3G3GA

Crystal structure of the glur6 ligand binding domain dimer k665r mutant with glutamate and nacl at 1.3 angstrom resolution
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
256
structure length
253
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKRSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWRCP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2
publication title Stability of ligand-binding domain dimer assembly controls kainate receptor desensitization.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 84
structure length 253
sequence length 256
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-02-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3g3gA02
1B5HA 4F1YA 1CB6A 1N7WA 3OO9A 4HCYA 3PV0E 5F1QA 3MVYA 4K3FA 4OVJA 1MXYA 2XHDA 2I48A 1B58A 2I58A 1NL5A 4BDMA 3S9NC 4YB5A 3B6TA 2ONKE 3Q26A 1MQIA 4AB5A 3PPOA 1B1XA 4F18A 3N6TA 1VSOA 2XD2A 3BFTA 4IY6A 5AA2D 1TFAA 3C32A 5H8HB 2O69A 1VE4A 2Y7IA 1QUIA 4YMAA 1Y3NA 4ZEBA 5H8HA 4JWYA 1QKBA 5JK4A 4MBPA 1UTBB 2XXWA 1MPBA 1NNPA 4LONB 3MVXA 4OFJA 3H03A 3TQWA 1B7UA 4LVQA 1UTBA 1OVTA 1XVYA 1MH4A 1O64A 1UIVA 1RYOA 4RXLA 3HHFA 3K01A 1LFGA 3M3LA 5IKBA 4EQ9A 4GL0A 3IK6B 3AXFA 3V89B 4ZE9A 1MQHA 3T9XB 2PBWA 3HV1A 4GVOA 1A7LA 5L9MA 4M1VA 5CMCA 3PGFA 2PMSA 1VR5A 4Q30B 3GXAA 3VXCA 4F3BA 3S9LC 5I84A 4TLMB 1SYHA 3FJ7A 4GL8A 3N6UA 2P2AA 1ZJLA 2OLBA 2H5YA 1I6AA 4KYEA 3IX1A 1XHYA 4I1DA 3SEVA 3K00A 1MQJA 4WKMA 3CFLA 3O6HA 3OEKA 4UACA 4G68B 5LOMA 4NTLA 4NEDA 4GXAA 2Q2CA 4RA1A 5DVFA 1JW5A 4YAHX 3U93A 4H8IA 2HZLA 1US4A 4I62A 4G68A 1AIVA 1B7ZA 1A8FA 4QF9A 3ZKKA 4R6KA 1S50A 1URGA 1GR2A 3K6UA 4RPNA 4OXVA 2V3UA 3LC8A 1UQWA 5K2XA 3EHSA 3TEPA 2AL5A 3RT6B 2XX7A 1DMBA 2H98A 3IL1B 1OVBA 3CSBA 3KJ7A 4GLIA 3F11A 1B7HA 4IY5A 4N07A 2B3FA 3G7WA 2PVUA 4U1ZA 1LB9A 3VVEA 2DWHA 5H8FB 1TWYA 2R9JA 1USYE 1VFEA 3QAXA 4LZ8A 4ELRA 3UORA 3R7XA 3IJXB 5H8FA 1BKAA 1GV8A 1MXZA 1RYXA 3ONMA 3MVZA 1A54A 4KPTA 4PP0A 3HO7A 2OCUA 3MAMA 1DTZA 1MDQA 1UTHB 1LAFE 1OLAA 4YZZA 2Z8FA 2HAUA 5I56B 4XKQA 4U2RA 2ABHA 3K6WA 1N76A 1UTHA 3KOTA 4C1TA 3SEYA 5I56A 1FQFA 3K1MA 4KI0E 4P0GA 3M8UA 3PD9A 5ICQA 1GVCA 2O6AA 2XXXA 3MP1A 4QSDA 3OMBA 3IORA 3KZGA 1AL3A 1SDXA 3K1PA 2GRVA 2Z8DA 1R1NA 2HAVA 4LATA 1DTGA 4ZEKA 2ZYNA 4TOZA 2Y7RA 3N5LA 3S4UA 3EPEA 1PBQA 4YICA 3K6VA 3FGSA 1IUDA 3FVGA 3PPNA 4QFKA 5DVJA 2ZNTA 3HCQA 3IOWA 1FQEA 5ISUA 4RK2A 3PUWE 3T9UA 3IO4A 2F6GA 2QSXA 2Q9TA 3M3KA 2NUVA 3O97A 2DWIA 3FATA 3SDFA 3E13X 1D4NA 4G2ZA 3TYHA 1MY3A 1LBCA 4G8MA 1FCKA 1ZTYA 4GD5A 2QPQA 1I6BA 4H8JA 3FVNA 2I4BA 1N04A 2FYIA 2P0SA 2PT1A 4DLDA 4JSDA 4GQOA 3PUYE 4TLLB 5I2KA 1MY0A 2VHAA 5DTBA 2XXRA 4YB6A 3OOAA 3U8QA 2M8CA 1H3DA 3QK6A 2NWJA 2HEUA 3VE1B 4JSOA 4EF1A 4R72A 1BIYA 2XXTA 1B3GA 3GBAA 5ELVA 4ZS9A 3KGCA 1VFDA 5CMBA 1M5DA 3T9HB 4O3AA 5H8QA 4U23A 5I2NB 5CI5A 4XXUA 1B5JA 1EZ9A 3FZVA 4R2FA 3PMXA 2V84A 4ZE8A 3QUFA 5I58A 5I2NA 4U22A 2F7AA 5ITOA 4EDPA 4AQ4A 3S9EA 2PYYA 1MXXA 3RQTA 3CG1A 2F36A 3SEXA 1FTLA 2DYXA 2CZLA 4KYDA 4R6YA 2RF1A 3FV2A 4R2BA 1FTKA 1LBBA 1EU8A 2KLFA 3KFMA 1JQFA 5FHMA 3ZS6A 4QFOA 4THIA 2F35A 4F3GA 2X7PA 2VP1A 4RY1A 5AE4A 5TP9B 3VDFA 4P0IA 1MXUA 4LZ5A 3TELA 3I3VA 1PBPA 3RUMA 2D5WA 2CMOA 2Z23A 4XKPA 4IGTA 5TP9A 3WAEA 3T93B 3FXRA 3OSRA 2RCBA 1OQHA 1PEBA 4MFIA 2X7QA 3RTFB 3P7IA 3O6GA 4E0WA 1D3KA 3HN0A 1QUKA 4LA9A 4F2QA 3UGWA 5EHSA 1LB8A 1WODA 4F31B 1CE2A 3QYTA 1UIUA 3TAJA 4F29A 4NMYA 5BUUA 4ECFA 4R73A 4YKIA 4DE8A 1R6ZA 1LFHA 4MH5A 4RYAA 1MY4A 2ZYMA 1SI0A 1IXGA 2RC7A 1ATGA 3VLUA 3V83A 3E9XA 4RPOA 4LP2B 1NH7A 3TTKA 3IO6A 2F8DA 4ESXA 1MH3A 1ZLQA 2ONSA 4GIZA 4X9TA 2I3WA 2XXHA 1OQGA 1N3WA 4FORA 4Q8RA 3PUVE 3TUSA 2GH9A 2G93A 1PB7A 3IB2A 4QFNA 1QKAA 4Z0IA 1YTVA 1TFDA 1XT8A 4LUBA 2XXYA 1B6HA 1B32A 3DP4A 4PFTA 2REGA 2OWTA 2V93A 5HM4B 4PFYA 4DZ1A 2ANJA 2XX9A 1DPEA 4XKNA 1OMPA 3C35A 3K0VA 1MM6A 3RPWA 4OESA 4XKRA 1HSJA 1R9LA 4ZEIA 3IOVA 3TTLA 4YKJA 1FQDA 4NWDA 2V25A 3CRBA 2RC8A 4F2OA 2H4IA 3MZ9A 5FHOA 4ZZEA 1T0KA 3TKDA 1P1NA 4F22A 4MF3A 4KD5A 2QS3A 3CG3A 3KN8A 1SW1A 1SVXB 2WKYA 2G29A 1P1OA 1LSTA 3PPQA 2DXRA 4GWOA 1S9TA 1ANFA 4IO4A 3L6GA 1PB8A 4QFPA 1Y20A 1B5IA 2VD3A 4QRZA 3OEMA 3C34A 1P99A 1EZPA 4PFWA 4RNSA 2ZNUA 3HHGA 4OFLA 4ELOA 4FATA 3FUZA 1DPPA 1N84A 1WDNA 4NF8B 4IO2A 1H43A 4N6PA 4Q5TA 5EHMA 1JW4A 3A3UA 4U21A 4F3PA 3UK4A 3U1OA 5ITPA 4NF8A 1IXHA 4OYVA 4NWCA 2NXOA 1N7XA 5CM6A 4QHQA 3N26A 1RKMA 2UVIA 2ALUA 3CSGA 3CIJA 1USYH 1B3FA 1QW0A 5AA3A 1XVXA 5CMKA 4F19A 3H6VA 5A5XB 1H45A 2XXUA 5AA4A 4OHNA 3ZKLA 3Q27A 1FTMA 5L8DA 2O7UA 2OWSA 4BDRA 2Z22A 3U92A 3SERA 3ECRA 5AA2B 5A5XA 2DVCA 4KCDA 5EYFA 1MG1A 1A40A 1M5FA 2RCAA 2Y7WA 5KZTA 4YKKA 3RT8A 3N94A 3QSLA 5I57B 5AA2A 4DXBA 2F97A 3DP6A 4OENA 1Y4CA 3O2AA 4GOTA 4MLQA 5I57A 4OERA 1B51A 4NF5B 4LQ5A 4OFOA 1JETA 4OEUA 2PT2A 2F6PA 2XD3A 1N0TA 4DXCA 3MWBA 2YJPA 2AL4A 3BBRA 4NF5A 3H4ZA 4U1OA 1SQYA 1FW0A 1NKXA 2AYSA 4YMBA 5KDTB 3SETA 1JEVA 4UA8A 4F1VA 3VVFA 5CC2A 1POY1 2A5SA 5KDTA 4JDFA 3LR1A 1IITA 3D4CA 4R9FA 3MC2A 3TMGA 1PC3A 1B1HA 3E4RA 4HW8A 4WXJA 4G8NA 3FD3A 3S2VA 3RY3A 3LSWA 3K02A 3QXMA 4F39A 1Y1MA 3C31A 4I8CA 4IGRA 1MQGA 4X1BA 3MVWA 1XS5A 2H25A 5I2KB 2OK2A 1LGBC 2UVGA 3GLBA 3MPLA 4HTGA 4EQ7A 2ONRA 3SEWA 5BWJA 4RK9A 3GZGA 1SI1A 2YLNA 1PDAA 1GTKA 3QUJA 4N13A 5H8NB 3U72A 1US5A 1JW1A 1ZU0A 3HPIA 3VLWA 1A55A 1AMFA 3W15C 5H8SA 5H8NA 1Q1KA 2A5TA 3MP8A 4LZ7A 5H8QB 3OO6A 3KOSA 4ELPA 1P1WA 2Y7PA 3FXUA 3Q29A 4X48A 5I58B 4IB2A 4G77A 2UYFA 1LAGE 4F3SA 3E3KA 4FIMA 2HCAA 3W9WA 1AOVA 1SBPA 3FJGA 4NF4B 4JXIA 4FE8A 3BFUA 3CR9A 3DLNA 3G3JA 4H5GA 4KR5A 4NF4A 2QL3A 3GBBA 3EQ1A 5L9OA 1JEUA 3SKPA 1NNTA 3RNNA 1MQDA 1F9BA 1SD3A 3U94A 4EXKA 4BDOA 4LQ2A 2B65A 1BTJA 4JWXA 1FQBA 1QUJA 2XXIA 1MPDA 4P11A 1EH3A 4H6DA 3I5OA 1YCJA 3SEUA 1XOCA 2VOZA 3OXNA 3IJOB 3G3FA 1Y3PA 2XXQA 3FJMA 2O68A 5B70A 3LUYA 5DVIA 4YKPA 3IOUA 5CMMA 3UP9A 1MY1A 1ZBMA 1IQ7A 1B05A 3MPKA 4BLAA 2QS2A 2VGQA 4KYSA 3TTNA 4L17A 1MXWA 1JNFA 3H3GA 4X1DA 3LSXA 2DXYA 3FV1A 4EF2A 2FNCA 2DP8A 1B40A 4XIGQ 1XC1A 4O3CA 3MQ9A 4NF6B 5ICTA 4QFLA 4KHZE 2HZKA 3IB1A 3KJTA 3PUZE 1P1UA 3K2DA 4ND9A 1ZIUA 1D9YA 3BKIB 3HSTA 4NF6A 3ZSFA 3PPRA 1NMUA 2QJEA 2QRYA 5JEIA 3FVOA 4M4GA 1O63A 2GFEA 1H44A 3A09A 2UVHA 1O7TA 2QMXA 3RTWB 3VVDA 3I6VA 1NNFA 2H99A 1TXFA 4ISUA 2F78A 5HPQA 3UIFA 2GHAA 1NNKA 4FJPA 5DYHA 3KN3A 1JVYA 3DM0A 4HCWA 3C9HA 4F1UA 3O6IA 4ELQA 4OZ9A 1IXIA 3VXBA 1Y1ZA 5M2VA 3R26A 4H5FA 4PFUA 4FEBA 4MLVA 5CBSA 1A8EA 4G4PA 3MW0A 3ILUB 5JTYB 3RGYA 3S9MC 1BLFA 1LCFA 3RN8A 1B9JA 3TCGA 2RINA 4ESWA 2BJJX 1M5EA 3DELB 1FQCA 1P1QA 4BDLA 5JTYA 5I59B 4IO5A 1GGGA 3KEIA 1Y4TA 2O84X 2ESNA 1URDA 3B6WA 3DP8A 3CVGA 2E0SA 5I59A 1JVXA 1KWHA 1HSLA 4GF8A 4U4SA 4ZZAA 2RKMA 1L5TA 1Y3QA 1YPNA 4Q0CA 4C1UA 4ZEFA 3MZ1A 4EUOA 1MXVA 1IEJA 3TTRA 3LSFB 5HBCA 3OENA 2D3IA 4DCYA 1II5A 2THIA 3O66A 3V5AA 3K6XA 1LCTA 2FA7A 4R9GA 1BP5A 2DS9A 2HFBA 2ZYOA 2DQVA 2O7IA 1URSA 2V3QA 4WEDA 3MZBA 2UYEA 3T9VA 4RJZA 4OTEA 2R71A 3LSLA 2F34A 3THIA 1B3EA 1SW5A 3C33A 1DSNA 1MDP1 4XTCQ 1FTOA 4WEPA 2ZXTA 4FECA 3K4UA 1FQAA 1OLCA 4KCCA 2QS4A 2RC9A 2O51A 5DT6A 4BDNA 1B3HA 3OD7A 3B6QA 2Y7KA 2DSFA 3L6HA 2UXAA 2B3BA 3OO8A 2Y84A 3H7MA 4ZDMA 4ZECA 3MBPA 2I3VA 5AA4B 5J1DA 1I6QA 2HQ0A 4KFQA 3ILTB 2V3TA 2ZNSA 4JWOA 3PMWA 5K2YA 2F7CA 2R6GE 3RLFE 3PPPA 3Q25A 2OJTA 3M3FA 2I49A 2LAOA 4FEDA 3UN6A 1SW2A 3TCFA 3OSQA 1Z7ME 2ZMBA 3KSXA 4JBZA 3IB0A 2DOJA 2GHBA 5TPAB 3VLVA 3PUXE 4NE4A 5F7VA 2I4CA 3TFLA 1B4HA 3FVKA 4QSEA 1FTJA 3EHTA 1MPCA 4IO3A 2W7YA 2F7BA 5TPAA 1MY2A 1OIBA 4O3BA 3KSJA 2E1SA 1LLSA 3T66A 2REJA 3QIMA 3O28A 4EQBA 4IO6A 2F5XA 1LFIA 1B46A 3JYRA 2DE4A 3IAZA 4TQUQ 3MP6A 4BDQA 2XXPA 4POWA 3G3GA 2Q89A 3A3CA 2Q88A 3H06B 1MM7A 2Q8JA 2Z8EA 3TQLA 2PX1A 2I0CA 3TODA 3CFXA 3UA8A 5AA1A 2DVZA 2QS1A 1B0HA 3VV5A 3CFZA 3G3IA 2Q2AA 4QSCA 3TCHA 3MJNA 4OETA 2HXWA 3G3KA 4R6HA 4E0XA 2OBGA 2XXVA 2AIXA 1R9QA 4H1XA 2DE2A 1QVSA 1Z7NE 3OO7A 2VD2A 2YPNA 5FTIA 4R75A 3G3HA 3B7DA 4JB7A 2QMWA 2DWJA 5FHNA 1B3LA 4I9DA 1S7YA 3PMVA 1Y9UA 3K1NA 2DE3A 2A5TB 3C4MA 4ONYA 2DWAA 2IEEA 3H6TA 3JZJA 4OWDA 1LAXA 1Q35A 3WAFA 4EXLA 5DEXB 3LBSA 3W9VA 2O1MA 2O1LA 1ZMGA 3KN7A 5CBRA 4OEVA 4R74A 5DEXA 1ELJA 5IAIA 2IA4A 4H65A 1TT1A 3OELA 1IIWA 3KG2A 1A99A 4DIGA 1HSEA 4OQOA 4HS7A 1PB9A 1SYIA 4KQPA 2UVJA 3O29A 3TDJA 3TPAA 3SESA 4U4XA 1I69A 3ODBA 2X26A 3T22A 2XX8A 4YB7A 5B7DA 1WVJA 3EF7A 1NFTA 1LAHE 3O9PA 1YAEA 2NOOA 3IOTA 4DXUA 1MS7A 1M5BA 4OMBA 1DOTA 1M5CA 3FASA 4YU0A 4PE5B 1N3XA 3R6UA 4POXA 1POTA 1QJMA 4GXSB 1B52A 3EN3A 3VFJA 4H67A 1SW4A 3CI8A 3PU5A 4GFRA 5TU0A 1IXCA 4G68C 3USDA 3TZAA 4GRKA 3Q28A 2H9BA 3H6WA 1AH5A 4AB6A 1D9VA 5CRYA 3FIRA 5KCJB 4C0RA 2NVUB 3FXQA 3T96B 4H0WA 4G8HA 3EHUA 3PD8A 1NH8A 1B2HA 4DCXA 5KCJA 5L9SA 1IZ1A 1ZKBA 2OZZA 1J1NA 4Z7EA 3IR1A 4IO7A 3V8XB 2I6EA 1B0LA 2P1SA 4PQJA 4DDDA 4FAJA 1H76A 2I0BA 4PETA 3D4GA 1EZOA 3KBRA 3TTMA 3C36A 2ZYKA 3H6UA 1B4ZA 2D21A 5FTHA 1MRPA 3MUQA 3JV9A 1QULA 4ZEDA
chains in the Genus database with same CATH superfamily
1B5HA 4F1YA 5DW8A 1CB6A 1N7WA 3OO9A 4HCYA 3PV0E 5F1QA 3MVYA 4N15A 4K3FA 4OVJA 1MXYA 2XHDA 2I48A 1B58A 2I58A 1NL5A 4PFBA 4BDMA 3S9NC 4YB5A 3B6TA 2ONKE 3Q26A 5F24A 1MQIA 4AB5A 3PPOA 1B1XA 4F18A 3N6TA 1VSOA 2XD2A 3BFTA 4IY6A 5AA2D 1TFAA 3C32A 5H8HB 2O69A 1VE4A 2Y7IA 1QUIA 1SPIA 4YMAA 1Y3NA 4ZEBA 5H8HA 2XWOA 4JWYA 1QKBA 5JK4A 4MBPA 1UTBB 2XXWA 1CNQA 1MPBA 4GX3A 1NNPA 4LONB 3MVXA 4OFJA 3H03A 3TQWA 1B7UA 4LVQA 1UTBA 1OVTA 1XVYA 1MH4A 1O64A 1UIVA 1RYOA 4RXLA 3HHFA 3K01A 1LFGA 3M3LA 5IKBA 4EQ9A 4GL0A 3IK6B 3AXFA 3V89B 4ZE9A 1MQHA 3T9XB 2PBWA 3HV1A 4GVOA 1A7LA 5L9MA 2QFLA 4MX6A 4M1VA 5CMCA 3PGFA 4P1EA 2PMSA 1VR5A 3B50A 4Q30B 3GXAA 3VXCA 4F3BA 2XWIA 4PAFA 3S9LC 5I84A 1RDYA 5EYHA 4TLMB 1SYHA 3FJ7A 4GL8A 3N6UA 4O94A 2P2AA 1ZJLA 2XA5A 2B4LA 1FBFA 2OLBA 2H5YA 1I6AA 4KYEA 3IX1A 4PDDA 4GX4A 1XHYA 4I1DA 3SEVA 3K00A 1MQJA 4WKMA 4FBPA 3SZPA 4I3EA 3CFLA 3O6HA 3OEKA 4UACA 3E79A 4G68B 5LOMA 4NTLA 4NEDA 4GXAA 2Q2CA 4RA1A 5DVFA 1JW5A 4YAHX 3U93A 4H8IA 2HZLA 1US4A 4I62A 4G68A 1AIVA 1B7ZA 1A8FA 4QF9A 3ZKKA 4R6KA 1S50A 1RDZA 1URGA 1GR2A 4QBAA 2XWVA 3K6UA 4RPNA 4OXVA 2V3UA 3LC8A 1UQWA 5K2XA 3EHSA 3TEPA 2AL5A 3RT6B 2XX7A 3LUZA 1DMBA 2H98A 3IL1B 1OVBA 3CSBA 3KJ7A 4GLIA 3F11A 1B7HA 4IY5A 4N07A 2B3FA 3G7WA 2PVUA 4U1ZA 1LB9A 3VVEA 2DWHA 5H8FB 1TWYA 2R9JA 1FBPA 1USYE 1VFEA 3QAXA 4N81A 4LZ8A 4ELRA 3UORA 3R7XA 3IJXB 5H8FA 1BKAA 1GV8A 3HFUA 1MXZA 1RYXA 3ONMA 4PC9A 5A5LA 3MVZA 1A54A 2FBPA 4KPTA 4PP0A 3HO7A 2OCUA 3MAMA 1DTZA 1MDQA 1UTHB 1LAFE 4PDHA 1OLAA 4YZZA 2Z8FA 2HAUA 5I56B 4XKQA 4U2RA 2ABHA 3K6WA 1N76A 1UTHA 3KOTA 4C1TA 3SEYA 5I56A 1FQFA 2XWKA 3K1MA 4KI0E 4P0GA 4P47A 3M8UA 3PD9A 5ICQA 1GVCA 2O6AA 2XXXA 3MP1A 4QSDA 3OMBA 3IORA 3KZGA 1AL3A 1SDXA 3K1PA 2GRVA 1RDXA 2Z8DA 1R1NA 2HAVA 4LATA 1DTGA 4ZEKA 3QMFA 2ZYNA 4TOZA 2Y7RA 2ZZVA 3N5LA 3S4UA 3EPEA 1PBQA 4P1LA 4YICA 3K6VA 3FGSA 2CZIA 1IUDA 3FVGA 3PPNA 4QFKA 5DVJA 2ZNTA 3HCQA 3IOWA 1FQEA 4N91A 5ISUA 1NV6A 4RK2A 3PUWE 3T9UA 3IO4A 2F6GA 2QSXA 2Q9TA 3ROJA 3M3KA 2NUVA 3O97A 4PF8A 2CEYA 2DWIA 3FATA 3SDFA 3E13X 2F3DA 1D4NA 4G2ZA 3TYHA 1MY3A 1LBCA 4G8MA 1FCKA 1ZTYA 4GD5A 3T1BA 2QPQA 4X8RA 1I6BA 4H8JA 3FVNA 2I4BA 1N04A 2FYIA 2P0SA 2PT1A 4AS4A 4DLDA 4JSDA 4GQOA 3PUYE 4TLLB 5I2KA 1MY0A 2VHAA 5DTBA 5J16A 2XXRA 4YB6A 3OOAA 3U8QA 2M8CA 1H3DA 4IR8A 3QK6A 2NWJA 2HEUA 3VE1B 4JSOA 4EF1A 4R72A 1BIYA 2XXTA 1B3GA 3GBAA 5ELVA 4JVDA 4ZS9A 3KGCA 1VFDA 5CMBA 4GWUA 3MSTA 1M5DA 1LBZA 3T9HB 4O3AA 5H8QA 4U23A 5I2NB 1XI6A 5CI5A 4XXUA 1B5JA 1EZ9A 3FZVA 4R2FA 3PMXA 4OA4A 5ET8A 1FBDA 2V84A 4ZE8A 3QUFA 5I58A 4I3YA 5I2NA 5IZZA 4U22A 2F7AA 5ITOA 4EDPA 4AQ4A 4DI4B 3S9EA 2PYYA 1MXXA 3RQTA 3CG1A 2F36A 3SEXA 1FTLA 2DYXA 2CZLA 1DK4A 3CHGA 1FJ9A 4KYDA 4R6YA 2RF1A 3FV2A 4R2BA 1FTKA 1LBBA 1EU8A 2KLFA 3KFMA 1JQFA 5FHMA 3ZS6A 4QFOA 4THIA 2F35A 4F3GA 2X7PA 2VP1A 4RY1A 5AE4A 5LTCA 4GWZA 5TP9B 3VDFA 4P0IA 1MXUA 4LZ5A 3TELA 3I3VA 1PBPA 3RUMA 2D5WA 2CMOA 2Z23A 4XKPA 4IGTA 5TP9A 3WAEA 3T93B 3FXRA 3OSRA 2RCBA 1OQHA 1PEBA 4MFIA 4OVPA 2X7QA 3LV0A 4I40A 2WYPA 1IMFA 3RTFB 3P7IA 3O6GA 4E0WA 1D3KA 3HN0A 1QUKA 4LA9A 4F2QA 3UGWA 4MIJA 5EHSA 1LB8A 4HE0A 1WODA 4F31B 1CE2A 3QYTA 1UIUA 3TAJA 4F29A 4NMYA 4MHFA 5BUUA 4N6DA 4ECFA 2MKZA 4R73A 4YKIA 4DE8A 1R6ZA 1LFHA 4MH5A 4RYAA 5I5PA 1MY4A 3IFCA 2ZYMA 2PCRA 1SI0A 1IXGA 1FBGA 2RC7A 1ATGA 3U65A 3VLUA 3V83A 3E9XA 4RPOA 4LP2B 1NH7A 2JJKA 3TTKA 3IO6A 2F8DA 5ET5A 4ESXA 1MH3A 1ZLQA 2ONSA 2CZHA 4GIZA 4X9TA 2I3WA 2XXHA 1OQGA 1N3WA 4FORA 4Q8RA 3PUVE 3TUSA 2GH9A 1DCUA 4QXDA 2G93A 1EYIA 1PB7A 3IB2A 4QFNA 1QKAA 4Z0IA 1YTVA 1TFDA 1EYKA 1XT8A 4LUBA 1LBVA 2XXYA 1B6HA 1B32A 3DP4A 4PFTA 2REGA 2OWTA 2V93A 5HM4B 4PFYA 1FJ6A 4DZ1A 2ANJA 2XX9A 1NUYA 5IM2A 1DPEA 4XKNA 1OMPA 3C35A 4PF6A 3K0VA 1MM6A 1NV7A 1FTAA 1FPLA 3RPWA 4OESA 4XKRA 1HSJA 1R9LA 4ZEIA 1FPGA 3IOVA 3TTLA 4YKJA 1FQDA 4NWDA 2V25A 3CRBA 2RC8A 4F2OA 2H4IA 3MZ9A 5FHOA 4ZZEA 1T0KA 4MCOA 4AS5A 3TKDA 1P1NA 4X04A 4F22A 4MF3A 4KD5A 2QS3A 3CG3A 3KN8A 4KXPA 1SW1A 1SVXB 3EKIA 2WKYA 2FVZA 4P3LA 4XF5A 2G29A 5LDZA 1P1OA 1LSTA 3PPQA 4H46A 2DXRA 4GWOA 1S9TA 4MJOA 2B4MA 1ANFA 4IO4A 3L6GA 4G61A 1PB8A 2BJIA 4QFPA 1Y20A 1B5IA 2VD3A 4QRZA 3OEMA 3C34A 1P99A 1EZPA 4PFWA 4RNSA 2ZNUA 3HHGA 4OFLA 4ELOA 2HXRA 4FATA 3FUZA 1DPPA 1N84A 1WDNA 4NHBA 4NF8B 5EQ8A 2Y5LA 4IO2A 4GX6A 1H43A 4N6PA 4Q5TA 3MYUA 5EHMA 1JW4A 3A3UA 4U21A 4F3PA 1FPEA 3UK4A 3U1OA 5ITPA 4OVSA 4XEQA 4NF8A 4OANA 1IXHA 4OYVA 4NWCA 4NX1A 2NXOA 1N7XA 5CM6A 4QHQA 3N26A 4OVTA 1RKMA 2UVIA 5ESYA 2ALUA 1NV5A 3CSGA 3A29A 4HE2A 3CIJA 1EYJA 2OX3A 2VPNA 1USYH 2ZZXA 1B3FA 1QW0A 5AA3A 1XVXA 1AWBA 5CMKA 4F19A 3H6VA 5A5XB 1H45A 2XXUA 1IMDA 5AA4A 4OHNA 3ZKLA 4XFEA 3Q27A 1FTMA 5L8DA 2O7UA 2OWSA 4BDRA 2Z22A 3U92A 4P9KA 3SERA 3ECRA 5AA2B 1IMBA 2DVCA 5A5XA 4KCDA 5EYFA 1MG1A 1A40A 1M5FA 2RCAA 2Y7WA 5KZTA 4YKKA 3RT8A 3N94A 4PFIA 3QSLA 5I57B 5AA2A 4DXBA 2F97A 3DP6A 4PBHA 4NF0A 4OENA 1Y4CA 3O2AA 4GOTA 4MLQA 5I57A 4OERA 1B51A 4NF5B 4LQ5A 4OFOA 1JETA 2CEXA 4OEUA 5FBPA 2PT2A 2F6PA 2XD3A 1N0TA 4DXCA 3MWBA 2YJPA 2AL4A 3BBRA 4NF5A 3H4ZA 4U1OA 1SQYA 2Y5KA 1FW0A 1NKXA 2AYSA 4YMBA 2CZKA 5KDTB 3SETA 3PTYA 1LEVA 1JEVA 4UA8A 4F1VA 3VVFA 5CC2A 1POY1 2A5SA 5KDTA 4JDFA 3LR1A 1IITA 3D4CA 4R9FA 3MC2A 3TMGA 1PC3A 1B1HA 3E4RA 2F3BA 4HW8A 4WXJA 4G8NA 3FD3A 3S2VA 3RY3A 3LSWA 3BIHA 3K02A 2GQ1A 3QXMA 2OWZA 4F39A 1Y1MA 3C31A 4I8CA 4IGRA 4PGNA 1MQGA 4X1BA 4MMPA 3MVWA 1XS5A 2H25A 5I2KB 2OK2A 1LGBC 2UVGA 3GLBA 3MPLA 4HTGA 4EQ7A 2ONRA 3SEWA 5BWJA 4RK9A 3GZGA 1SI1A 2YLNA 1PDAA 1GTKA 4PBQA 3QUJA 4N13A 5H8NB 3U72A 1US5A 1JW1A 1ZU0A 3HPIA 3VLWA 1A55A 1AMFA 3W15C 4N8GA 1FRPA 5H8SA 5H8NA 1FBEA 1Q1KA 4PAIA 2A5TA 3MP8A 4LZ7A 5H8QB 3OO6A 3B8BA 3KOSA 4ELPA 1P1WA 2Y7PA 1NUZA 3FXUA 3Q29A 4X48A 5I58B 4IB2A 4G77A 2UYFA 4GWYA 1LAGE 4F3SA 3E3KA 4FIMA 1YZ0A 2HCAA 3W9WA 1AOVA 1SBPA 5T3JA 3FJGA 4NF4B 4JXIA 4FE8A 3BFUA 3CR9A 3DLNA 3G3JA 4H5GA 2ZZWA 4KR5A 2WBBA 4NF4A 2QL3A 3GBBA 1NV0A 3ISPA 3EQ1A 5L9OA 1JEUA 3SKPA 1NNTA 3FXBA 3RNNA 5IZ3B 1MQDA 3T0JA 4NG7A 1F9BA 1SD3A 3U94A 4EXKA 4HXVA 5I7IA 4BDOA 4LQ2A 5IZ3A 2B65A 1BTJA 4JWXA 1FQBA 1QUJA 2XXIA 1MPDA 4P11A 1EH3A 4GWXA 4H6DA 1K9ZA 1NV1A 3I5OA 1YCJA 3SEUA 1XOCA 2VOZA 3OXNA 3IJOB 3G3FA 1Y3PA 2XXQA 3FJMA 2O68A 5B70A 5IGAA 2QVVA 3LUYA 3D1RA 5DVIA 4YKPA 3IOUA 5CMMA 4OVQA 3UP9A 1MY1A 1ZBMA 1IQ7A 1B05A 2WYKA 3MPKA 4BLAA 2QS2A 2VGQA 4KYSA 3TTNA 1G0IA 4L17A 1MXWA 1IMEA 1JNFA 3H3GA 4X1DA 3LSXA 2DXYA 1NV4A 3FV1A 2FNCA 4EF2A 2DP8A 3FBPA 1B40A 4XIGQ 4P56A 1XC1A 4O3CA 3MQ9A 4NF6B 5ICTA 4QFLA 1INPA 4KHZE 2HZKA 3IB1A 3KJTA 3PUZE 1P1UA 3K2DA 4ND9A 1FPFA 2VPOA 1ZIUA 1D9YA 2P3NA 3BKIB 3HSTA 4NF6A 3ZSFA 3PPRA 1NMUA 2QJEA 2QRYA 2PFYA 3RPLB 5JEIA 3FVOA 4M4GA 1O63A 2GFEA 1H44A 3A09A 2UVHA 1O7TA 2QMXA 4PFRA 3RTWB 4GWSA 3RPLA 3VVDA 3I6VA 4GWWA 1NNFA 2H99A 1TXFA 4MAGA 4ISUA 4N6KA 2V4CA 2F78A 5HPQA 3RYDA 3UIFA 2GHAA 1NNKA 3IFAA 4FJPA 5DYHA 3KN3A 1JVYA 3DM0A 4HCWA 3C9HA 4F1UA 3O6IA 4ELQA 4OZ9A 1IXIA 2QVRA 3VXBA 1Y1ZA 5M2VA 3R26A 4H5FA 4PFUA 4MNPA 4FEBA 1YYZA 4MLVA 5CBSA 1A8EA 4G4PA 3MW0A 3ILUB 5JTYB 3RGYA 3S9MC 1BLFA 1LCFA 3RN8A 1B9JA 3TCGA 2RINA 4ESWA 2BJJX 1M5EA 3DELB 1FQCA 1P1QA 4BDLA 5JTYA 5I59B 4IO5A 1GGGA 3KEIA 1Y4TA 2O84X 1LBWA 1FSAA 2WX9A 2ESNA 1URDA 3B6WA 3DP8A 3BIGA 3CVGA 2E0SA 3NOHA 4PCDA 5I59A 1JVXA 1KWHA 1HSLA 1FPJA 4GF8A 4U4SA 4ZZAA 3GYYA 2RKMA 1L5TA 1Y3QA 4MEVA 1YPNA 1G0HA 4Q0CA 1YXIA 4ZEDA 4C1UA 4ZEFA 3MZ1A 4EUOA 1MXVA 1IEJA 3TTRA 3LSFB 4N4UA 5HBCA 3OENA 2D3IA 4DCYA 1II5A 2THIA 3O66A 3V5AA 3K6XA 1LCTA 2FA7A 2FIXA 4R9GA 1BP5A 2DS9A 2HFBA 5EQ9A 2ZYOA 2DQVA 2O7IA 1URSA 1FPBA 2V3QA 4WEDA 3MZBA 3KBZA 2UYEA 2R8TA 3T9VA 1FBHA 4RJZA 4OTEA 2R71A 3LSLA 2F34A 3THIA 1B3EA 1SW5A 4PAKA 3C33A 4N17A 1DSNA 1MDP1 4XTCQ 1FTOA 4WEPA 2ZXTA 4FECA 3K4UA 5EQAA 4GBVA 1FQAA 1OLCA 4KCCA 2QS4A 2P3VA 2RC9A 2O51A 5DT6A 4BDNA 1B3HA 5ET6A 3OD7A 3B6QA 2Y7KA 2DSFA 3L6HA 2UXAA 2B3BA 3OO8A 4MNIA 2Y84A 3H7MA 4ZDMA 4ZECA 5EQ7A 3MBPA 2I3VA 5AA4B 1FPIA 5J1DA 1Q9DA 1I6QA 2HQ0A 2KR0A 4KFQA 3ILTB 2V3TA 2ZNSA 4JWOA 2Q8MA 3PMWA 5K2YA 2F7CA 4LN5A 4GBWA 2R6GE 3RLFE 3E78A 1LBYA 3PPPA 3Q25A 4O7MA 5I3SA 2OJTA 2QVUA 1FBCA 3M3FA 2I49A 2LAOA 4FEDA 3UN6A 1VDWA 1SW2A 3TCFA 3OSQA 1Z7ME 2ZMBA 3KSXA 4JBZA 3IB0A 2DOJA 2GHBA 5TPAB 3VLVA 3PUXE 2L5VA 4NE4A 4UABA 5F7VA 2I4CA 3TFLA 1B4HA 3FVKA 4QSEA 1FTJA 5ET7A 3EHTA 1MPCA 4IO3A 2W7YA 2F7BA 4O8MA 5TPAA 1MY2A 1NV2A 1OIBA 1KZ8A 4O3BA 3KSJA 2E1SA 1LLSA 3T66A 2REJA 3QIMA 3O28A 4EQBA 3KC1A 4IO6A 2F5XA 1LFIA 1NUXA 1B46A 3JYRA 2DE4A 1KA1A 3IAZA 4TQUQ 3MP6A 4BDQA 4N8YA 1NV3A 2XXPA 4H45A 2WBDA 4POWA 3G3GA 2Q89A 1BK4A 3A3CA 2Q88A 3H06B 1MM7A 2Q8JA 2Z8EA 3TQLA 2PX1A 4NGUA 2I0CA 3TODA 3CFXA 3UA8A 5AA1A 2DVZA 2QS1A 1B0HA 3VV5A 3CFZA 4NQ8A 3G3IA 2Q2AA 2Q74A 4QSCA 3TCHA 3MJNA 4OETA 2HXWA 1FPDA 2DDKA 3G3KA 4R6HA 4E0XA 2OBGA 2XXVA 2AIXA 1KA0A 1R9QA 4H1XA 2DE2A 1QVSA 1Z7NE 3OO7A 2VD2A 1IMAA 2YPNA 5FTIA 4R75A 3G3HA 3B7DA 4JB7A 4NN3A 2QMWA 2DWJA 5FHNA 1B3LA 4I9DA 1S7YA 3PMVA 1Y9UA 4P8BA 3K1NA 2DE3A 2A5TB 2WEFA 3C4MA 3KC0A 4ONYA 2DWAA 2IEEA 3H6TA 4MNCA 3JZJA 4OWDA 1LAXA 1Q35A 3WAFA 4EXLA 5DEXB 3LBSA 3W9VA 2FIEA 4O7IA 2O1MA 2O1LA 1ZMGA 3KN7A 1NUWA 5CBRA 4OEVA 1JP4A 4R74A 5DEXA 1ELJA 5IAIA 2HPGA 2IA4A 4H65A 1TT1A 3OELA 1IIWA 4PGPA 3KG2A 1A99A 4DIGA 1HSEA 4OQOA 4HS7A 1PB9A 1SYIA 4KQPA 2UVJA 3O29A 5EYGA 3TDJA 4DI3D 3TPAA 1NI9A 3SESA 4U4XA 1I69A 3ODBA 2X26A 3T22A 2VT5A 1FPKA 2XX8A 4YB7A 5B7DA 1WVJA 3EF7A 1NFTA 1LAHE 3O9PA 1YAEA 2NOOA 3IOTA 4PTKA 4DXUA 1MS7A 1IMCA 1M5BA 4OMBA 1DOTA 1M5CA 3FASA 4YU0A 4PE5B 1N3XA 3R6UA 4JVCA 4POXA 1POTA 1QJMA 4GXSB 4JVIA 1B52A 3EN3A 3VFJA 4H67A 1SW4A 3CI8A 3PU5A 4GFRA 5TU0A 1IXCA 2FHYA 2HHMA 4G68C 4GRKA 3TZAA 3USDA 3Q28A 5IZ1A 2H9BA 3H6WA 1AH5A 4AB6A 1D9VA 3FIRA 5KCJB 4C0RA 2NVUB 4OVRA 3FXQA 3T96B 4HE1A 4H0WA 4G8HA 3EHUA 3PD8A 1NH8A 1B2HA 4DCXA 5KCJA 5L9SA 1IZ1A 1K9YA 1ZKBA 2PFZA 2OZZA 1J1NA 1DBZA 4Z7EA 4PE3A 3IR1A 4IO7A 3V8XB 2XXKA 2I6EA 1B0LA 2P1SA 4PQJA 4DDDA 4FAJA 1H76A 2I0BA 4PETA 1D9QA 3D4GA 1EZOA 3KBRA 3TTMA 3C36A 2ZYKA 1QGXA 3H6UA 1B4ZA 2D21A 5FTHA 1MRPA 1LBXA 3MUQA 2KQZA 3JV9A 1QULA 4NAPA 5CRYA
chains in the Genus database with same CATH topology
1B5HA 4F1YA 1CB6A 1N7WA 3OO9A 4HCYA 3PV0E 5F1QA 3MVYA 4K3FA 4OVJA 1MXYA 2XHDA 2I48A 1B58A 2I58A 1NL5A 4BDMA 3S9NC 4YB5A 3B6TA 2ONKE 3Q26A 1MQIA 4AB5A 3PPOA 1B1XA 4F18A 3N6TA 1VSOA 2XD2A 3BFTA 4IY6A 5AA2D 1TFAA 3C32A 5H8HB 2O69A 1VE4A 2Y7IA 1QUIA 4YMAA 1Y3NA 4ZEBA 5H8HA 4JWYA 1QKBA 5JK4A 4MBPA 1UTBB 2XXWA 1MPBA 1NNPA 4LONB 3MVXA 4OFJA 3H03A 3TQWA 1B7UA 4LVQA 1UTBA 1OVTA 1XVYA 1MH4A 1O64A 1UIVA 1RYOA 4RXLA 3HHFA 3K01A 1LFGA 3M3LA 5IKBA 4EQ9A 4GL0A 3IK6B 3AXFA 3V89B 4ZE9A 1MQHA 3T9XB 2PBWA 3HV1A 4GVOA 1A7LA 5L9MA 4M1VA 5CMCA 3PGFA 2PMSA 1VR5A 4Q30B 3GXAA 3VXCA 4F3BA 3S9LC 5I84A 4TLMB 1SYHA 3FJ7A 4GL8A 3N6UA 2P2AA 1ZJLA 2OLBA 2H5YA 1I6AA 4KYEA 3IX1A 1XHYA 4I1DA 3SEVA 3K00A 1MQJA 4WKMA 3CFLA 3O6HA 3OEKA 4UACA 4G68B 5LOMA 4NTLA 4NEDA 4GXAA 2Q2CA 4RA1A 5DVFA 1JW5A 4YAHX 3U93A 4H8IA 2HZLA 1US4A 4I62A 4G68A 1AIVA 1B7ZA 1A8FA 4QF9A 3ZKKA 4R6KA 1S50A 1URGA 1GR2A 3K6UA 4RPNA 4OXVA 2V3UA 3LC8A 1UQWA 5K2XA 3EHSA 3TEPA 2AL5A 3RT6B 2XX7A 1DMBA 2H98A 3IL1B 1OVBA 3CSBA 3KJ7A 4GLIA 3F11A 1B7HA 4IY5A 4N07A 2B3FA 3G7WA 2PVUA 4U1ZA 1LB9A 3VVEA 2DWHA 5H8FB 1TWYA 2R9JA 1USYE 1VFEA 3QAXA 4LZ8A 4ELRA 3UORA 3R7XA 3IJXB 5H8FA 1BKAA 1GV8A 1MXZA 1RYXA 3ONMA 3MVZA 1A54A 4KPTA 4PP0A 3HO7A 2OCUA 3MAMA 1DTZA 1MDQA 1UTHB 1LAFE 1OLAA 4YZZA 2Z8FA 2HAUA 5I56B 4XKQA 4U2RA 2ABHA 3K6WA 1N76A 1UTHA 3KOTA 4C1TA 3SEYA 5I56A 1FQFA 3K1MA 4KI0E 4P0GA 3M8UA 3PD9A 5ICQA 1GVCA 2O6AA 2XXXA 3MP1A 4QSDA 3OMBA 3IORA 3KZGA 1AL3A 1SDXA 3K1PA 2GRVA 2Z8DA 1R1NA 2HAVA 4LATA 1DTGA 4ZEKA 2ZYNA 4TOZA 2Y7RA 3N5LA 3S4UA 3EPEA 1PBQA 4YICA 3K6VA 3FGSA 1IUDA 3FVGA 3PPNA 4QFKA 5DVJA 2ZNTA 3HCQA 3IOWA 1FQEA 5ISUA 4RK2A 3PUWE 3T9UA 3IO4A 2F6GA 2QSXA 2Q9TA 3M3KA 2NUVA 3O97A 2DWIA 3FATA 3SDFA 3E13X 1D4NA 4G2ZA 3TYHA 1MY3A 1LBCA 4G8MA 1FCKA 1ZTYA 4GD5A 2QPQA 1I6BA 4H8JA 3FVNA 2I4BA 1N04A 2FYIA 2P0SA 2PT1A 4DLDA 4JSDA 4GQOA 3PUYE 4TLLB 5I2KA 1MY0A 2VHAA 5DTBA 2XXRA 4YB6A 3OOAA 3U8QA 2M8CA 1H3DA 3QK6A 2NWJA 2HEUA 3VE1B 4JSOA 4EF1A 4R72A 1BIYA 2XXTA 1B3GA 3GBAA 5ELVA 4ZS9A 3KGCA 1VFDA 5CMBA 1M5DA 3T9HB 4O3AA 5H8QA 4U23A 5I2NB 5CI5A 4XXUA 1B5JA 1EZ9A 3FZVA 4R2FA 3PMXA 2V84A 4ZE8A 3QUFA 5I58A 5I2NA 4U22A 2F7AA 5ITOA 4EDPA 4AQ4A 3S9EA 2PYYA 1MXXA 3RQTA 3CG1A 2F36A 3SEXA 1FTLA 2DYXA 2CZLA 4KYDA 4R6YA 2RF1A 3FV2A 4R2BA 1FTKA 1LBBA 1EU8A 2KLFA 3KFMA 1JQFA 5FHMA 3ZS6A 4QFOA 4THIA 2F35A 4F3GA 2X7PA 2VP1A 4RY1A 5AE4A 5TP9B 3VDFA 4P0IA 1MXUA 4LZ5A 3TELA 3I3VA 1PBPA 3RUMA 2D5WA 2CMOA 2Z23A 4XKPA 4IGTA 5TP9A 3WAEA 3T93B 3FXRA 3OSRA 2RCBA 1OQHA 1PEBA 4MFIA 2X7QA 3RTFB 3P7IA 3O6GA 4E0WA 1D3KA 3HN0A 1QUKA 4LA9A 4F2QA 3UGWA 5EHSA 1LB8A 1WODA 4F31B 1CE2A 3QYTA 1UIUA 3TAJA 4F29A 4NMYA 5BUUA 4ECFA 4R73A 4YKIA 4DE8A 1R6ZA 1LFHA 4MH5A 4RYAA 1MY4A 2ZYMA 1SI0A 1IXGA 2RC7A 1ATGA 3VLUA 3V83A 3E9XA 4RPOA 4LP2B 1NH7A 3TTKA 3IO6A 2F8DA 4ESXA 1MH3A 1ZLQA 2ONSA 4GIZA 4X9TA 2I3WA 2XXHA 1OQGA 1N3WA 4FORA 4Q8RA 3PUVE 3TUSA 2GH9A 2G93A 1PB7A 3IB2A 4QFNA 1QKAA 4Z0IA 1YTVA 1TFDA 1XT8A 4LUBA 2XXYA 1B6HA 1B32A 3DP4A 4PFTA 2REGA 2OWTA 2V93A 5HM4B 4PFYA 4DZ1A 2ANJA 2XX9A 1DPEA 4XKNA 1OMPA 3C35A 3K0VA 1MM6A 3RPWA 4OESA 4XKRA 1HSJA 1R9LA 4ZEIA 3IOVA 3TTLA 4YKJA 1FQDA 4NWDA 2V25A 3CRBA 2RC8A 4F2OA 2H4IA 3MZ9A 5FHOA 4ZZEA 1T0KA 3TKDA 1P1NA 4F22A 4MF3A 4KD5A 2QS3A 3CG3A 3KN8A 1SW1A 1SVXB 2WKYA 2G29A 1P1OA 1LSTA 3PPQA 2DXRA 4GWOA 1S9TA 1ANFA 4IO4A 3L6GA 1PB8A 4QFPA 1Y20A 1B5IA 2VD3A 4QRZA 3OEMA 3C34A 1P99A 1EZPA 4PFWA 4RNSA 2ZNUA 3HHGA 4OFLA 4ELOA 4FATA 3FUZA 1DPPA 1N84A 1WDNA 4NF8B 4IO2A 1H43A 4N6PA 4Q5TA 5EHMA 1JW4A 3A3UA 4U21A 4F3PA 3UK4A 3U1OA 5ITPA 4NF8A 1IXHA 4OYVA 4NWCA 2NXOA 1N7XA 5CM6A 4QHQA 3N26A 1RKMA 2UVIA 2ALUA 3CSGA 3CIJA 1USYH 1B3FA 1QW0A 5AA3A 1XVXA 5CMKA 4F19A 3H6VA 5A5XB 1H45A 2XXUA 5AA4A 4OHNA 3ZKLA 3Q27A 1FTMA 5L8DA 2O7UA 2OWSA 4BDRA 2Z22A 3U92A 3SERA 3ECRA 5AA2B 5A5XA 2DVCA 4KCDA 5EYFA 1MG1A 1A40A 1M5FA 2RCAA 2Y7WA 5KZTA 4YKKA 3RT8A 3N94A 3QSLA 5I57B 5AA2A 4DXBA 2F97A 3DP6A 4OENA 1Y4CA 3O2AA 4GOTA 4MLQA 5I57A 4OERA 1B51A 4NF5B 4LQ5A 4OFOA 1JETA 4OEUA 2PT2A 2F6PA 2XD3A 1N0TA 4DXCA 3MWBA 2YJPA 2AL4A 3BBRA 4NF5A 3H4ZA 4U1OA 1SQYA 1FW0A 1NKXA 2AYSA 4YMBA 5KDTB 3SETA 1JEVA 4UA8A 4F1VA 3VVFA 5CC2A 1POY1 2A5SA 5KDTA 4JDFA 3LR1A 1IITA 3D4CA 4R9FA 3MC2A 3TMGA 1PC3A 1B1HA 3E4RA 4HW8A 4WXJA 4G8NA 3FD3A 3S2VA 3RY3A 3LSWA 3K02A 3QXMA 4F39A 1Y1MA 3C31A 4I8CA 4IGRA 1MQGA 4X1BA 3MVWA 1XS5A 2H25A 5I2KB 2OK2A 1LGBC 2UVGA 3GLBA 3MPLA 4HTGA 4EQ7A 2ONRA 3SEWA 5BWJA 4RK9A 3GZGA 1SI1A 2YLNA 1PDAA 1GTKA 3QUJA 4N13A 5H8NB 3U72A 1US5A 1JW1A 1ZU0A 3HPIA 3VLWA 1A55A 1AMFA 3W15C 5H8SA 5H8NA 1Q1KA 2A5TA 3MP8A 4LZ7A 5H8QB 3OO6A 3KOSA 4ELPA 1P1WA 2Y7PA 3FXUA 3Q29A 4X48A 5I58B 4IB2A 4G77A 2UYFA 1LAGE 4F3SA 3E3KA 4FIMA 2HCAA 3W9WA 1AOVA 1SBPA 3FJGA 4NF4B 4JXIA 4FE8A 3BFUA 3CR9A 3DLNA 3G3JA 4H5GA 4KR5A 4NF4A 2QL3A 3GBBA 3EQ1A 5L9OA 1JEUA 3SKPA 1NNTA 3RNNA 1MQDA 1F9BA 1SD3A 3U94A 4EXKA 4BDOA 4LQ2A 2B65A 1BTJA 4JWXA 1FQBA 1QUJA 2XXIA 1MPDA 4P11A 1EH3A 4H6DA 3I5OA 1YCJA 3SEUA 1XOCA 2VOZA 3OXNA 3IJOB 3G3FA 1Y3PA 2XXQA 3FJMA 2O68A 5B70A 3LUYA 5DVIA 4YKPA 3IOUA 5CMMA 3UP9A 1MY1A 1ZBMA 1IQ7A 1B05A 3MPKA 4BLAA 2QS2A 2VGQA 4KYSA 3TTNA 4L17A 1MXWA 1JNFA 3H3GA 4X1DA 3LSXA 2DXYA 3FV1A 4EF2A 2FNCA 2DP8A 1B40A 4XIGQ 1XC1A 4O3CA 3MQ9A 4NF6B 5ICTA 4QFLA 4KHZE 2HZKA 3IB1A 3KJTA 3PUZE 1P1UA 3K2DA 4ND9A 1ZIUA 1D9YA 3BKIB 3HSTA 4NF6A 3ZSFA 3PPRA 1NMUA 2QJEA 2QRYA 5JEIA 3FVOA 4M4GA 1O63A 2GFEA 1H44A 3A09A 2UVHA 1O7TA 2QMXA 3RTWB 3VVDA 3I6VA 1NNFA 2H99A 1TXFA 4ISUA 2F78A 5HPQA 3UIFA 2GHAA 1NNKA 4FJPA 5DYHA 3KN3A 1JVYA 3DM0A 4HCWA 3C9HA 4F1UA 3O6IA 4ELQA 4OZ9A 1IXIA 3VXBA 1Y1ZA 5M2VA 3R26A 4H5FA 4PFUA 4FEBA 4MLVA 5CBSA 1A8EA 4G4PA 3MW0A 3ILUB 5JTYB 3RGYA 3S9MC 1BLFA 1LCFA 3RN8A 1B9JA 3TCGA 2RINA 4ESWA 2BJJX 1M5EA 3DELB 1FQCA 1P1QA 4BDLA 5JTYA 5I59B 4IO5A 1GGGA 3KEIA 1Y4TA 2O84X 2ESNA 1URDA 3B6WA 3DP8A 3CVGA 2E0SA 5I59A 1JVXA 1KWHA 1HSLA 4GF8A 4U4SA 4ZZAA 2RKMA 1L5TA 1Y3QA 1YPNA 4Q0CA 4C1UA 4ZEFA 3MZ1A 4EUOA 1MXVA 1IEJA 3TTRA 3LSFB 5HBCA 3OENA 2D3IA 4DCYA 1II5A 2THIA 3O66A 3V5AA 3K6XA 1LCTA 2FA7A 4R9GA 1BP5A 2DS9A 2HFBA 2ZYOA 2DQVA 2O7IA 1URSA 2V3QA 4WEDA 3MZBA 2UYEA 3T9VA 4RJZA 4OTEA 2R71A 3LSLA 2F34A 3THIA 1B3EA 1SW5A 3C33A 1DSNA 1MDP1 4XTCQ 1FTOA 4WEPA 2ZXTA 4FECA 3K4UA 1FQAA 1OLCA 4KCCA 2QS4A 2RC9A 2O51A 5DT6A 4BDNA 1B3HA 3OD7A 3B6QA 2Y7KA 2DSFA 3L6HA 2UXAA 2B3BA 3OO8A 2Y84A 3H7MA 4ZDMA 4ZECA 3MBPA 2I3VA 5AA4B 5J1DA 1I6QA 2HQ0A 4KFQA 3ILTB 2V3TA 2ZNSA 4JWOA 3PMWA 5K2YA 2F7CA 2R6GE 3RLFE 3PPPA 3Q25A 2OJTA 3M3FA 2I49A 2LAOA 4FEDA 3UN6A 1SW2A 3TCFA 3OSQA 1Z7ME 2ZMBA 3KSXA 4JBZA 3IB0A 2DOJA 2GHBA 5TPAB 3VLVA 3PUXE 4NE4A 5F7VA 2I4CA 3TFLA 1B4HA 3FVKA 4QSEA 1FTJA 3EHTA 1MPCA 4IO3A 2W7YA 2F7BA 5TPAA 1MY2A 1OIBA 4O3BA 3KSJA 2E1SA 1LLSA 3T66A 2REJA 3QIMA 3O28A 4EQBA 4IO6A 2F5XA 1LFIA 1B46A 3JYRA 2DE4A 3IAZA 4TQUQ 3MP6A 4BDQA 2XXPA 4POWA 3G3GA 2Q89A 3A3CA 2Q88A 3H06B 1MM7A 2Q8JA 2Z8EA 3TQLA 2PX1A 2I0CA 3TODA 3CFXA 3UA8A 5AA1A 2DVZA 2QS1A 1B0HA 3VV5A 3CFZA 3G3IA 2Q2AA 4QSCA 3TCHA 3MJNA 4OETA 2HXWA 3G3KA 4R6HA 4E0XA 2OBGA 2XXVA 2AIXA 1R9QA 4H1XA 2DE2A 1QVSA 1Z7NE 3OO7A 2VD2A 2YPNA 5FTIA 4R75A 3G3HA 3B7DA 4JB7A 2QMWA 2DWJA 5FHNA 1B3LA 4I9DA 1S7YA 3PMVA 1Y9UA 3K1NA 2DE3A 2A5TB 3C4MA 4ONYA 2DWAA 2IEEA 3H6TA 3JZJA 4OWDA 1LAXA 1Q35A 3WAFA 4EXLA 5DEXB 3LBSA 3W9VA 2O1MA 2O1LA 1ZMGA 3KN7A 5CBRA 4OEVA 4R74A 5DEXA 1ELJA 5IAIA 2IA4A 4H65A 1TT1A 3OELA 1IIWA 3KG2A 1A99A 4DIGA 1HSEA 4OQOA 4HS7A 1PB9A 1SYIA 4KQPA 2UVJA 3O29A 3TDJA 3TPAA 3SESA 4U4XA 1I69A 3ODBA 2X26A 3T22A 2XX8A 4YB7A 5B7DA 1WVJA 3EF7A 1NFTA 1LAHE 3O9PA 1YAEA 2NOOA 3IOTA 4DXUA 1MS7A 1M5BA 4OMBA 1DOTA 1M5CA 3FASA 4YU0A 4PE5B 1N3XA 3R6UA 4POXA 1POTA 1QJMA 4GXSB 1B52A 3EN3A 3VFJA 4H67A 1SW4A 3CI8A 3PU5A 4GFRA 5TU0A 1IXCA 4G68C 3USDA 3TZAA 4GRKA 3Q28A 2H9BA 3H6WA 1AH5A 4AB6A 1D9VA 5CRYA 3FIRA 5KCJB 4C0RA 2NVUB 3FXQA 3T96B 4H0WA 4G8HA 3EHUA 3PD8A 1NH8A 1B2HA 4DCXA 5KCJA 5L9SA 1IZ1A 1ZKBA 2OZZA 1J1NA 4Z7EA 3IR1A 4IO7A 3V8XB 2I6EA 1B0LA 2P1SA 4PQJA 4DDDA 4FAJA 1H76A 2I0BA 4PETA 3D4GA 1EZOA 3KBRA 3TTMA 3C36A 2ZYKA 3H6UA 1B4ZA 2D21A 5FTHA 1MRPA 3MUQA 3JV9A 1QULA 4ZEDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B5H A;  4F1Y A;  1CB6 A;  1N7W A;  3OO9 A;  4HCY A;  3PV0 E;  5F1Q A;  3MVY A;  4K3F A;  4OVJ A;  1MXY A;  2XHD A;  2I48 A;  1B58 A;  2I58 A;  1NL5 A;  4BDM A;  3S9N C;  4YB5 A;  3B6T A;  2ONK E;  3Q26 A;  1MQI A;  4AB5 A;  3PPO A;  1B1X A;  4F18 A;  3N6T A;  1VSO A;  2XD2 A;  3BFT A;  4IY6 A;  5AA2 D;  1TFA A;  3C32 A;  5H8H B;  2O69 A;  1VE4 A;  2Y7I A;  1QUI A;  4YMA A;  1Y3N A;  4ZEB A;  5H8H A;  4JWY A;  1QKB A;  5JK4 A;  4MBP A;  1UTB B;  2XXW A;  1MPB A;  1NNP A;  4LON B;  3MVX A;  4OFJ A;  3H03 A;  3TQW A;  1B7U A;  4LVQ A;  1UTB A;  1OVT A;  1XVY A;  1MH4 A;  1O64 A;  1UIV A;  1RYO A;  4RXL A;  3HHF A;  3K01 A;  1LFG A;  3M3L A;  5IKB A;  4EQ9 A;  4GL0 A;  3IK6 B;  3AXF A;  3V89 B;  4ZE9 A;  1MQH A;  3T9X B;  2PBW A;  3HV1 A;  4GVO A;  1A7L A;  5L9M A;  4M1V A;  5CMC A;  3PGF A;  2PMS A;  1VR5 A;  4Q30 B;  3GXA A;  3VXC A;  4F3B A;  3S9L C;  5I84 A;  4TLM B;  1SYH A;  3FJ7 A;  4GL8 A;  3N6U A;  2P2A A;  1ZJL A;  2OLB A;  2H5Y A;  1I6A A;  4KYE A;  3IX1 A;  1XHY A;  4I1D A;  3SEV A;  3K00 A;  1MQJ A;  4WKM A;  3CFL A;  3O6H A;  3OEK A;  4UAC A;  4G68 B;  5LOM A;  4NTL A;  4NED A;  4GXA A;  2Q2C A;  4RA1 A;  5DVF A;  1JW5 A;  4YAH X;  3U93 A;  4H8I A;  2HZL A;  1US4 A;  4I62 A;  4G68 A;  1AIV A;  1B7Z A;  1A8F A;  4QF9 A;  3ZKK A;  4R6K A;  1S50 A;  1URG A;  1GR2 A;  3K6U A;  4RPN A;  4OXV A;  2V3U A;  3LC8 A;  1UQW A;  5K2X A;  3EHS A;  3TEP A;  2AL5 A;  3RT6 B;  2XX7 A;  1DMB A;  2H98 A;  3IL1 B;  1OVB A;  3CSB A;  3KJ7 A;  4GLI A;  3F11 A;  1B7H A;  4IY5 A;  4N07 A;  2B3F A;  3G7W A;  2PVU A;  4U1Z A;  1LB9 A;  3VVE A;  2DWH A;  5H8F B;  1TWY A;  2R9J A;  1USY E;  1VFE A;  3QAX A;  4LZ8 A;  4ELR A;  3UOR A;  3R7X A;  3IJX B;  5H8F A;  1BKA A;  1GV8 A;  1MXZ A;  1RYX A;  3ONM A;  3MVZ A;  1A54 A;  4KPT A;  4PP0 A;  3HO7 A;  2OCU A;  3MAM A;  1DTZ A;  1MDQ A;  1UTH B;  1LAF E;  1OLA A;  4YZZ A;  2Z8F A;  2HAU A;  5I56 B;  4XKQ A;  4U2R A;  2ABH A;  3K6W A;  1N76 A;  1UTH A;  3KOT A;  4C1T A;  3SEY A;  5I56 A;  1FQF A;  3K1M A;  4KI0 E;  4P0G A;  3M8U A;  3PD9 A;  5ICQ A;  1GVC A;  2O6A A;  2XXX A;  3MP1 A;  4QSD A;  3OMB A;  3IOR A;  3KZG A;  1AL3 A;  1SDX A;  3K1P A;  2GRV A;  2Z8D A;  1R1N A;  2HAV A;  4LAT A;  1DTG A;  4ZEK A;  2ZYN A;  4TOZ A;  2Y7R A;  3N5L A;  3S4U A;  3EPE A;  1PBQ A;  4YIC A;  3K6V A;  3FGS A;  1IUD A;  3FVG A;  3PPN A;  4QFK A;  5DVJ A;  2ZNT A;  3HCQ A;  3IOW A;  1FQE A;  5ISU A;  4RK2 A;  3PUW E;  3T9U A;  3IO4 A;  2F6G A;  2QSX A;  2Q9T A;  3M3K A;  2NUV A;  3O97 A;  2DWI A;  3FAT A;  3SDF A;  3E13 X;  1D4N A;  4G2Z A;  3TYH A;  1MY3 A;  1LBC A;  4G8M A;  1FCK A;  1ZTY A;  4GD5 A;  2QPQ A;  1I6B A;  4H8J A;  3FVN A;  2I4B A;  1N04 A;  2FYI A;  2P0S A;  2PT1 A;  4DLD A;  4JSD A;  4GQO A;  3PUY E;  4TLL B;  5I2K A;  1MY0 A;  2VHA A;  5DTB A;  2XXR A;  4YB6 A;  3OOA A;  3U8Q A;  2M8C A;  1H3D A;  3QK6 A;  2NWJ A;  2HEU A;  3VE1 B;  4JSO A;  4EF1 A;  4R72 A;  1BIY A;  2XXT A;  1B3G A;  3GBA A;  5ELV A;  4ZS9 A;  3KGC A;  1VFD A;  5CMB A;  1M5D A;  3T9H B;  4O3A A;  5H8Q A;  4U23 A;  5I2N B;  5CI5 A;  4XXU A;  1B5J A;  1EZ9 A;  3FZV A;  4R2F A;  3PMX A;  2V84 A;  4ZE8 A;  3QUF A;  5I58 A;  5I2N A;  4U22 A;  2F7A A;  5ITO A;  4EDP A;  4AQ4 A;  3S9E A;  2PYY A;  1MXX A;  3RQT A;  3CG1 A;  2F36 A;  3SEX A;  1FTL A;  2DYX A;  2CZL A;  4KYD A;  4R6Y A;  2RF1 A;  3FV2 A;  4R2B A;  1FTK A;  1LBB A;  1EU8 A;  2KLF A;  3KFM A;  1JQF A;  5FHM A;  3ZS6 A;  4QFO A;  4THI A;  2F35 A;  4F3G A;  2X7P A;  2VP1 A;  4RY1 A;  5AE4 A;  5TP9 B;  3VDF A;  4P0I A;  1MXU A;  4LZ5 A;  3TEL A;  3I3V A;  1PBP A;  3RUM A;  2D5W A;  2CMO A;  2Z23 A;  4XKP A;  4IGT A;  5TP9 A;  3WAE A;  3T93 B;  3FXR A;  3OSR A;  2RCB A;  1OQH A;  1PEB A;  4MFI A;  2X7Q A;  3RTF B;  3P7I A;  3O6G A;  4E0W A;  1D3K A;  3HN0 A;  1QUK A;  4LA9 A;  4F2Q A;  3UGW A;  5EHS A;  1LB8 A;  1WOD A;  4F31 B;  1CE2 A;  3QYT A;  1UIU A;  3TAJ A;  4F29 A;  4NMY A;  5BUU A;  4ECF A;  4R73 A;  4YKI A;  4DE8 A;  1R6Z A;  1LFH A;  4MH5 A;  4RYA A;  1MY4 A;  2ZYM A;  1SI0 A;  1IXG A;  2RC7 A;  1ATG A;  3VLU A;  3V83 A;  3E9X A;  4RPO A;  4LP2 B;  1NH7 A;  3TTK A;  3IO6 A;  2F8D A;  4ESX A;  1MH3 A;  1ZLQ A;  2ONS A;  4GIZ A;  4X9T A;  2I3W A;  2XXH A;  1OQG A;  1N3W A;  4FOR A;  4Q8R A;  3PUV E;  3TUS A;  2GH9 A;  2G93 A;  1PB7 A;  3IB2 A;  4QFN A;  1QKA A;  4Z0I A;  1YTV A;  1TFD A;  1XT8 A;  4LUB A;  2XXY A;  1B6H A;  1B32 A;  3DP4 A;  4PFT A;  2REG A;  2OWT A;  2V93 A;  5HM4 B;  4PFY A;  4DZ1 A;  2ANJ A;  2XX9 A;  1DPE A;  4XKN A;  1OMP A;  3C35 A;  3K0V A;  1MM6 A;  3RPW A;  4OES A;  4XKR A;  1HSJ A;  1R9L A;  4ZEI A;  3IOV A;  3TTL A;  4YKJ A;  1FQD A;  4NWD A;  2V25 A;  3CRB A;  2RC8 A;  4F2O A;  2H4I A;  3MZ9 A;  5FHO A;  4ZZE A;  1T0K A;  3TKD A;  1P1N A;  4F22 A;  4MF3 A;  4KD5 A;  2QS3 A;  3CG3 A;  3KN8 A;  1SW1 A;  1SVX B;  2WKY A;  2G29 A;  1P1O A;  1LST A;  3PPQ A;  2DXR A;  4GWO A;  1S9T A;  1ANF A;  4IO4 A;  3L6G A;  1PB8 A;  4QFP A;  1Y20 A;  1B5I A;  2VD3 A;  4QRZ A;  3OEM A;  3C34 A;  1P99 A;  1EZP A;  4PFW A;  4RNS A;  2ZNU A;  3HHG A;  4OFL A;  4ELO A;  4FAT A;  3FUZ A;  1DPP A;  1N84 A;  1WDN A;  4NF8 B;  4IO2 A;  1H43 A;  4N6P A;  4Q5T A;  5EHM A;  1JW4 A;  3A3U A;  4U21 A;  4F3P A;  3UK4 A;  3U1O A;  5ITP A;  4NF8 A;  1IXH A;  4OYV A;  4NWC A;  2NXO A;  1N7X A;  5CM6 A;  4QHQ A;  3N26 A;  1RKM A;  2UVI A;  2ALU A;  3CSG A;  3CIJ A;  1USY H;  1B3F A;  1QW0 A;  5AA3 A;  1XVX A;  5CMK A;  4F19 A;  3H6V A;  5A5X B;  1H45 A;  2XXU A;  5AA4 A;  4OHN A;  3ZKL A;  3Q27 A;  1FTM A;  5L8D A;  2O7U A;  2OWS A;  4BDR A;  2Z22 A;  3U92 A;  3SER A;  3ECR A;  5AA2 B;  5A5X A;  2DVC A;  4KCD A;  5EYF A;  1MG1 A;  1A40 A;  1M5F A;  2RCA A;  2Y7W A;  5KZT A;  4YKK A;  3RT8 A;  3N94 A;  3QSL A;  5I57 B;  5AA2 A;  4DXB A;  2F97 A;  3DP6 A;  4OEN A;  1Y4C A;  3O2A A;  4GOT A;  4MLQ A;  5I57 A;  4OER A;  1B51 A;  4NF5 B;  4LQ5 A;  4OFO A;  1JET A;  4OEU A;  2PT2 A;  2F6P A;  2XD3 A;  1N0T A;  4DXC A;  3MWB A;  2YJP A;  2AL4 A;  3BBR A;  4NF5 A;  3H4Z A;  4U1O A;  1SQY A;  1FW0 A;  1NKX A;  2AYS A;  4YMB A;  5KDT B;  3SET A;  1JEV A;  4UA8 A;  4F1V A;  3VVF A;  5CC2 A;  1POY 1;  2A5S A;  5KDT A;  4JDF A;  3LR1 A;  1IIT A;  3D4C A;  4R9F A;  3MC2 A;  3TMG A;  1PC3 A;  1B1H A;  3E4R A;  4HW8 A;  4WXJ A;  4G8N A;  3FD3 A;  3S2V A;  3RY3 A;  3LSW A;  3K02 A;  3QXM A;  4F39 A;  1Y1M A;  3C31 A;  4I8C A;  4IGR A;  1MQG A;  4X1B A;  3MVW A;  1XS5 A;  2H25 A;  5I2K B;  2OK2 A;  1LGB C;  2UVG A;  3GLB A;  3MPL A;  4HTG A;  4EQ7 A;  2ONR A;  3SEW A;  5BWJ A;  4RK9 A;  3GZG A;  1SI1 A;  2YLN A;  1PDA A;  1GTK A;  3QUJ A;  4N13 A;  5H8N B;  3U72 A;  1US5 A;  1JW1 A;  1ZU0 A;  3HPI A;  3VLW A;  1A55 A;  1AMF A;  3W15 C;  5H8S A;  5H8N A;  1Q1K A;  2A5T A;  3MP8 A;  4LZ7 A;  5H8Q B;  3OO6 A;  3KOS A;  4ELP A;  1P1W A;  2Y7P A;  3FXU A;  3Q29 A;  4X48 A;  5I58 B;  4IB2 A;  4G77 A;  2UYF A;  1LAG E;  4F3S A;  3E3K A;  4FIM A;  2HCA A;  3W9W A;  1AOV A;  1SBP A;  3FJG A;  4NF4 B;  4JXI A;  4FE8 A;  3BFU A;  3CR9 A;  3DLN A;  3G3J A;  4H5G A;  4KR5 A;  4NF4 A;  2QL3 A;  3GBB A;  3EQ1 A;  5L9O A;  1JEU A;  3SKP A;  1NNT A;  3RNN A;  1MQD A;  1F9B A;  1SD3 A;  3U94 A;  4EXK A;  4BDO A;  4LQ2 A;  2B65 A;  1BTJ A;  4JWX A;  1FQB A;  1QUJ A;  2XXI A;  1MPD A;  4P11 A;  1EH3 A;  4H6D A;  3I5O A;  1YCJ A;  3SEU A;  1XOC A;  2VOZ A;  3OXN A;  3IJO B;  3G3F A;  1Y3P A;  2XXQ A;  3FJM A;  2O68 A;  5B70 A;  3LUY A;  5DVI A;  4YKP A;  3IOU A;  5CMM A;  3UP9 A;  1MY1 A;  1ZBM A;  1IQ7 A;  1B05 A;  3MPK A;  4BLA A;  2QS2 A;  2VGQ A;  4KYS A;  3TTN A;  4L17 A;  1MXW A;  1JNF A;  3H3G A;  4X1D A;  3LSX A;  2DXY A;  3FV1 A;  4EF2 A;  2FNC A;  2DP8 A;  1B40 A;  4XIG Q;  1XC1 A;  4O3C A;  3MQ9 A;  4NF6 B;  5ICT A;  4QFL A;  4KHZ E;  2HZK A;  3IB1 A;  3KJT A;  3PUZ E;  1P1U A;  3K2D A;  4ND9 A;  1ZIU A;  1D9Y A;  3BKI B;  3HST A;  4NF6 A;  3ZSF A;  3PPR A;  1NMU A;  2QJE A;  2QRY A;  5JEI A;  3FVO A;  4M4G A;  1O63 A;  2GFE A;  1H44 A;  3A09 A;  2UVH A;  1O7T A;  2QMX A;  3RTW B;  3VVD A;  3I6V A;  1NNF A;  2H99 A;  1TXF A;  4ISU A;  2F78 A;  5HPQ A;  3UIF A;  2GHA A;  1NNK A;  4FJP A;  5DYH A;  3KN3 A;  1JVY A;  3DM0 A;  4HCW A;  3C9H A;  4F1U A;  3O6I A;  4ELQ A;  4OZ9 A;  1IXI A;  3VXB A;  1Y1Z A;  5M2V A;  3R26 A;  4H5F A;  4PFU A;  4FEB A;  4MLV A;  5CBS A;  1A8E A;  4G4P A;  3MW0 A;  3ILU B;  5JTY B;  3RGY A;  3S9M C;  1BLF A;  1LCF A;  3RN8 A;  1B9J A;  3TCG A;  2RIN A;  4ESW A;  2BJJ X;  1M5E A;  3DEL B;  1FQC A;  1P1Q A;  4BDL A;  5JTY A;  5I59 B;  4IO5 A;  1GGG A;  3KEI A;  1Y4T A;  2O84 X;  2ESN A;  1URD A;  3B6W A;  3DP8 A;  3CVG A;  2E0S A;  5I59 A;  1JVX A;  1KWH A;  1HSL A;  4GF8 A;  4U4S A;  4ZZA A;  2RKM A;  1L5T A;  1Y3Q A;  1YPN A;  4Q0C A;  4C1U A;  4ZEF A;  3MZ1 A;  4EUO A;  1MXV A;  1IEJ A;  3TTR A;  3LSF B;  5HBC A;  3OEN A;  2D3I A;  4DCY A;  1II5 A;  2THI A;  3O66 A;  3V5A A;  3K6X A;  1LCT A;  2FA7 A;  4R9G A;  1BP5 A;  2DS9 A;  2HFB A;  2ZYO A;  2DQV A;  2O7I A;  1URS A;  2V3Q A;  4WED A;  3MZB A;  2UYE A;  3T9V A;  4RJZ A;  4OTE A;  2R71 A;  3LSL A;  2F34 A;  3THI A;  1B3E A;  1SW5 A;  3C33 A;  1DSN A;  1MDP 1;  4XTC Q;  1FTO A;  4WEP A;  2ZXT A;  4FEC A;  3K4U A;  1FQA A;  1OLC A;  4KCC A;  2QS4 A;  2RC9 A;  2O51 A;  5DT6 A;  4BDN A;  1B3H A;  3OD7 A;  3B6Q A;  2Y7K A;  2DSF A;  3L6H A;  2UXA A;  2B3B A;  3OO8 A;  2Y84 A;  3H7M A;  4ZDM A;  4ZEC A;  3MBP A;  2I3V A;  5AA4 B;  5J1D A;  1I6Q A;  2HQ0 A;  4KFQ A;  3ILT B;  2V3T A;  2ZNS A;  4JWO A;  3PMW A;  5K2Y A;  2F7C A;  2R6G E;  3RLF E;  3PPP A;  3Q25 A;  2OJT A;  3M3F A;  2I49 A;  2LAO A;  4FED A;  3UN6 A;  1SW2 A;  3TCF A;  3OSQ A;  1Z7M E;  2ZMB A;  3KSX A;  4JBZ A;  3IB0 A;  2DOJ A;  2GHB A;  5TPA B;  3VLV A;  3PUX E;  4NE4 A;  5F7V A;  2I4C A;  3TFL A;  1B4H A;  3FVK A;  4QSE A;  1FTJ A;  3EHT A;  1MPC A;  4IO3 A;  2W7Y A;  2F7B A;  5TPA A;  1MY2 A;  1OIB A;  4O3B A;  3KSJ A;  2E1S A;  1LLS A;  3T66 A;  2REJ A;  3QIM A;  3O28 A;  4EQB A;  4IO6 A;  2F5X A;  1LFI A;  1B46 A;  3JYR A;  2DE4 A;  3IAZ A;  4TQU Q;  3MP6 A;  4BDQ A;  2XXP A;  4POW A;  3G3G A;  2Q89 A;  3A3C A;  2Q88 A;  3H06 B;  1MM7 A;  2Q8J A;  2Z8E A;  3TQL A;  2PX1 A;  2I0C A;  3TOD A;  3CFX A;  3UA8 A;  5AA1 A;  2DVZ A;  2QS1 A;  1B0H A;  3VV5 A;  3CFZ A;  3G3I A;  2Q2A A;  4QSC A;  3TCH A;  3MJN A;  4OET A;  2HXW A;  3G3K A;  4R6H A;  4E0X A;  2OBG A;  2XXV A;  2AIX A;  1R9Q A;  4H1X A;  2DE2 A;  1QVS A;  1Z7N E;  3OO7 A;  2VD2 A;  2YPN A;  5FTI A;  4R75 A;  3G3H A;  3B7D A;  4JB7 A;  2QMW A;  2DWJ A;  5FHN A;  1B3L A;  4I9D A;  1S7Y A;  3PMV A;  1Y9U A;  3K1N A;  2DE3 A;  2A5T B;  3C4M A;  4ONY A;  2DWA A;  2IEE A;  3H6T A;  3JZJ A;  4OWD A;  1LAX A;  1Q35 A;  3WAF A;  4EXL A;  5DEX B;  3LBS A;  3W9V A;  2O1M A;  2O1L A;  1ZMG A;  3KN7 A;  5CBR A;  4OEV A;  4R74 A;  5DEX A;  1ELJ A;  5IAI A;  2IA4 A;  4H65 A;  1TT1 A;  3OEL A;  1IIW A;  3KG2 A;  1A99 A;  4DIG A;  1HSE A;  4OQO A;  4HS7 A;  1PB9 A;  1SYI A;  4KQP A;  2UVJ A;  3O29 A;  3TDJ A;  3TPA A;  3SES A;  4U4X A;  1I69 A;  3ODB A;  2X26 A;  3T22 A;  2XX8 A;  4YB7 A;  5B7D A;  1WVJ A;  3EF7 A;  1NFT A;  1LAH E;  3O9P A;  1YAE A;  2NOO A;  3IOT A;  4DXU A;  1MS7 A;  1M5B A;  4OMB A;  1DOT A;  1M5C A;  3FAS A;  4YU0 A;  4PE5 B;  1N3X A;  3R6U A;  4POX A;  1POT A;  1QJM A;  4GXS B;  1B52 A;  3EN3 A;  3VFJ A;  4H67 A;  1SW4 A;  3CI8 A;  3PU5 A;  4GFR A;  5TU0 A;  1IXC A;  4G68 C;  3USD A;  3TZA A;  4GRK A;  3Q28 A;  2H9B A;  3H6W A;  1AH5 A;  4AB6 A;  1D9V A;  5CRY A;  3FIR A;  5KCJ B;  4C0R A;  2NVU B;  3FXQ A;  3T96 B;  4H0W A;  4G8H A;  3EHU A;  3PD8 A;  1NH8 A;  1B2H A;  4DCX A;  5KCJ A;  5L9S A;  1IZ1 A;  1ZKB A;  2OZZ A;  1J1N A;  4Z7E A;  3IR1 A;  4IO7 A;  3V8X B;  2I6E A;  1B0L A;  2P1S A;  4PQJ A;  4DDD A;  4FAJ A;  1H76 A;  2I0B A;  4PET A;  3D4G A;  1EZO A;  3KBR A;  3TTM A;  3C36 A;  2ZYK A;  3H6U A;  1B4Z A;  2D21 A;  5FTH A;  1MRP A;  3MUQ A;  3JV9 A;  1QUL A;  4ZED A; 
#chains in the Genus database with same CATH topology
 1B5H A;  4F1Y A;  5DW8 A;  1CB6 A;  1N7W A;  3OO9 A;  4HCY A;  3PV0 E;  5F1Q A;  3MVY A;  4N15 A;  4K3F A;  4OVJ A;  1MXY A;  2XHD A;  2I48 A;  1B58 A;  2I58 A;  1NL5 A;  4PFB A;  4BDM A;  3S9N C;  4YB5 A;  3B6T A;  2ONK E;  3Q26 A;  5F24 A;  1MQI A;  4AB5 A;  3PPO A;  1B1X A;  4F18 A;  3N6T A;  1VSO A;  2XD2 A;  3BFT A;  4IY6 A;  5AA2 D;  1TFA A;  3C32 A;  5H8H B;  2O69 A;  1VE4 A;  2Y7I A;  1QUI A;  1SPI A;  4YMA A;  1Y3N A;  4ZEB A;  5H8H A;  2XWO A;  4JWY A;  1QKB A;  5JK4 A;  4MBP A;  1UTB B;  2XXW A;  1CNQ A;  1MPB A;  4GX3 A;  1NNP A;  4LON B;  3MVX A;  4OFJ A;  3H03 A;  3TQW A;  1B7U A;  4LVQ A;  1UTB A;  1OVT A;  1XVY A;  1MH4 A;  1O64 A;  1UIV A;  1RYO A;  4RXL A;  3HHF A;  3K01 A;  1LFG A;  3M3L A;  5IKB A;  4EQ9 A;  4GL0 A;  3IK6 B;  3AXF A;  3V89 B;  4ZE9 A;  1MQH A;  3T9X B;  2PBW A;  3HV1 A;  4GVO A;  1A7L A;  5L9M A;  2QFL A;  4MX6 A;  4M1V A;  5CMC A;  3PGF A;  4P1E A;  2PMS A;  1VR5 A;  3B50 A;  4Q30 B;  3GXA A;  3VXC A;  4F3B A;  2XWI A;  4PAF A;  3S9L C;  5I84 A;  1RDY A;  5EYH A;  4TLM B;  1SYH A;  3FJ7 A;  4GL8 A;  3N6U A;  4O94 A;  2P2A A;  1ZJL A;  2XA5 A;  2B4L A;  1FBF A;  2OLB A;  2H5Y A;  1I6A A;  4KYE A;  3IX1 A;  4PDD A;  4GX4 A;  1XHY A;  4I1D A;  3SEV A;  3K00 A;  1MQJ A;  4WKM A;  4FBP A;  3SZP A;  4I3E A;  3CFL A;  3O6H A;  3OEK A;  4UAC A;  3E79 A;  4G68 B;  5LOM A;  4NTL A;  4NED A;  4GXA A;  2Q2C A;  4RA1 A;  5DVF A;  1JW5 A;  4YAH X;  3U93 A;  4H8I A;  2HZL A;  1US4 A;  4I62 A;  4G68 A;  1AIV A;  1B7Z A;  1A8F A;  4QF9 A;  3ZKK A;  4R6K A;  1S50 A;  1RDZ A;  1URG A;  1GR2 A;  4QBA A;  2XWV A;  3K6U A;  4RPN A;  4OXV A;  2V3U A;  3LC8 A;  1UQW A;  5K2X A;  3EHS A;  3TEP A;  2AL5 A;  3RT6 B;  2XX7 A;  3LUZ A;  1DMB A;  2H98 A;  3IL1 B;  1OVB A;  3CSB A;  3KJ7 A;  4GLI A;  3F11 A;  1B7H A;  4IY5 A;  4N07 A;  2B3F A;  3G7W A;  2PVU A;  4U1Z A;  1LB9 A;  3VVE A;  2DWH A;  5H8F B;  1TWY A;  2R9J A;  1FBP A;  1USY E;  1VFE A;  3QAX A;  4N81 A;  4LZ8 A;  4ELR A;  3UOR A;  3R7X A;  3IJX B;  5H8F A;  1BKA A;  1GV8 A;  3HFU A;  1MXZ A;  1RYX A;  3ONM A;  4PC9 A;  5A5L A;  3MVZ A;  1A54 A;  2FBP A;  4KPT A;  4PP0 A;  3HO7 A;  2OCU A;  3MAM A;  1DTZ A;  1MDQ A;  1UTH B;  1LAF E;  4PDH A;  1OLA A;  4YZZ A;  2Z8F A;  2HAU A;  5I56 B;  4XKQ A;  4U2R A;  2ABH A;  3K6W A;  1N76 A;  1UTH A;  3KOT A;  4C1T A;  3SEY A;  5I56 A;  1FQF A;  2XWK A;  3K1M A;  4KI0 E;  4P0G A;  4P47 A;  3M8U A;  3PD9 A;  5ICQ A;  1GVC A;  2O6A A;  2XXX A;  3MP1 A;  4QSD A;  3OMB A;  3IOR A;  3KZG A;  1AL3 A;  1SDX A;  3K1P A;  2GRV A;  1RDX A;  2Z8D A;  1R1N A;  2HAV A;  4LAT A;  1DTG A;  4ZEK A;  3QMF A;  2ZYN A;  4TOZ A;  2Y7R A;  2ZZV A;  3N5L A;  3S4U A;  3EPE A;  1PBQ A;  4P1L A;  4YIC A;  3K6V A;  3FGS A;  2CZI A;  1IUD A;  3FVG A;  3PPN A;  4QFK A;  5DVJ A;  2ZNT A;  3HCQ A;  3IOW A;  1FQE A;  4N91 A;  5ISU A;  1NV6 A;  4RK2 A;  3PUW E;  3T9U A;  3IO4 A;  2F6G A;  2QSX A;  2Q9T A;  3ROJ A;  3M3K A;  2NUV A;  3O97 A;  4PF8 A;  2CEY A;  2DWI A;  3FAT A;  3SDF A;  3E13 X;  2F3D A;  1D4N A;  4G2Z A;  3TYH A;  1MY3 A;  1LBC A;  4G8M A;  1FCK A;  1ZTY A;  4GD5 A;  3T1B A;  2QPQ A;  4X8R A;  1I6B A;  4H8J A;  3FVN A;  2I4B A;  1N04 A;  2FYI A;  2P0S A;  2PT1 A;  4AS4 A;  4DLD A;  4JSD A;  4GQO A;  3PUY E;  4TLL B;  5I2K A;  1MY0 A;  2VHA A;  5DTB A;  5J16 A;  2XXR A;  4YB6 A;  3OOA A;  3U8Q A;  2M8C A;  1H3D A;  4IR8 A;  3QK6 A;  2NWJ A;  2HEU A;  3VE1 B;  4JSO A;  4EF1 A;  4R72 A;  1BIY A;  2XXT A;  1B3G A;  3GBA A;  5ELV A;  4JVD A;  4ZS9 A;  3KGC A;  1VFD A;  5CMB A;  4GWU A;  3MST A;  1M5D A;  1LBZ A;  3T9H B;  4O3A A;  5H8Q A;  4U23 A;  5I2N B;  1XI6 A;  5CI5 A;  4XXU A;  1B5J A;  1EZ9 A;  3FZV A;  4R2F A;  3PMX A;  4OA4 A;  5ET8 A;  1FBD A;  2V84 A;  4ZE8 A;  3QUF A;  5I58 A;  4I3Y A;  5I2N A;  5IZZ A;  4U22 A;  2F7A A;  5ITO A;  4EDP A;  4AQ4 A;  4DI4 B;  3S9E A;  2PYY A;  1MXX A;  3RQT A;  3CG1 A;  2F36 A;  3SEX A;  1FTL A;  2DYX A;  2CZL A;  1DK4 A;  3CHG A;  1FJ9 A;  4KYD A;  4R6Y A;  2RF1 A;  3FV2 A;  4R2B A;  1FTK A;  1LBB A;  1EU8 A;  2KLF A;  3KFM A;  1JQF A;  5FHM A;  3ZS6 A;  4QFO A;  4THI A;  2F35 A;  4F3G A;  2X7P A;  2VP1 A;  4RY1 A;  5AE4 A;  5LTC A;  4GWZ A;  5TP9 B;  3VDF A;  4P0I A;  1MXU A;  4LZ5 A;  3TEL A;  3I3V A;  1PBP A;  3RUM A;  2D5W A;  2CMO A;  2Z23 A;  4XKP A;  4IGT A;  5TP9 A;  3WAE A;  3T93 B;  3FXR A;  3OSR A;  2RCB A;  1OQH A;  1PEB A;  4MFI A;  4OVP A;  2X7Q A;  3LV0 A;  4I40 A;  2WYP A;  1IMF A;  3RTF B;  3P7I A;  3O6G A;  4E0W A;  1D3K A;  3HN0 A;  1QUK A;  4LA9 A;  4F2Q A;  3UGW A;  4MIJ A;  5EHS A;  1LB8 A;  4HE0 A;  1WOD A;  4F31 B;  1CE2 A;  3QYT A;  1UIU A;  3TAJ A;  4F29 A;  4NMY A;  4MHF A;  5BUU A;  4N6D A;  4ECF A;  2MKZ A;  4R73 A;  4YKI A;  4DE8 A;  1R6Z A;  1LFH A;  4MH5 A;  4RYA A;  5I5P A;  1MY4 A;  3IFC A;  2ZYM A;  2PCR A;  1SI0 A;  1IXG A;  1FBG A;  2RC7 A;  1ATG A;  3U65 A;  3VLU A;  3V83 A;  3E9X A;  4RPO A;  4LP2 B;  1NH7 A;  2JJK A;  3TTK A;  3IO6 A;  2F8D A;  5ET5 A;  4ESX A;  1MH3 A;  1ZLQ A;  2ONS A;  2CZH A;  4GIZ A;  4X9T A;  2I3W A;  2XXH A;  1OQG A;  1N3W A;  4FOR A;  4Q8R A;  3PUV E;  3TUS A;  2GH9 A;  1DCU A;  4QXD A;  2G93 A;  1EYI A;  1PB7 A;  3IB2 A;  4QFN A;  1QKA A;  4Z0I A;  1YTV A;  1TFD A;  1EYK A;  1XT8 A;  4LUB A;  1LBV A;  2XXY A;  1B6H A;  1B32 A;  3DP4 A;  4PFT A;  2REG A;  2OWT A;  2V93 A;  5HM4 B;  4PFY A;  1FJ6 A;  4DZ1 A;  2ANJ A;  2XX9 A;  1NUY A;  5IM2 A;  1DPE A;  4XKN A;  1OMP A;  3C35 A;  4PF6 A;  3K0V A;  1MM6 A;  1NV7 A;  1FTA A;  1FPL A;  3RPW A;  4OES A;  4XKR A;  1HSJ A;  1R9L A;  4ZEI A;  1FPG A;  3IOV A;  3TTL A;  4YKJ A;  1FQD A;  4NWD A;  2V25 A;  3CRB A;  2RC8 A;  4F2O A;  2H4I A;  3MZ9 A;  5FHO A;  4ZZE A;  1T0K A;  4MCO A;  4AS5 A;  3TKD A;  1P1N A;  4X04 A;  4F22 A;  4MF3 A;  4KD5 A;  2QS3 A;  3CG3 A;  3KN8 A;  4KXP A;  1SW1 A;  1SVX B;  3EKI A;  2WKY A;  2FVZ A;  4P3L A;  4XF5 A;  2G29 A;  5LDZ A;  1P1O A;  1LST A;  3PPQ A;  4H46 A;  2DXR A;  4GWO A;  1S9T A;  4MJO A;  2B4M A;  1ANF A;  4IO4 A;  3L6G A;  4G61 A;  1PB8 A;  2BJI A;  4QFP A;  1Y20 A;  1B5I A;  2VD3 A;  4QRZ A;  3OEM A;  3C34 A;  1P99 A;  1EZP A;  4PFW A;  4RNS A;  2ZNU A;  3HHG A;  4OFL A;  4ELO A;  2HXR A;  4FAT A;  3FUZ A;  1DPP A;  1N84 A;  1WDN A;  4NHB A;  4NF8 B;  5EQ8 A;  2Y5L A;  4IO2 A;  4GX6 A;  1H43 A;  4N6P A;  4Q5T A;  3MYU A;  5EHM A;  1JW4 A;  3A3U A;  4U21 A;  4F3P A;  1FPE A;  3UK4 A;  3U1O A;  5ITP A;  4OVS A;  4XEQ A;  4NF8 A;  4OAN A;  1IXH A;  4OYV A;  4NWC A;  4NX1 A;  2NXO A;  1N7X A;  5CM6 A;  4QHQ A;  3N26 A;  4OVT A;  1RKM A;  2UVI A;  5ESY A;  2ALU A;  1NV5 A;  3CSG A;  3A29 A;  4HE2 A;  3CIJ A;  1EYJ A;  2OX3 A;  2VPN A;  1USY H;  2ZZX A;  1B3F A;  1QW0 A;  5AA3 A;  1XVX A;  1AWB A;  5CMK A;  4F19 A;  3H6V A;  5A5X B;  1H45 A;  2XXU A;  1IMD A;  5AA4 A;  4OHN A;  3ZKL A;  4XFE A;  3Q27 A;  1FTM A;  5L8D A;  2O7U A;  2OWS A;  4BDR A;  2Z22 A;  3U92 A;  4P9K A;  3SER A;  3ECR A;  5AA2 B;  1IMB A;  2DVC A;  5A5X A;  4KCD A;  5EYF A;  1MG1 A;  1A40 A;  1M5F A;  2RCA A;  2Y7W A;  5KZT A;  4YKK A;  3RT8 A;  3N94 A;  4PFI A;  3QSL A;  5I57 B;  5AA2 A;  4DXB A;  2F97 A;  3DP6 A;  4PBH A;  4NF0 A;  4OEN A;  1Y4C A;  3O2A A;  4GOT A;  4MLQ A;  5I57 A;  4OER A;  1B51 A;  4NF5 B;  4LQ5 A;  4OFO A;  1JET A;  2CEX A;  4OEU A;  5FBP A;  2PT2 A;  2F6P A;  2XD3 A;  1N0T A;  4DXC A;  3MWB A;  2YJP A;  2AL4 A;  3BBR A;  4NF5 A;  3H4Z A;  4U1O A;  1SQY A;  2Y5K A;  1FW0 A;  1NKX A;  2AYS A;  4YMB A;  2CZK A;  5KDT B;  3SET A;  3PTY A;  1LEV A;  1JEV A;  4UA8 A;  4F1V A;  3VVF A;  5CC2 A;  1POY 1;  2A5S A;  5KDT A;  4JDF A;  3LR1 A;  1IIT A;  3D4C A;  4R9F A;  3MC2 A;  3TMG A;  1PC3 A;  1B1H A;  3E4R A;  2F3B A;  4HW8 A;  4WXJ A;  4G8N A;  3FD3 A;  3S2V A;  3RY3 A;  3LSW A;  3BIH A;  3K02 A;  2GQ1 A;  3QXM A;  2OWZ A;  4F39 A;  1Y1M A;  3C31 A;  4I8C A;  4IGR A;  4PGN A;  1MQG A;  4X1B A;  4MMP A;  3MVW A;  1XS5 A;  2H25 A;  5I2K B;  2OK2 A;  1LGB C;  2UVG A;  3GLB A;  3MPL A;  4HTG A;  4EQ7 A;  2ONR A;  3SEW A;  5BWJ A;  4RK9 A;  3GZG A;  1SI1 A;  2YLN A;  1PDA A;  1GTK A;  4PBQ A;  3QUJ A;  4N13 A;  5H8N B;  3U72 A;  1US5 A;  1JW1 A;  1ZU0 A;  3HPI A;  3VLW A;  1A55 A;  1AMF A;  3W15 C;  4N8G A;  1FRP A;  5H8S A;  5H8N A;  1FBE A;  1Q1K A;  4PAI A;  2A5T A;  3MP8 A;  4LZ7 A;  5H8Q B;  3OO6 A;  3B8B A;  3KOS A;  4ELP A;  1P1W A;  2Y7P A;  1NUZ A;  3FXU A;  3Q29 A;  4X48 A;  5I58 B;  4IB2 A;  4G77 A;  2UYF A;  4GWY A;  1LAG E;  4F3S A;  3E3K A;  4FIM A;  1YZ0 A;  2HCA A;  3W9W A;  1AOV A;  1SBP A;  5T3J A;  3FJG A;  4NF4 B;  4JXI A;  4FE8 A;  3BFU A;  3CR9 A;  3DLN A;  3G3J A;  4H5G A;  2ZZW A;  4KR5 A;  2WBB A;  4NF4 A;  2QL3 A;  3GBB A;  1NV0 A;  3ISP A;  3EQ1 A;  5L9O A;  1JEU A;  3SKP A;  1NNT A;  3FXB A;  3RNN A;  5IZ3 B;  1MQD A;  3T0J A;  4NG7 A;  1F9B A;  1SD3 A;  3U94 A;  4EXK A;  4HXV A;  5I7I A;  4BDO A;  4LQ2 A;  5IZ3 A;  2B65 A;  1BTJ A;  4JWX A;  1FQB A;  1QUJ A;  2XXI A;  1MPD A;  4P11 A;  1EH3 A;  4GWX A;  4H6D A;  1K9Z A;  1NV1 A;  3I5O A;  1YCJ A;  3SEU A;  1XOC A;  2VOZ A;  3OXN A;  3IJO B;  3G3F A;  1Y3P A;  2XXQ A;  3FJM A;  2O68 A;  5B70 A;  5IGA A;  2QVV A;  3LUY A;  3D1R A;  5DVI A;  4YKP A;  3IOU A;  5CMM A;  4OVQ A;  3UP9 A;  1MY1 A;  1ZBM A;  1IQ7 A;  1B05 A;  2WYK A;  3MPK A;  4BLA A;  2QS2 A;  2VGQ A;  4KYS A;  3TTN A;  1G0I A;  4L17 A;  1MXW A;  1IME A;  1JNF A;  3H3G A;  4X1D A;  3LSX A;  2DXY A;  1NV4 A;  3FV1 A;  2FNC A;  4EF2 A;  2DP8 A;  3FBP A;  1B40 A;  4XIG Q;  4P56 A;  1XC1 A;  4O3C A;  3MQ9 A;  4NF6 B;  5ICT A;  4QFL A;  1INP A;  4KHZ E;  2HZK A;  3IB1 A;  3KJT A;  3PUZ E;  1P1U A;  3K2D A;  4ND9 A;  1FPF A;  2VPO A;  1ZIU A;  1D9Y A;  2P3N A;  3BKI B;  3HST A;  4NF6 A;  3ZSF A;  3PPR A;  1NMU A;  2QJE A;  2QRY A;  2PFY A;  3RPL B;  5JEI A;  3FVO A;  4M4G A;  1O63 A;  2GFE A;  1H44 A;  3A09 A;  2UVH A;  1O7T A;  2QMX A;  4PFR A;  3RTW B;  4GWS A;  3RPL A;  3VVD A;  3I6V A;  4GWW A;  1NNF A;  2H99 A;  1TXF A;  4MAG A;  4ISU A;  4N6K A;  2V4C A;  2F78 A;  5HPQ A;  3RYD A;  3UIF A;  2GHA A;  1NNK A;  3IFA A;  4FJP A;  5DYH A;  3KN3 A;  1JVY A;  3DM0 A;  4HCW A;  3C9H A;  4F1U A;  3O6I A;  4ELQ A;  4OZ9 A;  1IXI A;  2QVR A;  3VXB A;  1Y1Z A;  5M2V A;  3R26 A;  4H5F A;  4PFU A;  4MNP A;  4FEB A;  1YYZ A;  4MLV A;  5CBS A;  1A8E A;  4G4P A;  3MW0 A;  3ILU B;  5JTY B;  3RGY A;  3S9M C;  1BLF A;  1LCF A;  3RN8 A;  1B9J A;  3TCG A;  2RIN A;  4ESW A;  2BJJ X;  1M5E A;  3DEL B;  1FQC A;  1P1Q A;  4BDL A;  5JTY A;  5I59 B;  4IO5 A;  1GGG A;  3KEI A;  1Y4T A;  2O84 X;  1LBW A;  1FSA A;  2WX9 A;  2ESN A;  1URD A;  3B6W A;  3DP8 A;  3BIG A;  3CVG A;  2E0S A;  3NOH A;  4PCD A;  5I59 A;  1JVX A;  1KWH A;  1HSL A;  1FPJ A;  4GF8 A;  4U4S A;  4ZZA A;  3GYY A;  2RKM A;  1L5T A;  1Y3Q A;  4MEV A;  1YPN A;  1G0H A;  4Q0C A;  1YXI A;  4ZED A;  4C1U A;  4ZEF A;  3MZ1 A;  4EUO A;  1MXV A;  1IEJ A;  3TTR A;  3LSF B;  4N4U A;  5HBC A;  3OEN A;  2D3I A;  4DCY A;  1II5 A;  2THI A;  3O66 A;  3V5A A;  3K6X A;  1LCT A;  2FA7 A;  2FIX A;  4R9G A;  1BP5 A;  2DS9 A;  2HFB A;  5EQ9 A;  2ZYO A;  2DQV A;  2O7I A;  1URS A;  1FPB A;  2V3Q A;  4WED A;  3MZB A;  3KBZ A;  2UYE A;  2R8T A;  3T9V A;  1FBH A;  4RJZ A;  4OTE A;  2R71 A;  3LSL A;  2F34 A;  3THI A;  1B3E A;  1SW5 A;  4PAK A;  3C33 A;  4N17 A;  1DSN A;  1MDP 1;  4XTC Q;  1FTO A;  4WEP A;  2ZXT A;  4FEC A;  3K4U A;  5EQA A;  4GBV A;  1FQA A;  1OLC A;  4KCC A;  2QS4 A;  2P3V A;  2RC9 A;  2O51 A;  5DT6 A;  4BDN A;  1B3H A;  5ET6 A;  3OD7 A;  3B6Q A;  2Y7K A;  2DSF A;  3L6H A;  2UXA A;  2B3B A;  3OO8 A;  4MNI A;  2Y84 A;  3H7M A;  4ZDM A;  4ZEC A;  5EQ7 A;  3MBP A;  2I3V A;  5AA4 B;  1FPI A;  5J1D A;  1Q9D A;  1I6Q A;  2HQ0 A;  2KR0 A;  4KFQ A;  3ILT B;  2V3T A;  2ZNS A;  4JWO A;  2Q8M A;  3PMW A;  5K2Y A;  2F7C A;  4LN5 A;  4GBW A;  2R6G E;  3RLF E;  3E78 A;  1LBY A;  3PPP A;  3Q25 A;  4O7M A;  5I3S A;  2OJT A;  2QVU A;  1FBC A;  3M3F A;  2I49 A;  2LAO A;  4FED A;  3UN6 A;  1VDW A;  1SW2 A;  3TCF A;  3OSQ A;  1Z7M E;  2ZMB A;  3KSX A;  4JBZ A;  3IB0 A;  2DOJ A;  2GHB A;  5TPA B;  3VLV A;  3PUX E;  2L5V A;  4NE4 A;  4UAB A;  5F7V A;  2I4C A;  3TFL A;  1B4H A;  3FVK A;  4QSE A;  1FTJ A;  5ET7 A;  3EHT A;  1MPC A;  4IO3 A;  2W7Y A;  2F7B A;  4O8M A;  5TPA A;  1MY2 A;  1NV2 A;  1OIB A;  1KZ8 A;  4O3B A;  3KSJ A;  2E1S A;  1LLS A;  3T66 A;  2REJ A;  3QIM A;  3O28 A;  4EQB A;  3KC1 A;  4IO6 A;  2F5X A;  1LFI A;  1NUX A;  1B46 A;  3JYR A;  2DE4 A;  1KA1 A;  3IAZ A;  4TQU Q;  3MP6 A;  4BDQ A;  4N8Y A;  1NV3 A;  2XXP A;  4H45 A;  2WBD A;  4POW A;  3G3G A;  2Q89 A;  1BK4 A;  3A3C A;  2Q88 A;  3H06 B;  1MM7 A;  2Q8J A;  2Z8E A;  3TQL A;  2PX1 A;  4NGU A;  2I0C A;  3TOD A;  3CFX A;  3UA8 A;  5AA1 A;  2DVZ A;  2QS1 A;  1B0H A;  3VV5 A;  3CFZ A;  4NQ8 A;  3G3I A;  2Q2A A;  2Q74 A;  4QSC A;  3TCH A;  3MJN A;  4OET A;  2HXW A;  1FPD A;  2DDK A;  3G3K A;  4R6H A;  4E0X A;  2OBG A;  2XXV A;  2AIX A;  1KA0 A;  1R9Q A;  4H1X A;  2DE2 A;  1QVS A;  1Z7N E;  3OO7 A;  2VD2 A;  1IMA A;  2YPN A;  5FTI A;  4R75 A;  3G3H A;  3B7D A;  4JB7 A;  4NN3 A;  2QMW A;  2DWJ A;  5FHN A;  1B3L A;  4I9D A;  1S7Y A;  3PMV A;  1Y9U A;  4P8B A;  3K1N A;  2DE3 A;  2A5T B;  2WEF A;  3C4M A;  3KC0 A;  4ONY A;  2DWA A;  2IEE A;  3H6T A;  4MNC A;  3JZJ A;  4OWD A;  1LAX A;  1Q35 A;  3WAF A;  4EXL A;  5DEX B;  3LBS A;  3W9V A;  2FIE A;  4O7I A;  2O1M A;  2O1L A;  1ZMG A;  3KN7 A;  1NUW A;  5CBR A;  4OEV A;  1JP4 A;  4R74 A;  5DEX A;  1ELJ A;  5IAI A;  2HPG A;  2IA4 A;  4H65 A;  1TT1 A;  3OEL A;  1IIW A;  4PGP A;  3KG2 A;  1A99 A;  4DIG A;  1HSE A;  4OQO A;  4HS7 A;  1PB9 A;  1SYI A;  4KQP A;  2UVJ A;  3O29 A;  5EYG A;  3TDJ A;  4DI3 D;  3TPA A;  1NI9 A;  3SES A;  4U4X A;  1I69 A;  3ODB A;  2X26 A;  3T22 A;  2VT5 A;  1FPK A;  2XX8 A;  4YB7 A;  5B7D A;  1WVJ A;  3EF7 A;  1NFT A;  1LAH E;  3O9P A;  1YAE A;  2NOO A;  3IOT A;  4PTK A;  4DXU A;  1MS7 A;  1IMC A;  1M5B A;  4OMB A;  1DOT A;  1M5C A;  3FAS A;  4YU0 A;  4PE5 B;  1N3X A;  3R6U A;  4JVC A;  4POX A;  1POT A;  1QJM A;  4GXS B;  4JVI A;  1B52 A;  3EN3 A;  3VFJ A;  4H67 A;  1SW4 A;  3CI8 A;  3PU5 A;  4GFR A;  5TU0 A;  1IXC A;  2FHY A;  2HHM A;  4G68 C;  4GRK A;  3TZA A;  3USD A;  3Q28 A;  5IZ1 A;  2H9B A;  3H6W A;  1AH5 A;  4AB6 A;  1D9V A;  3FIR A;  5KCJ B;  4C0R A;  2NVU B;  4OVR A;  3FXQ A;  3T96 B;  4HE1 A;  4H0W A;  4G8H A;  3EHU A;  3PD8 A;  1NH8 A;  1B2H A;  4DCX A;  5KCJ A;  5L9S A;  1IZ1 A;  1K9Y A;  1ZKB A;  2PFZ A;  2OZZ A;  1J1N A;  1DBZ A;  4Z7E A;  4PE3 A;  3IR1 A;  4IO7 A;  3V8X B;  2XXK A;  2I6E A;  1B0L A;  2P1S A;  4PQJ A;  4DDD A;  4FAJ A;  1H76 A;  2I0B A;  4PET A;  1D9Q A;  3D4G A;  1EZO A;  3KBR A;  3TTM A;  3C36 A;  2ZYK A;  1QGX A;  3H6U A;  1B4Z A;  2D21 A;  5FTH A;  1MRP A;  1LBX A;  3MUQ A;  2KQZ A;  3JV9 A;  1QUL A;  4NAP A;  5CRY A; 
#chains in the Genus database with same CATH homology
 1B5H A;  4F1Y A;  1CB6 A;  1N7W A;  3OO9 A;  4HCY A;  3PV0 E;  5F1Q A;  3MVY A;  4K3F A;  4OVJ A;  1MXY A;  2XHD A;  2I48 A;  1B58 A;  2I58 A;  1NL5 A;  4BDM A;  3S9N C;  4YB5 A;  3B6T A;  2ONK E;  3Q26 A;  1MQI A;  4AB5 A;  3PPO A;  1B1X A;  4F18 A;  3N6T A;  1VSO A;  2XD2 A;  3BFT A;  4IY6 A;  5AA2 D;  1TFA A;  3C32 A;  5H8H B;  2O69 A;  1VE4 A;  2Y7I A;  1QUI A;  4YMA A;  1Y3N A;  4ZEB A;  5H8H A;  4JWY A;  1QKB A;  5JK4 A;  4MBP A;  1UTB B;  2XXW A;  1MPB A;  1NNP A;  4LON B;  3MVX A;  4OFJ A;  3H03 A;  3TQW A;  1B7U A;  4LVQ A;  1UTB A;  1OVT A;  1XVY A;  1MH4 A;  1O64 A;  1UIV A;  1RYO A;  4RXL A;  3HHF A;  3K01 A;  1LFG A;  3M3L A;  5IKB A;  4EQ9 A;  4GL0 A;  3IK6 B;  3AXF A;  3V89 B;  4ZE9 A;  1MQH A;  3T9X B;  2PBW A;  3HV1 A;  4GVO A;  1A7L A;  5L9M A;  4M1V A;  5CMC A;  3PGF A;  2PMS A;  1VR5 A;  4Q30 B;  3GXA A;  3VXC A;  4F3B A;  3S9L C;  5I84 A;  4TLM B;  1SYH A;  3FJ7 A;  4GL8 A;  3N6U A;  2P2A A;  1ZJL A;  2OLB A;  2H5Y A;  1I6A A;  4KYE A;  3IX1 A;  1XHY A;  4I1D A;  3SEV A;  3K00 A;  1MQJ A;  4WKM A;  3CFL A;  3O6H A;  3OEK A;  4UAC A;  4G68 B;  5LOM A;  4NTL A;  4NED A;  4GXA A;  2Q2C A;  4RA1 A;  5DVF A;  1JW5 A;  4YAH X;  3U93 A;  4H8I A;  2HZL A;  1US4 A;  4I62 A;  4G68 A;  1AIV A;  1B7Z A;  1A8F A;  4QF9 A;  3ZKK A;  4R6K A;  1S50 A;  1URG A;  1GR2 A;  3K6U A;  4RPN A;  4OXV A;  2V3U A;  3LC8 A;  1UQW A;  5K2X A;  3EHS A;  3TEP A;  2AL5 A;  3RT6 B;  2XX7 A;  1DMB A;  2H98 A;  3IL1 B;  1OVB A;  3CSB A;  3KJ7 A;  4GLI A;  3F11 A;  1B7H A;  4IY5 A;  4N07 A;  2B3F A;  3G7W A;  2PVU A;  4U1Z A;  1LB9 A;  3VVE A;  2DWH A;  5H8F B;  1TWY A;  2R9J A;  1USY E;  1VFE A;  3QAX A;  4LZ8 A;  4ELR A;  3UOR A;  3R7X A;  3IJX B;  5H8F A;  1BKA A;  1GV8 A;  1MXZ A;  1RYX A;  3ONM A;  3MVZ A;  1A54 A;  4KPT A;  4PP0 A;  3HO7 A;  2OCU A;  3MAM A;  1DTZ A;  1MDQ A;  1UTH B;  1LAF E;  1OLA A;  4YZZ A;  2Z8F A;  2HAU A;  5I56 B;  4XKQ A;  4U2R A;  2ABH A;  3K6W A;  1N76 A;  1UTH A;  3KOT A;  4C1T A;  3SEY A;  5I56 A;  1FQF A;  3K1M A;  4KI0 E;  4P0G A;  3M8U A;  3PD9 A;  5ICQ A;  1GVC A;  2O6A A;  2XXX A;  3MP1 A;  4QSD A;  3OMB A;  3IOR A;  3KZG A;  1AL3 A;  1SDX A;  3K1P A;  2GRV A;  2Z8D A;  1R1N A;  2HAV A;  4LAT A;  1DTG A;  4ZEK A;  2ZYN A;  4TOZ A;  2Y7R A;  3N5L A;  3S4U A;  3EPE A;  1PBQ A;  4YIC A;  3K6V A;  3FGS A;  1IUD A;  3FVG A;  3PPN A;  4QFK A;  5DVJ A;  2ZNT A;  3HCQ A;  3IOW A;  1FQE A;  5ISU A;  4RK2 A;  3PUW E;  3T9U A;  3IO4 A;  2F6G A;  2QSX A;  2Q9T A;  3M3K A;  2NUV A;  3O97 A;  2DWI A;  3FAT A;  3SDF A;  3E13 X;  1D4N A;  4G2Z A;  3TYH A;  1MY3 A;  1LBC A;  4G8M A;  1FCK A;  1ZTY A;  4GD5 A;  2QPQ A;  1I6B A;  4H8J A;  3FVN A;  2I4B A;  1N04 A;  2FYI A;  2P0S A;  2PT1 A;  4DLD A;  4JSD A;  4GQO A;  3PUY E;  4TLL B;  5I2K A;  1MY0 A;  2VHA A;  5DTB A;  2XXR A;  4YB6 A;  3OOA A;  3U8Q A;  2M8C A;  1H3D A;  3QK6 A;  2NWJ A;  2HEU A;  3VE1 B;  4JSO A;  4EF1 A;  4R72 A;  1BIY A;  2XXT A;  1B3G A;  3GBA A;  5ELV A;  4ZS9 A;  3KGC A;  1VFD A;  5CMB A;  1M5D A;  3T9H B;  4O3A A;  5H8Q A;  4U23 A;  5I2N B;  5CI5 A;  4XXU A;  1B5J A;  1EZ9 A;  3FZV A;  4R2F A;  3PMX A;  2V84 A;  4ZE8 A;  3QUF A;  5I58 A;  5I2N A;  4U22 A;  2F7A A;  5ITO A;  4EDP A;  4AQ4 A;  3S9E A;  2PYY A;  1MXX A;  3RQT A;  3CG1 A;  2F36 A;  3SEX A;  1FTL A;  2DYX A;  2CZL A;  4KYD A;  4R6Y A;  2RF1 A;  3FV2 A;  4R2B A;  1FTK A;  1LBB A;  1EU8 A;  2KLF A;  3KFM A;  1JQF A;  5FHM A;  3ZS6 A;  4QFO A;  4THI A;  2F35 A;  4F3G A;  2X7P A;  2VP1 A;  4RY1 A;  5AE4 A;  5TP9 B;  3VDF A;  4P0I A;  1MXU A;  4LZ5 A;  3TEL A;  3I3V A;  1PBP A;  3RUM A;  2D5W A;  2CMO A;  2Z23 A;  4XKP A;  4IGT A;  5TP9 A;  3WAE A;  3T93 B;  3FXR A;  3OSR A;  2RCB A;  1OQH A;  1PEB A;  4MFI A;  2X7Q A;  3RTF B;  3P7I A;  3O6G A;  4E0W A;  1D3K A;  3HN0 A;  1QUK A;  4LA9 A;  4F2Q A;  3UGW A;  5EHS A;  1LB8 A;  1WOD A;  4F31 B;  1CE2 A;  3QYT A;  1UIU A;  3TAJ A;  4F29 A;  4NMY A;  5BUU A;  4ECF A;  4R73 A;  4YKI A;  4DE8 A;  1R6Z A;  1LFH A;  4MH5 A;  4RYA A;  1MY4 A;  2ZYM A;  1SI0 A;  1IXG A;  2RC7 A;  1ATG A;  3VLU A;  3V83 A;  3E9X A;  4RPO A;  4LP2 B;  1NH7 A;  3TTK A;  3IO6 A;  2F8D A;  4ESX A;  1MH3 A;  1ZLQ A;  2ONS A;  4GIZ A;  4X9T A;  2I3W A;  2XXH A;  1OQG A;  1N3W A;  4FOR A;  4Q8R A;  3PUV E;  3TUS A;  2GH9 A;  2G93 A;  1PB7 A;  3IB2 A;  4QFN A;  1QKA A;  4Z0I A;  1YTV A;  1TFD A;  1XT8 A;  4LUB A;  2XXY A;  1B6H A;  1B32 A;  3DP4 A;  4PFT A;  2REG A;  2OWT A;  2V93 A;  5HM4 B;  4PFY A;  4DZ1 A;  2ANJ A;  2XX9 A;  1DPE A;  4XKN A;  1OMP A;  3C35 A;  3K0V A;  1MM6 A;  3RPW A;  4OES A;  4XKR A;  1HSJ A;  1R9L A;  4ZEI A;  3IOV A;  3TTL A;  4YKJ A;  1FQD A;  4NWD A;  2V25 A;  3CRB A;  2RC8 A;  4F2O A;  2H4I A;  3MZ9 A;  5FHO A;  4ZZE A;  1T0K A;  3TKD A;  1P1N A;  4F22 A;  4MF3 A;  4KD5 A;  2QS3 A;  3CG3 A;  3KN8 A;  1SW1 A;  1SVX B;  2WKY A;  2G29 A;  1P1O A;  1LST A;  3PPQ A;  2DXR A;  4GWO A;  1S9T A;  1ANF A;  4IO4 A;  3L6G A;  1PB8 A;  4QFP A;  1Y20 A;  1B5I A;  2VD3 A;  4QRZ A;  3OEM A;  3C34 A;  1P99 A;  1EZP A;  4PFW A;  4RNS A;  2ZNU A;  3HHG A;  4OFL A;  4ELO A;  4FAT A;  3FUZ A;  1DPP A;  1N84 A;  1WDN A;  4NF8 B;  4IO2 A;  1H43 A;  4N6P A;  4Q5T A;  5EHM A;  1JW4 A;  3A3U A;  4U21 A;  4F3P A;  3UK4 A;  3U1O A;  5ITP A;  4NF8 A;  1IXH A;  4OYV A;  4NWC A;  2NXO A;  1N7X A;  5CM6 A;  4QHQ A;  3N26 A;  1RKM A;  2UVI A;  2ALU A;  3CSG A;  3CIJ A;  1USY H;  1B3F A;  1QW0 A;  5AA3 A;  1XVX A;  5CMK A;  4F19 A;  3H6V A;  5A5X B;  1H45 A;  2XXU A;  5AA4 A;  4OHN A;  3ZKL A;  3Q27 A;  1FTM A;  5L8D A;  2O7U A;  2OWS A;  4BDR A;  2Z22 A;  3U92 A;  3SER A;  3ECR A;  5AA2 B;  5A5X A;  2DVC A;  4KCD A;  5EYF A;  1MG1 A;  1A40 A;  1M5F A;  2RCA A;  2Y7W A;  5KZT A;  4YKK A;  3RT8 A;  3N94 A;  3QSL A;  5I57 B;  5AA2 A;  4DXB A;  2F97 A;  3DP6 A;  4OEN A;  1Y4C A;  3O2A A;  4GOT A;  4MLQ A;  5I57 A;  4OER A;  1B51 A;  4NF5 B;  4LQ5 A;  4OFO A;  1JET A;  4OEU A;  2PT2 A;  2F6P A;  2XD3 A;  1N0T A;  4DXC A;  3MWB A;  2YJP A;  2AL4 A;  3BBR A;  4NF5 A;  3H4Z A;  4U1O A;  1SQY A;  1FW0 A;  1NKX A;  2AYS A;  4YMB A;  5KDT B;  3SET A;  1JEV A;  4UA8 A;  4F1V A;  3VVF A;  5CC2 A;  1POY 1;  2A5S A;  5KDT A;  4JDF A;  3LR1 A;  1IIT A;  3D4C A;  4R9F A;  3MC2 A;  3TMG A;  1PC3 A;  1B1H A;  3E4R A;  4HW8 A;  4WXJ A;  4G8N A;  3FD3 A;  3S2V A;  3RY3 A;  3LSW A;  3K02 A;  3QXM A;  4F39 A;  1Y1M A;  3C31 A;  4I8C A;  4IGR A;  1MQG A;  4X1B A;  3MVW A;  1XS5 A;  2H25 A;  5I2K B;  2OK2 A;  1LGB C;  2UVG A;  3GLB A;  3MPL A;  4HTG A;  4EQ7 A;  2ONR A;  3SEW A;  5BWJ A;  4RK9 A;  3GZG A;  1SI1 A;  2YLN A;  1PDA A;  1GTK A;  3QUJ A;  4N13 A;  5H8N B;  3U72 A;  1US5 A;  1JW1 A;  1ZU0 A;  3HPI A;  3VLW A;  1A55 A;  1AMF A;  3W15 C;  5H8S A;  5H8N A;  1Q1K A;  2A5T A;  3MP8 A;  4LZ7 A;  5H8Q B;  3OO6 A;  3KOS A;  4ELP A;  1P1W A;  2Y7P A;  3FXU A;  3Q29 A;  4X48 A;  5I58 B;  4IB2 A;  4G77 A;  2UYF A;  1LAG E;  4F3S A;  3E3K A;  4FIM A;  2HCA A;  3W9W A;  1AOV A;  1SBP A;  3FJG A;  4NF4 B;  4JXI A;  4FE8 A;  3BFU A;  3CR9 A;  3DLN A;  3G3J A;  4H5G A;  4KR5 A;  4NF4 A;  2QL3 A;  3GBB A;  3EQ1 A;  5L9O A;  1JEU A;  3SKP A;  1NNT A;  3RNN A;  1MQD A;  1F9B A;  1SD3 A;  3U94 A;  4EXK A;  4BDO A;  4LQ2 A;  2B65 A;  1BTJ A;  4JWX A;  1FQB A;  1QUJ A;  2XXI A;  1MPD A;  4P11 A;  1EH3 A;  4H6D A;  3I5O A;  1YCJ A;  3SEU A;  1XOC A;  2VOZ A;  3OXN A;  3IJO B;  3G3F A;  1Y3P A;  2XXQ A;  3FJM A;  2O68 A;  5B70 A;  3LUY A;  5DVI A;  4YKP A;  3IOU A;  5CMM A;  3UP9 A;  1MY1 A;  1ZBM A;  1IQ7 A;  1B05 A;  3MPK A;  4BLA A;  2QS2 A;  2VGQ A;  4KYS A;  3TTN A;  4L17 A;  1MXW A;  1JNF A;  3H3G A;  4X1D A;  3LSX A;  2DXY A;  3FV1 A;  4EF2 A;  2FNC A;  2DP8 A;  1B40 A;  4XIG Q;  1XC1 A;  4O3C A;  3MQ9 A;  4NF6 B;  5ICT A;  4QFL A;  4KHZ E;  2HZK A;  3IB1 A;  3KJT A;  3PUZ E;  1P1U A;  3K2D A;  4ND9 A;  1ZIU A;  1D9Y A;  3BKI B;  3HST A;  4NF6 A;  3ZSF A;  3PPR A;  1NMU A;  2QJE A;  2QRY A;  5JEI A;  3FVO A;  4M4G A;  1O63 A;  2GFE A;  1H44 A;  3A09 A;  2UVH A;  1O7T A;  2QMX A;  3RTW B;  3VVD A;  3I6V A;  1NNF A;  2H99 A;  1TXF A;  4ISU A;  2F78 A;  5HPQ A;  3UIF A;  2GHA A;  1NNK A;  4FJP A;  5DYH A;  3KN3 A;  1JVY A;  3DM0 A;  4HCW A;  3C9H A;  4F1U A;  3O6I A;  4ELQ A;  4OZ9 A;  1IXI A;  3VXB A;  1Y1Z A;  5M2V A;  3R26 A;  4H5F A;  4PFU A;  4FEB A;  4MLV A;  5CBS A;  1A8E A;  4G4P A;  3MW0 A;  3ILU B;  5JTY B;  3RGY A;  3S9M C;  1BLF A;  1LCF A;  3RN8 A;  1B9J A;  3TCG A;  2RIN A;  4ESW A;  2BJJ X;  1M5E A;  3DEL B;  1FQC A;  1P1Q A;  4BDL A;  5JTY A;  5I59 B;  4IO5 A;  1GGG A;  3KEI A;  1Y4T A;  2O84 X;  2ESN A;  1URD A;  3B6W A;  3DP8 A;  3CVG A;  2E0S A;  5I59 A;  1JVX A;  1KWH A;  1HSL A;  4GF8 A;  4U4S A;  4ZZA A;  2RKM A;  1L5T A;  1Y3Q A;  1YPN A;  4Q0C A;  4C1U A;  4ZEF A;  3MZ1 A;  4EUO A;  1MXV A;  1IEJ A;  3TTR A;  3LSF B;  5HBC A;  3OEN A;  2D3I A;  4DCY A;  1II5 A;  2THI A;  3O66 A;  3V5A A;  3K6X A;  1LCT A;  2FA7 A;  4R9G A;  1BP5 A;  2DS9 A;  2HFB A;  2ZYO A;  2DQV A;  2O7I A;  1URS A;  2V3Q A;  4WED A;  3MZB A;  2UYE A;  3T9V A;  4RJZ A;  4OTE A;  2R71 A;  3LSL A;  2F34 A;  3THI A;  1B3E A;  1SW5 A;  3C33 A;  1DSN A;  1MDP 1;  4XTC Q;  1FTO A;  4WEP A;  2ZXT A;  4FEC A;  3K4U A;  1FQA A;  1OLC A;  4KCC A;  2QS4 A;  2RC9 A;  2O51 A;  5DT6 A;  4BDN A;  1B3H A;  3OD7 A;  3B6Q A;  2Y7K A;  2DSF A;  3L6H A;  2UXA A;  2B3B A;  3OO8 A;  2Y84 A;  3H7M A;  4ZDM A;  4ZEC A;  3MBP A;  2I3V A;  5AA4 B;  5J1D A;  1I6Q A;  2HQ0 A;  4KFQ A;  3ILT B;  2V3T A;  2ZNS A;  4JWO A;  3PMW A;  5K2Y A;  2F7C A;  2R6G E;  3RLF E;  3PPP A;  3Q25 A;  2OJT A;  3M3F A;  2I49 A;  2LAO A;  4FED A;  3UN6 A;  1SW2 A;  3TCF A;  3OSQ A;  1Z7M E;  2ZMB A;  3KSX A;  4JBZ A;  3IB0 A;  2DOJ A;  2GHB A;  5TPA B;  3VLV A;  3PUX E;  4NE4 A;  5F7V A;  2I4C A;  3TFL A;  1B4H A;  3FVK A;  4QSE A;  1FTJ A;  3EHT A;  1MPC A;  4IO3 A;  2W7Y A;  2F7B A;  5TPA A;  1MY2 A;  1OIB A;  4O3B A;  3KSJ A;  2E1S A;  1LLS A;  3T66 A;  2REJ A;  3QIM A;  3O28 A;  4EQB A;  4IO6 A;  2F5X A;  1LFI A;  1B46 A;  3JYR A;  2DE4 A;  3IAZ A;  4TQU Q;  3MP6 A;  4BDQ A;  2XXP A;  4POW A;  3G3G A;  2Q89 A;  3A3C A;  2Q88 A;  3H06 B;  1MM7 A;  2Q8J A;  2Z8E A;  3TQL A;  2PX1 A;  2I0C A;  3TOD A;  3CFX A;  3UA8 A;  5AA1 A;  2DVZ A;  2QS1 A;  1B0H A;  3VV5 A;  3CFZ A;  3G3I A;  2Q2A A;  4QSC A;  3TCH A;  3MJN A;  4OET A;  2HXW A;  3G3K A;  4R6H A;  4E0X A;  2OBG A;  2XXV A;  2AIX A;  1R9Q A;  4H1X A;  2DE2 A;  1QVS A;  1Z7N E;  3OO7 A;  2VD2 A;  2YPN A;  5FTI A;  4R75 A;  3G3H A;  3B7D A;  4JB7 A;  2QMW A;  2DWJ A;  5FHN A;  1B3L A;  4I9D A;  1S7Y A;  3PMV A;  1Y9U A;  3K1N A;  2DE3 A;  2A5T B;  3C4M A;  4ONY A;  2DWA A;  2IEE A;  3H6T A;  3JZJ A;  4OWD A;  1LAX A;  1Q35 A;  3WAF A;  4EXL A;  5DEX B;  3LBS A;  3W9V A;  2O1M A;  2O1L A;  1ZMG A;  3KN7 A;  5CBR A;  4OEV A;  4R74 A;  5DEX A;  1ELJ A;  5IAI A;  2IA4 A;  4H65 A;  1TT1 A;  3OEL A;  1IIW A;  3KG2 A;  1A99 A;  4DIG A;  1HSE A;  4OQO A;  4HS7 A;  1PB9 A;  1SYI A;  4KQP A;  2UVJ A;  3O29 A;  3TDJ A;  3TPA A;  3SES A;  4U4X A;  1I69 A;  3ODB A;  2X26 A;  3T22 A;  2XX8 A;  4YB7 A;  5B7D A;  1WVJ A;  3EF7 A;  1NFT A;  1LAH E;  3O9P A;  1YAE A;  2NOO A;  3IOT A;  4DXU A;  1MS7 A;  1M5B A;  4OMB A;  1DOT A;  1M5C A;  3FAS A;  4YU0 A;  4PE5 B;  1N3X A;  3R6U A;  4POX A;  1POT A;  1QJM A;  4GXS B;  1B52 A;  3EN3 A;  3VFJ A;  4H67 A;  1SW4 A;  3CI8 A;  3PU5 A;  4GFR A;  5TU0 A;  1IXC A;  4G68 C;  3USD A;  3TZA A;  4GRK A;  3Q28 A;  2H9B A;  3H6W A;  1AH5 A;  4AB6 A;  1D9V A;  5CRY A;  3FIR A;  5KCJ B;  4C0R A;  2NVU B;  3FXQ A;  3T96 B;  4H0W A;  4G8H A;  3EHU A;  3PD8 A;  1NH8 A;  1B2H A;  4DCX A;  5KCJ A;  5L9S A;  1IZ1 A;  1ZKB A;  2OZZ A;  1J1N A;  4Z7E A;  3IR1 A;  4IO7 A;  3V8X B;  2I6E A;  1B0L A;  2P1S A;  4PQJ A;  4DDD A;  4FAJ A;  1H76 A;  2I0B A;  4PET A;  3D4G A;  1EZO A;  3KBR A;  3TTM A;  3C36 A;  2ZYK A;  3H6U A;  1B4Z A;  2D21 A;  5FTH A;  1MRP A;  3MUQ A;  3JV9 A;  1QUL A;  4ZED A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...