ISUA 2XXVA 3ZKKA 5AA2A 1TFDA 4KI0E 1OLCA 2PBWA 4R73A 2PYYA 3EQ1A 1GTKA 1URSA 5JEIA 4BDNA 2QS3A 1BIYA 1LAGE 4O3CA 3SETA 1PBQA 3SKPA 4OTEA 1H45A 3A3UA 1N3XA 1ZMGA 2O7UA 1PB7A 3O97A 3H6VA 3GXAA 3HHFA 3EHTA 1LLSA 4I8CA 2OZZA 2V3TA 2ZMBA 1HSJA 2ZYOA 3OENA 2UVIA 1PB8A 3CSGA 3RGYA 3K0VA 2VHAA 4OEUA 3OXNA 3FJMA 2XD3A 1B52A 2HQ0A 3FV2A 4WKMA 4QSEA 4FECA 1ANFA 5H8SA 2I4CA 1QUJA 4YKJA 4QFNA 2O69A 5JK4A 3PD8A 3VVFA 4H1XA 1SW5A 4NE4A 3MZ9A 2V84A 3K6VA 1MQGA 1EZPA 5K2XA 1B5IA 1UTBB 2A5TB 3FXQA 2XXQA 3K02A 3Q29A 5I58B 2Q89A 1MXWA 2F7BA 3TZAA 1FTOA 1MH4A 3RLFE 3BBRA 3C31A 2HAUA 2Y7PA 5CC2A 3HO7A 4LQ2A 1Y9UA 2UVJA 2Q2CA 3LSLA 4DLDA 2Z8FA 3MZ1A 3FASA 2PT1A 2XXIA 3BKIB 4H8JA 3UP9A 4OENA 3PUZE 1B3LA 5FTIA 4YB5A 3H6UA 1Y4TA 3MC2A 1YCJA 1M5FA 3N26A 4U23A 1VFEA 1ATGA 3PPNA 5AA4B 5H8HA 3IL1B 2O84X 2V3QA 2OCUA 1DPEA 4Q5TA 2HFBA 1MS7A 4JDFA 4JWXA 4QFKA 1NH8A 1MM6A 1SVXB 3L6HA 1TXFA 3EPEA 3EHSA 1IZ1A 4MF3A 4YICA 4QF9A 2OJTA 2B3FA 2FNCA 2ZYKA 2V93A 4H67A 2DWHA 4Q8RA 3DELB 4OFLA 1OQHA 3ZS6A 4IY5A 5I59A 2FYIA 3KSJA 3K4UA 4RPNA 4PFYA 2IEEA 1OVTA 3WAEA 3FIRA 3Q25A 1SI0A 1RYXA 1MQDA 4L17A 2F36A 1FTLA 1MPCA 1SQYA 5IAIA 3LC8A 3Q28A 4RNSA 1CE2A 2V3UA 2XXRA 1SBPA 5H8QA 5JTYB 2RCBA 5CI5A 2DOJA 3FJ7A 5ISUA 4F31B 2XXWA 4LVQA 2XXUA 1PEBA 1IUDA 1S7YA 3TODA 1H43A 5I57A 1D9VA 3QYTA 4OETA 2D5WA 3G3GA 2ZNUA 5ELVA 1OQGA 5DEXA 2F6GA 3U93A 3UORA 2OWTA 3V8XB 1OVBA 1PB9A 1IITA 2F35A 5KZTA 2R9JA 4EXLA 2ONRA 4ND9A 1JW5A 1IXCA 3MP6A 1PBPA 1AL3A 1MG1A 2OWSA 4IGTA 1ZLQA 1URDA 4M1VA 3OO6A 1NMUA 3IX1A 3O6IA 3IOVA 3QAXA 3TTLA 4MBPA 3UA8A 4H5FA 4BLAA 1GVCA 5I56B 3TUSA 4R9FA 2E0SA 3AXFA 1VR5A 3OEMA 4TQUQ 5EYFA 4F3SA 3FJGA 1US5A 3TAJA 1JEUA 4E0XA 2HZKA 5CRYA 2XD2A 3CIJA 4Z0IA 2ZNSA 3SESA 4R2FA 3RNNA 4KR5A 3E3KA 4KYEA 4NTLA 3BFUA 1NKXA 2GH9A 1MDQA 3TTMA 1FTJA 3K00A 4KHZE 4QSCA 3T96B 1XOCA 5TP9B 1HSLA 5FHNA 3O66A 4GVOA 4JXIA 4OZ9A 1ZKBA 3D4GA 1MY4A 2NWJA 2I0BA 1NNTA 4OWDA 4NF5B 2VOZA 5I84A 3DP6A 3LBSA 3S9MC 2DQVA 4Z7EA 1N04A 1Y3NA 4O3AA 3U92A 3DLNA 1LFGA 4TOZA 4WEPA 1MY2A 3CFLA 1UTHB 3T9VA 3KN8A 3ILTB 4F19A 4LUBA 1Y3PA 4G4PA 4U4XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5EHM A;  3VLU A;  2Y7I A;  4XTC Q;  1FQE A;  3QUJ A;  2QS2 A;  3T9H B;  4IO4 A;  2Z8D A;  2Y84 A;  4C1T A;  2ABH A;  3PPP A;  4DCY A;  3B6T A;  2REJ A;  2O51 A;  3TFL A;  5KCJ A;  3V5A A;  3SEY A;  3TQW A;  1EH3 A;  4F2O A;  3MVY A;  4NMY A;  2I48 A;  3USD A;  3CI8 A;  1OLA A;  3Q27 A;  3HST A;  4G8H A;  4Q0C A;  4C1U A;  4AB6 A;  4LA9 A;  1UQW A;  1B3F A;  1PC3 A;  4F1U A;  4ZE8 A;  5DVF A;  3S9E A;  4AB5 A;  1N84 A;  1Z7N E;  1Q1K A;  5ICQ A;  3ZKL A;  2I58 A;  4ZE9 A;  5HM4 B;  3TMG A;  1A8F A;  2I3V A;  3CRB A;  4IO5 A;  4KPT A;  4KYS A;  5FTH A;  5DYH A;  1P1N A;  3TCF A;  3H3G A;  1J1N A;  2M8C A;  1UTB A;  2DS9 A;  1XS5 A;  2RKM A;  5TU0 A;  5I58 A;  4RY1 A;  2OLB A;  1BKA A;  4U4S A;  4FOR A;  1N0T A;  4JBZ A;  4ZZA A;  4THI A;  3H03 A;  2I49 A;  1FQB A;  5A5X B;  1QKA A;  2Q8J A;  3GBA A;  3C9H A;  3ECR A;  2QMX A;  3V89 B;  2RCA A;  1B05 A;  4IY6 A;  4UAC A;  1MXY A;  3MPK A;  1Y20 A;  3QSL A;  4XKQ A;  4R9G A;  1O7T A;  3OEK A;  3KN3 A;  3LSF B;  1LST A;  1GGG A;  2E1S A;  3TQL A;  5AA4 A;  4XKP A;  3T22 A;  5DVJ A;  4G68 B;  4JWY A;  2XX9 A;  1YAE A;  3UIF A;  3C4M A;  3TPA A;  1KWH A;  5LOM A;  4NED A;  4I1D A;  4GF8 A;  3OMB A;  1A40 A;  3PUV E;  3UK4 A;  5FHO A;  2P1S A;  5M2V A;  3O9P A;  4PP0 A;  4OFJ A;  1DSN A;  4F39 A;  4EQB A;  1A55 A;  1YPN A;  2Q2A A;  3VFJ A;  3TTR A;  4YB6 A;  4U21 A;  2VP1 A;  3KN7 A;  4X1B A;  1I6B A;  2UXA A;  4ZDM A;  3C33 A;  3O6G A;  4I62 A;  5I2N A;  3FXR A;  1WDN A;  2F7A A;  4XKN A;  1M5C A;  1MQI A;  2YPN A;  2H5Y A;  3IAZ A;  4FED A;  4PFU A;  3VDF A;  1R9L A;  3MP1 A;  3TKD A;  4QSD A;  1P1U A;  1B7Z A;  5JTY A;  3PPR A;  1A99 A;  1MM7 A;  4NF4 A;  3EHU A;  5L8D A;  4RJZ A;  3FVG A;  3DM0 A;  1JVX A;  5ICT A;  1B40 A;  1FQD A;  5CMK A;  2F97 A;  2DWA A;  3KZG A;  4X1D A;  3R26 A;  1MPD A;  2VD3 A;  3U94 A;  5I2K B;  3KJT A;  3PMX A;  1QKB A;  5H8N A;  3D4C A;  1NH7 A;  4IO7 A;  2AYS A;  4PET A;  2OBG A;  1JW1 A;  4LON B;  3I6V A;  1JVY A;  4LZ8 A;  3UN6 A;  3PU5 A;  5CBR A;  5H8F A;  3IJO B;  2QPQ A;  1CB6 A;  1LCF A;  1JNF A;  1H44 A;  2O1M A;  1B6H A;  2GHA A;  4ZEI A;  5I56 A;  1LBB A;  3VLW A;  2F5X A;  3LSW A;  4N07 A;  3H6W A;  2H98 A;  1MY1 A;  3F11 A;  3VXC A;  2ZXT A;  2I0C A;  4YU0 A;  3MVW A;  3G3F A;  3ZSF A;  5AA2 D;  2RF1 A;  3VV5 A;  1XHY A;  1B9J A;  4IO6 A;  1YTV A;  3IOT A;  4G2Z A;  3K1P A;  3OO8 A;  3PMW A;  3C32 A;  3JV9 A;  2X7P A;  5F1Q A;  1TFA A;  1TT1 A;  1XVX A;  3VXB A;  2R6G E;  4DZ1 A;  4TLM B;  4G77 A;  2REG A;  5TP9 A;  1B0L A;  2O7I A;  3K6U A;  4F3B A;  2QMW A;  4U1Z A;  4X48 A;  1XVY A;  3IK6 B;  4WED A;  1H76 A;  3IB0 A;  2AL4 A;  3EF7 A;  3H7M A;  4NF6 A;  4HW8 A;  1UIU A;  1MH3 A;  3CFZ A;  2GHB A;  1VSO A;  4RA1 A;  1MY0 A;  1H3D A;  3MQ9 A;  3CVG A;  4U2R A;  4BDM A;  4EF1 A;  2W7Y A;  4OQO A;  3RT8 A;  3A3C A;  3KSX A;  3GZG A;  4R2B A;  2DXR A;  1SYH A;  3IOR A;  1L5T A;  4LQ5 A;  5B70 A;  3H4Z A;  5B7D A;  4GIZ A;  3RTW B;  4ZEF A;  4AQ4 A;  3K2D A;  2YLN A;  2DE2 A;  3OSQ A;  2DXY A;  4HS7 A;  1MPB A;  4JB7 A;  3T9X B;  4POX A;  1MXX A;  3W15 C;  4I9D A;  4ZEC A;  3KJ7 A;  2H99 A;  3MZB A;  1N7X A;  3SDF A;  3S9L C;  2QS4 A;  1FQC A;  3FD3 A;  3PV0 E;  3T66 A;  4G68 C;  4GD5 A;  2ALU A;  3HN0 A;  3MW0 A;  1JET A;  3K1N A;  1OIB A;  5L9S A;  4QHQ A;  3M3K A;  3RTF B;  1SD3 A;  1SW4 A;  2G29 A;  1US4 A;  4ELO A;  5KDT A;  2HZL A;  4QFO A;  3FGS A;  4GRK A;  4HCW A;  3K1M A;  4WXJ A;  4H6D A;  3ONM A;  3PUX E;  5DEX B;  3IJX B;  5IKB A;  1D3K A;  3KG2 A;  1ZBM A;  4OFO A;  1N7W A;  1FW0 A;  5HPQ A;  4R6K A;  4JWO A;  1M5B A;  4MH5 A;  4ZEB A;  3M3L A;  3N94 A;  3LR1 A;  4KFQ A;  1NNK A;  3MJN A;  2NXO A;  1MQH A;  3C36 A;  3WAF A;  1B3G A;  4MLQ A;  3IB2 A;  4ELQ A;  4OES A;  3OSR A;  2F78 A;  3K6W A;  4DE8 A;  1S9T A;  4FIM A;  2Y7W A;  4N13 A;  4OMB A;  1AIV A;  3DP8 A;  3FVO A;  2Q9T A;  4KYD A;  3VE1 B;  2UVG A;  3V83 A;  1R9Q A;  5CMC A;  4G8N A;  4FAT A;  2F8D A;  1D4N A;  1MXU A;  2CZL A;  4BDR A;  1AH5 A;  3SEX A;  4LAT A;  2RC8 A;  3P7I A;  3SEW A;  3FVK A;  4ZZE A;  2DVC A;  1SI1 A;  4NWD A;  3HCQ A;  2QL3 A;  4XIG Q;  2XX7 A;  4BDO A;  1ZJL A;  4KQP A;  4MLV A;  3E13 X;  4P11 A;  1IIW A;  2V25 A;  1POY 1;  3QXM A;  2XXX A;  4GXA A;  4GFR A;  4JSD A;  3SER A;  4F18 A;  1MXV A;  1P1O A;  1QUK A;  1N3W A;  4EDP A;  4DXB A;  2QRY A;  2A5T A;  4P0G A;  5CBS A;  1QJM A;  2A5S A;  3O6H A;  4X9T A;  2DVZ A;  3THI A;  5CM6 A;  5FHM A;  4H5G A;  1JEV A;  2F7C A;  3DP4 A;  4EXK A;  2RC7 A;  3KFM A;  2Q88 A;  2HCA A;  1USY H;  1B46 A;  2O1L A;  4N6P A;  3T93 B;  1B1X A;  1D9Y A;  1LB9 A;  1B0H A;  1A54 A;  2DE3 A;  1DMB A;  4ELP A;  4ZS9 A;  4KCD A;  1NL5 A;  3GLB A;  1LB8 A;  1IXG A;  4NF8 B;  4EUO A;  2ONS A;  4G8M A;  1Y4C A;  1LAH E;  1B5J A;  4OYV A;  2Z22 A;  3N6U A;  3TTN A;  1II5 A;  3LUY A;  4E0W A;  4YKP A;  1MRP A;  5TPA B;  1B4H A;  2NVU B;  5KCJ B;  3KEI A;  5K2Y A;  2X26 A;  1B3E A;  4U1O A;  5I2K A;  1B58 A;  3FVN A;  4MFI A;  2O6A A;  1LBC A;  3KOT A;  2H25 A;  2ZNT A;  2HXW A;  4DXC A;  1FQF A;  4DXU A;  2O68 A;  3MUQ A;  5DTB A;  4OXV A;  2VGQ A;  3O29 A;  1MY3 A;  2DYX A;  4R6Y A;  1A7L A;  2KLF A;  3MVZ A;  4OEV A;  5L9M A;  1JQF A;  4GXS B;  3VLV A;  1I6Q A;  2THI A;  4F3G A;  4IO2 A;  2H4I A;  1B2H A;  3HHG A;  1BP5 A;  3KGC A;  3MBP A;  4KD5 A;  4YZZ A;  3FUZ A;  4F3P A;  1WVJ A;  4R75 A;  3IOW A;  4R6H A;  2IA4 A;  3S4U A;  3QK6 A;  4RK2 A;  4NWC A;  2RC9 A;  2ONK E;  3HV1 A;  3G3I A;  3UGW A;  1I69 A;  5AA2 B;  4QRZ A;  1LAF E;  1EZO A;  3O28 A;  1DPP A;  2I6E A;  1BLF A;  1URG A;  4FE8 A;  1B32 A;  3A09 A;  4P0I A;  1LFH A;  2UVH A;  3TEL A;  1QUI A;  3B7D A;  1SYI A;  3G3J A;  3QIM A;  3MP8 A;  1FTM A;  1S50 A;  3PPO A;  3E4R A;  1O63 A;  1RKM A;  1QVS A;  4DIG A;  2PVU A;  1B3H A;  1OMP A;  3U72 A;  4GL8 A;  2XXP A;  2HAV A;  4EQ9 A;  1BTJ A;  3PUW E;  4FJP A;  4M4G A;  3JZJ A;  2QJE A;  1O64 A;  3R7X A;  2HEU A;  4POW A;  3MAM A;  3FXU A;  1P99 A;  3MVX A;  3IR1 A;  2GRV A;  1HSE A;  1QUL A;  1MDP 1;  1LCT A;  1P1W A;  4OVJ A;  2Y7R A;  4RK9 A;  2D3I A;  2NUV A;  3S9N C;  4GQO A;  3W9W A;  1QW0 A;  2UYE A;  4BDL A;  1DOT A;  4H65 A;  2ZYM A;  5ITP A;  1N76 A;  2XXY A;  3RT6 B;  5EHS A;  4ONY A;  2YJP A;  3U1O A;  3OEL A;  4F1V A;  3K01 A;  4EQ7 A;  5CMM A;  5AE4 A;  2DSF A;  1VE4 A;  4F2Q A;  1XT8 A;  2P0S A;  1GR2 A;  1UIV A;  3G7W A;  5I2N B;  3EN3 A;  1FQA A;  4YKK A;  2XX8 A;  2CMO A;  1POT A;  4K3F A;  2ESN A;  4PFW A;  4DDD A;  3C35 A;  4OHN A;  3GBB A;  5F7V A;  1XC1 A;  4PFT A;  3PMV A;  4NF4 B;  4PE5 B;  3H6T A;  1FCK A;  3W9V A;  1Z7M E;  4O3B A;  1SW2 A;  1B7U A;  4ZED A;  4R74 A;  4NF5 A;  1LFI A;  1AMF A;  1NFT A;  1B1H A;  1B7H A;  3FZV A;  1MXZ A;  3K6X A;  5BUU A;  2WKY A;  4FEB A;  5H8H B;  4F22 A;  3T9U A;  1B51 A;  2I4B A;  1UTH A;  4ESW A;  5H8N B;  1F9B A;  3HPI A;  3TYH A;  3CG1 A;  1Y1Z A;  3TCH A;  4FAJ A;  1TWY A;  3CR9 A;  3MWB A;  2D21 A;  1B4Z A;  4C0R A;  1AOV A;  1NNP A;  1IQ7 A;  3I5O A;  5DVI A;  2XHD A;  4ELR A;  2Z23 A;  5H8F B;  1Y3Q A;  1A8E A;  4QFP A;  4JSO A;  3OO7 A;  3PPQ A;  1RYO A;  2Z8E A;  3PD9 A;  5I59 B;  1WOD A;  4ZEK A;  4IGR A;  5AA3 A;  2AIX A;  4EF2 A;  3RN8 A;  4ECF A;  5CMB A;  4YB7 A;  4YMB A;  4GL0 A;  4IO3 A;  1Q35 A;  3FV1 A;  4LZ5 A;  2PX1 A;  3G3K A;  1ZIU A;  2PMS A;  3PUY E;  3RUM A;  2I3W A;  4YAH X;  1VFD A;  2XXH A;  2GFE A;  3M3F A;  5L9O A;  3OD7 A;  2H9B A;  2F6P A;  5H8Q B;  2B65 A;  3C34 A;  4R72 A;  2DP8 A;  1ZU0 A;  3ILU B;  4IB2 A;  1DTZ A;  1JW4 A;  4F29 A;  3IOU A;  1P1Q A;  3IO6 A;  2NOO A;  4KCC A;  1FTK A;  1EZ9 A;  3B6W A;  3BFT A;  3IB1 A;  2ANJ A;  5I57 B;  4XKR A;  1Y1M A;  2OK2 A;  4GWO A;  3TDJ A;  4BDQ A;  1PDA A;  2QSX A;  3KOS A;  1SW1 A;  5AA1 A;  3OO9 A;  4HCY A;  3I3V A;  4GLI A;  4Q30 B;  4NF6 B;  1R6Z A;  3B6Q A;  3LSX A;  3U8Q A;  1IXI A;  4RXL A;  3VVE A;  3R6U A;  4PQJ A;  2UYF A;  3RY3 A;  2FA7 A;  1M5D A;  4RYA A;  1EU8 A;  1LGB C;  1IXH A;  3JYR A;  1ELJ A;  1R1N A;  2B3B A;  5A5X A;  3Q26 A;  4DCX A;  3OOA A;  4LP2 B;  3S2V A;  2ZYN A;  3ODB A;  3N5L A;  4NF8 A;  1GV8 A;  4U22 A;  3TTK A;  5ITO A;  1DTG A;  3KBR A;  4YMA A;  3VVD A;  1I6A A;  3TEP A;  5TPA A;  2X7Q A;  3RPW A;  1USY E;  3CSB A;  4G68 A;  2Y7K A;  4GOT A;  4QFL A;  2R71 A;  3L6G A;  3QUF A;  2PT2 A;  2RIN A;  3CFX A;  3RQT A;  3SEV A;  2QS1 A;  2LAO A;  4XXU A;  1SDX A;  3FAT A;  1NNF A;  3IO4 A;  5BWJ A;  3M8U A;  3MPL A;  4UA8 A;  2F34 A;  3O2A A;  4TLL B;  3G3H A;  4LZ7 A;  5HBC A;  4H0W A;  1IEJ A;  1B5H A;  2P2A A;  4F1Y A;  3N6T A;  4OER A;  1M5E A;  2VD2 A;  5KDT B;  2DWI A;  5J1D A;  4ESX A;  4HTG A;  2XXT A;  1MQJ A;  1ZTY A;  2AL5 A;  4YKI A;  4RPO A;  2BJJ X;  3H06 B;  3SEU A;  1LAX A;  4H8I A;  5DT6 A;  3E9X A;  2DWJ A;  1T0K A;  2DE4 A;  3TCG A;  3PGF A;  2G93 A;  3CG3 A;  4ISU A;  2XXV A;  3ZKK A;  5AA2 A;  1TFD A;  4KI0 E;  1OLC A;  2PBW A;  4R73 A;  2PYY A;  3EQ1 A;  1GTK A;  1URS A;  5JEI A;  4BDN A;  2QS3 A;  1BIY A;  1LAG E;  4O3C A;  3SET A;  1PBQ A;  3SKP A;  4OTE A;  1H45 A;  3A3U A;  1N3X A;  1ZMG A;  2O7U A;  1PB7 A;  3O97 A;  3H6V A;  3GXA A;  3HHF A;  3EHT A;  1LLS A;  4I8C A;  2OZZ A;  2V3T A;  2ZMB A;  1HSJ A;  2ZYO A;  3OEN A;  2UVI A;  1PB8 A;  3CSG A;  3RGY A;  3K0V A;  2VHA A;  4OEU A;  3OXN A;  3FJM A;  2XD3 A;  1B52 A;  2HQ0 A;  3FV2 A;  4WKM A;  4QSE A;  4FEC A;  1ANF A;  5H8S A;  2I4C A;  1QUJ A;  4YKJ A;  4QFN A;  2O69 A;  5JK4 A;  3PD8 A;  3VVF A;  4H1X A;  1SW5 A;  4NE4 A;  3MZ9 A;  2V84 A;  3K6V A;  1MQG A;  1EZP A;  5K2X A;  1B5I A;  1UTB B;  2A5T B;  3FXQ A;  2XXQ A;  3K02 A;  3Q29 A;  5I58 B;  2Q89 A;  1MXW A;  2F7B A;  3TZA A;  1FTO A;  1MH4 A;  3RLF E;  3BBR A;  3C31 A;  2HAU A;  2Y7P A;  5CC2 A;  3HO7 A;  4LQ2 A;  1Y9U A;  2UVJ A;  2Q2C A;  3LSL A;  4DLD A;  2Z8F A;  3MZ1 A;  3FAS A;  2PT1 A;  2XXI A;  3BKI B;  4H8J A;  3UP9 A;  4OEN A;  3PUZ E;  1B3L A;  5FTI A;  4YB5 A;  3H6U A;  1Y4T A;  3MC2 A;  1YCJ A;  1M5F A;  3N26 A;  4U23 A;  1VFE A;  1ATG A;  3PPN A;  5AA4 B;  5H8H A;  3IL1 B;  2O84 X;  2V3Q A;  2OCU A;  1DPE A;  4Q5T A;  2HFB A;  1MS7 A;  4JDF A;  4JWX A;  4QFK A;  1NH8 A;  1MM6 A;  1SVX B;  3L6H A;  1TXF A;  3EPE A;  3EHS A;  1IZ1 A;  4MF3 A;  4YIC A;  4QF9 A;  2OJT A;  2B3F A;  2FNC A;  2ZYK A;  2V93 A;  4H67 A;  2DWH A;  4Q8R A;  3DEL B;  4OFL A;  1OQH A;  3ZS6 A;  4IY5 A;  5I59 A;  2FYI A;  3KSJ A;  3K4U A;  4RPN A;  4PFY A;  2IEE A;  1OVT A;  3WAE A;  3FIR A;  3Q25 A;  1SI0 A;  1RYX A;  1MQD A;  4L17 A;  2F36 A;  1FTL A;  1MPC A;  1SQY A;  5IAI A;  3LC8 A;  3Q28 A;  4RNS A;  1CE2 A;  2V3U A;  2XXR A;  1SBP A;  5H8Q A;  5JTY B;  2RCB A;  5CI5 A;  2DOJ A;  3FJ7 A;  5ISU A;  4F31 B;  2XXW A;  4LVQ A;  2XXU A;  1PEB A;  1IUD A;  1S7Y A;  3TOD A;  1H43 A;  5I57 A;  1D9V A;  3QYT A;  4OET A;  2D5W A;  3G3G A;  2ZNU A;  5ELV A;  1OQG A;  5DEX A;  2F6G A;  3U93 A;  3UOR A;  2OWT A;  3V8X B;  1OVB A;  1PB9 A;  1IIT A;  2F35 A;  5KZT A;  2R9J A;  4EXL A;  2ONR A;  4ND9 A;  1JW5 A;  1IXC A;  3MP6 A;  1PBP A;  1AL3 A;  1MG1 A;  2OWS A;  4IGT A;  1ZLQ A;  1URD A;  4M1V A;  3OO6 A;  1NMU A;  3IX1 A;  3O6I A;  3IOV A;  3QAX A;  3TTL A;  4MBP A;  3UA8 A;  4H5F A;  4BLA A;  1GVC A;  5I56 B;  3TUS A;  4R9F A;  2E0S A;  3AXF A;  1VR5 A;  3OEM A;  4TQU Q;  5EYF A;  4F3S A;  3FJG A;  1US5 A;  3TAJ A;  1JEU A;  4E0X A;  2HZK A;  5CRY A;  2XD2 A;  3CIJ A;  4Z0I A;  2ZNS A;  3SES A;  4R2F A;  3RNN A;  4KR5 A;  3E3K A;  4KYE A;  4NTL A;  3BFU A;  1NKX A;  2GH9 A;  1MDQ A;  3TTM A;  1FTJ A;  3K00 A;  4KHZ E;  4QSC A;  3T96 B;  1XOC A;  5TP9 B;  1HSL A;  5FHN A;  3O66 A;  4GVO A;  4JXI A;  4OZ9 A;  1ZKB A;  3D4G A;  1MY4 A;  2NWJ A;  2I0B A;  1NNT A;  4OWD A;  4NF5 B;  2VOZ A;  5I84 A;  3DP6 A;  3LBS A;  3S9M C;  2DQV A;  4Z7E A;  1N04 A;  1Y3N A;  4O3A A;  3U92 A;  3DLN A;  1LFG A;  4TOZ A;  4WEP A;  1MY2 A;  3CFL A;  1UTH B;  3T9V A;  3KN8 A;  3ILT B;  4F19 A;  4LUB A;  1Y3P A;  4G4P A;  4U4X A; 
#chains in the Genus database with same CATH topology
 2HHM A;  5EHM A;  4N8G A;  3VLU A;  2Y7I A;  4XTC Q;  1FQE A;  3QUJ A;  2QS2 A;  3CHG A;  3T9H B;  4IO4 A;  2Z8D A;  2Y84 A;  4C1T A;  2ABH A;  3PPP A;  4DCY A;  3B6T A;  2Q8M A;  2REJ A;  2O51 A;  4GWZ A;  3TFL A;  5KCJ A;  3V5A A;  3SEY A;  1FPF A;  4AS5 A;  1NV6 A;  3TQW A;  1EH3 A;  4F2O A;  1SPI A;  4N6D A;  3MVY A;  4NMY A;  2I48 A;  3USD A;  3CI8 A;  1OLA A;  3Q27 A;  3HST A;  4G8H A;  4Q0C A;  4C1U A;  4AB6 A;  4LA9 A;  1UQW A;  1B3F A;  1PC3 A;  4F1U A;  4ZE8 A;  5DVF A;  2HXR A;  3S9E A;  4N17 A;  4AB5 A;  1N84 A;  1Z7N E;  1Q1K A;  5ICQ A;  3ZKL A;  2I58 A;  4ZE9 A;  2VPN A;  5IM2 A;  5HM4 B;  3TMG A;  1A8F A;  2I3V A;  3CRB A;  4IO5 A;  4KPT A;  4KYS A;  5FTH A;  5DYH A;  1P1N A;  3TCF A;  3H3G A;  1J1N A;  2M8C A;  1UTB A;  2DS9 A;  1XS5 A;  2RKM A;  5TU0 A;  5I58 A;  4PAK A;  4RY1 A;  2OLB A;  4GBV A;  4MEV A;  1BKA A;  4PGP A;  4HXV A;  4U4S A;  4FOR A;  4MNP A;  1N0T A;  4P3L A;  4JBZ A;  4ZZA A;  1D9Q A;  2WBD A;  4THI A;  3H03 A;  2I49 A;  1FQB A;  5A5X B;  1QKA A;  2Q8J A;  3GBA A;  3C9H A;  3ECR A;  2QMX A;  3V89 B;  2RCA A;  1B05 A;  4IY6 A;  1INP A;  1NV4 A;  4UAC A;  1LEV A;  4MJO A;  1MXY A;  3MPK A;  1Y20 A;  3QSL A;  4XKQ A;  4R9G A;  1O7T A;  4XFE A;  3OEK A;  3KN3 A;  3LSF B;  1NI9 A;  1LST A;  1GGG A;  2E1S A;  2P3N A;  3TQL A;  1IME A;  5AA4 A;  4XKP A;  2P3V A;  3T22 A;  4N15 A;  4MNI A;  4PAF A;  5DVJ A;  4G68 B;  2BJI A;  4JWY A;  4PFI A;  2XX9 A;  1YAE A;  3UIF A;  3C4M A;  3TPA A;  1KWH A;  5LOM A;  4NED A;  4I1D A;  4GF8 A;  3OMB A;  1A40 A;  3PUV E;  3UK4 A;  5FHO A;  2P1S A;  5M2V A;  2MKZ A;  3O9P A;  3PTY A;  1EYK A;  4O8M A;  3GYY A;  4PP0 A;  4OFJ A;  1DSN A;  4F39 A;  4EQB A;  1A55 A;  4KXP A;  1YPN A;  1RDY A;  2Q2A A;  3VFJ A;  2FVZ A;  3TTR A;  4YB6 A;  4U21 A;  2VP1 A;  4HE2 A;  3KN7 A;  4X1B A;  1I6B A;  2UXA A;  4ZDM A;  3C33 A;  3O6G A;  4I62 A;  5I2N A;  1YYZ A;  3FXR A;  1WDN A;  2F7A A;  4XKN A;  1M5C A;  1MQI A;  2YPN A;  2H5Y A;  3IAZ A;  4FED A;  2XWK A;  3EKI A;  4PFU A;  3VDF A;  1R9L A;  3MP1 A;  4QSD A;  1P1U A;  3TKD A;  1B7Z A;  5JTY A;  3PPR A;  1RDZ A;  1A99 A;  4I3E A;  1MM7 A;  4NF4 A;  3EHU A;  5L8D A;  4RJZ A;  3FVG A;  2VPO A;  2Q74 A;  3DM0 A;  1JVX A;  5ICT A;  1B40 A;  1FQD A;  5CMK A;  2F97 A;  2DWA A;  3KZG A;  4X1D A;  3R26 A;  1MPD A;  2VD3 A;  3U94 A;  5I2K B;  3KJT A;  1LBX A;  3PMX A;  1QKB A;  5H8N A;  2XWI A;  3D4C A;  1NH7 A;  4PC9 A;  4IO7 A;  5F24 A;  2AYS A;  4PET A;  2OBG A;  1JW1 A;  4LON B;  3I6V A;  1JVY A;  4LZ8 A;  2KQZ A;  3UN6 A;  4JVC A;  2WBB A;  3PU5 A;  5CBR A;  5H8F A;  3IJO B;  2QPQ A;  1CB6 A;  1LCF A;  1JNF A;  1H44 A;  2O1M A;  1B6H A;  2GHA A;  4ZEI A;  5I56 A;  1LBB A;  3VLW A;  2F5X A;  3LSW A;  4N07 A;  2PFY A;  3H6W A;  2H98 A;  1MY1 A;  3F11 A;  3VXC A;  2ZXT A;  2I0C A;  4YU0 A;  3MVW A;  3G3F A;  3ZSF A;  5AA2 D;  4OA4 A;  2RF1 A;  2PCR A;  1XHY A;  3VV5 A;  1B9J A;  4IO6 A;  1YTV A;  3IOT A;  3KC1 A;  4G2Z A;  3K1P A;  3OO8 A;  3PMW A;  4H46 A;  3C32 A;  3JV9 A;  2X7P A;  5F1Q A;  1TFA A;  1TT1 A;  2OWZ A;  1XVX A;  3VXB A;  2R6G E;  3HFU A;  4DZ1 A;  4TLM B;  3FXB A;  4G77 A;  3KBZ A;  2REG A;  5TP9 A;  1B0L A;  1LBV A;  2O7I A;  3K6U A;  4F3B A;  4GWU A;  2QMW A;  4U1Z A;  4X48 A;  1XVY A;  2HPG A;  3IK6 B;  1H76 A;  3IB0 A;  4NX1 A;  4WED A;  1KA0 A;  2AL4 A;  3EF7 A;  3H7M A;  4GX3 A;  4NF6 A;  4HW8 A;  5I7I A;  1UIU A;  1MH3 A;  3CFZ A;  5IGA A;  2GHB A;  1VSO A;  4RA1 A;  1MY0 A;  1H3D A;  3MQ9 A;  3CVG A;  4U2R A;  4BDM A;  4EF1 A;  2W7Y A;  4OQO A;  4PTK A;  3RT8 A;  3A3C A;  3KSX A;  3GZG A;  4R2B A;  1IMD A;  2DXR A;  1SYH A;  3IOR A;  1L5T A;  1NV3 A;  1FJ9 A;  4LQ5 A;  4GX6 A;  5B70 A;  4IR8 A;  3H4Z A;  5B7D A;  4GIZ A;  3RTW B;  4ZEF A;  4AQ4 A;  3K2D A;  2YLN A;  2DE2 A;  3OSQ A;  2DXY A;  4HS7 A;  1MPB A;  4JB7 A;  3T9X B;  4POX A;  1MXX A;  1VDW A;  3W15 C;  4I9D A;  4ZEC A;  3KJ7 A;  2H99 A;  1LBW A;  4MCO A;  1DBZ A;  3MZB A;  1N7X A;  4GBW A;  3SDF A;  2CEX A;  1IMB A;  3S9L C;  2QS4 A;  3RPL A;  1FQC A;  3FD3 A;  3PV0 E;  1KZ8 A;  3T66 A;  2WYP A;  4G68 C;  4GD5 A;  2ALU A;  3HN0 A;  3MW0 A;  1NV7 A;  1JET A;  3K1N A;  1Q9D A;  1OIB A;  5L9S A;  4QHQ A;  3M3K A;  3RTF B;  4PAI A;  1SD3 A;  1SW4 A;  2G29 A;  1YZ0 A;  1US4 A;  4ELO A;  5KDT A;  2HZL A;  4QBA A;  4QFO A;  3FGS A;  4GRK A;  4HCW A;  1FPL A;  3K1M A;  4WXJ A;  4H6D A;  3ONM A;  3PUX E;  5DEX B;  5IZZ A;  3IJX B;  2JJK A;  1D3K A;  5IKB A;  3LUZ A;  3KG2 A;  1ZBM A;  4OFO A;  1N7W A;  1FW0 A;  5HPQ A;  4O94 A;  1FPG A;  4R6K A;  4JWO A;  1M5B A;  4MH5 A;  4ZEB A;  3M3L A;  3N94 A;  3ROJ A;  3LR1 A;  5I5P A;  1NUY A;  4KFQ A;  4N8Y A;  4FBP A;  1NNK A;  1FBD A;  1QGX A;  2NXO A;  3MJN A;  4JVD A;  1MQH A;  2DDK A;  3C36 A;  3WAF A;  1B3G A;  4MLQ A;  3IB2 A;  4ELQ A;  4OES A;  3OSR A;  2F78 A;  3K6W A;  4DE8 A;  1S9T A;  4FIM A;  4NQ8 A;  2Y7W A;  4N13 A;  4OMB A;  1AIV A;  3DP8 A;  5ET6 A;  3FVO A;  2F3D A;  2Q9T A;  4KYD A;  4NG7 A;  3VE1 B;  2UVG A;  3T0J A;  3V83 A;  1R9Q A;  5IZ1 A;  5CMC A;  4G8N A;  4FAT A;  2F8D A;  2XXK A;  1D4N A;  2ZZX A;  1MXU A;  2CZL A;  4BDR A;  1AH5 A;  3SEX A;  4LAT A;  2RC8 A;  3P7I A;  3SEW A;  3FVK A;  4I40 A;  4ZZE A;  2DVC A;  4GWY A;  1DCU A;  1SI1 A;  4NWD A;  3HCQ A;  5ET7 A;  2QL3 A;  4XIG Q;  2XX7 A;  4BDO A;  1ZJL A;  4DI4 B;  2QVR A;  1FBG A;  4KQP A;  4MLV A;  4OVT A;  4P1E A;  3E13 X;  4P11 A;  4PDH A;  1IIW A;  2V25 A;  5EQA A;  1POY 1;  3QXM A;  2XXX A;  4GXA A;  4MX6 A;  4GFR A;  4JSD A;  3SER A;  4F18 A;  1MXV A;  1P1O A;  2V4C A;  1FPB A;  1QUK A;  1N3W A;  5IZ3 B;  4EDP A;  4DXB A;  2QRY A;  2A5T A;  4P0G A;  5CBS A;  3U65 A;  4MIJ A;  1QJM A;  2A5S A;  3O6H A;  4X9T A;  2DVZ A;  3THI A;  5CM6 A;  5FHM A;  4H5G A;  1JEV A;  2F7C A;  3DP4 A;  4EXK A;  2RC7 A;  3KFM A;  2Q88 A;  2HCA A;  1USY H;  1B46 A;  2O1L A;  4N6P A;  3T93 B;  1B1X A;  1D9Y A;  1LB9 A;  1B0H A;  1A54 A;  4P1L A;  2DE3 A;  1DMB A;  4ELP A;  4O7I A;  4ZS9 A;  4KCD A;  1NL5 A;  3GLB A;  1LB8 A;  1IXG A;  4NF8 B;  4EUO A;  2ONS A;  4G8M A;  1Y4C A;  1LAH E;  1B5J A;  1FPI A;  4OYV A;  2Z22 A;  3N6U A;  3TTN A;  1II5 A;  3LUY A;  4E0W A;  4YKP A;  5FBP A;  1MRP A;  5TPA B;  1B4H A;  2NVU B;  5KCJ B;  3KEI A;  5K2Y A;  2X26 A;  1B3E A;  4U1O A;  2PFZ A;  5I2K A;  5ESY A;  1XI6 A;  1B58 A;  3FVN A;  4MFI A;  2O6A A;  1LBC A;  3D1R A;  3KOT A;  2H25 A;  2ZNT A;  4HE0 A;  3KC0 A;  2HXW A;  2FIX A;  4DXC A;  1FQF A;  2O68 A;  5DTB A;  3MUQ A;  4DXU A;  4OXV A;  4XEQ A;  2VGQ A;  3O29 A;  1NUX A;  1MY3 A;  1DK4 A;  2DYX A;  4R6Y A;  1A7L A;  2KLF A;  3MVZ A;  4OEV A;  1FPJ A;  5L9M A;  1JQF A;  4GXS B;  3VLV A;  1I6Q A;  2THI A;  4F3G A;  4IO2 A;  4O7M A;  2H4I A;  1B2H A;  3HHG A;  1BP5 A;  3KGC A;  3MBP A;  4KD5 A;  4OVS A;  4YZZ A;  3FUZ A;  4F3P A;  1WVJ A;  4R75 A;  3IOW A;  4R6H A;  2IA4 A;  3S4U A;  3QK6 A;  4RK2 A;  1G0H A;  4NWC A;  2RC9 A;  2WYK A;  4PDD A;  2ONK E;  3HV1 A;  3SZP A;  3G3I A;  3UGW A;  1I69 A;  5AA2 B;  5EYH A;  4QRZ A;  1LAF E;  1EZO A;  3O28 A;  1DPP A;  2I6E A;  1BLF A;  3B50 A;  2CZH A;  1URG A;  4FE8 A;  1B32 A;  3A09 A;  4P0I A;  1LFH A;  2UVH A;  3TEL A;  1QUI A;  3B7D A;  1SYI A;  3G3J A;  3T1B A;  3QIM A;  4JVI A;  3MP8 A;  1FTM A;  1S50 A;  3PPO A;  3E4R A;  1O63 A;  1KA1 A;  4N91 A;  4X04 A;  1RKM A;  1QVS A;  4DIG A;  2PVU A;  2Y5L A;  5T3J A;  1B3H A;  1OMP A;  3U72 A;  4GL8 A;  2XXP A;  2HAV A;  4EQ9 A;  1BTJ A;  3PUW E;  4FJP A;  4M4G A;  3JZJ A;  2QJE A;  1O64 A;  3R7X A;  3A29 A;  2HEU A;  4POW A;  3MAM A;  3FXU A;  1P99 A;  3MVX A;  3IR1 A;  2GRV A;  4DI3 D;  1HSE A;  1QUL A;  1MDP 1;  1LCT A;  1P1W A;  4OVJ A;  2Y7R A;  4RK9 A;  2D3I A;  1IMF A;  2NUV A;  3S9N C;  3E79 A;  4GQO A;  4MAG A;  3W9W A;  1QW0 A;  4AS4 A;  2UYE A;  4BDL A;  1DOT A;  4MHF A;  4H65 A;  2ZYM A;  5ITP A;  1N76 A;  2XXY A;  1FPD A;  3RT6 B;  4OVR A;  5EHS A;  4MMP A;  4ONY A;  1LBZ A;  2YJP A;  3U1O A;  3OEL A;  4F1V A;  3IFA A;  3K01 A;  4EQ7 A;  5CMM A;  5AE4 A;  2DSF A;  1VE4 A;  4F2Q A;  1XT8 A;  2P0S A;  1GR2 A;  1UIV A;  3G7W A;  5I2N B;  3EN3 A;  1FQA A;  2GQ1 A;  4P8B A;  4YKK A;  2XX8 A;  2CMO A;  1POT A;  4K3F A;  2ESN A;  4PFW A;  2F3B A;  4DDD A;  3C35 A;  4OHN A;  3GBB A;  5F7V A;  1XC1 A;  2B4L A;  4HE1 A;  5EQ7 A;  4PFT A;  1AWB A;  3PMV A;  3BIH A;  1G0I A;  4NF4 B;  4PE5 B;  1JP4 A;  3H6T A;  1FCK A;  3W9V A;  4PFB A;  1Z7M E;  4O3B A;  1SW2 A;  1B7U A;  4ZED A;  2CEY A;  4R74 A;  4NF5 A;  1LFI A;  1AMF A;  1NFT A;  4QXD A;  1B1H A;  1NUW A;  1B7H A;  3FZV A;  1MXZ A;  3K6X A;  5BUU A;  2WKY A;  4FEB A;  5H8H B;  4F22 A;  3T9U A;  1B51 A;  2I4B A;  1UTH A;  4ESW A;  5H8N B;  1F9B A;  2CZI A;  3HPI A;  3TYH A;  3CG1 A;  1Y1Z A;  3TCH A;  4FAJ A;  1TWY A;  3CR9 A;  3MWB A;  2D21 A;  1B4Z A;  4C0R A;  4GX4 A;  1AOV A;  1NNP A;  2QFL A;  1IQ7 A;  3I5O A;  5DVI A;  2XHD A;  4ELR A;  2Z23 A;  5H8F B;  1Y3Q A;  1A8E A;  4QFP A;  4JSO A;  3OO7 A;  3PPQ A;  1RYO A;  2Z8E A;  3PD9 A;  5I59 B;  1WOD A;  4ZEK A;  4IGR A;  5AA3 A;  2AIX A;  4EF2 A;  3E78 A;  3RN8 A;  4ECF A;  5CMB A;  4YB7 A;  4YMB A;  4GL0 A;  4IO3 A;  1Q35 A;  3FV1 A;  4LZ5 A;  2PX1 A;  3G3K A;  1ZIU A;  2PMS A;  3PUY E;  4NHB A;  3RUM A;  2I3W A;  4YAH X;  1VFD A;  2XXH A;  2GFE A;  4LN5 A;  3M3F A;  5L9O A;  3FBP A;  3OD7 A;  2H9B A;  3RYD A;  4UAB A;  2F6P A;  5H8Q B;  2B65 A;  3C34 A;  4R72 A;  1LBY A;  2DP8 A;  1ZU0 A;  3ILU B;  4IB2 A;  1DTZ A;  1JW4 A;  4F29 A;  3IOU A;  1P1Q A;  3IO6 A;  2NOO A;  4KCC A;  1FTK A;  1EZ9 A;  3B6W A;  3BFT A;  3IB1 A;  2ANJ A;  5I57 B;  4XKR A;  5LTC A;  1Y1M A;  2OK2 A;  4GWO A;  3TDJ A;  4BDQ A;  1PDA A;  2QSX A;  3KOS A;  1SW1 A;  5AA1 A;  3OO9 A;  4HCY A;  3I3V A;  5EQ8 A;  4GLI A;  1K9Y A;  5IZ3 A;  2R8T A;  2FBP A;  1NUZ A;  4Q30 B;  4NF6 B;  1R6Z A;  3B6Q A;  4PCD A;  3LSX A;  3U8Q A;  1IXI A;  4RXL A;  3VVE A;  5DW8 A;  3R6U A;  4PQJ A;  2UYF A;  3RY3 A;  2L5V A;  2FA7 A;  3QMF A;  4PBH A;  1M5D A;  4RYA A;  1EU8 A;  1LGB C;  1IXH A;  3JYR A;  1ELJ A;  4MNC A;  1R1N A;  2B3B A;  5A5X A;  3Q26 A;  4DCX A;  3OOA A;  4LP2 B;  3S2V A;  2ZYN A;  3ODB A;  3N5L A;  4NF8 A;  1GV8 A;  4U22 A;  3TTK A;  5ITO A;  1DTG A;  1FJ6 A;  3KBR A;  4YMA A;  3VVD A;  1I6A A;  3TEP A;  5TPA A;  2X7Q A;  3RPW A;  5ET8 A;  1USY E;  3CSB A;  4G68 A;  2Y7K A;  4GOT A;  4QFL A;  2R71 A;  3L6G A;  3QUF A;  2PT2 A;  2RIN A;  3CFX A;  3RQT A;  3SEV A;  2QS1 A;  2LAO A;  3RPL B;  4XXU A;  1SDX A;  1FSA A;  3FAT A;  1NNF A;  3IO4 A;  5BWJ A;  3M8U A;  4UA8 A;  3MPL A;  2F34 A;  3O2A A;  4TLL B;  3G3H A;  4LZ7 A;  5HBC A;  4H0W A;  1IEJ A;  1B5H A;  1FBF A;  2P2A A;  5EQ9 A;  4F1Y A;  3N6T A;  4OER A;  4XF5 A;  1M5E A;  2VD2 A;  5KDT B;  2DWI A;  5J1D A;  1NV0 A;  4ESX A;  4HTG A;  2XXT A;  1MQJ A;  1ZTY A;  2AL5 A;  4YKI A;  4NGU A;  4RPO A;  4NF0 A;  2BJJ X;  3H06 B;  3SEU A;  1LAX A;  4H8I A;  2ZZV A;  5DT6 A;  3E9X A;  2DWJ A;  1T0K A;  2DE4 A;  3TCG A;  1FBC A;  3PGF A;  2G93 A;  3CG3 A;  4ISU A;  2XXV A;  3ZKK A;  5AA2 A;  1TFD A;  4KI0 E;  1OLC A;  2PBW A;  4R73 A;  2PYY A;  1EYJ A;  3EQ1 A;  1GTK A;  1URS A;  5JEI A;  4BDN A;  2QS3 A;  1BIY A;  1LAG E;  4O3C A;  4P9K A;  3SET A;  5EYG A;  1PBQ A;  2WEF A;  3SKP A;  4OTE A;  1H45 A;  3A3U A;  5I3S A;  1N3X A;  1ZMG A;  2O7U A;  1PB7 A;  3O97 A;  3H6V A;  4OAN A;  3GXA A;  3HHF A;  3EHT A;  1LLS A;  1FBH A;  4I8C A;  2OZZ A;  2V3T A;  2ZMB A;  1HSJ A;  2ZYO A;  3OEN A;  2UVI A;  1PB8 A;  3CSG A;  3RGY A;  3K0V A;  2VHA A;  4OEU A;  3OXN A;  1FPK A;  3FJM A;  2XD3 A;  1B52 A;  2HQ0 A;  2B4M A;  3FV2 A;  4WKM A;  4QSE A;  4FEC A;  4GWS A;  1ANF A;  5H8S A;  2I4C A;  1QUJ A;  4YKJ A;  4QFN A;  2O69 A;  5JK4 A;  3PD8 A;  3VVF A;  4H1X A;  1SW5 A;  4NE4 A;  3MZ9 A;  2V84 A;  3K6V A;  1MQG A;  1EZP A;  5K2X A;  1B5I A;  2FHY A;  1UTB B;  2A5T B;  3FXQ A;  2XXQ A;  3K02 A;  3Q29 A;  5I58 B;  2Q89 A;  1MXW A;  2XA5 A;  2F7B A;  3IFC A;  3TZA A;  1FTO A;  1MH4 A;  3RLF E;  1YXI A;  3BBR A;  3C31 A;  4N6K A;  2HAU A;  2Y7P A;  5CC2 A;  4PE3 A;  3HO7 A;  4LQ2 A;  1Y9U A;  2UVJ A;  2Q2C A;  3LSL A;  4DLD A;  2Z8F A;  3MZ1 A;  3FAS A;  2PT1 A;  2XXI A;  3BKI B;  4H8J A;  3UP9 A;  4OEN A;  3PUZ E;  1B3L A;  5FTI A;  4PF8 A;  4YB5 A;  3H6U A;  1FPE A;  1Y4T A;  3MC2 A;  1YCJ A;  1M5F A;  3N26 A;  4U23 A;  1VFE A;  1ATG A;  1FTA A;  3PPN A;  2CZK A;  5AA4 B;  4X8R A;  5H8H A;  3IL1 B;  2O84 X;  2V3Q A;  2OCU A;  3LV0 A;  4Q5T A;  1DPE A;  2HFB A;  1CNQ A;  1MS7 A;  4JDF A;  4JWX A;  4QFK A;  1NH8 A;  1MM6 A;  1SVX B;  4NAP A;  4I3Y A;  3L6H A;  1TXF A;  3EPE A;  3EHS A;  1IZ1 A;  2QVU A;  4MF3 A;  4YIC A;  2QVV A;  4QF9 A;  2OJT A;  2B3F A;  2FNC A;  2ZYK A;  2V93 A;  1EYI A;  4H67 A;  2DWH A;  4Q8R A;  3DEL B;  4OFL A;  1OQH A;  3ZS6 A;  4IY5 A;  5I59 A;  2FYI A;  3KSJ A;  3K4U A;  4RPN A;  4PGN A;  2ZZW A;  4PFY A;  2IEE A;  1OVT A;  2Y5K A;  3WAE A;  3FIR A;  3Q25 A;  1SI0 A;  1RYX A;  1MQD A;  4L17 A;  4OVP A;  2F36 A;  1FTL A;  1MPC A;  1SQY A;  5IAI A;  3LC8 A;  3Q28 A;  5A5L A;  4RNS A;  1CE2 A;  2V3U A;  4PBQ A;  2XXR A;  1SBP A;  5H8Q A;  5JTY B;  2RCB A;  1NV5 A;  4G61 A;  5CI5 A;  2DOJ A;  3FJ7 A;  5ISU A;  4F31 B;  2XXW A;  4LVQ A;  1IMA A;  2XXU A;  1PEB A;  1IUD A;  2XWV A;  1S7Y A;  3TOD A;  4GWW A;  1H43 A;  4GWX A;  5I57 A;  1D9V A;  3QYT A;  3NOH A;  1IMC A;  4OET A;  2D5W A;  3G3G A;  2ZNU A;  4P47 A;  5ELV A;  2FIE A;  1OQG A;  5DEX A;  2F6G A;  3U93 A;  3UOR A;  2OWT A;  2WX9 A;  3V8X B;  1OVB A;  4N4U A;  1PB9 A;  1IIT A;  1FBP A;  2F35 A;  4P56 A;  2OX3 A;  5KZT A;  2R9J A;  4EXL A;  5J16 A;  2ONR A;  4ND9 A;  1JW5 A;  1IXC A;  1NV2 A;  3MP6 A;  1PBP A;  2XWO A;  1AL3 A;  1MG1 A;  3ISP A;  2OWS A;  4IGT A;  1URD A;  1ZLQ A;  3MYU A;  4M1V A;  3OO6 A;  1NMU A;  3IX1 A;  2VT5 A;  4PF6 A;  3O6I A;  3IOV A;  3QAX A;  3BIG A;  3TTL A;  4MBP A;  3UA8 A;  4H5F A;  4BLA A;  1GVC A;  5ET5 A;  5I56 B;  5LDZ A;  3TUS A;  4R9F A;  2E0S A;  3AXF A;  1VR5 A;  3OEM A;  4OVQ A;  4N81 A;  4TQU Q;  1BK4 A;  2KR0 A;  5EYF A;  4F3S A;  3FJG A;  1US5 A;  3TAJ A;  1JEU A;  4E0X A;  2HZK A;  5CRY A;  2XD2 A;  3CIJ A;  4NN3 A;  1FBE A;  4Z0I A;  2ZNS A;  3SES A;  1FRP A;  4R2F A;  3RNN A;  4KR5 A;  3E3K A;  4PFR A;  4KYE A;  4NTL A;  3BFU A;  1NKX A;  2GH9 A;  1MDQ A;  3TTM A;  1FTJ A;  4H45 A;  3K00 A;  4KHZ E;  4QSC A;  3T96 B;  1XOC A;  5TP9 B;  1HSL A;  5FHN A;  3O66 A;  4GVO A;  4JXI A;  1RDX A;  4OZ9 A;  1ZKB A;  3D4G A;  1K9Z A;  1MY4 A;  2NWJ A;  2I0B A;  1NNT A;  4OWD A;  4NF5 B;  2VOZ A;  5I84 A;  3DP6 A;  3LBS A;  3S9M C;  2DQV A;  4Z7E A;  1N04 A;  1Y3N A;  4O3A A;  3U92 A;  3DLN A;  4TOZ A;  4WEP A;  1LFG A;  1MY2 A;  3CFL A;  1UTH B;  3T9V A;  3KN8 A;  1NV1 A;  3ILT B;  4F19 A;  4LUB A;  1Y3P A;  3B8B A;  3MST A;  4G4P A;  4U4X A; 
#chains in the Genus database with same CATH homology
 5EHM A;  3VLU A;  2Y7I A;  4XTC Q;  1FQE A;  3QUJ A;  2QS2 A;  3T9H B;  4IO4 A;  2Z8D A;  2Y84 A;  4C1T A;  2ABH A;  3PPP A;  4DCY A;  3B6T A;  2REJ A;  2O51 A;  3TFL A;  5KCJ A;  3V5A A;  3SEY A;  3TQW A;  1EH3 A;  4F2O A;  3MVY A;  4NMY A;  2I48 A;  3USD A;  3CI8 A;  1OLA A;  3Q27 A;  3HST A;  4G8H A;  4Q0C A;  4C1U A;  4AB6 A;  4LA9 A;  1UQW A;  1B3F A;  1PC3 A;  4F1U A;  4ZE8 A;  5DVF A;  3S9E A;  4AB5 A;  1N84 A;  1Z7N E;  1Q1K A;  5ICQ A;  3ZKL A;  2I58 A;  4ZE9 A;  5HM4 B;  3TMG A;  1A8F A;  2I3V A;  3CRB A;  4IO5 A;  4KPT A;  4KYS A;  5FTH A;  5DYH A;  1P1N A;  3TCF A;  3H3G A;  1J1N A;  2M8C A;  1UTB A;  2DS9 A;  1XS5 A;  2RKM A;  5TU0 A;  5I58 A;  4RY1 A;  2OLB A;  1BKA A;  4U4S A;  4FOR A;  1N0T A;  4JBZ A;  4ZZA A;  4THI A;  3H03 A;  2I49 A;  1FQB A;  5A5X B;  1QKA A;  2Q8J A;  3GBA A;  3C9H A;  3ECR A;  2QMX A;  3V89 B;  2RCA A;  1B05 A;  4IY6 A;  4UAC A;  1MXY A;  3MPK A;  1Y20 A;  3QSL A;  4XKQ A;  4R9G A;  1O7T A;  3OEK A;  3KN3 A;  3LSF B;  1LST A;  1GGG A;  2E1S A;  3TQL A;  5AA4 A;  4XKP A;  3T22 A;  5DVJ A;  4G68 B;  4JWY A;  2XX9 A;  1YAE A;  3UIF A;  3C4M A;  3TPA A;  1KWH A;  5LOM A;  4NED A;  4I1D A;  4GF8 A;  3OMB A;  1A40 A;  3PUV E;  3UK4 A;  5FHO A;  2P1S A;  5M2V A;  3O9P A;  4PP0 A;  4OFJ A;  1DSN A;  4F39 A;  4EQB A;  1A55 A;  1YPN A;  2Q2A A;  3VFJ A;  3TTR A;  4YB6 A;  4U21 A;  2VP1 A;  3KN7 A;  4X1B A;  1I6B A;  2UXA A;  4ZDM A;  3C33 A;  3O6G A;  4I62 A;  5I2N A;  3FXR A;  1WDN A;  2F7A A;  4XKN A;  1M5C A;  1MQI A;  2YPN A;  2H5Y A;  3IAZ A;  4FED A;  4PFU A;  3VDF A;  1R9L A;  3MP1 A;  3TKD A;  4QSD A;  1P1U A;  1B7Z A;  5JTY A;  3PPR A;  1A99 A;  1MM7 A;  4NF4 A;  3EHU A;  5L8D A;  4RJZ A;  3FVG A;  3DM0 A;  1JVX A;  5ICT A;  1B40 A;  1FQD A;  5CMK A;  2F97 A;  2DWA A;  3KZG A;  4X1D A;  3R26 A;  1MPD A;  2VD3 A;  3U94 A;  5I2K B;  3KJT A;  3PMX A;  1QKB A;  5H8N A;  3D4C A;  1NH7 A;  4IO7 A;  2AYS A;  4PET A;  2OBG A;  1JW1 A;  4LON B;  3I6V A;  1JVY A;  4LZ8 A;  3UN6 A;  3PU5 A;  5CBR A;  5H8F A;  3IJO B;  2QPQ A;  1CB6 A;  1LCF A;  1JNF A;  1H44 A;  2O1M A;  1B6H A;  2GHA A;  4ZEI A;  5I56 A;  1LBB A;  3VLW A;  2F5X A;  3LSW A;  4N07 A;  3H6W A;  2H98 A;  1MY1 A;  3F11 A;  3VXC A;  2ZXT A;  2I0C A;  4YU0 A;  3MVW A;  3G3F A;  3ZSF A;  5AA2 D;  2RF1 A;  3VV5 A;  1XHY A;  1B9J A;  4IO6 A;  1YTV A;  3IOT A;  4G2Z A;  3K1P A;  3OO8 A;  3PMW A;  3C32 A;  3JV9 A;  2X7P A;  5F1Q A;  1TFA A;  1TT1 A;  1XVX A;  3VXB A;  2R6G E;  4DZ1 A;  4TLM B;  4G77 A;  2REG A;  5TP9 A;  1B0L A;  2O7I A;  3K6U A;  4F3B A;  2QMW A;  4U1Z A;  4X48 A;  1XVY A;  3IK6 B;  4WED A;  1H76 A;  3IB0 A;  2AL4 A;  3EF7 A;  3H7M A;  4NF6 A;  4HW8 A;  1UIU A;  1MH3 A;  3CFZ A;  2GHB A;  1VSO A;  4RA1 A;  1MY0 A;  1H3D A;  3MQ9 A;  3CVG A;  4U2R A;  4BDM A;  4EF1 A;  2W7Y A;  4OQO A;  3RT8 A;  3A3C A;  3KSX A;  3GZG A;  4R2B A;  2DXR A;  1SYH A;  3IOR A;  1L5T A;  4LQ5 A;  5B70 A;  3H4Z A;  5B7D A;  4GIZ A;  3RTW B;  4ZEF A;  4AQ4 A;  3K2D A;  2YLN A;  2DE2 A;  3OSQ A;  2DXY A;  4HS7 A;  1MPB A;  4JB7 A;  3T9X B;  4POX A;  1MXX A;  3W15 C;  4I9D A;  4ZEC A;  3KJ7 A;  2H99 A;  3MZB A;  1N7X A;  3SDF A;  3S9L C;  2QS4 A;  1FQC A;  3FD3 A;  3PV0 E;  3T66 A;  4G68 C;  4GD5 A;  2ALU A;  3HN0 A;  3MW0 A;  1JET A;  3K1N A;  1OIB A;  5L9S A;  4QHQ A;  3M3K A;  3RTF B;  1SD3 A;  1SW4 A;  2G29 A;  1US4 A;  4ELO A;  5KDT A;  2HZL A;  4QFO A;  3FGS A;  4GRK A;  4HCW A;  3K1M A;  4WXJ A;  4H6D A;  3ONM A;  3PUX E;  5DEX B;  3IJX B;  5IKB A;  1D3K A;  3KG2 A;  1ZBM A;  4OFO A;  1N7W A;  1FW0 A;  5HPQ A;  4R6K A;  4JWO A;  1M5B A;  4MH5 A;  4ZEB A;  3M3L A;  3N94 A;  3LR1 A;  4KFQ A;  1NNK A;  3MJN A;  2NXO A;  1MQH A;  3C36 A;  3WAF A;  1B3G A;  4MLQ A;  3IB2 A;  4ELQ A;  4OES A;  3OSR A;  2F78 A;  3K6W A;  4DE8 A;  1S9T A;  4FIM A;  2Y7W A;  4N13 A;  4OMB A;  1AIV A;  3DP8 A;  3FVO A;  2Q9T A;  4KYD A;  3VE1 B;  2UVG A;  3V83 A;  1R9Q A;  5CMC A;  4G8N A;  4FAT A;  2F8D A;  1D4N A;  1MXU A;  2CZL A;  4BDR A;  1AH5 A;  3SEX A;  4LAT A;  2RC8 A;  3P7I A;  3SEW A;  3FVK A;  4ZZE A;  2DVC A;  1SI1 A;  4NWD A;  3HCQ A;  2QL3 A;  4XIG Q;  2XX7 A;  4BDO A;  1ZJL A;  4KQP A;  4MLV A;  3E13 X;  4P11 A;  1IIW A;  2V25 A;  1POY 1;  3QXM A;  2XXX A;  4GXA A;  4GFR A;  4JSD A;  3SER A;  4F18 A;  1MXV A;  1P1O A;  1QUK A;  1N3W A;  4EDP A;  4DXB A;  2QRY A;  2A5T A;  4P0G A;  5CBS A;  1QJM A;  2A5S A;  3O6H A;  4X9T A;  2DVZ A;  3THI A;  5CM6 A;  5FHM A;  4H5G A;  1JEV A;  2F7C A;  3DP4 A;  4EXK A;  2RC7 A;  3KFM A;  2Q88 A;  2HCA A;  1USY H;  1B46 A;  2O1L A;  4N6P A;  3T93 B;  1B1X A;  1D9Y A;  1LB9 A;  1B0H A;  1A54 A;  2DE3 A;  1DMB A;  4ELP A;  4ZS9 A;  4KCD A;  1NL5 A;  3GLB A;  1LB8 A;  1IXG A;  4NF8 B;  4EUO A;  2ONS A;  4G8M A;  1Y4C A;  1LAH E;  1B5J A;  4OYV A;  2Z22 A;  3N6U A;  3TTN A;  1II5 A;  3LUY A;  4E0W A;  4YKP A;  1MRP A;  5TPA B;  1B4H A;  2NVU B;  5KCJ B;  3KEI A;  5K2Y A;  2X26 A;  1B3E A;  4U1O A;  5I2K A;  1B58 A;  3FVN A;  4MFI A;  2O6A A;  1LBC A;  3KOT A;  2H25 A;  2ZNT A;  2HXW A;  4DXC A;  1FQF A;  4DXU A;  2O68 A;  3MUQ A;  5DTB A;  4OXV A;  2VGQ A;  3O29 A;  1MY3 A;  2DYX A;  4R6Y A;  1A7L A;  2KLF A;  3MVZ A;  4OEV A;  5L9M A;  1JQF A;  4GXS B;  3VLV A;  1I6Q A;  2THI A;  4F3G A;  4IO2 A;  2H4I A;  1B2H A;  3HHG A;  1BP5 A;  3KGC A;  3MBP A;  4KD5 A;  4YZZ A;  3FUZ A;  4F3P A;  1WVJ A;  4R75 A;  3IOW A;  4R6H A;  2IA4 A;  3S4U A;  3QK6 A;  4RK2 A;  4NWC A;  2RC9 A;  2ONK E;  3HV1 A;  3G3I A;  3UGW A;  1I69 A;  5AA2 B;  4QRZ A;  1LAF E;  1EZO A;  3O28 A;  1DPP A;  2I6E A;  1BLF A;  1URG A;  4FE8 A;  1B32 A;  3A09 A;  4P0I A;  1LFH A;  2UVH A;  3TEL A;  1QUI A;  3B7D A;  1SYI A;  3G3J A;  3QIM A;  3MP8 A;  1FTM A;  1S50 A;  3PPO A;  3E4R A;  1O63 A;  1RKM A;  1QVS A;  4DIG A;  2PVU A;  1B3H A;  1OMP A;  3U72 A;  4GL8 A;  2XXP A;  2HAV A;  4EQ9 A;  1BTJ A;  3PUW E;  4FJP A;  4M4G A;  3JZJ A;  2QJE A;  1O64 A;  3R7X A;  2HEU A;  4POW A;  3MAM A;  3FXU A;  1P99 A;  3MVX A;  3IR1 A;  2GRV A;  1HSE A;  1QUL A;  1MDP 1;  1LCT A;  1P1W A;  4OVJ A;  2Y7R A;  4RK9 A;  2D3I A;  2NUV A;  3S9N C;  4GQO A;  3W9W A;  1QW0 A;  2UYE A;  4BDL A;  1DOT A;  4H65 A;  2ZYM A;  5ITP A;  1N76 A;  2XXY A;  3RT6 B;  5EHS A;  4ONY A;  2YJP A;  3U1O A;  3OEL A;  4F1V A;  3K01 A;  4EQ7 A;  5CMM A;  5AE4 A;  2DSF A;  1VE4 A;  4F2Q A;  1XT8 A;  2P0S A;  1GR2 A;  1UIV A;  3G7W A;  5I2N B;  3EN3 A;  1FQA A;  4YKK A;  2XX8 A;  2CMO A;  1POT A;  4K3F A;  2ESN A;  4PFW A;  4DDD A;  3C35 A;  4OHN A;  3GBB A;  5F7V A;  1XC1 A;  4PFT A;  3PMV A;  4NF4 B;  4PE5 B;  3H6T A;  1FCK A;  3W9V A;  1Z7M E;  4O3B A;  1SW2 A;  1B7U A;  4ZED A;  4R74 A;  4NF5 A;  1LFI A;  1AMF A;  1NFT A;  1B1H A;  1B7H A;  3FZV A;  1MXZ A;  3K6X A;  5BUU A;  2WKY A;  4FEB A;  5H8H B;  4F22 A;  3T9U A;  1B51 A;  2I4B A;  1UTH A;  4ESW A;  5H8N B;  1F9B A;  3HPI A;  3TYH A;  3CG1 A;  1Y1Z A;  3TCH A;  4FAJ A;  1TWY A;  3CR9 A;  3MWB A;  2D21 A;  1B4Z A;  4C0R A;  1AOV A;  1NNP A;  1IQ7 A;  3I5O A;  5DVI A;  2XHD A;  4ELR A;  2Z23 A;  5H8F B;  1Y3Q A;  1A8E A;  4QFP A;  4JSO A;  3OO7 A;  3PPQ A;  1RYO A;  2Z8E A;  3PD9 A;  5I59 B;  1WOD A;  4ZEK A;  4IGR A;  5AA3 A;  2AIX A;  4EF2 A;  3RN8 A;  4ECF A;  5CMB A;  4YB7 A;  4YMB A;  4GL0 A;  4IO3 A;  1Q35 A;  3FV1 A;  4LZ5 A;  2PX1 A;  3G3K A;  1ZIU A;  2PMS A;  3PUY E;  3RUM A;  2I3W A;  4YAH X;  1VFD A;  2XXH A;  2GFE A;  3M3F A;  5L9O A;  3OD7 A;  2H9B A;  2F6P A;  5H8Q B;  2B65 A;  3C34 A;  4R72 A;  2DP8 A;  1ZU0 A;  3ILU B;  4IB2 A;  1DTZ A;  1JW4 A;  4F29 A;  3IOU A;  1P1Q A;  3IO6 A;  2NOO A;  4KCC A;  1FTK A;  1EZ9 A;  3B6W A;  3BFT A;  3IB1 A;  2ANJ A;  5I57 B;  4XKR A;  1Y1M A;  2OK2 A;  4GWO A;  3TDJ A;  4BDQ A;  1PDA A;  2QSX A;  3KOS A;  1SW1 A;  5AA1 A;  3OO9 A;  4HCY A;  3I3V A;  4GLI A;  4Q30 B;  4NF6 B;  1R6Z A;  3B6Q A;  3LSX A;  3U8Q A;  1IXI A;  4RXL A;  3VVE A;  3R6U A;  4PQJ A;  2UYF A;  3RY3 A;  2FA7 A;  1M5D A;  4RYA A;  1EU8 A;  1LGB C;  1IXH A;  3JYR A;  1ELJ A;  1R1N A;  2B3B A;  5A5X A;  3Q26 A;  4DCX A;  3OOA A;  4LP2 B;  3S2V A;  2ZYN A;  3ODB A;  3N5L A;  4NF8 A;  1GV8 A;  4U22 A;  3TTK A;  5ITO A;  1DTG A;  3KBR A;  4YMA A;  3VVD A;  1I6A A;  3TEP A;  5TPA A;  2X7Q A;  3RPW A;  1USY E;  3CSB A;  4G68 A;  2Y7K A;  4GOT A;  4QFL A;  2R71 A;  3L6G A;  3QUF A;  2PT2 A;  2RIN A;  3CFX A;  3RQT A;  3SEV A;  2QS1 A;  2LAO A;  4XXU A;  1SDX A;  3FAT A;  1NNF A;  3IO4 A;  5BWJ A;  3M8U A;  3MPL A;  4UA8 A;  2F34 A;  3O2A A;  4TLL B;  3G3H A;  4LZ7 A;  5HBC A;  4H0W A;  1IEJ A;  1B5H A;  2P2A A;  4F1Y A;  3N6T A;  4OER A;  1M5E A;  2VD2 A;  5KDT B;  2DWI A;  5J1D A;  4ESX A;  4HTG A;  2XXT A;  1MQJ A;  1ZTY A;  2AL5 A;  4YKI A;  4RPO A;  2BJJ X;  3H06 B;  3SEU A;  1LAX A;  4H8I A;  5DT6 A;  3E9X A;  2DWJ A;  1T0K A;  2DE4 A;  3TCG A;  3PGF A;  2G93 A;  3CG3 A;  4ISU A;  2XXV A;  3ZKK A;  5AA2 A;  1TFD A;  4KI0 E;  1OLC A;  2PBW A;  4R73 A;  2PYY A;  3EQ1 A;  1GTK A;  1URS A;  5JEI A;  4BDN A;  2QS3 A;  1BIY A;  1LAG E;  4O3C A;  3SET A;  1PBQ A;  3SKP A;  4OTE A;  1H45 A;  3A3U A;  1N3X A;  1ZMG A;  2O7U A;  1PB7 A;  3O97 A;  3H6V A;  3GXA A;  3HHF A;  3EHT A;  1LLS A;  4I8C A;  2OZZ A;  2V3T A;  2ZMB A;  1HSJ A;  2ZYO A;  3OEN A;  2UVI A;  1PB8 A;  3CSG A;  3RGY A;  3K0V A;  2VHA A;  4OEU A;  3OXN A;  3FJM A;  2XD3 A;  1B52 A;  2HQ0 A;  3FV2 A;  4WKM A;  4QSE A;  4FEC A;  1ANF A;  5H8S A;  2I4C A;  1QUJ A;  4YKJ A;  4QFN A;  2O69 A;  5JK4 A;  3PD8 A;  3VVF A;  4H1X A;  1SW5 A;  4NE4 A;  3MZ9 A;  2V84 A;  3K6V A;  1MQG A;  1EZP A;  5K2X A;  1B5I A;  1UTB B;  2A5T B;  3FXQ A;  2XXQ A;  3K02 A;  3Q29 A;  5I58 B;  2Q89 A;  1MXW A;  2F7B A;  3TZA A;  1FTO A;  1MH4 A;  3RLF E;  3BBR A;  3C31 A;  2HAU A;  2Y7P A;  5CC2 A;  3HO7 A;  4LQ2 A;  1Y9U A;  2UVJ A;  2Q2C A;  3LSL A;  4DLD A;  2Z8F A;  3MZ1 A;  3FAS A;  2PT1 A;  2XXI A;  3BKI B;  4H8J A;  3UP9 A;  4OEN A;  3PUZ E;  1B3L A;  5FTI A;  4YB5 A;  3H6U A;  1Y4T A;  3MC2 A;  1YCJ A;  1M5F A;  3N26 A;  4U23 A;  1VFE A;  1ATG A;  3PPN A;  5AA4 B;  5H8H A;  3IL1 B;  2O84 X;  2V3Q A;  2OCU A;  1DPE A;  4Q5T A;  2HFB A;  1MS7 A;  4JDF A;  4JWX A;  4QFK A;  1NH8 A;  1MM6 A;  1SVX B;  3L6H A;  1TXF A;  3EPE A;  3EHS A;  1IZ1 A;  4MF3 A;  4YIC A;  4QF9 A;  2OJT A;  2B3F A;  2FNC A;  2ZYK A;  2V93 A;  4H67 A;  2DWH A;  4Q8R A;  3DEL B;  4OFL A;  1OQH A;  3ZS6 A;  4IY5 A;  5I59 A;  2FYI A;  3KSJ A;  3K4U A;  4RPN A;  4PFY A;  2IEE A;  1OVT A;  3WAE A;  3FIR A;  3Q25 A;  1SI0 A;  1RYX A;  1MQD A;  4L17 A;  2F36 A;  1FTL A;  1MPC A;  1SQY A;  5IAI A;  3LC8 A;  3Q28 A;  4RNS A;  1CE2 A;  2V3U A;  2XXR A;  1SBP A;  5H8Q A;  5JTY B;  2RCB A;  5CI5 A;  2DOJ A;  3FJ7 A;  5ISU A;  4F31 B;  2XXW A;  4LVQ A;  2XXU A;  1PEB A;  1IUD A;  1S7Y A;  3TOD A;  1H43 A;  5I57 A;  1D9V A;  3QYT A;  4OET A;  2D5W A;  3G3G A;  2ZNU A;  5ELV A;  1OQG A;  5DEX A;  2F6G A;  3U93 A;  3UOR A;  2OWT A;  3V8X B;  1OVB A;  1PB9 A;  1IIT A;  2F35 A;  5KZT A;  2R9J A;  4EXL A;  2ONR A;  4ND9 A;  1JW5 A;  1IXC A;  3MP6 A;  1PBP A;  1AL3 A;  1MG1 A;  2OWS A;  4IGT A;  1ZLQ A;  1URD A;  4M1V A;  3OO6 A;  1NMU A;  3IX1 A;  3O6I A;  3IOV A;  3QAX A;  3TTL A;  4MBP A;  3UA8 A;  4H5F A;  4BLA A;  1GVC A;  5I56 B;  3TUS A;  4R9F A;  2E0S A;  3AXF A;  1VR5 A;  3OEM A;  4TQU Q;  5EYF A;  4F3S A;  3FJG A;  1US5 A;  3TAJ A;  1JEU A;  4E0X A;  2HZK A;  5CRY A;  2XD2 A;  3CIJ A;  4Z0I A;  2ZNS A;  3SES A;  4R2F A;  3RNN A;  4KR5 A;  3E3K A;  4KYE A;  4NTL A;  3BFU A;  1NKX A;  2GH9 A;  1MDQ A;  3TTM A;  1FTJ A;  3K00 A;  4KHZ E;  4QSC A;  3T96 B;  1XOC A;  5TP9 B;  1HSL A;  5FHN A;  3O66 A;  4GVO A;  4JXI A;  4OZ9 A;  1ZKB A;  3D4G A;  1MY4 A;  2NWJ A;  2I0B A;  1NNT A;  4OWD A;  4NF5 B;  2VOZ A;  5I84 A;  3DP6 A;  3LBS A;  3S9M C;  2DQV A;  4Z7E A;  1N04 A;  1Y3N A;  4O3A A;  3U92 A;  3DLN A;  1LFG A;  4TOZ A;  4WEP A;  1MY2 A;  3CFL A;  1UTH B;  3T9V A;  3KN8 A;  3ILT B;  4F19 A;  4LUB A;  1Y3P A;  4G4P A;  4U4X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...