3HFUA

Crystal structure of the ligand binding domain of e. coli cynr with its specific effector azide
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
202
structure length
202
Chain Sequence
GSLRIAVTPTFTSYFIGPLMADFYARYPSITLQLQEMSQEKIEDMLCRDELDVGIAFAPVHSPELEAIPLLTESLALVVAQHHPLAVHEQVALSRLHDEKLVLLSAEFATREQIDHYCEKAGLHPQVVIEANSISAVLELIRRTSLSTLLPAAIATQHDGLKAISLAPPLLERTAVLLRRKNSWQTAAAKAFLHMALDKCAV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator cynR
publication title Crystal structure of the ligand binding domain of E. coli CynR with its specific effector azide
rcsb
source organism Escherichia coli
molecule tags Transcription
total genus 56
structure length 202
sequence length 202
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-05-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.290 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 3hfuA00
4JVDA 4JVIA 4QBAA 3SZPA 2HXRA 4JVCA 3T1BA 3ISPA 3HFUA
chains in the Genus database with same CATH superfamily
5DEXB 2DE2A 1YAEA 1EZOA 3EHUA 3OSQA 1IMEA 1FQDA 4P56A 4YMAA 5I58A 3N6UA 5I56B 2ALUA 3GBAA 1DMBA 1OLCA 5ITPA 1IQ7A 4RJZA 4XKNA 4R72A 4GLIA 2I3VA 1FQFA 1LFGA 3LUYA 1M5BA 2H99A 3KOSA 1DPEA 4KQPA 2GRVA 4OZ9A 2ZYKA 4EF1A 2F34A 4H1XA 1II5A 4I8CA 4NF8A 2REJA 4U1ZA 3T96B 5FHNA 2Y7PA 4KYEA 1Y4CA 3C9HA 3I5OA 3W9VA 1WDNA 5TPAA 4O7IA 2F3DA 1EYKA 3H6UA 4NF6A 4BDMA 3G3GA 5K2XA 1A40A 4YB7A 3IJOB 1LFIA 2QS2A 3FXRA 4GIZA 1NNKA 3SEUA 1Y1MA 2F5XA 1POTA 1MXUA 1JW5A 1UTBB 1H3DA 2Y7RA 3CFXA 2AL5A 1JNFA 3RGYA 4ZS9A 4FECA 1EZ9A 2V3TA 4UACA 2WBDA 3FJMA 4PFTA 4PETA 3UK4A 1MXWA 1LAGE 4XKRA 4O7MA 3I3VA 4BDQA 3MWBA 3B6TA 4BDNA 3VV5A 2GQ1A 3U65A 4R74A 3QSLA 4H46A 2CZHA 1US5A 4MX6A 5L9OA 2OK2A 3VDFA 2B65A 2XX7A 3M3LA 1BP5A 3CFZA 4AQ4A 2Q89A 5K2YA 4XKPA 4QSDA 2KQZA 1YCJA 2A5TA 3B8BA 3HV1A 1VFEA 2P3NA 3O2AA 4GFRA 3IR1A 4PQJA 3S2VA 3FV2A 3KEIA 3JV9A 4E0WA 1URGA 4QXDA 1AMFA 2RINA 4OFOA 5IKBA 3PV0E 3QK6A 4NHBA 3ZS6A 3D1RA 4ZEIA 3ILUB 2OBGA 4PAIA 4JVCA 4JBZA 1DSNA 5IGAA 5ICQA 4ECFA 4Q0CA 3TTRA 2QS3A 1B5IA 3EPEA 4U4XA 1N84A 2RC9A 4PC9A 3GYYA 1HSJA 1QULA 1ZMGA 2W7YA 1NV1A 1LAHE 1OLAA 5H8HA 2D21A 3CIJA 2Z8DA 4H0WA 4PFIA 1BTJA 3LR1A 5H8NA 2ANJA 2DOJA 4RPOA 4GQOA 4Q8RA 1FBHA 1QUJA 1SQYA 1P1NA 2O68A 3IK6B 3S9LC 4IB2A 4ELOA 2F7CA 4EQ9A 1I6QA 3IB0A 4PFRA 1KA1A 2Y84A 5EQAA 1NH8A 3CVGA 4MNPA 3SEWA 3IO6A 1FQEA 2B4LA 1GTKA 5EYHA 5IZ3A 1AH5A 3ZKLA 3O97A 5IZZA 4GWUA 3G3HA 4UA8A 1A8FA 1ZKBA 2OWSA 2I58A 4R6YA 2JJKA 4QFKA 3IOUA 1D9YA 3N6TA 5FTHA 3K6VA 3IFAA 1XVYA 3TDJA 1TT1A 4GXSB 1B9JA 2I0BA 1MPBA 4HW8A 3N5LA 3U94A 3B6WA 3TCGA 3TKDA 5H8FB 4ZE9A 3SEYA 1N7XA 2QSXA 2R71A 4MCOA 4BLAA 1QJMA 3C34A 1FQAA 3O66A 3T22A 2I4BA 1MRPA 2GHBA 1B32A 4I62A 4F3PA 4FEBA 5LOMA 5TP9A 3FATA 4AS4A 1PB7A 4OMBA 4AB5A 3S9MC 4P47A 4F2QA 2XX8A 4GXAA 2BJJX 3PD8A 2DVCA 1L5TA 4P9KA 3C31A 4AS5A 1VSOA 2HXRA 2XWOA 3UORA 2RCAA 3H4ZA 2NUVA 2FNCA 3QUFA 1XT8A 4N8GA 4FBPA 1IZ1A 1G0HA 4MLVA 3VXCA 1FBEA 3MUQA 4PFUA 2O7IA 4WKMA 1USYE 2XX9A 2ZXTA 4KR5A 3ROJA 5AA2A 1LGBC 3MPLA 4MF3A 4OERA 1D9VA 3O29A 3C36A 3G3IA 3UGWA 4R75A 1Y3NA 1JETA 1MPCA 3SESA 4GD5A 1CE2A 4XTCQ 4MFIA 1F9BA 1B5HA 1WVJA 1ZU0A 3H6VA 1UIUA 3RUMA 2PBWA 3E13X 2X26A 4GX4A 4HE0A 2ZYMA 4G8NA 2DWHA 2MKZA 4GL0A 4X1DA 1B1XA 2ONSA 3OXNA 1S50A 3C33A 2PFYA 4R2BA 1EYJA 4GWXA 3L6HA 4DDDA 4IY5A 3B6QA 3MC2A 3RQTA 1VE4A 3A09A 3KN3A 3OO8A 5AA4B 3KC0A 1NMUA 1PEBA 1MQHA 1FQCA 4OTEA 3IORA 1MM7A 3M3KA 2B3BA 4R9FA 4KCDA 4X9TA 1FPBA 3PMVA 4K3FA 4PGPA 1VFDA 4GWWA 3PPPA 2UVHA 4Q5TA 3PPOA 1USYH 4KYDA 3IL1B 1BLFA 3H6TA 1NI9A 1Q35A 1A7LA 3MZ1A 4IO7A 2VD3A 3RPLB 5EQ7A 1YYZA 1HSEA 4KI0E 5FHOA 2RF1A 4PF8A 3BBRA 1LB8A 3SETA 3OEKA 5I84A 2ZNTA 4NF5A 3RT6B 2V4CA 3RTWB 3CRBA 4YICA 1A54A 1FPLA 1LLSA 1UQWA 4PF6A 3EF7A 1OVTA 2DE4A 3QIMA 3KOTA 2ZYNA 4MAGA 5CM6A 2HXWA 4LQ5A 3FJGA 2H4IA 4ZZAA 5I57A 2P3VA 1SYIA 2OWZA 1N3WA 4LZ8A 5A5LA 2WKYA 4R2FA 2Q9TA 2YJPA 1IXGA 1A99A 3KJTA 3E9XA 3HCQA 5DVIA 4PCDA 3TQLA 3GZGA 1Q9DA 2CZLA 5I2NB 3O6GA 3RTFB 3W9WA 2R8TA 1XC1A 4KFQA 3IFCA 3FXUA 1MQIA 1RDXA 4FEDA 2D5WA 2OJTA 3NOHA 3IAZA 1Y3QA 5ELVA 2WX9A 4KD5A 4NWDA 2VPOA 1M5FA 5M2VA 1K9ZA 5I5PA 4EDPA 4GWZA 2QS1A 2OWTA 5DVJA 1FPKA 1INPA 3MVYA 3DP8A 4F18A 2DP8A 1A55A 4PBHA 3R26A 4NX1A 1B2HA 1KWHA 3MBPA 4EXKA 3CHGA 1NUYA 2CEYA 3R6UA 3FASA 4XIGQ 2CZIA 3N94A 3VVDA 1B4HA 1IUDA 5EHSA 2DQVA 3MQ9A 3EQ1A 3OSRA 1LB9A 1KZ8A 3VE1B 4IO4A 1R9QA 3RPWA 2VOZA 3KSJA 2UVIA 1T0KA 3MZ9A 3SEXA 1IEJA 3RN8A 5JTYA 3K02A 3K6XA 2F97A 2UYEA 1SW5A 5TU0A 1HSLA 3N26A 4G68B 3TCFA 3OMBA 3R7XA 5H8SA 1SD3A 2QL3A 1VR5A 2QVRA 2O1MA 3H06B 3K0VA 3C35A 1B1HA 3UN6A 3CI8A 3GLBA 3FGSA 3SERA 4F2OA 2L5VA 1EU8A 4KXPA 3DP6A 1B3LA 3MYUA 4ESWA 4M1VA 3IX1A 3KN7A 4GX6A 5EQ9A 5AA1A 4H5GA 5A5XA 2B4MA 2DSFA 3PUVE 2DE3A 4P8BA 1NUZA 3B50A 5CI5A 4IO3A 1D4NA 5FBPA 5J16A 2O6AA 4QBAA 1MY2A 3KJ7A 2V93A 5AE4A 2ZZVA 4RYAA 1H44A 3USDA 3KZGA 1P1QA 3ONMA 1FCKA 1MDQA 2RCBA 4HE1A 3RY3A 3OELA 5F7VA 2X7QA 3DELB 3H6WA 3VLVA 4P1LA 1MQDA 3HN0A 1FW0A 2RC7A 1DK4A 4PAKA 2AIXA 3DLNA 3OOAA 4GX3A 1SPIA 1B7HA 5I2KB 1WODA 3TYHA 3IOVA 2VPNA 2PX1A 1B40A 3HSTA 4OEVA 3PMWA 4IR8A 1AL3A 1ATGA 2DVZA 1NV5A 1UTHA 3AXFA 5LDZA 3IB2A 2CMOA 3T0JA 4MLQA 3K1NA 2UVJA 4O94A 2OCUA 1J1NA 1JVXA 3T9HB 4F39A 1SW2A 1O64A 5DT6A 1LAFE 3TFLA 1LBWA 2ABHA 4QSEA 3VLUA 3S9EA 4YZZA 1AWBA 2ZYOA 3TCHA 3U93A 3D4CA 1DTGA 3KC1A 2V25A 2XXUA 3LSWA 4FAJA 5KDTB 1PB9A 4JVIA 4OESA 5H8QB 5KCJA 2F6GA 2O84X 3ZKKA 2V3QA 4XKQA 3TMGA 2Q8JA 5CBRA 1LBVA 1MY1A 4U23A 4IGTA 1IMDA 4ND9A 2B3FA 3IO4A 1ZBMA 3PUZE 3KG2A 4DZ1A 2AL4A 4EXLA 2QS4A 4F1VA 4DCYA 1DBZA 2LAOA 2QJEA 1ZLQA 4OFLA 2KLFA 3MVXA 1N7WA 2I6EA 1QKAA 3RT8A 1YPNA 3FVNA 5ET7A 3MPKA 1MS7A 2HQ0A 5DEXA 2IEEA 3KFMA 2YPNA 1B3FA 2R9JA 4I3YA 4NF4B 4G68A 5I56A 2E1SA 2QMWA 5L9SA 1B05A 1JEVA 3TAJA 3E3KA 2HHMA 4H65A 4JWYA 4N81A 3E78A 2Z23A 3GXAA 3EN3A 2NVUB 2HAUA 2PYYA 1R9LA 4OENA 4HS7A 4UABA 4M4GA 3BIGA 4PFWA 3H3GA 4H6DA 4H8JA 4R9GA 1NV6A 2HCAA 3FVKA 4QFOA 3MP6A 2DS9A 4N8YA 1H43A 4PDHA 2O1LA 1MQGA 3PU5A 5ET5A 2G93A 1OQGA 1H76A 1NUXA 2XWVA 3FD3A 1N76A 5L9MA 1M5EA 2F36A 5J1DA 1NV7A 3WAEA 2KR0A 1RYXA 4OXVA 1FRPA 3K1MA 3T9VA 4MH5A 1Q1KA 2RKMA 3EHSA 4YKPA 4FATA 4LATA 2IA4A 1UTBA 1ZIUA 3EKIA 2ONRA 2PVUA 1NNFA 3T93B 1R6ZA 1AIVA 1FTMA 2HZLA 3FUZA 1MG1A 3MSTA 3HHGA 4OVJA 5AA3A 4MIJA 3QAXA 5DW8A 2FIXA 2XWKA 1PB8A 4NGUA 1TWYA 1FTKA 3L6GA 3M3FA 3TEPA 4G4PA 4N4UA 3U72A 5I59B 3FXBA 4LA9A 1SW1A 2M8CA 1AOVA 3BFUA 2FA7A 2REGA 3O6HA 3A3CA 5ITOA 4ZDMA 5IAIA 3FVGA 4KPTA 4OA4A 4N6DA 5EYFA 4PFYA 3FZVA 2HAVA 2XWIA 3KBRA 3PMXA 3OO7A 4RNSA 2VP1A 4GVOA 4G2ZA 3K2DA 4ZZEA 1P1WA 1US4A 3EHTA 3FJ7A 4X8RA 2RC8A 4E0XA 1YXIA 4ISUA 1Y20A 1XVXA 4ELRA 3LC8A 3TTKA 4OQOA 2DYXA 3CSBA 4ONYA 1I69A 1NKXA 1R1NA 4QF9A 4N13A 2PMSA 2WYPA 4GRKA 5DYHA 2A5SA 4YB5A 2PT2A 1RYOA 4EQBA 3G7WA 4GWOA 2F7BA 1PBPA 3UIFA 1FBPA 4OHNA 4MHFA 1B7ZA 4N91A 2PT1A 1JP4A 4BDLA 4WEPA 4BDRA 3HFUA 4XEQA 4I1DA 2ZNSA 1PDAA 5I58B 2GFEA 2XXIA 1DTZA 2NWJA 1IIWA 2UXAA 3IOWA 1LBCA 1FPIA 4I9DA 3SZPA 4NEDA 1LBYA 4JVDA 2XXHA 2XXVA 4BDOA 4DXUA 1BK4A 4OWDA 2DXYA 4YB6A 4JWOA 1OQHA 4QFNA 1MM6A 4JSOA 3LSXA 3LSFB 1FTLA 4U2RA 4DE8A 3FBPA 3S9NC 4NF8B 1P1OA 4N17A 5TPAB 1IITA 4F3SA 4C1TA 2P2AA 4YKJA 5H8FA 5LTCA 3OENA 3K00A 4ZEBA 2HPGA 3OEMA 1FTOA 3PPQA 1P99A 2HEUA 2XXRA 3KSXA 4I3EA 4N15A 3JZJA 4OVRA 4QHQA 1N04A 1MY3A 3QXMA 3TPAA 1I6BA 4QRZA 3QYTA 2XXTA 3E4RA 4IO5A 3BKIB 4NAPA 4MNIA 4AB6A 3BFTA 4H8IA 2Z8FA 2I49A 5BUUA 2F6PA 2F78A 2XXWA 4F29A 2FYIA 4LVQA 2CZKA 1M5CA 4X04A 2Z8EA 1H45A 2XXQA 1S9TA 1FJ9A 3V83A 4NE4A 4PGNA 2P1SA 4RK2A 2X7PA 1IXHA 2BJIA 3DM0A 3SKPA 3MJNA 3VFJA 1TXFA 4OVQA 3C32A 4YAHX 1FPGA 3DP4A 1Y3PA 3LBSA 2A5TB 2DXRA 1LCFA 4OVPA 3CG1A 1B3HA 1O63A 1FJ6A 2HFBA 4IO2A 3U92A 4EUOA 1XHYA 3LUZA 3MZBA 2HZKA 4N6PA 4F1YA 1N3XA 2H98A 3MVWA 2OZZA 2Y7KA 2NOOA 4R6KA 3TZAA 2DDKA 3OO6A 2WBBA 1URSA 3M8UA 5H8HB 5HPQA 1Y1ZA 1Z7NE 2ZZWA 4P1EA 4TLMB 1MY4A 3CG3A 1MH4A 2DWJA 1NNPA 5AA4A 4FE8A 2XHDA 3THIA 4FIMA 5H8NB 3U8QA 4FORA 3VVEA 3A29A 2Q8MA 1FBFA 4U21A 4HCYA 4RXLA 2XD2A 4O3CA 4P0GA 1G0IA 1K9YA 5T3JA 1QVSA 1KA0A 4THIA 4EF2A 1XOCA 3T9UA 4ZEKA 4JXIA 5EQ8A 1JEUA 1B4ZA 5IZ3B 1B5JA 1FSAA 3RPLA 4F3BA 1YTVA 4PAFA 4P0IA 1SVXB 3V8XB 3BIHA 1SI1A 3CSGA 5I7IA 4HCWA 1NV3A 5B70A 3PPRA 2H5YA 1O7TA 4KYSA 1LAXA 4Z7EA 3B7DA 4LZ5A 4ELPA 3MW0A 3QMFA 4OVSA 4F31B 5CMCA 5CRYA 1NNTA 1FTJA 4WXJA 1QUKA 4HE2A 4DCXA 1IMCA 1IMFA 2I48A 1MQJA 2YLNA 3IOTA 3PUWE 3ZSFA 5HM4B 3TODA 2OX3A 3S4UA 4U1OA 4F3GA 1SYHA 5TP9B 1BKAA 1M5DA 5ESYA 1URDA 4OETA 1RKMA 3LV0A 2Y5KA 4PE3A 4Z0IA 4DIGA 4PP0A 4IGRA 5I2NA 4GF8A 4GL8A 4O3BA 2R6GE 4ZECA 2Y7WA 2PFZA 5ISUA 5I3SA 1GVCA 2V3UA 4GWSA 1QW0A 3HO7A 1IXIA 4U22A 4XFEA 2H9BA 3MP1A 2ONKE 5B7DA 4F19A 4QFLA 1B6HA 3RNNA 4EQ7A 5AA2B 2UYFA 3H7MA 3T9XB 3O6IA 4QSCA 4NG7A 4P11A 3ECRA 1I6AA 1FPJA 2FHYA 4DLDA 1GR2A 2DWAA 2O51A 1B0LA 5FTIA 2ZMBA 1GV8A 4GWYA 5ET8A 5EYGA 1LBBA 5CMMA 4ZEDA 1Z7ME 1IMAA 1EH3A 1DOTA 3FIRA 3Q27A 2QFLA 3F11A 1SI0A 5CC2A 2VGQA 1IMBA 2O7UA 1NV4A 3VVFA 2PCRA 4RPNA 4H67A 5JK4A 4WEDA 1NH7A 1SW4A 1B51A 2THIA 3ILTB 4HTGA 4C0RA 1OMPA 2ZZXA 1FBDA 4PDDA 1B3GA 1NV2A 4NWCA 2QMXA 3TUSA 4ZE8A 2D3IA 1FQBA 4LZ7A 4NTLA 4YKIA 5KZTA 3TTMA 5CMKA 4G8MA 4ELQA 2NXOA 4X48A 1FPFA 2QPQA 2P0SA 5CBSA 4RK9A 1DCUA 3A3UA 5HBCA 4G61A 4YMBA 1TFAA 4NMYA 2H25A 2FBPA 3FVOA 4QFPA 4P3LA 2E0SA 3KGCA 4G77A 4NF5B 3I6VA 1LEVA 2Q74A 1FBGA 2OLBA 2Q88A 1Y4TA 3G3KA 3MAMA 4I40A 1Y9UA 3FXQA 4OFJA 5I2KA 4MEVA 3UP9A 5I57B 2WYKA 1S7YA 2WEFA 2Y5LA 3PUYE 4PE5B 4DI3D 3O9PA 2VD2A 1B52A 1DPPA 3GBBA 3PUXE 3Q25A 3IJXB 4JSDA 5ICTA 4NN3A 3PGFA 1MXVA 4MNCA 4LUBA 3TELA 4DXBA 2QVVA 2XA5A 4G68C 1PBQA 1D9QA 3KN8A 2Q2CA 1MXXA 2FIEA 1B46A 2I3WA 3SEVA 4IY6A 4U4SA 5AA2D 3LSLA 1NV0A 3PTYA 3RLFE 4IO6A 1YZ0A 1JVYA 1QUIA 2G29A 1N0TA 1SDXA 5KDTA 3V89B 5H8QA 3K4UA 1B3EA 1RDZA 4R73A 3HPIA 4LQ2A 4POXA 5F24A 3ISPA 4H5FA 3E79A 1LFHA 2F7AA 4DI4B 1B58A 1TFDA 4ESXA 1EYIA 1LBXA 1EZPA 4ZEFA 1LBZA 1ZTYA 4KHZE 5JTYB 4MBPA 4GBWA 1OVBA 4MJOA 1MDP1 1BIYA 1QGXA 4N6KA 4OEUA 4YU0A 1D3KA 1FPDA 4LP2B 1NL5A 2XD3A 4NF4A 5IZ1A 1MPDA 1CB6A 5FHMA 1CNQA 5BWJA 3O28A 3HHFA 4F22A 1QKBA 3H03A 4F1UA 4O8MA 3PPNA 4JDFA 4GOTA 5CMBA 3G3FA 1JQFA 2DWIA 5L8DA 1FPEA 3SDFA 2XXKA 4PTKA 1P1UA 5ET6A 4RY1A 3QUJA 4FJPA 5A5XB 1B7UA 1ZJLA 4O3AA 5EHMA 4NF0A 2Y7IA 3RYDA 4OANA 1POY1 1ANFA 4X1BA 1VDWA 1MXYA 1XI6A 4NF6B 2GH9A 4JWXA 3CFLA 4R6HA 5DVFA 3UA8A 4LONB 4KCCA 4XXUA 4Q30B 4TLLB 3VXBA 1NFTA 5IM2A 2FVZA 4NQ8A 1GGGA 2ZNUA 3G3JA 2UVGA 3FV1A 3Q29A 4TQUQ 5JEIA 4PFBA 3K6WA 2QRYA 2I4CA 2Z22A 3CR9A 4YKKA 4G8HA 1JW1A 2XXXA 1IXCA 2V84A 1B0HA 1MXZA 4XF5A 4MMPA 1PC3A 1JW4A 5I59A 4OYVA 4JB7A 3T66A 2GHAA 4OVTA 3TTNA 2Q2AA 3MP8A 1UTHB 4H45A 1MY0A 1LSTA 2XXYA 4GBVA 1OIBA 3V5AA 3Q26A 2I0CA 4TOZA 1MH3A 3P7IA 4C1UA 4POWA 2F8DA 3K1PA 1LCTA 2CEXA 5DTBA 3C4MA 3U1OA 3WAFA 3PD9A 4PBQA 2XXPA 4L17A 4N07A 3TTLA 1FBCA 5KCJB 2VHAA 2O69A 3T1BA 2QVUA 3OO9A 2ESNA 3D4GA 3K01A 5F1QA 1SBPA 3VLWA 2F35A 1FTAA 2F3BA 3W15C 3TQWA 1ELJA 4HXVA 2VT5A 1UIVA 1XS5A 4RA1A 4LN5A 3MVZA 3IB1A 2AYSA 1RDYA 3JYRA 3KBZA 3K6UA 3OD7A 1NUWA 1A8EA 4DXCA 3ODBA 3Q28A
chains in the Genus database with same CATH topology
2DE2A 4NGUA 1IMEA 4P56A 4N4UA 2V4CA 4NG7A 4YICA 1FPLA 1FPJA 2FHYA 3FXBA 4PF6A 2DE4A 4GWYA 5ET8A 5EYGA 4MAGA 5CM6A 4OA4A 1IMAA 4N6DA 2P3VA 2XWIA 2OWZA 5A5LA 2QFLA 2Q9TA 1IMBA 1NV4A 2PCRA 4X8RA 3W9VA 5JK4A 4PCDA 4O7IA 2F3DA 1YXIA 1EYKA 1Q9DA 2ZZXA 1FBDA 4PDDA 3W9WA 2R8TA 1NV2A 3IFCA 2F5XA 1RDXA 3NOHA 2WX9A 2VPOA 2WYPA 1K9ZA 5I5PA 4GWZA 1FPKA 2WBDA 1INPA 4PETA 1FPFA 2QPQA 4PBHA 4F18A 4NX1A 1FBPA 4O7MA 1DCUA 3CHGA 1NUYA 4MHFA 4G61A 2CEYA 3U65A 2GQ1A 4N91A 2FBPA 1JP4A 4H46A 4P3LA 2CZIA 2CZHA 4XEQA 3HFUA 4MX6A 1LEVA 2Q74A 1KZ8A 1FBGA 1FPIA 3SZPA 1LBYA 2KQZA 4JVDA 4I40A 1BK4A 3B8BA 2P3NA 4MEVA 2WYKA 2WEFA 2Y5LA 4DI3D 4QXDA 3FBPA 4NHBA 3D1RA 4N17A 4PAIA 4JVCA 2QVRA 4NN3A 5LTCA 5IGAA 4MNCA 2HPGA 2QVVA 4I3EA 4N15A 4OVRA 2XA5A 4PC9A 3GYYA 1D9QA 2L5VA 2FIEA 4KXPA 1NV1A 3MYUA 4NAPA 4M1VA 1NV0A 3PTYA 4GX6A 4MNIA 5EQ9A 2B4MA 1YZ0A 2DE3A 4P8BA 1NUZA 4PFIA 3B50A 2CZKA 4X04A 5FBPA 5J16A 4QBAA 1RDZA 1FBHA 1FJ9A 2ZZVA 4PGNA 2BJIA 5F24A 3ISPA 3E79A 4OVQA 4PFRA 4DI4B 1KA1A 5EQAA 4HE1A 1FPGA 4MNPA 2B4LA 1EYIA 1LBXA 5EYHA 5IZ3A 1LBZA 5IZZA 4P1LA 4GWUA 1DK4A 4PAKA 4GBWA 4MJOA 4GX3A 4N6KA 1SPIA 1QGXA 1FPDA 2JJKA 5IZ1A 2VPNA 4OVPA 3IFAA 4IR8A 1CNQA 1FJ6A 2DVZA 1NV5A 5LDZA 3LUZA 4F1UA 2HZKA 4O8MA 3T0JA 4O94A 4MCOA 1FPEA 2XXKA 4PTKA 1LBWA 2DDKA 2WBBA 5ET6A 4YZZA 1AWBA 4AS4A 2ZZWA 4P1EA 3KC1A 4NF0A 4P47A 3RYDA 4OANA 1VDWA 1XI6A 4JVIA 4P9KA 2V3QA 4AS5A 3A29A 2HXRA 2Q8MA 1FBFA 5IM2A 2XWOA 2FVZA 1LBVA 4HCYA 4NQ8A 1IMDA 1G0IA 1K9YA 4N8GA 5T3JA 4FBPA 1G0HA 1KA0A 4F1VA 1FBEA 5EQ8A 1DBZA 4PFBA 5IZ3B 3RPLA 1FSAA 4PAFA 3ROJA 5ET7A 3BIHA 5I7IA 4XF5A 4HCWA 1NV3A 4MMPA 4I3YA 2HHMA 3QMFA 4OVSA 4N81A 4OVTA 3E78A 4H45A 4HE2A 4GBVA 1IMCA 1IMFA 4GX4A 4HE0A 4UABA 3BIGA 1NV6A 2MKZA 2OX3A 4N8YA 4PDHA 2PFYA 5ET5A 5ESYA 1EYJA 4GWXA 2CEXA 1NUXA 2XWVA 3LV0A 2Y5KA 4PE3A 5J1DA 1NV7A 4PBQA 3KC0A 2KR0A 2PFZA 1FBCA 1FRPA 3T1BA 2QVUA 5I3SA 1FTAA 2F3BA 4X9TA 1FPBA 4GWSA 3EKIA 4PGPA 4HXVA 4GWWA 2VT5A 4XFEA 2HZLA 1NI9A 3MSTA 4LN5A 4F19A 1RDYA 3KBZA 3RPLB 5EQ7A 1NUWA 1YYZA 4MIJA 4PF8A 5DW8A 2FIXA 2XWKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JVD A;  4JVI A;  4QBA A;  3SZP A;  2HXR A;  4JVC A;  3T1B A;  3ISP A;  3HFU A; 
#chains in the Genus database with same CATH topology
 5DEX B;  2DE2 A;  1YAE A;  1EZO A;  3EHU A;  3OSQ A;  1IME A;  1FQD A;  4P56 A;  4YMA A;  5I58 A;  3N6U A;  5I56 B;  2ALU A;  3GBA A;  1DMB A;  1OLC A;  5ITP A;  1IQ7 A;  4RJZ A;  4XKN A;  4R72 A;  4GLI A;  2I3V A;  1FQF A;  1LFG A;  3LUY A;  1M5B A;  2H99 A;  3KOS A;  1DPE A;  4KQP A;  2GRV A;  4OZ9 A;  2ZYK A;  4EF1 A;  2F34 A;  4H1X A;  1II5 A;  4I8C A;  4NF8 A;  2REJ A;  4U1Z A;  3T96 B;  5FHN A;  2Y7P A;  4KYE A;  1Y4C A;  3C9H A;  3I5O A;  3W9V A;  1WDN A;  5TPA A;  4O7I A;  2F3D A;  1EYK A;  3H6U A;  4NF6 A;  4BDM A;  3G3G A;  5K2X A;  1A40 A;  4YB7 A;  3IJO B;  1LFI A;  2QS2 A;  3FXR A;  4GIZ A;  1NNK A;  3SEU A;  1Y1M A;  2F5X A;  1POT A;  1MXU A;  1JW5 A;  1UTB B;  1H3D A;  2Y7R A;  3CFX A;  2AL5 A;  1JNF A;  3RGY A;  4ZS9 A;  4FEC A;  1EZ9 A;  2V3T A;  4UAC A;  2WBD A;  3FJM A;  4PFT A;  4PET A;  3UK4 A;  1MXW A;  1LAG E;  4XKR A;  4O7M A;  3I3V A;  4BDQ A;  3MWB A;  3B6T A;  4BDN A;  3VV5 A;  2GQ1 A;  3U65 A;  4R74 A;  3QSL A;  4H46 A;  2CZH A;  1US5 A;  4MX6 A;  5L9O A;  2OK2 A;  3VDF A;  2B65 A;  2XX7 A;  3M3L A;  1BP5 A;  3CFZ A;  4AQ4 A;  2Q89 A;  5K2Y A;  4XKP A;  4QSD A;  2KQZ A;  1YCJ A;  2A5T A;  3B8B A;  3HV1 A;  1VFE A;  2P3N A;  3O2A A;  4GFR A;  3IR1 A;  4PQJ A;  3S2V A;  3FV2 A;  3KEI A;  3JV9 A;  4E0W A;  1URG A;  4QXD A;  1AMF A;  2RIN A;  4OFO A;  5IKB A;  3PV0 E;  3QK6 A;  4NHB A;  3ZS6 A;  3D1R A;  4ZEI A;  3ILU B;  2OBG A;  4PAI A;  4JVC A;  4JBZ A;  1DSN A;  5IGA A;  5ICQ A;  4ECF A;  4Q0C A;  3TTR A;  2QS3 A;  1B5I A;  3EPE A;  4U4X A;  1N84 A;  2RC9 A;  4PC9 A;  3GYY A;  1HSJ A;  1QUL A;  1ZMG A;  2W7Y A;  1NV1 A;  1LAH E;  1OLA A;  5H8H A;  2D21 A;  3CIJ A;  2Z8D A;  4H0W A;  4PFI A;  1BTJ A;  3LR1 A;  5H8N A;  2ANJ A;  2DOJ A;  4RPO A;  4GQO A;  4Q8R A;  1FBH A;  1QUJ A;  1SQY A;  1P1N A;  2O68 A;  3IK6 B;  3S9L C;  4IB2 A;  4ELO A;  2F7C A;  4EQ9 A;  1I6Q A;  3IB0 A;  4PFR A;  1KA1 A;  2Y84 A;  5EQA A;  1NH8 A;  3CVG A;  4MNP A;  3SEW A;  3IO6 A;  1FQE A;  2B4L A;  1GTK A;  5EYH A;  5IZ3 A;  1AH5 A;  3ZKL A;  3O97 A;  5IZZ A;  4GWU A;  3G3H A;  4UA8 A;  1A8F A;  1ZKB A;  2OWS A;  2I58 A;  4R6Y A;  2JJK A;  4QFK A;  3IOU A;  1D9Y A;  3N6T A;  5FTH A;  3K6V A;  3IFA A;  1XVY A;  3TDJ A;  1TT1 A;  4GXS B;  1B9J A;  2I0B A;  1MPB A;  4HW8 A;  3N5L A;  3U94 A;  3B6W A;  3TCG A;  3TKD A;  5H8F B;  4ZE9 A;  3SEY A;  1N7X A;  2QSX A;  2R71 A;  4MCO A;  4BLA A;  1QJM A;  3C34 A;  1FQA A;  3O66 A;  3T22 A;  2I4B A;  1MRP A;  2GHB A;  1B32 A;  4I62 A;  4F3P A;  4FEB A;  5LOM A;  5TP9 A;  3FAT A;  4AS4 A;  1PB7 A;  4OMB A;  4AB5 A;  3S9M C;  4P47 A;  4F2Q A;  2XX8 A;  4GXA A;  2BJJ X;  3PD8 A;  2DVC A;  1L5T A;  4P9K A;  3C31 A;  4AS5 A;  1VSO A;  2HXR A;  2XWO A;  3UOR A;  2RCA A;  3H4Z A;  2NUV A;  2FNC A;  3QUF A;  1XT8 A;  4N8G A;  4FBP A;  1IZ1 A;  1G0H A;  4MLV A;  3VXC A;  1FBE A;  3MUQ A;  4PFU A;  2O7I A;  4WKM A;  1USY E;  2XX9 A;  2ZXT A;  4KR5 A;  3ROJ A;  5AA2 A;  1LGB C;  3MPL A;  4MF3 A;  4OER A;  1D9V A;  3O29 A;  3C36 A;  3G3I A;  3UGW A;  4R75 A;  1Y3N A;  1JET A;  1MPC A;  3SES A;  4GD5 A;  1CE2 A;  4XTC Q;  4MFI A;  1F9B A;  1B5H A;  1WVJ A;  1ZU0 A;  3H6V A;  1UIU A;  3RUM A;  2PBW A;  3E13 X;  2X26 A;  4GX4 A;  4HE0 A;  2ZYM A;  4G8N A;  2DWH A;  2MKZ A;  4GL0 A;  4X1D A;  1B1X A;  2ONS A;  3OXN A;  1S50 A;  3C33 A;  2PFY A;  4R2B A;  1EYJ A;  4GWX A;  3L6H A;  4DDD A;  4IY5 A;  3B6Q A;  3MC2 A;  3RQT A;  1VE4 A;  3A09 A;  3KN3 A;  3OO8 A;  5AA4 B;  3KC0 A;  1NMU A;  1PEB A;  1MQH A;  1FQC A;  4OTE A;  3IOR A;  1MM7 A;  3M3K A;  2B3B A;  4R9F A;  4KCD A;  4X9T A;  1FPB A;  3PMV A;  4K3F A;  4PGP A;  1VFD A;  4GWW A;  3PPP A;  2UVH A;  4Q5T A;  3PPO A;  1USY H;  4KYD A;  3IL1 B;  1BLF A;  3H6T A;  1NI9 A;  1Q35 A;  1A7L A;  3MZ1 A;  4IO7 A;  2VD3 A;  3RPL B;  5EQ7 A;  1YYZ A;  1HSE A;  4KI0 E;  5FHO A;  2RF1 A;  4PF8 A;  3BBR A;  1LB8 A;  3SET A;  3OEK A;  5I84 A;  2ZNT A;  4NF5 A;  3RT6 B;  2V4C A;  3RTW B;  3CRB A;  4YIC A;  1A54 A;  1FPL A;  1LLS A;  1UQW A;  4PF6 A;  3EF7 A;  1OVT A;  2DE4 A;  3QIM A;  3KOT A;  2ZYN A;  4MAG A;  5CM6 A;  2HXW A;  4LQ5 A;  3FJG A;  2H4I A;  4ZZA A;  5I57 A;  2P3V A;  1SYI A;  2OWZ A;  1N3W A;  4LZ8 A;  5A5L A;  2WKY A;  4R2F A;  2Q9T A;  2YJP A;  1IXG A;  1A99 A;  3KJT A;  3E9X A;  3HCQ A;  5DVI A;  4PCD A;  3TQL A;  3GZG A;  1Q9D A;  2CZL A;  5I2N B;  3O6G A;  3RTF B;  3W9W A;  2R8T A;  1XC1 A;  4KFQ A;  3IFC A;  3FXU A;  1MQI A;  1RDX A;  4FED A;  2D5W A;  2OJT A;  3NOH A;  3IAZ A;  1Y3Q A;  5ELV A;  2WX9 A;  4KD5 A;  4NWD A;  2VPO A;  1M5F A;  5M2V A;  1K9Z A;  5I5P A;  4EDP A;  4GWZ A;  2QS1 A;  2OWT A;  5DVJ A;  1FPK A;  1INP A;  3MVY A;  3DP8 A;  4F18 A;  2DP8 A;  1A55 A;  4PBH A;  3R26 A;  4NX1 A;  1B2H A;  1KWH A;  3MBP A;  4EXK A;  3CHG A;  1NUY A;  2CEY A;  3R6U A;  3FAS A;  4XIG Q;  2CZI A;  3N94 A;  3VVD A;  1B4H A;  1IUD A;  5EHS A;  2DQV A;  3MQ9 A;  3EQ1 A;  3OSR A;  1LB9 A;  1KZ8 A;  3VE1 B;  4IO4 A;  1R9Q A;  3RPW A;  2VOZ A;  3KSJ A;  2UVI A;  1T0K A;  3MZ9 A;  3SEX A;  1IEJ A;  3RN8 A;  5JTY A;  3K02 A;  3K6X A;  2F97 A;  2UYE A;  1SW5 A;  5TU0 A;  1HSL A;  3N26 A;  4G68 B;  3TCF A;  3OMB A;  3R7X A;  5H8S A;  1SD3 A;  2QL3 A;  1VR5 A;  2QVR A;  2O1M A;  3H06 B;  3K0V A;  3C35 A;  1B1H A;  3UN6 A;  3CI8 A;  3GLB A;  3FGS A;  3SER A;  4F2O A;  2L5V A;  1EU8 A;  4KXP A;  3DP6 A;  1B3L A;  3MYU A;  4ESW A;  4M1V A;  3IX1 A;  3KN7 A;  4GX6 A;  5EQ9 A;  5AA1 A;  4H5G A;  5A5X A;  2B4M A;  2DSF A;  3PUV E;  2DE3 A;  4P8B A;  1NUZ A;  3B50 A;  5CI5 A;  4IO3 A;  1D4N A;  5FBP A;  5J16 A;  2O6A A;  4QBA A;  1MY2 A;  3KJ7 A;  2V93 A;  5AE4 A;  2ZZV A;  4RYA A;  1H44 A;  3USD A;  3KZG A;  1P1Q A;  3ONM A;  1FCK A;  1MDQ A;  2RCB A;  4HE1 A;  3RY3 A;  3OEL A;  5F7V A;  2X7Q A;  3DEL B;  3H6W A;  3VLV A;  4P1L A;  1MQD A;  3HN0 A;  1FW0 A;  2RC7 A;  1DK4 A;  4PAK A;  2AIX A;  3DLN A;  3OOA A;  4GX3 A;  1SPI A;  1B7H A;  5I2K B;  1WOD A;  3TYH A;  3IOV A;  2VPN A;  2PX1 A;  1B40 A;  3HST A;  4OEV A;  3PMW A;  4IR8 A;  1AL3 A;  1ATG A;  2DVZ A;  1NV5 A;  1UTH A;  3AXF A;  5LDZ A;  3IB2 A;  2CMO A;  3T0J A;  4MLQ A;  3K1N A;  2UVJ A;  4O94 A;  2OCU A;  1J1N A;  1JVX A;  3T9H B;  4F39 A;  1SW2 A;  1O64 A;  5DT6 A;  1LAF E;  3TFL A;  1LBW A;  2ABH A;  4QSE A;  3VLU A;  3S9E A;  4YZZ A;  1AWB A;  2ZYO A;  3TCH A;  3U93 A;  3D4C A;  1DTG A;  3KC1 A;  2V25 A;  2XXU A;  3LSW A;  4FAJ A;  5KDT B;  1PB9 A;  4JVI A;  4OES A;  5H8Q B;  5KCJ A;  2F6G A;  2O84 X;  3ZKK A;  2V3Q A;  4XKQ A;  3TMG A;  2Q8J A;  5CBR A;  1LBV A;  1MY1 A;  4U23 A;  4IGT A;  1IMD A;  4ND9 A;  2B3F A;  3IO4 A;  1ZBM A;  3PUZ E;  3KG2 A;  4DZ1 A;  2AL4 A;  4EXL A;  2QS4 A;  4F1V A;  4DCY A;  1DBZ A;  2LAO A;  2QJE A;  1ZLQ A;  4OFL A;  2KLF A;  3MVX A;  1N7W A;  2I6E A;  1QKA A;  3RT8 A;  1YPN A;  3FVN A;  5ET7 A;  3MPK A;  1MS7 A;  2HQ0 A;  5DEX A;  2IEE A;  3KFM A;  2YPN A;  1B3F A;  2R9J A;  4I3Y A;  4NF4 B;  4G68 A;  5I56 A;  2E1S A;  2QMW A;  5L9S A;  1B05 A;  1JEV A;  3TAJ A;  3E3K A;  2HHM A;  4H65 A;  4JWY A;  4N81 A;  3E78 A;  2Z23 A;  3GXA A;  3EN3 A;  2NVU B;  2HAU A;  2PYY A;  1R9L A;  4OEN A;  4HS7 A;  4UAB A;  4M4G A;  3BIG A;  4PFW A;  3H3G A;  4H6D A;  4H8J A;  4R9G A;  1NV6 A;  2HCA A;  3FVK A;  4QFO A;  3MP6 A;  2DS9 A;  4N8Y A;  1H43 A;  4PDH A;  2O1L A;  1MQG A;  3PU5 A;  5ET5 A;  2G93 A;  1OQG A;  1H76 A;  1NUX A;  2XWV A;  3FD3 A;  1N76 A;  5L9M A;  1M5E A;  2F36 A;  5J1D A;  1NV7 A;  3WAE A;  2KR0 A;  1RYX A;  4OXV A;  1FRP A;  3K1M A;  3T9V A;  4MH5 A;  1Q1K A;  2RKM A;  3EHS A;  4YKP A;  4FAT A;  4LAT A;  2IA4 A;  1UTB A;  1ZIU A;  3EKI A;  2ONR A;  2PVU A;  1NNF A;  3T93 B;  1R6Z A;  1AIV A;  1FTM A;  2HZL A;  3FUZ A;  1MG1 A;  3MST A;  3HHG A;  4OVJ A;  5AA3 A;  4MIJ A;  3QAX A;  5DW8 A;  2FIX A;  2XWK A;  1PB8 A;  4NGU A;  1TWY A;  1FTK A;  3L6G A;  3M3F A;  3TEP A;  4G4P A;  4N4U A;  3U72 A;  5I59 B;  3FXB A;  4LA9 A;  1SW1 A;  2M8C A;  1AOV A;  3BFU A;  2FA7 A;  2REG A;  3O6H A;  3A3C A;  5ITO A;  4ZDM A;  5IAI A;  3FVG A;  4KPT A;  4OA4 A;  4N6D A;  5EYF A;  4PFY A;  3FZV A;  2HAV A;  2XWI A;  3KBR A;  3PMX A;  3OO7 A;  4RNS A;  2VP1 A;  4GVO A;  4G2Z A;  3K2D A;  4ZZE A;  1P1W A;  1US4 A;  3EHT A;  3FJ7 A;  4X8R A;  2RC8 A;  4E0X A;  1YXI A;  4ISU A;  1Y20 A;  1XVX A;  4ELR A;  3LC8 A;  3TTK A;  4OQO A;  2DYX A;  3CSB A;  4ONY A;  1I69 A;  1NKX A;  1R1N A;  4QF9 A;  4N13 A;  2PMS A;  2WYP A;  4GRK A;  5DYH A;  2A5S A;  4YB5 A;  2PT2 A;  1RYO A;  4EQB A;  3G7W A;  4GWO A;  2F7B A;  1PBP A;  3UIF A;  1FBP A;  4OHN A;  4MHF A;  1B7Z A;  4N91 A;  2PT1 A;  1JP4 A;  4BDL A;  4WEP A;  4BDR A;  3HFU A;  4XEQ A;  4I1D A;  2ZNS A;  1PDA A;  5I58 B;  2GFE A;  2XXI A;  1DTZ A;  2NWJ A;  1IIW A;  2UXA A;  3IOW A;  1LBC A;  1FPI A;  4I9D A;  3SZP A;  4NED A;  1LBY A;  4JVD A;  2XXH A;  2XXV A;  4BDO A;  4DXU A;  1BK4 A;  4OWD A;  2DXY A;  4YB6 A;  4JWO A;  1OQH A;  4QFN A;  1MM6 A;  4JSO A;  3LSX A;  3LSF B;  1FTL A;  4U2R A;  4DE8 A;  3FBP A;  3S9N C;  4NF8 B;  1P1O A;  4N17 A;  5TPA B;  1IIT A;  4F3S A;  4C1T A;  2P2A A;  4YKJ A;  5H8F A;  5LTC A;  3OEN A;  3K00 A;  4ZEB A;  2HPG A;  3OEM A;  1FTO A;  3PPQ A;  1P99 A;  2HEU A;  2XXR A;  3KSX A;  4I3E A;  4N15 A;  3JZJ A;  4OVR A;  4QHQ A;  1N04 A;  1MY3 A;  3QXM A;  3TPA A;  1I6B A;  4QRZ A;  3QYT A;  2XXT A;  3E4R A;  4IO5 A;  3BKI B;  4NAP A;  4MNI A;  4AB6 A;  3BFT A;  4H8I A;  2Z8F A;  2I49 A;  5BUU A;  2F6P A;  2F78 A;  2XXW A;  4F29 A;  2FYI A;  4LVQ A;  2CZK A;  1M5C A;  4X04 A;  2Z8E A;  1H45 A;  2XXQ A;  1S9T A;  1FJ9 A;  3V83 A;  4NE4 A;  4PGN A;  2P1S A;  4RK2 A;  2X7P A;  1IXH A;  2BJI A;  3DM0 A;  3SKP A;  3MJN A;  3VFJ A;  1TXF A;  4OVQ A;  3C32 A;  4YAH X;  1FPG A;  3DP4 A;  1Y3P A;  3LBS A;  2A5T B;  2DXR A;  1LCF A;  4OVP A;  3CG1 A;  1B3H A;  1O63 A;  1FJ6 A;  2HFB A;  4IO2 A;  3U92 A;  4EUO A;  1XHY A;  3LUZ A;  3MZB A;  2HZK A;  4N6P A;  4F1Y A;  1N3X A;  2H98 A;  3MVW A;  2OZZ A;  2Y7K A;  2NOO A;  4R6K A;  3TZA A;  2DDK A;  3OO6 A;  2WBB A;  1URS A;  3M8U A;  5H8H B;  5HPQ A;  1Y1Z A;  1Z7N E;  2ZZW A;  4P1E A;  4TLM B;  1MY4 A;  3CG3 A;  1MH4 A;  2DWJ A;  1NNP A;  5AA4 A;  4FE8 A;  2XHD A;  3THI A;  4FIM A;  5H8N B;  3U8Q A;  4FOR A;  3VVE A;  3A29 A;  2Q8M A;  1FBF A;  4U21 A;  4HCY A;  4RXL A;  2XD2 A;  4O3C A;  4P0G A;  1G0I A;  1K9Y A;  5T3J A;  1QVS A;  1KA0 A;  4THI A;  4EF2 A;  1XOC A;  3T9U A;  4ZEK A;  4JXI A;  5EQ8 A;  1JEU A;  1B4Z A;  5IZ3 B;  1B5J A;  1FSA A;  3RPL A;  4F3B A;  1YTV A;  4PAF A;  4P0I A;  1SVX B;  3V8X B;  3BIH A;  1SI1 A;  3CSG A;  5I7I A;  4HCW A;  1NV3 A;  5B70 A;  3PPR A;  2H5Y A;  1O7T A;  4KYS A;  1LAX A;  4Z7E A;  3B7D A;  4LZ5 A;  4ELP A;  3MW0 A;  3QMF A;  4OVS A;  4F31 B;  5CMC A;  5CRY A;  1NNT A;  1FTJ A;  4WXJ A;  1QUK A;  4HE2 A;  4DCX A;  1IMC A;  1IMF A;  2I48 A;  1MQJ A;  2YLN A;  3IOT A;  3PUW E;  3ZSF A;  5HM4 B;  3TOD A;  2OX3 A;  3S4U A;  4U1O A;  4F3G A;  1SYH A;  5TP9 B;  1BKA A;  1M5D A;  5ESY A;  1URD A;  4OET A;  1RKM A;  3LV0 A;  2Y5K A;  4PE3 A;  4Z0I A;  4DIG A;  4PP0 A;  4IGR A;  5I2N A;  4GF8 A;  4GL8 A;  4O3B A;  2R6G E;  4ZEC A;  2Y7W A;  2PFZ A;  5ISU A;  5I3S A;  1GVC A;  2V3U A;  4GWS A;  1QW0 A;  3HO7 A;  1IXI A;  4U22 A;  4XFE A;  2H9B A;  3MP1 A;  2ONK E;  5B7D A;  4F19 A;  4QFL A;  1B6H A;  3RNN A;  4EQ7 A;  5AA2 B;  2UYF A;  3H7M A;  3T9X B;  3O6I A;  4QSC A;  4NG7 A;  4P11 A;  3ECR A;  1I6A A;  1FPJ A;  2FHY A;  4DLD A;  1GR2 A;  2DWA A;  2O51 A;  1B0L A;  5FTI A;  2ZMB A;  1GV8 A;  4GWY A;  5ET8 A;  5EYG A;  1LBB A;  5CMM A;  4ZED A;  1Z7M E;  1IMA A;  1EH3 A;  1DOT A;  3FIR A;  3Q27 A;  2QFL A;  3F11 A;  1SI0 A;  5CC2 A;  2VGQ A;  1IMB A;  2O7U A;  1NV4 A;  3VVF A;  2PCR A;  4RPN A;  4H67 A;  5JK4 A;  4WED A;  1NH7 A;  1SW4 A;  1B51 A;  2THI A;  3ILT B;  4HTG A;  4C0R A;  1OMP A;  2ZZX A;  1FBD A;  4PDD A;  1B3G A;  1NV2 A;  4NWC A;  2QMX A;  3TUS A;  4ZE8 A;  2D3I A;  1FQB A;  4LZ7 A;  4NTL A;  4YKI A;  5KZT A;  3TTM A;  5CMK A;  4G8M A;  4ELQ A;  2NXO A;  4X48 A;  1FPF A;  2QPQ A;  2P0S A;  5CBS A;  4RK9 A;  1DCU A;  3A3U A;  5HBC A;  4G61 A;  4YMB A;  1TFA A;  4NMY A;  2H25 A;  2FBP A;  3FVO A;  4QFP A;  4P3L A;  2E0S A;  3KGC A;  4G77 A;  4NF5 B;  3I6V A;  1LEV A;  2Q74 A;  1FBG A;  2OLB A;  2Q88 A;  1Y4T A;  3G3K A;  3MAM A;  4I40 A;  1Y9U A;  3FXQ A;  4OFJ A;  5I2K A;  4MEV A;  3UP9 A;  5I57 B;  2WYK A;  1S7Y A;  2WEF A;  2Y5L A;  3PUY E;  4PE5 B;  4DI3 D;  3O9P A;  2VD2 A;  1B52 A;  1DPP A;  3GBB A;  3PUX E;  3Q25 A;  3IJX B;  4JSD A;  5ICT A;  4NN3 A;  3PGF A;  1MXV A;  4MNC A;  4LUB A;  3TEL A;  4DXB A;  2QVV A;  2XA5 A;  4G68 C;  1PBQ A;  1D9Q A;  3KN8 A;  2Q2C A;  1MXX A;  2FIE A;  1B46 A;  2I3W A;  3SEV A;  4IY6 A;  4U4S A;  5AA2 D;  3LSL A;  1NV0 A;  3PTY A;  3RLF E;  4IO6 A;  1YZ0 A;  1JVY A;  1QUI A;  2G29 A;  1N0T A;  1SDX A;  5KDT A;  3V89 B;  5H8Q A;  3K4U A;  1B3E A;  1RDZ A;  4R73 A;  3HPI A;  4LQ2 A;  4POX A;  5F24 A;  3ISP A;  4H5F A;  3E79 A;  1LFH A;  2F7A A;  4DI4 B;  1B58 A;  1TFD A;  4ESX A;  1EYI A;  1LBX A;  1EZP A;  4ZEF A;  1LBZ A;  1ZTY A;  4KHZ E;  5JTY B;  4MBP A;  4GBW A;  1OVB A;  4MJO A;  1MDP 1;  1BIY A;  1QGX A;  4N6K A;  4OEU A;  4YU0 A;  1D3K A;  1FPD A;  4LP2 B;  1NL5 A;  2XD3 A;  4NF4 A;  5IZ1 A;  1MPD A;  1CB6 A;  5FHM A;  1CNQ A;  5BWJ A;  3O28 A;  3HHF A;  4F22 A;  1QKB A;  3H03 A;  4F1U A;  4O8M A;  3PPN A;  4JDF A;  4GOT A;  5CMB A;  3G3F A;  1JQF A;  2DWI A;  5L8D A;  1FPE A;  3SDF A;  2XXK A;  4PTK A;  1P1U A;  5ET6 A;  4RY1 A;  3QUJ A;  4FJP A;  5A5X B;  1B7U A;  1ZJL A;  4O3A A;  5EHM A;  4NF0 A;  2Y7I A;  3RYD A;  4OAN A;  1POY 1;  1ANF A;  4X1B A;  1VDW A;  1MXY A;  1XI6 A;  4NF6 B;  2GH9 A;  4JWX A;  3CFL A;  4R6H A;  5DVF A;  3UA8 A;  4LON B;  4KCC A;  4XXU A;  4Q30 B;  4TLL B;  3VXB A;  1NFT A;  5IM2 A;  2FVZ A;  4NQ8 A;  1GGG A;  2ZNU A;  3G3J A;  2UVG A;  3FV1 A;  3Q29 A;  4TQU Q;  5JEI A;  4PFB A;  3K6W A;  2QRY A;  2I4C A;  2Z22 A;  3CR9 A;  4YKK A;  4G8H A;  1JW1 A;  2XXX A;  1IXC A;  2V84 A;  1B0H A;  1MXZ A;  4XF5 A;  4MMP A;  1PC3 A;  1JW4 A;  5I59 A;  4OYV A;  4JB7 A;  3T66 A;  2GHA A;  4OVT A;  3TTN A;  2Q2A A;  3MP8 A;  1UTH B;  4H45 A;  1MY0 A;  1LST A;  2XXY A;  4GBV A;  1OIB A;  3V5A A;  3Q26 A;  2I0C A;  4TOZ A;  1MH3 A;  3P7I A;  4C1U A;  4POW A;  2F8D A;  3K1P A;  1LCT A;  2CEX A;  5DTB A;  3C4M A;  3U1O A;  3WAF A;  3PD9 A;  4PBQ A;  2XXP A;  4L17 A;  4N07 A;  3TTL A;  1FBC A;  5KCJ B;  2VHA A;  2O69 A;  3T1B A;  2QVU A;  3OO9 A;  2ESN A;  3D4G A;  3K01 A;  5F1Q A;  1SBP A;  3VLW A;  2F35 A;  1FTA A;  2F3B A;  3W15 C;  3TQW A;  1ELJ A;  4HXV A;  2VT5 A;  1UIV A;  1XS5 A;  4RA1 A;  4LN5 A;  3MVZ A;  3IB1 A;  2AYS A;  1RDY A;  3JYR A;  3KBZ A;  3K6U A;  3OD7 A;  1NUW A;  1A8E A;  4DXC A;  3ODB A;  3Q28 A; 
#chains in the Genus database with same CATH homology
 2DE2 A;  4NGU A;  1IME A;  4P56 A;  4N4U A;  2V4C A;  4NG7 A;  4YIC A;  1FPL A;  1FPJ A;  2FHY A;  3FXB A;  4PF6 A;  2DE4 A;  4GWY A;  5ET8 A;  5EYG A;  4MAG A;  5CM6 A;  4OA4 A;  1IMA A;  4N6D A;  2P3V A;  2XWI A;  2OWZ A;  5A5L A;  2QFL A;  2Q9T A;  1IMB A;  1NV4 A;  2PCR A;  4X8R A;  3W9V A;  5JK4 A;  4PCD A;  4O7I A;  2F3D A;  1YXI A;  1EYK A;  1Q9D A;  2ZZX A;  1FBD A;  4PDD A;  3W9W A;  2R8T A;  1NV2 A;  3IFC A;  2F5X A;  1RDX A;  3NOH A;  2WX9 A;  2VPO A;  2WYP A;  1K9Z A;  5I5P A;  4GWZ A;  1FPK A;  2WBD A;  1INP A;  4PET A;  1FPF A;  2QPQ A;  4PBH A;  4F18 A;  4NX1 A;  1FBP A;  4O7M A;  1DCU A;  3CHG A;  1NUY A;  4MHF A;  4G61 A;  2CEY A;  3U65 A;  2GQ1 A;  4N91 A;  2FBP A;  1JP4 A;  4H46 A;  4P3L A;  2CZI A;  2CZH A;  4XEQ A;  3HFU A;  4MX6 A;  1LEV A;  2Q74 A;  1KZ8 A;  1FBG A;  1FPI A;  3SZP A;  1LBY A;  2KQZ A;  4JVD A;  4I40 A;  1BK4 A;  3B8B A;  2P3N A;  4MEV A;  2WYK A;  2WEF A;  2Y5L A;  4DI3 D;  4QXD A;  3FBP A;  4NHB A;  3D1R A;  4N17 A;  4PAI A;  4JVC A;  2QVR A;  4NN3 A;  5LTC A;  5IGA A;  4MNC A;  2HPG A;  2QVV A;  4I3E A;  4N15 A;  4OVR A;  2XA5 A;  4PC9 A;  3GYY A;  1D9Q A;  2L5V A;  2FIE A;  4KXP A;  1NV1 A;  3MYU A;  4NAP A;  4M1V A;  1NV0 A;  3PTY A;  4GX6 A;  4MNI A;  5EQ9 A;  2B4M A;  1YZ0 A;  2DE3 A;  4P8B A;  1NUZ A;  4PFI A;  3B50 A;  2CZK A;  4X04 A;  5FBP A;  5J16 A;  4QBA A;  1RDZ A;  1FBH A;  1FJ9 A;  2ZZV A;  4PGN A;  2BJI A;  5F24 A;  3ISP A;  3E79 A;  4OVQ A;  4PFR A;  4DI4 B;  1KA1 A;  5EQA A;  4HE1 A;  1FPG A;  4MNP A;  2B4L A;  1EYI A;  1LBX A;  5EYH A;  5IZ3 A;  1LBZ A;  5IZZ A;  4P1L A;  4GWU A;  1DK4 A;  4PAK A;  4GBW A;  4MJO A;  4GX3 A;  4N6K A;  1SPI A;  1QGX A;  1FPD A;  2JJK A;  5IZ1 A;  2VPN A;  4OVP A;  3IFA A;  4IR8 A;  1CNQ A;  1FJ6 A;  2DVZ A;  1NV5 A;  5LDZ A;  3LUZ A;  4F1U A;  2HZK A;  4O8M A;  3T0J A;  4O94 A;  4MCO A;  1FPE A;  2XXK A;  4PTK A;  1LBW A;  2DDK A;  2WBB A;  5ET6 A;  4YZZ A;  1AWB A;  4AS4 A;  2ZZW A;  4P1E A;  3KC1 A;  4NF0 A;  4P47 A;  3RYD A;  4OAN A;  1VDW A;  1XI6 A;  4JVI A;  4P9K A;  2V3Q A;  4AS5 A;  3A29 A;  2HXR A;  2Q8M A;  1FBF A;  5IM2 A;  2XWO A;  2FVZ A;  1LBV A;  4HCY A;  4NQ8 A;  1IMD A;  1G0I A;  1K9Y A;  4N8G A;  5T3J A;  4FBP A;  1G0H A;  1KA0 A;  4F1V A;  1FBE A;  5EQ8 A;  1DBZ A;  4PFB A;  5IZ3 B;  3RPL A;  1FSA A;  4PAF A;  3ROJ A;  5ET7 A;  3BIH A;  5I7I A;  4XF5 A;  4HCW A;  1NV3 A;  4MMP A;  4I3Y A;  2HHM A;  3QMF A;  4OVS A;  4N81 A;  4OVT A;  3E78 A;  4H45 A;  4HE2 A;  4GBV A;  1IMC A;  1IMF A;  4GX4 A;  4HE0 A;  4UAB A;  3BIG A;  1NV6 A;  2MKZ A;  2OX3 A;  4N8Y A;  4PDH A;  2PFY A;  5ET5 A;  5ESY A;  1EYJ A;  4GWX A;  2CEX A;  1NUX A;  2XWV A;  3LV0 A;  2Y5K A;  4PE3 A;  5J1D A;  1NV7 A;  4PBQ A;  3KC0 A;  2KR0 A;  2PFZ A;  1FBC A;  1FRP A;  3T1B A;  2QVU A;  5I3S A;  1FTA A;  2F3B A;  4X9T A;  1FPB A;  4GWS A;  3EKI A;  4PGP A;  4HXV A;  4GWW A;  2VT5 A;  4XFE A;  2HZL A;  1NI9 A;  3MST A;  4LN5 A;  4F19 A;  1RDY A;  3KBZ A;  3RPL B;  5EQ7 A;  1NUW A;  1YYZ A;  4MIJ A;  4PF8 A;  5DW8 A;  2FIX A;  2XWK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...