4EUOA

Structure of atu4243-gaba sensor
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
313
structure length
313
Chain Sequence
DLVFSSWGGTTQDAQKAAWAEKFMVETGINVLQDGPTDYGKLKAMVEANGVTWDVVDVEGDYAAQAGPKGLLEKLDFSVIDKTKLDPRFVTDYSVGSFYYSFVIGCNVDSVSACPKSWADLFDTAKFPGKRTFYKWSAPGVIEAALLADGVTADKLYPLDLDRAFKKLDTIKSDIIWWSGGAQSQQLIASAEAPFGSVWNGRMTALEQSGVKVETSWAQNITAADSLVVPKGTKNKDAAMKFIALATSAQAQADMATATGYAPVNIESAKLMDPKIAKSLPDQQTESQVNADMNYWAQHRDEIGERWYAWQAK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, substrate binding protein (Polyamine)
publication title Structural basis for selective GABA binding in bacterial pathogens.
pubmed doi rcsb
source organism Agrobacterium tumefaciens
total genus 114
structure length 313
sequence length 313
ec nomenclature
pdb deposition date 2012-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4euoA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4euoA01
1B0LA 1LB8A 3C32A 3IJXB 3K00A 3O28A 1MDP1 2UYEA 3B6TA 3IOUA 4XKQA 1FTLA 2ZYOA 1ZMGA 4TLMB 3VLUA 4POXA 1OQGA 3TTNA 3TFLA 2ZYMA 1Q35A 3OXNA 1B4HA 3PMVA 1B32A 2IEEA 4EQ9A 4EF2A 3D4CA 4OFOA 3O2AA 4JWOA 3OELA 3I6VA 2F5XA 3B7DA 3TQLA 4XKNA 5H8SA 1LGBC 3K6UA 3DP4A 2AIXA 4BLAA 2HZKA 1MM6A 4GOTA 1QKBA 2V3TA 4IGTA 4R2BA 4N07A 4YU0A 1XVXA 2I3VA 3K6VA 2H98A 1Q1KA 4AQ4A 1JVYA 4FJPA 3C4MA 3O9PA 5I56B 2X7QA 4BDQA 2VGQA 4BDMA 4AB5A 3FD3A 2RC9A 3OO8A 3H6TA 1P1WA 1LAFE 2V84A 4GL0A 4K3FA 4P11A 4GFRA 5FHOA 1YPNA 4JWXA 1SBPA 4F31B 4TLLB 2DE2A 3ILTB 2DP8A 1LFHA 1BIYA 4OQOA 4C0RA 5M2VA 1YTVA 1Z7ME 3ZKLA 2QRYA 3TUSA 3TQWA 3RPWA 3RUMA 3K2DA 4QFNA 4LVQA 3MQ9A 1NH8A 3LSFB 4OXVA 2D5WA 4GD5A 2OBGA 5JTYB 1QKAA 1MS7A 3TZAA 3GLBA 1MQDA 4HS7A 3KOSA 4YKIA 4OTEA 3H6WA 3PV0E 4H8JA 5TPAA 3T93B 2XX7A 4ZE8A 3FIRA 3THIA 4F22A 4QSCA 3QUJA 4OMBA 1TFAA 1FQCA 1O63A 4YMAA 2YJPA 2RF1A 3ZKKA 3OSRA 3K1MA 3QIMA 4MF3A 2QMXA 1J1NA 3OO6A 4EQ7A 3PU5A 1IEJA 4G4PA 1AH5A 4F29A 1JVXA 2O6AA 2FYIA 3N94A 4EXKA 3IL1B 4RPOA 3TTRA 2H9BA 2GH9A 3FJMA 2XXYA 3IAZA 4LA9A 3BFTA 1RYOA 3VFJA 1JW4A 4E0WA 2F8DA 3CG1A 4WEPA 2ABHA 5H8HB 2DWIA 2QPQA 2D3IA 1H76A 2LAOA 2O68A 4IO4A 1S7YA 4ZEIA 3DP8A 1FTJA 2R71A 3UN6A 2XXTA 3CG3A 3OSQA 3U92A 4ZEKA 3BKIB 3L6HA 5CC2A 2XXWA 4U1ZA 2DWJA 2QS4A 3S9NC 1SI0A 1SQYA 4YKJA 4F3PA 1UTBB 3KN8A 4IB2A 4RA1A 2V25A 1LAGE 5H8NB 4HCYA 3IB1A 3MPKA 4FEDA 3LBSA 1ZTYA 3M3FA 1MH3A 3SESA 1B1HA 3TYHA 2Q2CA 3FJ7A 4ZECA 4RJZA 4JDFA 3MJNA 3G7WA 2XD3A 3T9UA 2E0SA 4NF8A 4FEBA 1N7WA 3TELA 5HPQA 1S50A 5CMKA 2P1SA 3T22A 1URGA 3M3KA 2F7BA 2ZXTA 3QUFA 3H3GA 4E0XA 4JSDA 1ZLQA 5AA4A 1H44A 5B7DA 3MC2A 1B3GA 2UVJA 3ZSFA 3U1OA 4MH5A 5JK4A 1NNKA 3VLVA 4OERA 2Z23A 4Z7EA 4HTGA 1WDNA 3V8XB 3W9WA 1PB7A 1Z7NE 1AL3A 5AA2B 4YKKA 2Z8FA 4RNSA 3ILUB 3SKPA 1MQIA 5TP9A 1D9VA 5I2KA 4QFOA 1DSNA 4H8IA 2NWJA 2B3FA 3CR9A 4ELRA 2XXQA 1GV8A 3PMWA 1P99A 3MW0A 3T9XB 4DZ1A 1B2HA 3LSLA 4HCWA 1SW4A 3IR1A 1VFEA 3KEIA 2I4CA 1B3EA 1R9LA 4U21A 4UACA 4ZEFA 3TTLA 3E13X 2RCBA 2O51A 1H43A 3HN0A 3JV9A 4XKRA 3FXUA 4EF1A 3FJGA 3FVNA 1GTKA 1EZPA 4NF6B 3MAMA 2Y7WA 5AA2D 4RK9A 3KSXA 5HM4B 1WODA 5DEXA 1B5IA 3RT6B 4PFWA 3GBAA 3H03A 1A99A 1POTA 4R72A 2O1LA 2HAUA 4GQOA 4GRKA 3A09A 5CRYA 1PB8A 4NF4A 3Q28A 2PX1A 1B58A 1B7HA 1P1UA 2BJJX 1Y4CA 3PUYE 5H8QA 3R6UA 5F7VA 3USDA 2Q8JA 4H5FA 2V3UA 3E4RA 4NWCA 4LQ2A 1IXCA 3UGWA 3HV1A 2FNCA 2NVUB 4OENA 4ELQA 2DXRA 2H25A 1JEVA 3C9HA 1IQ7A 3U8QA 1MPDA 2ZYKA 1N3WA 4HW8A 4PFUA 3EHTA 3VXCA 2XXHA 4KCDA 2RKMA 2O1MA 1Y20A 4F2QA 4F3SA 3V83A 4DXBA 5I2NA 3F11A 3RTWB 4Q0CA 4KR5A 1EZ9A 3H4ZA 3RNNA 3VLWA 5TPAB 3OENA 1PDAA 1TWYA 4MLQA 3PPOA 1MQHA 3TTKA 3IB2A 2PBWA 4Q30B 1DTGA 4H65A 3IK6B 2OWTA 3PUVE 3HO7A 4R6KA 1B1XA 1UTHB 4MBPA 4DCXA 1IITA 5A5XB 2GFEA 2XXXA 3FASA 3PUWE 1MXVA 3FXRA 3QAXA 2QL3A 1QW0A 1US5A 2DQVA 5I84A 4M1VA 4U1OA 2I49A 1LSTA 4NMYA 5FHMA 4QSEA 4Q8RA 5EHSA 4N6PA 3SEYA 3IO4A 1D4NA 5DTBA 5IAIA 4IO7A 2RC7A 3T9HB 4G68C 3K0VA 1NL5A 3MP1A 2F35A 2F6GA 1ELJA 4JWYA 3K1NA 1LLSA 1XVYA 2Q9TA 4G68A 1MM7A 3UK4A 3HHGA 1VFDA 4LUBA 2VOZA 1OIBA 2A5TB 1NKXA 4KQPA 5LOMA 4ONYA 4GVOA 4IO6A 2HCAA 1XOCA 1MY1A 1N04A 5ITPA 1M5BA 2OZZA 3TKDA 3FV1A 2PMSA 5K2XA 3IX1A 3FVGA 5EYFA 2H5YA 3T96B 2ZNUA 3EQ1A 4WXJA 2UYFA 1LFIA 1EH3A 1SYIA 5B70A 2I3WA 1QUIA 4F19A 4FE8A 1SI1A 5ICTA 4THIA 4F1UA 1BP5A 5I58A 1O7TA 3OO7A 1B0HA 4ZS9A 4GXAA 3IO6A 2GHBA 3LC8A 3MVZA 1OMPA 1LAXA 3S4UA 1M5EA 1KWHA 1S9TA 1MY0A 4JXIA 4DCYA 1B5JA 1YCJA 4I9DA 4JB7A 2YLNA 4QFPA 4MFIA 4PP0A 2XXIA 4OFJA 3W15C 3O6HA 3DLNA 4OETA 1F9BA 1B3FA 1B3HA 1FQFA 3G3KA 2F34A 3KJTA 4KFQA 2O7UA 4AB6A 1P1NA 4ELOA 3D4GA 2DOJA 3FVKA 1Y3PA 3MVXA 2UVHA 1ZU0A 4F18A 4DLDA 2DSFA 1M5CA 3SEXA 3KGCA 3A3CA 3MVYA 3DELB 1AOVA 3MWBA 3S9EA 3U72A 4KYDA 4IY5A 2KLFA 4QHQA 1MY2A 4ZEDA 3RQTA 1VE4A 4GL8A 1FQEA 4YKPA 1HSLA 1A55A 4NTLA 2V3QA 5I56A 3LR1A 4F3GA 4ESXA 1P1OA 1JW5A 3FZVA 1LB9A 1OLCA 1URSA 4PQJA 4RXLA 1JETA 1MQGA 1EZOA 3VVDA 1DPEA 2QSXA 2RINA 3HPIA 1MY3A 4H6DA 5I59A 3U93A 3UORA 3VVEA 1VR5A 2RC8A 3LSXA 2VD3A 1P1QA 3TDJA 2ZNSA 4F3BA 4GIZA 1CE2A 1WVJA 3JYRA 1MH4A 1MPBA 1XT8A 3S9MC 4NF5B 5EHMA 1QJMA 3EHSA 3EPEA 4X9TA 4YB7A 4U4XA 5I57A 5JTYA 1BTJA 4IGRA 3FGSA 3CIJA 3MP8A 3CRBA 3LSWA 3PPPA 4NF4B 1IXGA 1SD3A 3MBPA 2I58A 4I1DA 4PETA 3O66A 4ELPA 2DE3A 4GXSB 4N13A 1NMUA 1USYH 2FA7A 5FTIA 1POY1 5J1DA 3U94A 4R9FA 4NE4A 3FVOA 5F1QA 4R6YA 5IKBA 4GF8A 2ZNTA 3AXFA 1N84A 4PFTA 2ONRA 4KD5A 2P2AA 3OMBA 2XXUA 1SVXB 2VD2A 2P0SA 3EN3A 1IXIA 2VP1A 4QRZA 3BFUA 1B9JA 2ESNA 4XIGQ 4R9GA 2REJA 3ZS6A 4TQUQ 2AL4A 3S2VA 5I2NB 3KSJA 1ZIUA 3TAJA 4OEUA 1LAHE 5H8HA 1GGGA 2WKYA 1FQDA 3FUZA 5L9SA 3C31A 4OVJA 2Z22A 2H4IA 4F2OA 1B46A 1BLFA 3WAEA 4R74A 4TOZA 1Y3NA 4DDDA 4PFYA 3IOTA 5CBRA 4NEDA 1B51A 1US4A 3QXMA 1Y1MA 1DPPA 1PBPA 4JBZA 4LZ7A 1QUKA 4C1UA 3SERA 4DE8A 4ESWA 5DVIA 3KG2A 5KCJA 2HAVA 4YICA 5CBSA 2QMWA 4LZ5A 2PT1A 2OK2A 4EXLA 5H8NA 1ZKBA 3M3LA 3MZ9A 1L5TA 4Z0IA 4QFKA 1YAEA 4IO5A 1I6AA 2F97A 2GHAA 1N7XA 3GZGA 2ZMBA 1M5FA 2AYSA 2THIA 2Y7RA 3MZBA 3RY3A 2V93A 4O3BA 2XX8A 1SDXA 4F1VA 1DMBA 1R6ZA 1AIVA 3MZ1A 4X48A 1MDQA 2F6PA 1VSOA 1NH7A 3MPLA 1B4ZA 1UIUA 1IUDA 2G93A 1HSEA 3K02A 4YB5A 2Y84A 3FXQA 4BDLA 3C36A 2Q89A 1RYXA 2XXVA 3C35A 4LATA 2DWHA 1UIVA 4GLIA 1OVBA 2XXRA 4GWOA 3N5LA 4LONB 1B5HA 1IZ1A 3EF7A 2DVZA 1XS5A 1N76A 3IJOB 2F36A 2O69A 3MUQA 2VHAA 1T0KA 2I0BA 4G8NA 1UQWA 1D9YA 4YAHX 3UA8A 5I58B 3H6UA 3O6IA 2AL5A 4F39A 3KJ7A 4H5GA 5H8FA 4EQBA 1NFTA 3TCHA 1DTZA 4QSDA 1MPCA 2OLBA 5AA2A 2XHDA 3N6UA 4G8MA 4BDNA 4QFLA 5KDTA 2HZLA 2CZLA 3CFZA 3H7MA 1ZJLA 5CI5A 1I6BA 4RYAA 2OJTA 4X1BA 3SEVA 2Y7KA 3VV5A 2XX9A 5BUUA 2YPNA 3T9VA 1LFGA 4KYSA 2CMOA 1GVCA 3L6GA 3PGFA 4KCCA 4XTCQ 2H99A 4OFLA 2GRVA 2PVUA 2QS2A 2QS3A 3RLFE 1SW5A 1H3DA 5CMMA 4PE5B 3PPRA 3P7IA 1MXWA 3RT8A 1EU8A 1LCFA 3DP6A 4G77A 3PPNA 4KPTA 2Q2AA 5JEIA 4NF6A 3CSGA 2B3BA 2Y7PA 3CSBA 2R6GE 1II5A 4OHNA 5HBCA 4I62A 2QS1A 3PMXA 5ISUA 4OZ9A 2HFBA 4IY6A 2X26A 3KN7A 3IOVA 4H67A 4YB6A 3TCFA 3C33A 1FTMA 4EUOA 4DXCA 5CMBA 3OEMA 3N26A 2A5SA 1LCTA 1M5DA 3GXAA 3Q27A 3K6XA 5DVJA 2Y7IA 1MXZA 3TCGA 1BKAA 1PC3A 5I59B 3K1PA 2UXAA 3KN3A 3VVFA 4ISUA 3PD8A 1B05A 2RCAA 1MRPA 4YZZA 1A7LA 3E3KA 4OEVA 3V89B 5DT6A 1SW2A 1JEUA 1CB6A 3G3HA 1FQBA 1AMFA 4NF8B 3K01A 3CFXA 3G3IA 3RN8A 1I6QA 1MQJA 5I57B 3HHFA 3PUXE 3ODBA 4OWDA 4O3CA 4QF9A 2DXYA 1TT1A 3KFMA 4FATA 1B6HA 2DVCA 2ONKE 5K2YA 4POWA 1O64A 1A8FA 4R75A 5L8DA 5AA4B 5L9OA 1UTHA 2E1SA 5A5XA 2DYXA 3R7XA 1MXXA 4KI0E 4M4GA 2UVIA 1I69A 3EHUA 2IA4A 1RKMA 2B65A 3BBRA 1NNTA 4RY1A 2I4BA 4L17A 4LP2B 2ONSA 3CFLA 3SETA 4ZE9A 4FECA 1B7UA 5ITOA 2XD2A 4O3AA 1MG1A 3RTFB 5TP9B 5I2KB 3V5AA 1B52A 1JNFA 2O7IA 3M8UA 1N0TA 3SDFA 1XC1A 1IXHA 1H45A 2A5TA 4P0GA 3E9XA 2I0CA 3TEPA 1JW1A 1A40A 5AE4A 3UP9A 3DM0A 4Q5TA 4DIGA 1SYHA 4P0IA 4ZZEA 1R1NA 3TPAA 3B6WA 3G3FA 5KCJB 2D21A 2HEUA 5ICQA 3KZGA 1PBQA 3VXBA 4U2RA 4BDOA 1FW0A 5L9MA 2XXPA 3HSTA 3UIFA 2UVGA 4DXUA 4F1YA 1DOTA 1B40A 2NXOA 4BDRA 4XKPA 3H6VA 4JSOA 4UA8A 5DEXB 1IIWA 3K4UA 4FORA 3W9VA 2G29A 1OQHA 2ANJA 1FTKA 1FTOA 4G8HA 2M8CA 1OLAA 3G3JA 1FQAA 5H8QB 3K6WA 3TODA 2DE4A 1NNPA 2NOOA 2REGA 4MLVA 3PD9A 3O97A 5AA3A 3FV2A 2F7CA 1A8EA 3I5OA 3Q26A 5DVFA 4X1DA 2ZYNA 4FIMA 1ATGA 4C1TA 2HXWA 4KYEA 3IB0A 1XHYA 2PYYA 4NWDA 3KOTA 2OWSA 3IORA 2HQ0A 3O6GA 3PUZE 5H8FB 3OOAA 5DYHA 1LBBA 4KHZE 4LZ8A 4U4SA 4FAJA 5KDTB 3S9LC 2X7PA 3OD7A 1ZBMA 2QJEA 1B3LA 3KBRA 4ND9A 3IOWA 5BWJA 3RGYA 1PB9A 3GBBA 3N6TA 3ONMA 3VDFA 2F78A 1D3KA 1OVTA 1PEBA 1GR2A 2F7AA 3R26A 1SW1A 1N3XA 1B7ZA 3A3UA 4U23A 4H1XA 1Y9UA 1URDA 2W7YA 1UTBA 2Q88A 3TTMA 3SEWA 2DS9A 4R73A 2R9JA 4ZEBA 1LBCA 2OCUA 1MXYA 4R2FA 3MP6A 3SEUA 2Z8EA 1A54A 4G68B 5KZTA 1Y3QA 3B6QA 4H0WA 2PT2A 4OYVA 3PPQA 4ZDMA 3QK6A 4WKMA 4R6HA 5FHNA 4NF5A 3CI8A 2DWAA 3I3VA 5CM6A 1HSJA 3OEKA 3CVGA 1NNFA 3G3GA 3JZJA 3T66A 1Y4TA 3FATA 4EDPA 4ZZAA 3Q29A 2O84X 4OESA 3ECRA 3TMGA 4I8CA 3Q25A 1Y1ZA 3LUYA 3WAFA 1MXUA 1TFDA 4G2ZA 5TU0A 2I6EA 1QVSA 1FCKA 3QYTA 3MVWA 1USYE 4XXUA 3O29A 3C34A 4RK2A 4RPNA 4YMBA 3VE1B 2Z8DA 1QUJA 1MY4A 4ECFA 1JQFA 4IO2A 5ELVA 1QULA 3QSLA 2ALUA 5FTHA 5AA1A 3H06B 4WEDA 2NUVA 4U22A 4IO3A 3OO9A 1TXFA 1ANFA 1R9QA 4LQ5A 2I48A 3HCQA 5CMCA
chains in the Genus database with same CATH superfamily
1B0LA 1LB8A 3C32A 3IJXB 3K00A 3QMFA 1IMAA 3O28A 1MDP1 2UYEA 3B6TA 3IOUA 4XKQA 1FTLA 1FJ9A 2ZYOA 1ZMGA 4TLMB 3VLUA 4POXA 1OQGA 4FBPA 5EYHA 3TTNA 3TFLA 2ZYMA 3LV0A 1Q35A 4MHFA 5IZZA 3OXNA 1B4HA 3PMVA 1B32A 2IEEA 5LTCA 4EQ9A 4EF2A 3D4CA 4OFOA 3O2AA 4JWOA 2P3NA 3OELA 3I6VA 2F5XA 3B7DA 3TQLA 4NHBA 4PAIA 4XKNA 5H8SA 1LGBC 3K6UA 3DP4A 2AIXA 4BLAA 1RDXA 2HZKA 1FPBA 4JVIA 1MM6A 4GOTA 4N81A 1QKBA 4OVTA 2V3TA 4IGTA 4R2BA 4N07A 4YU0A 1XVXA 2I3VA 3K6VA 2H98A 1Q1KA 2KR0A 4AQ4A 2PFZA 1JVYA 2XXKA 4FJPA 3C4MA 3O9PA 5I56B 2X7QA 4BDQA 2VGQA 4BDMA 4AB5A 3FD3A 1NV5A 3RPLB 2RC9A 3OO8A 3H6TA 1P1WA 1LAFE 2V84A 3B50A 4GL0A 4K3FA 4P11A 4GFRA 5FHOA 1YPNA 4JWXA 1SBPA 4F31B 4TLLB 4N6KA 2DE2A 4GX3A 3ILTB 2WYPA 2DP8A 1FJ6A 1LFHA 1BIYA 4OQOA 4C0RA 2VPNA 5M2VA 1YTVA 4I3EA 1Z7ME 2Y5KA 1FBPA 3ZKLA 2QRYA 3TUSA 3TQWA 3RPWA 3RUMA 3K2DA 4MX6A 4QFNA 4LVQA 3MQ9A 5ET7A 1NH8A 3LSFB 4OXVA 2D5WA 4GD5A 2OBGA 5JTYB 1QKAA 4GWZA 1MS7A 2CZIA 3TZAA 3GLBA 1MQDA 3MSTA 4HS7A 3KOSA 4YKIA 4GX4A 4OTEA 3H6WA 3PV0E 4H8JA 5TPAA 3T93B 2XX7A 4ZE8A 4MNIA 3FIRA 3THIA 4F22A 4QSCA 2FHYA 3QUJA 4OMBA 1TFAA 3RYDA 1FQCA 1O63A 4YMAA 4GWWA 2YJPA 2RF1A 3ZKKA 3OSRA 3K1MA 3QIMA 4MF3A 2QMXA 1J1NA 3OO6A 4EQ7A 3PU5A 1IEJA 4G4PA 1SPIA 2ZZWA 1AH5A 1IMBA 4F29A 1FPIA 1JVXA 2O6AA 4PCDA 2FYIA 4PF8A 5LDZA 3N94A 4EXKA 2HPGA 3IL1B 3KBZA 4RPOA 3TTRA 2H9BA 2GH9A 3FJMA 2XXYA 3IAZA 4LA9A 3BFTA 1RYOA 3FXBA 1JW4A 3VFJA 4E0WA 1LBWA 2F8DA 3CG1A 4JVDA 4WEPA 2ABHA 5H8HB 2DWIA 2QPQA 2D3IA 1H76A 2LAOA 2O68A 4IO4A 1S7YA 4ZEIA 4MJOA 3DP8A 1FTJA 2R71A 3UN6A 1LBZA 2XXTA 3MYUA 3CG3A 1EYJA 3OSQA 3U92A 4ZEKA 3BKIB 3L6HA 5CC2A 2XXWA 1IMEA 4U1ZA 2DWJA 2QS4A 3S9NC 1SI0A 1SQYA 4YKJA 4F3PA 1UTBB 3KN8A 4NQ8A 3PTYA 4IB2A 4RA1A 4NAPA 2V25A 1LAGE 2F3DA 5H8NB 4HCYA 3IB1A 3MPKA 4FEDA 1XI6A 3LBSA 1ZTYA 3M3FA 1MH3A 3SESA 1B1HA 3TYHA 2Q2CA 3FJ7A 2CEYA 4XEQA 4ZECA 4RJZA 4JDFA 3MJNA 3G7WA 2XD3A 3T9UA 4OVSA 2E0SA 4NF8A 4FEBA 1N7WA 3TELA 5HPQA 1S50A 5CMKA 2P1SA 3T22A 1URGA 3M3KA 3BIHA 2F7BA 2ZXTA 5ESYA 3QUFA 3H3GA 4E0XA 5EQ8A 4XFEA 4JSDA 1ZLQA 5AA4A 1H44A 3MC2A 5B7DA 1B3GA 5IZ1A 4PAKA 2UVJA 3ZSFA 3U1OA 4MH5A 5JK4A 1NNKA 3VLVA 4OERA 2Z23A 4P1EA 4Z7EA 4HTGA 1WDNA 3V8XB 3W9WA 1PB7A 2HXRA 3KC0A 1Z7NE 1AL3A 5AA2B 4YKKA 2Z8FA 4RNSA 3ILUB 3SKPA 1MQIA 5I5PA 5TP9A 1D9VA 5I3SA 5I2KA 4QFOA 2FIEA 1DSNA 3IFCA 4H8IA 2NWJA 2B3FA 3CR9A 1LBYA 4ELRA 2XXQA 1GV8A 3PMWA 1P99A 3MW0A 3T9XB 4DZ1A 1B2HA 3LSLA 4HCWA 1SW4A 3IR1A 1VFEA 3KEIA 2I4CA 1B3EA 1R9LA 4U21A 4UACA 4ZEFA 4OA4A 3TTLA 3E13X 2RCBA 3D1RA 2O51A 1H43A 3HN0A 3JV9A 4XKRA 3FXUA 4EF1A 3FJGA 3FVNA 1GTKA 1EZPA 4NF6B 2XWOA 3MAMA 2Y7WA 5AA2D 3LUZA 4PTKA 4PGNA 4RK9A 3KSXA 5HM4B 1WODA 5DEXA 2JJKA 1B5IA 3RT6B 4PFWA 3GBAA 3H03A 1A99A 1POTA 4R72A 4HE0A 5ET8A 3NOHA 2O1LA 2HAUA 4GQOA 4GRKA 3A09A 1FBGA 5CRYA 1PB8A 2V4CA 3Q28A 4NF4A 2PX1A 1B58A 1EYIA 1B7HA 1P1UA 2BJJX 3HFUA 2L5VA 1Y4CA 3PUYE 5H8QA 3R6UA 5F7VA 3USDA 2Q8JA 4H5FA 2V3UA 1RDYA 3E4RA 4NWCA 4LQ2A 1IXCA 2WBDA 3UGWA 3HV1A 1FPDA 2FNCA 2NVUB 4OENA 4ELQA 2DXRA 2H25A 4H45A 1JEVA 3C9HA 1IQ7A 1NV7A 3U8QA 1MPDA 2ZYKA 1N3WA 4HW8A 4PFUA 3EHTA 3VXCA 2XXHA 4KCDA 2RKMA 4QXDA 2O1MA 1Y20A 4F2QA 4F3SA 3V83A 1NV6A 4DXBA 5I2NA 3F11A 4HE1A 1KZ8A 3RTWB 4Q0CA 4KR5A 1EZ9A 3H4ZA 3RNNA 3VLWA 5TPAB 3OENA 1PDAA 1TWYA 4MLQA 3PPOA 1MQHA 3IB2A 3TTKA 2PBWA 1YZ0A 4Q30B 1DTGA 4H65A 3IK6B 2HHMA 2OWTA 3PUVE 4NF0A 3HO7A 4R6KA 1B1XA 1UTHB 4MBPA 4DCXA 1IITA 5A5XB 2GFEA 2XXXA 3FASA 3PUWE 1MXVA 3FXRA 3QAXA 2QL3A 1QW0A 1US5A 2DQVA 5I84A 4M1VA 4U1OA 2I49A 1LSTA 1NV1A 4NMYA 5FHMA 4QSEA 4Q8RA 5EHSA 4N6PA 3SEYA 3IO4A 1D4NA 3E78A 5DTBA 5IAIA 4IO7A 2RC7A 3T9HB 4G68C 3K0VA 1NL5A 3MP1A 2F35A 2F6GA 1ELJA 4JWYA 3K1NA 1LLSA 1XVYA 2WBBA 4OANA 2Q9TA 4G68A 1MM7A 3UK4A 3HHGA 1VFDA 2PFYA 4LUBA 2VOZA 1OIBA 2A5TB 1NKXA 4KQPA 4NX1A 5LOMA 4ONYA 5F24A 4GVOA 4IO6A 2HCAA 1XOCA 1MY1A 3IFAA 1N04A 4PC9A 5ITPA 1M5BA 2OZZA 3TKDA 3FV1A 2PMSA 5K2XA 3IX1A 3FVGA 2B4LA 5EYFA 2H5YA 1YXIA 4P1LA 2OWZA 3T96B 2ZNUA 3EQ1A 4WXJA 5IZ3A 2UYFA 1LFIA 1G0HA 1EH3A 1SYIA 5B70A 4PDHA 2I3WA 1QUIA 4F19A 4FE8A 1SI1A 5ICTA 4THIA 4F1UA 1BP5A 4H46A 5I58A 1O7TA 3OO7A 5EYGA 1B0HA 1LBXA 4ZS9A 4GXAA 3IO6A 2GHBA 3LC8A 3MVZA 1OMPA 4X04A 1LAXA 3S4UA 1M5EA 1KWHA 1S9TA 1MY0A 4JXIA 4DCYA 1B5JA 1YCJA 4I9DA 4JB7A 2YLNA 4QFPA 4MCOA 4MFIA 4PP0A 2XXIA 4OFJA 3W15C 3O6HA 3DLNA 4OETA 4NN3A 1F9BA 1B3FA 1B3HA 1FQFA 3G3KA 5EQ7A 2F34A 2FVZA 3KJTA 4KFQA 2O7UA 4AB6A 1P1NA 4ELOA 3D4GA 2DOJA 3FVKA 1Y3PA 5I7IA 3MVXA 2UVHA 1ZU0A 4F18A 4DLDA 2DSFA 1M5CA 3SEXA 1NUYA 3KGCA 3A3CA 3MVYA 3DELB 1AOVA 4GWYA 1NV0A 3MWBA 3S9EA 3U72A 4KYDA 4IY5A 4PBQA 2KLFA 4QHQA 1MY2A 4ZEDA 1D9QA 5IGAA 1JP4A 3RQTA 4G61A 1VE4A 4GL8A 1FQEA 4YKPA 1HSLA 1A55A 4NTLA 2V3QA 5I56A 3LR1A 4F3GA 4ESXA 4NG7A 3RPLA 1P1OA 1JW5A 3FZVA 4PFIA 1LB9A 3ROJA 1OLCA 1URSA 4PQJA 4RXLA 1JETA 1MQGA 4MEVA 1EZOA 3VVDA 1DPEA 2Q74A 4GWUA 2QSXA 2RINA 3HPIA 4PBHA 1MY3A 4H6DA 2QVRA 5I59A 4P9KA 3U93A 3UORA 2OX3A 3VVEA 1VR5A 2RC8A 3LSXA 2VD3A 1P1QA 3TDJA 4MNPA 2ZZVA 2ZNSA 4F3BA 4GIZA 4GWXA 1CE2A 1WVJA 1LEVA 2XWVA 3JYRA 1MH4A 1MPBA 1XT8A 3S9MC 4NF5B 5EHMA 1QJMA 3EHSA 3EPEA 4X9TA 4YB7A 4U4XA 5I57A 5JTYA 1BTJA 2B4MA 5J16A 4IGRA 3FGSA 3CIJA 4PE3A 3MP8A 2CEXA 1KA0A 3CRBA 3LSWA 3PPPA 4NF4B 1IXGA 1SD3A 3MBPA 2I58A 4I1DA 1FPFA 4PETA 3O66A 1NUWA 4ELPA 2VPOA 2DE3A 4GXSB 4N13A 1NMUA 1USYH 2FA7A 5FTIA 1POY1 3BIGA 5J1DA 3U94A 2DDKA 5EQAA 4AS5A 4R9FA 4MNCA 4NE4A 3FVOA 5F1QA 1NV2A 4R6YA 5IKBA 4GF8A 2ZNTA 1CNQA 1FTAA 3AXFA 1N84A 4PFTA 2ONRA 4KD5A 1IMDA 2P2AA 3OMBA 2XXUA 1SVXB 2VD2A 2P0SA 3EN3A 5FBPA 1IXIA 2VP1A 3GYYA 3BFUA 1B9JA 4QRZA 2ESNA 4XIGQ 4R9GA 2REJA 3ZS6A 1K9ZA 4TQUQ 1FBEA 2AL4A 3S2VA 5I2NB 5T3JA 3KSJA 1ZIUA 3TAJA 4OEUA 1LAHE 5H8HA 1FBHA 1GGGA 2WKYA 1FQDA 3FUZA 5L9SA 3C31A 4OVJA 2Z22A 2H4IA 4F2OA 1B46A 1BLFA 3WAEA 1DCUA 4P3LA 4R74A 4TOZA 1Y3NA 4DDDA 4PFYA 3IOTA 5CBRA 4NEDA 1B51A 1US4A 3QXMA 1Y1MA 3KC1A 4HE2A 1DPPA 1PBPA 4JBZA 4LZ7A 1QUKA 2CZKA 2XWKA 4C1UA 3SERA 4DE8A 4ESWA 5DVIA 1YYZA 3KG2A 5KCJA 2HAVA 4YICA 5CBSA 2QMWA 2QFLA 4LZ5A 2PT1A 2OK2A 4EXLA 5H8NA 1ZKBA 3M3LA 3MZ9A 1L5TA 4Z0IA 4QFKA 1YAEA 4IO5A 1I6AA 2F97A 4NGUA 2GHAA 1N7XA 3GZGA 2ZMBA 1M5FA 2AYSA 2THIA 2Y7RA 3MZBA 4XF5A 4N6DA 3RY3A 2V93A 4O3BA 2XX8A 1SDXA 4F1VA 1DMBA 1R6ZA 1AIVA 3MZ1A 4O94A 4X48A 1MDQA 2F6PA 1VSOA 3SZPA 1NH7A 1AWBA 3MPLA 1B4ZA 1NV4A 1UIUA 1IUDA 2G93A 1HSEA 3K02A 4YB5A 2Y84A 3FXQA 4BDLA 3C36A 2Q89A 1RYXA 2QVUA 2XXVA 3C35A 4LATA 2DWHA 1UIVA 4GLIA 4MMPA 1OVBA 2XXRA 4GWOA 5IZ3B 3N5LA 4LONB 1B5HA 1IZ1A 3EF7A 2DVZA 1XS5A 1N76A 3IJOB 2F36A 2O69A 3MUQA 2VHAA 1T0KA 2I0BA 4G8NA 1UQWA 4GBWA 1FPGA 1D9YA 4YAHX 3UA8A 5I58B 3H6UA 4PGPA 3O6IA 2AL5A 4F39A 3KJ7A 4UABA 4H5GA 5H8FA 4EQBA 4GBVA 1NFTA 1EYKA 3TCHA 1DTZA 4QSDA 1MPCA 2OLBA 5AA2A 2XHDA 3N6UA 4G8MA 4BDNA 4KXPA 4QFLA 5KDTA 2HZLA 2CZLA 5A5LA 3CFZA 3H7MA 1ZJLA 5CI5A 1I6BA 1FBCA 4RYAA 2ZZXA 2OJTA 4X1BA 2QVVA 3SEVA 2Y7KA 3VV5A 1DBZA 2XX9A 5BUUA 2YPNA 3T1BA 1LFGA 3T9VA 4KYSA 2CMOA 4AS4A 4IR8A 1GVCA 4P56A 3L6GA 3PGFA 4X8RA 4KCCA 4XTCQ 2H99A 4OFLA 2GRVA 3T0JA 2PVUA 2QS2A 2FBPA 2QS3A 3RLFE 3CHGA 1SW5A 5EQ9A 1H3DA 5CMMA 4PE5B 3PPRA 3P7IA 1MXWA 3RT8A 1IMCA 1EU8A 1LCFA 3DP6A 4O8MA 4G77A 3PPNA 4KPTA 1NUXA 2Q2AA 5JEIA 4NF6A 3CSGA 2B3BA 2Y7PA 3CSBA 2R6GE 1II5A 4OHNA 5HBCA 4I62A 2QS1A 3PMXA 5ISUA 4OZ9A 2HFBA 4IY6A 2X26A 3KN7A 4HXVA 3IOVA 4H67A 4YB6A 3TCFA 3C33A 1FTMA 4EUOA 4DXCA 5CMBA 1FSAA 1G0IA 3OEMA 3N26A 2A5SA 1LCTA 1M5DA 1Q9DA 3GXAA 3Q27A 3K6XA 5DVJA 2Y7IA 1MXZA 3TCGA 1BKAA 1PC3A 5I59B 3K1PA 2UXAA 3KN3A 3VVFA 4ISUA 3PD8A 1B05A 4O7IA 5ET5A 2RCAA 1MRPA 4YZZA 1A7LA 2CZHA 3E3KA 4OEVA 3V89B 5DT6A 1SW2A 1JEUA 1CB6A 3G3HA 1FQBA 4OVQA 1AMFA 4NF8B 4O7MA 3K01A 3CFXA 2F3BA 3G3IA 3A29A 3RN8A 1I6QA 1MQJA 5I57B 3HHFA 1NUZA 3PUXE 3ODBA 4OWDA 4O3CA 4QF9A 2DXYA 1TT1A 3KFMA 4FATA 1B6HA 2DVCA 2ONKE 5K2YA 2Q8MA 4POWA 1O64A 2WEFA 1A8FA 4R75A 5L8DA 5AA4B 5L9OA 1UTHA 2E1SA 5DW8A 5A5XA 2DYXA 3R7XA 1MXXA 1FPEA 4KI0E 3FBPA 4M4GA 2UVIA 1I69A 3EHUA 4N4UA 2IA4A 1RKMA 2B65A 3BBRA 1NNTA 4RY1A 2I4BA 3E79A 4L17A 4LP2B 2ONSA 1KA1A 3CFLA 3SETA 5IM2A 4ZE9A 4FECA 1B7UA 5ITOA 2XWIA 2XD2A 4O3AA 4N17A 4PAFA 1MG1A 3RTFB 3ISPA 5TP9B 5I2KB 3V5AA 1B52A 1JNFA 2O7IA 3M8UA 1N0TA 1FBDA 3SDFA 1XC1A 4N91A 1IXHA 1H45A 2A5TA 4P0GA 3E9XA 2Y5LA 2I0CA 3TEPA 1JW1A 1A40A 5AE4A 2P3VA 4I40A 3UP9A 3DM0A 4Q5TA 4DIGA 1SYHA 4P0IA 1FBFA 4ZZEA 1R1NA 5ET6A 3TPAA 1NI9A 3B6WA 3G3FA 4DI3D 5KCJB 2D21A 2HEUA 5ICQA 3KZGA 4JVCA 1PBQA 3VXBA 4U2RA 4BDOA 1FW0A 5L9MA 4N8YA 2XXPA 3HSTA 3UIFA 2XA5A 2UVGA 2WX9A 1IMFA 4MIJA 4DXUA 4F1YA 1DOTA 1B40A 2NXOA 4BDRA 4XKPA 4GWSA 3H6VA 4JSOA 4UA8A 5DEXB 4DI4B 2WYKA 1IIWA 4PF6A 4PFRA 1RDZA 3K4UA 4FORA 3W9VA 2G29A 4I3YA 1OQHA 2ANJA 4P8BA 1FTKA 1FTOA 4OVRA 4G8HA 2M8CA 1OLAA 3G3JA 1FQAA 5H8QB 3K6WA 3TODA 2DE4A 1NNPA 2NOOA 2REGA 1NV3A 4MLVA 3PD9A 3O97A 5AA3A 3FV2A 2F7CA 2PCRA 1A8EA 3I5OA 3Q26A 1DK4A 5DVFA 4X1DA 2ZYNA 4PFBA 4FIMA 2GQ1A 1ATGA 4C1TA 1VDWA 2HXWA 4KYEA 3IB0A 1XHYA 2PYYA 4NWDA 3KOTA 2OWSA 3IORA 2HQ0A 4QBAA 3O6GA 3PUZE 5H8FB 3OOAA 4MAGA 5DYHA 1LBBA 1FRPA 4KHZE 4LZ8A 4U4SA 4FAJA 5KDTB 3S9LC 2X7PA 3OD7A 1ZBMA 2QJEA 1B3LA 3KBRA 4ND9A 3IOWA 5BWJA 3RGYA 4OVPA 1PB9A 3GBBA 3N6TA 3ONMA 3VDFA 2F78A 1D3KA 1LBVA 3B8BA 2MKZA 1OVTA 1PEBA 1GR2A 2F7AA 3R26A 1SW1A 2VT5A 1N3XA 1B7ZA 3A3UA 3U65A 4U23A 4H1XA 1Y9UA 1URDA 2W7YA 1UTBA 2Q88A 1QGXA 3TTMA 3SEWA 2BJIA 2DS9A 4R73A 2R9JA 4ZEBA 4GX6A 1LBCA 2OCUA 1FPLA 4P47A 1MXYA 1BK4A 4R2FA 3MP6A 3SEUA 2Z8EA 4LN5A 2FIXA 1A54A 4G68B 5KZTA 1Y3QA 3B6QA 4H0WA 2PT2A 4OYVA 3PPQA 4ZDMA 3QK6A 4WKMA 4R6HA 5FHNA 4NF5A 3CI8A 2DWAA 3I3VA 5CM6A 1HSJA 3OEKA 3CVGA 1NNFA 3G3GA 3JZJA 3T66A 1Y4TA 3FATA 4EDPA 4ZZAA 3Q29A 2O84X 4OESA 3ECRA 3TMGA 4I8CA 3Q25A 1Y1ZA 3LUYA 3WAFA 1MXUA 1TFDA 4G2ZA 4PDDA 5TU0A 1FPJA 2I6EA 1QVSA 1FCKA 3QYTA 3MVWA 1USYE 4XXUA 3O29A 3C34A 2KQZA 4RK2A 2R8TA 4RPNA 4N15A 4YMBA 3VE1B 2Z8DA 1QUJA 1MY4A 4ECFA 1K9YA 1JQFA 4IO2A 4N8GA 5ELVA 1QULA 3QSLA 2ALUA 5FTHA 5AA1A 3H06B 4WEDA 2NUVA 4U22A 1INPA 4IO3A 3OO9A 1FPKA 1TXFA 1ANFA 1R9QA 4LQ5A 2I48A 3EKIA 3HCQA 5CMCA
chains in the Genus database with same CATH topology
1B0LA 1LB8A 3C32A 3IJXB 3K00A 3O28A 1MDP1 2UYEA 3B6TA 3IOUA 4XKQA 1FTLA 2ZYOA 1ZMGA 4TLMB 3VLUA 4POXA 1OQGA 3TTNA 3TFLA 2ZYMA 1Q35A 3OXNA 1B4HA 3PMVA 1B32A 2IEEA 4EQ9A 4EF2A 3D4CA 4OFOA 3O2AA 4JWOA 3OELA 3I6VA 2F5XA 3B7DA 3TQLA 4XKNA 5H8SA 1LGBC 3K6UA 3DP4A 2AIXA 4BLAA 2HZKA 1MM6A 4GOTA 1QKBA 2V3TA 4IGTA 4R2BA 4N07A 4YU0A 1XVXA 2I3VA 3K6VA 2H98A 1Q1KA 4AQ4A 1JVYA 4FJPA 3C4MA 3O9PA 5I56B 2X7QA 4BDQA 2VGQA 4BDMA 4AB5A 3FD3A 2RC9A 3OO8A 3H6TA 1P1WA 1LAFE 2V84A 4GL0A 4K3FA 4P11A 4GFRA 5FHOA 1YPNA 4JWXA 1SBPA 4F31B 4TLLB 2DE2A 3ILTB 2DP8A 1LFHA 1BIYA 4OQOA 4C0RA 5M2VA 1YTVA 1Z7ME 3ZKLA 2QRYA 3TUSA 3TQWA 3RPWA 3RUMA 3K2DA 4QFNA 4LVQA 3MQ9A 1NH8A 3LSFB 4OXVA 2D5WA 4GD5A 2OBGA 5JTYB 1QKAA 1MS7A 3TZAA 3GLBA 1MQDA 4HS7A 3KOSA 4YKIA 4OTEA 3H6WA 3PV0E 4H8JA 5TPAA 3T93B 2XX7A 4ZE8A 3FIRA 3THIA 4F22A 4QSCA 3QUJA 4OMBA 1TFAA 1FQCA 1O63A 4YMAA 2YJPA 2RF1A 3ZKKA 3OSRA 3K1MA 3QIMA 4MF3A 2QMXA 1J1NA 3OO6A 4EQ7A 3PU5A 1IEJA 4G4PA 1AH5A 4F29A 1JVXA 2O6AA 2FYIA 3N94A 4EXKA 3IL1B 4RPOA 3TTRA 2H9BA 2GH9A 3FJMA 2XXYA 3IAZA 4LA9A 3BFTA 1RYOA 3VFJA 1JW4A 4E0WA 2F8DA 3CG1A 4WEPA 2ABHA 5H8HB 2DWIA 2QPQA 2D3IA 1H76A 2LAOA 2O68A 4IO4A 1S7YA 4ZEIA 3DP8A 1FTJA 2R71A 3UN6A 2XXTA 3CG3A 3OSQA 3U92A 4ZEKA 3BKIB 3L6HA 5CC2A 2XXWA 4U1ZA 2DWJA 2QS4A 3S9NC 1SI0A 1SQYA 4YKJA 4F3PA 1UTBB 3KN8A 4IB2A 4RA1A 2V25A 1LAGE 5H8NB 4HCYA 3IB1A 3MPKA 4FEDA 3LBSA 1ZTYA 3M3FA 1MH3A 3SESA 1B1HA 3TYHA 2Q2CA 3FJ7A 4ZECA 4RJZA 4JDFA 3MJNA 3G7WA 2XD3A 3T9UA 2E0SA 4NF8A 4FEBA 1N7WA 3TELA 5HPQA 1S50A 5CMKA 2P1SA 3T22A 1URGA 3M3KA 2F7BA 2ZXTA 3QUFA 3H3GA 4E0XA 4JSDA 1ZLQA 5AA4A 1H44A 5B7DA 3MC2A 1B3GA 2UVJA 3ZSFA 3U1OA 4MH5A 5JK4A 1NNKA 3VLVA 4OERA 2Z23A 4Z7EA 4HTGA 1WDNA 3V8XB 3W9WA 1PB7A 1Z7NE 1AL3A 5AA2B 4YKKA 2Z8FA 4RNSA 3ILUB 3SKPA 1MQIA 5TP9A 1D9VA 5I2KA 4QFOA 1DSNA 4H8IA 2NWJA 2B3FA 3CR9A 4ELRA 2XXQA 1GV8A 3PMWA 1P99A 3MW0A 3T9XB 4DZ1A 1B2HA 3LSLA 4HCWA 1SW4A 3IR1A 1VFEA 3KEIA 2I4CA 1B3EA 1R9LA 4U21A 4UACA 4ZEFA 3TTLA 3E13X 2RCBA 2O51A 1H43A 3HN0A 3JV9A 4XKRA 3FXUA 4EF1A 3FJGA 3FVNA 1GTKA 1EZPA 4NF6B 3MAMA 2Y7WA 5AA2D 4RK9A 3KSXA 5HM4B 1WODA 5DEXA 1B5IA 3RT6B 4PFWA 3GBAA 3H03A 1A99A 1POTA 4R72A 2O1LA 2HAUA 4GQOA 4GRKA 3A09A 5CRYA 1PB8A 4NF4A 3Q28A 2PX1A 1B58A 1B7HA 1P1UA 2BJJX 1Y4CA 3PUYE 5H8QA 3R6UA 5F7VA 3USDA 2Q8JA 4H5FA 2V3UA 3E4RA 4NWCA 4LQ2A 1IXCA 3UGWA 3HV1A 2FNCA 2NVUB 4OENA 4ELQA 2DXRA 2H25A 1JEVA 3C9HA 1IQ7A 3U8QA 1MPDA 2ZYKA 1N3WA 4HW8A 4PFUA 3EHTA 3VXCA 2XXHA 4KCDA 2RKMA 2O1MA 1Y20A 4F2QA 4F3SA 3V83A 4DXBA 5I2NA 3F11A 3RTWB 4Q0CA 4KR5A 1EZ9A 3H4ZA 3RNNA 3VLWA 5TPAB 3OENA 1PDAA 1TWYA 4MLQA 3PPOA 1MQHA 3TTKA 3IB2A 2PBWA 4Q30B 1DTGA 4H65A 3IK6B 2OWTA 3PUVE 3HO7A 4R6KA 1B1XA 1UTHB 4MBPA 4DCXA 1IITA 5A5XB 2GFEA 2XXXA 3FASA 3PUWE 1MXVA 3FXRA 3QAXA 2QL3A 1QW0A 1US5A 2DQVA 5I84A 4M1VA 4U1OA 2I49A 1LSTA 4NMYA 5FHMA 4QSEA 4Q8RA 5EHSA 4N6PA 3SEYA 3IO4A 1D4NA 5DTBA 5IAIA 4IO7A 2RC7A 3T9HB 4G68C 3K0VA 1NL5A 3MP1A 2F35A 2F6GA 1ELJA 4JWYA 3K1NA 1LLSA 1XVYA 2Q9TA 4G68A 1MM7A 3UK4A 3HHGA 1VFDA 4LUBA 2VOZA 1OIBA 2A5TB 1NKXA 4KQPA 5LOMA 4ONYA 4GVOA 4IO6A 2HCAA 1XOCA 1MY1A 1N04A 5ITPA 1M5BA 2OZZA 3TKDA 3FV1A 2PMSA 5K2XA 3IX1A 3FVGA 5EYFA 2H5YA 3T96B 2ZNUA 3EQ1A 4WXJA 2UYFA 1LFIA 1EH3A 1SYIA 5B70A 2I3WA 1QUIA 4F19A 4FE8A 1SI1A 5ICTA 4THIA 4F1UA 1BP5A 5I58A 1O7TA 3OO7A 1B0HA 4ZS9A 4GXAA 3IO6A 2GHBA 3LC8A 3MVZA 1OMPA 1LAXA 3S4UA 1M5EA 1KWHA 1S9TA 1MY0A 4JXIA 4DCYA 1B5JA 1YCJA 4I9DA 4JB7A 2YLNA 4QFPA 4MFIA 4PP0A 2XXIA 4OFJA 3W15C 3O6HA 3DLNA 4OETA 1F9BA 1B3FA 1B3HA 1FQFA 3G3KA 2F34A 3KJTA 4KFQA 2O7UA 4AB6A 1P1NA 4ELOA 3D4GA 2DOJA 3FVKA 1Y3PA 3MVXA 2UVHA 1ZU0A 4F18A 4DLDA 2DSFA 1M5CA 3SEXA 3KGCA 3A3CA 3MVYA 3DELB 1AOVA 3MWBA 3S9EA 3U72A 4KYDA 4IY5A 2KLFA 4QHQA 1MY2A 4ZEDA 3RQTA 1VE4A 4GL8A 1FQEA 4YKPA 1HSLA 1A55A 4NTLA 2V3QA 5I56A 3LR1A 4F3GA 4ESXA 1P1OA 1JW5A 3FZVA 1LB9A 1OLCA 1URSA 4PQJA 4RXLA 1JETA 1MQGA 1EZOA 3VVDA 1DPEA 2QSXA 2RINA 3HPIA 1MY3A 4H6DA 5I59A 3U93A 3UORA 3VVEA 1VR5A 2RC8A 3LSXA 2VD3A 1P1QA 3TDJA 2ZNSA 4F3BA 4GIZA 1CE2A 1WVJA 3JYRA 1MH4A 1MPBA 1XT8A 3S9MC 4NF5B 5EHMA 1QJMA 3EHSA 3EPEA 4X9TA 4YB7A 4U4XA 5I57A 5JTYA 1BTJA 4IGRA 3FGSA 3CIJA 3MP8A 3CRBA 3LSWA 3PPPA 4NF4B 1IXGA 1SD3A 3MBPA 2I58A 4I1DA 4PETA 3O66A 4ELPA 2DE3A 4GXSB 4N13A 1NMUA 1USYH 2FA7A 5FTIA 1POY1 5J1DA 3U94A 4R9FA 4NE4A 3FVOA 5F1QA 4R6YA 5IKBA 4GF8A 2ZNTA 3AXFA 1N84A 4PFTA 2ONRA 4KD5A 2P2AA 3OMBA 2XXUA 1SVXB 2VD2A 2P0SA 3EN3A 1IXIA 2VP1A 4QRZA 3BFUA 1B9JA 2ESNA 4XIGQ 4R9GA 2REJA 3ZS6A 4TQUQ 2AL4A 3S2VA 5I2NB 3KSJA 1ZIUA 3TAJA 4OEUA 1LAHE 5H8HA 1GGGA 2WKYA 1FQDA 3FUZA 5L9SA 3C31A 4OVJA 2Z22A 2H4IA 4F2OA 1B46A 1BLFA 3WAEA 4R74A 4TOZA 1Y3NA 4DDDA 4PFYA 3IOTA 5CBRA 4NEDA 1B51A 1US4A 3QXMA 1Y1MA 1DPPA 1PBPA 4JBZA 4LZ7A 1QUKA 4C1UA 3SERA 4DE8A 4ESWA 5DVIA 3KG2A 5KCJA 2HAVA 4YICA 5CBSA 2QMWA 4LZ5A 2PT1A 2OK2A 4EXLA 5H8NA 1ZKBA 3M3LA 3MZ9A 1L5TA 4Z0IA 4QFKA 1YAEA 4IO5A 1I6AA 2F97A 2GHAA 1N7XA 3GZGA 2ZMBA 1M5FA 2AYSA 2THIA 2Y7RA 3MZBA 3RY3A 2V93A 4O3BA 2XX8A 1SDXA 4F1VA 1DMBA 1R6ZA 1AIVA 3MZ1A 4X48A 1MDQA 2F6PA 1VSOA 1NH7A 3MPLA 1B4ZA 1UIUA 1IUDA 2G93A 1HSEA 3K02A 4YB5A 2Y84A 3FXQA 4BDLA 3C36A 2Q89A 1RYXA 2XXVA 3C35A 4LATA 2DWHA 1UIVA 4GLIA 1OVBA 2XXRA 4GWOA 3N5LA 4LONB 1B5HA 1IZ1A 3EF7A 2DVZA 1XS5A 1N76A 3IJOB 2F36A 2O69A 3MUQA 2VHAA 1T0KA 2I0BA 4G8NA 1UQWA 1D9YA 4YAHX 3UA8A 5I58B 3H6UA 3O6IA 2AL5A 4F39A 3KJ7A 4H5GA 5H8FA 4EQBA 1NFTA 3TCHA 1DTZA 4QSDA 1MPCA 2OLBA 5AA2A 2XHDA 3N6UA 4G8MA 4BDNA 4QFLA 5KDTA 2HZLA 2CZLA 3CFZA 3H7MA 1ZJLA 5CI5A 1I6BA 4RYAA 2OJTA 4X1BA 3SEVA 2Y7KA 3VV5A 2XX9A 5BUUA 2YPNA 3T9VA 1LFGA 4KYSA 2CMOA 1GVCA 3L6GA 3PGFA 4KCCA 4XTCQ 2H99A 4OFLA 2GRVA 2PVUA 2QS2A 2QS3A 3RLFE 1SW5A 1H3DA 5CMMA 4PE5B 3PPRA 3P7IA 1MXWA 3RT8A 1EU8A 1LCFA 3DP6A 4G77A 3PPNA 4KPTA 2Q2AA 5JEIA 4NF6A 3CSGA 2B3BA 2Y7PA 3CSBA 2R6GE 1II5A 4OHNA 5HBCA 4I62A 2QS1A 3PMXA 5ISUA 4OZ9A 2HFBA 4IY6A 2X26A 3KN7A 3IOVA 4H67A 4YB6A 3TCFA 3C33A 1FTMA 4EUOA 4DXCA 5CMBA 3OEMA 3N26A 2A5SA 1LCTA 1M5DA 3GXAA 3Q27A 3K6XA 5DVJA 2Y7IA 1MXZA 3TCGA 1BKAA 1PC3A 5I59B 3K1PA 2UXAA 3KN3A 3VVFA 4ISUA 3PD8A 1B05A 2RCAA 1MRPA 4YZZA 1A7LA 3E3KA 4OEVA 3V89B 5DT6A 1SW2A 1JEUA 1CB6A 3G3HA 1FQBA 1AMFA 4NF8B 3K01A 3CFXA 3G3IA 3RN8A 1I6QA 1MQJA 5I57B 3HHFA 3PUXE 3ODBA 4OWDA 4O3CA 4QF9A 2DXYA 1TT1A 3KFMA 4FATA 1B6HA 2DVCA 2ONKE 5K2YA 4POWA 1O64A 1A8FA 4R75A 5L8DA 5AA4B 5L9OA 1UTHA 2E1SA 5A5XA 2DYXA 3R7XA 1MXXA 4KI0E 4M4GA 2UVIA 1I69A 3EHUA 2IA4A 1RKMA 2B65A 3BBRA 1NNTA 4RY1A 2I4BA 4L17A 4LP2B 2ONSA 3CFLA 3SETA 4ZE9A 4FECA 1B7UA 5ITOA 2XD2A 4O3AA 1MG1A 3RTFB 5TP9B 5I2KB 3V5AA 1B52A 1JNFA 2O7IA 3M8UA 1N0TA 3SDFA 1XC1A 1IXHA 1H45A 2A5TA 4P0GA 3E9XA 2I0CA 3TEPA 1JW1A 1A40A 5AE4A 3UP9A 3DM0A 4Q5TA 4DIGA 1SYHA 4P0IA 4ZZEA 1R1NA 3TPAA 3B6WA 3G3FA 5KCJB 2D21A 2HEUA 5ICQA 3KZGA 1PBQA 3VXBA 4U2RA 4BDOA 1FW0A 5L9MA 2XXPA 3HSTA 3UIFA 2UVGA 4DXUA 4F1YA 1DOTA 1B40A 2NXOA 4BDRA 4XKPA 3H6VA 4JSOA 4UA8A 5DEXB 1IIWA 3K4UA 4FORA 3W9VA 2G29A 1OQHA 2ANJA 1FTKA 1FTOA 4G8HA 2M8CA 1OLAA 3G3JA 1FQAA 5H8QB 3K6WA 3TODA 2DE4A 1NNPA 2NOOA 2REGA 4MLVA 3PD9A 3O97A 5AA3A 3FV2A 2F7CA 1A8EA 3I5OA 3Q26A 5DVFA 4X1DA 2ZYNA 4FIMA 1ATGA 4C1TA 2HXWA 4KYEA 3IB0A 1XHYA 2PYYA 4NWDA 3KOTA 2OWSA 3IORA 2HQ0A 3O6GA 3PUZE 5H8FB 3OOAA 5DYHA 1LBBA 4KHZE 4LZ8A 4U4SA 4FAJA 5KDTB 3S9LC 2X7PA 3OD7A 1ZBMA 2QJEA 1B3LA 3KBRA 4ND9A 3IOWA 5BWJA 3RGYA 1PB9A 3GBBA 3N6TA 3ONMA 3VDFA 2F78A 1D3KA 1OVTA 1PEBA 1GR2A 2F7AA 3R26A 1SW1A 1N3XA 1B7ZA 3A3UA 4U23A 4H1XA 1Y9UA 1URDA 2W7YA 1UTBA 2Q88A 3TTMA 3SEWA 2DS9A 4R73A 2R9JA 4ZEBA 1LBCA 2OCUA 1MXYA 4R2FA 3MP6A 3SEUA 2Z8EA 1A54A 4G68B 5KZTA 1Y3QA 3B6QA 4H0WA 2PT2A 4OYVA 3PPQA 4ZDMA 3QK6A 4WKMA 4R6HA 5FHNA 4NF5A 3CI8A 2DWAA 3I3VA 5CM6A 1HSJA 3OEKA 3CVGA 1NNFA 3G3GA 3JZJA 3T66A 1Y4TA 3FATA 4EDPA 4ZZAA 3Q29A 2O84X 4OESA 3ECRA 3TMGA 4I8CA 3Q25A 1Y1ZA 3LUYA 3WAFA 1MXUA 1TFDA 4G2ZA 5TU0A 2I6EA 1QVSA 1FCKA 3QYTA 3MVWA 1USYE 4XXUA 3O29A 3C34A 4RK2A 4RPNA 4YMBA 3VE1B 2Z8DA 1QUJA 1MY4A 4ECFA 1JQFA 4IO2A 5ELVA 1QULA 3QSLA 2ALUA 5FTHA 5AA1A 3H06B 4WEDA 2NUVA 4U22A 4IO3A 3OO9A 1TXFA 1ANFA 1R9QA 4LQ5A 2I48A 3HCQA 5CMCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B0L A;  1LB8 A;  3C32 A;  3IJX B;  3K00 A;  3O28 A;  1MDP 1;  2UYE A;  3B6T A;  3IOU A;  4XKQ A;  1FTL A;  2ZYO A;  1ZMG A;  4TLM B;  3VLU A;  4POX A;  1OQG A;  3TTN A;  3TFL A;  2ZYM A;  1Q35 A;  3OXN A;  1B4H A;  3PMV A;  1B32 A;  2IEE A;  4EQ9 A;  4EF2 A;  3D4C A;  4OFO A;  3O2A A;  4JWO A;  3OEL A;  3I6V A;  2F5X A;  3B7D A;  3TQL A;  4XKN A;  5H8S A;  1LGB C;  3K6U A;  3DP4 A;  2AIX A;  4BLA A;  2HZK A;  1MM6 A;  4GOT A;  1QKB A;  2V3T A;  4IGT A;  4R2B A;  4N07 A;  4YU0 A;  1XVX A;  2I3V A;  3K6V A;  2H98 A;  1Q1K A;  4AQ4 A;  1JVY A;  4FJP A;  3C4M A;  3O9P A;  5I56 B;  2X7Q A;  4BDQ A;  2VGQ A;  4BDM A;  4AB5 A;  3FD3 A;  2RC9 A;  3OO8 A;  3H6T A;  1P1W A;  1LAF E;  2V84 A;  4GL0 A;  4K3F A;  4P11 A;  4GFR A;  5FHO A;  1YPN A;  4JWX A;  1SBP A;  4F31 B;  4TLL B;  2DE2 A;  3ILT B;  2DP8 A;  1LFH A;  1BIY A;  4OQO A;  4C0R A;  5M2V A;  1YTV A;  1Z7M E;  3ZKL A;  2QRY A;  3TUS A;  3TQW A;  3RPW A;  3RUM A;  3K2D A;  4QFN A;  4LVQ A;  3MQ9 A;  1NH8 A;  3LSF B;  4OXV A;  2D5W A;  4GD5 A;  2OBG A;  5JTY B;  1QKA A;  1MS7 A;  3TZA A;  3GLB A;  1MQD A;  4HS7 A;  3KOS A;  4YKI A;  4OTE A;  3H6W A;  3PV0 E;  4H8J A;  5TPA A;  3T93 B;  2XX7 A;  4ZE8 A;  3FIR A;  3THI A;  4F22 A;  4QSC A;  3QUJ A;  4OMB A;  1TFA A;  1FQC A;  1O63 A;  4YMA A;  2YJP A;  2RF1 A;  3ZKK A;  3OSR A;  3K1M A;  3QIM A;  4MF3 A;  2QMX A;  1J1N A;  3OO6 A;  4EQ7 A;  3PU5 A;  1IEJ A;  4G4P A;  1AH5 A;  4F29 A;  1JVX A;  2O6A A;  2FYI A;  3N94 A;  4EXK A;  3IL1 B;  4RPO A;  3TTR A;  2H9B A;  2GH9 A;  3FJM A;  2XXY A;  3IAZ A;  4LA9 A;  3BFT A;  1RYO A;  3VFJ A;  1JW4 A;  4E0W A;  2F8D A;  3CG1 A;  4WEP A;  2ABH A;  5H8H B;  2DWI A;  2QPQ A;  2D3I A;  1H76 A;  2LAO A;  2O68 A;  4IO4 A;  1S7Y A;  4ZEI A;  3DP8 A;  1FTJ A;  2R71 A;  3UN6 A;  2XXT A;  3CG3 A;  3OSQ A;  3U92 A;  4ZEK A;  3BKI B;  3L6H A;  5CC2 A;  2XXW A;  4U1Z A;  2DWJ A;  2QS4 A;  3S9N C;  1SI0 A;  1SQY A;  4YKJ A;  4F3P A;  1UTB B;  3KN8 A;  4IB2 A;  4RA1 A;  2V25 A;  1LAG E;  5H8N B;  4HCY A;  3IB1 A;  3MPK A;  4FED A;  3LBS A;  1ZTY A;  3M3F A;  1MH3 A;  3SES A;  1B1H A;  3TYH A;  2Q2C A;  3FJ7 A;  4ZEC A;  4RJZ A;  4JDF A;  3MJN A;  3G7W A;  2XD3 A;  3T9U A;  2E0S A;  4NF8 A;  4FEB A;  1N7W A;  3TEL A;  5HPQ A;  1S50 A;  5CMK A;  2P1S A;  3T22 A;  1URG A;  3M3K A;  2F7B A;  2ZXT A;  3QUF A;  3H3G A;  4E0X A;  4JSD A;  1ZLQ A;  5AA4 A;  1H44 A;  5B7D A;  3MC2 A;  1B3G A;  2UVJ A;  3ZSF A;  3U1O A;  4MH5 A;  5JK4 A;  1NNK A;  3VLV A;  4OER A;  2Z23 A;  4Z7E A;  4HTG A;  1WDN A;  3V8X B;  3W9W A;  1PB7 A;  1Z7N E;  1AL3 A;  5AA2 B;  4YKK A;  2Z8F A;  4RNS A;  3ILU B;  3SKP A;  1MQI A;  5TP9 A;  1D9V A;  5I2K A;  4QFO A;  1DSN A;  4H8I A;  2NWJ A;  2B3F A;  3CR9 A;  4ELR A;  2XXQ A;  1GV8 A;  3PMW A;  1P99 A;  3MW0 A;  3T9X B;  4DZ1 A;  1B2H A;  3LSL A;  4HCW A;  1SW4 A;  3IR1 A;  1VFE A;  3KEI A;  2I4C A;  1B3E A;  1R9L A;  4U21 A;  4UAC A;  4ZEF A;  3TTL A;  3E13 X;  2RCB A;  2O51 A;  1H43 A;  3HN0 A;  3JV9 A;  4XKR A;  3FXU A;  4EF1 A;  3FJG A;  3FVN A;  1GTK A;  1EZP A;  4NF6 B;  3MAM A;  2Y7W A;  5AA2 D;  4RK9 A;  3KSX A;  5HM4 B;  1WOD A;  5DEX A;  1B5I A;  3RT6 B;  4PFW A;  3GBA A;  3H03 A;  1A99 A;  1POT A;  4R72 A;  2O1L A;  2HAU A;  4GQO A;  4GRK A;  3A09 A;  5CRY A;  1PB8 A;  4NF4 A;  3Q28 A;  2PX1 A;  1B58 A;  1B7H A;  1P1U A;  2BJJ X;  1Y4C A;  3PUY E;  5H8Q A;  3R6U A;  5F7V A;  3USD A;  2Q8J A;  4H5F A;  2V3U A;  3E4R A;  4NWC A;  4LQ2 A;  1IXC A;  3UGW A;  3HV1 A;  2FNC A;  2NVU B;  4OEN A;  4ELQ A;  2DXR A;  2H25 A;  1JEV A;  3C9H A;  1IQ7 A;  3U8Q A;  1MPD A;  2ZYK A;  1N3W A;  4HW8 A;  4PFU A;  3EHT A;  3VXC A;  2XXH A;  4KCD A;  2RKM A;  2O1M A;  1Y20 A;  4F2Q A;  4F3S A;  3V83 A;  4DXB A;  5I2N A;  3F11 A;  3RTW B;  4Q0C A;  4KR5 A;  1EZ9 A;  3H4Z A;  3RNN A;  3VLW A;  5TPA B;  3OEN A;  1PDA A;  1TWY A;  4MLQ A;  3PPO A;  1MQH A;  3TTK A;  3IB2 A;  2PBW A;  4Q30 B;  1DTG A;  4H65 A;  3IK6 B;  2OWT A;  3PUV E;  3HO7 A;  4R6K A;  1B1X A;  1UTH B;  4MBP A;  4DCX A;  1IIT A;  5A5X B;  2GFE A;  2XXX A;  3FAS A;  3PUW E;  1MXV A;  3FXR A;  3QAX A;  2QL3 A;  1QW0 A;  1US5 A;  2DQV A;  5I84 A;  4M1V A;  4U1O A;  2I49 A;  1LST A;  4NMY A;  5FHM A;  4QSE A;  4Q8R A;  5EHS A;  4N6P A;  3SEY A;  3IO4 A;  1D4N A;  5DTB A;  5IAI A;  4IO7 A;  2RC7 A;  3T9H B;  4G68 C;  3K0V A;  1NL5 A;  3MP1 A;  2F35 A;  2F6G A;  1ELJ A;  4JWY A;  3K1N A;  1LLS A;  1XVY A;  2Q9T A;  4G68 A;  1MM7 A;  3UK4 A;  3HHG A;  1VFD A;  4LUB A;  2VOZ A;  1OIB A;  2A5T B;  1NKX A;  4KQP A;  5LOM A;  4ONY A;  4GVO A;  4IO6 A;  2HCA A;  1XOC A;  1MY1 A;  1N04 A;  5ITP A;  1M5B A;  2OZZ A;  3TKD A;  3FV1 A;  2PMS A;  5K2X A;  3IX1 A;  3FVG A;  5EYF A;  2H5Y A;  3T96 B;  2ZNU A;  3EQ1 A;  4WXJ A;  2UYF A;  1LFI A;  1EH3 A;  1SYI A;  5B70 A;  2I3W A;  1QUI A;  4F19 A;  4FE8 A;  1SI1 A;  5ICT A;  4THI A;  4F1U A;  1BP5 A;  5I58 A;  1O7T A;  3OO7 A;  1B0H A;  4ZS9 A;  4GXA A;  3IO6 A;  2GHB A;  3LC8 A;  3MVZ A;  1OMP A;  1LAX A;  3S4U A;  1M5E A;  1KWH A;  1S9T A;  1MY0 A;  4JXI A;  4DCY A;  1B5J A;  1YCJ A;  4I9D A;  4JB7 A;  2YLN A;  4QFP A;  4MFI A;  4PP0 A;  2XXI A;  4OFJ A;  3W15 C;  3O6H A;  3DLN A;  4OET A;  1F9B A;  1B3F A;  1B3H A;  1FQF A;  3G3K A;  2F34 A;  3KJT A;  4KFQ A;  2O7U A;  4AB6 A;  1P1N A;  4ELO A;  3D4G A;  2DOJ A;  3FVK A;  1Y3P A;  3MVX A;  2UVH A;  1ZU0 A;  4F18 A;  4DLD A;  2DSF A;  1M5C A;  3SEX A;  3KGC A;  3A3C A;  3MVY A;  3DEL B;  1AOV A;  3MWB A;  3S9E A;  3U72 A;  4KYD A;  4IY5 A;  2KLF A;  4QHQ A;  1MY2 A;  4ZED A;  3RQT A;  1VE4 A;  4GL8 A;  1FQE A;  4YKP A;  1HSL A;  1A55 A;  4NTL A;  2V3Q A;  5I56 A;  3LR1 A;  4F3G A;  4ESX A;  1P1O A;  1JW5 A;  3FZV A;  1LB9 A;  1OLC A;  1URS A;  4PQJ A;  4RXL A;  1JET A;  1MQG A;  1EZO A;  3VVD A;  1DPE A;  2QSX A;  2RIN A;  3HPI A;  1MY3 A;  4H6D A;  5I59 A;  3U93 A;  3UOR A;  3VVE A;  1VR5 A;  2RC8 A;  3LSX A;  2VD3 A;  1P1Q A;  3TDJ A;  2ZNS A;  4F3B A;  4GIZ A;  1CE2 A;  1WVJ A;  3JYR A;  1MH4 A;  1MPB A;  1XT8 A;  3S9M C;  4NF5 B;  5EHM A;  1QJM A;  3EHS A;  3EPE A;  4X9T A;  4YB7 A;  4U4X A;  5I57 A;  5JTY A;  1BTJ A;  4IGR A;  3FGS A;  3CIJ A;  3MP8 A;  3CRB A;  3LSW A;  3PPP A;  4NF4 B;  1IXG A;  1SD3 A;  3MBP A;  2I58 A;  4I1D A;  4PET A;  3O66 A;  4ELP A;  2DE3 A;  4GXS B;  4N13 A;  1NMU A;  1USY H;  2FA7 A;  5FTI A;  1POY 1;  5J1D A;  3U94 A;  4R9F A;  4NE4 A;  3FVO A;  5F1Q A;  4R6Y A;  5IKB A;  4GF8 A;  2ZNT A;  3AXF A;  1N84 A;  4PFT A;  2ONR A;  4KD5 A;  2P2A A;  3OMB A;  2XXU A;  1SVX B;  2VD2 A;  2P0S A;  3EN3 A;  1IXI A;  2VP1 A;  4QRZ A;  3BFU A;  1B9J A;  2ESN A;  4XIG Q;  4R9G A;  2REJ A;  3ZS6 A;  4TQU Q;  2AL4 A;  3S2V A;  5I2N B;  3KSJ A;  1ZIU A;  3TAJ A;  4OEU A;  1LAH E;  5H8H A;  1GGG A;  2WKY A;  1FQD A;  3FUZ A;  5L9S A;  3C31 A;  4OVJ A;  2Z22 A;  2H4I A;  4F2O A;  1B46 A;  1BLF A;  3WAE A;  4R74 A;  4TOZ A;  1Y3N A;  4DDD A;  4PFY A;  3IOT A;  5CBR A;  4NED A;  1B51 A;  1US4 A;  3QXM A;  1Y1M A;  1DPP A;  1PBP A;  4JBZ A;  4LZ7 A;  1QUK A;  4C1U A;  3SER A;  4DE8 A;  4ESW A;  5DVI A;  3KG2 A;  5KCJ A;  2HAV A;  4YIC A;  5CBS A;  2QMW A;  4LZ5 A;  2PT1 A;  2OK2 A;  4EXL A;  5H8N A;  1ZKB A;  3M3L A;  3MZ9 A;  1L5T A;  4Z0I A;  4QFK A;  1YAE A;  4IO5 A;  1I6A A;  2F97 A;  2GHA A;  1N7X A;  3GZG A;  2ZMB A;  1M5F A;  2AYS A;  2THI A;  2Y7R A;  3MZB A;  3RY3 A;  2V93 A;  4O3B A;  2XX8 A;  1SDX A;  4F1V A;  1DMB A;  1R6Z A;  1AIV A;  3MZ1 A;  4X48 A;  1MDQ A;  2F6P A;  1VSO A;  1NH7 A;  3MPL A;  1B4Z A;  1UIU A;  1IUD A;  2G93 A;  1HSE A;  3K02 A;  4YB5 A;  2Y84 A;  3FXQ A;  4BDL A;  3C36 A;  2Q89 A;  1RYX A;  2XXV A;  3C35 A;  4LAT A;  2DWH A;  1UIV A;  4GLI A;  1OVB A;  2XXR A;  4GWO A;  3N5L A;  4LON B;  1B5H A;  1IZ1 A;  3EF7 A;  2DVZ A;  1XS5 A;  1N76 A;  3IJO B;  2F36 A;  2O69 A;  3MUQ A;  2VHA A;  1T0K A;  2I0B A;  4G8N A;  1UQW A;  1D9Y A;  4YAH X;  3UA8 A;  5I58 B;  3H6U A;  3O6I A;  2AL5 A;  4F39 A;  3KJ7 A;  4H5G A;  5H8F A;  4EQB A;  1NFT A;  3TCH A;  1DTZ A;  4QSD A;  1MPC A;  2OLB A;  5AA2 A;  2XHD A;  3N6U A;  4G8M A;  4BDN A;  4QFL A;  5KDT A;  2HZL A;  2CZL A;  3CFZ A;  3H7M A;  1ZJL A;  5CI5 A;  1I6B A;  4RYA A;  2OJT A;  4X1B A;  3SEV A;  2Y7K A;  3VV5 A;  2XX9 A;  5BUU A;  2YPN A;  3T9V A;  1LFG A;  4KYS A;  2CMO A;  1GVC A;  3L6G A;  3PGF A;  4KCC A;  4XTC Q;  2H99 A;  4OFL A;  2GRV A;  2PVU A;  2QS2 A;  2QS3 A;  3RLF E;  1SW5 A;  1H3D A;  5CMM A;  4PE5 B;  3PPR A;  3P7I A;  1MXW A;  3RT8 A;  1EU8 A;  1LCF A;  3DP6 A;  4G77 A;  3PPN A;  4KPT A;  2Q2A A;  5JEI A;  4NF6 A;  3CSG A;  2B3B A;  2Y7P A;  3CSB A;  2R6G E;  1II5 A;  4OHN A;  5HBC A;  4I62 A;  2QS1 A;  3PMX A;  5ISU A;  4OZ9 A;  2HFB A;  4IY6 A;  2X26 A;  3KN7 A;  3IOV A;  4H67 A;  4YB6 A;  3TCF A;  3C33 A;  1FTM A;  4EUO A;  4DXC A;  5CMB A;  3OEM A;  3N26 A;  2A5S A;  1LCT A;  1M5D A;  3GXA A;  3Q27 A;  3K6X A;  5DVJ A;  2Y7I A;  1MXZ A;  3TCG A;  1BKA A;  1PC3 A;  5I59 B;  3K1P A;  2UXA A;  3KN3 A;  3VVF A;  4ISU A;  3PD8 A;  1B05 A;  2RCA A;  1MRP A;  4YZZ A;  1A7L A;  3E3K A;  4OEV A;  3V89 B;  5DT6 A;  1SW2 A;  1JEU A;  1CB6 A;  3G3H A;  1FQB A;  1AMF A;  4NF8 B;  3K01 A;  3CFX A;  3G3I A;  3RN8 A;  1I6Q A;  1MQJ A;  5I57 B;  3HHF A;  3PUX E;  3ODB A;  4OWD A;  4O3C A;  4QF9 A;  2DXY A;  1TT1 A;  3KFM A;  4FAT A;  1B6H A;  2DVC A;  2ONK E;  5K2Y A;  4POW A;  1O64 A;  1A8F A;  4R75 A;  5L8D A;  5AA4 B;  5L9O A;  1UTH A;  2E1S A;  5A5X A;  2DYX A;  3R7X A;  1MXX A;  4KI0 E;  4M4G A;  2UVI A;  1I69 A;  3EHU A;  2IA4 A;  1RKM A;  2B65 A;  3BBR A;  1NNT A;  4RY1 A;  2I4B A;  4L17 A;  4LP2 B;  2ONS A;  3CFL A;  3SET A;  4ZE9 A;  4FEC A;  1B7U A;  5ITO A;  2XD2 A;  4O3A A;  1MG1 A;  3RTF B;  5TP9 B;  5I2K B;  3V5A A;  1B52 A;  1JNF A;  2O7I A;  3M8U A;  1N0T A;  3SDF A;  1XC1 A;  1IXH A;  1H45 A;  2A5T A;  4P0G A;  3E9X A;  2I0C A;  3TEP A;  1JW1 A;  1A40 A;  5AE4 A;  3UP9 A;  3DM0 A;  4Q5T A;  4DIG A;  1SYH A;  4P0I A;  4ZZE A;  1R1N A;  3TPA A;  3B6W A;  3G3F A;  5KCJ B;  2D21 A;  2HEU A;  5ICQ A;  3KZG A;  1PBQ A;  3VXB A;  4U2R A;  4BDO A;  1FW0 A;  5L9M A;  2XXP A;  3HST A;  3UIF A;  2UVG A;  4DXU A;  4F1Y A;  1DOT A;  1B40 A;  2NXO A;  4BDR A;  4XKP A;  3H6V A;  4JSO A;  4UA8 A;  5DEX B;  1IIW A;  3K4U A;  4FOR A;  3W9V A;  2G29 A;  1OQH A;  2ANJ A;  1FTK A;  1FTO A;  4G8H A;  2M8C A;  1OLA A;  3G3J A;  1FQA A;  5H8Q B;  3K6W A;  3TOD A;  2DE4 A;  1NNP A;  2NOO A;  2REG A;  4MLV A;  3PD9 A;  3O97 A;  5AA3 A;  3FV2 A;  2F7C A;  1A8E A;  3I5O A;  3Q26 A;  5DVF A;  4X1D A;  2ZYN A;  4FIM A;  1ATG A;  4C1T A;  2HXW A;  4KYE A;  3IB0 A;  1XHY A;  2PYY A;  4NWD A;  3KOT A;  2OWS A;  3IOR A;  2HQ0 A;  3O6G A;  3PUZ E;  5H8F B;  3OOA A;  5DYH A;  1LBB A;  4KHZ E;  4LZ8 A;  4U4S A;  4FAJ A;  5KDT B;  3S9L C;  2X7P A;  3OD7 A;  1ZBM A;  2QJE A;  1B3L A;  3KBR A;  4ND9 A;  3IOW A;  5BWJ A;  3RGY A;  1PB9 A;  3GBB A;  3N6T A;  3ONM A;  3VDF A;  2F78 A;  1D3K A;  1OVT A;  1PEB A;  1GR2 A;  2F7A A;  3R26 A;  1SW1 A;  1N3X A;  1B7Z A;  3A3U A;  4U23 A;  4H1X A;  1Y9U A;  1URD A;  2W7Y A;  1UTB A;  2Q88 A;  3TTM A;  3SEW A;  2DS9 A;  4R73 A;  2R9J A;  4ZEB A;  1LBC A;  2OCU A;  1MXY A;  4R2F A;  3MP6 A;  3SEU A;  2Z8E A;  1A54 A;  4G68 B;  5KZT A;  1Y3Q A;  3B6Q A;  4H0W A;  2PT2 A;  4OYV A;  3PPQ A;  4ZDM A;  3QK6 A;  4WKM A;  4R6H A;  5FHN A;  4NF5 A;  3CI8 A;  2DWA A;  3I3V A;  5CM6 A;  1HSJ A;  3OEK A;  3CVG A;  1NNF A;  3G3G A;  3JZJ A;  3T66 A;  1Y4T A;  3FAT A;  4EDP A;  4ZZA A;  3Q29 A;  2O84 X;  4OES A;  3ECR A;  3TMG A;  4I8C A;  3Q25 A;  1Y1Z A;  3LUY A;  3WAF A;  1MXU A;  1TFD A;  4G2Z A;  5TU0 A;  2I6E A;  1QVS A;  1FCK A;  3QYT A;  3MVW A;  1USY E;  4XXU A;  3O29 A;  3C34 A;  4RK2 A;  4RPN A;  4YMB A;  3VE1 B;  2Z8D A;  1QUJ A;  1MY4 A;  4ECF A;  1JQF A;  4IO2 A;  5ELV A;  1QUL A;  3QSL A;  2ALU A;  5FTH A;  5AA1 A;  3H06 B;  4WED A;  2NUV A;  4U22 A;  4IO3 A;  3OO9 A;  1TXF A;  1ANF A;  1R9Q A;  4LQ5 A;  2I48 A;  3HCQ A;  5CMC A; 
#chains in the Genus database with same CATH topology
 1B0L A;  1LB8 A;  3C32 A;  3IJX B;  3K00 A;  3QMF A;  1IMA A;  3O28 A;  1MDP 1;  2UYE A;  3B6T A;  3IOU A;  4XKQ A;  1FTL A;  1FJ9 A;  2ZYO A;  1ZMG A;  4TLM B;  3VLU A;  4POX A;  1OQG A;  4FBP A;  5EYH A;  3TTN A;  3TFL A;  2ZYM A;  3LV0 A;  1Q35 A;  4MHF A;  5IZZ A;  3OXN A;  1B4H A;  3PMV A;  1B32 A;  2IEE A;  5LTC A;  4EQ9 A;  4EF2 A;  3D4C A;  4OFO A;  3O2A A;  4JWO A;  2P3N A;  3OEL A;  3I6V A;  2F5X A;  3B7D A;  3TQL A;  4NHB A;  4PAI A;  4XKN A;  5H8S A;  1LGB C;  3K6U A;  3DP4 A;  2AIX A;  4BLA A;  1RDX A;  2HZK A;  1FPB A;  4JVI A;  1MM6 A;  4GOT A;  4N81 A;  1QKB A;  4OVT A;  2V3T A;  4IGT A;  4R2B A;  4N07 A;  4YU0 A;  1XVX A;  2I3V A;  3K6V A;  2H98 A;  1Q1K A;  2KR0 A;  4AQ4 A;  2PFZ A;  1JVY A;  2XXK A;  4FJP A;  3C4M A;  3O9P A;  5I56 B;  2X7Q A;  4BDQ A;  2VGQ A;  4BDM A;  4AB5 A;  3FD3 A;  1NV5 A;  3RPL B;  2RC9 A;  3OO8 A;  3H6T A;  1P1W A;  1LAF E;  2V84 A;  3B50 A;  4GL0 A;  4K3F A;  4P11 A;  4GFR A;  5FHO A;  1YPN A;  4JWX A;  1SBP A;  4F31 B;  4TLL B;  4N6K A;  2DE2 A;  4GX3 A;  3ILT B;  2WYP A;  2DP8 A;  1FJ6 A;  1LFH A;  1BIY A;  4OQO A;  4C0R A;  2VPN A;  5M2V A;  1YTV A;  4I3E A;  1Z7M E;  2Y5K A;  1FBP A;  3ZKL A;  2QRY A;  3TUS A;  3TQW A;  3RPW A;  3RUM A;  3K2D A;  4MX6 A;  4QFN A;  4LVQ A;  3MQ9 A;  5ET7 A;  1NH8 A;  3LSF B;  4OXV A;  2D5W A;  4GD5 A;  2OBG A;  5JTY B;  1QKA A;  4GWZ A;  1MS7 A;  2CZI A;  3TZA A;  3GLB A;  1MQD A;  3MST A;  4HS7 A;  3KOS A;  4YKI A;  4GX4 A;  4OTE A;  3H6W A;  3PV0 E;  4H8J A;  5TPA A;  3T93 B;  2XX7 A;  4ZE8 A;  4MNI A;  3FIR A;  3THI A;  4F22 A;  4QSC A;  2FHY A;  3QUJ A;  4OMB A;  1TFA A;  3RYD A;  1FQC A;  1O63 A;  4YMA A;  4GWW A;  2YJP A;  2RF1 A;  3ZKK A;  3OSR A;  3K1M A;  3QIM A;  4MF3 A;  2QMX A;  1J1N A;  3OO6 A;  4EQ7 A;  3PU5 A;  1IEJ A;  4G4P A;  1SPI A;  2ZZW A;  1AH5 A;  1IMB A;  4F29 A;  1FPI A;  1JVX A;  2O6A A;  4PCD A;  2FYI A;  4PF8 A;  5LDZ A;  3N94 A;  4EXK A;  2HPG A;  3IL1 B;  3KBZ A;  4RPO A;  3TTR A;  2H9B A;  2GH9 A;  3FJM A;  2XXY A;  3IAZ A;  4LA9 A;  3BFT A;  1RYO A;  3FXB A;  1JW4 A;  3VFJ A;  4E0W A;  1LBW A;  2F8D A;  3CG1 A;  4JVD A;  4WEP A;  2ABH A;  5H8H B;  2DWI A;  2QPQ A;  2D3I A;  1H76 A;  2LAO A;  2O68 A;  4IO4 A;  1S7Y A;  4ZEI A;  4MJO A;  3DP8 A;  1FTJ A;  2R71 A;  3UN6 A;  1LBZ A;  2XXT A;  3MYU A;  3CG3 A;  1EYJ A;  3OSQ A;  3U92 A;  4ZEK A;  3BKI B;  3L6H A;  5CC2 A;  2XXW A;  1IME A;  4U1Z A;  2DWJ A;  2QS4 A;  3S9N C;  1SI0 A;  1SQY A;  4YKJ A;  4F3P A;  1UTB B;  3KN8 A;  4NQ8 A;  3PTY A;  4IB2 A;  4RA1 A;  4NAP A;  2V25 A;  1LAG E;  2F3D A;  5H8N B;  4HCY A;  3IB1 A;  3MPK A;  4FED A;  1XI6 A;  3LBS A;  1ZTY A;  3M3F A;  1MH3 A;  3SES A;  1B1H A;  3TYH A;  2Q2C A;  3FJ7 A;  2CEY A;  4XEQ A;  4ZEC A;  4RJZ A;  4JDF A;  3MJN A;  3G7W A;  2XD3 A;  3T9U A;  4OVS A;  2E0S A;  4NF8 A;  4FEB A;  1N7W A;  3TEL A;  5HPQ A;  1S50 A;  5CMK A;  2P1S A;  3T22 A;  1URG A;  3M3K A;  3BIH A;  2F7B A;  2ZXT A;  5ESY A;  3QUF A;  3H3G A;  4E0X A;  5EQ8 A;  4XFE A;  4JSD A;  1ZLQ A;  5AA4 A;  1H44 A;  3MC2 A;  5B7D A;  1B3G A;  5IZ1 A;  4PAK A;  2UVJ A;  3ZSF A;  3U1O A;  4MH5 A;  5JK4 A;  1NNK A;  3VLV A;  4OER A;  2Z23 A;  4P1E A;  4Z7E A;  4HTG A;  1WDN A;  3V8X B;  3W9W A;  1PB7 A;  2HXR A;  3KC0 A;  1Z7N E;  1AL3 A;  5AA2 B;  4YKK A;  2Z8F A;  4RNS A;  3ILU B;  3SKP A;  1MQI A;  5I5P A;  5TP9 A;  1D9V A;  5I3S A;  5I2K A;  4QFO A;  2FIE A;  1DSN A;  3IFC A;  4H8I A;  2NWJ A;  2B3F A;  3CR9 A;  1LBY A;  4ELR A;  2XXQ A;  1GV8 A;  3PMW A;  1P99 A;  3MW0 A;  3T9X B;  4DZ1 A;  1B2H A;  3LSL A;  4HCW A;  1SW4 A;  3IR1 A;  1VFE A;  3KEI A;  2I4C A;  1B3E A;  1R9L A;  4U21 A;  4UAC A;  4ZEF A;  4OA4 A;  3TTL A;  3E13 X;  2RCB A;  3D1R A;  2O51 A;  1H43 A;  3HN0 A;  3JV9 A;  4XKR A;  3FXU A;  4EF1 A;  3FJG A;  3FVN A;  1GTK A;  1EZP A;  4NF6 B;  2XWO A;  3MAM A;  2Y7W A;  5AA2 D;  3LUZ A;  4PTK A;  4PGN A;  4RK9 A;  3KSX A;  5HM4 B;  1WOD A;  5DEX A;  2JJK A;  1B5I A;  3RT6 B;  4PFW A;  3GBA A;  3H03 A;  1A99 A;  1POT A;  4R72 A;  4HE0 A;  5ET8 A;  3NOH A;  2O1L A;  2HAU A;  4GQO A;  4GRK A;  3A09 A;  1FBG A;  5CRY A;  1PB8 A;  2V4C A;  3Q28 A;  4NF4 A;  2PX1 A;  1B58 A;  1EYI A;  1B7H A;  1P1U A;  2BJJ X;  3HFU A;  2L5V A;  1Y4C A;  3PUY E;  5H8Q A;  3R6U A;  5F7V A;  3USD A;  2Q8J A;  4H5F A;  2V3U A;  1RDY A;  3E4R A;  4NWC A;  4LQ2 A;  1IXC A;  2WBD A;  3UGW A;  3HV1 A;  1FPD A;  2FNC A;  2NVU B;  4OEN A;  4ELQ A;  2DXR A;  2H25 A;  4H45 A;  1JEV A;  3C9H A;  1IQ7 A;  1NV7 A;  3U8Q A;  1MPD A;  2ZYK A;  1N3W A;  4HW8 A;  4PFU A;  3EHT A;  3VXC A;  2XXH A;  4KCD A;  2RKM A;  4QXD A;  2O1M A;  1Y20 A;  4F2Q A;  4F3S A;  3V83 A;  1NV6 A;  4DXB A;  5I2N A;  3F11 A;  4HE1 A;  1KZ8 A;  3RTW B;  4Q0C A;  4KR5 A;  1EZ9 A;  3H4Z A;  3RNN A;  3VLW A;  5TPA B;  3OEN A;  1PDA A;  1TWY A;  4MLQ A;  3PPO A;  1MQH A;  3IB2 A;  3TTK A;  2PBW A;  1YZ0 A;  4Q30 B;  1DTG A;  4H65 A;  3IK6 B;  2HHM A;  2OWT A;  3PUV E;  4NF0 A;  3HO7 A;  4R6K A;  1B1X A;  1UTH B;  4MBP A;  4DCX A;  1IIT A;  5A5X B;  2GFE A;  2XXX A;  3FAS A;  3PUW E;  1MXV A;  3FXR A;  3QAX A;  2QL3 A;  1QW0 A;  1US5 A;  2DQV A;  5I84 A;  4M1V A;  4U1O A;  2I49 A;  1LST A;  1NV1 A;  4NMY A;  5FHM A;  4QSE A;  4Q8R A;  5EHS A;  4N6P A;  3SEY A;  3IO4 A;  1D4N A;  3E78 A;  5DTB A;  5IAI A;  4IO7 A;  2RC7 A;  3T9H B;  4G68 C;  3K0V A;  1NL5 A;  3MP1 A;  2F35 A;  2F6G A;  1ELJ A;  4JWY A;  3K1N A;  1LLS A;  1XVY A;  2WBB A;  4OAN A;  2Q9T A;  4G68 A;  1MM7 A;  3UK4 A;  3HHG A;  1VFD A;  2PFY A;  4LUB A;  2VOZ A;  1OIB A;  2A5T B;  1NKX A;  4KQP A;  4NX1 A;  5LOM A;  4ONY A;  5F24 A;  4GVO A;  4IO6 A;  2HCA A;  1XOC A;  1MY1 A;  3IFA A;  1N04 A;  4PC9 A;  5ITP A;  1M5B A;  2OZZ A;  3TKD A;  3FV1 A;  2PMS A;  5K2X A;  3IX1 A;  3FVG A;  2B4L A;  5EYF A;  2H5Y A;  1YXI A;  4P1L A;  2OWZ A;  3T96 B;  2ZNU A;  3EQ1 A;  4WXJ A;  5IZ3 A;  2UYF A;  1LFI A;  1G0H A;  1EH3 A;  1SYI A;  5B70 A;  4PDH A;  2I3W A;  1QUI A;  4F19 A;  4FE8 A;  1SI1 A;  5ICT A;  4THI A;  4F1U A;  1BP5 A;  4H46 A;  5I58 A;  1O7T A;  3OO7 A;  5EYG A;  1B0H A;  1LBX A;  4ZS9 A;  4GXA A;  3IO6 A;  2GHB A;  3LC8 A;  3MVZ A;  1OMP A;  4X04 A;  1LAX A;  3S4U A;  1M5E A;  1KWH A;  1S9T A;  1MY0 A;  4JXI A;  4DCY A;  1B5J A;  1YCJ A;  4I9D A;  4JB7 A;  2YLN A;  4QFP A;  4MCO A;  4MFI A;  4PP0 A;  2XXI A;  4OFJ A;  3W15 C;  3O6H A;  3DLN A;  4OET A;  4NN3 A;  1F9B A;  1B3F A;  1B3H A;  1FQF A;  3G3K A;  5EQ7 A;  2F34 A;  2FVZ A;  3KJT A;  4KFQ A;  2O7U A;  4AB6 A;  1P1N A;  4ELO A;  3D4G A;  2DOJ A;  3FVK A;  1Y3P A;  5I7I A;  3MVX A;  2UVH A;  1ZU0 A;  4F18 A;  4DLD A;  2DSF A;  1M5C A;  3SEX A;  1NUY A;  3KGC A;  3A3C A;  3MVY A;  3DEL B;  1AOV A;  4GWY A;  1NV0 A;  3MWB A;  3S9E A;  3U72 A;  4KYD A;  4IY5 A;  4PBQ A;  2KLF A;  4QHQ A;  1MY2 A;  4ZED A;  1D9Q A;  5IGA A;  1JP4 A;  3RQT A;  4G61 A;  1VE4 A;  4GL8 A;  1FQE A;  4YKP A;  1HSL A;  1A55 A;  4NTL A;  2V3Q A;  5I56 A;  3LR1 A;  4F3G A;  4ESX A;  4NG7 A;  3RPL A;  1P1O A;  1JW5 A;  3FZV A;  4PFI A;  1LB9 A;  3ROJ A;  1OLC A;  1URS A;  4PQJ A;  4RXL A;  1JET A;  1MQG A;  4MEV A;  1EZO A;  3VVD A;  1DPE A;  2Q74 A;  4GWU A;  2QSX A;  2RIN A;  3HPI A;  4PBH A;  1MY3 A;  4H6D A;  2QVR A;  5I59 A;  4P9K A;  3U93 A;  3UOR A;  2OX3 A;  3VVE A;  1VR5 A;  2RC8 A;  3LSX A;  2VD3 A;  1P1Q A;  3TDJ A;  4MNP A;  2ZZV A;  2ZNS A;  4F3B A;  4GIZ A;  4GWX A;  1CE2 A;  1WVJ A;  1LEV A;  2XWV A;  3JYR A;  1MH4 A;  1MPB A;  1XT8 A;  3S9M C;  4NF5 B;  5EHM A;  1QJM A;  3EHS A;  3EPE A;  4X9T A;  4YB7 A;  4U4X A;  5I57 A;  5JTY A;  1BTJ A;  2B4M A;  5J16 A;  4IGR A;  3FGS A;  3CIJ A;  4PE3 A;  3MP8 A;  2CEX A;  1KA0 A;  3CRB A;  3LSW A;  3PPP A;  4NF4 B;  1IXG A;  1SD3 A;  3MBP A;  2I58 A;  4I1D A;  1FPF A;  4PET A;  3O66 A;  1NUW A;  4ELP A;  2VPO A;  2DE3 A;  4GXS B;  4N13 A;  1NMU A;  1USY H;  2FA7 A;  5FTI A;  1POY 1;  3BIG A;  5J1D A;  3U94 A;  2DDK A;  5EQA A;  4AS5 A;  4R9F A;  4MNC A;  4NE4 A;  3FVO A;  5F1Q A;  1NV2 A;  4R6Y A;  5IKB A;  4GF8 A;  2ZNT A;  1CNQ A;  1FTA A;  3AXF A;  1N84 A;  4PFT A;  2ONR A;  4KD5 A;  1IMD A;  2P2A A;  3OMB A;  2XXU A;  1SVX B;  2VD2 A;  2P0S A;  3EN3 A;  5FBP A;  1IXI A;  2VP1 A;  3GYY A;  3BFU A;  1B9J A;  4QRZ A;  2ESN A;  4XIG Q;  4R9G A;  2REJ A;  3ZS6 A;  1K9Z A;  4TQU Q;  1FBE A;  2AL4 A;  3S2V A;  5I2N B;  5T3J A;  3KSJ A;  1ZIU A;  3TAJ A;  4OEU A;  1LAH E;  5H8H A;  1FBH A;  1GGG A;  2WKY A;  1FQD A;  3FUZ A;  5L9S A;  3C31 A;  4OVJ A;  2Z22 A;  2H4I A;  4F2O A;  1B46 A;  1BLF A;  3WAE A;  1DCU A;  4P3L A;  4R74 A;  4TOZ A;  1Y3N A;  4DDD A;  4PFY A;  3IOT A;  5CBR A;  4NED A;  1B51 A;  1US4 A;  3QXM A;  1Y1M A;  3KC1 A;  4HE2 A;  1DPP A;  1PBP A;  4JBZ A;  4LZ7 A;  1QUK A;  2CZK A;  2XWK A;  4C1U A;  3SER A;  4DE8 A;  4ESW A;  5DVI A;  1YYZ A;  3KG2 A;  5KCJ A;  2HAV A;  4YIC A;  5CBS A;  2QMW A;  2QFL A;  4LZ5 A;  2PT1 A;  2OK2 A;  4EXL A;  5H8N A;  1ZKB A;  3M3L A;  3MZ9 A;  1L5T A;  4Z0I A;  4QFK A;  1YAE A;  4IO5 A;  1I6A A;  2F97 A;  4NGU A;  2GHA A;  1N7X A;  3GZG A;  2ZMB A;  1M5F A;  2AYS A;  2THI A;  2Y7R A;  3MZB A;  4XF5 A;  4N6D A;  3RY3 A;  2V93 A;  4O3B A;  2XX8 A;  1SDX A;  4F1V A;  1DMB A;  1R6Z A;  1AIV A;  3MZ1 A;  4O94 A;  4X48 A;  1MDQ A;  2F6P A;  1VSO A;  3SZP A;  1NH7 A;  1AWB A;  3MPL A;  1B4Z A;  1NV4 A;  1UIU A;  1IUD A;  2G93 A;  1HSE A;  3K02 A;  4YB5 A;  2Y84 A;  3FXQ A;  4BDL A;  3C36 A;  2Q89 A;  1RYX A;  2QVU A;  2XXV A;  3C35 A;  4LAT A;  2DWH A;  1UIV A;  4GLI A;  4MMP A;  1OVB A;  2XXR A;  4GWO A;  5IZ3 B;  3N5L A;  4LON B;  1B5H A;  1IZ1 A;  3EF7 A;  2DVZ A;  1XS5 A;  1N76 A;  3IJO B;  2F36 A;  2O69 A;  3MUQ A;  2VHA A;  1T0K A;  2I0B A;  4G8N A;  1UQW A;  4GBW A;  1FPG A;  1D9Y A;  4YAH X;  3UA8 A;  5I58 B;  3H6U A;  4PGP A;  3O6I A;  2AL5 A;  4F39 A;  3KJ7 A;  4UAB A;  4H5G A;  5H8F A;  4EQB A;  4GBV A;  1NFT A;  1EYK A;  3TCH A;  1DTZ A;  4QSD A;  1MPC A;  2OLB A;  5AA2 A;  2XHD A;  3N6U A;  4G8M A;  4BDN A;  4KXP A;  4QFL A;  5KDT A;  2HZL A;  2CZL A;  5A5L A;  3CFZ A;  3H7M A;  1ZJL A;  5CI5 A;  1I6B A;  1FBC A;  4RYA A;  2ZZX A;  2OJT A;  4X1B A;  2QVV A;  3SEV A;  2Y7K A;  3VV5 A;  1DBZ A;  2XX9 A;  5BUU A;  2YPN A;  3T1B A;  1LFG A;  3T9V A;  4KYS A;  2CMO A;  4AS4 A;  4IR8 A;  1GVC A;  4P56 A;  3L6G A;  3PGF A;  4X8R A;  4KCC A;  4XTC Q;  2H99 A;  4OFL A;  2GRV A;  3T0J A;  2PVU A;  2QS2 A;  2FBP A;  2QS3 A;  3RLF E;  3CHG A;  1SW5 A;  5EQ9 A;  1H3D A;  5CMM A;  4PE5 B;  3PPR A;  3P7I A;  1MXW A;  3RT8 A;  1IMC A;  1EU8 A;  1LCF A;  3DP6 A;  4O8M A;  4G77 A;  3PPN A;  4KPT A;  1NUX A;  2Q2A A;  5JEI A;  4NF6 A;  3CSG A;  2B3B A;  2Y7P A;  3CSB A;  2R6G E;  1II5 A;  4OHN A;  5HBC A;  4I62 A;  2QS1 A;  3PMX A;  5ISU A;  4OZ9 A;  2HFB A;  4IY6 A;  2X26 A;  3KN7 A;  4HXV A;  3IOV A;  4H67 A;  4YB6 A;  3TCF A;  3C33 A;  1FTM A;  4EUO A;  4DXC A;  5CMB A;  1FSA A;  1G0I A;  3OEM A;  3N26 A;  2A5S A;  1LCT A;  1M5D A;  1Q9D A;  3GXA A;  3Q27 A;  3K6X A;  5DVJ A;  2Y7I A;  1MXZ A;  3TCG A;  1BKA A;  1PC3 A;  5I59 B;  3K1P A;  2UXA A;  3KN3 A;  3VVF A;  4ISU A;  3PD8 A;  1B05 A;  4O7I A;  5ET5 A;  2RCA A;  1MRP A;  4YZZ A;  1A7L A;  2CZH A;  3E3K A;  4OEV A;  3V89 B;  5DT6 A;  1SW2 A;  1JEU A;  1CB6 A;  3G3H A;  1FQB A;  4OVQ A;  1AMF A;  4NF8 B;  4O7M A;  3K01 A;  3CFX A;  2F3B A;  3G3I A;  3A29 A;  3RN8 A;  1I6Q A;  1MQJ A;  5I57 B;  3HHF A;  1NUZ A;  3PUX E;  3ODB A;  4OWD A;  4O3C A;  4QF9 A;  2DXY A;  1TT1 A;  3KFM A;  4FAT A;  1B6H A;  2DVC A;  2ONK E;  5K2Y A;  2Q8M A;  4POW A;  1O64 A;  2WEF A;  1A8F A;  4R75 A;  5L8D A;  5AA4 B;  5L9O A;  1UTH A;  2E1S A;  5DW8 A;  5A5X A;  2DYX A;  3R7X A;  1MXX A;  1FPE A;  4KI0 E;  3FBP A;  4M4G A;  2UVI A;  1I69 A;  3EHU A;  4N4U A;  2IA4 A;  1RKM A;  2B65 A;  3BBR A;  1NNT A;  4RY1 A;  2I4B A;  3E79 A;  4L17 A;  4LP2 B;  2ONS A;  1KA1 A;  3CFL A;  3SET A;  5IM2 A;  4ZE9 A;  4FEC A;  1B7U A;  5ITO A;  2XWI A;  2XD2 A;  4O3A A;  4N17 A;  4PAF A;  1MG1 A;  3RTF B;  3ISP A;  5TP9 B;  5I2K B;  3V5A A;  1B52 A;  1JNF A;  2O7I A;  3M8U A;  1N0T A;  1FBD A;  3SDF A;  1XC1 A;  4N91 A;  1IXH A;  1H45 A;  2A5T A;  4P0G A;  3E9X A;  2Y5L A;  2I0C A;  3TEP A;  1JW1 A;  1A40 A;  5AE4 A;  2P3V A;  4I40 A;  3UP9 A;  3DM0 A;  4Q5T A;  4DIG A;  1SYH A;  4P0I A;  1FBF A;  4ZZE A;  1R1N A;  5ET6 A;  3TPA A;  1NI9 A;  3B6W A;  3G3F A;  4DI3 D;  5KCJ B;  2D21 A;  2HEU A;  5ICQ A;  3KZG A;  4JVC A;  1PBQ A;  3VXB A;  4U2R A;  4BDO A;  1FW0 A;  5L9M A;  4N8Y A;  2XXP A;  3HST A;  3UIF A;  2XA5 A;  2UVG A;  2WX9 A;  1IMF A;  4MIJ A;  4DXU A;  4F1Y A;  1DOT A;  1B40 A;  2NXO A;  4BDR A;  4XKP A;  4GWS A;  3H6V A;  4JSO A;  4UA8 A;  5DEX B;  4DI4 B;  2WYK A;  1IIW A;  4PF6 A;  4PFR A;  1RDZ A;  3K4U A;  4FOR A;  3W9V A;  2G29 A;  4I3Y A;  1OQH A;  2ANJ A;  4P8B A;  1FTK A;  1FTO A;  4OVR A;  4G8H A;  2M8C A;  1OLA A;  3G3J A;  1FQA A;  5H8Q B;  3K6W A;  3TOD A;  2DE4 A;  1NNP A;  2NOO A;  2REG A;  1NV3 A;  4MLV A;  3PD9 A;  3O97 A;  5AA3 A;  3FV2 A;  2F7C A;  2PCR A;  1A8E A;  3I5O A;  3Q26 A;  1DK4 A;  5DVF A;  4X1D A;  2ZYN A;  4PFB A;  4FIM A;  2GQ1 A;  1ATG A;  4C1T A;  1VDW A;  2HXW A;  4KYE A;  3IB0 A;  1XHY A;  2PYY A;  4NWD A;  3KOT A;  2OWS A;  3IOR A;  2HQ0 A;  4QBA A;  3O6G A;  3PUZ E;  5H8F B;  3OOA A;  4MAG A;  5DYH A;  1LBB A;  1FRP A;  4KHZ E;  4LZ8 A;  4U4S A;  4FAJ A;  5KDT B;  3S9L C;  2X7P A;  3OD7 A;  1ZBM A;  2QJE A;  1B3L A;  3KBR A;  4ND9 A;  3IOW A;  5BWJ A;  3RGY A;  4OVP A;  1PB9 A;  3GBB A;  3N6T A;  3ONM A;  3VDF A;  2F78 A;  1D3K A;  1LBV A;  3B8B A;  2MKZ A;  1OVT A;  1PEB A;  1GR2 A;  2F7A A;  3R26 A;  1SW1 A;  2VT5 A;  1N3X A;  1B7Z A;  3A3U A;  3U65 A;  4U23 A;  4H1X A;  1Y9U A;  1URD A;  2W7Y A;  1UTB A;  2Q88 A;  1QGX A;  3TTM A;  3SEW A;  2BJI A;  2DS9 A;  4R73 A;  2R9J A;  4ZEB A;  4GX6 A;  1LBC A;  2OCU A;  1FPL A;  4P47 A;  1MXY A;  1BK4 A;  4R2F A;  3MP6 A;  3SEU A;  2Z8E A;  4LN5 A;  2FIX A;  1A54 A;  4G68 B;  5KZT A;  1Y3Q A;  3B6Q A;  4H0W A;  2PT2 A;  4OYV A;  3PPQ A;  4ZDM A;  3QK6 A;  4WKM A;  4R6H A;  5FHN A;  4NF5 A;  3CI8 A;  2DWA A;  3I3V A;  5CM6 A;  1HSJ A;  3OEK A;  3CVG A;  1NNF A;  3G3G A;  3JZJ A;  3T66 A;  1Y4T A;  3FAT A;  4EDP A;  4ZZA A;  3Q29 A;  2O84 X;  4OES A;  3ECR A;  3TMG A;  4I8C A;  3Q25 A;  1Y1Z A;  3LUY A;  3WAF A;  1MXU A;  1TFD A;  4G2Z A;  4PDD A;  5TU0 A;  1FPJ A;  2I6E A;  1QVS A;  1FCK A;  3QYT A;  3MVW A;  1USY E;  4XXU A;  3O29 A;  3C34 A;  2KQZ A;  4RK2 A;  2R8T A;  4RPN A;  4N15 A;  4YMB A;  3VE1 B;  2Z8D A;  1QUJ A;  1MY4 A;  4ECF A;  1K9Y A;  1JQF A;  4IO2 A;  4N8G A;  5ELV A;  1QUL A;  3QSL A;  2ALU A;  5FTH A;  5AA1 A;  3H06 B;  4WED A;  2NUV A;  4U22 A;  1INP A;  4IO3 A;  3OO9 A;  1FPK A;  1TXF A;  1ANF A;  1R9Q A;  4LQ5 A;  2I48 A;  3EKI A;  3HCQ A;  5CMC A; 
#chains in the Genus database with same CATH homology
 1B0L A;  1LB8 A;  3C32 A;  3IJX B;  3K00 A;  3O28 A;  1MDP 1;  2UYE A;  3B6T A;  3IOU A;  4XKQ A;  1FTL A;  2ZYO A;  1ZMG A;  4TLM B;  3VLU A;  4POX A;  1OQG A;  3TTN A;  3TFL A;  2ZYM A;  1Q35 A;  3OXN A;  1B4H A;  3PMV A;  1B32 A;  2IEE A;  4EQ9 A;  4EF2 A;  3D4C A;  4OFO A;  3O2A A;  4JWO A;  3OEL A;  3I6V A;  2F5X A;  3B7D A;  3TQL A;  4XKN A;  5H8S A;  1LGB C;  3K6U A;  3DP4 A;  2AIX A;  4BLA A;  2HZK A;  1MM6 A;  4GOT A;  1QKB A;  2V3T A;  4IGT A;  4R2B A;  4N07 A;  4YU0 A;  1XVX A;  2I3V A;  3K6V A;  2H98 A;  1Q1K A;  4AQ4 A;  1JVY A;  4FJP A;  3C4M A;  3O9P A;  5I56 B;  2X7Q A;  4BDQ A;  2VGQ A;  4BDM A;  4AB5 A;  3FD3 A;  2RC9 A;  3OO8 A;  3H6T A;  1P1W A;  1LAF E;  2V84 A;  4GL0 A;  4K3F A;  4P11 A;  4GFR A;  5FHO A;  1YPN A;  4JWX A;  1SBP A;  4F31 B;  4TLL B;  2DE2 A;  3ILT B;  2DP8 A;  1LFH A;  1BIY A;  4OQO A;  4C0R A;  5M2V A;  1YTV A;  1Z7M E;  3ZKL A;  2QRY A;  3TUS A;  3TQW A;  3RPW A;  3RUM A;  3K2D A;  4QFN A;  4LVQ A;  3MQ9 A;  1NH8 A;  3LSF B;  4OXV A;  2D5W A;  4GD5 A;  2OBG A;  5JTY B;  1QKA A;  1MS7 A;  3TZA A;  3GLB A;  1MQD A;  4HS7 A;  3KOS A;  4YKI A;  4OTE A;  3H6W A;  3PV0 E;  4H8J A;  5TPA A;  3T93 B;  2XX7 A;  4ZE8 A;  3FIR A;  3THI A;  4F22 A;  4QSC A;  3QUJ A;  4OMB A;  1TFA A;  1FQC A;  1O63 A;  4YMA A;  2YJP A;  2RF1 A;  3ZKK A;  3OSR A;  3K1M A;  3QIM A;  4MF3 A;  2QMX A;  1J1N A;  3OO6 A;  4EQ7 A;  3PU5 A;  1IEJ A;  4G4P A;  1AH5 A;  4F29 A;  1JVX A;  2O6A A;  2FYI A;  3N94 A;  4EXK A;  3IL1 B;  4RPO A;  3TTR A;  2H9B A;  2GH9 A;  3FJM A;  2XXY A;  3IAZ A;  4LA9 A;  3BFT A;  1RYO A;  3VFJ A;  1JW4 A;  4E0W A;  2F8D A;  3CG1 A;  4WEP A;  2ABH A;  5H8H B;  2DWI A;  2QPQ A;  2D3I A;  1H76 A;  2LAO A;  2O68 A;  4IO4 A;  1S7Y A;  4ZEI A;  3DP8 A;  1FTJ A;  2R71 A;  3UN6 A;  2XXT A;  3CG3 A;  3OSQ A;  3U92 A;  4ZEK A;  3BKI B;  3L6H A;  5CC2 A;  2XXW A;  4U1Z A;  2DWJ A;  2QS4 A;  3S9N C;  1SI0 A;  1SQY A;  4YKJ A;  4F3P A;  1UTB B;  3KN8 A;  4IB2 A;  4RA1 A;  2V25 A;  1LAG E;  5H8N B;  4HCY A;  3IB1 A;  3MPK A;  4FED A;  3LBS A;  1ZTY A;  3M3F A;  1MH3 A;  3SES A;  1B1H A;  3TYH A;  2Q2C A;  3FJ7 A;  4ZEC A;  4RJZ A;  4JDF A;  3MJN A;  3G7W A;  2XD3 A;  3T9U A;  2E0S A;  4NF8 A;  4FEB A;  1N7W A;  3TEL A;  5HPQ A;  1S50 A;  5CMK A;  2P1S A;  3T22 A;  1URG A;  3M3K A;  2F7B A;  2ZXT A;  3QUF A;  3H3G A;  4E0X A;  4JSD A;  1ZLQ A;  5AA4 A;  1H44 A;  5B7D A;  3MC2 A;  1B3G A;  2UVJ A;  3ZSF A;  3U1O A;  4MH5 A;  5JK4 A;  1NNK A;  3VLV A;  4OER A;  2Z23 A;  4Z7E A;  4HTG A;  1WDN A;  3V8X B;  3W9W A;  1PB7 A;  1Z7N E;  1AL3 A;  5AA2 B;  4YKK A;  2Z8F A;  4RNS A;  3ILU B;  3SKP A;  1MQI A;  5TP9 A;  1D9V A;  5I2K A;  4QFO A;  1DSN A;  4H8I A;  2NWJ A;  2B3F A;  3CR9 A;  4ELR A;  2XXQ A;  1GV8 A;  3PMW A;  1P99 A;  3MW0 A;  3T9X B;  4DZ1 A;  1B2H A;  3LSL A;  4HCW A;  1SW4 A;  3IR1 A;  1VFE A;  3KEI A;  2I4C A;  1B3E A;  1R9L A;  4U21 A;  4UAC A;  4ZEF A;  3TTL A;  3E13 X;  2RCB A;  2O51 A;  1H43 A;  3HN0 A;  3JV9 A;  4XKR A;  3FXU A;  4EF1 A;  3FJG A;  3FVN A;  1GTK A;  1EZP A;  4NF6 B;  3MAM A;  2Y7W A;  5AA2 D;  4RK9 A;  3KSX A;  5HM4 B;  1WOD A;  5DEX A;  1B5I A;  3RT6 B;  4PFW A;  3GBA A;  3H03 A;  1A99 A;  1POT A;  4R72 A;  2O1L A;  2HAU A;  4GQO A;  4GRK A;  3A09 A;  5CRY A;  1PB8 A;  4NF4 A;  3Q28 A;  2PX1 A;  1B58 A;  1B7H A;  1P1U A;  2BJJ X;  1Y4C A;  3PUY E;  5H8Q A;  3R6U A;  5F7V A;  3USD A;  2Q8J A;  4H5F A;  2V3U A;  3E4R A;  4NWC A;  4LQ2 A;  1IXC A;  3UGW A;  3HV1 A;  2FNC A;  2NVU B;  4OEN A;  4ELQ A;  2DXR A;  2H25 A;  1JEV A;  3C9H A;  1IQ7 A;  3U8Q A;  1MPD A;  2ZYK A;  1N3W A;  4HW8 A;  4PFU A;  3EHT A;  3VXC A;  2XXH A;  4KCD A;  2RKM A;  2O1M A;  1Y20 A;  4F2Q A;  4F3S A;  3V83 A;  4DXB A;  5I2N A;  3F11 A;  3RTW B;  4Q0C A;  4KR5 A;  1EZ9 A;  3H4Z A;  3RNN A;  3VLW A;  5TPA B;  3OEN A;  1PDA A;  1TWY A;  4MLQ A;  3PPO A;  1MQH A;  3TTK A;  3IB2 A;  2PBW A;  4Q30 B;  1DTG A;  4H65 A;  3IK6 B;  2OWT A;  3PUV E;  3HO7 A;  4R6K A;  1B1X A;  1UTH B;  4MBP A;  4DCX A;  1IIT A;  5A5X B;  2GFE A;  2XXX A;  3FAS A;  3PUW E;  1MXV A;  3FXR A;  3QAX A;  2QL3 A;  1QW0 A;  1US5 A;  2DQV A;  5I84 A;  4M1V A;  4U1O A;  2I49 A;  1LST A;  4NMY A;  5FHM A;  4QSE A;  4Q8R A;  5EHS A;  4N6P A;  3SEY A;  3IO4 A;  1D4N A;  5DTB A;  5IAI A;  4IO7 A;  2RC7 A;  3T9H B;  4G68 C;  3K0V A;  1NL5 A;  3MP1 A;  2F35 A;  2F6G A;  1ELJ A;  4JWY A;  3K1N A;  1LLS A;  1XVY A;  2Q9T A;  4G68 A;  1MM7 A;  3UK4 A;  3HHG A;  1VFD A;  4LUB A;  2VOZ A;  1OIB A;  2A5T B;  1NKX A;  4KQP A;  5LOM A;  4ONY A;  4GVO A;  4IO6 A;  2HCA A;  1XOC A;  1MY1 A;  1N04 A;  5ITP A;  1M5B A;  2OZZ A;  3TKD A;  3FV1 A;  2PMS A;  5K2X A;  3IX1 A;  3FVG A;  5EYF A;  2H5Y A;  3T96 B;  2ZNU A;  3EQ1 A;  4WXJ A;  2UYF A;  1LFI A;  1EH3 A;  1SYI A;  5B70 A;  2I3W A;  1QUI A;  4F19 A;  4FE8 A;  1SI1 A;  5ICT A;  4THI A;  4F1U A;  1BP5 A;  5I58 A;  1O7T A;  3OO7 A;  1B0H A;  4ZS9 A;  4GXA A;  3IO6 A;  2GHB A;  3LC8 A;  3MVZ A;  1OMP A;  1LAX A;  3S4U A;  1M5E A;  1KWH A;  1S9T A;  1MY0 A;  4JXI A;  4DCY A;  1B5J A;  1YCJ A;  4I9D A;  4JB7 A;  2YLN A;  4QFP A;  4MFI A;  4PP0 A;  2XXI A;  4OFJ A;  3W15 C;  3O6H A;  3DLN A;  4OET A;  1F9B A;  1B3F A;  1B3H A;  1FQF A;  3G3K A;  2F34 A;  3KJT A;  4KFQ A;  2O7U A;  4AB6 A;  1P1N A;  4ELO A;  3D4G A;  2DOJ A;  3FVK A;  1Y3P A;  3MVX A;  2UVH A;  1ZU0 A;  4F18 A;  4DLD A;  2DSF A;  1M5C A;  3SEX A;  3KGC A;  3A3C A;  3MVY A;  3DEL B;  1AOV A;  3MWB A;  3S9E A;  3U72 A;  4KYD A;  4IY5 A;  2KLF A;  4QHQ A;  1MY2 A;  4ZED A;  3RQT A;  1VE4 A;  4GL8 A;  1FQE A;  4YKP A;  1HSL A;  1A55 A;  4NTL A;  2V3Q A;  5I56 A;  3LR1 A;  4F3G A;  4ESX A;  1P1O A;  1JW5 A;  3FZV A;  1LB9 A;  1OLC A;  1URS A;  4PQJ A;  4RXL A;  1JET A;  1MQG A;  1EZO A;  3VVD A;  1DPE A;  2QSX A;  2RIN A;  3HPI A;  1MY3 A;  4H6D A;  5I59 A;  3U93 A;  3UOR A;  3VVE A;  1VR5 A;  2RC8 A;  3LSX A;  2VD3 A;  1P1Q A;  3TDJ A;  2ZNS A;  4F3B A;  4GIZ A;  1CE2 A;  1WVJ A;  3JYR A;  1MH4 A;  1MPB A;  1XT8 A;  3S9M C;  4NF5 B;  5EHM A;  1QJM A;  3EHS A;  3EPE A;  4X9T A;  4YB7 A;  4U4X A;  5I57 A;  5JTY A;  1BTJ A;  4IGR A;  3FGS A;  3CIJ A;  3MP8 A;  3CRB A;  3LSW A;  3PPP A;  4NF4 B;  1IXG A;  1SD3 A;  3MBP A;  2I58 A;  4I1D A;  4PET A;  3O66 A;  4ELP A;  2DE3 A;  4GXS B;  4N13 A;  1NMU A;  1USY H;  2FA7 A;  5FTI A;  1POY 1;  5J1D A;  3U94 A;  4R9F A;  4NE4 A;  3FVO A;  5F1Q A;  4R6Y A;  5IKB A;  4GF8 A;  2ZNT A;  3AXF A;  1N84 A;  4PFT A;  2ONR A;  4KD5 A;  2P2A A;  3OMB A;  2XXU A;  1SVX B;  2VD2 A;  2P0S A;  3EN3 A;  1IXI A;  2VP1 A;  4QRZ A;  3BFU A;  1B9J A;  2ESN A;  4XIG Q;  4R9G A;  2REJ A;  3ZS6 A;  4TQU Q;  2AL4 A;  3S2V A;  5I2N B;  3KSJ A;  1ZIU A;  3TAJ A;  4OEU A;  1LAH E;  5H8H A;  1GGG A;  2WKY A;  1FQD A;  3FUZ A;  5L9S A;  3C31 A;  4OVJ A;  2Z22 A;  2H4I A;  4F2O A;  1B46 A;  1BLF A;  3WAE A;  4R74 A;  4TOZ A;  1Y3N A;  4DDD A;  4PFY A;  3IOT A;  5CBR A;  4NED A;  1B51 A;  1US4 A;  3QXM A;  1Y1M A;  1DPP A;  1PBP A;  4JBZ A;  4LZ7 A;  1QUK A;  4C1U A;  3SER A;  4DE8 A;  4ESW A;  5DVI A;  3KG2 A;  5KCJ A;  2HAV A;  4YIC A;  5CBS A;  2QMW A;  4LZ5 A;  2PT1 A;  2OK2 A;  4EXL A;  5H8N A;  1ZKB A;  3M3L A;  3MZ9 A;  1L5T A;  4Z0I A;  4QFK A;  1YAE A;  4IO5 A;  1I6A A;  2F97 A;  2GHA A;  1N7X A;  3GZG A;  2ZMB A;  1M5F A;  2AYS A;  2THI A;  2Y7R A;  3MZB A;  3RY3 A;  2V93 A;  4O3B A;  2XX8 A;  1SDX A;  4F1V A;  1DMB A;  1R6Z A;  1AIV A;  3MZ1 A;  4X48 A;  1MDQ A;  2F6P A;  1VSO A;  1NH7 A;  3MPL A;  1B4Z A;  1UIU A;  1IUD A;  2G93 A;  1HSE A;  3K02 A;  4YB5 A;  2Y84 A;  3FXQ A;  4BDL A;  3C36 A;  2Q89 A;  1RYX A;  2XXV A;  3C35 A;  4LAT A;  2DWH A;  1UIV A;  4GLI A;  1OVB A;  2XXR A;  4GWO A;  3N5L A;  4LON B;  1B5H A;  1IZ1 A;  3EF7 A;  2DVZ A;  1XS5 A;  1N76 A;  3IJO B;  2F36 A;  2O69 A;  3MUQ A;  2VHA A;  1T0K A;  2I0B A;  4G8N A;  1UQW A;  1D9Y A;  4YAH X;  3UA8 A;  5I58 B;  3H6U A;  3O6I A;  2AL5 A;  4F39 A;  3KJ7 A;  4H5G A;  5H8F A;  4EQB A;  1NFT A;  3TCH A;  1DTZ A;  4QSD A;  1MPC A;  2OLB A;  5AA2 A;  2XHD A;  3N6U A;  4G8M A;  4BDN A;  4QFL A;  5KDT A;  2HZL A;  2CZL A;  3CFZ A;  3H7M A;  1ZJL A;  5CI5 A;  1I6B A;  4RYA A;  2OJT A;  4X1B A;  3SEV A;  2Y7K A;  3VV5 A;  2XX9 A;  5BUU A;  2YPN A;  3T9V A;  1LFG A;  4KYS A;  2CMO A;  1GVC A;  3L6G A;  3PGF A;  4KCC A;  4XTC Q;  2H99 A;  4OFL A;  2GRV A;  2PVU A;  2QS2 A;  2QS3 A;  3RLF E;  1SW5 A;  1H3D A;  5CMM A;  4PE5 B;  3PPR A;  3P7I A;  1MXW A;  3RT8 A;  1EU8 A;  1LCF A;  3DP6 A;  4G77 A;  3PPN A;  4KPT A;  2Q2A A;  5JEI A;  4NF6 A;  3CSG A;  2B3B A;  2Y7P A;  3CSB A;  2R6G E;  1II5 A;  4OHN A;  5HBC A;  4I62 A;  2QS1 A;  3PMX A;  5ISU A;  4OZ9 A;  2HFB A;  4IY6 A;  2X26 A;  3KN7 A;  3IOV A;  4H67 A;  4YB6 A;  3TCF A;  3C33 A;  1FTM A;  4EUO A;  4DXC A;  5CMB A;  3OEM A;  3N26 A;  2A5S A;  1LCT A;  1M5D A;  3GXA A;  3Q27 A;  3K6X A;  5DVJ A;  2Y7I A;  1MXZ A;  3TCG A;  1BKA A;  1PC3 A;  5I59 B;  3K1P A;  2UXA A;  3KN3 A;  3VVF A;  4ISU A;  3PD8 A;  1B05 A;  2RCA A;  1MRP A;  4YZZ A;  1A7L A;  3E3K A;  4OEV A;  3V89 B;  5DT6 A;  1SW2 A;  1JEU A;  1CB6 A;  3G3H A;  1FQB A;  1AMF A;  4NF8 B;  3K01 A;  3CFX A;  3G3I A;  3RN8 A;  1I6Q A;  1MQJ A;  5I57 B;  3HHF A;  3PUX E;  3ODB A;  4OWD A;  4O3C A;  4QF9 A;  2DXY A;  1TT1 A;  3KFM A;  4FAT A;  1B6H A;  2DVC A;  2ONK E;  5K2Y A;  4POW A;  1O64 A;  1A8F A;  4R75 A;  5L8D A;  5AA4 B;  5L9O A;  1UTH A;  2E1S A;  5A5X A;  2DYX A;  3R7X A;  1MXX A;  4KI0 E;  4M4G A;  2UVI A;  1I69 A;  3EHU A;  2IA4 A;  1RKM A;  2B65 A;  3BBR A;  1NNT A;  4RY1 A;  2I4B A;  4L17 A;  4LP2 B;  2ONS A;  3CFL A;  3SET A;  4ZE9 A;  4FEC A;  1B7U A;  5ITO A;  2XD2 A;  4O3A A;  1MG1 A;  3RTF B;  5TP9 B;  5I2K B;  3V5A A;  1B52 A;  1JNF A;  2O7I A;  3M8U A;  1N0T A;  3SDF A;  1XC1 A;  1IXH A;  1H45 A;  2A5T A;  4P0G A;  3E9X A;  2I0C A;  3TEP A;  1JW1 A;  1A40 A;  5AE4 A;  3UP9 A;  3DM0 A;  4Q5T A;  4DIG A;  1SYH A;  4P0I A;  4ZZE A;  1R1N A;  3TPA A;  3B6W A;  3G3F A;  5KCJ B;  2D21 A;  2HEU A;  5ICQ A;  3KZG A;  1PBQ A;  3VXB A;  4U2R A;  4BDO A;  1FW0 A;  5L9M A;  2XXP A;  3HST A;  3UIF A;  2UVG A;  4DXU A;  4F1Y A;  1DOT A;  1B40 A;  2NXO A;  4BDR A;  4XKP A;  3H6V A;  4JSO A;  4UA8 A;  5DEX B;  1IIW A;  3K4U A;  4FOR A;  3W9V A;  2G29 A;  1OQH A;  2ANJ A;  1FTK A;  1FTO A;  4G8H A;  2M8C A;  1OLA A;  3G3J A;  1FQA A;  5H8Q B;  3K6W A;  3TOD A;  2DE4 A;  1NNP A;  2NOO A;  2REG A;  4MLV A;  3PD9 A;  3O97 A;  5AA3 A;  3FV2 A;  2F7C A;  1A8E A;  3I5O A;  3Q26 A;  5DVF A;  4X1D A;  2ZYN A;  4FIM A;  1ATG A;  4C1T A;  2HXW A;  4KYE A;  3IB0 A;  1XHY A;  2PYY A;  4NWD A;  3KOT A;  2OWS A;  3IOR A;  2HQ0 A;  3O6G A;  3PUZ E;  5H8F B;  3OOA A;  5DYH A;  1LBB A;  4KHZ E;  4LZ8 A;  4U4S A;  4FAJ A;  5KDT B;  3S9L C;  2X7P A;  3OD7 A;  1ZBM A;  2QJE A;  1B3L A;  3KBR A;  4ND9 A;  3IOW A;  5BWJ A;  3RGY A;  1PB9 A;  3GBB A;  3N6T A;  3ONM A;  3VDF A;  2F78 A;  1D3K A;  1OVT A;  1PEB A;  1GR2 A;  2F7A A;  3R26 A;  1SW1 A;  1N3X A;  1B7Z A;  3A3U A;  4U23 A;  4H1X A;  1Y9U A;  1URD A;  2W7Y A;  1UTB A;  2Q88 A;  3TTM A;  3SEW A;  2DS9 A;  4R73 A;  2R9J A;  4ZEB A;  1LBC A;  2OCU A;  1MXY A;  4R2F A;  3MP6 A;  3SEU A;  2Z8E A;  1A54 A;  4G68 B;  5KZT A;  1Y3Q A;  3B6Q A;  4H0W A;  2PT2 A;  4OYV A;  3PPQ A;  4ZDM A;  3QK6 A;  4WKM A;  4R6H A;  5FHN A;  4NF5 A;  3CI8 A;  2DWA A;  3I3V A;  5CM6 A;  1HSJ A;  3OEK A;  3CVG A;  1NNF A;  3G3G A;  3JZJ A;  3T66 A;  1Y4T A;  3FAT A;  4EDP A;  4ZZA A;  3Q29 A;  2O84 X;  4OES A;  3ECR A;  3TMG A;  4I8C A;  3Q25 A;  1Y1Z A;  3LUY A;  3WAF A;  1MXU A;  1TFD A;  4G2Z A;  5TU0 A;  2I6E A;  1QVS A;  1FCK A;  3QYT A;  3MVW A;  1USY E;  4XXU A;  3O29 A;  3C34 A;  4RK2 A;  4RPN A;  4YMB A;  3VE1 B;  2Z8D A;  1QUJ A;  1MY4 A;  4ECF A;  1JQF A;  4IO2 A;  5ELV A;  1QUL A;  3QSL A;  2ALU A;  5FTH A;  5AA1 A;  3H06 B;  4WED A;  2NUV A;  4U22 A;  4IO3 A;  3OO9 A;  1TXF A;  1ANF A;  1R9Q A;  4LQ5 A;  2I48 A;  3HCQ A;  5CMC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...