2KQZA

Solution structure of the rpn13 deubad domain
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
155
structure length
155
Chain Sequence
STAASPTQPIQLSDLQSILATMNVPAGPAGGQQVDLASVLTPEIMAPILANADVQERLLPYLPSGESLPQTADEIQNTLTSPQFQQALGMFSAALASGQLGPLMCQFGLPAEAVEAANKGDVEAFAKAMQNNAKPEQKEGDTKDKKDEEEDMSLD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Proteasomal ubiquitin receptor ADRM1
publication title Structure of Proteasome Ubiquitin Receptor hRpn13 and Its Activation by the Scaffolding Protein hRpn2.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 27
structure length 155
sequence length 155
ec nomenclature
pdb deposition date 2009-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16550 RPN13_C UCH-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.140 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2kqzA01
2MKZA 2KR0A 2KQZA 2L5VA
chains in the Genus database with same CATH superfamily
3RT6B 4P1LA 2PCRA 1LFIA 5AA2A 3KN3A 3E78A 3QYTA 1PB9A 2FBPA 1M5BA 2DOJA 4DXCA 4MHFA 2DE4A 2O68A 1FPEA 3FVNA 2OWTA 4HS7A 4LZ5A 4ZZEA 1FQDA 3LC8A 3IB1A 1GVCA 1QGXA 1YTVA 2ABHA 3IAZA 3QUJA 4FECA 5JEIA 1FBEA 1FTJA 3G3KA 1B52A 1JEUA 2Y5KA 2V3UA 3Q26A 1QKBA 1J1NA 3KN7A 1N0TA 2OX3A 4R2FA 3FZVA 5CC2A 4PFRA 1R6ZA 2ONKE 4PAKA 5H8HA 3PUZE 3MP8A 3G3GA 3K4UA 3ILTB 5L8DA 3KJTA 4F3PA 2HCAA 3KEIA 3ECRA 2WBDA 4BLAA 3TCGA 4NHBA 4NF6B 2F8DA 3FUZA 1N84A 4GIZA 1Y1MA 2FA7A 5H8FB 3ONMA 4ECFA 3TMGA 1LAHE 1EH3A 2F3DA 3FASA 3OOAA 3CSBA 3FV2A 3AXFA 3GZGA 1INPA 1MQGA 3R26A 1CNQA 1MPDA 2D21A 3MP1A 5L9OA 4RK9A 3S9NC 4N15A 4JSOA 4NF0A 1BP5A 4H8IA 5EHSA 4MH5A 4AS4A 4POXA 1ZJLA 4I3YA 3O6HA 4K3FA 3KBRA 4JWOA 4YKPA 2OJTA 5CMBA 3FGSA 1NI9A 1I6AA 1IZ1A 1QULA 3S9MC 4YKKA 5BUUA 1SW4A 4WKMA 1IUDA 3ZKLA 2XXQA 4G8MA 5DW8A 3PU5A 3RT8A 1M5FA 1MQJA 4MLQA 1SDXA 3A3CA 4BDQA 2DSFA 1FQAA 3RY3A 5ET7A 1N7WA 2KLFA 4GX4A 4TLLB 1MG1A 3QAXA 2XD2A 1XHYA 4NAPA 4MJOA 1B5HA 4XKNA 2HZLA 1A40A 3OO8A 3PPNA 4IO7A 4PTKA 1FPGA 5ITPA 3HN0A 2Y7WA 4HTGA 1EYKA 1LBWA 3MPKA 2B4MA 5ICTA 4QHQA 1CE2A 1B3FA 3UK4A 5I58B 4ONYA 4GBVA 2BJIA 1OLCA 1LBVA 4I62A 2ZYKA 3FVOA 1BK4A 4DIGA 2NOOA 3BKIB 4DDDA 5DEXB 1NV7A 3MZBA 3O66A 4MNIA 4QFLA 3CG1A 3F11A 4Q5TA 4H67A 5ELVA 1AH5A 3A09A 2DWAA 2R9JA 1KA1A 3EHUA 2V25A 3GXAA 3QIMA 4O3BA 1DTGA 3SEYA 5KZTA 1JETA 3MAMA 5F24A 3K00A 1LAGE 3MUQA 1M5CA 4H5FA 1D4NA 2ESNA 4GWUA 4HW8A 1LBYA 2H98A 3M3KA 5B7DA 4F3GA 4XKPA 4LQ5A 2HZKA 3BIGA 3H7MA 1NV2A 5T3JA 4YZZA 1LBCA 4Z7EA 4F29A 1OIBA 3PMXA 3IJXB 2XXHA 3PUXE 5K2XA 1B05A 2HHMA 2XXIA 4NQ8A 4O7MA 4DXBA 1KA0A 4MF3A 1FTAA 4DZ1A 2XD3A 3GLBA 4G8NA 3FJGA 1NMUA 1CB6A 2D5WA 3KSJA 3PV0E 1Y3PA 4PCDA 1B0LA 3UN6A 1QUJA 1SW5A 3IB2A 2Y7KA 5EQ8A 2XXYA 1MY1A 1FBFA 3TCHA 3CI8A 4RNSA 4FATA 4O94A 3K6UA 2FIEA 1MXYA 3TYHA 4C1UA 2HXRA 1LFGA 2ONSA 3IOTA 4IO6A 2ZYOA 1T0KA 3BFTA 4FJPA 3W9VA 3FBPA 1FTOA 1B1HA 2E1SA 3CFXA 2XWIA 3ZSFA 2QS3A 1MY2A 2H99A 1XVYA 3H3GA 2MKZA 3H6UA 3LV0A 4LA9A 4NN3A 2UYEA 5I2NB 1USYE 4PAIA 3ODBA 3V5AA 4NEDA 1NV5A 3KZGA 3MBPA 4O7IA 1OLAA 4HXVA 1Z7NE 3VXBA 4ELQA 1G0HA 4QBAA 2I0BA 1H43A 1FQEA 4XEQA 3RPLA 5J1DA 1RKMA 2HAUA 4G2ZA 3BBRA 1SPIA 4G61A 4NF4B 1QKAA 2A5SA 3OO9A 1XT8A 5A5LA 5I56A 5ET5A 3C9HA 2A5TA 1IMFA 4QFOA 3C34A 3SEUA 1MY4A 1IXHA 2XX7A 3MVZA 1JP4A 3O9PA 3IORA 2I49A 5LOMA 2F34A 3MQ9A 2AL5A 1FBGA 4P9KA 1N7XA 4PFBA 1B46A 5ICQA 5AA1A 3CHGA 3A3UA 3B6WA 2WEFA 1D9YA 3H06B 4ELPA 2WKYA 1FJ6A 2PFZA 3T9HB 5I84A 3FXBA 2B4LA 4GXSB 4PGPA 4IB2A 3EN3A 5FTIA 1JW5A 1LBXA 4JWYA 3TTNA 2YPNA 1DOTA 1AIVA 3HV1A 3BFUA 4ZE8A 2VOZA 1MPBA 1NV0A 1NL5A 4R73A 1FBPA 4KYEA 5F7VA 1IMCA 5I59A 2Z8EA 3SEWA 5AA2D 1FRPA 2GRVA 3EQ1A 1B6HA 1B5JA 5KDTA 3FXRA 5DYHA 1EZ9A 1IEJA 2DQVA 1LAXA 4GWZA 2ZZVA 4N91A 1Y9UA 2DXYA 3PUYE 4F1YA 1A55A 1MXWA 3W15C 2H9BA 3EKIA 1SW2A 1N3XA 2AIXA 3TPAA 4IR8A 3RGYA 1O63A 3OO6A 4MCOA 4EQ9A 4RJZA 5AA2B 4OA4A 1PBQA 4H8JA 4ZEBA 4QFNA 4LVQA 3KOSA 3OENA 3VE1B 5ET8A 3WAEA 3CR9A 4XKQA 1IMBA 2DWHA 4I9DA 1GV8A 4EQ7A 2D3IA 1R9QA 3H6VA 1S50A 3TCFA 2WX9A 3LUYA 3FV1A 3Q25A 4ZEKA 5CMKA 4BDMA 4YB5A 1B40A 2F35A 2OCUA 3OD7A 2XXVA 1RDXA 2GH9A 4GWWA 4ZECA 2B65A 4R6KA 4LONB 4ZEFA 4JSDA 2Z8FA 1P1OA 5H8HB 2UVHA 2XX9A 1MXXA 2XWOA 2H25A 3KG2A 4EQBA 4WEDA 5CMMA 4DI4B 4HE2A 3FJ7A 1R1NA 4THIA 3TELA 2Q74A 4N8GA 2NWJA 5H8NA 3S2VA 3K6XA 4GLIA 2P3VA 2F36A 3B6QA 3WAFA 5I5PA 3PUWE 5EQ9A 5ISUA 3O28A 4OXVA 1DPPA 5IM2A 2HEUA 1OVBA 2VGQA 4XTCQ 1IQ7A 2ZYNA 3PTYA 4ISUA 1I6QA 3B50A 4H6DA 1DTZA 2E0SA 1DPEA 5FHOA 1PB7A 1K9YA 5EYFA 1B1XA 4KR5A 4PAFA 3SZPA 2CMOA 1G0IA 4OENA 2B3FA 1Y20A 4R75A 4X48A 1SW1A 3MVWA 2CZHA 4TOZA 3FD3A 3U65A 1XVXA 1ZTYA 1SI1A 3SESA 1H44A 4QF9A 3PPRA 2PBWA 4C1TA 4JVCA 3S9EA 2F7BA 1MXVA 4GWYA 2XXPA 1LBBA 4KI0E 5I57A 5IAIA 4IO3A 1YZ0A 1MY3A 3HPIA 3CFZA 5H8QA 4ZZAA 4OERA 2V93A 2I58A 1SBPA 4YAHX 4OQOA 4KYDA 3O2AA 3SEXA 2FNCA 1ZIUA 2AL4A 4MX6A 4H5GA 3QUFA 4NTLA 4AB6A 1NNPA 3TTKA 3LSFB 4Q0CA 1SVXB 1AMFA 4PE5B 5DVIA 5AA4A 2CEXA 2F3BA 4OYVA 2OWZA 4G68A 1PDAA 2PMSA 2DWIA 3TQWA 4F1VA 2ZNTA 4JVDA 2V4CA 2IA4A 4Q30B 3CIJA 1LB8A 2ZXTA 4H46A 3KFMA 3THIA 1MM6A 1RDYA 2ZZXA 4DE8A 2ONRA 5TU0A 5IZ3A 2Q2CA 5L9MA 1DBZA 3D4GA 4E0XA 3MYUA 4F3SA 1A8FA 2I4CA 1YAEA 1XOCA 5IZZA 5B70A 3K1PA 4EF2A 2PFYA 1FQFA 3SERA 2QSXA 3CRBA 3UGWA 2ALUA 4PFUA 1JVYA 3K0VA 2CZLA 4FEBA 4P8BA 4P0IA 4NWCA 1ZLQA 2R8TA 3KBZA 1Q9DA 1MPCA 2UYFA 4R9FA 4XFEA 5H8SA 4OANA 1FBCA 1KWHA 1FPKA 1POY1 1QVSA 4UABA 1B4HA 2I48A 1Z7ME 4LP2B 1LCTA 4Z0IA 5FHMA 4DLDA 2H4IA 3K1NA 2QL3A 1ELJA 3SETA 3H03A 4MMPA 3T66A 2O84X 1MXUA 3GBAA 4MBPA 4OWDA 3MPLA 4RPNA 4OFLA 1GTKA 3LR1A 3OSQA 4O8MA 4N6DA 4LZ7A 3EPEA 2Z22A 1KZ8A 3IJOB 1P1UA 5FTHA 1IIWA 1IMAA 1B7UA 4I1DA 3O97A 2XA5A 2ZZWA 4YKJA 3VV5A 1NUYA 5DT6A 3HCQA 5K2YA 4O3CA 4IY6A 4L17A 5FHNA 2RC8A 4PQJA 1NUXA 3IOVA 1IXIA 3TEPA 4OVQA 3IO6A 2P1SA 3ZKKA 1B7ZA 1Y4TA 5JK4A 1LGBC 1ZKBA 1F9BA 3FXQA 5HPQA 3QMFA 2DWJA 4GL8A 1NKXA 1L5TA 5I58A 2VT5A 3RPLB 1FQCA 2Q8MA 1B5IA 2QFLA 3IK6B 3L6HA 4GVOA 4BDRA 3MVYA 2QS4A 1HSEA 3G7WA 3UORA 5I56B 2XXKA 1SYHA 3OEMA 1FCKA 4YU0A 2A5TB 2F6GA 3T9UA 4OVJA 4N07A 2V3QA 4GQOA 4LQ2A 3PMWA 3CG3A 3MZ1A 2CEYA 1LLSA 3OELA 3Q27A 2DE2A 1ZU0A 5JTYA 4R6YA 4AQ4A 3JYRA 1UTHA 4RXLA 4MEVA 2Z8DA 1WDNA 5TP9A 2QRYA 4KXPA 3T1BA 3UP9A 4QSCA 1BKAA 3BIHA 4XXUA 2B3BA 5L9SA 3I3VA 2I0CA 2L5VA 4M1VA 4H0WA 4U1OA 3V89B 2OWSA 3TTLA 2F6PA 2Q88A 2VD2A 2HPGA 1Y4CA 2QS2A 4KPTA 3MP6A 1WODA 4F31B 4IGRA 4QSEA 2QJEA 3U92A 1FW0A 3RQTA 4FAJA 4F1UA 2FYIA 3IFCA 5EQ7A 4GWXA 5I59B 4M4GA 2PT1A 2F7AA 4ZEIA 4N6KA 3K02A 1JEVA 5TPAA 3K6WA 1PEBA 1UTBA 4N81A 5KDTB 4U2RA 1MXZA 2WBBA 3FXUA 1URDA 4C0RA 1K9ZA 4GL0A 5F1QA 1JW1A 4O3AA 2HFBA 2Y7RA 1MY0A 2RF1A 1NV1A 4IO2A 1USYH 4FORA 4OVTA 4P56A 5DVJA 1NV4A 3T96B 1B4ZA 4HE0A 4OZ9A 4WEPA 3I5OA 1FJ9A 3LSWA 1PB8A 1UQWA 1YYZA 2P3NA 3L6GA 4PFIA 4NF8A 3TAJA 3IOWA 5J16A 4OETA 3V8XB 1R9LA 1JQFA 4YB6A 3T22A 1US5A 4TQUQ 2XXRA 4P1EA 4IO4A 4FIMA 3QK6A 5CMCA 1EU8A 5EQAA 3KSXA 1UIUA 4LUBA 4UACA 3UA8A 1H76A 1FPJA 4YMAA 2X7QA 4BDOA 2V3TA 3LUZA 2Y5LA 4ELRA 4R74A 2XXWA 1B2HA 2YJPA 2REGA 1B3EA 3OSRA 5AA3A 4G4PA 1AWBA 3IOUA 1FTLA 3R6UA 3HFUA 2P2AA 3T9VA 3TFLA 3O29A 4PF8A 3DP6A 5CBSA 5EYHA 5H8NB 2VPOA 3ISPA 1BIYA 4GX6A 2R71A 5A5XA 4POWA 1FBHA 1IITA 5CI5A 3ILUB 1FPFA 4KQPA 4YKIA 1VFDA 2XWVA 3SEVA 1Y1ZA 2QS1A 3MZ9A 3V83A 2RC7A 3ROJA 3NOHA 3DP8A 2RKMA 3LSXA 1JW4A 1FBDA 4P11A 4ESWA 2CZKA 1H3DA 2F78A 3PPOA 2OBGA 2I3VA 2CZIA 4RY1A 1IMDA 4R9GA 3IR1A 2BJJX 3JV9A 4PP0A 3O6IA 3KOTA 4PDDA 3B7DA 4PFYA 2FIXA 3VVDA 3M3LA 2GHBA 4KCDA 1TFAA 2THIA 1JNFA 2REJA 1LBZA 3T9XB 2Y7PA 1JVXA 2OZZA 4AS5A 4KHZE 3T93B 4UA8A 2QPQA 2PVUA 5I57B 3I6VA 5H8QB 2QVRA 3E4RA 3EHSA 1A54A 3DLNA 3MC2A 3VVEA 2DE3A 3HO7A 4GXAA 1I69A 3FJMA 4KFQA 4IO5A 1ATGA 5I2KA 3MWBA 4PGNA 4GBWA 4EDPA 5CBRA 4I8CA 1MM7A 4JWXA 4QSDA 5AA4B 1B3GA 3G3FA 1NNFA 3TTMA 4ZE9A 3OMBA 4GRKA 1B3LA 1MS7A 1MH3A 3Q28A 4G68B 4OVSA 3PD8A 4P47A 3C32A 3VFJA 4KCCA 4MLVA 2XX8A 4EXLA 1YCJA 1H45A 4QFPA 5KCJA 3VLWA 2O6AA 2M8CA 3G3JA 3RUMA 1FPIA 1TWYA 4X04A 4GWOA 1NNKA 5M2VA 4HCWA 5IZ3B 1S9TA 4LZ8A 1A7LA 4YICA 4LATA 1NUZA 2Z23A 3PMVA 2P0SA 2NUVA 1B32A 4PDHA 4XIGQ 4PETA 4PE3A 3CSGA 3PPQA 4OFOA 3EHTA 1QW0A 1FTMA 1I6BA 4EUOA 1UIVA 3TTRA 4NF5A 1RDZA 4R72A 1FTKA 3K01A 2F5XA 4GWSA 3C35A 4OVRA 4ESXA 4PBHA 3OEKA 2HQ0A 3TUSA 3RN8A 2DS9A 4OFJA 4DXUA 3DM0A 2QMWA 4X9TA 1IXCA 4U22A 2KQZA 2I3WA 3P7IA 1VE4A 4OEUA 4NX1A 5I7IA 1OVTA 3VLUA 5IKBA 3T0JA 1MRPA 4MAGA 1LCFA 1SI0A 3O6GA 3QXMA 1GGGA 5ESYA 2Q8JA 1D9QA 4ELOA 4U4SA 3RNNA 1TFDA 1SD3A 4PFWA 1FPLA 4U1ZA 5DTBA 2HXWA 1XC1A 1NFTA 1D9VA 3IFAA 4NF6A 3LBSA 1MDP1 4ND9A 5H8FA 3N6UA 1DSNA 2QVVA 3IB0A 3JZJA 1XI6A 3U94A 5ITOA 4G8HA 4F19A 3N5LA 4GD5A 4RYAA 4HCYA 4DCYA 1Q1KA 3FIRA 5LTCA 3RTWB 4E0WA 3RPWA 4YB7A 3EF7A 4U21A 3TZAA 2OLBA 1M5EA 2Q2AA 4X8RA 3KN8A 4IGTA 3HSTA 4N6PA 2PYYA 2ZNUA 5I3SA 2RC9A 1YPNA 1QJMA 4P3LA 2XXUA 3FATA 3C33A 3K2DA 2UVJA 4LN5A 3FVGA 2DYXA 1WVJA 3N26A 1MH4A 3OO7A 3K1MA 4ZDMA 2Q9TA 3KJ7A 2ZNSA 3C36A 3W9WA 1M5DA 3OXNA 5JTYB 2Q89A 2G29A 1UTHB 3N6TA 1MDQA 5TP9B 3U72A 1II5A 2DDKA 4JDFA 4PFTA 2IEEA 1VFEA 1XS5A 3CVGA 4G68C 1O64A 3U1OA 1FQBA 4R6HA 3H6WA 1O7TA 2Y7IA 4MFIA 3DELB 1NUWA 2F7CA 2O1LA 5IZ1A 4GOTA 3VXCA 1N3WA 3S9LC 1MQHA 4MIJA 1DK4A 3HHFA 3PPPA 4DI3D 1A8EA 2F97A 2O69A 4JBZA 1QUIA 1N76A 5DEXA 4H65A 1EYJA 3QSLA 5ET6A 2UXAA 4GFRA 2W7YA 1US4A 2ZYMA 1FPBA 4N13A 3RTFB 1LB9A 1QUKA 3MSTA 5TPAB 2V84A 1UTBB 3B8BA 5EYGA 3VDFA 3IX1A 1HSJA 3ZS6A 1DCUA 1D3KA 3GBBA 5LDZA 3TDJA 4AB5A 1P1QA 4EF1A 2I6EA 1LSTA 1EZPA 4WXJA 1FPDA 3S4UA 4PBQA 1IMEA 4RA1A 4BDNA 2XXTA 1MQDA 1Q35A 2LAOA 1B0HA 2RCBA 3G3IA 3C4MA 2XXXA 4YMBA 5AE4A 3IL1B 2FHYA 3TODA 1NH7A 1POTA 2VPNA 3H6TA 3H4ZA 4X1BA 3VLVA 5CRYA 3HHGA 2XWKA 4NF8B 5CM6A 3MJNA 1NV3A 1PBPA 3A29A 4DCXA 4H1XA 2GQ1A 4ZS9A 2VP1A 4N17A 4NG7A 1S7YA 2G93A 4Q8RA 2ZMBA 2DVCA 1YXIA 2VHAA 3DP4A 2OK2A 3KGCA 1A99A 4IY5A 3USDA 3IO4A 3UIFA 1OMPA 2X7PA 4N4UA 2PX1A 1LFHA 4G77A 4GX3A 1BTJA 1P99A 4GF8A 4U23A 4JB7A 5DVFA 1RYXA 1FSAA 1NNTA 1RYOA 2NXOA 1N04A 3MVXA 1ZBMA 2DP8A 3TQLA 4OESA 4N8YA 4XF5A 1OQHA 3RLFE 1IXGA 4NE4A 3E13X 2QVUA 4PF6A 1ZMGA 5A5XB 5HBCA 4XKRA 1SQYA 4KD5A 4F39A 4RK2A 4R2BA 2I4BA 2O7IA 3G3HA 4JVIA 5I2NA 1P1WA 3VVFA 1NV6A 4KYSA 2AYSA 1P1NA 4FBPA 3C31A 1GR2A 2FVZA 3D4CA 5FBPA 2Y84A 4QFKA 1AOVA 4NMYA 4OHNA 4F3BA 3M3FA 4I3EA 4F2OA 4F2QA 4NF4A 2QMXA 1SYIA 2VD3A 4ZEDA 4HE1A 2R6GE 3KC1A 5BWJA 2YLNA 4FE8A 1BLFA 3R7XA 3KC0A 4OEVA 1EYIA 3PD9A 2UVGA 2GFEA 4X1DA 4RPOA 1PC3A 2NVUB 4QRZA 4TLMB 3E79A 3N94A 4OVPA 4NGUA 3SDFA 3PUVE 4I40A 1B9JA 4PC9A 3U8QA 2JJKA 1VSOA 3PGFA 3U93A 4JXIA 4EXKA 2WYPA 1URGA 1LEVA 2DVZA 2X26A 4H45A 4FEDA 1B51A 3CFLA 5I2KB 1AL3A 3GYYA 1DMBA 1B3HA 1B58A 2GHAA 2WYKA 3E9XA 1OQGA 4U4XA 4OTEA 4P0GA 1EZOA 1Y3QA 3E3KA 2RINA 3LSLA 1VDWA 5KCJB 5IGAA 1TXFA 2ANJA 1ANFA 3M8UA 1MQIA 2HAVA 4F18A 3RYDA 3TKDA 2XHDA 2O51A 1LAFE 3MW0A 4F22A 1TT1A 2PT2A 3SKPA 1HSLA 2UVIA 2O1MA 2O7UA 1VR5A 3FVKA 1NH8A 3K6VA 2H5YA 5EHMA 4MNCA 3B6TA 4MNPA 5HM4B 3Q29A 1B7HA 2KR0A 1URSA 2DXRA 1Y3NA 2RCAA 4QXDA 4NF5B 4NWDA 3D1RA 4BDLA 4OMBA
chains in the Genus database with same CATH topology
4P1LA 2PCRA 3E78A 3IFAA 2FBPA 2V3QA 1NV0A 4MHFA 2DE4A 2CEYA 1FBPA 1FPEA 1IMCA 2QVVA 2DE2A 1XI6A 4MEVA 1FRPA 1QGXA 4F19A 4KXPA 4HCYA 1FBEA 3T1BA 5LTCA 4GWZA 2ZZVA 4N91A 2Y5KA 3BIHA 4X8RA 2L5VA 2OX3A 4M1VA 4PFRA 4PAKA 5I3SA 3EKIA 4P3LA 4IR8A 4MCOA 2WBDA 4LN5A 2HPGA 4NHBA 4OA4A 2Q9TA 5ET8A 3W9WA 4F1UA 3IFCA 5EQ7A 4GWXA 2F3DA 1IMBA 4N6KA 2WX9A 1INPA 4N81A 1CNQA 2DDKA 2WBBA 4N15A 1RDXA 4GWWA 1K9ZA 4NF0A 1NV1A 4AS4A 4OVTA 1NUWA 4I3YA 4P56A 1NV4A 5IZ1A 2XWOA 4HE0A 1NI9A 4DI4B 4MIJA 4HE2A 1DK4A 1FJ9A 4DI3D 1YYZA 2P3NA 2Q74A 4N8GA 4PFIA 1EYJA 5ET6A 5DW8A 2P3VA 1FPBA 5J16A 5I5PA 5ET7A 3MSTA 5EQ9A 4GX4A 3B8BA 4NAPA 4MJOA 5EYGA 5IM2A 2HZLA 4P1EA 1DCUA 4PTKA 3PTYA 1FPGA 5LDZA 5EQAA 3B50A 1EYKA 1LBWA 1FPJA 2B4MA 1FPDA 1K9YA 4PBQA 1IMEA 3LUZA 4PAFA 2Y5LA 4GBVA 3SZPA 2BJIA 1G0IA 2FHYA 1LBVA 1AWBA 2VPNA 1BK4A 3HFUA 2CZHA 4PF8A 2XWKA 1NV7A 3U65A 5CM6A 4MNIA 5EYHA 1NV3A 2VPOA 3A29A 3ISPA 4GX6A 2GQ1A 4N17A 1FBHA 4NG7A 1FPFA 2XWVA 4JVCA 1KA1A 1YXIA 4GWYA 3ROJA 1YZ0A 3NOHA 5F24A 4N4UA 1FBDA 4GWUA 1LBYA 4GX3A 2CZKA 4MX6A 1FSAA 2CZIA 1IMDA 2HZKA 3BIGA 1NV2A 5T3JA 2CEXA 4YZZA 2F3BA 4PDDA 2OWZA 4N8YA 4XF5A 2FIXA 4F1VA 2HHMA 4NQ8A 2QVUA 4JVDA 4O7MA 4PF6A 2V4CA 1LBZA 1KA0A 4H46A 4AS5A 1FTAA 1RDYA 2ZZXA 2QPQA 5IZ3A 4PCDA 1DBZA 4JVIA 3MYUA 1NV6A 2QVRA 4FBPA 2FVZA 5IZZA 2DE3A 5FBPA 5EQ8A 1FBFA 4I3EA 4PGNA 2PFYA 4GBWA 4O94A 2FIEA 2HXRA 4P8BA 4HE1A 2R8TA 3KBZA 1Q9DA 3KC1A 4XFEA 4OANA 1FBCA 4OVSA 1FPKA 4P47A 3KC0A 3W9VA 4UABA 1EYIA 3FBPA 1FPIA 2XWIA 3E79A 4X04A 4OVPA 2MKZA 4NGUA 3LV0A 4HCWA 4NN3A 5IZ3B 4I40A 4YICA 4PAIA 4MMPA 4PC9A 1NUZA 2JJKA 1NV5A 4O7IA 2WYPA 4HXVA 4PDHA 1LEVA 2DVZA 4H45A 1G0HA 4PETA 4PE3A 4O8MA 4QBAA 4N6DA 4XEQA 1KZ8A 3RPLA 5J1DA 1IMAA 3GYYA 2WYKA 1SPIA 4G61A 2XA5A 5A5LA 2ZZWA 1RDZA 5ET5A 2F5XA 1NUYA 1IMFA 4GWSA 4OVRA 1VDWA 4PBHA 5IGAA 1NUXA 1JP4A 4OVQA 4F18A 3RYDA 4X9TA 1FBGA 2KQZA 4P9KA 4PFBA 5JK4A 3CHGA 4NX1A 3QMFA 5I7IA 3T0JA 2WEFA 4MAGA 5ESYA 2VT5A 4MNCA 4MNPA 3RPLB 2Q8MA 1FJ6A 2PFZA 1D9QA 2KR0A 2QFLA 3FXBA 2B4LA 4QXDA 4PGPA 1LBXA 1FPLA 3D1RA 2XXKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MKZ A;  2KR0 A;  2KQZ A;  2L5V A; 
#chains in the Genus database with same CATH topology
 3RT6 B;  4P1L A;  2PCR A;  1LFI A;  5AA2 A;  3KN3 A;  3E78 A;  3QYT A;  1PB9 A;  2FBP A;  1M5B A;  2DOJ A;  4DXC A;  4MHF A;  2DE4 A;  2O68 A;  1FPE A;  3FVN A;  2OWT A;  4HS7 A;  4LZ5 A;  4ZZE A;  1FQD A;  3LC8 A;  3IB1 A;  1GVC A;  1QGX A;  1YTV A;  2ABH A;  3IAZ A;  3QUJ A;  4FEC A;  5JEI A;  1FBE A;  1FTJ A;  3G3K A;  1B52 A;  1JEU A;  2Y5K A;  2V3U A;  3Q26 A;  1QKB A;  1J1N A;  3KN7 A;  1N0T A;  2OX3 A;  4R2F A;  3FZV A;  5CC2 A;  4PFR A;  1R6Z A;  2ONK E;  4PAK A;  5H8H A;  3PUZ E;  3MP8 A;  3G3G A;  3K4U A;  3ILT B;  5L8D A;  3KJT A;  4F3P A;  2HCA A;  3KEI A;  3ECR A;  2WBD A;  4BLA A;  3TCG A;  4NHB A;  4NF6 B;  2F8D A;  3FUZ A;  1N84 A;  4GIZ A;  1Y1M A;  2FA7 A;  5H8F B;  3ONM A;  4ECF A;  3TMG A;  1LAH E;  1EH3 A;  2F3D A;  3FAS A;  3OOA A;  3CSB A;  3FV2 A;  3AXF A;  3GZG A;  1INP A;  1MQG A;  3R26 A;  1CNQ A;  1MPD A;  2D21 A;  3MP1 A;  5L9O A;  4RK9 A;  3S9N C;  4N15 A;  4JSO A;  4NF0 A;  1BP5 A;  4H8I A;  5EHS A;  4MH5 A;  4AS4 A;  4POX A;  1ZJL A;  4I3Y A;  3O6H A;  4K3F A;  3KBR A;  4JWO A;  4YKP A;  2OJT A;  5CMB A;  3FGS A;  1NI9 A;  1I6A A;  1IZ1 A;  1QUL A;  3S9M C;  4YKK A;  5BUU A;  1SW4 A;  4WKM A;  1IUD A;  3ZKL A;  2XXQ A;  4G8M A;  5DW8 A;  3PU5 A;  3RT8 A;  1M5F A;  1MQJ A;  4MLQ A;  1SDX A;  3A3C A;  4BDQ A;  2DSF A;  1FQA A;  3RY3 A;  5ET7 A;  1N7W A;  2KLF A;  4GX4 A;  4TLL B;  1MG1 A;  3QAX A;  2XD2 A;  1XHY A;  4NAP A;  4MJO A;  1B5H A;  4XKN A;  2HZL A;  1A40 A;  3OO8 A;  3PPN A;  4IO7 A;  4PTK A;  1FPG A;  5ITP A;  3HN0 A;  2Y7W A;  4HTG A;  1EYK A;  1LBW A;  3MPK A;  2B4M A;  5ICT A;  4QHQ A;  1CE2 A;  1B3F A;  3UK4 A;  5I58 B;  4ONY A;  4GBV A;  2BJI A;  1OLC A;  1LBV A;  4I62 A;  2ZYK A;  3FVO A;  1BK4 A;  4DIG A;  2NOO A;  3BKI B;  4DDD A;  5DEX B;  1NV7 A;  3MZB A;  3O66 A;  4MNI A;  4QFL A;  3CG1 A;  3F11 A;  4Q5T A;  4H67 A;  5ELV A;  1AH5 A;  3A09 A;  2DWA A;  2R9J A;  1KA1 A;  3EHU A;  2V25 A;  3GXA A;  3QIM A;  4O3B A;  1DTG A;  3SEY A;  5KZT A;  1JET A;  3MAM A;  5F24 A;  3K00 A;  1LAG E;  3MUQ A;  1M5C A;  4H5F A;  1D4N A;  2ESN A;  4GWU A;  4HW8 A;  1LBY A;  2H98 A;  3M3K A;  5B7D A;  4F3G A;  4XKP A;  4LQ5 A;  2HZK A;  3BIG A;  3H7M A;  1NV2 A;  5T3J A;  4YZZ A;  1LBC A;  4Z7E A;  4F29 A;  1OIB A;  3PMX A;  3IJX B;  2XXH A;  3PUX E;  5K2X A;  1B05 A;  2HHM A;  2XXI A;  4NQ8 A;  4O7M A;  4DXB A;  1KA0 A;  4MF3 A;  1FTA A;  4DZ1 A;  2XD3 A;  3GLB A;  4G8N A;  3FJG A;  1NMU A;  1CB6 A;  2D5W A;  3KSJ A;  3PV0 E;  1Y3P A;  4PCD A;  1B0L A;  3UN6 A;  1QUJ A;  1SW5 A;  3IB2 A;  2Y7K A;  5EQ8 A;  2XXY A;  1MY1 A;  1FBF A;  3TCH A;  3CI8 A;  4RNS A;  4FAT A;  4O94 A;  3K6U A;  2FIE A;  1MXY A;  3TYH A;  4C1U A;  2HXR A;  1LFG A;  2ONS A;  3IOT A;  4IO6 A;  2ZYO A;  1T0K A;  3BFT A;  4FJP A;  3W9V A;  3FBP A;  1FTO A;  1B1H A;  2E1S A;  3CFX A;  2XWI A;  3ZSF A;  2QS3 A;  1MY2 A;  2H99 A;  1XVY A;  3H3G A;  2MKZ A;  3H6U A;  3LV0 A;  4LA9 A;  4NN3 A;  2UYE A;  5I2N B;  1USY E;  4PAI A;  3ODB A;  3V5A A;  4NED A;  1NV5 A;  3KZG A;  3MBP A;  4O7I A;  1OLA A;  4HXV A;  1Z7N E;  3VXB A;  4ELQ A;  1G0H A;  4QBA A;  2I0B A;  1H43 A;  1FQE A;  4XEQ A;  3RPL A;  5J1D A;  1RKM A;  2HAU A;  4G2Z A;  3BBR A;  1SPI A;  4G61 A;  4NF4 B;  1QKA A;  2A5S A;  3OO9 A;  1XT8 A;  5A5L A;  5I56 A;  5ET5 A;  3C9H A;  2A5T A;  1IMF A;  4QFO A;  3C34 A;  3SEU A;  1MY4 A;  1IXH A;  2XX7 A;  3MVZ A;  1JP4 A;  3O9P A;  3IOR A;  2I49 A;  5LOM A;  2F34 A;  3MQ9 A;  2AL5 A;  1FBG A;  4P9K A;  1N7X A;  4PFB A;  1B46 A;  5ICQ A;  5AA1 A;  3CHG A;  3A3U A;  3B6W A;  2WEF A;  1D9Y A;  3H06 B;  4ELP A;  2WKY A;  1FJ6 A;  2PFZ A;  3T9H B;  5I84 A;  3FXB A;  2B4L A;  4GXS B;  4PGP A;  4IB2 A;  3EN3 A;  5FTI A;  1JW5 A;  1LBX A;  4JWY A;  3TTN A;  2YPN A;  1DOT A;  1AIV A;  3HV1 A;  3BFU A;  4ZE8 A;  2VOZ A;  1MPB A;  1NV0 A;  1NL5 A;  4R73 A;  1FBP A;  4KYE A;  5F7V A;  1IMC A;  5I59 A;  2Z8E A;  3SEW A;  5AA2 D;  1FRP A;  2GRV A;  3EQ1 A;  1B6H A;  1B5J A;  5KDT A;  3FXR A;  5DYH A;  1EZ9 A;  1IEJ A;  2DQV A;  1LAX A;  4GWZ A;  2ZZV A;  4N91 A;  1Y9U A;  2DXY A;  3PUY E;  4F1Y A;  1A55 A;  1MXW A;  3W15 C;  2H9B A;  3EKI A;  1SW2 A;  1N3X A;  2AIX A;  3TPA A;  4IR8 A;  3RGY A;  1O63 A;  3OO6 A;  4MCO A;  4EQ9 A;  4RJZ A;  5AA2 B;  4OA4 A;  1PBQ A;  4H8J A;  4ZEB A;  4QFN A;  4LVQ A;  3KOS A;  3OEN A;  3VE1 B;  5ET8 A;  3WAE A;  3CR9 A;  4XKQ A;  1IMB A;  2DWH A;  4I9D A;  1GV8 A;  4EQ7 A;  2D3I A;  1R9Q A;  3H6V A;  1S50 A;  3TCF A;  2WX9 A;  3LUY A;  3FV1 A;  3Q25 A;  4ZEK A;  5CMK A;  4BDM A;  4YB5 A;  1B40 A;  2F35 A;  2OCU A;  3OD7 A;  2XXV A;  1RDX A;  2GH9 A;  4GWW A;  4ZEC A;  2B65 A;  4R6K A;  4LON B;  4ZEF A;  4JSD A;  2Z8F A;  1P1O A;  5H8H B;  2UVH A;  2XX9 A;  1MXX A;  2XWO A;  2H25 A;  3KG2 A;  4EQB A;  4WED A;  5CMM A;  4DI4 B;  4HE2 A;  3FJ7 A;  1R1N A;  4THI A;  3TEL A;  2Q74 A;  4N8G A;  2NWJ A;  5H8N A;  3S2V A;  3K6X A;  4GLI A;  2P3V A;  2F36 A;  3B6Q A;  3WAF A;  5I5P A;  3PUW E;  5EQ9 A;  5ISU A;  3O28 A;  4OXV A;  1DPP A;  5IM2 A;  2HEU A;  1OVB A;  2VGQ A;  4XTC Q;  1IQ7 A;  2ZYN A;  3PTY A;  4ISU A;  1I6Q A;  3B50 A;  4H6D A;  1DTZ A;  2E0S A;  1DPE A;  5FHO A;  1PB7 A;  1K9Y A;  5EYF A;  1B1X A;  4KR5 A;  4PAF A;  3SZP A;  2CMO A;  1G0I A;  4OEN A;  2B3F A;  1Y20 A;  4R75 A;  4X48 A;  1SW1 A;  3MVW A;  2CZH A;  4TOZ A;  3FD3 A;  3U65 A;  1XVX A;  1ZTY A;  1SI1 A;  3SES A;  1H44 A;  4QF9 A;  3PPR A;  2PBW A;  4C1T A;  4JVC A;  3S9E A;  2F7B A;  1MXV A;  4GWY A;  2XXP A;  1LBB A;  4KI0 E;  5I57 A;  5IAI A;  4IO3 A;  1YZ0 A;  1MY3 A;  3HPI A;  3CFZ A;  5H8Q A;  4ZZA A;  4OER A;  2V93 A;  2I58 A;  1SBP A;  4YAH X;  4OQO A;  4KYD A;  3O2A A;  3SEX A;  2FNC A;  1ZIU A;  2AL4 A;  4MX6 A;  4H5G A;  3QUF A;  4NTL A;  4AB6 A;  1NNP A;  3TTK A;  3LSF B;  4Q0C A;  1SVX B;  1AMF A;  4PE5 B;  5DVI A;  5AA4 A;  2CEX A;  2F3B A;  4OYV A;  2OWZ A;  4G68 A;  1PDA A;  2PMS A;  2DWI A;  3TQW A;  4F1V A;  2ZNT A;  4JVD A;  2V4C A;  2IA4 A;  4Q30 B;  3CIJ A;  1LB8 A;  2ZXT A;  4H46 A;  3KFM A;  3THI A;  1MM6 A;  1RDY A;  2ZZX A;  4DE8 A;  2ONR A;  5TU0 A;  5IZ3 A;  2Q2C A;  5L9M A;  1DBZ A;  3D4G A;  4E0X A;  3MYU A;  4F3S A;  1A8F A;  2I4C A;  1YAE A;  1XOC A;  5IZZ A;  5B70 A;  3K1P A;  4EF2 A;  2PFY A;  1FQF A;  3SER A;  2QSX A;  3CRB A;  3UGW A;  2ALU A;  4PFU A;  1JVY A;  3K0V A;  2CZL A;  4FEB A;  4P8B A;  4P0I A;  4NWC A;  1ZLQ A;  2R8T A;  3KBZ A;  1Q9D A;  1MPC A;  2UYF A;  4R9F A;  4XFE A;  5H8S A;  4OAN A;  1FBC A;  1KWH A;  1FPK A;  1POY 1;  1QVS A;  4UAB A;  1B4H A;  2I48 A;  1Z7M E;  4LP2 B;  1LCT A;  4Z0I A;  5FHM A;  4DLD A;  2H4I A;  3K1N A;  2QL3 A;  1ELJ A;  3SET A;  3H03 A;  4MMP A;  3T66 A;  2O84 X;  1MXU A;  3GBA A;  4MBP A;  4OWD A;  3MPL A;  4RPN A;  4OFL A;  1GTK A;  3LR1 A;  3OSQ A;  4O8M A;  4N6D A;  4LZ7 A;  3EPE A;  2Z22 A;  1KZ8 A;  3IJO B;  1P1U A;  5FTH A;  1IIW A;  1IMA A;  1B7U A;  4I1D A;  3O97 A;  2XA5 A;  2ZZW A;  4YKJ A;  3VV5 A;  1NUY A;  5DT6 A;  3HCQ A;  5K2Y A;  4O3C A;  4IY6 A;  4L17 A;  5FHN A;  2RC8 A;  4PQJ A;  1NUX A;  3IOV A;  1IXI A;  3TEP A;  4OVQ A;  3IO6 A;  2P1S A;  3ZKK A;  1B7Z A;  1Y4T A;  5JK4 A;  1LGB C;  1ZKB A;  1F9B A;  3FXQ A;  5HPQ A;  3QMF A;  2DWJ A;  4GL8 A;  1NKX A;  1L5T A;  5I58 A;  2VT5 A;  3RPL B;  1FQC A;  2Q8M A;  1B5I A;  2QFL A;  3IK6 B;  3L6H A;  4GVO A;  4BDR A;  3MVY A;  2QS4 A;  1HSE A;  3G7W A;  3UOR A;  5I56 B;  2XXK A;  1SYH A;  3OEM A;  1FCK A;  4YU0 A;  2A5T B;  2F6G A;  3T9U A;  4OVJ A;  4N07 A;  2V3Q A;  4GQO A;  4LQ2 A;  3PMW A;  3CG3 A;  3MZ1 A;  2CEY A;  1LLS A;  3OEL A;  3Q27 A;  2DE2 A;  1ZU0 A;  5JTY A;  4R6Y A;  4AQ4 A;  3JYR A;  1UTH A;  4RXL A;  4MEV A;  2Z8D A;  1WDN A;  5TP9 A;  2QRY A;  4KXP A;  3T1B A;  3UP9 A;  4QSC A;  1BKA A;  3BIH A;  4XXU A;  2B3B A;  5L9S A;  3I3V A;  2I0C A;  2L5V A;  4M1V A;  4H0W A;  4U1O A;  3V89 B;  2OWS A;  3TTL A;  2F6P A;  2Q88 A;  2VD2 A;  2HPG A;  1Y4C A;  2QS2 A;  4KPT A;  3MP6 A;  1WOD A;  4F31 B;  4IGR A;  4QSE A;  2QJE A;  3U92 A;  1FW0 A;  3RQT A;  4FAJ A;  4F1U A;  2FYI A;  3IFC A;  5EQ7 A;  4GWX A;  5I59 B;  4M4G A;  2PT1 A;  2F7A A;  4ZEI A;  4N6K A;  3K02 A;  1JEV A;  5TPA A;  3K6W A;  1PEB A;  1UTB A;  4N81 A;  5KDT B;  4U2R A;  1MXZ A;  2WBB A;  3FXU A;  1URD A;  4C0R A;  1K9Z A;  4GL0 A;  5F1Q A;  1JW1 A;  4O3A A;  2HFB A;  2Y7R A;  1MY0 A;  2RF1 A;  1NV1 A;  4IO2 A;  1USY H;  4FOR A;  4OVT A;  4P56 A;  5DVJ A;  1NV4 A;  3T96 B;  1B4Z A;  4HE0 A;  4OZ9 A;  4WEP A;  3I5O A;  1FJ9 A;  3LSW A;  1PB8 A;  1UQW A;  1YYZ A;  2P3N A;  3L6G A;  4PFI A;  4NF8 A;  3TAJ A;  3IOW A;  5J16 A;  4OET A;  3V8X B;  1R9L A;  1JQF A;  4YB6 A;  3T22 A;  1US5 A;  4TQU Q;  2XXR A;  4P1E A;  4IO4 A;  4FIM A;  3QK6 A;  5CMC A;  1EU8 A;  5EQA A;  3KSX A;  1UIU A;  4LUB A;  4UAC A;  3UA8 A;  1H76 A;  1FPJ A;  4YMA A;  2X7Q A;  4BDO A;  2V3T A;  3LUZ A;  2Y5L A;  4ELR A;  4R74 A;  2XXW A;  1B2H A;  2YJP A;  2REG A;  1B3E A;  3OSR A;  5AA3 A;  4G4P A;  1AWB A;  3IOU A;  1FTL A;  3R6U A;  3HFU A;  2P2A A;  3T9V A;  3TFL A;  3O29 A;  4PF8 A;  3DP6 A;  5CBS A;  5EYH A;  5H8N B;  2VPO A;  3ISP A;  1BIY A;  4GX6 A;  2R71 A;  5A5X A;  4POW A;  1FBH A;  1IIT A;  5CI5 A;  3ILU B;  1FPF A;  4KQP A;  4YKI A;  1VFD A;  2XWV A;  3SEV A;  1Y1Z A;  2QS1 A;  3MZ9 A;  3V83 A;  2RC7 A;  3ROJ A;  3NOH A;  3DP8 A;  2RKM A;  3LSX A;  1JW4 A;  1FBD A;  4P11 A;  4ESW A;  2CZK A;  1H3D A;  2F78 A;  3PPO A;  2OBG A;  2I3V A;  2CZI A;  4RY1 A;  1IMD A;  4R9G A;  3IR1 A;  2BJJ X;  3JV9 A;  4PP0 A;  3O6I A;  3KOT A;  4PDD A;  3B7D A;  4PFY A;  2FIX A;  3VVD A;  3M3L A;  2GHB A;  4KCD A;  1TFA A;  2THI A;  1JNF A;  2REJ A;  1LBZ A;  3T9X B;  2Y7P A;  1JVX A;  2OZZ A;  4AS5 A;  4KHZ E;  3T93 B;  4UA8 A;  2QPQ A;  2PVU A;  5I57 B;  3I6V A;  5H8Q B;  2QVR A;  3E4R A;  3EHS A;  1A54 A;  3DLN A;  3MC2 A;  3VVE A;  2DE3 A;  3HO7 A;  4GXA A;  1I69 A;  3FJM A;  4KFQ A;  4IO5 A;  1ATG A;  5I2K A;  3MWB A;  4PGN A;  4GBW A;  4EDP A;  5CBR A;  4I8C A;  1MM7 A;  4JWX A;  4QSD A;  5AA4 B;  1B3G A;  3G3F A;  1NNF A;  3TTM A;  4ZE9 A;  3OMB A;  4GRK A;  1B3L A;  1MS7 A;  1MH3 A;  3Q28 A;  4G68 B;  4OVS A;  3PD8 A;  4P47 A;  3C32 A;  3VFJ A;  4KCC A;  4MLV A;  2XX8 A;  4EXL A;  1YCJ A;  1H45 A;  4QFP A;  5KCJ A;  3VLW A;  2O6A A;  2M8C A;  3G3J A;  3RUM A;  1FPI A;  1TWY A;  4X04 A;  4GWO A;  1NNK A;  5M2V A;  4HCW A;  5IZ3 B;  1S9T A;  4LZ8 A;  1A7L A;  4YIC A;  4LAT A;  1NUZ A;  2Z23 A;  3PMV A;  2P0S A;  2NUV A;  1B32 A;  4PDH A;  4XIG Q;  4PET A;  4PE3 A;  3CSG A;  3PPQ A;  4OFO A;  3EHT A;  1QW0 A;  1FTM A;  1I6B A;  4EUO A;  1UIV A;  3TTR A;  4NF5 A;  1RDZ A;  4R72 A;  1FTK A;  3K01 A;  2F5X A;  4GWS A;  3C35 A;  4OVR A;  4ESX A;  4PBH A;  3OEK A;  2HQ0 A;  3TUS A;  3RN8 A;  2DS9 A;  4OFJ A;  4DXU A;  3DM0 A;  2QMW A;  4X9T A;  1IXC A;  4U22 A;  2KQZ A;  2I3W A;  3P7I A;  1VE4 A;  4OEU A;  4NX1 A;  5I7I A;  1OVT A;  3VLU A;  5IKB A;  3T0J A;  1MRP A;  4MAG A;  1LCF A;  1SI0 A;  3O6G A;  3QXM A;  1GGG A;  5ESY A;  2Q8J A;  1D9Q A;  4ELO A;  4U4S A;  3RNN A;  1TFD A;  1SD3 A;  4PFW A;  1FPL A;  4U1Z A;  5DTB A;  2HXW A;  1XC1 A;  1NFT A;  1D9V A;  3IFA A;  4NF6 A;  3LBS A;  1MDP 1;  4ND9 A;  5H8F A;  3N6U A;  1DSN A;  2QVV A;  3IB0 A;  3JZJ A;  1XI6 A;  3U94 A;  5ITO A;  4G8H A;  4F19 A;  3N5L A;  4GD5 A;  4RYA A;  4HCY A;  4DCY A;  1Q1K A;  3FIR A;  5LTC A;  3RTW B;  4E0W A;  3RPW A;  4YB7 A;  3EF7 A;  4U21 A;  3TZA A;  2OLB A;  1M5E A;  2Q2A A;  4X8R A;  3KN8 A;  4IGT A;  3HST A;  4N6P A;  2PYY A;  2ZNU A;  5I3S A;  2RC9 A;  1YPN A;  1QJM A;  4P3L A;  2XXU A;  3FAT A;  3C33 A;  3K2D A;  2UVJ A;  4LN5 A;  3FVG A;  2DYX A;  1WVJ A;  3N26 A;  1MH4 A;  3OO7 A;  3K1M A;  4ZDM A;  2Q9T A;  3KJ7 A;  2ZNS A;  3C36 A;  3W9W A;  1M5D A;  3OXN A;  5JTY B;  2Q89 A;  2G29 A;  1UTH B;  3N6T A;  1MDQ A;  5TP9 B;  3U72 A;  1II5 A;  2DDK A;  4JDF A;  4PFT A;  2IEE A;  1VFE A;  1XS5 A;  3CVG A;  4G68 C;  1O64 A;  3U1O A;  1FQB A;  4R6H A;  3H6W A;  1O7T A;  2Y7I A;  4MFI A;  3DEL B;  1NUW A;  2F7C A;  2O1L A;  5IZ1 A;  4GOT A;  3VXC A;  1N3W A;  3S9L C;  1MQH A;  4MIJ A;  1DK4 A;  3HHF A;  3PPP A;  4DI3 D;  1A8E A;  2F97 A;  2O69 A;  4JBZ A;  1QUI A;  1N76 A;  5DEX A;  4H65 A;  1EYJ A;  3QSL A;  5ET6 A;  2UXA A;  4GFR A;  2W7Y A;  1US4 A;  2ZYM A;  1FPB A;  4N13 A;  3RTF B;  1LB9 A;  1QUK A;  3MST A;  5TPA B;  2V84 A;  1UTB B;  3B8B A;  5EYG A;  3VDF A;  3IX1 A;  1HSJ A;  3ZS6 A;  1DCU A;  1D3K A;  3GBB A;  5LDZ A;  3TDJ A;  4AB5 A;  1P1Q A;  4EF1 A;  2I6E A;  1LST A;  1EZP A;  4WXJ A;  1FPD A;  3S4U A;  4PBQ A;  1IME A;  4RA1 A;  4BDN A;  2XXT A;  1MQD A;  1Q35 A;  2LAO A;  1B0H A;  2RCB A;  3G3I A;  3C4M A;  2XXX A;  4YMB A;  5AE4 A;  3IL1 B;  2FHY A;  3TOD A;  1NH7 A;  1POT A;  2VPN A;  3H6T A;  3H4Z A;  4X1B A;  3VLV A;  5CRY A;  3HHG A;  2XWK A;  4NF8 B;  5CM6 A;  3MJN A;  1NV3 A;  1PBP A;  3A29 A;  4DCX A;  4H1X A;  2GQ1 A;  4ZS9 A;  2VP1 A;  4N17 A;  4NG7 A;  1S7Y A;  2G93 A;  4Q8R A;  2ZMB A;  2DVC A;  1YXI A;  2VHA A;  3DP4 A;  2OK2 A;  3KGC A;  1A99 A;  4IY5 A;  3USD A;  3IO4 A;  3UIF A;  1OMP A;  2X7P A;  4N4U A;  2PX1 A;  1LFH A;  4G77 A;  4GX3 A;  1BTJ A;  1P99 A;  4GF8 A;  4U23 A;  4JB7 A;  5DVF A;  1RYX A;  1FSA A;  1NNT A;  1RYO A;  2NXO A;  1N04 A;  3MVX A;  1ZBM A;  2DP8 A;  3TQL A;  4OES A;  4N8Y A;  4XF5 A;  1OQH A;  3RLF E;  1IXG A;  4NE4 A;  3E13 X;  2QVU A;  4PF6 A;  1ZMG A;  5A5X B;  5HBC A;  4XKR A;  1SQY A;  4KD5 A;  4F39 A;  4RK2 A;  4R2B A;  2I4B A;  2O7I A;  3G3H A;  4JVI A;  5I2N A;  1P1W A;  3VVF A;  1NV6 A;  4KYS A;  2AYS A;  1P1N A;  4FBP A;  3C31 A;  1GR2 A;  2FVZ A;  3D4C A;  5FBP A;  2Y84 A;  4QFK A;  1AOV A;  4NMY A;  4OHN A;  4F3B A;  3M3F A;  4I3E A;  4F2O A;  4F2Q A;  4NF4 A;  2QMX A;  1SYI A;  2VD3 A;  4ZED A;  4HE1 A;  2R6G E;  3KC1 A;  5BWJ A;  2YLN A;  4FE8 A;  1BLF A;  3R7X A;  3KC0 A;  4OEV A;  1EYI A;  3PD9 A;  2UVG A;  2GFE A;  4X1D A;  4RPO A;  1PC3 A;  2NVU B;  4QRZ A;  4TLM B;  3E79 A;  3N94 A;  4OVP A;  4NGU A;  3SDF A;  3PUV E;  4I40 A;  1B9J A;  4PC9 A;  3U8Q A;  2JJK A;  1VSO A;  3PGF A;  3U93 A;  4JXI A;  4EXK A;  2WYP A;  1URG A;  1LEV A;  2DVZ A;  2X26 A;  4H45 A;  4FED A;  1B51 A;  3CFL A;  5I2K B;  1AL3 A;  3GYY A;  1DMB A;  1B3H A;  1B58 A;  2GHA A;  2WYK A;  3E9X A;  1OQG A;  4U4X A;  4OTE A;  4P0G A;  1EZO A;  1Y3Q A;  3E3K A;  2RIN A;  3LSL A;  1VDW A;  5KCJ B;  5IGA A;  1TXF A;  2ANJ A;  1ANF A;  3M8U A;  1MQI A;  2HAV A;  4F18 A;  3RYD A;  3TKD A;  2XHD A;  2O51 A;  1LAF E;  3MW0 A;  4F22 A;  1TT1 A;  2PT2 A;  3SKP A;  1HSL A;  2UVI A;  2O1M A;  2O7U A;  1VR5 A;  3FVK A;  1NH8 A;  3K6V A;  2H5Y A;  5EHM A;  4MNC A;  3B6T A;  4MNP A;  5HM4 B;  3Q29 A;  1B7H A;  2KR0 A;  1URS A;  2DXR A;  1Y3N A;  2RCA A;  4QXD A;  4NF5 B;  4NWD A;  3D1R A;  4BDL A;  4OMB A; 
#chains in the Genus database with same CATH homology
 4P1L A;  2PCR A;  3E78 A;  3IFA A;  2FBP A;  2V3Q A;  1NV0 A;  4MHF A;  2DE4 A;  2CEY A;  1FBP A;  1FPE A;  1IMC A;  2QVV A;  2DE2 A;  1XI6 A;  4MEV A;  1FRP A;  1QGX A;  4F19 A;  4KXP A;  4HCY A;  1FBE A;  3T1B A;  5LTC A;  4GWZ A;  2ZZV A;  4N91 A;  2Y5K A;  3BIH A;  4X8R A;  2L5V A;  2OX3 A;  4M1V A;  4PFR A;  4PAK A;  5I3S A;  3EKI A;  4P3L A;  4IR8 A;  4MCO A;  2WBD A;  4LN5 A;  2HPG A;  4NHB A;  4OA4 A;  2Q9T A;  5ET8 A;  3W9W A;  4F1U A;  3IFC A;  5EQ7 A;  4GWX A;  2F3D A;  1IMB A;  4N6K A;  2WX9 A;  1INP A;  4N81 A;  1CNQ A;  2DDK A;  2WBB A;  4N15 A;  1RDX A;  4GWW A;  1K9Z A;  4NF0 A;  1NV1 A;  4AS4 A;  4OVT A;  1NUW A;  4I3Y A;  4P56 A;  1NV4 A;  5IZ1 A;  2XWO A;  4HE0 A;  1NI9 A;  4DI4 B;  4MIJ A;  4HE2 A;  1DK4 A;  1FJ9 A;  4DI3 D;  1YYZ A;  2P3N A;  2Q74 A;  4N8G A;  4PFI A;  1EYJ A;  5ET6 A;  5DW8 A;  2P3V A;  1FPB A;  5J16 A;  5I5P A;  5ET7 A;  3MST A;  5EQ9 A;  4GX4 A;  3B8B A;  4NAP A;  4MJO A;  5EYG A;  5IM2 A;  2HZL A;  4P1E A;  1DCU A;  4PTK A;  3PTY A;  1FPG A;  5LDZ A;  5EQA A;  3B50 A;  1EYK A;  1LBW A;  1FPJ A;  2B4M A;  1FPD A;  1K9Y A;  4PBQ A;  1IME A;  3LUZ A;  4PAF A;  2Y5L A;  4GBV A;  3SZP A;  2BJI A;  1G0I A;  2FHY A;  1LBV A;  1AWB A;  2VPN A;  1BK4 A;  3HFU A;  2CZH A;  4PF8 A;  2XWK A;  1NV7 A;  3U65 A;  5CM6 A;  4MNI A;  5EYH A;  1NV3 A;  2VPO A;  3A29 A;  3ISP A;  4GX6 A;  2GQ1 A;  4N17 A;  1FBH A;  4NG7 A;  1FPF A;  2XWV A;  4JVC A;  1KA1 A;  1YXI A;  4GWY A;  3ROJ A;  1YZ0 A;  3NOH A;  5F24 A;  4N4U A;  1FBD A;  4GWU A;  1LBY A;  4GX3 A;  2CZK A;  4MX6 A;  1FSA A;  2CZI A;  1IMD A;  2HZK A;  3BIG A;  1NV2 A;  5T3J A;  2CEX A;  4YZZ A;  2F3B A;  4PDD A;  2OWZ A;  4N8Y A;  4XF5 A;  2FIX A;  4F1V A;  2HHM A;  4NQ8 A;  2QVU A;  4JVD A;  4O7M A;  4PF6 A;  2V4C A;  1LBZ A;  1KA0 A;  4H46 A;  4AS5 A;  1FTA A;  1RDY A;  2ZZX A;  2QPQ A;  5IZ3 A;  4PCD A;  1DBZ A;  4JVI A;  3MYU A;  1NV6 A;  2QVR A;  4FBP A;  2FVZ A;  5IZZ A;  2DE3 A;  5FBP A;  5EQ8 A;  1FBF A;  4I3E A;  4PGN A;  2PFY A;  4GBW A;  4O94 A;  2FIE A;  2HXR A;  4P8B A;  4HE1 A;  2R8T A;  3KBZ A;  1Q9D A;  3KC1 A;  4XFE A;  4OAN A;  1FBC A;  4OVS A;  1FPK A;  4P47 A;  3KC0 A;  3W9V A;  4UAB A;  1EYI A;  3FBP A;  1FPI A;  2XWI A;  3E79 A;  4X04 A;  4OVP A;  2MKZ A;  4NGU A;  3LV0 A;  4HCW A;  4NN3 A;  5IZ3 B;  4I40 A;  4YIC A;  4PAI A;  4MMP A;  4PC9 A;  1NUZ A;  2JJK A;  1NV5 A;  4O7I A;  2WYP A;  4HXV A;  4PDH A;  1LEV A;  2DVZ A;  4H45 A;  1G0H A;  4PET A;  4PE3 A;  4O8M A;  4QBA A;  4N6D A;  4XEQ A;  1KZ8 A;  3RPL A;  5J1D A;  1IMA A;  3GYY A;  2WYK A;  1SPI A;  4G61 A;  2XA5 A;  5A5L A;  2ZZW A;  1RDZ A;  5ET5 A;  2F5X A;  1NUY A;  1IMF A;  4GWS A;  4OVR A;  1VDW A;  4PBH A;  5IGA A;  1NUX A;  1JP4 A;  4OVQ A;  4F18 A;  3RYD A;  4X9T A;  1FBG A;  2KQZ A;  4P9K A;  4PFB A;  5JK4 A;  3CHG A;  4NX1 A;  3QMF A;  5I7I A;  3T0J A;  2WEF A;  4MAG A;  5ESY A;  2VT5 A;  4MNC A;  4MNP A;  3RPL B;  2Q8M A;  1FJ6 A;  2PFZ A;  1D9Q A;  2KR0 A;  2QFL A;  3FXB A;  2B4L A;  4QXD A;  4PGP A;  1LBX A;  1FPL A;  3D1R A;  2XXK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...