3HFUA

Crystal structure of the ligand binding domain of e. coli cynr with its specific effector azide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
202
Chain Sequence
GSLRIAVTPTFTSYFIGPLMADFYARYPSITLQLQEMSQEKIEDMLCRDELDVGIAFAPVHSPELEAIPLLTESLALVVAQHHPLAVHEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEANSISAVLELIRRTSLSTLLPAAIATQHDGLKAISLAPPLLERTAVLLRRKNSWQTAAAKAFLHMALDKCAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator cynR
publication title Crystal structure of the ligand binding domain of E. coli CynR with its specific effector azide
rcsb
source organism Escherichia coli
total genus 56
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3hfuA00
3HFUA 4QBAA 3T1BA 4JVCA 4JVIA 4JVDA 2HXRA 3ISPA 3SZPA
chains in the Genus database with same CATH superfamily
4P47A 1LLSA 4N6PA 1NV1A 1LCTA 1D4NA 5I56A 4R9GA 5EQ9A 2FIEA 1MPBA 2AIXA 3Q28A 4RPOA 4GX4A 4K3FA 4OVJA 3UA8A 1KZ8A 4KD5A 2WYPA 4G68C 3A3CA 5IM2A 3TZAA 2V3TA 3V5AA 4ELOA 2FBPA 2Q8MA 4AB6A 4GWOA 4H45A 1POY1 1Q35A 4IGTA 4HS7A 2GHAA 4JWOA 4NF6B 1MQDA 1YYZA 4XKRA 2OWTA 1FQDA 1XHYA 5I59B 4XTCQ 4EDPA 4NF6A 3QXMA 1HSLA 3K2DA 5ICQA 5IAIA 1KA1A 4OVPA 2XXQA 4PFWA 1FTJA 3E3KA 4H5FA 1USYE 3TFLA 3R7XA 1TXFA 2XXWA 2B3FA 2YLNA 1B5JA 4XKPA 2F3DA 3IFCA 4MNPA 3CRBA 4I3YA 1EZ9A 2ZNSA 4N8YA 2I58A 1FTKA 3GLBA 4O3BA 4X9TA 1Y9UA 1VFDA 4IO7A 2UVIA 2GRVA 2Z22A 2Q9TA 1JEVA 4O8MA 5FTIA 3IFAA 3I5OA 4P0GA 3MZ9A 4E0XA 1D9YA 4POXA 2OWSA 1QJMA 4N07A 4Q5TA 1GV8A 1K9ZA 1CB6A 5TP9B 4BDOA 1YAEA 4GXAA 1PDAA 2PFYA 3E13X 4NQ8A 3UK4A 2VOZA 3TPAA 2Y84A 4JVDA 4OMBA 1FBDA 4GFRA 4R73A 1S7YA 5TP9A 4IB2A 3RGYA 2HZLA 2CZHA 2H5YA 4EUOA 1NUZA 3PTYA 2D21A 2H25A 3V8XB 2X7QA 3MPKA 1QVSA 2DWIA 2Q8JA 1I69A 4FE8A 4QF9A 3B6QA 3K1MA 5TU0A 3C9HA 3B50A 5ICTA 5IZ3B 3BKIB 1BTJA 3UN6A 1RDXA 3O6IA 5IGAA 2W7YA 2RINA 3H4ZA 2JJKA 5IZ3A 4PE5B 1B51A 2V3UA 3DP6A 1Y20A 4GWUA 2O69A 1MG1A 4PFTA 1LCFA 1B2HA 4PDHA 2X7PA 3PUXE 1JW1A 1LAHE 3VLWA 1LFIA 4EF1A 1FTOA 1O63A 4OENA 1SI1A 3S9NC 3PUYE 5F24A 3PPOA 5AE4A 3A29A 2QS2A 1EZOA 1NV3A 1PB9A 2GHBA 4GWYA 1A7LA 2DYXA 2I48A 4DXBA 1SW2A 3VFJA 4HE1A 4QRZA 3KBRA 1MM6A 1DPEA 2R6GE 5IZ1A 2B3BA 1Y1MA 3B6TA 3IB0A 1N76A 2XWVA 2XD2A 3MP8A 4KYDA 2GFEA 3VVEA 2P0SA 4XF5A 4EQ7A 4ZZEA 1UTHB 4LQ5A 1TFAA 1IUDA 1MXYA 4OWDA 1MQIA 2HEUA 2HXWA 4X8RA 2IA4A 1UTHA 2KLFA 2FIXA 1A99A 4U21A 2WBDA 3UORA 4NGUA 1IXCA 4O3AA 4OEUA 3C4MA 2I3WA 5FBPA 3IJOB 3HHGA 4HCWA 2UVHA 3KN7A 5I2NB 1MDQA 3JYRA 4E0WA 4ZEDA 4C1TA 5ISUA 5LTCA 4NWDA 4MNIA 5DTBA 4NMYA 2NUVA 1FPJA 4LONB 4THIA 2DVZA 4NN3A 2P3NA 4MX6A 1P1UA 1B7UA 3KN8A 1KA0A 1IMFA 5JEIA 2Q2AA 4UA8A 2HCAA 2ZYOA 2A5TA 3C32A 3O28A 3OO7A 2XWKA 3SEXA 3RTWB 4G4PA 2CEXA 4KQPA 3QSLA 3PD8A 4R6KA 4OFLA 5DW8A 3QAXA 2Y7WA 3G3HA 4R9FA 5K2XA 3TTRA 1IZ1A 2VT5A 4PF8A 5CBSA 1ZTYA 2PT1A 3CG1A 2PT2A 1ZIUA 1FBFA 4NF4B 3H03A 1I6BA 2BJIA 2RCAA 1O7TA 1LFHA 1FBGA 3S9LC 2O7IA 4JB7A 3C36A 3JV9A 3O6HA 1L5TA 4NF4A 4LUBA 2Z8FA 4QSEA 1II5A 2XXYA 5CRYA 3SKPA 3OO8A 1ZMGA 4JXIA 3TELA 3OO6A 1XS5A 1XVXA 1KWHA 3FXBA 1A40A 4O7IA 4P3LA 2QS4A 4NE4A 3ZKKA 5AA2D 1LBXA 2F7BA 3L6HA 2Y5KA 5BWJA 2WX9A 1NNFA 2X26A 4PAIA 3MVWA 4EF2A 4ZEIA 1LBWA 2XXUA 1RDZA 5EQ8A 1B4HA 2RC7A 2ZYKA 5ITPA 1QKAA 4AS5A 3EKIA 1UIVA 1SQYA 3RQTA 3SERA 1PB7A 1JVXA 5AA1A 2WBBA 1MXXA 2RC8A 2DWJA 4H0WA 3TUSA 5EQAA 3FBPA 3CFXA 3U1OA 3E9XA 1BK4A 1BIYA 1S9TA 1VSOA 2UVGA 4XKNA 1BLFA 4XFEA 4GBVA 4NF5B 2Z8EA 2XXRA 2ZMBA 3IORA 3MC2A 2QSXA 3VLUA 2F7CA 1P1WA 1OLAA 4NF5A 3RUMA 4OVQA 4ZEKA 3KSXA 3LSFB 1MDP1 3ILUB 1FBCA 4AB5A 3ODBA 1MRPA 1NFTA 3SETA 4RY1A 3TKDA 1Y3PA 4PC9A 3EHSA 4N4UA 2VP1A 1B9JA 2O6AA 1MY0A 2YJPA 1MY2A 4O3CA 4PGPA 4OTEA 2QVRA 1MS7A 3CI8A 1LEVA 3KBZA 3K4UA 4JSOA 4RJZA 3RN8A 5BUUA 4EQBA 4I3EA 1VFEA 4DDDA 4GWZA 4GWXA 4PAKA 1OVBA 4JWXA 4M1VA 1MXZA 3PV0E 4X1BA 2DE3A 1MXVA 1NV5A 4PTKA 4P9KA 2OZZA 2CZIA 1EU8A 2VD2A 1MH4A 3TCGA 5L8DA 5T3JA 4FEDA 5EYGA 4ELPA 1INPA 3FVKA 3K1PA 2DS9A 1SDXA 3O29A 5F1QA 4XIGQ 4XEQA 4F39A 4FORA 4OYVA 1LB9A 3EPEA 4N13A 5EHMA 1F9BA 4U22A 3ZKLA 2RF1A 4OHNA 5HPQA 2ESNA 1I6AA 4ISUA 3S4UA 4FAJA 2ZYMA 3E4RA 4QFKA 1US4A 5B7DA 1FPKA 4U4XA 3V83A 1FW0A 2PX1A 1POTA 1FBPA 3IL1B 4H65A 1H3DA 1N7XA 4GIZA 1PBQA 1B6HA 2F36A 1B3FA 4DI3D 3USDA 1WODA 1URDA 2IEEA 1MY4A 2VD3A 3T9HB 3N26A 4KCCA 3LV0A 3Q29A 4YMBA 5EQ7A 3CG3A 4QFOA 1DCUA 1EYIA 3KOSA 4WEPA 3G3GA 3IR1A 1Y4CA 1FQEA 4XKQA 5H8QB 2FHYA 4IO5A 5DVJA 3G3FA 3D4CA 2GH9A 3RY3A 4MIJA 3RPWA 3LSLA 2OCUA 4OVTA 5H8QA 2OK2A 1G0IA 2I4BA 1USYH 4I1DA 4LN5A 4C1UA 3FIRA 3SDFA 1S50A 2O84X 5JTYA 4KPTA 1MPCA 4HTGA 3IO4A 1IIWA 1IXGA 2XXVA 4KR5A 1CNQA 5ELVA 4R72A 3G3IA 1EYKA 1GVCA 3PD9A 1Z7NE 1FPDA 2Y7PA 2R71A 2QRYA 2WKYA 4I9DA 1N04A 3Q26A 1DBZA 3CHGA 3K6VA 3MP1A 4ONYA 2F35A 2VHAA 2B4MA 3G3JA 5EYHA 3BFTA 2F78A 2OX3A 5KDTB 3O6GA 1DPPA 1M5BA 3T1BA 1AOVA 1B1HA 4N81A 3H3GA 4OVRA 1OQHA 5KDTA 2Y7KA 4G2ZA 4H8JA 3MZBA 4N15A 3IB1A 3PGFA 4JSDA 2PMSA 3KZGA 1OIBA 4R2BA 5KZTA 4OESA 2I4CA 3ROJA 5CC2A 1NMUA 2PYYA 1B5IA 1M5EA 5DYHA 1NV7A 4IO3A 1VDWA 3FXUA 3HSTA 3BIHA 4F18A 3T22A 4RNSA 2ALUA 1JW4A 3QMFA 3P7IA 3T9XB 4OZ9A 3N94A 3TQWA 4KCDA 2AYSA 1ZU0A 1MQHA 3H06B 2REJA 3MPLA 3MUQA 3VVFA 1A54A 1JEUA 4NX1A 1FPFA 4X48A 2XXTA 4MLQA 3FUZA 3TTMA 3K6UA 1NV0A 3KC1A 1QULA 1NI9A 3IJXB 3HFUA 3PUZE 3O97A 3Q27A 3N6UA 2Y7RA 2ONKE 4U1ZA 1SW1A 2CEYA 1IXIA 1WDNA 2UYFA 3FJMA 4P0IA 5IZZA 4LQ2A 4MF3A 4FIMA 4GOTA 4ND9A 4IGRA 4YB7A 3BIGA 1FTAA 3LUYA 4MHFA 1D9QA 2QFLA 2RKMA 4OFOA 4F2OA 2Q89A 1FRPA 4Q30B 5FHNA 2DP8A 2O1LA 4ELQA 2PVUA 4DXCA 2DWHA 3IX1A 3I3VA 3KOTA 1Y4TA 4F29A 3EHUA 4QFPA 4O94A 3PPPA 4PQJA 1LFGA 2PBWA 1FTMA 4LP2B 4MMPA 1DMBA 4OA4A 2NVUB 5LDZA 2ONRA 2OJTA 3HCQA 1XT8A 4F1VA 1LAXA 1NH7A 5F7VA 4G61A 2KR0A 1SD3A 1FQBA 4MFIA 1JW5A 4GVOA 1ATGA 3MWBA 4HW8A 3MVXA 3T66A 2Z8DA 2HAVA 3KGCA 5FTHA 4DXUA 4MNCA 3H6TA 4GL8A 3QYTA 1IMEA 2QJEA 3ECRA 3MP6A 4U4SA 3SEUA 3ILTB 1N3WA 4LZ8A 3AXFA 1DTGA 1TWYA 3FV1A 1EZPA 4RYAA 3VDFA 5ET6A 5I7IA 1B7ZA 2A5TB 1SI0A 3R26A 4LATA 1BP5A 3TCFA 4U1OA 4GQOA 3DELB 4FBPA 3IO6A 4YKIA 4PFBA 2Q74A 4YZZA 1A8FA 4WEDA 4DLDA 2AL5A 5AA4B 2R9JA 1NH8A 4TOZA 4NF8B 1R9LA 1XC1A 4RK9A 4ZZAA 4NWCA 4PETA 2O7UA 5AA4A 5B70A 1NUYA 3O66A 1ZBMA 3IAZA 4NF8A 2G93A 1R1NA 4H8IA 1UTBA 3FATA 4ZDMA 1AWBA 5FHMA 4P1EA 4NF0A 5I2KB 2E1SA 3K6WA 5CMBA 2NOOA 1AH5A 2P3VA 3MSTA 1Y1ZA 4G8NA 5I2KA 2M8CA 1LB8A 1PB8A 5KCJB 2FA7A 4ZE8A 4H6DA 4MEVA 1FPEA 4I40A 4GL0A 3TDJA 5KCJA 5I58B 3M3LA 3GBBA 1B32A 4JWYA 1FBEA 3MVZA 3KC0A 4HE0A 4LZ5A 1OLCA 1H76A 4POWA 4F1UA 4L17A 5I58A 5CBRA 1QUJA 4KI0E 4YICA 3SESA 3HV1A 2ONSA 4EXLA 3FZVA 2D5WA 1DK4A 4OEVA 3WAEA 3U92A 3TEPA 1MXWA 4QXDA 2ZZVA 1LBBA 3I6VA 1XI6A 3SEWA 3M3KA 2G29A 3TYHA 3UIFA 5H8HA 3QUFA 3IOUA 2ZYNA 5FHOA 2DSFA 5ITOA 3CFLA 2DOJA 3MVYA 4PBQA 1LAGE 4JVCA 5AA2B 3MYUA 2Z23A 2VPNA 4QBAA 3UP9A 2H99A 5I57B 4YB5A 2HHMA 1LBYA 1FBHA 5AA2A 3MBPA 2V84A 4P8BA 2ZNUA 1FPGA 5I57A 4FJPA 4PAFA 3G3KA 2XXIA 4DE8A 4H1XA 1RDYA 1NV4A 4F31B 4FECA 1LBZA 5DEXB 2V93A 2WYKA 3KEIA 3U72A 1M5DA 3GXAA 3FJGA 2HXRA 4ZECA 1MQJA 2XXPA 1A8EA 1IMAA 4LZ7A 5DEXA 4R2FA 3OSRA 3IOVA 1FJ6A 2NXOA 3OEMA 1A55A 1NL5A 3VXBA 1GTKA 4R74A 2XXKA 4LA9A 3ZSFA 1NNTA 2DDKA 4U23A 2OWZA 3BFUA 4Z7EA 2DWAA 1SYHA 4BDQA 1QKBA 3RTFB 2UXAA 5DVFA 3D4GA 4P11A 2HPGA 3CVGA 3OD7A 4G8MA 5M2VA 1P99A 4N6KA 1N7WA 3CSBA 5I5PA 1IQ7A 2ZNTA 3OSQA 3T9VA 1MY1A 3TMGA 4RXLA 4GRKA 5TPAB 1PBPA 3KJTA 3FGSA 3T93B 1IEJA 3T9UA 2XXHA 1N3XA 1QW0A 1TFDA 1QGXA 3PUVE 5TPAA 2F3BA 4G77A 2WEFA 1Q1KA 4TLLB 4R75A 2XA5A 4BDMA 3G7WA 5CMKA 3QK6A 4C0RA 1B5HA 2PCRA 2AL4A 3IK6B 3MJNA 4DI4B 2ABHA 2P1SA 4NAPA 1M5FA 3ONMA 3Q25A 3FV2A 3A3UA 4PFUA 4FATA 3HHFA 4Q0CA 1B3HA 2ZXTA 1FQAA 4KXPA 1MQGA 4XXUA 2GQ1A 3W9WA 2V3QA 1IXHA 4BLAA 4ZS9A 5HM4B 3KG2A 4F19A 4PP0A 3MW0A 4NEDA 5I3SA 4JDFA 5JTYB 4NHBA 4UACA 4AQ4A 5DVIA 3KSJA 3THIA 2RCBA 4NG7A 3TQLA 4GWSA 1B3GA 1K9YA 4GX6A 2MKZA 2B4LA 4WKMA 5EYFA 1YZ0A 4OXVA 2F6PA 4KHZE 1B40A 3NOHA 1FPLA 4I62A 1NNKA 1P1OA 1EYJA 3PMVA 3LC8A 2QMWA 1XOCA 1ELJA 3C35A 3TTNA 4QSDA 1LGBC 1UQWA 1URGA 3TODA 5I59A 1SW4A 3V89B 1AIVA 1FPBA 3B6WA 3K01A 2XD3A 1FPIA 2XHDA 2DXRA 3CFZA 5H8NB 4RPNA 3SEYA 1H43A 1US5A 4IO2A 1FTLA 4F3PA 4N91A 5CMMA 3IOTA 2CZKA 2L5VA 5H8NA 1BKAA 4ZEBA 5CM6A 4OVSA 4P1LA 1NUXA 3WAFA 4PFYA 3U94A 4TQUQ 2KQZA 1SW5A 3E79A 3MQ9A 2F8DA 3MZ1A 4NTLA 1ZLQA 2QMXA 5ET7A 4ZEFA 4IO6A 4BDLA 5HBCA 3M8UA 2P2AA 4KYEA 2DE2A 2FVZA 4KFQA 3TCHA 3K6XA 3H6UA 1B7HA 2B65A 4YB6A 4FEBA 1LBVA 5A5LA 4OQOA 4N17A 4Q8RA 1MY3A 3FJ7A 4R6YA 2DE4A 1SPIA 4F3BA 4R6HA 3B7DA 5L9OA 3SEVA 1Y3NA 4EQ9A 4PBHA 3N5LA 1URSA 3VXCA 2O1MA 3UGWA 2REGA 4QSCA 3LR1A 5AA3A 5J1DA 5A5XB 2XWIA 2QL3A 2OBGA 3OOAA 3EF7A 3B8BA 3W9VA 5J16A 4IY6A 1ZKBA 4X04A 2DVCA 2CMOA 1SYIA 3DM0A 1PEBA 4YMAA 2UVJA 4IY5A 5A5XA 1HSEA 2HAUA 1MH3A 2QVVA 3K00A 2I49A 3K02A 3L6GA 4PF6A 3SZPA 3JZJA 2XX7A 1MPDA 1GR2A 4HCYA 1RYXA 1OVTA 3DP4A 4DIGA 4ESWA 4YKKA 4LVQA 1MM7A 3EQ1A 3FXQA 3H6WA 4OANA 2QVUA 1B3EA 2LAOA 3FVOA 3U8QA 4DCYA 1WVJA 3FXRA 2XWOA 4ECFA 2V25A 3S2VA 3T0JA 1NV6A 1LAFE 4GXSB 4PGNA 1RKMA 4WXJA 1YPNA 1N0TA 3O2AA 4MLVA 3A09A 3MAMA 2XX8A 1ZJLA 1FQCA 3BBRA 4JBZA 3W15C 4G68B 5H8FB 4ESXA 1G0HA 3OO9A 2VPOA 3CIJA 4H5GA 1QUIA 3KN3A 4G68A 3KJ7A 5H8FA 3TTLA 4QFLA 4N6DA 4QFNA 4MCOA 4I8CA 3S9EA 3F11A 4MAGA 1N84A 4IO4A 3RT6B 3C34A 1B05A 5I2NA 4GLIA 3PMWA 4YAHX 2F97A 4EXKA 3HO7A 3VV5A 4PFRA 3RLFE 3IB2A 4GX3A 1TT1A 1UTBB 1UIUA 1YTVA 4QHQA 2RC9A 4IR8A 3EN3A 3FVNA 1JVYA 4ELRA 3U65A 2F34A 2I0CA 3FVGA 4PDDA 1IMDA 5ET5A 2E0SA 1B46A 1XVYA 1B0HA 1DOTA 3QUJA 3OELA 3K1NA 2VGQA 2DQVA 4DZ1A 3RT8A 5I84A 5LOMA 1PC3A 4N8GA 1IITA 1EH3A 4RK2A 4M4GA 3IOWA 1ANFA 3EHTA 2Y7IA 1JNFA 2BJJX 2UYEA 4UABA 3LSXA 1I6QA 3KFMA 1JQFA 1QUKA 1NKXA 3PUWE 4H46A 1FCKA 3H7MA 4GF8A 2Q2CA 1Y3QA 4OFJA 3PU5A 2F7AA 4P56A 4Z0IA 4GBWA 1YXIA 2O51A 5H8SA 3CSGA 1H45A 2HQ0A 1B4ZA 4G8HA 3N6TA 1OQGA 1B3LA 1LBCA 4TLMB 3ZS6A 2A5SA 2D3IA 3HN0A 3LUZA 4HE2A 4U2RA 3DP8A 1NV2A 2YPNA 3C33A 5H8HB 3LBSA 1P1NA 1B0LA 4PCDA 1P1QA 1Z7ME 3PPQA 1R9QA 4OERA 1AMFA 4JVIA 3R6UA 1OMPA 4OETA 3GZGA 2NWJA 1RYOA 2HZKA 2V4CA 4HXVA 5ESYA 3OXNA 2XX9A 2I3VA 1VE4A 3TAJA 4GD5A 5CMCA 1J1NA 3HPIA 1M5CA 1D9VA 1YCJA 1NNPA 2CZLA 2ZZWA 2H9BA 3FASA 3CR9A 3QIMA 4GWWA 3TTKA 4YKPA 5L9SA 5K2YA 1O64A 5JK4A 5ET8A 3O9PA 4PE3A 3S9MC 5L9MA 3M3FA 2XXXA 3LSWA 3OENA 1B52A 3U93A 2QS3A 1FQFA 1T0KA 4F22A 3H6VA 5EHSA 4KYSA 1MXUA 4YKJA 3T96B 4DCXA 5CI5A 4BDRA 1HSJA 3FD3A 2O68A 2Y5LA 3PPRA 1Q9DA 1IMBA 1FSAA 2I6EA 1DTZA 2ZZXA 2Q88A 4X1DA 3RYDA 1JP4A 2F6GA 4YU0A 4MJOA 2DXYA 3GBAA 1R6ZA 2I0BA 4F3SA 1GGGA 3C31A 1CE2A 1D3KA 2F5XA 3RNNA 2FNCA 1B1XA 1B58A 2QS1A 3K0VA 4PFIA 2ANJA 4BDNA 4F3GA 2QPQA 1AL3A 4ZE9A 1SVXB 1IMCA 3OMBA 2FYIA 2H4IA 2THIA 4AS4A 3VLVA 1SBPA 3D1RA 1FJ9A 2OLBA 3PPNA 4F1YA 1VR5A 2HFBA 1DSNA 1JETA 4RA1A 1H44A 3ISPA 4F2QA 3GYYA 3PMXA 4MBPA 5IKBA 3VE1B 2PFZA 2R8TA 4O7MA 3DLNA 3OEKA 4MH5A 3RPLB 2H98A 5DT6A 3E78A 4H67A 3VVDA 1NUWA 5I56B 1LSTA 3RPLA
chains in the Genus database with same CATH topology
1BK4A 4P47A 4XFEA 2DE4A 4GBVA 1SPIA 1NV1A 5EQ9A 4FBPA 4PFBA 2Q74A 2FIEA 4YZZA 4PBHA 4GX4A 4OVQA 1KZ8A 1FBCA 2WYPA 5IM2A 5J1DA 4PC9A 2FBPA 4N4UA 2XWIA 2Q8MA 4H45A 4PETA 1NUYA 3B8BA 3W9VA 5J16A 4X04A 4PGPA 2QVRA 1LEVA 3KBZA 1YYZA 2QVVA 1AWBA 4I3EA 4GWZA 4GWXA 4PF6A 3SZPA 4P1EA 4NF0A 4PAKA 1KA1A 4M1VA 4HCYA 4OVPA 2DE3A 1NV5A 4PTKA 2P3VA 3MSTA 4P9KA 2CZIA 2F3DA 3IFCA 4MNPA 4OANA 2QVUA 4I3YA 4N8YA 5T3JA 4X9TA 5EYGA 1INPA 4MEVA 1FPEA 2XWOA 4I40A 3T0JA 2Q9TA 1NV6A 4O8MA 4PGNA 3IFAA 1FBEA 3KC0A 4HE0A 4XEQA 4F1UA 1K9ZA 4NQ8A 2PFYA 4YICA 1DK4A 4JVDA 1FBDA 4QXDA 2ZZVA 1G0HA 2VPOA 1XI6A 2HZLA 2CZHA 1FPKA 1NUZA 3PTYA 1FBPA 4N6DA 4MCOA 4DI3D 3B50A 5IZ3B 4MAGA 4PBQA 4JVCA 3LV0A 1RDXA 5IGAA 3MYUA 5EQ7A 2VPNA 4QBAA 1DCUA 1EYIA 2JJKA 5IZ3A 2HHMA 1LBYA 1FBHA 4PFRA 4GX3A 4GWUA 2FHYA 4P8BA 1FPGA 4PDHA 4PAFA 1RDYA 1NV4A 4MIJA 4IR8A 1LBZA 4OVTA 2WYKA 1G0IA 4LN5A 2HXRA 3U65A 1IMAA 4PDDA 1IMDA 5ET5A 1FJ6A 5F24A 3A29A 1CNQA 1NV3A 2XXKA 4GWYA 2DDKA 2OWZA 4N8GA 1EYKA 1FPDA 4HE1A 4UABA 1DBZA 3CHGA 5IZ1A 2HPGA 2B4MA 5EYHA 4H46A 2OX3A 2XWVA 4N6KA 4P56A 4GBWA 1YXIA 3T1BA 5I5PA 4N81A 4OVRA 4XF5A 4N15A 4X8RA 2FIXA 3LUZA 3ROJA 4HE2A 1NV2A 1QGXA 2F3BA 2WBDA 1NV7A 2WEFA 4NGUA 4PCDA 1VDWA 2XA5A 3BIHA 4F18A 5FBPA 4HCWA 2PCRA 3QMFA 4JVIA 4DI4B 2HZKA 2V4CA 4HXVA 5LTCA 4NAPA 5ESYA 4NX1A 4MNIA 1FPFA 1FPJA 1NV0A 3KC1A 4KXPA 2DVZA 2ZZWA 1NI9A 4NN3A 2GQ1A 3HFUA 4GWWA 2P3NA 4MX6A 3W9WA 2V3QA 5JK4A 1KA0A 1IMFA 5ET8A 2CEYA 4PE3A 4F19A 2XWKA 5I3SA 2CEXA 5IZZA 4NHBA 5DW8A 4NG7A 4GWSA 1K9YA 4GX6A 2MKZA 3BIGA 2B4LA 1FTAA 4MHFA 2VT5A 1YZ0A 1D9QA 4PF8A 2QFLA 1FRPA 1FBFA 3NOHA 1FPLA 2Y5LA 1Q9DA 2BJIA 1IMBA 1FSAA 1FBGA 1EYJA 2ZZXA 3RYDA 4O94A 1JP4A 1FPBA 4MJOA 4MMPA 4OA4A 1FPIA 5LDZA 3FXBA 2F5XA 4O7IA 4P3LA 4F1VA 4PFIA 4N91A 1LBXA 2CZKA 2L5VA 4G61A 2KR0A 5CM6A 2QPQA 4OVSA 4P1LA 2Y5KA 1NUXA 1IMCA 2WX9A 4PAIA 2KQZA 3E79A 4AS4A 1LBWA 4MNCA 3D1RA 1RDZA 5ET7A 1FJ9A 1IMEA 5EQ8A 3ISPA 4AS5A 3EKIA 3GYYA 2DE2A 2FVZA 2PFZA 2R8TA 4O7MA 3RPLB 2WBBA 3E78A 1LBVA 1NUWA 5EQAA 5ET6A 3FBPA 5A5LA 4N17A 5I7IA 3RPLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HFU A;  4QBA A;  3T1B A;  4JVC A;  4JVI A;  4JVD A;  2HXR A;  3ISP A;  3SZP A; 
#chains in the Genus database with same CATH topology
 4P47 A;  1LLS A;  4N6P A;  1NV1 A;  1LCT A;  1D4N A;  5I56 A;  4R9G A;  5EQ9 A;  2FIE A;  1MPB A;  2AIX A;  3Q28 A;  4RPO A;  4GX4 A;  4K3F A;  4OVJ A;  3UA8 A;  1KZ8 A;  4KD5 A;  2WYP A;  4G68 C;  3A3C A;  5IM2 A;  3TZA A;  2V3T A;  3V5A A;  4ELO A;  2FBP A;  2Q8M A;  4AB6 A;  4GWO A;  4H45 A;  1POY 1;  1Q35 A;  4IGT A;  4HS7 A;  2GHA A;  4JWO A;  4NF6 B;  1MQD A;  1YYZ A;  4XKR A;  2OWT A;  1FQD A;  1XHY A;  5I59 B;  4XTC Q;  4EDP A;  4NF6 A;  3QXM A;  1HSL A;  3K2D A;  5ICQ A;  5IAI A;  1KA1 A;  4OVP A;  2XXQ A;  4PFW A;  1FTJ A;  3E3K A;  4H5F A;  1USY E;  3TFL A;  3R7X A;  1TXF A;  2XXW A;  2B3F A;  2YLN A;  1B5J A;  4XKP A;  2F3D A;  3IFC A;  4MNP A;  3CRB A;  4I3Y A;  1EZ9 A;  2ZNS A;  4N8Y A;  2I58 A;  1FTK A;  3GLB A;  4O3B A;  4X9T A;  1Y9U A;  1VFD A;  4IO7 A;  2UVI A;  2GRV A;  2Z22 A;  2Q9T A;  1JEV A;  4O8M A;  5FTI A;  3IFA A;  3I5O A;  4P0G A;  3MZ9 A;  4E0X A;  1D9Y A;  4POX A;  2OWS A;  1QJM A;  4N07 A;  4Q5T A;  1GV8 A;  1K9Z A;  1CB6 A;  5TP9 B;  4BDO A;  1YAE A;  4GXA A;  1PDA A;  2PFY A;  3E13 X;  4NQ8 A;  3UK4 A;  2VOZ A;  3TPA A;  2Y84 A;  4JVD A;  4OMB A;  1FBD A;  4GFR A;  4R73 A;  1S7Y A;  5TP9 A;  4IB2 A;  3RGY A;  2HZL A;  2CZH A;  2H5Y A;  4EUO A;  1NUZ A;  3PTY A;  2D21 A;  2H25 A;  3V8X B;  2X7Q A;  3MPK A;  1QVS A;  2DWI A;  2Q8J A;  1I69 A;  4FE8 A;  4QF9 A;  3B6Q A;  3K1M A;  5TU0 A;  3C9H A;  3B50 A;  5ICT A;  5IZ3 B;  3BKI B;  1BTJ A;  3UN6 A;  1RDX A;  3O6I A;  5IGA A;  2W7Y A;  2RIN A;  3H4Z A;  2JJK A;  5IZ3 A;  4PE5 B;  1B51 A;  2V3U A;  3DP6 A;  1Y20 A;  4GWU A;  2O69 A;  1MG1 A;  4PFT A;  1LCF A;  1B2H A;  4PDH A;  2X7P A;  3PUX E;  1JW1 A;  1LAH E;  3VLW A;  1LFI A;  4EF1 A;  1FTO A;  1O63 A;  4OEN A;  1SI1 A;  3S9N C;  3PUY E;  5F24 A;  3PPO A;  5AE4 A;  3A29 A;  2QS2 A;  1EZO A;  1NV3 A;  1PB9 A;  2GHB A;  4GWY A;  1A7L A;  2DYX A;  2I48 A;  4DXB A;  1SW2 A;  3VFJ A;  4HE1 A;  4QRZ A;  3KBR A;  1MM6 A;  1DPE A;  2R6G E;  5IZ1 A;  2B3B A;  1Y1M A;  3B6T A;  3IB0 A;  1N76 A;  2XWV A;  2XD2 A;  3MP8 A;  4KYD A;  2GFE A;  3VVE A;  2P0S A;  4XF5 A;  4EQ7 A;  4ZZE A;  1UTH B;  4LQ5 A;  1TFA A;  1IUD A;  1MXY A;  4OWD A;  1MQI A;  2HEU A;  2HXW A;  4X8R A;  2IA4 A;  1UTH A;  2KLF A;  2FIX A;  1A99 A;  4U21 A;  2WBD A;  3UOR A;  4NGU A;  1IXC A;  4O3A A;  4OEU A;  3C4M A;  2I3W A;  5FBP A;  3IJO B;  3HHG A;  4HCW A;  2UVH A;  3KN7 A;  5I2N B;  1MDQ A;  3JYR A;  4E0W A;  4ZED A;  4C1T A;  5ISU A;  5LTC A;  4NWD A;  4MNI A;  5DTB A;  4NMY A;  2NUV A;  1FPJ A;  4LON B;  4THI A;  2DVZ A;  4NN3 A;  2P3N A;  4MX6 A;  1P1U A;  1B7U A;  3KN8 A;  1KA0 A;  1IMF A;  5JEI A;  2Q2A A;  4UA8 A;  2HCA A;  2ZYO A;  2A5T A;  3C32 A;  3O28 A;  3OO7 A;  2XWK A;  3SEX A;  3RTW B;  4G4P A;  2CEX A;  4KQP A;  3QSL A;  3PD8 A;  4R6K A;  4OFL A;  5DW8 A;  3QAX A;  2Y7W A;  3G3H A;  4R9F A;  5K2X A;  3TTR A;  1IZ1 A;  2VT5 A;  4PF8 A;  5CBS A;  1ZTY A;  2PT1 A;  3CG1 A;  2PT2 A;  1ZIU A;  1FBF A;  4NF4 B;  3H03 A;  1I6B A;  2BJI A;  2RCA A;  1O7T A;  1LFH A;  1FBG A;  3S9L C;  2O7I A;  4JB7 A;  3C36 A;  3JV9 A;  3O6H A;  1L5T A;  4NF4 A;  4LUB A;  2Z8F A;  4QSE A;  1II5 A;  2XXY A;  5CRY A;  3SKP A;  3OO8 A;  1ZMG A;  4JXI A;  3TEL A;  3OO6 A;  1XS5 A;  1XVX A;  1KWH A;  3FXB A;  1A40 A;  4O7I A;  4P3L A;  2QS4 A;  4NE4 A;  3ZKK A;  5AA2 D;  1LBX A;  2F7B A;  3L6H A;  2Y5K A;  5BWJ A;  2WX9 A;  1NNF A;  2X26 A;  4PAI A;  3MVW A;  4EF2 A;  4ZEI A;  1LBW A;  2XXU A;  1RDZ A;  5EQ8 A;  1B4H A;  2RC7 A;  2ZYK A;  5ITP A;  1QKA A;  4AS5 A;  3EKI A;  1UIV A;  1SQY A;  3RQT A;  3SER A;  1PB7 A;  1JVX A;  5AA1 A;  2WBB A;  1MXX A;  2RC8 A;  2DWJ A;  4H0W A;  3TUS A;  5EQA A;  3FBP A;  3CFX A;  3U1O A;  3E9X A;  1BK4 A;  1BIY A;  1S9T A;  1VSO A;  2UVG A;  4XKN A;  1BLF A;  4XFE A;  4GBV A;  4NF5 B;  2Z8E A;  2XXR A;  2ZMB A;  3IOR A;  3MC2 A;  2QSX A;  3VLU A;  2F7C A;  1P1W A;  1OLA A;  4NF5 A;  3RUM A;  4OVQ A;  4ZEK A;  3KSX A;  3LSF B;  1MDP 1;  3ILU B;  1FBC A;  4AB5 A;  3ODB A;  1MRP A;  1NFT A;  3SET A;  4RY1 A;  3TKD A;  1Y3P A;  4PC9 A;  3EHS A;  4N4U A;  2VP1 A;  1B9J A;  2O6A A;  1MY0 A;  2YJP A;  1MY2 A;  4O3C A;  4PGP A;  4OTE A;  2QVR A;  1MS7 A;  3CI8 A;  1LEV A;  3KBZ A;  3K4U A;  4JSO A;  4RJZ A;  3RN8 A;  5BUU A;  4EQB A;  4I3E A;  1VFE A;  4DDD A;  4GWZ A;  4GWX A;  4PAK A;  1OVB A;  4JWX A;  4M1V A;  1MXZ A;  3PV0 E;  4X1B A;  2DE3 A;  1MXV A;  1NV5 A;  4PTK A;  4P9K A;  2OZZ A;  2CZI A;  1EU8 A;  2VD2 A;  1MH4 A;  3TCG A;  5L8D A;  5T3J A;  4FED A;  5EYG A;  4ELP A;  1INP A;  3FVK A;  3K1P A;  2DS9 A;  1SDX A;  3O29 A;  5F1Q A;  4XIG Q;  4XEQ A;  4F39 A;  4FOR A;  4OYV A;  1LB9 A;  3EPE A;  4N13 A;  5EHM A;  1F9B A;  4U22 A;  3ZKL A;  2RF1 A;  4OHN A;  5HPQ A;  2ESN A;  1I6A A;  4ISU A;  3S4U A;  4FAJ A;  2ZYM A;  3E4R A;  4QFK A;  1US4 A;  5B7D A;  1FPK A;  4U4X A;  3V83 A;  1FW0 A;  2PX1 A;  1POT A;  1FBP A;  3IL1 B;  4H65 A;  1H3D A;  1N7X A;  4GIZ A;  1PBQ A;  1B6H A;  2F36 A;  1B3F A;  4DI3 D;  3USD A;  1WOD A;  1URD A;  2IEE A;  1MY4 A;  2VD3 A;  3T9H B;  3N26 A;  4KCC A;  3LV0 A;  3Q29 A;  4YMB A;  5EQ7 A;  3CG3 A;  4QFO A;  1DCU A;  1EYI A;  3KOS A;  4WEP A;  3G3G A;  3IR1 A;  1Y4C A;  1FQE A;  4XKQ A;  5H8Q B;  2FHY A;  4IO5 A;  5DVJ A;  3G3F A;  3D4C A;  2GH9 A;  3RY3 A;  4MIJ A;  3RPW A;  3LSL A;  2OCU A;  4OVT A;  5H8Q A;  2OK2 A;  1G0I A;  2I4B A;  1USY H;  4I1D A;  4LN5 A;  4C1U A;  3FIR A;  3SDF A;  1S50 A;  2O84 X;  5JTY A;  4KPT A;  1MPC A;  4HTG A;  3IO4 A;  1IIW A;  1IXG A;  2XXV A;  4KR5 A;  1CNQ A;  5ELV A;  4R72 A;  3G3I A;  1EYK A;  1GVC A;  3PD9 A;  1Z7N E;  1FPD A;  2Y7P A;  2R71 A;  2QRY A;  2WKY A;  4I9D A;  1N04 A;  3Q26 A;  1DBZ A;  3CHG A;  3K6V A;  3MP1 A;  4ONY A;  2F35 A;  2VHA A;  2B4M A;  3G3J A;  5EYH A;  3BFT A;  2F78 A;  2OX3 A;  5KDT B;  3O6G A;  1DPP A;  1M5B A;  3T1B A;  1AOV A;  1B1H A;  4N81 A;  3H3G A;  4OVR A;  1OQH A;  5KDT A;  2Y7K A;  4G2Z A;  4H8J A;  3MZB A;  4N15 A;  3IB1 A;  3PGF A;  4JSD A;  2PMS A;  3KZG A;  1OIB A;  4R2B A;  5KZT A;  4OES A;  2I4C A;  3ROJ A;  5CC2 A;  1NMU A;  2PYY A;  1B5I A;  1M5E A;  5DYH A;  1NV7 A;  4IO3 A;  1VDW A;  3FXU A;  3HST A;  3BIH A;  4F18 A;  3T22 A;  4RNS A;  2ALU A;  1JW4 A;  3QMF A;  3P7I A;  3T9X B;  4OZ9 A;  3N94 A;  3TQW A;  4KCD A;  2AYS A;  1ZU0 A;  1MQH A;  3H06 B;  2REJ A;  3MPL A;  3MUQ A;  3VVF A;  1A54 A;  1JEU A;  4NX1 A;  1FPF A;  4X48 A;  2XXT A;  4MLQ A;  3FUZ A;  3TTM A;  3K6U A;  1NV0 A;  3KC1 A;  1QUL A;  1NI9 A;  3IJX B;  3HFU A;  3PUZ E;  3O97 A;  3Q27 A;  3N6U A;  2Y7R A;  2ONK E;  4U1Z A;  1SW1 A;  2CEY A;  1IXI A;  1WDN A;  2UYF A;  3FJM A;  4P0I A;  5IZZ A;  4LQ2 A;  4MF3 A;  4FIM A;  4GOT A;  4ND9 A;  4IGR A;  4YB7 A;  3BIG A;  1FTA A;  3LUY A;  4MHF A;  1D9Q A;  2QFL A;  2RKM A;  4OFO A;  4F2O A;  2Q89 A;  1FRP A;  4Q30 B;  5FHN A;  2DP8 A;  2O1L A;  4ELQ A;  2PVU A;  4DXC A;  2DWH A;  3IX1 A;  3I3V A;  3KOT A;  1Y4T A;  4F29 A;  3EHU A;  4QFP A;  4O94 A;  3PPP A;  4PQJ A;  1LFG A;  2PBW A;  1FTM A;  4LP2 B;  4MMP A;  1DMB A;  4OA4 A;  2NVU B;  5LDZ A;  2ONR A;  2OJT A;  3HCQ A;  1XT8 A;  4F1V A;  1LAX A;  1NH7 A;  5F7V A;  4G61 A;  2KR0 A;  1SD3 A;  1FQB A;  4MFI A;  1JW5 A;  4GVO A;  1ATG A;  3MWB A;  4HW8 A;  3MVX A;  3T66 A;  2Z8D A;  2HAV A;  3KGC A;  5FTH A;  4DXU A;  4MNC A;  3H6T A;  4GL8 A;  3QYT A;  1IME A;  2QJE A;  3ECR A;  3MP6 A;  4U4S A;  3SEU A;  3ILT B;  1N3W A;  4LZ8 A;  3AXF A;  1DTG A;  1TWY A;  3FV1 A;  1EZP A;  4RYA A;  3VDF A;  5ET6 A;  5I7I A;  1B7Z A;  2A5T B;  1SI0 A;  3R26 A;  4LAT A;  1BP5 A;  3TCF A;  4U1O A;  4GQO A;  3DEL B;  4FBP A;  3IO6 A;  4YKI A;  4PFB A;  2Q74 A;  4YZZ A;  1A8F A;  4WED A;  4DLD A;  2AL5 A;  5AA4 B;  2R9J A;  1NH8 A;  4TOZ A;  4NF8 B;  1R9L A;  1XC1 A;  4RK9 A;  4ZZA A;  4NWC A;  4PET A;  2O7U A;  5AA4 A;  5B70 A;  1NUY A;  3O66 A;  1ZBM A;  3IAZ A;  4NF8 A;  2G93 A;  1R1N A;  4H8I A;  1UTB A;  3FAT A;  4ZDM A;  1AWB A;  5FHM A;  4P1E A;  4NF0 A;  5I2K B;  2E1S A;  3K6W A;  5CMB A;  2NOO A;  1AH5 A;  2P3V A;  3MST A;  1Y1Z A;  4G8N A;  5I2K A;  2M8C A;  1LB8 A;  1PB8 A;  5KCJ B;  2FA7 A;  4ZE8 A;  4H6D A;  4MEV A;  1FPE A;  4I40 A;  4GL0 A;  3TDJ A;  5KCJ A;  5I58 B;  3M3L A;  3GBB A;  1B32 A;  4JWY A;  1FBE A;  3MVZ A;  3KC0 A;  4HE0 A;  4LZ5 A;  1OLC A;  1H76 A;  4POW A;  4F1U A;  4L17 A;  5I58 A;  5CBR A;  1QUJ A;  4KI0 E;  4YIC A;  3SES A;  3HV1 A;  2ONS A;  4EXL A;  3FZV A;  2D5W A;  1DK4 A;  4OEV A;  3WAE A;  3U92 A;  3TEP A;  1MXW A;  4QXD A;  2ZZV A;  1LBB A;  3I6V A;  1XI6 A;  3SEW A;  3M3K A;  2G29 A;  3TYH A;  3UIF A;  5H8H A;  3QUF A;  3IOU A;  2ZYN A;  5FHO A;  2DSF A;  5ITO A;  3CFL A;  2DOJ A;  3MVY A;  4PBQ A;  1LAG E;  4JVC A;  5AA2 B;  3MYU A;  2Z23 A;  2VPN A;  4QBA A;  3UP9 A;  2H99 A;  5I57 B;  4YB5 A;  2HHM A;  1LBY A;  1FBH A;  5AA2 A;  3MBP A;  2V84 A;  4P8B A;  2ZNU A;  1FPG A;  5I57 A;  4FJP A;  4PAF A;  3G3K A;  2XXI A;  4DE8 A;  4H1X A;  1RDY A;  1NV4 A;  4F31 B;  4FEC A;  1LBZ A;  5DEX B;  2V93 A;  2WYK A;  3KEI A;  3U72 A;  1M5D A;  3GXA A;  3FJG A;  2HXR A;  4ZEC A;  1MQJ A;  2XXP A;  1A8E A;  1IMA A;  4LZ7 A;  5DEX A;  4R2F A;  3OSR A;  3IOV A;  1FJ6 A;  2NXO A;  3OEM A;  1A55 A;  1NL5 A;  3VXB A;  1GTK A;  4R74 A;  2XXK A;  4LA9 A;  3ZSF A;  1NNT A;  2DDK A;  4U23 A;  2OWZ A;  3BFU A;  4Z7E A;  2DWA A;  1SYH A;  4BDQ A;  1QKB A;  3RTF B;  2UXA A;  5DVF A;  3D4G A;  4P11 A;  2HPG A;  3CVG A;  3OD7 A;  4G8M A;  5M2V A;  1P99 A;  4N6K A;  1N7W A;  3CSB A;  5I5P A;  1IQ7 A;  2ZNT A;  3OSQ A;  3T9V A;  1MY1 A;  3TMG A;  4RXL A;  4GRK A;  5TPA B;  1PBP A;  3KJT A;  3FGS A;  3T93 B;  1IEJ A;  3T9U A;  2XXH A;  1N3X A;  1QW0 A;  1TFD A;  1QGX A;  3PUV E;  5TPA A;  2F3B A;  4G77 A;  2WEF A;  1Q1K A;  4TLL B;  4R75 A;  2XA5 A;  4BDM A;  3G7W A;  5CMK A;  3QK6 A;  4C0R A;  1B5H A;  2PCR A;  2AL4 A;  3IK6 B;  3MJN A;  4DI4 B;  2ABH A;  2P1S A;  4NAP A;  1M5F A;  3ONM A;  3Q25 A;  3FV2 A;  3A3U A;  4PFU A;  4FAT A;  3HHF A;  4Q0C A;  1B3H A;  2ZXT A;  1FQA A;  4KXP A;  1MQG A;  4XXU A;  2GQ1 A;  3W9W A;  2V3Q A;  1IXH A;  4BLA A;  4ZS9 A;  5HM4 B;  3KG2 A;  4F19 A;  4PP0 A;  3MW0 A;  4NED A;  5I3S A;  4JDF A;  5JTY B;  4NHB A;  4UAC A;  4AQ4 A;  5DVI A;  3KSJ A;  3THI A;  2RCB A;  4NG7 A;  3TQL A;  4GWS A;  1B3G A;  1K9Y A;  4GX6 A;  2MKZ A;  2B4L A;  4WKM A;  5EYF A;  1YZ0 A;  4OXV A;  2F6P A;  4KHZ E;  1B40 A;  3NOH A;  1FPL A;  4I62 A;  1NNK A;  1P1O A;  1EYJ A;  3PMV A;  3LC8 A;  2QMW A;  1XOC A;  1ELJ A;  3C35 A;  3TTN A;  4QSD A;  1LGB C;  1UQW A;  1URG A;  3TOD A;  5I59 A;  1SW4 A;  3V89 B;  1AIV A;  1FPB A;  3B6W A;  3K01 A;  2XD3 A;  1FPI A;  2XHD A;  2DXR A;  3CFZ A;  5H8N B;  4RPN A;  3SEY A;  1H43 A;  1US5 A;  4IO2 A;  1FTL A;  4F3P A;  4N91 A;  5CMM A;  3IOT A;  2CZK A;  2L5V A;  5H8N A;  1BKA A;  4ZEB A;  5CM6 A;  4OVS A;  4P1L A;  1NUX A;  3WAF A;  4PFY A;  3U94 A;  4TQU Q;  2KQZ A;  1SW5 A;  3E79 A;  3MQ9 A;  2F8D A;  3MZ1 A;  4NTL A;  1ZLQ A;  2QMX A;  5ET7 A;  4ZEF A;  4IO6 A;  4BDL A;  5HBC A;  3M8U A;  2P2A A;  4KYE A;  2DE2 A;  2FVZ A;  4KFQ A;  3TCH A;  3K6X A;  3H6U A;  1B7H A;  2B65 A;  4YB6 A;  4FEB A;  1LBV A;  5A5L A;  4OQO A;  4N17 A;  4Q8R A;  1MY3 A;  3FJ7 A;  4R6Y A;  2DE4 A;  1SPI A;  4F3B A;  4R6H A;  3B7D A;  5L9O A;  3SEV A;  1Y3N A;  4EQ9 A;  4PBH A;  3N5L A;  1URS A;  3VXC A;  2O1M A;  3UGW A;  2REG A;  4QSC A;  3LR1 A;  5AA3 A;  5J1D A;  5A5X B;  2XWI A;  2QL3 A;  2OBG A;  3OOA A;  3EF7 A;  3B8B A;  3W9V A;  5J16 A;  4IY6 A;  1ZKB A;  4X04 A;  2DVC A;  2CMO A;  1SYI A;  3DM0 A;  1PEB A;  4YMA A;  2UVJ A;  4IY5 A;  5A5X A;  1HSE A;  2HAU A;  1MH3 A;  2QVV A;  3K00 A;  2I49 A;  3K02 A;  3L6G A;  4PF6 A;  3SZP A;  3JZJ A;  2XX7 A;  1MPD A;  1GR2 A;  4HCY A;  1RYX A;  1OVT A;  3DP4 A;  4DIG A;  4ESW A;  4YKK A;  4LVQ A;  1MM7 A;  3EQ1 A;  3FXQ A;  3H6W A;  4OAN A;  2QVU A;  1B3E A;  2LAO A;  3FVO A;  3U8Q A;  4DCY A;  1WVJ A;  3FXR A;  2XWO A;  4ECF A;  2V25 A;  3S2V A;  3T0J A;  1NV6 A;  1LAF E;  4GXS B;  4PGN A;  1RKM A;  4WXJ A;  1YPN A;  1N0T A;  3O2A A;  4MLV A;  3A09 A;  3MAM A;  2XX8 A;  1ZJL A;  1FQC A;  3BBR A;  4JBZ A;  3W15 C;  4G68 B;  5H8F B;  4ESX A;  1G0H A;  3OO9 A;  2VPO A;  3CIJ A;  4H5G A;  1QUI A;  3KN3 A;  4G68 A;  3KJ7 A;  5H8F A;  3TTL A;  4QFL A;  4N6D A;  4QFN A;  4MCO A;  4I8C A;  3S9E A;  3F11 A;  4MAG A;  1N84 A;  4IO4 A;  3RT6 B;  3C34 A;  1B05 A;  5I2N A;  4GLI A;  3PMW A;  4YAH X;  2F97 A;  4EXK A;  3HO7 A;  3VV5 A;  4PFR A;  3RLF E;  3IB2 A;  4GX3 A;  1TT1 A;  1UTB B;  1UIU A;  1YTV A;  4QHQ A;  2RC9 A;  4IR8 A;  3EN3 A;  3FVN A;  1JVY A;  4ELR A;  3U65 A;  2F34 A;  2I0C A;  3FVG A;  4PDD A;  1IMD A;  5ET5 A;  2E0S A;  1B46 A;  1XVY A;  1B0H A;  1DOT A;  3QUJ A;  3OEL A;  3K1N A;  2VGQ A;  2DQV A;  4DZ1 A;  3RT8 A;  5I84 A;  5LOM A;  1PC3 A;  4N8G A;  1IIT A;  1EH3 A;  4RK2 A;  4M4G A;  3IOW A;  1ANF A;  3EHT A;  2Y7I A;  1JNF A;  2BJJ X;  2UYE A;  4UAB A;  3LSX A;  1I6Q A;  3KFM A;  1JQF A;  1QUK A;  1NKX A;  3PUW E;  4H46 A;  1FCK A;  3H7M A;  4GF8 A;  2Q2C A;  1Y3Q A;  4OFJ A;  3PU5 A;  2F7A A;  4P56 A;  4Z0I A;  4GBW A;  1YXI A;  2O51 A;  5H8S A;  3CSG A;  1H45 A;  2HQ0 A;  1B4Z A;  4G8H A;  3N6T A;  1OQG A;  1B3L A;  1LBC A;  4TLM B;  3ZS6 A;  2A5S A;  2D3I A;  3HN0 A;  3LUZ A;  4HE2 A;  4U2R A;  3DP8 A;  1NV2 A;  2YPN A;  3C33 A;  5H8H B;  3LBS A;  1P1N A;  1B0L A;  4PCD A;  1P1Q A;  1Z7M E;  3PPQ A;  1R9Q A;  4OER A;  1AMF A;  4JVI A;  3R6U A;  1OMP A;  4OET A;  3GZG A;  2NWJ A;  1RYO A;  2HZK A;  2V4C A;  4HXV A;  5ESY A;  3OXN A;  2XX9 A;  2I3V A;  1VE4 A;  3TAJ A;  4GD5 A;  5CMC A;  1J1N A;  3HPI A;  1M5C A;  1D9V A;  1YCJ A;  1NNP A;  2CZL A;  2ZZW A;  2H9B A;  3FAS A;  3CR9 A;  3QIM A;  4GWW A;  3TTK A;  4YKP A;  5L9S A;  5K2Y A;  1O64 A;  5JK4 A;  5ET8 A;  3O9P A;  4PE3 A;  3S9M C;  5L9M A;  3M3F A;  2XXX A;  3LSW A;  3OEN A;  1B52 A;  3U93 A;  2QS3 A;  1FQF A;  1T0K A;  4F22 A;  3H6V A;  5EHS A;  4KYS A;  1MXU A;  4YKJ A;  3T96 B;  4DCX A;  5CI5 A;  4BDR A;  1HSJ A;  3FD3 A;  2O68 A;  2Y5L A;  3PPR A;  1Q9D A;  1IMB A;  1FSA A;  2I6E A;  1DTZ A;  2ZZX A;  2Q88 A;  4X1D A;  3RYD A;  1JP4 A;  2F6G A;  4YU0 A;  4MJO A;  2DXY A;  3GBA A;  1R6Z A;  2I0B A;  4F3S A;  1GGG A;  3C31 A;  1CE2 A;  1D3K A;  2F5X A;  3RNN A;  2FNC A;  1B1X A;  1B58 A;  2QS1 A;  3K0V A;  4PFI A;  2ANJ A;  4BDN A;  4F3G A;  2QPQ A;  1AL3 A;  4ZE9 A;  1SVX B;  1IMC A;  3OMB A;  2FYI A;  2H4I A;  2THI A;  4AS4 A;  3VLV A;  1SBP A;  3D1R A;  1FJ9 A;  2OLB A;  3PPN A;  4F1Y A;  1VR5 A;  2HFB A;  1DSN A;  1JET A;  4RA1 A;  1H44 A;  3ISP A;  4F2Q A;  3GYY A;  3PMX A;  4MBP A;  5IKB A;  3VE1 B;  2PFZ A;  2R8T A;  4O7M A;  3DLN A;  3OEK A;  4MH5 A;  3RPL B;  2H98 A;  5DT6 A;  3E78 A;  4H67 A;  3VVD A;  1NUW A;  5I56 B;  1LST A;  3RPL A; 
#chains in the Genus database with same CATH homology
 1BK4 A;  4P47 A;  4XFE A;  2DE4 A;  4GBV A;  1SPI A;  1NV1 A;  5EQ9 A;  4FBP A;  4PFB A;  2Q74 A;  2FIE A;  4YZZ A;  4PBH A;  4GX4 A;  4OVQ A;  1KZ8 A;  1FBC A;  2WYP A;  5IM2 A;  5J1D A;  4PC9 A;  2FBP A;  4N4U A;  2XWI A;  2Q8M A;  4H45 A;  4PET A;  1NUY A;  3B8B A;  3W9V A;  5J16 A;  4X04 A;  4PGP A;  2QVR A;  1LEV A;  3KBZ A;  1YYZ A;  2QVV A;  1AWB A;  4I3E A;  4GWZ A;  4GWX A;  4PF6 A;  3SZP A;  4P1E A;  4NF0 A;  4PAK A;  1KA1 A;  4M1V A;  4HCY A;  4OVP A;  2DE3 A;  1NV5 A;  4PTK A;  2P3V A;  3MST A;  4P9K A;  2CZI A;  2F3D A;  3IFC A;  4MNP A;  4OAN A;  2QVU A;  4I3Y A;  4N8Y A;  5T3J A;  4X9T A;  5EYG A;  1INP A;  4MEV A;  1FPE A;  2XWO A;  4I40 A;  3T0J A;  2Q9T A;  1NV6 A;  4O8M A;  4PGN A;  3IFA A;  1FBE A;  3KC0 A;  4HE0 A;  4XEQ A;  4F1U A;  1K9Z A;  4NQ8 A;  2PFY A;  4YIC A;  1DK4 A;  4JVD A;  1FBD A;  4QXD A;  2ZZV A;  1G0H A;  2VPO A;  1XI6 A;  2HZL A;  2CZH A;  1FPK A;  1NUZ A;  3PTY A;  1FBP A;  4N6D A;  4MCO A;  4DI3 D;  3B50 A;  5IZ3 B;  4MAG A;  4PBQ A;  4JVC A;  3LV0 A;  1RDX A;  5IGA A;  3MYU A;  5EQ7 A;  2VPN A;  4QBA A;  1DCU A;  1EYI A;  2JJK A;  5IZ3 A;  2HHM A;  1LBY A;  1FBH A;  4PFR A;  4GX3 A;  4GWU A;  2FHY A;  4P8B A;  1FPG A;  4PDH A;  4PAF A;  1RDY A;  1NV4 A;  4MIJ A;  4IR8 A;  1LBZ A;  4OVT A;  2WYK A;  1G0I A;  4LN5 A;  2HXR A;  3U65 A;  1IMA A;  4PDD A;  1IMD A;  5ET5 A;  1FJ6 A;  5F24 A;  3A29 A;  1CNQ A;  1NV3 A;  2XXK A;  4GWY A;  2DDK A;  2OWZ A;  4N8G A;  1EYK A;  1FPD A;  4HE1 A;  4UAB A;  1DBZ A;  3CHG A;  5IZ1 A;  2HPG A;  2B4M A;  5EYH A;  4H46 A;  2OX3 A;  2XWV A;  4N6K A;  4P56 A;  4GBW A;  1YXI A;  3T1B A;  5I5P A;  4N81 A;  4OVR A;  4XF5 A;  4N15 A;  4X8R A;  2FIX A;  3LUZ A;  3ROJ A;  4HE2 A;  1NV2 A;  1QGX A;  2F3B A;  2WBD A;  1NV7 A;  2WEF A;  4NGU A;  4PCD A;  1VDW A;  2XA5 A;  3BIH A;  4F18 A;  5FBP A;  4HCW A;  2PCR A;  3QMF A;  4JVI A;  4DI4 B;  2HZK A;  2V4C A;  4HXV A;  5LTC A;  4NAP A;  5ESY A;  4NX1 A;  4MNI A;  1FPF A;  1FPJ A;  1NV0 A;  3KC1 A;  4KXP A;  2DVZ A;  2ZZW A;  1NI9 A;  4NN3 A;  2GQ1 A;  3HFU A;  4GWW A;  2P3N A;  4MX6 A;  3W9W A;  2V3Q A;  5JK4 A;  1KA0 A;  1IMF A;  5ET8 A;  2CEY A;  4PE3 A;  4F19 A;  2XWK A;  5I3S A;  2CEX A;  5IZZ A;  4NHB A;  5DW8 A;  4NG7 A;  4GWS A;  1K9Y A;  4GX6 A;  2MKZ A;  3BIG A;  2B4L A;  1FTA A;  4MHF A;  2VT5 A;  1YZ0 A;  1D9Q A;  4PF8 A;  2QFL A;  1FRP A;  1FBF A;  3NOH A;  1FPL A;  2Y5L A;  1Q9D A;  2BJI A;  1IMB A;  1FSA A;  1FBG A;  1EYJ A;  2ZZX A;  3RYD A;  4O94 A;  1JP4 A;  1FPB A;  4MJO A;  4MMP A;  4OA4 A;  1FPI A;  5LDZ A;  3FXB A;  2F5X A;  4O7I A;  4P3L A;  4F1V A;  4PFI A;  4N91 A;  1LBX A;  2CZK A;  2L5V A;  4G61 A;  2KR0 A;  5CM6 A;  2QPQ A;  4OVS A;  4P1L A;  2Y5K A;  1NUX A;  1IMC A;  2WX9 A;  4PAI A;  2KQZ A;  3E79 A;  4AS4 A;  1LBW A;  4MNC A;  3D1R A;  1RDZ A;  5ET7 A;  1FJ9 A;  1IME A;  5EQ8 A;  3ISP A;  4AS5 A;  3EKI A;  3GYY A;  2DE2 A;  2FVZ A;  2PFZ A;  2R8T A;  4O7M A;  3RPL B;  2WBB A;  3E78 A;  1LBV A;  1NUW A;  5EQA A;  5ET6 A;  3FBP A;  5A5L A;  4N17 A;  5I7I A;  3RPL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...