2KQZA

Solution structure of the rpn13 deubad domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
STAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein binding
molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Structure of Proteasome Ubiquitin Receptor hRpn13 and Its Activation by the Scaffolding Protein hRpn2.
pubmed doi rcsb
source organism Homo sapiens
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16550 RPN13_C UCH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.140 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2kqzA01
2KQZA 2MKZA 2L5VA 2KR0A
chains in the Genus database with same CATH superfamily
2ANJA 5JTYA 4JVDA 4XIGQ 1FCKA 5HBCA 2DE3A 4NWDA 3RPLB 4HE1A 1FQCA 1MS7A 3K1PA 2AIXA 4PFTA 1FPLA 5DYHA 3UP9A 3TCGA 4JSOA 3C9HA 4PF8A 3OD7A 1GVCA 1PB7A 1DMBA 1TWYA 2O51A 5H8QB 2DQVA 1FPIA 4GX6A 3CSBA 4MLVA 2AL5A 2HPGA 2I4CA 4QFPA 4KYEA 1PBPA 4LQ5A 3IO4A 3TTLA 1TXFA 4LZ8A 4NMYA 4PFWA 4MFIA 4F29A 4K3FA 4PAIA 3SKPA 3TTKA 4NHBA 3SEUA 3TZAA 2V3QA 4THIA 4E0WA 1D9QA 2XXYA 2XXRA 4HW8A 4P0IA 3RUMA 3HCQA 5TPAA 4OESA 4ZE8A 4POXA 1UTBB 4X8RA 2VGQA 2VOZA 2XX9A 5H8FA 1XT8A 3K6XA 2Q89A 1FPEA 2A5TB 3GZGA 2I3WA 4QRZA 4PFIA 4U2RA 1FQAA 4N13A 3PGFA 2FYIA 3QXMA 4MIJA 3CFZA 1G0HA 2ZZVA 4C1TA 4RXLA 4IY6A 1B2HA 4PAFA 4ZDMA 1KWHA 1YPNA 3K4UA 4H46A 4TLLB 4KYSA 3S2VA 2XXVA 3PPOA 1SQYA 2ZYMA 2I49A 1VFDA 3VVEA 3OOAA 1JP4A 1ZLQA 3JV9A 2FA7A 4DZ1A 4NF5A 4ZEFA 1QULA 1A54A 3FXUA 3BIHA 4GWXA 2X7PA 4UACA 1FPDA 2XXPA 3HHGA 1UTHA 2W7YA 1IUDA 2F8DA 4L17A 4YB7A 2HXRA 1FQDA 3K0VA 4ESXA 1IMFA 4LONB 4N91A 1BK4A 4OVSA 3SERA 3KJTA 3FVKA 3MPKA 4YAHX 2ZNUA 2R8TA 4ZZAA 1RYXA 1AL3A 4XKQA 2XXTA 1N76A 1M5CA 1BTJA 3KGCA 5CM6A 3LUYA 4ESWA 4F1UA 3PUXE 4MEVA 3O9PA 1FPGA 5TP9A 3RNNA 3TUSA 1VE4A 3N6TA 1OQHA 2ZYOA 1FQBA 4IO7A 2WYKA 1B4HA 1PB8A 1BIYA 2MKZA 3ZSFA 3H4ZA 3ILUB 1FBPA 4HCYA 5M2VA 1FBCA 3QUFA 4Q0CA 4JVIA 1CE2A 2VD2A 1B3LA 1US5A 1HSLA 4PFBA 2F3DA 2I0BA 3TDJA 3H03A 4P47A 5AA4B 3O2AA 3MQ9A 4UABA 4MBPA 2QVUA 1LBWA 3HV1A 2HQ0A 2OWZA 4F3BA 2DE2A 2F7BA 3IOTA 5CMCA 3D4CA 2X26A 3IB1A 4Q5TA 3DM0A 3CSGA 4EUOA 3EQ1A 1RYOA 1SBPA 4KFQA 3KSXA 2WKYA 4H0WA 1QGXA 4F22A 3MYUA 1D3KA 5DVJA 1B5JA 3IOVA 1R9QA 4NQ8A 2O7UA 3DP6A 3KC0A 2Q8JA 3K6UA 1MPBA 4E0XA 4R6KA 2YPNA 3RQTA 4NTLA 3TKDA 2THIA 1IMBA 2ZXTA 1SW1A 4MAGA 4AQ4A 3C31A 3PPQA 2QVVA 3MP6A 1LFHA 4NEDA 3TMGA 5KZTA 3DP4A 1B58A 4I62A 3FIRA 4PCDA 1LBYA 1IMCA 3U72A 3IFCA 1NV6A 4I3EA 1FRPA 3VLUA 3E78A 1NH8A 4ZEBA 4FAJA 4U4XA 1MXXA 2CZIA 4OERA 3FXRA 4LVQA 4N17A 4NF4B 5ICQA 4XKRA 1PDAA 4H5FA 3TTMA 2QJEA 5H8NA 2X7QA 2PCRA 3S9NC 1ATGA 4BDRA 2QL3A 4EQBA 2GHBA 3PUYE 1FSAA 3IAZA 2REGA 3K6WA 4X9TA 3I6VA 2QVRA 4XKPA 2IEEA 1SW2A 1ZMGA 4GWWA 4X04A 3IFAA 3UA8A 5CBRA 1XOCA 4MX6A 1BKAA 2E0SA 4N6KA 4F31B 1PBQA 1MXUA 2DOJA 4LA9A 1SYHA 2XHDA 2Z8EA 4ZE9A 1B1XA 1P1OA 2I48A 3FV1A 3MZ1A 1Y3PA 5I56A 2PVUA 1IMEA 1VDWA 3PD8A 4KD5A 3C32A 4XXUA 3V8XB 4XF5A 3RN8A 2XWVA 2DS9A 4I1DA 4ZS9A 5I5PA 5JEIA 4YICA 1LAFE 2KQZA 4XKNA 1H44A 4DCYA 3FV2A 3IOUA 2O1MA 2XXXA 3C33A 2ZNTA 4OMBA 2CMOA 1B05A 2PMSA 4MCOA 3O29A 1MQDA 3ZKLA 2V4CA 1MQHA 1D9VA 1JEVA 4FIMA 1EU8A 4U1ZA 1LBCA 3LSLA 4LZ5A 3PU5A 1SD3A 4LZ7A 4R6YA 4JB7A 2VP1A 2FBPA 2DSFA 5AA2B 4P3LA 4OVTA 1YZ0A 2H98A 4YKIA 4GWZA 4JWXA 4NN3A 1MDQA 3H7MA 3USDA 1B0HA 2DWJA 1IITA 1I69A 2WYPA 4LQ2A 4PDHA 1Y1MA 2F6PA 4ZEKA 5ESYA 2YLNA 3VVDA 4PBQA 3K1MA 1FPFA 4IGTA 2OLBA 4ISUA 3C34A 3IO6A 3IB0A 4F2QA 1F9BA 5DEXA 3B6WA 1SYIA 3E9XA 2Y7RA 3UGWA 2D3IA 3AXFA 3B50A 5EYGA 1AH5A 3OO8A 4OA4A 3E4RA 5I2KB 2WX9A 2XWIA 3EN3A 4QFKA 4Z0IA 1N7XA 4U4SA 1MY3A 1FTLA 3N94A 3T1BA 2NXOA 1MY1A 3FJ7A 4GWYA 4G77A 1FPJA 3B6TA 3CIJA 4N8YA 3BBRA 3B6QA 3VXCA 5CRYA 3MSTA 3H6UA 3FBPA 3V83A 3M3KA 2QSXA 5IM2A 3SEWA 3LSFB 3SETA 2DVCA 2XD2A 2DWHA 2G93A 1GV8A 5FTHA 4RA1A 3H3GA 1RDXA 1HSEA 1Z7ME 4PP0A 1M5BA 2DVZA 4F2OA 4KCCA 2H4IA 4G68B 4P11A 2D21A 3M8UA 3T93B 2H5YA 4PTKA 1XS5A 2REJA 5I3SA 3L6HA 2VD3A 5I2NB 3A3UA 4R6HA 4HE0A 2PT2A 2ONSA 4HE2A 2Z22A 2RKMA 3LR1A 3NOHA 1MDP1 4O8MA 5FTIA 2GFEA 1M5DA 4GX4A 5ICTA 3L6GA 1GR2A 1LGBC 3KFMA 3OENA 4DDDA 2XXHA 3MVYA 1RDYA 4FEDA 4MLQA 1ZTYA 4KHZE 1POY1 3VXBA 2XXWA 1URDA 1NH7A 3EHTA 5I59A 2O1LA 3LC8A 1EZ9A 3C35A 4FATA 2B4LA 2HZKA 4DIGA 1JEUA 4GD5A 4H8JA 4POWA 2Q8MA 1M5FA 1H3DA 1IZ1A 1MXWA 3MC2A 3MBPA 4F3PA 4H5GA 4N15A 3RPLA 4UA8A 1NNFA 3V5AA 1MXZA 3U93A 1DCUA 1KZ8A 2Q9TA 2PFYA 1NNPA 4ELPA 5KCJB 3S4UA 5LTCA 3T9XB 5H8QA 3VDFA 5TU0A 1NV1A 2F3BA 2D5WA 4DI4B 3QUJA 3R7XA 4BDQA 3Q29A 3GYYA 1QJMA 4HTGA 4ZECA 3MVXA 1MQIA 1I6QA 4BLAA 1LBXA 4R2FA 4N6DA 4M1VA 3W9WA 3PUZE 1UTBA 2ZZWA 3TTNA 2HEUA 4PFYA 1DK4A 2Z8FA 3PMWA 4KCDA 5DVIA 3UORA 1NI9A 4OXVA 2I3VA 2V3UA 2XX7A 1MPCA 1AIVA 1XVXA 3IJXB 2P3NA 4R75A 2ONKE 3TQLA 2VT5A 4Q8RA 3KG2A 4JWOA 4NG7A 1Y9UA 2I4BA 1SW4A 4YKKA 4NX1A 3ZKKA 1TFDA 4I8CA 4H67A 3ISPA 2QMWA 1MM7A 3IX1A 3TELA 5BWJA 1PEBA 2V3TA 1WODA 4RK2A 1GGGA 2FVZA 4XFEA 1K9ZA 1ELJA 4FECA 4ELQA 3SEXA 3PD9A 2OBGA 1I6BA 2QFLA 2DWAA 3Q28A 1P1UA 5ELVA 3SESA 1SDXA 1MY2A 3OO7A 2P3VA 2HCAA 1IMDA 2O84X 4RYAA 4LATA 3KC1A 3OELA 3T0JA 3A09A 2FHYA 2XXUA 1YYZA 4EXLA 1N3WA 3PPNA 4O7MA 3HSTA 3RY3A 1YAEA 5AE4A 1JETA 4MNIA 3FXQA 1I6AA 3CHGA 3KN7A 1B7UA 5AA2D 3R26A 5EQAA 3N5LA 2O69A 4R9FA 4FEBA 1P1WA 5IZ3B 4OVQA 4RK9A 3T9UA 5KDTA 5H8HB 5HPQA 1NV3A 4R9GA 1QVSA 4OHNA 3U92A 3FASA 4PGPA 5DT6A 1P1NA 1B5IA 3N6UA 4QFNA 1B6HA 5CMBA 4MMPA 3QYTA 1Z7NE 5L9MA 4TQUQ 2ESNA 2ZYKA 4LN5A 3ZS6A 3TEPA 5AA4A 4IO3A 1DSNA 5EHMA 4OFLA 4F3GA 2L5VA 4GX3A 3T22A 3K01A 5T3JA 4RNSA 5DTBA 4M4GA 3FVOA 1SW5A 2GH9A 2KLFA 4QSCA 3ODBA 5IGAA 5I57B 2M8CA 1A40A 3TYHA 2NOOA 2RCBA 4HS7A 3IJOB 3OEMA 4Q30B 4RJZA 1DPEA 4DI3D 3VE1B 1FJ6A 3O6GA 2DDKA 2F7CA 1UIVA 3H6TA 4OENA 4N81A 1A99A 2PX1A 2UVHA 4ND9A 5AA3A 2FIXA 1B3FA 1Y3QA 3G3JA 4R2BA 1ANFA 4JWYA 2V93A 3IL1B 1ZKBA 4F1VA 3PV0E 3T66A 4GXAA 4H8IA 3G7WA 1B7HA 2F36A 3EF7A 3DP8A 2Z23A 1FBGA 1YXIA 1Y3NA 1NV7A 5IZZA 4X1DA 2F6GA 4GRKA 2XXQA 4QFLA 4QBAA 3UIFA 2R9JA 2XXKA 3WAFA 3RGYA 4OEVA 4ELRA 3CFLA 4KPTA 4OTEA 4P1EA 2HXWA 4O3BA 3FZVA 1IXCA 2Y84A 5L9SA 2KR0A 1YTVA 4PDDA 2HFBA 3OSRA 3VFJA 4X48A 3MW0A 2E1SA 4EQ9A 1FQFA 4TLMB 2BJJX 4WKMA 1YCJA 5EQ8A 4H6DA 5F24A 1II5A 5FHMA 4OFJA 2AL4A 1EYJA 4GIZA 4F3SA 2O7IA 4FJPA 2FNCA 2ABHA 1B3GA 1VSOA 1TT1A 4IO5A 4GL0A 1B0LA 5L9OA 3H6VA 1OVTA 5JK4A 1JVXA 4RPOA 3FJGA 4G8MA 5CBSA 4GVOA 2LAOA 1EYKA 4F1YA 1LLSA 3KBZA 2RCAA 5IKBA 4R72A 3IOWA 4GLIA 4C1UA 1MY4A 2Y7IA 1FPKA 3MWBA 4OVRA 3MVZA 1Q35A 4XTCQ 3IB2A 1LBBA 2ZZXA 4GQOA 2RINA 1Y20A 3BKIB 4IO4A 2B4MA 4KQPA 1QKAA 3U94A 2Q2CA 4GBWA 3KOTA 4PC9A 4NF8B 3W15C 2OX3A 4X1BA 1O63A 1NUYA 4OVPA 4OZ9A 1S7YA 3MZ9A 5H8SA 3CR9A 5I84A 4NF0A 1NV2A 1MM6A 4DXBA 4KYDA 1GTKA 2PT1A 3G3IA 3KN8A 1O7TA 4U22A 1B46A 3N26A 4P8BA 4N6PA 1N84A 1NKXA 4MH5A 1USYE 3M3LA 5K2XA 1IXHA 4OEUA 1B5HA 3VLWA 5AA2A 2NUVA 3CRBA 3JZJA 4JSDA 4GWSA 1UIUA 3C4MA 1SI1A 2PFZA 4NF6B 1B51A 3CFXA 1ZIUA 1N04A 4PAKA 3V89B 1L5TA 4OWDA 2B65A 2QS1A 3CG1A 4OANA 5A5XB 3TQWA 3TFLA 1NL5A 5CC2A 5EYFA 3CVGA 5DW8A 1FBFA 1Y1ZA 1LAXA 5FBPA 2HAVA 4PBHA 4O7IA 2VPNA 2NWJA 3KEIA 2XWKA 3K02A 1MXYA 1M5EA 2GRVA 1US4A 1H45A 1FBHA 5I2KA 1IQ7A 2DWIA 3FATA 2CZLA 4OYVA 3KZGA 2CEXA 1FJ9A 3SDFA 3FD3A 1FW0A 3PMVA 1OQGA 3RLFE 5EQ7A 3QIMA 4PETA 3BIGA 2QRYA 4HCWA 3EKIA 1XI6A 1VFEA 5I58B 2GQ1A 2OCUA 5JTYB 2UYFA 1AWBA 3A3CA 5L8DA 4TOZA 4NAPA 2GHAA 1AMFA 1NMUA 2R71A 3O6HA 1B9JA 4WEDA 3D4GA 2VHAA 4GWOA 3CG3A 1N0TA 3MZBA 3PTYA 3IK6B 1POTA 4AS4A 4G68A 3GBBA 4N4UA 5DVFA 5I2NA 1DTGA 2Q74A 1B1HA 3E3KA 1IIWA 1NNTA 1Y4CA 2QPQA 5ET8A 3PPPA 3K00A 1URGA 4GF8A 1DPPA 1MH3A 4OETA 4GOTA 3ILTB 4GBVA 2B3FA 2CZHA 3KJ7A 5TPAB 1NUWA 2DP8A 4O3AA 2F97A 3M3FA 3PPRA 3RPWA 4JXIA 2P0SA 2OK2A 2UVIA 4PE3A 1VR5A 2O6AA 5ITPA 3U1OA 4Z7EA 1G0IA 2V25A 1Q1KA 2HHMA 5ITOA 4ELOA 3H6WA 5H8FB 1MRPA 2XXIA 4G8NA 4BDLA 3LV0A 3RT8A 1MY0A 2H25A 3E79A 1USYH 2Q2AA 1B7ZA 3TPAA 3EHSA 3TTRA 2ZMBA 1QW0A 3QK6A 5KCJA 4G4PA 1PC3A 4N8GA 4I9DA 4H45A 1EYIA 3D1RA 1B32A 3I5OA 1LB9A 2H99A 3FVNA 1LFIA 4RPNA 4EXKA 4EF1A 4PF6A 4OFOA 5CI5A 2Z8DA 5ET5A 1PB9A 3MJNA 1OLCA 1JW1A 1O64A 1WVJA 1A7LA 1NV0A 1TFAA 5EHSA 2A5TA 1SI0A 4NF5B 4BDOA 3K2DA 1T0KA 4P9KA 1RDZA 3MVWA 3FUZA 1IXIA 4QXDA 2Q88A 4JBZA 4DE8A 1UTHB 4O94A 2XA5A 4KXPA 4R73A 2XX8A 1FQEA 3FXBA 3ONMA 2QMXA 4DXUA 3GXAA 2UYEA 3OEKA 4R74A 3GLBA 5F1QA 3TCHA 4YMAA 1XC1A 1QUIA 3C36A 3MUQA 3IR1A 1A55A 5FHNA 1IEJA 4KI0E 3HO7A 5BUUA 2HAUA 3G3KA 5TP9B 2WBBA 2P1SA 3ROJA 5EQ9A 2DXYA 3B7DA 4KR5A 1ZU0A 4RY1A 1NFTA 3TODA 3B8BA 5FHOA 3VLVA 1JNFA 4IR8A 4YZZA 4ECFA 1XHYA 4AB6A 5CMKA 4FBPA 1D9YA 2B3BA 3T9VA 2V84A 3BFTA 1B3EA 4U23A 1IMAA 1NV4A 3UN6A 2JJKA 3EPEA 4YKJA 1J1NA 3EHUA 4GFRA 4GXSB 3BFUA 2O68A 5ET6A 5KDTB 4ZZEA 1LFGA 2QS3A 4QSDA 4F18A 1FTOA 2RF1A 3QAXA 4AB5A 1QKBA 2G29A 4MF3A 1RKMA 2XWOA 3U65A 3TAJA 1JQFA 1FTMA 3HFUA 1LBVA 2Y5KA 4QFOA 1N7WA 5AA1A 2F5XA 1LAHE 3WAEA 4FORA 4WXJA 1MQJA 2AYSA 2IA4A 2A5SA 5IZ3A 5H8HA 3SEYA 1R1NA 4N07A 2Y7KA 4YKPA 5EYHA 1H76A 4YB6A 1NUZA 4QSEA 4G68C 4PQJA 1NUXA 1MG1A 1JVYA 4WEPA 1MH4A 3HPIA 3JYRA 4NE4A 4JVCA 2F34A 4BDNA 3OO9A 3P7IA 4OVJA 1A8FA 3KSJA 2DXRA 4DLDA 4EF2A 3FVGA 3Q26A 5I57A 1Q9DA 2I6EA 4IO2A 1EZOA 4P56A 1OIBA 4PE5B 4U1OA 2ZNSA 1DBZA 3T9HB 3OSQA 3Q25A 1A8EA 5H8NB 3Q27A 5IZ1A 1LSTA 1SVXB 3KN3A 4P1LA 1WDNA 3I3VA 1B3HA 2NVUB 5J1DA 1Y4TA 2Y7WA 5LDZA 2UVJA 3E13X 4MNPA 4IB2A 4MNCA 2DE4A 4C0RA 5ISUA 1H43A 1QUJA 3SZPA 4PFRA 4U21A 3OMBA 4IY5A 3PUVE 3FJMA 2CEYA 4NF4A 4ZEDA 4NWCA 2QS2A 3O6IA 1LB8A 3S9EA 2HZLA 4YMBA 4GL8A 2CZKA 3K1NA 3MAMA 3KBRA 2F78A 1KA1A 1ZJLA 4JDFA 5I56B 3LSXA 4ZEIA 5J16A 3K6VA 4F39A 4XEQA 2ALUA 4HXVA 1IXGA 2R6GE 5IAIA 1LCFA 4BDMA 3RTFB 4MHFA 1DOTA 1MPDA 4PGNA 2Y7PA 2PYYA 4PFUA 2RC9A 4GWUA 3RT6B 3VV5A 2WBDA 4G8HA 3ECRA 4F19A 3VVFA 4IGRA 2OWTA 1R9LA 1FTKA 5K2YA 3TCFA 1P99A 1NV5A 2DYXA 1AOVA 3IORA 3HHFA 4DXCA 3QMFA 1OLAA 3G3GA 1S50A 2OZZA 2PBWA 3CI8A 4NGUA 2OWSA 1QUKA 1S9TA 3HN0A 1INPA 2Y5LA 4H1XA 3DLNA 3U8QA 1FTJA 2XD3A 3S9MC 4FE8A 4O3CA 3H06B 1B4ZA 1FBDA 3A29A 1FTAA 5F7VA 2RC7A 1B52A 1ZBMA 4LP2B 3R6UA 5HM4B 3OO6A 4G2ZA 4EQ7A 4NF8A 3KOSA 3T96B 5DEXB 5B70A 1NNKA 3MPLA 2RC8A 1FPBA 3RTWB 1JW5A 1CNQA 3LSWA 1JW4A 3LUZA 2H9BA 4LUBA 3SEVA 4OQOA 3S9LC 4P0GA 3O66A 3G3HA 3MP1A 3FGSA 4YB5A 1FBEA 1MXVA 2F35A 3F11A 1D4NA 3RYDA 4QHQA 5A5LA 3DELB 2P2AA 4ONYA 1SPIA 1LCTA 2ZYNA 1OMPA 3PUWE 1LAGE 4QF9A 1BP5A 2ONRA 1KA0A 2I0CA 3G3FA 3LBSA 4NF6A 1R6ZA 4I3YA 4G61A 3O28A 3W9VA 1P1QA 4DCXA 2QS4A 5I7IA 5A5XA 2OJTA 3QSLA 2FIEA 3THIA 1URSA 2WEFA 4I40A 1BLFA 2I58A 3OXNA 4MJOA 5CMMA 5B7DA 1XVYA 1MQGA 1K9YA 2VPOA 1B40A 2F7AA 3MP8A 1LEVA 1UQWA 3PMXA 1HSJA 1CB6A 5ET7A 2YJPA 2UVGA 5LOMA 4AS5A 4EDPA 2UXAA 4YU0A 2BJIA 4H65A 3O97A 1DTZA 1N3XA 4IO6A 3UK4A 1OVBA 1EH3A 5I59B 1EZPA 5I58A 3GBAA 1LBZA
chains in the Genus database with same CATH topology
1FJ6A 2DDKA 4JVDA 2DE3A 4N81A 3RPLB 4HE1A 2FIXA 1FPLA 2FBPA 4P3LA 2WBBA 3ROJA 4F1VA 4OVTA 4PF8A 1YZ0A 5EQ9A 4GWZA 1FBGA 1YXIA 3B8BA 1FPIA 1NV7A 4GX6A 4NN3A 5IZZA 2HPGA 4IR8A 4YZZA 2WYPA 4QBAA 4PDHA 2XXKA 4FBPA 5ESYA 4PBQA 1FPFA 4P1EA 4PAIA 1IMAA 4NHBA 1NV4A 2V3QA 2JJKA 2KR0A 1D9QA 4PDDA 3B50A 5EYGA 5ET6A 4OA4A 4F18A 2WX9A 2XWIA 4X8RA 5EQ8A 5F24A 3T1BA 4GWYA 1EYJA 2XWOA 3U65A 1FPJA 4N8YA 3HFUA 1FPEA 1LBVA 2Y5KA 3MSTA 3FBPA 4PFIA 5IM2A 2F5XA 5JK4A 4MIJA 1G0HA 2ZZVA 5IZ3A 4PAFA 1RDXA 4H46A 1EYKA 3KBZA 5EYHA 2DVZA 1NUZA 1FPKA 1NUXA 4PTKA 4OVRA 5I3SA 1JP4A 2ZZXA 4HE0A 4JVCA 4HE2A 3BIHA 4GWXA 2B4MA 3NOHA 4O8MA 4GX4A 1FPDA 4PC9A 4GBWA 1RDYA 2OX3A 1NUYA 2HXRA 4OVPA 1IMFA 1Q9DA 4N91A 4P56A 1BK4A 4OVSA 2B4LA 2HZKA 4NF0A 1DBZA 1NV2A 2R8TA 5IZ1A 2Q8MA 4P1LA 4N15A 4P8BA 3RPLA 5CM6A 4F1UA 4MEVA 5J1DA 1DCUA 1KZ8A 2Q9TA 1FPGA 2PFYA 5LDZA 4MNPA 4MNCA 4GWSA 2DE4A 5LTCA 3SZPA 2WYKA 4PFRA 2PFZA 2MKZA 1NV1A 2F3BA 4PAKA 2CEYA 4DI4B 4OANA 1FBPA 2HZLA 3GYYA 4HCYA 2CZKA 1FBCA 4JVIA 5DW8A 1FBFA 4PFBA 2F3DA 5FBPA 1KA1A 4PBHA 4O7IA 2VPNA 4P47A 2XWKA 4UABA 5J16A 2QVUA 1LBWA 1LBXA 4XEQA 2OWZA 4HXVA 1FBHA 4N6DA 4M1VA 2DE2A 3W9WA 2ZZWA 4MHFA 4PGNA 2CEXA 1FJ9A 1DK4A 4GWUA 5EQ7A 1NI9A 4PETA 2WBDA 3BIGA 4HCWA 3EKIA 4F19A 1QGXA 1XI6A 2P3NA 3MYUA 2GQ1A 2VT5A 4NG7A 1AWBA 1NV5A 4NQ8A 4NAPA 3QMFA 4NX1A 3KC0A 3ISPA 4NGUA 3PTYA 4AS4A 4N4UA 1INPA 2Y5LA 2FVZA 1IMBA 4XFEA 1K9ZA 2Q74A 4MAGA 2QVVA 2QPQA 5ET8A 1FBDA 3A29A 1FTAA 4PCDA 1LBYA 1IMCA 3IFCA 1NV6A 4I3EA 1FRPA 2QFLA 3E78A 4GBVA 2CZHA 2CZIA 1NUWA 1FPBA 4N17A 2P3VA 1CNQA 1IMDA 3LUZA 3KC1A 3T0JA 4PE3A 2FHYA 1YYZA 1G0IA 2HHMA 4O7MA 2PCRA 1FBEA 3LV0A 3E79A 1FSAA 3RYDA 4X9TA 4MNIA 5A5LA 3CHGA 1SPIA 2QVRA 4N8GA 4GWWA 4X04A 5EQAA 4H45A 1EYIA 3D1RA 3IFAA 1KA0A 4MX6A 5IZ3B 4I3YA 4OVQA 4N6KA 4G61A 1NV3A 4PF6A 3W9VA 4PGPA 5ET5A 5I7IA 2FIEA 4MMPA 2WEFA 4I40A 1NV0A 4LN5A 4MJOA 1IMEA 1VDWA 4XF5A 2L5VA 1K9YA 2VPOA 4GX3A 4P9KA 1RDZA 2XWVA 1LEVA 5T3JA 5I5PA 4YICA 5ET7A 2KQZA 4QXDA 4AS5A 4O94A 2BJIA 2XA5A 4KXPA 5IGAA 3FXBA 4MCOA 2V4CA 4DI3D 1LBZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KQZ A;  2MKZ A;  2L5V A;  2KR0 A; 
#chains in the Genus database with same CATH topology
 2ANJ A;  5JTY A;  4JVD A;  4XIG Q;  1FCK A;  5HBC A;  2DE3 A;  4NWD A;  3RPL B;  4HE1 A;  1FQC A;  1MS7 A;  3K1P A;  2AIX A;  4PFT A;  1FPL A;  5DYH A;  3UP9 A;  3TCG A;  4JSO A;  3C9H A;  4PF8 A;  3OD7 A;  1GVC A;  1PB7 A;  1DMB A;  1TWY A;  2O51 A;  5H8Q B;  2DQV A;  1FPI A;  4GX6 A;  3CSB A;  4MLV A;  2AL5 A;  2HPG A;  2I4C A;  4QFP A;  4KYE A;  1PBP A;  4LQ5 A;  3IO4 A;  3TTL A;  1TXF A;  4LZ8 A;  4NMY A;  4PFW A;  4MFI A;  4F29 A;  4K3F A;  4PAI A;  3SKP A;  3TTK A;  4NHB A;  3SEU A;  3TZA A;  2V3Q A;  4THI A;  4E0W A;  1D9Q A;  2XXY A;  2XXR A;  4HW8 A;  4P0I A;  3RUM A;  3HCQ A;  5TPA A;  4OES A;  4ZE8 A;  4POX A;  1UTB B;  4X8R A;  2VGQ A;  2VOZ A;  2XX9 A;  5H8F A;  1XT8 A;  3K6X A;  2Q89 A;  1FPE A;  2A5T B;  3GZG A;  2I3W A;  4QRZ A;  4PFI A;  4U2R A;  1FQA A;  4N13 A;  3PGF A;  2FYI A;  3QXM A;  4MIJ A;  3CFZ A;  1G0H A;  2ZZV A;  4C1T A;  4RXL A;  4IY6 A;  1B2H A;  4PAF A;  4ZDM A;  1KWH A;  1YPN A;  3K4U A;  4H46 A;  4TLL B;  4KYS A;  3S2V A;  2XXV A;  3PPO A;  1SQY A;  2ZYM A;  2I49 A;  1VFD A;  3VVE A;  3OOA A;  1JP4 A;  1ZLQ A;  3JV9 A;  2FA7 A;  4DZ1 A;  4NF5 A;  4ZEF A;  1QUL A;  1A54 A;  3FXU A;  3BIH A;  4GWX A;  2X7P A;  4UAC A;  1FPD A;  2XXP A;  3HHG A;  1UTH A;  2W7Y A;  1IUD A;  2F8D A;  4L17 A;  4YB7 A;  2HXR A;  1FQD A;  3K0V A;  4ESX A;  1IMF A;  4LON B;  4N91 A;  1BK4 A;  4OVS A;  3SER A;  3KJT A;  3FVK A;  3MPK A;  4YAH X;  2ZNU A;  2R8T A;  4ZZA A;  1RYX A;  1AL3 A;  4XKQ A;  2XXT A;  1N76 A;  1M5C A;  1BTJ A;  3KGC A;  5CM6 A;  3LUY A;  4ESW A;  4F1U A;  3PUX E;  4MEV A;  3O9P A;  1FPG A;  5TP9 A;  3RNN A;  3TUS A;  1VE4 A;  3N6T A;  1OQH A;  2ZYO A;  1FQB A;  4IO7 A;  2WYK A;  1B4H A;  1PB8 A;  1BIY A;  2MKZ A;  3ZSF A;  3H4Z A;  3ILU B;  1FBP A;  4HCY A;  5M2V A;  1FBC A;  3QUF A;  4Q0C A;  4JVI A;  1CE2 A;  2VD2 A;  1B3L A;  1US5 A;  1HSL A;  4PFB A;  2F3D A;  2I0B A;  3TDJ A;  3H03 A;  4P47 A;  5AA4 B;  3O2A A;  3MQ9 A;  4UAB A;  4MBP A;  2QVU A;  1LBW A;  3HV1 A;  2HQ0 A;  2OWZ A;  4F3B A;  2DE2 A;  2F7B A;  3IOT A;  5CMC A;  3D4C A;  2X26 A;  3IB1 A;  4Q5T A;  3DM0 A;  3CSG A;  4EUO A;  3EQ1 A;  1RYO A;  1SBP A;  4KFQ A;  3KSX A;  2WKY A;  4H0W A;  1QGX A;  4F22 A;  3MYU A;  1D3K A;  5DVJ A;  1B5J A;  3IOV A;  1R9Q A;  4NQ8 A;  2O7U A;  3DP6 A;  3KC0 A;  2Q8J A;  3K6U A;  1MPB A;  4E0X A;  4R6K A;  2YPN A;  3RQT A;  4NTL A;  3TKD A;  2THI A;  1IMB A;  2ZXT A;  1SW1 A;  4MAG A;  4AQ4 A;  3C31 A;  3PPQ A;  2QVV A;  3MP6 A;  1LFH A;  4NED A;  3TMG A;  5KZT A;  3DP4 A;  1B58 A;  4I62 A;  3FIR A;  4PCD A;  1LBY A;  1IMC A;  3U72 A;  3IFC A;  1NV6 A;  4I3E A;  1FRP A;  3VLU A;  3E78 A;  1NH8 A;  4ZEB A;  4FAJ A;  4U4X A;  1MXX A;  2CZI A;  4OER A;  3FXR A;  4LVQ A;  4N17 A;  4NF4 B;  5ICQ A;  4XKR A;  1PDA A;  4H5F A;  3TTM A;  2QJE A;  5H8N A;  2X7Q A;  2PCR A;  3S9N C;  1ATG A;  4BDR A;  2QL3 A;  4EQB A;  2GHB A;  3PUY E;  1FSA A;  3IAZ A;  2REG A;  3K6W A;  4X9T A;  3I6V A;  2QVR A;  4XKP A;  2IEE A;  1SW2 A;  1ZMG A;  4GWW A;  4X04 A;  3IFA A;  3UA8 A;  5CBR A;  1XOC A;  4MX6 A;  1BKA A;  2E0S A;  4N6K A;  4F31 B;  1PBQ A;  1MXU A;  2DOJ A;  4LA9 A;  1SYH A;  2XHD A;  2Z8E A;  4ZE9 A;  1B1X A;  1P1O A;  2I48 A;  3FV1 A;  3MZ1 A;  1Y3P A;  5I56 A;  2PVU A;  1IME A;  1VDW A;  3PD8 A;  4KD5 A;  3C32 A;  4XXU A;  3V8X B;  4XF5 A;  3RN8 A;  2XWV A;  2DS9 A;  4I1D A;  4ZS9 A;  5I5P A;  5JEI A;  4YIC A;  1LAF E;  2KQZ A;  4XKN A;  1H44 A;  4DCY A;  3FV2 A;  3IOU A;  2O1M A;  2XXX A;  3C33 A;  2ZNT A;  4OMB A;  2CMO A;  1B05 A;  2PMS A;  4MCO A;  3O29 A;  1MQD A;  3ZKL A;  2V4C A;  1MQH A;  1D9V A;  1JEV A;  4FIM A;  1EU8 A;  4U1Z A;  1LBC A;  3LSL A;  4LZ5 A;  3PU5 A;  1SD3 A;  4LZ7 A;  4R6Y A;  4JB7 A;  2VP1 A;  2FBP A;  2DSF A;  5AA2 B;  4P3L A;  4OVT A;  1YZ0 A;  2H98 A;  4YKI A;  4GWZ A;  4JWX A;  4NN3 A;  1MDQ A;  3H7M A;  3USD A;  1B0H A;  2DWJ A;  1IIT A;  1I69 A;  2WYP A;  4LQ2 A;  4PDH A;  1Y1M A;  2F6P A;  4ZEK A;  5ESY A;  2YLN A;  3VVD A;  4PBQ A;  3K1M A;  1FPF A;  4IGT A;  2OLB A;  4ISU A;  3C34 A;  3IO6 A;  3IB0 A;  4F2Q A;  1F9B A;  5DEX A;  3B6W A;  1SYI A;  3E9X A;  2Y7R A;  3UGW A;  2D3I A;  3AXF A;  3B50 A;  5EYG A;  1AH5 A;  3OO8 A;  4OA4 A;  3E4R A;  5I2K B;  2WX9 A;  2XWI A;  3EN3 A;  4QFK A;  4Z0I A;  1N7X A;  4U4S A;  1MY3 A;  1FTL A;  3N94 A;  3T1B A;  2NXO A;  1MY1 A;  3FJ7 A;  4GWY A;  4G77 A;  1FPJ A;  3B6T A;  3CIJ A;  4N8Y A;  3BBR A;  3B6Q A;  3VXC A;  5CRY A;  3MST A;  3H6U A;  3FBP A;  3V83 A;  3M3K A;  2QSX A;  5IM2 A;  3SEW A;  3LSF B;  3SET A;  2DVC A;  2XD2 A;  2DWH A;  2G93 A;  1GV8 A;  5FTH A;  4RA1 A;  3H3G A;  1RDX A;  1HSE A;  1Z7M E;  4PP0 A;  1M5B A;  2DVZ A;  4F2O A;  4KCC A;  2H4I A;  4G68 B;  4P11 A;  2D21 A;  3M8U A;  3T93 B;  2H5Y A;  4PTK A;  1XS5 A;  2REJ A;  5I3S A;  3L6H A;  2VD3 A;  5I2N B;  3A3U A;  4R6H A;  4HE0 A;  2PT2 A;  2ONS A;  4HE2 A;  2Z22 A;  2RKM A;  3LR1 A;  3NOH A;  1MDP 1;  4O8M A;  5FTI A;  2GFE A;  1M5D A;  4GX4 A;  5ICT A;  3L6G A;  1GR2 A;  1LGB C;  3KFM A;  3OEN A;  4DDD A;  2XXH A;  3MVY A;  1RDY A;  4FED A;  4MLQ A;  1ZTY A;  4KHZ E;  1POY 1;  3VXB A;  2XXW A;  1URD A;  1NH7 A;  3EHT A;  5I59 A;  2O1L A;  3LC8 A;  1EZ9 A;  3C35 A;  4FAT A;  2B4L A;  2HZK A;  4DIG A;  1JEU A;  4GD5 A;  4H8J A;  4POW A;  2Q8M A;  1M5F A;  1H3D A;  1IZ1 A;  1MXW A;  3MC2 A;  3MBP A;  4F3P A;  4H5G A;  4N15 A;  3RPL A;  4UA8 A;  1NNF A;  3V5A A;  1MXZ A;  3U93 A;  1DCU A;  1KZ8 A;  2Q9T A;  2PFY A;  1NNP A;  4ELP A;  5KCJ B;  3S4U A;  5LTC A;  3T9X B;  5H8Q A;  3VDF A;  5TU0 A;  1NV1 A;  2F3B A;  2D5W A;  4DI4 B;  3QUJ A;  3R7X A;  4BDQ A;  3Q29 A;  3GYY A;  1QJM A;  4HTG A;  4ZEC A;  3MVX A;  1MQI A;  1I6Q A;  4BLA A;  1LBX A;  4R2F A;  4N6D A;  4M1V A;  3W9W A;  3PUZ E;  1UTB A;  2ZZW A;  3TTN A;  2HEU A;  4PFY A;  1DK4 A;  2Z8F A;  3PMW A;  4KCD A;  5DVI A;  3UOR A;  1NI9 A;  4OXV A;  2I3V A;  2V3U A;  2XX7 A;  1MPC A;  1AIV A;  1XVX A;  3IJX B;  2P3N A;  4R75 A;  2ONK E;  3TQL A;  2VT5 A;  4Q8R A;  3KG2 A;  4JWO A;  4NG7 A;  1Y9U A;  2I4B A;  1SW4 A;  4YKK A;  4NX1 A;  3ZKK A;  1TFD A;  4I8C A;  4H67 A;  3ISP A;  2QMW A;  1MM7 A;  3IX1 A;  3TEL A;  5BWJ A;  1PEB A;  2V3T A;  1WOD A;  4RK2 A;  1GGG A;  2FVZ A;  4XFE A;  1K9Z A;  1ELJ A;  4FEC A;  4ELQ A;  3SEX A;  3PD9 A;  2OBG A;  1I6B A;  2QFL A;  2DWA A;  3Q28 A;  1P1U A;  5ELV A;  3SES A;  1SDX A;  1MY2 A;  3OO7 A;  2P3V A;  2HCA A;  1IMD A;  2O84 X;  4RYA A;  4LAT A;  3KC1 A;  3OEL A;  3T0J A;  3A09 A;  2FHY A;  2XXU A;  1YYZ A;  4EXL A;  1N3W A;  3PPN A;  4O7M A;  3HST A;  3RY3 A;  1YAE A;  5AE4 A;  1JET A;  4MNI A;  3FXQ A;  1I6A A;  3CHG A;  3KN7 A;  1B7U A;  5AA2 D;  3R26 A;  5EQA A;  3N5L A;  2O69 A;  4R9F A;  4FEB A;  1P1W A;  5IZ3 B;  4OVQ A;  4RK9 A;  3T9U A;  5KDT A;  5H8H B;  5HPQ A;  1NV3 A;  4R9G A;  1QVS A;  4OHN A;  3U92 A;  3FAS A;  4PGP A;  5DT6 A;  1P1N A;  1B5I A;  3N6U A;  4QFN A;  1B6H A;  5CMB A;  4MMP A;  3QYT A;  1Z7N E;  5L9M A;  4TQU Q;  2ESN A;  2ZYK A;  4LN5 A;  3ZS6 A;  3TEP A;  5AA4 A;  4IO3 A;  1DSN A;  5EHM A;  4OFL A;  4F3G A;  2L5V A;  4GX3 A;  3T22 A;  3K01 A;  5T3J A;  4RNS A;  5DTB A;  4M4G A;  3FVO A;  1SW5 A;  2GH9 A;  2KLF A;  4QSC A;  3ODB A;  5IGA A;  5I57 B;  2M8C A;  1A40 A;  3TYH A;  2NOO A;  2RCB A;  4HS7 A;  3IJO B;  3OEM A;  4Q30 B;  4RJZ A;  1DPE A;  4DI3 D;  3VE1 B;  1FJ6 A;  3O6G A;  2DDK A;  2F7C A;  1UIV A;  3H6T A;  4OEN A;  4N81 A;  1A99 A;  2PX1 A;  2UVH A;  4ND9 A;  5AA3 A;  2FIX A;  1B3F A;  1Y3Q A;  3G3J A;  4R2B A;  1ANF A;  4JWY A;  2V93 A;  3IL1 B;  1ZKB A;  4F1V A;  3PV0 E;  3T66 A;  4GXA A;  4H8I A;  3G7W A;  1B7H A;  2F36 A;  3EF7 A;  3DP8 A;  2Z23 A;  1FBG A;  1YXI A;  1Y3N A;  1NV7 A;  5IZZ A;  4X1D A;  2F6G A;  4GRK A;  2XXQ A;  4QFL A;  4QBA A;  3UIF A;  2R9J A;  2XXK A;  3WAF A;  3RGY A;  4OEV A;  4ELR A;  3CFL A;  4KPT A;  4OTE A;  4P1E A;  2HXW A;  4O3B A;  3FZV A;  1IXC A;  2Y84 A;  5L9S A;  2KR0 A;  1YTV A;  4PDD A;  2HFB A;  3OSR A;  3VFJ A;  4X48 A;  3MW0 A;  2E1S A;  4EQ9 A;  1FQF A;  4TLM B;  2BJJ X;  4WKM A;  1YCJ A;  5EQ8 A;  4H6D A;  5F24 A;  1II5 A;  5FHM A;  4OFJ A;  2AL4 A;  1EYJ A;  4GIZ A;  4F3S A;  2O7I A;  4FJP A;  2FNC A;  2ABH A;  1B3G A;  1VSO A;  1TT1 A;  4IO5 A;  4GL0 A;  1B0L A;  5L9O A;  3H6V A;  1OVT A;  5JK4 A;  1JVX A;  4RPO A;  3FJG A;  4G8M A;  5CBS A;  4GVO A;  2LAO A;  1EYK A;  4F1Y A;  1LLS A;  3KBZ A;  2RCA A;  5IKB A;  4R72 A;  3IOW A;  4GLI A;  4C1U A;  1MY4 A;  2Y7I A;  1FPK A;  3MWB A;  4OVR A;  3MVZ A;  1Q35 A;  4XTC Q;  3IB2 A;  1LBB A;  2ZZX A;  4GQO A;  2RIN A;  1Y20 A;  3BKI B;  4IO4 A;  2B4M A;  4KQP A;  1QKA A;  3U94 A;  2Q2C A;  4GBW A;  3KOT A;  4PC9 A;  4NF8 B;  3W15 C;  2OX3 A;  4X1B A;  1O63 A;  1NUY A;  4OVP A;  4OZ9 A;  1S7Y A;  3MZ9 A;  5H8S A;  3CR9 A;  5I84 A;  4NF0 A;  1NV2 A;  1MM6 A;  4DXB A;  4KYD A;  1GTK A;  2PT1 A;  3G3I A;  3KN8 A;  1O7T A;  4U22 A;  1B46 A;  3N26 A;  4P8B A;  4N6P A;  1N84 A;  1NKX A;  4MH5 A;  1USY E;  3M3L A;  5K2X A;  1IXH A;  4OEU A;  1B5H A;  3VLW A;  5AA2 A;  2NUV A;  3CRB A;  3JZJ A;  4JSD A;  4GWS A;  1UIU A;  3C4M A;  1SI1 A;  2PFZ A;  4NF6 B;  1B51 A;  3CFX A;  1ZIU A;  1N04 A;  4PAK A;  3V89 B;  1L5T A;  4OWD A;  2B65 A;  2QS1 A;  3CG1 A;  4OAN A;  5A5X B;  3TQW A;  3TFL A;  1NL5 A;  5CC2 A;  5EYF A;  3CVG A;  5DW8 A;  1FBF A;  1Y1Z A;  1LAX A;  5FBP A;  2HAV A;  4PBH A;  4O7I A;  2VPN A;  2NWJ A;  3KEI A;  2XWK A;  3K02 A;  1MXY A;  1M5E A;  2GRV A;  1US4 A;  1H45 A;  1FBH A;  5I2K A;  1IQ7 A;  2DWI A;  3FAT A;  2CZL A;  4OYV A;  3KZG A;  2CEX A;  1FJ9 A;  3SDF A;  3FD3 A;  1FW0 A;  3PMV A;  1OQG A;  3RLF E;  5EQ7 A;  3QIM A;  4PET A;  3BIG A;  2QRY A;  4HCW A;  3EKI A;  1XI6 A;  1VFE A;  5I58 B;  2GQ1 A;  2OCU A;  5JTY B;  2UYF A;  1AWB A;  3A3C A;  5L8D A;  4TOZ A;  4NAP A;  2GHA A;  1AMF A;  1NMU A;  2R71 A;  3O6H A;  1B9J A;  4WED A;  3D4G A;  2VHA A;  4GWO A;  3CG3 A;  1N0T A;  3MZB A;  3PTY A;  3IK6 B;  1POT A;  4AS4 A;  4G68 A;  3GBB A;  4N4U A;  5DVF A;  5I2N A;  1DTG A;  2Q74 A;  1B1H A;  3E3K A;  1IIW A;  1NNT A;  1Y4C A;  2QPQ A;  5ET8 A;  3PPP A;  3K00 A;  1URG A;  4GF8 A;  1DPP A;  1MH3 A;  4OET A;  4GOT A;  3ILT B;  4GBV A;  2B3F A;  2CZH A;  3KJ7 A;  5TPA B;  1NUW A;  2DP8 A;  4O3A A;  2F97 A;  3M3F A;  3PPR A;  3RPW A;  4JXI A;  2P0S A;  2OK2 A;  2UVI A;  4PE3 A;  1VR5 A;  2O6A A;  5ITP A;  3U1O A;  4Z7E A;  1G0I A;  2V25 A;  1Q1K A;  2HHM A;  5ITO A;  4ELO A;  3H6W A;  5H8F B;  1MRP A;  2XXI A;  4G8N A;  4BDL A;  3LV0 A;  3RT8 A;  1MY0 A;  2H25 A;  3E79 A;  1USY H;  2Q2A A;  1B7Z A;  3TPA A;  3EHS A;  3TTR A;  2ZMB A;  1QW0 A;  3QK6 A;  5KCJ A;  4G4P A;  1PC3 A;  4N8G A;  4I9D A;  4H45 A;  1EYI A;  3D1R A;  1B32 A;  3I5O A;  1LB9 A;  2H99 A;  3FVN A;  1LFI A;  4RPN A;  4EXK A;  4EF1 A;  4PF6 A;  4OFO A;  5CI5 A;  2Z8D A;  5ET5 A;  1PB9 A;  3MJN A;  1OLC A;  1JW1 A;  1O64 A;  1WVJ A;  1A7L A;  1NV0 A;  1TFA A;  5EHS A;  2A5T A;  1SI0 A;  4NF5 B;  4BDO A;  3K2D A;  1T0K A;  4P9K A;  1RDZ A;  3MVW A;  3FUZ A;  1IXI A;  4QXD A;  2Q88 A;  4JBZ A;  4DE8 A;  1UTH B;  4O94 A;  2XA5 A;  4KXP A;  4R73 A;  2XX8 A;  1FQE A;  3FXB A;  3ONM A;  2QMX A;  4DXU A;  3GXA A;  2UYE A;  3OEK A;  4R74 A;  3GLB A;  5F1Q A;  3TCH A;  4YMA A;  1XC1 A;  1QUI A;  3C36 A;  3MUQ A;  3IR1 A;  1A55 A;  5FHN A;  1IEJ A;  4KI0 E;  3HO7 A;  5BUU A;  2HAU A;  3G3K A;  5TP9 B;  2WBB A;  2P1S A;  3ROJ A;  5EQ9 A;  2DXY A;  3B7D A;  4KR5 A;  1ZU0 A;  4RY1 A;  1NFT A;  3TOD A;  3B8B A;  5FHO A;  3VLV A;  1JNF A;  4IR8 A;  4YZZ A;  4ECF A;  1XHY A;  4AB6 A;  5CMK A;  4FBP A;  1D9Y A;  2B3B A;  3T9V A;  2V84 A;  3BFT A;  1B3E A;  4U23 A;  1IMA A;  1NV4 A;  3UN6 A;  2JJK A;  3EPE A;  4YKJ A;  1J1N A;  3EHU A;  4GFR A;  4GXS B;  3BFU A;  2O68 A;  5ET6 A;  5KDT B;  4ZZE A;  1LFG A;  2QS3 A;  4QSD A;  4F18 A;  1FTO A;  2RF1 A;  3QAX A;  4AB5 A;  1QKB A;  2G29 A;  4MF3 A;  1RKM A;  2XWO A;  3U65 A;  3TAJ A;  1JQF A;  1FTM A;  3HFU A;  1LBV A;  2Y5K A;  4QFO A;  1N7W A;  5AA1 A;  2F5X A;  1LAH E;  3WAE A;  4FOR A;  4WXJ A;  1MQJ A;  2AYS A;  2IA4 A;  2A5S A;  5IZ3 A;  5H8H A;  3SEY A;  1R1N A;  4N07 A;  2Y7K A;  4YKP A;  5EYH A;  1H76 A;  4YB6 A;  1NUZ A;  4QSE A;  4G68 C;  4PQJ A;  1NUX A;  1MG1 A;  1JVY A;  4WEP A;  1MH4 A;  3HPI A;  3JYR A;  4NE4 A;  4JVC A;  2F34 A;  4BDN A;  3OO9 A;  3P7I A;  4OVJ A;  1A8F A;  3KSJ A;  2DXR A;  4DLD A;  4EF2 A;  3FVG A;  3Q26 A;  5I57 A;  1Q9D A;  2I6E A;  4IO2 A;  1EZO A;  4P56 A;  1OIB A;  4PE5 B;  4U1O A;  2ZNS A;  1DBZ A;  3T9H B;  3OSQ A;  3Q25 A;  1A8E A;  5H8N B;  3Q27 A;  5IZ1 A;  1LST A;  1SVX B;  3KN3 A;  4P1L A;  1WDN A;  3I3V A;  1B3H A;  2NVU B;  5J1D A;  1Y4T A;  2Y7W A;  5LDZ A;  2UVJ A;  3E13 X;  4MNP A;  4IB2 A;  4MNC A;  2DE4 A;  4C0R A;  5ISU A;  1H43 A;  1QUJ A;  3SZP A;  4PFR A;  4U21 A;  3OMB A;  4IY5 A;  3PUV E;  3FJM A;  2CEY A;  4NF4 A;  4ZED A;  4NWC A;  2QS2 A;  3O6I A;  1LB8 A;  3S9E A;  2HZL A;  4YMB A;  4GL8 A;  2CZK A;  3K1N A;  3MAM A;  3KBR A;  2F78 A;  1KA1 A;  1ZJL A;  4JDF A;  5I56 B;  3LSX A;  4ZEI A;  5J16 A;  3K6V A;  4F39 A;  4XEQ A;  2ALU A;  4HXV A;  1IXG A;  2R6G E;  5IAI A;  1LCF A;  4BDM A;  3RTF B;  4MHF A;  1DOT A;  1MPD A;  4PGN A;  2Y7P A;  2PYY A;  4PFU A;  2RC9 A;  4GWU A;  3RT6 B;  3VV5 A;  2WBD A;  4G8H A;  3ECR A;  4F19 A;  3VVF A;  4IGR A;  2OWT A;  1R9L A;  1FTK A;  5K2Y A;  3TCF A;  1P99 A;  1NV5 A;  2DYX A;  1AOV A;  3IOR A;  3HHF A;  4DXC A;  3QMF A;  1OLA A;  3G3G A;  1S50 A;  2OZZ A;  2PBW A;  3CI8 A;  4NGU A;  2OWS A;  1QUK A;  1S9T A;  3HN0 A;  1INP A;  2Y5L A;  4H1X A;  3DLN A;  3U8Q A;  1FTJ A;  2XD3 A;  3S9M C;  4FE8 A;  4O3C A;  3H06 B;  1B4Z A;  1FBD A;  3A29 A;  1FTA A;  5F7V A;  2RC7 A;  1B52 A;  1ZBM A;  4LP2 B;  3R6U A;  5HM4 B;  3OO6 A;  4G2Z A;  4EQ7 A;  4NF8 A;  3KOS A;  3T96 B;  5DEX B;  5B70 A;  1NNK A;  3MPL A;  2RC8 A;  1FPB A;  3RTW B;  1JW5 A;  1CNQ A;  3LSW A;  1JW4 A;  3LUZ A;  2H9B A;  4LUB A;  3SEV A;  4OQO A;  3S9L C;  4P0G A;  3O66 A;  3G3H A;  3MP1 A;  3FGS A;  4YB5 A;  1FBE A;  1MXV A;  2F35 A;  3F11 A;  1D4N A;  3RYD A;  4QHQ A;  5A5L A;  3DEL B;  2P2A A;  4ONY A;  1SPI A;  1LCT A;  2ZYN A;  1OMP A;  3PUW E;  1LAG E;  4QF9 A;  1BP5 A;  2ONR A;  1KA0 A;  2I0C A;  3G3F A;  3LBS A;  4NF6 A;  1R6Z A;  4I3Y A;  4G61 A;  3O28 A;  3W9V A;  1P1Q A;  4DCX A;  2QS4 A;  5I7I A;  5A5X A;  2OJT A;  3QSL A;  2FIE A;  3THI A;  1URS A;  2WEF A;  4I40 A;  1BLF A;  2I58 A;  3OXN A;  4MJO A;  5CMM A;  5B7D A;  1XVY A;  1MQG A;  1K9Y A;  2VPO A;  1B40 A;  2F7A A;  3MP8 A;  1LEV A;  1UQW A;  3PMX A;  1HSJ A;  1CB6 A;  5ET7 A;  2YJP A;  2UVG A;  5LOM A;  4AS5 A;  4EDP A;  2UXA A;  4YU0 A;  2BJI A;  4H65 A;  3O97 A;  1DTZ A;  1N3X A;  4IO6 A;  3UK4 A;  1OVB A;  1EH3 A;  5I59 B;  1EZP A;  5I58 A;  3GBA A;  1LBZ A; 
#chains in the Genus database with same CATH homology
 1FJ6 A;  2DDK A;  4JVD A;  2DE3 A;  4N81 A;  3RPL B;  4HE1 A;  2FIX A;  1FPL A;  2FBP A;  4P3L A;  2WBB A;  3ROJ A;  4F1V A;  4OVT A;  4PF8 A;  1YZ0 A;  5EQ9 A;  4GWZ A;  1FBG A;  1YXI A;  3B8B A;  1FPI A;  1NV7 A;  4GX6 A;  4NN3 A;  5IZZ A;  2HPG A;  4IR8 A;  4YZZ A;  2WYP A;  4QBA A;  4PDH A;  2XXK A;  4FBP A;  5ESY A;  4PBQ A;  1FPF A;  4P1E A;  4PAI A;  1IMA A;  4NHB A;  1NV4 A;  2V3Q A;  2JJK A;  2KR0 A;  1D9Q A;  4PDD A;  3B50 A;  5EYG A;  5ET6 A;  4OA4 A;  4F18 A;  2WX9 A;  2XWI A;  4X8R A;  5EQ8 A;  5F24 A;  3T1B A;  4GWY A;  1EYJ A;  2XWO A;  3U65 A;  1FPJ A;  4N8Y A;  3HFU A;  1FPE A;  1LBV A;  2Y5K A;  3MST A;  3FBP A;  4PFI A;  5IM2 A;  2F5X A;  5JK4 A;  4MIJ A;  1G0H A;  2ZZV A;  5IZ3 A;  4PAF A;  1RDX A;  4H46 A;  1EYK A;  3KBZ A;  5EYH A;  2DVZ A;  1NUZ A;  1FPK A;  1NUX A;  4PTK A;  4OVR A;  5I3S A;  1JP4 A;  2ZZX A;  4HE0 A;  4JVC A;  4HE2 A;  3BIH A;  4GWX A;  2B4M A;  3NOH A;  4O8M A;  4GX4 A;  1FPD A;  4PC9 A;  4GBW A;  1RDY A;  2OX3 A;  1NUY A;  2HXR A;  4OVP A;  1IMF A;  1Q9D A;  4N91 A;  4P56 A;  1BK4 A;  4OVS A;  2B4L A;  2HZK A;  4NF0 A;  1DBZ A;  1NV2 A;  2R8T A;  5IZ1 A;  2Q8M A;  4P1L A;  4N15 A;  4P8B A;  3RPL A;  5CM6 A;  4F1U A;  4MEV A;  5J1D A;  1DCU A;  1KZ8 A;  2Q9T A;  1FPG A;  2PFY A;  5LDZ A;  4MNP A;  4MNC A;  4GWS A;  2DE4 A;  5LTC A;  3SZP A;  2WYK A;  4PFR A;  2PFZ A;  2MKZ A;  1NV1 A;  2F3B A;  4PAK A;  2CEY A;  4DI4 B;  4OAN A;  1FBP A;  2HZL A;  3GYY A;  4HCY A;  2CZK A;  1FBC A;  4JVI A;  5DW8 A;  1FBF A;  4PFB A;  2F3D A;  5FBP A;  1KA1 A;  4PBH A;  4O7I A;  2VPN A;  4P47 A;  2XWK A;  4UAB A;  5J16 A;  2QVU A;  1LBW A;  1LBX A;  4XEQ A;  2OWZ A;  4HXV A;  1FBH A;  4N6D A;  4M1V A;  2DE2 A;  3W9W A;  2ZZW A;  4MHF A;  4PGN A;  2CEX A;  1FJ9 A;  1DK4 A;  4GWU A;  5EQ7 A;  1NI9 A;  4PET A;  2WBD A;  3BIG A;  4HCW A;  3EKI A;  4F19 A;  1QGX A;  1XI6 A;  2P3N A;  3MYU A;  2GQ1 A;  2VT5 A;  4NG7 A;  1AWB A;  1NV5 A;  4NQ8 A;  4NAP A;  3QMF A;  4NX1 A;  3KC0 A;  3ISP A;  4NGU A;  3PTY A;  4AS4 A;  4N4U A;  1INP A;  2Y5L A;  2FVZ A;  1IMB A;  4XFE A;  1K9Z A;  2Q74 A;  4MAG A;  2QVV A;  2QPQ A;  5ET8 A;  1FBD A;  3A29 A;  1FTA A;  4PCD A;  1LBY A;  1IMC A;  3IFC A;  1NV6 A;  4I3E A;  1FRP A;  2QFL A;  3E78 A;  4GBV A;  2CZH A;  2CZI A;  1NUW A;  1FPB A;  4N17 A;  2P3V A;  1CNQ A;  1IMD A;  3LUZ A;  3KC1 A;  3T0J A;  4PE3 A;  2FHY A;  1YYZ A;  1G0I A;  2HHM A;  4O7M A;  2PCR A;  1FBE A;  3LV0 A;  3E79 A;  1FSA A;  3RYD A;  4X9T A;  4MNI A;  5A5L A;  3CHG A;  1SPI A;  2QVR A;  4N8G A;  4GWW A;  4X04 A;  5EQA A;  4H45 A;  1EYI A;  3D1R A;  3IFA A;  1KA0 A;  4MX6 A;  5IZ3 B;  4I3Y A;  4OVQ A;  4N6K A;  4G61 A;  1NV3 A;  4PF6 A;  3W9V A;  4PGP A;  5ET5 A;  5I7I A;  2FIE A;  4MMP A;  2WEF A;  4I40 A;  1NV0 A;  4LN5 A;  4MJO A;  1IME A;  1VDW A;  4XF5 A;  2L5V A;  1K9Y A;  2VPO A;  4GX3 A;  4P9K A;  1RDZ A;  2XWV A;  1LEV A;  5T3J A;  5I5P A;  4YIC A;  5ET7 A;  2KQZ A;  4QXD A;  4AS5 A;  4O94 A;  2BJI A;  2XA5 A;  4KXP A;  5IGA A;  3FXB A;  4MCO A;  2V4C A;  4DI3 D;  1LBZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...