1SI1A

Crystal structure of mannheimia haemolytica ferric iron-binding protein a in an open conformation
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRVGKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKPQGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAKNYEAALKLVDEVKFDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords iron binding protein FbpA
publication title Structural basis for iron binding and release by a novel class of periplasmic iron-binding proteins found in gram-negative pathogens.
pubmed doi rcsb
source organism Mannheimia haemolytica
total genus 126
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1si1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1si1A02
2ZMBA 4GQOA 3HHGA 1B05A 1A55A 5JK4A 3PGFA 2GRVA 4QRZA 4OWDA 1LFIA 3VVDA 4YZZA 2DQVA 3RT6B 4MLQA 1Y4CA 3V83A 2PBWA 3SESA 3RPWA 2O84X 2Z8FA 3L6HA 4X48A 3VV5A 3IJXB 4BLAA 1LSTA 1XS5A 1JETA 1FCKA 2QSXA 2X7PA 3K2DA 3Q28A 1Y9UA 4OQOA 5L9SA 3S9EA 2HZKA 1RKMA 3SKPA 4MF3A 4N6PA 5FHNA 1CE2A 4F1VA 4ZDMA 2FNCA 1SD3A 1YAEA 3KOTA 3BBRA 2R9JA 1FTJA 4QFKA 5I2KA 3JZJA 2O7IA 2YLNA 4TOZA 3OD7A 2OWTA 4XXUA 1SYHA 2H99A 4M1VA 5H8NA 3QSLA 3IOVA 1XOCA 5CMKA 1Q1KA 1LFHA 5TPAA 2G29A 3TQLA 2UVIA 2F5XA 4LUBA 3MVZA 3QYTA 4WEDA 2DYXA 4G68C 3TODA 4QSCA 3KN3A 1ZTYA 3KN7A 4EUOA 3B6WA 1AOVA 4P11A 5KCJB 4R2FA 3N6TA 3H6TA 2Q9TA 4NF5A 1TT1A 1OQGA 1Y20A 1BTJA 4RY1A 4ZEDA 3SEWA 3S9LC 2RC9A 4O3CA 3MJNA 3T66A 1IXCA 2R71A 1B40A 3G3KA 3PUXE 3MPLA 4ECFA 3BFTA 2Q89A 2DS9A 3SEUA 3UN6A 4ZZAA 5JTYB 4XKRA 3ILUB 3C4MA 5ELVA 4KD5A 2XD2A 3E9XA 4F3GA 3KSXA 3D4CA 1NL5A 1GV8A 5DVIA 4R73A 3MP6A 1SW5A 3O6IA 1IZ1A 1S50A 3HV1A 4UACA 1QUJA 1AL3A 4RPOA 5I59A 2DOJA 3LBSA 3TPAA 3WAFA 3T9HB 2Z8EA 3MVYA 2X7QA 4DXCA 4U1ZA 1QVSA 4F2QA 5I84A 1HSEA 5I56B 2XXXA 4C0RA 4RYAA 2RINA 5I2KB 1B3HA 1MXVA 4IO2A 3EHUA 5L9MA 3I6VA 3FZVA 4G8HA 1ANFA 2QMWA 3W9VA 4LONB 4OYVA 1LGBC 1FTKA 5H8NB 1P1WA 3RLFE 1FQDA 1EZPA 3K6VA 3HCQA 3OXNA 3S4UA 3G3JA 2V93A 2XHDA 1OVTA 4RJZA 2V3QA 3B7DA 5DYHA 4Z0IA 2XXTA 4ZECA 1L5TA 4U21A 3PMVA 3TCFA 4FE8A 2F35A 4MBPA 1HSLA 1UQWA 1SVXB 3K4UA 3VE1B 3IOTA 1OIBA 3IO4A 3O2AA 4NF5B 1FTMA 2QRYA 3CI8A 4LQ5A 3UA8A 2I58A 3IB2A 4U4XA 1B3EA 4NF8A 1GR2A 1DMBA 2O1LA 3ZKKA 3E13X 4ESWA 3FVGA 1IQ7A 1WVJA 5B70A 1B7ZA 1SW1A 1B58A 3FGSA 1N84A 2B65A 4RPNA 4XIGQ 5H8HA 1RYOA 4YMBA 4R72A 3TFLA 3I3VA 4KPTA 2QS3A 3CG1A 4RNSA 4PE5B 3RN8A 3HO7A 1UTHB 2F36A 4NF6A 1JQFA 3DELB 3ECRA 1PBQA 4EXKA 4YB5A 3H06B 3BFUA 2CZLA 4OFLA 4JXIA 1NH7A 1JVYA 1LLSA 4U23A 4N13A 3U1OA 1DTZA 2P0SA 2WKYA 1D9YA 3PUVE 1M5DA 3IJOB 2IA4A 2XXVA 4R2BA 4MLVA 2O6AA 3T96B 3ZSFA 4U1OA 2I0BA 4POXA 4F31B 1PB8A 1NKXA 1IEJA 1FTLA 5H8FB 4GVOA 4H5FA 2Q8JA 1NNKA 3O97A 3EHTA 3GXAA 4R6HA 3BKIB 2GH9A 1H43A 3CFXA 1FQBA 1MXYA 1LCFA 1PC3A 4JB7A 1IIWA 1P1UA 1US4A 2PT1A 1S7YA 1ZMGA 3QUJA 4OENA 2DWHA 1CB6A 3TTRA 2I3VA 2H9BA 4TQUQ 1JVXA 4K3FA 1USYH 1SI1A 3FVKA 4IO5A 2REJA 3MZ9A 2VHAA 1EH3A 1AMFA 4DZ1A 3D4GA 3MP8A 2NOOA 4H5GA 4ELRA 3SEYA 4EF1A 2IEEA 2I6EA 4R9FA 1H45A 4WEPA 2THIA 1N04A 2W7YA 3LC8A 3V5AA 1MXWA 1Z7ME 2UVJA 4KYSA 5IKBA 2ZNTA 1EZ9A 2R6GE 3FJGA 4GXSB 4JBZA 3MC2A 2YJPA 4FJPA 4H0WA 3CIJA 3G3IA 1DOTA 2D5WA 1ZIUA 1N0TA 3VLUA 4QFNA 4LVQA 3U94A 3TTKA 2NWJA 1JEVA 3TCHA 5KCJA 1B5JA 1NNFA 4QSDA 4ZS9A 1I6QA 4RXLA 1VSOA 4OVJA 1JW1A 2BJJX 3LSLA 2PX1A 3W15C 4OMBA 3C35A 5FTIA 4XTCQ 2RCAA 2HCAA 5ITOA 2Z22A 1Q35A 2DWIA 3CFLA 3K00A 5CBRA 3Q29A 4F3BA 4NF6B 1M5CA 3RY3A 4FATA 1TWYA 5JTYA 1Y1MA 4U2RA 2DXRA 5I58A 3SERA 1USYE 3TQWA 3VLWA 4X1BA 4ZEIA 2HXWA 4F3PA 4H1XA 3RTFB 4BDNA 2UVHA 2DWJA 1D9VA 2F6PA 4PFWA 1FQEA 3TTLA 1S9TA 3GZGA 3CG3A 4GL8A 2HEUA 1VR5A 1I6BA 4AB6A 5AA4A 3OEKA 2I48A 1TFDA 3K01A 4RK9A 4F29A 3MZ1A 3QIMA 5HM4B 1DTGA 4GIZA 1QJMA 1BKAA 4PQJA 4UA8A 4BDRA 4DE8A 1MQDA 3OMBA 1POY1 4G77A 1P99A 3RTWB 5L9OA 4YKPA 2PMSA 5I56A 3ODBA 2HFBA 1KWHA 1NMUA 1US5A 1NNTA 2XXUA 3EQ1A 2RF1A 3HHFA 4GXAA 2AYSA 3SEXA 3HPIA 3UGWA 3RT8A 2RCBA 1FQCA 3C34A 5AA2B 5EYFA 1JW4A 2B3FA 4DDDA 3FXRA 2I4BA 3VLVA 4I1DA 3PPNA 3UIFA 1PB7A 3FV1A 3VVFA 3GBBA 1MQGA 4ZEKA 1P1QA 4C1UA 3KOSA 4BDQA 2V3UA 1MH4A 4OERA 2XXQA 3H6VA 3PD8A 3G3FA 1LAGE 4O3AA 3ZS6A 4XKQA 4OEVA 2FA7A 1MM7A 1B3GA 1TFAA 2ANJA 1B51A 2Y7RA 2QPQA 4FAJA 4E0WA 4KYDA 4Q0CA 2YPNA 2VD3A 5CC2A 2XXYA 1BP5A 3MPKA 5CBSA 1FW0A 3A3UA 3H3GA 2Y7WA 3H4ZA 2DXYA 1IXIA 3IB0A 4NF4A 1PB9A 5I58B 3LSXA 2REGA 2VD2A 1UTHA 5B7DA 2QMXA 2GHAA 4QF9A 4DXUA 3MVWA 3ONMA 1VFDA 1B32A 5FTHA 1VE4A 3MAMA 3QK6A 1XVXA 4DIGA 4DCYA 3O29A 2ZXTA 1B0LA 4RA1A 2H4IA 3M3LA 3RQTA 1WODA 2RC8A 5AA4B 4OZ9A 4QFPA 3MBPA 4H8IA 3PPRA 5H8FA 3FASA 3LSFB 3MQ9A 2PVUA 1GVCA 4LQ2A 2XD3A 3CSGA 3PU5A 4OEUA 4G68A 2V3TA 1B4ZA 1AIVA 4OXVA 3GLBA 4F1YA 3FXQA 4X9TA 3T9VA 2V25A 2Y84A 3Q26A 4TLLB 2OZZA 1B9JA 4NWDA 3OEMA 4KQPA 1MPBA 2F7AA 3T9XB 4IY5A 4LP2B 4EXLA 5K2XA 3K1MA 2O7UA 3CR9A 3T9UA 3G3GA 4HW8A 3LSWA 4IGRA 3FJ7A 2LAOA 3O6HA 1FQAA 1M5BA 3SETA 1UIVA 3VFJA 4PFYA 1Y3NA 3W9WA 1II5A 1B5IA 3B6TA 3DP6A 4Q5TA 4WXJA 3RUMA 3WAEA 2OWSA 1LAFE 1QULA 3PUZE 2KLFA 4XKNA 4F2OA 4O3BA 1T0KA 2I3WA 2D21A 1FQFA 2ZNUA 4P0GA 3SDFA 1URDA 3TUSA 3PPPA 2ONSA 3S9NC 2I0CA 2GHBA 3C9HA 4M4GA 2E0SA 4G8MA 3MW0A 4OETA 4KR5A 1ZKBA 4NF4B 3O66A 4YICA 1MDP1 4GFRA 3MZBA 1NNPA 4PETA 4XKPA 4NWCA 3ZKLA 2OK2A 1EU8A 3R6UA 3IOWA 4Z7EA 4F3SA 5A5XA 4EQBA 5ITPA 1R1NA 3TYHA 2D3IA 4OTEA 2O1MA 2ABHA 4DXBA 5ISUA 4DLDA 2XXPA 4NEDA 2G93A 3G7WA 3TELA 4QHQA 2RKMA 1POTA 2UXAA 1MPDA 2E1SA 2PT2A 3KJ7A 2Y7IA 4GL0A 4LATA 4DCXA 4IY6A 2GFEA 2F78A 1ZU0A 1MXXA 4G68B 3S9MC 5F7VA 3OOAA 5CI5A 1FTOA 1LAHE 1F9BA 4KHZE 4U4SA 3SEVA 5DVFA 5ICQA 3EPEA 4THIA 4OHNA 3FUZA 3JV9A 3OO7A 3M3FA 4OFOA 5TP9B 3E3KA 3IO6A 1QKAA 2VOZA 3KGCA 4POWA 4MH5A 5I57B 5AA2A 4HCYA 4ZE8A 3O9PA 1NH8A 5F1QA 5JEIA 4F22A 4KCCA 4YKKA 3EN3A 1AH5A 3RNNA 3FD3A 1XC1A 1LBBA 2OJTA 4C1TA 1MXUA 2AL4A 1JEUA 1QKBA 3TTNA 1MPCA 3P7IA 4PFTA 2NXOA 3TKDA 1Y1ZA 1SYIA 2DP8A 3N26A 2QL3A 3QUFA 5KDTA 4QFLA 1PDAA 4JWXA 4IO4A 3TTMA 3K1PA 3FVOA 1N3XA 3O6GA 5DT6A 1J1NA 2QS4A 3UP9A 4GOTA 1OVBA 3PMWA 2XXWA 4JSOA 1MQHA 2A5SA 2ZNSA 1Y4TA 4I62A 4YKIA 2A5TB 3VXBA 2F7BA 3PD9A 3TMGA 3FJMA 5FHOA 2ALUA 4FEBA 2DVCA 4ZZEA 2Q88A 1B3LA 2CMOA 5A5XB 3EF7A 4BDLA 1MY1A 1ELJA 5H8QA 4BDOA 1BLFA 1MY4A 2Y7PA 4R75A 2AIXA 3C31A 1BIYA 3OSQA 3KFMA 3PPQA 3UORA 4ZEFA 3FVNA 1DSNA 1B7HA 4GF8A 3S2VA 3UK4A 2M8CA 4JWYA 4NTLA 5EHMA 1N76A 1B5HA 4WKMA 3PUWE 1MG1A 4GWOA 2OBGA 3V89B 4ZEBA 4IO3A 4AQ4A 1MH3A 3KZGA 2P2AA 2ONRA 4NE4A 3VXCA 1A7LA 1DPEA 3E4RA 5AA1A 5CMCA 4E0XA 4JDFA 1MY0A 1A8FA 3G3HA 1LFGA 4HS7A 3OO6A 4FEDA 2OLBA 1XVYA 1LBCA 3R7XA 4IB2A 3CSBA 3R26A 3HSTA 3IL1B 5M2VA 4YB6A 3Q25A 4EF2A 5CMMA 2ZYKA 4ONYA 4ELQA 5IAIA 1EZOA 4F19A 2ZYOA 1N7WA 3MP1A 5L8DA 3IORA 1WDNA 3TAJA 4ND9A 1D4NA 1O63A 1H44A 4YKJA 2P1SA 4OESA 3DP4A 2F34A 3U72A 2O68A 1OQHA 4KFQA 5KDTB 1MY2A 1M5FA 4EQ7A 3Q27A 2VGQA 2QS1A 1Y3QA 2ZYNA 3CVGA 4FECA 4MFIA 3H6WA 3PV0E 1ATGA 1N7XA 5TU0A 1MQJA 2H25A 4EQ9A 3USDA 5EHSA 5HPQA 4YMAA 4LZ5A 1A54A 2ZYMA 4QFOA 2UVGA 4H6DA 5K2YA 2AL5A 1GTKA 5CM6A 5ICTA 4IO7A 1H3DA 2DE3A 3OENA 3FATA 1PEBA 2F6GA 5H8QB 2RC7A 5J1DA 1B2HA 4F1UA 4H65A 4ISUA 1I6AA 3K6XA 3AXFA 1R9LA 4F39A 3PPOA 3KG2A 1UIUA 2Y7KA 3THIA 1URGA 3VVEA 3C36A 4GRKA 3V8XB 1RYXA 4LZ7A 3T93B 4I9DA 4PP0A 3A3CA 5DEXA 2DVZA 3QXMA 3KN8A 5DVJA 1Y3PA 3CRBA 3FXUA 3IR1A 4JWOA 1MS7A 3PMXA 3MWBA 3TDJA 1HSJA 1IXGA 1LB8A 1PBPA 3U8QA 4GD5A 1I69A 1MXZA 1NFTA 3VDFA 1YPNA 2DWAA 2UYEA 3N6UA 1M5EA 4LZ8A 2NVUB 1ZLQA 1B1XA 4ELOA 1R9QA 2HQ0A 4LA9A 1YCJA 1VFEA 5TP9A 3IK6B 5I2NA 3MVXA 4Q8RA 1P1OA 4FIMA 1XHYA 1IITA 1A8EA 3OO9A 4RK2A 4I8CA 1B46A 1SDXA 5I57A 1A40A 3CFZA 2UYFA 3LUYA 5CRYA 1MRPA 3OSRA 3PUYE 2NUVA 1LAXA 5TPAB 2H98A 1D3KA 4R74A 1LCTA 1MDQA 3H03A 4KYEA 2Q2CA 5AA2D 1B3FA 1B0HA 3M3KA 2Q2AA 5CMBA 3H7MA 3I5OA 4IGTA 5KZTA 3DP8A 1R6ZA 2PYYA 3IAZA 4F18A 5HBCA 3H6UA 2XX8A 4FORA 2HAUA 3K1NA 3MUQA 2A5TA 3M8UA 3RGYA 2XXHA 4NMYA 1UTBA 1OLCA 2I4CA 3IX1A 3K6WA 3K0VA 4R6YA 3K02A 2OCUA 1ZBMA 2H5YA 3B6QA 2F8DA 3C32A 4L17A 2V84A 2ONKE 3IB1A 5FHMA 1XT8A 1YTVA 3DLNA 1O64A 4JSDA 5DEXB 2ESNA 2XXRA 3KSJA 1QUIA 1SW2A 4U22A 3FV2A 4AB5A 1GGGA 1B7UA 4HTGA 4KI0E 3KJTA 3T22A 3K6UA 3KEIA 5I59B 1B6HA 2XX7A 2DE4A 2Z23A 1JNFA 1QUKA 4YAHX 4X1DA 1B52A 4R9GA 3OO8A 4QSEA 1OMPA 4OFJA 1OLAA 3JYRA 2X26A 4R6KA 4ELPA 5AA3A 3TEPA 5I2NB 4EDPA 1TXFA 4YU0A 4PFUA 5AE4A 1N3WA 4TLMB 2XX9A 4H67A 2O51A 2DSFA 1ZJLA 3U93A 2VP1A 3C33A 1B4HA 3OELA 3QAXA 5LOMA 2QJEA 3IOUA 3L6GA 3A09A 4G8NA 1SW4A 3HN0A 1SQYA 4G2ZA 2QS2A 4GLIA 4P0IA 5BUUA 1SBPA 2FYIA 3O28A 1SI0A 1B1HA 3N94A 2I49A 1H76A 1IUDA 3LR1A 5DTBA 1DPPA 4HCWA 4Q30B 4KCDA 4N07A 4YB7A 4NF8B 4ESXA 3TCGA 5H8SA 1MQIA 3TZAA 4IO6A 1QW0A 2Z8DA 1MY3A 3EHSA 3N5LA 3FIRA 4ZE9A 1Z7NE 2O69A 1MM6A 1IXHA 5H8HB 3GBAA 1JW5A 2DE2A 3ILTB 4BDMA 2XXIA 2F7CA 2HZLA 5BWJA 1UTBB 2B3BA 3DM0A 1A99A 3KBRA 1URSA 4H8JA 3F11A 4G4PA 2F97A 3U92A 1LB9A 1P1NA 1O7TA 2HAVA
chains in the Genus database with same CATH superfamily
2ZMBA 4GQOA 3HHGA 1B05A 1A55A 5JK4A 3PGFA 2GRVA 3RPLB 4QRZA 4N8GA 1LBVA 4OWDA 1LFIA 3VVDA 4YZZA 2DQVA 2ZZVA 3RT6B 4MLQA 1Y4CA 3V83A 2PBWA 3SESA 3RPWA 2O84X 2Z8FA 3L6HA 4X48A 3VV5A 3IJXB 5T3JA 4BLAA 1LSTA 1XS5A 1JETA 4MJOA 1FCKA 4O94A 2QSXA 2X7PA 3KBZA 3K2DA 3Q28A 1Y9UA 4OQOA 5L9SA 3S9EA 2HZKA 1RKMA 3SKPA 4MF3A 4N6PA 5FHNA 1CE2A 4F1VA 4ZDMA 2FNCA 1SD3A 1YAEA 3KOTA 3BBRA 5EQ8A 2R9JA 1FTJA 4QFKA 5I2KA 3JZJA 2O7IA 2YLNA 4TOZA 3OD7A 2OWTA 4XXUA 1SYHA 2H99A 1JP4A 4M1VA 5H8NA 3QSLA 3IOVA 1XOCA 5CMKA 1Q1KA 5IZ3A 1LFHA 4X8RA 5TPAA 2CZHA 2G29A 3TQLA 2UVIA 2F5XA 1FSAA 4LUBA 3MVZA 3QYTA 4WEDA 2DYXA 4G68C 3TODA 4QSCA 3KN3A 1ZTYA 3KN7A 4EUOA 1RDXA 3B6WA 1AOVA 4P11A 5KCJB 4R2FA 4MIJA 3N6TA 3H6TA 2Q9TA 4NF5A 1TT1A 1OQGA 3KC0A 1Y20A 1BTJA 4RY1A 4ZEDA 4OVPA 3SEWA 3S9LC 2RC9A 1NV4A 4O3CA 3MJNA 3T66A 1IXCA 2R71A 1B40A 3G3KA 4GX3A 3PUXE 4N6DA 3MPLA 4ECFA 3BFTA 2Q89A 2DS9A 3SEUA 3UN6A 4ZZAA 5JTYB 4XKRA 3ILUB 5LTCA 3E79A 4PF6A 3C4MA 5ELVA 1DK4A 4KD5A 2XD2A 4PF8A 4N6KA 3E9XA 4F3GA 1FPEA 3KSXA 3D4CA 4N81A 2QVRA 5DW8A 1NL5A 1GV8A 5DVIA 4R73A 3MP6A 1SW5A 3O6IA 4OVSA 1IZ1A 2CEXA 1S50A 3HV1A 4UACA 1QUJA 1AL3A 4RPOA 5I59A 2DOJA 3LBSA 1NUWA 3TPAA 3WAFA 3T9HB 2Z8EA 3MVYA 2X7QA 4DXCA 4U1ZA 1QVSA 4PDHA 4F2QA 5I84A 1HSEA 5I56B 2XXXA 4C0RA 3BIGA 4MX6A 4RYAA 2RINA 5I2KB 1B3HA 1MXVA 4IO2A 3EHUA 5L9MA 3I6VA 3FZVA 4G8HA 1ANFA 2QMWA 3W9VA 1QGXA 4LONB 4OYVA 1LGBC 1FTKA 5H8NB 1P1WA 3RLFE 1FQDA 1EZPA 2XWOA 3K6VA 3HCQA 3OXNA 3S4UA 3G3JA 3QMFA 2V93A 2XHDA 2P3VA 2Q8MA 1OVTA 4RJZA 2V3QA 3B7DA 4GX4A 5DYHA 4Z0IA 5ET5A 2XXTA 4ZECA 1L5TA 4U21A 3PMVA 3TCFA 4FE8A 2F35A 4MBPA 1HSLA 1NV7A 1UQWA 1SVXB 1FRPA 3K4UA 3VE1B 3IOTA 4H46A 1OIBA 3RYDA 3IO4A 3O2AA 4NF5B 1FTMA 2OWZA 2Y5KA 2QRYA 3CI8A 4LQ5A 3UA8A 2I58A 5I3SA 3IB2A 4U4XA 1B3EA 4NF8A 1GR2A 1DMBA 2O1LA 2L5VA 3ZKKA 3E13X 4GWWA 4ESWA 3FVGA 1IQ7A 1WVJA 4QXDA 5B70A 1B7ZA 1SW1A 1B58A 3FGSA 1N84A 2B65A 4RPNA 4XIGQ 5H8HA 1RYOA 4YMBA 4R72A 3TFLA 2HXRA 3I3VA 4KPTA 2QS3A 3CG1A 4MEVA 4RNSA 4PE5B 3RN8A 3HO7A 1UTHB 2F36A 4NF6A 1JQFA 3DELB 3ECRA 1FPLA 4GX6A 1PBQA 4EXKA 4YB5A 3H06B 3BFUA 2CZLA 2WYKA 4JXIA 4OFLA 2WBDA 1NH7A 1JVYA 1LLSA 4U23A 4N13A 3U65A 3U1OA 1DTZA 2P0SA 2WKYA 5IZZA 1D9YA 3PUVE 1M5DA 3IJOB 2IA4A 2XXVA 4R2BA 4MLVA 2O6AA 3T96B 3ZSFA 4U1OA 2CEYA 2I0BA 4POXA 4F31B 1PB8A 1NKXA 1IEJA 1FTLA 5H8FB 4DI4B 4GVOA 4H5FA 2Q8JA 1DCUA 1NNKA 4NAPA 1NV5A 3O97A 3EHTA 4OA4A 1KZ8A 3GXAA 4R6HA 3BKIB 2F3DA 2GH9A 1H43A 4GWYA 3CFXA 1FQBA 1MXYA 1LCFA 1PC3A 3SZPA 4JB7A 1IIWA 1P1UA 1US4A 2PT1A 1S7YA 1ZMGA 3QUJA 4OENA 2DWHA 1CB6A 3TTRA 2I3VA 2H9BA 4TQUQ 1JVXA 4OANA 2JJKA 4K3FA 1USYH 1SI1A 3FVKA 4IO5A 2REJA 3MZ9A 2VHAA 1EH3A 1AMFA 4DZ1A 2XWKA 3D4GA 3MP8A 1EYKA 2NOOA 4H5GA 4ELRA 3SEYA 4EF1A 2IEEA 2I6EA 4R9FA 1H45A 3BIHA 2THIA 1N04A 4WEPA 2W7YA 3LC8A 2WBBA 3V5AA 1MXWA 1Z7ME 2UVJA 4KYSA 5IKBA 2ZNTA 1EZ9A 2R6GE 1FBDA 3FJGA 4GXSB 4JBZA 3MC2A 2YJPA 2CZIA 2XWVA 4FJPA 4H0WA 3CIJA 3G3IA 4P47A 1DOTA 2D5WA 1ZIUA 1N0TA 1NV6A 3VLUA 4QFNA 3FBPA 4LVQA 3TTKA 3U94A 2NWJA 1JEVA 4O7IA 3TCHA 1YZ0A 5KCJA 1B5JA 1YYZA 1NNFA 4QSDA 4IR8A 4ZS9A 1I6QA 4RXLA 1VSOA 4OVJA 1JW1A 2BJJX 3LSLA 2PX1A 3W15C 4OMBA 3C35A 5FTIA 4XTCQ 2RCAA 2HCAA 5ITOA 2Z22A 1Q35A 2DWIA 1FBGA 5IGAA 3CFLA 3K00A 5CBRA 3Q29A 4F3BA 4NF6B 1M5CA 3RY3A 4FATA 1TWYA 5JTYA 4PTKA 1Y1MA 4U2RA 2DXRA 5I58A 4P3LA 3SERA 1USYE 5A5LA 5IM2A 3TQWA 3VLWA 4X1BA 4ZEIA 2HXWA 1SPIA 4F3PA 4H1XA 3RTFB 4BDNA 2UVHA 2DWJA 4P56A 1D9VA 2F6PA 5J16A 4PFWA 1FQEA 3TTLA 1S9TA 2FIEA 3GZGA 3CG3A 4O7MA 4GL8A 2HEUA 3T0JA 1VR5A 1I6BA 4AB6A 1IMEA 5AA4A 3OEKA 2I48A 1TFDA 3K01A 4RK9A 4F29A 3MZ1A 3QIMA 5HM4B 1DTGA 1NUXA 2XA5A 5EQ7A 4GIZA 1QJMA 1BKAA 2Y5LA 4PQJA 4UA8A 4BDRA 4DE8A 4HE2A 1MQDA 3OMBA 1POY1 4G77A 3A29A 1P99A 3RTWB 5L9OA 4YKPA 1AWBA 2PMSA 5I56A 3ODBA 2HFBA 2KQZA 4HXVA 1KWHA 1NMUA 1US5A 1NNTA 4XF5A 2XXUA 3EQ1A 2RF1A 3HHFA 4GXAA 2AYSA 3SEXA 3HPIA 3UGWA 3RT8A 2RCBA 4PFRA 1FQCA 3C34A 5AA2B 5EYFA 1JW4A 2B3FA 2WYPA 1FBCA 3D1RA 4DDDA 3FXRA 2I4BA 3VLVA 4I1DA 3PPNA 3UIFA 4LN5A 1PB7A 4GWUA 2VT5A 4NG7A 1FPKA 3FV1A 3VVFA 3GBBA 1MQGA 4ZEKA 1P1QA 4PAIA 4QBAA 4C1UA 3KOSA 4BDQA 5ET6A 2V3UA 2MKZA 1MH4A 4OERA 2XXQA 3H6VA 3PD8A 3G3FA 1LAGE 4O3AA 1FJ6A 3ZS6A 4XKQA 4OEVA 2FA7A 1MM7A 1B3GA 1TFAA 2ANJA 1B51A 2Y7RA 4PAFA 4I40A 2QPQA 4GBWA 4FAJA 4E0WA 2VPNA 4KYDA 4Q0CA 2YPNA 4OVQA 1NI9A 2VD3A 5CC2A 2XXYA 1BP5A 4OVRA 3MPKA 5CBSA 1FW0A 3A3UA 3H3GA 2Y7WA 3H4ZA 1IMCA 2DXYA 1IXIA 1NUYA 3IB0A 4NF4A 5ET8A 1PB9A 4N91A 5I58B 3LSXA 2REGA 2VD2A 1UTHA 5B7DA 2QMXA 4P1EA 2GHAA 4QF9A 4DXUA 3MVWA 4N4UA 3ONMA 1VFDA 1B32A 5FTHA 1VE4A 3MAMA 3QK6A 1XVXA 5I7IA 4DIGA 4DCYA 3O29A 2ZXTA 1B0LA 4RA1A 4PE3A 2H4IA 3M3LA 3RQTA 1WODA 2RC8A 5AA4B 4OZ9A 4QFPA 3MBPA 4H8IA 3PPRA 5H8FA 2B4LA 3FASA 3LSFB 3MQ9A 1INPA 2PVUA 1GVCA 4LQ2A 2XD3A 3CSGA 3PU5A 5I5PA 4UABA 4G61A 4OEUA 4G68A 2V3TA 1B4ZA 1AIVA 4OXVA 3GLBA 2Q74A 4F1YA 3FXQA 4X9TA 3T9VA 2V25A 2Y84A 3Q26A 4JVDA 4P8BA 4TLLB 2OZZA 1B9JA 4NWDA 3OEMA 4KQPA 4GBVA 1MPBA 2F7AA 3T9XB 4IY5A 4LP2B 4EXLA 2DDKA 5K2XA 3K1MA 2O7UA 1FPBA 3CR9A 3T9UA 3G3GA 4HW8A 3LSWA 1DBZA 4IGRA 2PCRA 3FJ7A 1NV3A 2LAOA 3O6HA 1FQAA 1M5BA 3SETA 4AS4A 4PC9A 2FIXA 1UIVA 3VFJA 4PFYA 4GWSA 1Y3NA 3W9WA 1II5A 1B5IA 3B6TA 3DP6A 4Q5TA 4PFBA 4WXJA 3RUMA 3WAEA 4NF0A 2OWSA 1LAFE 1QULA 4PGNA 3PUZE 3EKIA 2KLFA 4XKNA 4F2OA 4O3BA 1T0KA 1D9QA 2I3WA 2D21A 1FQFA 2ZNUA 4P0GA 3SDFA 1URDA 3TUSA 3PPPA 2ONSA 3S9NC 2I0CA 2GHBA 3C9HA 4M4GA 1XI6A 2E0SA 4G8MA 3MW0A 4OETA 4FBPA 4KR5A 1ZKBA 4NF4B 3O66A 4YICA 1MDP1 2QVUA 4GFRA 3MZBA 1NNPA 4PETA 4XKPA 4NWCA 3ZKLA 2OK2A 1EU8A 3R6UA 3IOWA 4Z7EA 4F3SA 5A5XA 4EQBA 5ITPA 1LBYA 1R1NA 2QVVA 3TYHA 2D3IA 1FPIA 4OTEA 2O1MA 1NV1A 2ABHA 4DXBA 5ISUA 4MNPA 4DLDA 4GWZA 2XXPA 1IMDA 4NEDA 1NUZA 2G93A 3G7WA 4GWXA 3TELA 4QHQA 2RKMA 1POTA 2UXAA 1MPDA 2E1SA 2PT2A 3KJ7A 2Y7IA 4GL0A 4LATA 4DCXA 4IY6A 4HE0A 2GFEA 2F78A 4JVCA 1ZU0A 1MXXA 4G68B 3S9MC 5F7VA 3OOAA 5CI5A 1FTOA 1LAHE 1F9BA 4KHZE 4U4SA 3SEVA 5DVFA 5ICQA 3EPEA 4THIA 4OHNA 3FUZA 3JV9A 3OO7A 3M3FA 4OFOA 5TP9B 1K9YA 3E3KA 3IO6A 1QKAA 2VOZA 5ESYA 3KGCA 4HE1A 4POWA 4MH5A 5I57B 5AA2A 4HCYA 4ZE8A 3O9PA 1NH8A 5F1QA 5JEIA 1G0HA 4F22A 4KCCA 4YKKA 3EN3A 1AH5A 3RNNA 3FD3A 1XC1A 1LBBA 2OJTA 4NHBA 4C1TA 1NV2A 1MXUA 2AL4A 1JEUA 1QKBA 4PAKA 3TTNA 1MPCA 3P7IA 4PFTA 2NXOA 3TKDA 1Y1ZA 1LBXA 1SYIA 2DP8A 3N26A 2QL3A 2R8TA 3QUFA 5KDTA 4QFLA 1PDAA 4JWXA 4IO4A 3TTMA 1G0IA 3K1PA 3T1BA 3FVOA 1N3XA 2V4CA 3O6GA 5DT6A 1J1NA 2QS4A 5EYHA 3UP9A 4GOTA 1OVBA 3PMWA 4MCOA 2XXWA 4JSOA 1MQHA 2A5SA 2ZNSA 1Y4TA 4I62A 4N17A 4YKIA 2A5TB 1BK4A 3VXBA 2F7BA 3PD9A 4MMPA 3TMGA 3MYUA 3FJMA 5FHOA 2ALUA 4FEBA 2BJIA 2DVCA 4ZZEA 2Q88A 1B3LA 4O8MA 2CMOA 5A5XB 3EF7A 4BDLA 1MY1A 1ELJA 5H8QA 4BDOA 1BLFA 1MY4A 2Y7PA 4R75A 2AIXA 3C31A 2PFYA 1BIYA 3OSQA 4NN3A 3KFMA 3PPQA 2CZKA 3FXBA 3UORA 3HFUA 4P1LA 4ZEFA 3FVNA 1DSNA 1B7HA 4GF8A 3S2VA 3UK4A 2M8CA 4JWYA 4NTLA 5EHMA 1N76A 2XWIA 1Q9DA 3PTYA 1B5HA 4WKMA 3PUWE 4MNIA 1MG1A 5LDZA 4MNCA 1FTAA 4GWOA 2OBGA 3V89B 4ZEBA 1LEVA 2VPOA 4IO3A 4AQ4A 1MH3A 3KZGA 2P2AA 2ONRA 1LBZA 4NE4A 3VXCA 5EQ9A 1A7LA 4MHFA 1DPEA 3E4RA 5AA1A 1YXIA 2P3NA 5CMCA 4E0XA 4JDFA 1MY0A 1A8FA 3G3HA 1LFGA 4HS7A 3OO6A 4FEDA 2OLBA 1XVYA 1LBCA 4XEQA 3R7XA 4IB2A 3CSBA 3R26A 3HSTA 3IL1B 5M2VA 4YB6A 3Q25A 1VDWA 4EF2A 5CMMA 2ZYKA 4ONYA 4ELQA 5IAIA 1EZOA 4F19A 2ZYOA 1N7WA 1FBEA 2B4MA 3MP1A 5L8DA 3IORA 1FJ9A 1WDNA 3TAJA 4ND9A 1D4NA 1O63A 1H44A 4YKJA 2P1SA 4OESA 1K9ZA 3DP4A 2F34A 3U72A 2O68A 2HHMA 1OQHA 4KFQA 5KDTB 1MY2A 4PBQA 1M5FA 4EQ7A 3E78A 3Q27A 2VGQA 2QS1A 1Y3QA 4AS5A 2ZYNA 3CVGA 4FECA 4MFIA 3H6WA 3PV0E 1ATGA 4PCDA 1N7XA 5TU0A 1MQJA 2H25A 4EQ9A 3USDA 5EHSA 5HPQA 4YMAA 3GYYA 4LZ5A 5IZ1A 1A54A 2ZYMA 4I3YA 4PGPA 4QFOA 4DI3D 2UVGA 4H6DA 5K2YA 4KXPA 1IMFA 2AL5A 1GTKA 1FPJA 5CM6A 5ICTA 4IO7A 1H3DA 2DE3A 3OENA 3FATA 1FPGA 1PEBA 2F6GA 5H8QB 2RC7A 5J1DA 1IMAA 1B2HA 4F1UA 4H65A 4ISUA 4OVTA 1I6AA 3K6XA 4MAGA 3AXFA 1R9LA 4F39A 3PPOA 3KG2A 3B50A 1UIUA 2Y7KA 3THIA 2WX9A 1LBWA 1URGA 3VVEA 2FHYA 3C36A 4GRKA 4NX1A 3V8XB 1RYXA 4LZ7A 3T93B 4I9DA 4PP0A 3A3CA 5DEXA 2DVZA 3QXMA 3KN8A 5DVJA 1Y3PA 3CRBA 3FXUA 4PDDA 3IR1A 4JWOA 1MS7A 3PMXA 5FBPA 3MWBA 3TDJA 1HSJA 1IXGA 1LB8A 1PBPA 3U8QA 4GD5A 1I69A 1MXZA 1NFTA 3VDFA 1YPNA 4PBHA 2DWAA 2UYEA 3N6UA 1M5EA 4LZ8A 2GQ1A 2NVUB 1ZLQA 1B1XA 4ELOA 1R9QA 2HQ0A 4PFIA 1FPDA 4LA9A 1YCJA 1VFEA 5TP9A 3IK6B 5I2NA 3MVXA 4Q8RA 1P1OA 4FIMA 2ZZXA 1XHYA 1IITA 1A8EA 3OO9A 4RK2A 4I8CA 1B46A 1SDXA 5I57A 1A40A 3CFZA 3LV0A 2UYFA 3LUYA 5CRYA 1MRPA 3OSRA 4N15A 3PUYE 3B8BA 4P9KA 5IZ3B 2NUVA 1LAXA 5TPAB 3IFAA 2H98A 1D3KA 4R74A 1LCTA 2PFZA 1RDZA 1MDQA 3H03A 4KYEA 2Q2CA 5AA2D 1B3FA 1B0HA 3KC1A 3M3KA 1RDYA 2Q2AA 5CMBA 3H7MA 3I5OA 4IGTA 3ROJA 2KR0A 5KZTA 3DP8A 1R6ZA 2PYYA 5EYGA 3IAZA 4F18A 5HBCA 3H6UA 2XX8A 4FORA 4X04A 2HAUA 3K1NA 3MUQA 2A5TA 1FBFA 3M8UA 4JVIA 3RGYA 2XXHA 4NMYA 1UTBA 1OLCA 2I4CA 3IX1A 3K6WA 3K0VA 5EQAA 4R6YA 1KA0A 3K02A 2OCUA 1ZBMA 2H5YA 3B6QA 2F8DA 2FVZA 3C32A 4L17A 2V84A 2ONKE 3IB1A 5FHMA 1XT8A 1YTVA 3DLNA 4XFEA 1O64A 4JSDA 5DEXB 2ESNA 1IMBA 1FBPA 2XXRA 3KSJA 1QUIA 1SW2A 4U22A 2FBPA 3FV2A 4AB5A 1GGGA 1B7UA 2QFLA 4HTGA 4KI0E 3KJTA 3T22A 3K6UA 3RPLA 3KEIA 5I59B 1B6HA 2XX7A 2OX3A 2DE4A 2Z23A 1EYJA 1JNFA 1QUKA 2ZZWA 4YAHX 4X1DA 1B52A 3ISPA 4R9GA 3OO8A 4QSEA 1OMPA 4OFJA 1OLAA 3JYRA 2X26A 4R6KA 4ELPA 5AA3A 3TEPA 5I2NB 4EDPA 1TXFA 4YU0A 4PFUA 5AE4A 1N3WA 4I3EA 4TLMB 2XX9A 4H67A 2O51A 4NQ8A 2DSFA 3IFCA 1ZJLA 3U93A 2VP1A 3C33A 1NV0A 1B4HA 3OELA 3QAXA 5LOMA 2QJEA 3IOUA 3L6GA 3A09A 4G8NA 1SW4A 2WEFA 3HN0A 1SQYA 4G2ZA 2QS2A 3LUZA 4GLIA 4P0IA 5BUUA 1SBPA 2FYIA 2HPGA 3O28A 1SI0A 1B1HA 3N94A 2I49A 1H76A 5F24A 1IUDA 3LR1A 1CNQA 5DTBA 1DPPA 4HCWA 4Q30B 1KA1A 1FPFA 4KCDA 4N07A 4YB7A 4NF8B 4ESXA 4H45A 3TCGA 5H8SA 2F3BA 1MQIA 3TZAA 4IO6A 1QW0A 2Z8DA 1MY3A 3EHSA 4NGUA 3N5LA 3FIRA 4ZE9A 1Z7NE 2O69A 1MM6A 1IXHA 5H8HB 5ET7A 4N8YA 1FBHA 3GBAA 1JW5A 2DE2A 3ILTB 4BDMA 2XXIA 2F7CA 2HZLA 5BWJA 1UTBB 1EYIA 2B3BA 3DM0A 3MSTA 1A99A 3KBRA 3CHGA 1URSA 4H8JA 2XXKA 3F11A 4G4PA 2F97A 3U92A 1LB9A 1P1NA 1O7TA 2HAVA 3NOHA
chains in the Genus database with same CATH topology
2ZMBA 4GQOA 3HHGA 1B05A 1A55A 5JK4A 3PGFA 2GRVA 4QRZA 4OWDA 1LFIA 3VVDA 4YZZA 2DQVA 3RT6B 4MLQA 1Y4CA 3V83A 2PBWA 3SESA 3RPWA 2O84X 2Z8FA 3L6HA 4X48A 3VV5A 3IJXB 4BLAA 1LSTA 1XS5A 1JETA 1FCKA 2QSXA 2X7PA 3K2DA 3Q28A 1Y9UA 4OQOA 5L9SA 3S9EA 2HZKA 1RKMA 3SKPA 4MF3A 4N6PA 5FHNA 1CE2A 4F1VA 4ZDMA 2FNCA 1SD3A 1YAEA 3KOTA 3BBRA 2R9JA 1FTJA 4QFKA 5I2KA 3JZJA 2O7IA 2YLNA 4TOZA 3OD7A 2OWTA 4XXUA 1SYHA 2H99A 4M1VA 5H8NA 3QSLA 3IOVA 1XOCA 5CMKA 1Q1KA 1LFHA 5TPAA 2G29A 3TQLA 2UVIA 2F5XA 4LUBA 3MVZA 3QYTA 4WEDA 2DYXA 4G68C 3TODA 4QSCA 3KN3A 1ZTYA 3KN7A 4EUOA 3B6WA 1AOVA 4P11A 5KCJB 4R2FA 3N6TA 3H6TA 2Q9TA 4NF5A 1TT1A 1OQGA 1Y20A 1BTJA 4RY1A 4ZEDA 3SEWA 3S9LC 2RC9A 4O3CA 3MJNA 3T66A 1IXCA 2R71A 1B40A 3G3KA 3PUXE 3MPLA 4ECFA 3BFTA 2Q89A 2DS9A 3SEUA 3UN6A 4ZZAA 5JTYB 4XKRA 3ILUB 3C4MA 5ELVA 4KD5A 2XD2A 3E9XA 4F3GA 3KSXA 3D4CA 1NL5A 1GV8A 5DVIA 4R73A 3MP6A 1SW5A 3O6IA 1IZ1A 1S50A 3HV1A 4UACA 1QUJA 1AL3A 4RPOA 5I59A 2DOJA 3LBSA 3TPAA 3WAFA 3T9HB 2Z8EA 3MVYA 2X7QA 4DXCA 4U1ZA 1QVSA 4F2QA 5I84A 1HSEA 5I56B 2XXXA 4C0RA 4RYAA 2RINA 5I2KB 1B3HA 1MXVA 4IO2A 3EHUA 5L9MA 3I6VA 3FZVA 4G8HA 1ANFA 2QMWA 3W9VA 4LONB 4OYVA 1LGBC 1FTKA 5H8NB 1P1WA 3RLFE 1FQDA 1EZPA 3K6VA 3HCQA 3OXNA 3S4UA 3G3JA 2V93A 2XHDA 1OVTA 4RJZA 2V3QA 3B7DA 5DYHA 4Z0IA 2XXTA 4ZECA 1L5TA 4U21A 3PMVA 3TCFA 4FE8A 2F35A 4MBPA 1HSLA 1UQWA 1SVXB 3K4UA 3VE1B 3IOTA 1OIBA 3IO4A 3O2AA 4NF5B 1FTMA 2QRYA 3CI8A 4LQ5A 3UA8A 2I58A 3IB2A 4U4XA 1B3EA 4NF8A 1GR2A 1DMBA 2O1LA 3ZKKA 3E13X 4ESWA 3FVGA 1IQ7A 1WVJA 5B70A 1B7ZA 1SW1A 1B58A 3FGSA 1N84A 2B65A 4RPNA 4XIGQ 5H8HA 1RYOA 4YMBA 4R72A 3TFLA 3I3VA 4KPTA 2QS3A 3CG1A 4RNSA 4PE5B 3RN8A 3HO7A 1UTHB 2F36A 4NF6A 1JQFA 3DELB 3ECRA 1PBQA 4EXKA 4YB5A 3H06B 3BFUA 2CZLA 4OFLA 4JXIA 1NH7A 1JVYA 1LLSA 4U23A 4N13A 3U1OA 1DTZA 2P0SA 2WKYA 1D9YA 3PUVE 1M5DA 3IJOB 2IA4A 2XXVA 4R2BA 4MLVA 2O6AA 3T96B 3ZSFA 4U1OA 2I0BA 4POXA 4F31B 1PB8A 1NKXA 1IEJA 1FTLA 5H8FB 4GVOA 4H5FA 2Q8JA 1NNKA 3O97A 3EHTA 3GXAA 4R6HA 3BKIB 2GH9A 1H43A 3CFXA 1FQBA 1MXYA 1LCFA 1PC3A 4JB7A 1IIWA 1P1UA 1US4A 2PT1A 1S7YA 1ZMGA 3QUJA 4OENA 2DWHA 1CB6A 3TTRA 2I3VA 2H9BA 4TQUQ 1JVXA 4K3FA 1USYH 1SI1A 3FVKA 4IO5A 2REJA 3MZ9A 2VHAA 1EH3A 1AMFA 4DZ1A 3D4GA 3MP8A 2NOOA 4H5GA 4ELRA 3SEYA 4EF1A 2IEEA 2I6EA 4R9FA 1H45A 4WEPA 2THIA 1N04A 2W7YA 3LC8A 3V5AA 1MXWA 1Z7ME 2UVJA 4KYSA 5IKBA 2ZNTA 1EZ9A 2R6GE 3FJGA 4GXSB 4JBZA 3MC2A 2YJPA 4FJPA 4H0WA 3CIJA 3G3IA 1DOTA 2D5WA 1ZIUA 1N0TA 3VLUA 4QFNA 4LVQA 3U94A 3TTKA 2NWJA 1JEVA 3TCHA 5KCJA 1B5JA 1NNFA 4QSDA 4ZS9A 1I6QA 4RXLA 1VSOA 4OVJA 1JW1A 2BJJX 3LSLA 2PX1A 3W15C 4OMBA 3C35A 5FTIA 4XTCQ 2RCAA 2HCAA 5ITOA 2Z22A 1Q35A 2DWIA 3CFLA 3K00A 5CBRA 3Q29A 4F3BA 4NF6B 1M5CA 3RY3A 4FATA 1TWYA 5JTYA 1Y1MA 4U2RA 2DXRA 5I58A 3SERA 1USYE 3TQWA 3VLWA 4X1BA 4ZEIA 2HXWA 4F3PA 4H1XA 3RTFB 4BDNA 2UVHA 2DWJA 1D9VA 2F6PA 4PFWA 1FQEA 3TTLA 1S9TA 3GZGA 3CG3A 4GL8A 2HEUA 1VR5A 1I6BA 4AB6A 5AA4A 3OEKA 2I48A 1TFDA 3K01A 4RK9A 4F29A 3MZ1A 3QIMA 5HM4B 1DTGA 4GIZA 1QJMA 1BKAA 4PQJA 4UA8A 4BDRA 4DE8A 1MQDA 3OMBA 1POY1 4G77A 1P99A 3RTWB 5L9OA 4YKPA 2PMSA 5I56A 3ODBA 2HFBA 1KWHA 1NMUA 1US5A 1NNTA 2XXUA 3EQ1A 2RF1A 3HHFA 4GXAA 2AYSA 3SEXA 3HPIA 3UGWA 3RT8A 2RCBA 1FQCA 3C34A 5AA2B 5EYFA 1JW4A 2B3FA 4DDDA 3FXRA 2I4BA 3VLVA 4I1DA 3PPNA 3UIFA 1PB7A 3FV1A 3VVFA 3GBBA 1MQGA 4ZEKA 1P1QA 4C1UA 3KOSA 4BDQA 2V3UA 1MH4A 4OERA 2XXQA 3H6VA 3PD8A 3G3FA 1LAGE 4O3AA 3ZS6A 4XKQA 4OEVA 2FA7A 1MM7A 1B3GA 1TFAA 2ANJA 1B51A 2Y7RA 2QPQA 4FAJA 4E0WA 4KYDA 4Q0CA 2YPNA 2VD3A 5CC2A 2XXYA 1BP5A 3MPKA 5CBSA 1FW0A 3A3UA 3H3GA 2Y7WA 3H4ZA 2DXYA 1IXIA 3IB0A 4NF4A 1PB9A 5I58B 3LSXA 2REGA 2VD2A 1UTHA 5B7DA 2QMXA 2GHAA 4QF9A 4DXUA 3MVWA 3ONMA 1VFDA 1B32A 5FTHA 1VE4A 3MAMA 3QK6A 1XVXA 4DIGA 4DCYA 3O29A 2ZXTA 1B0LA 4RA1A 2H4IA 3M3LA 3RQTA 1WODA 2RC8A 5AA4B 4OZ9A 4QFPA 3MBPA 4H8IA 3PPRA 5H8FA 3FASA 3LSFB 3MQ9A 2PVUA 1GVCA 4LQ2A 2XD3A 3CSGA 3PU5A 4OEUA 4G68A 2V3TA 1B4ZA 1AIVA 4OXVA 3GLBA 4F1YA 3FXQA 4X9TA 3T9VA 2V25A 2Y84A 3Q26A 4TLLB 2OZZA 1B9JA 4NWDA 3OEMA 4KQPA 1MPBA 2F7AA 3T9XB 4IY5A 4LP2B 4EXLA 5K2XA 3K1MA 2O7UA 3CR9A 3T9UA 3G3GA 4HW8A 3LSWA 4IGRA 3FJ7A 2LAOA 3O6HA 1FQAA 1M5BA 3SETA 1UIVA 3VFJA 4PFYA 1Y3NA 3W9WA 1II5A 1B5IA 3B6TA 3DP6A 4Q5TA 4WXJA 3RUMA 3WAEA 2OWSA 1LAFE 1QULA 3PUZE 2KLFA 4XKNA 4F2OA 4O3BA 1T0KA 2I3WA 2D21A 1FQFA 2ZNUA 4P0GA 3SDFA 1URDA 3TUSA 3PPPA 2ONSA 3S9NC 2I0CA 2GHBA 3C9HA 4M4GA 2E0SA 4G8MA 3MW0A 4OETA 4KR5A 1ZKBA 4NF4B 3O66A 4YICA 1MDP1 4GFRA 3MZBA 1NNPA 4PETA 4XKPA 4NWCA 3ZKLA 2OK2A 1EU8A 3R6UA 3IOWA 4Z7EA 4F3SA 5A5XA 4EQBA 5ITPA 1R1NA 3TYHA 2D3IA 4OTEA 2O1MA 2ABHA 4DXBA 5ISUA 4DLDA 2XXPA 4NEDA 2G93A 3G7WA 3TELA 4QHQA 2RKMA 1POTA 2UXAA 1MPDA 2E1SA 2PT2A 3KJ7A 2Y7IA 4GL0A 4LATA 4DCXA 4IY6A 2GFEA 2F78A 1ZU0A 1MXXA 4G68B 3S9MC 5F7VA 3OOAA 5CI5A 1FTOA 1LAHE 1F9BA 4KHZE 4U4SA 3SEVA 5DVFA 5ICQA 3EPEA 4THIA 4OHNA 3FUZA 3JV9A 3OO7A 3M3FA 4OFOA 5TP9B 3E3KA 3IO6A 1QKAA 2VOZA 3KGCA 4POWA 4MH5A 5I57B 5AA2A 4HCYA 4ZE8A 3O9PA 1NH8A 5F1QA 5JEIA 4F22A 4KCCA 4YKKA 3EN3A 1AH5A 3RNNA 3FD3A 1XC1A 1LBBA 2OJTA 4C1TA 1MXUA 2AL4A 1JEUA 1QKBA 3TTNA 1MPCA 3P7IA 4PFTA 2NXOA 3TKDA 1Y1ZA 1SYIA 2DP8A 3N26A 2QL3A 3QUFA 5KDTA 4QFLA 1PDAA 4JWXA 4IO4A 3TTMA 3K1PA 3FVOA 1N3XA 3O6GA 5DT6A 1J1NA 2QS4A 3UP9A 4GOTA 1OVBA 3PMWA 2XXWA 4JSOA 1MQHA 2A5SA 2ZNSA 1Y4TA 4I62A 4YKIA 2A5TB 3VXBA 2F7BA 3PD9A 3TMGA 3FJMA 5FHOA 2ALUA 4FEBA 2DVCA 4ZZEA 2Q88A 1B3LA 2CMOA 5A5XB 3EF7A 4BDLA 1MY1A 1ELJA 5H8QA 4BDOA 1BLFA 1MY4A 2Y7PA 4R75A 2AIXA 3C31A 1BIYA 3OSQA 3KFMA 3PPQA 3UORA 4ZEFA 3FVNA 1DSNA 1B7HA 4GF8A 3S2VA 3UK4A 2M8CA 4JWYA 4NTLA 5EHMA 1N76A 1B5HA 4WKMA 3PUWE 1MG1A 4GWOA 2OBGA 3V89B 4ZEBA 4IO3A 4AQ4A 1MH3A 3KZGA 2P2AA 2ONRA 4NE4A 3VXCA 1A7LA 1DPEA 3E4RA 5AA1A 5CMCA 4E0XA 4JDFA 1MY0A 1A8FA 3G3HA 1LFGA 4HS7A 3OO6A 4FEDA 2OLBA 1XVYA 1LBCA 3R7XA 4IB2A 3CSBA 3R26A 3HSTA 3IL1B 5M2VA 4YB6A 3Q25A 4EF2A 5CMMA 2ZYKA 4ONYA 4ELQA 5IAIA 1EZOA 4F19A 2ZYOA 1N7WA 3MP1A 5L8DA 3IORA 1WDNA 3TAJA 4ND9A 1D4NA 1O63A 1H44A 4YKJA 2P1SA 4OESA 3DP4A 2F34A 3U72A 2O68A 1OQHA 4KFQA 5KDTB 1MY2A 1M5FA 4EQ7A 3Q27A 2VGQA 2QS1A 1Y3QA 2ZYNA 3CVGA 4FECA 4MFIA 3H6WA 3PV0E 1ATGA 1N7XA 5TU0A 1MQJA 2H25A 4EQ9A 3USDA 5EHSA 5HPQA 4YMAA 4LZ5A 1A54A 2ZYMA 4QFOA 2UVGA 4H6DA 5K2YA 2AL5A 1GTKA 5CM6A 5ICTA 4IO7A 1H3DA 2DE3A 3OENA 3FATA 1PEBA 2F6GA 5H8QB 2RC7A 5J1DA 1B2HA 4F1UA 4H65A 4ISUA 1I6AA 3K6XA 3AXFA 1R9LA 4F39A 3PPOA 3KG2A 1UIUA 2Y7KA 3THIA 1URGA 3VVEA 3C36A 4GRKA 3V8XB 1RYXA 4LZ7A 3T93B 4I9DA 4PP0A 3A3CA 5DEXA 2DVZA 3QXMA 3KN8A 5DVJA 1Y3PA 3CRBA 3FXUA 3IR1A 4JWOA 1MS7A 3PMXA 3MWBA 3TDJA 1HSJA 1IXGA 1LB8A 1PBPA 3U8QA 4GD5A 1I69A 1MXZA 1NFTA 3VDFA 1YPNA 2DWAA 2UYEA 3N6UA 1M5EA 4LZ8A 2NVUB 1ZLQA 1B1XA 4ELOA 1R9QA 2HQ0A 4LA9A 1YCJA 1VFEA 5TP9A 3IK6B 5I2NA 3MVXA 4Q8RA 1P1OA 4FIMA 1XHYA 1IITA 1A8EA 3OO9A 4RK2A 4I8CA 1B46A 1SDXA 5I57A 1A40A 3CFZA 2UYFA 3LUYA 5CRYA 1MRPA 3OSRA 3PUYE 2NUVA 1LAXA 5TPAB 2H98A 1D3KA 4R74A 1LCTA 1MDQA 3H03A 4KYEA 2Q2CA 5AA2D 1B3FA 1B0HA 3M3KA 2Q2AA 5CMBA 3H7MA 3I5OA 4IGTA 5KZTA 3DP8A 1R6ZA 2PYYA 3IAZA 4F18A 5HBCA 3H6UA 2XX8A 4FORA 2HAUA 3K1NA 3MUQA 2A5TA 3M8UA 3RGYA 2XXHA 4NMYA 1UTBA 1OLCA 2I4CA 3IX1A 3K6WA 3K0VA 4R6YA 3K02A 2OCUA 1ZBMA 2H5YA 3B6QA 2F8DA 3C32A 4L17A 2V84A 2ONKE 3IB1A 5FHMA 1XT8A 1YTVA 3DLNA 1O64A 4JSDA 5DEXB 2ESNA 2XXRA 3KSJA 1QUIA 1SW2A 4U22A 3FV2A 4AB5A 1GGGA 1B7UA 4HTGA 4KI0E 3KJTA 3T22A 3K6UA 3KEIA 5I59B 1B6HA 2XX7A 2DE4A 2Z23A 1JNFA 1QUKA 4YAHX 4X1DA 1B52A 4R9GA 3OO8A 4QSEA 1OMPA 4OFJA 1OLAA 3JYRA 2X26A 4R6KA 4ELPA 5AA3A 3TEPA 5I2NB 4EDPA 1TXFA 4YU0A 4PFUA 5AE4A 1N3WA 4TLMB 2XX9A 4H67A 2O51A 2DSFA 1ZJLA 3U93A 2VP1A 3C33A 1B4HA 3OELA 3QAXA 5LOMA 2QJEA 3IOUA 3L6GA 3A09A 4G8NA 1SW4A 3HN0A 1SQYA 4G2ZA 2QS2A 4GLIA 4P0IA 5BUUA 1SBPA 2FYIA 3O28A 1SI0A 1B1HA 3N94A 2I49A 1H76A 1IUDA 3LR1A 5DTBA 1DPPA 4HCWA 4Q30B 4KCDA 4N07A 4YB7A 4NF8B 4ESXA 3TCGA 5H8SA 1MQIA 3TZAA 4IO6A 1QW0A 2Z8DA 1MY3A 3EHSA 3N5LA 3FIRA 4ZE9A 1Z7NE 2O69A 1MM6A 1IXHA 5H8HB 3GBAA 1JW5A 2DE2A 3ILTB 4BDMA 2XXIA 2F7CA 2HZLA 5BWJA 1UTBB 2B3BA 3DM0A 1A99A 3KBRA 1URSA 4H8JA 3F11A 4G4PA 2F97A 3U92A 1LB9A 1P1NA 1O7TA 2HAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZMB A;  4GQO A;  3HHG A;  1B05 A;  1A55 A;  5JK4 A;  3PGF A;  2GRV A;  4QRZ A;  4OWD A;  1LFI A;  3VVD A;  4YZZ A;  2DQV A;  3RT6 B;  4MLQ A;  1Y4C A;  3V83 A;  2PBW A;  3SES A;  3RPW A;  2O84 X;  2Z8F A;  3L6H A;  4X48 A;  3VV5 A;  3IJX B;  4BLA A;  1LST A;  1XS5 A;  1JET A;  1FCK A;  2QSX A;  2X7P A;  3K2D A;  3Q28 A;  1Y9U A;  4OQO A;  5L9S A;  3S9E A;  2HZK A;  1RKM A;  3SKP A;  4MF3 A;  4N6P A;  5FHN A;  1CE2 A;  4F1V A;  4ZDM A;  2FNC A;  1SD3 A;  1YAE A;  3KOT A;  3BBR A;  2R9J A;  1FTJ A;  4QFK A;  5I2K A;  3JZJ A;  2O7I A;  2YLN A;  4TOZ A;  3OD7 A;  2OWT A;  4XXU A;  1SYH A;  2H99 A;  4M1V A;  5H8N A;  3QSL A;  3IOV A;  1XOC A;  5CMK A;  1Q1K A;  1LFH A;  5TPA A;  2G29 A;  3TQL A;  2UVI A;  2F5X A;  4LUB A;  3MVZ A;  3QYT A;  4WED A;  2DYX A;  4G68 C;  3TOD A;  4QSC A;  3KN3 A;  1ZTY A;  3KN7 A;  4EUO A;  3B6W A;  1AOV A;  4P11 A;  5KCJ B;  4R2F A;  3N6T A;  3H6T A;  2Q9T A;  4NF5 A;  1TT1 A;  1OQG A;  1Y20 A;  1BTJ A;  4RY1 A;  4ZED A;  3SEW A;  3S9L C;  2RC9 A;  4O3C A;  3MJN A;  3T66 A;  1IXC A;  2R71 A;  1B40 A;  3G3K A;  3PUX E;  3MPL A;  4ECF A;  3BFT A;  2Q89 A;  2DS9 A;  3SEU A;  3UN6 A;  4ZZA A;  5JTY B;  4XKR A;  3ILU B;  3C4M A;  5ELV A;  4KD5 A;  2XD2 A;  3E9X A;  4F3G A;  3KSX A;  3D4C A;  1NL5 A;  1GV8 A;  5DVI A;  4R73 A;  3MP6 A;  1SW5 A;  3O6I A;  1IZ1 A;  1S50 A;  3HV1 A;  4UAC A;  1QUJ A;  1AL3 A;  4RPO A;  5I59 A;  2DOJ A;  3LBS A;  3TPA A;  3WAF A;  3T9H B;  2Z8E A;  3MVY A;  2X7Q A;  4DXC A;  4U1Z A;  1QVS A;  4F2Q A;  5I84 A;  1HSE A;  5I56 B;  2XXX A;  4C0R A;  4RYA A;  2RIN A;  5I2K B;  1B3H A;  1MXV A;  4IO2 A;  3EHU A;  5L9M A;  3I6V A;  3FZV A;  4G8H A;  1ANF A;  2QMW A;  3W9V A;  4LON B;  4OYV A;  1LGB C;  1FTK A;  5H8N B;  1P1W A;  3RLF E;  1FQD A;  1EZP A;  3K6V A;  3HCQ A;  3OXN A;  3S4U A;  3G3J A;  2V93 A;  2XHD A;  1OVT A;  4RJZ A;  2V3Q A;  3B7D A;  5DYH A;  4Z0I A;  2XXT A;  4ZEC A;  1L5T A;  4U21 A;  3PMV A;  3TCF A;  4FE8 A;  2F35 A;  4MBP A;  1HSL A;  1UQW A;  1SVX B;  3K4U A;  3VE1 B;  3IOT A;  1OIB A;  3IO4 A;  3O2A A;  4NF5 B;  1FTM A;  2QRY A;  3CI8 A;  4LQ5 A;  3UA8 A;  2I58 A;  3IB2 A;  4U4X A;  1B3E A;  4NF8 A;  1GR2 A;  1DMB A;  2O1L A;  3ZKK A;  3E13 X;  4ESW A;  3FVG A;  1IQ7 A;  1WVJ A;  5B70 A;  1B7Z A;  1SW1 A;  1B58 A;  3FGS A;  1N84 A;  2B65 A;  4RPN A;  4XIG Q;  5H8H A;  1RYO A;  4YMB A;  4R72 A;  3TFL A;  3I3V A;  4KPT A;  2QS3 A;  3CG1 A;  4RNS A;  4PE5 B;  3RN8 A;  3HO7 A;  1UTH B;  2F36 A;  4NF6 A;  1JQF A;  3DEL B;  3ECR A;  1PBQ A;  4EXK A;  4YB5 A;  3H06 B;  3BFU A;  2CZL A;  4OFL A;  4JXI A;  1NH7 A;  1JVY A;  1LLS A;  4U23 A;  4N13 A;  3U1O A;  1DTZ A;  2P0S A;  2WKY A;  1D9Y A;  3PUV E;  1M5D A;  3IJO B;  2IA4 A;  2XXV A;  4R2B A;  4MLV A;  2O6A A;  3T96 B;  3ZSF A;  4U1O A;  2I0B A;  4POX A;  4F31 B;  1PB8 A;  1NKX A;  1IEJ A;  1FTL A;  5H8F B;  4GVO A;  4H5F A;  2Q8J A;  1NNK A;  3O97 A;  3EHT A;  3GXA A;  4R6H A;  3BKI B;  2GH9 A;  1H43 A;  3CFX A;  1FQB A;  1MXY A;  1LCF A;  1PC3 A;  4JB7 A;  1IIW A;  1P1U A;  1US4 A;  2PT1 A;  1S7Y A;  1ZMG A;  3QUJ A;  4OEN A;  2DWH A;  1CB6 A;  3TTR A;  2I3V A;  2H9B A;  4TQU Q;  1JVX A;  4K3F A;  1USY H;  1SI1 A;  3FVK A;  4IO5 A;  2REJ A;  3MZ9 A;  2VHA A;  1EH3 A;  1AMF A;  4DZ1 A;  3D4G A;  3MP8 A;  2NOO A;  4H5G A;  4ELR A;  3SEY A;  4EF1 A;  2IEE A;  2I6E A;  4R9F A;  1H45 A;  4WEP A;  2THI A;  1N04 A;  2W7Y A;  3LC8 A;  3V5A A;  1MXW A;  1Z7M E;  2UVJ A;  4KYS A;  5IKB A;  2ZNT A;  1EZ9 A;  2R6G E;  3FJG A;  4GXS B;  4JBZ A;  3MC2 A;  2YJP A;  4FJP A;  4H0W A;  3CIJ A;  3G3I A;  1DOT A;  2D5W A;  1ZIU A;  1N0T A;  3VLU A;  4QFN A;  4LVQ A;  3U94 A;  3TTK A;  2NWJ A;  1JEV A;  3TCH A;  5KCJ A;  1B5J A;  1NNF A;  4QSD A;  4ZS9 A;  1I6Q A;  4RXL A;  1VSO A;  4OVJ A;  1JW1 A;  2BJJ X;  3LSL A;  2PX1 A;  3W15 C;  4OMB A;  3C35 A;  5FTI A;  4XTC Q;  2RCA A;  2HCA A;  5ITO A;  2Z22 A;  1Q35 A;  2DWI A;  3CFL A;  3K00 A;  5CBR A;  3Q29 A;  4F3B A;  4NF6 B;  1M5C A;  3RY3 A;  4FAT A;  1TWY A;  5JTY A;  1Y1M A;  4U2R A;  2DXR A;  5I58 A;  3SER A;  1USY E;  3TQW A;  3VLW A;  4X1B A;  4ZEI A;  2HXW A;  4F3P A;  4H1X A;  3RTF B;  4BDN A;  2UVH A;  2DWJ A;  1D9V A;  2F6P A;  4PFW A;  1FQE A;  3TTL A;  1S9T A;  3GZG A;  3CG3 A;  4GL8 A;  2HEU A;  1VR5 A;  1I6B A;  4AB6 A;  5AA4 A;  3OEK A;  2I48 A;  1TFD A;  3K01 A;  4RK9 A;  4F29 A;  3MZ1 A;  3QIM A;  5HM4 B;  1DTG A;  4GIZ A;  1QJM A;  1BKA A;  4PQJ A;  4UA8 A;  4BDR A;  4DE8 A;  1MQD A;  3OMB A;  1POY 1;  4G77 A;  1P99 A;  3RTW B;  5L9O A;  4YKP A;  2PMS A;  5I56 A;  3ODB A;  2HFB A;  1KWH A;  1NMU A;  1US5 A;  1NNT A;  2XXU A;  3EQ1 A;  2RF1 A;  3HHF A;  4GXA A;  2AYS A;  3SEX A;  3HPI A;  3UGW A;  3RT8 A;  2RCB A;  1FQC A;  3C34 A;  5AA2 B;  5EYF A;  1JW4 A;  2B3F A;  4DDD A;  3FXR A;  2I4B A;  3VLV A;  4I1D A;  3PPN A;  3UIF A;  1PB7 A;  3FV1 A;  3VVF A;  3GBB A;  1MQG A;  4ZEK A;  1P1Q A;  4C1U A;  3KOS A;  4BDQ A;  2V3U A;  1MH4 A;  4OER A;  2XXQ A;  3H6V A;  3PD8 A;  3G3F A;  1LAG E;  4O3A A;  3ZS6 A;  4XKQ A;  4OEV A;  2FA7 A;  1MM7 A;  1B3G A;  1TFA A;  2ANJ A;  1B51 A;  2Y7R A;  2QPQ A;  4FAJ A;  4E0W A;  4KYD A;  4Q0C A;  2YPN A;  2VD3 A;  5CC2 A;  2XXY A;  1BP5 A;  3MPK A;  5CBS A;  1FW0 A;  3A3U A;  3H3G A;  2Y7W A;  3H4Z A;  2DXY A;  1IXI A;  3IB0 A;  4NF4 A;  1PB9 A;  5I58 B;  3LSX A;  2REG A;  2VD2 A;  1UTH A;  5B7D A;  2QMX A;  2GHA A;  4QF9 A;  4DXU A;  3MVW A;  3ONM A;  1VFD A;  1B32 A;  5FTH A;  1VE4 A;  3MAM A;  3QK6 A;  1XVX A;  4DIG A;  4DCY A;  3O29 A;  2ZXT A;  1B0L A;  4RA1 A;  2H4I A;  3M3L A;  3RQT A;  1WOD A;  2RC8 A;  5AA4 B;  4OZ9 A;  4QFP A;  3MBP A;  4H8I A;  3PPR A;  5H8F A;  3FAS A;  3LSF B;  3MQ9 A;  2PVU A;  1GVC A;  4LQ2 A;  2XD3 A;  3CSG A;  3PU5 A;  4OEU A;  4G68 A;  2V3T A;  1B4Z A;  1AIV A;  4OXV A;  3GLB A;  4F1Y A;  3FXQ A;  4X9T A;  3T9V A;  2V25 A;  2Y84 A;  3Q26 A;  4TLL B;  2OZZ A;  1B9J A;  4NWD A;  3OEM A;  4KQP A;  1MPB A;  2F7A A;  3T9X B;  4IY5 A;  4LP2 B;  4EXL A;  5K2X A;  3K1M A;  2O7U A;  3CR9 A;  3T9U A;  3G3G A;  4HW8 A;  3LSW A;  4IGR A;  3FJ7 A;  2LAO A;  3O6H A;  1FQA A;  1M5B A;  3SET A;  1UIV A;  3VFJ A;  4PFY A;  1Y3N A;  3W9W A;  1II5 A;  1B5I A;  3B6T A;  3DP6 A;  4Q5T A;  4WXJ A;  3RUM A;  3WAE A;  2OWS A;  1LAF E;  1QUL A;  3PUZ E;  2KLF A;  4XKN A;  4F2O A;  4O3B A;  1T0K A;  2I3W A;  2D21 A;  1FQF A;  2ZNU A;  4P0G A;  3SDF A;  1URD A;  3TUS A;  3PPP A;  2ONS A;  3S9N C;  2I0C A;  2GHB A;  3C9H A;  4M4G A;  2E0S A;  4G8M A;  3MW0 A;  4OET A;  4KR5 A;  1ZKB A;  4NF4 B;  3O66 A;  4YIC A;  1MDP 1;  4GFR A;  3MZB A;  1NNP A;  4PET A;  4XKP A;  4NWC A;  3ZKL A;  2OK2 A;  1EU8 A;  3R6U A;  3IOW A;  4Z7E A;  4F3S A;  5A5X A;  4EQB A;  5ITP A;  1R1N A;  3TYH A;  2D3I A;  4OTE A;  2O1M A;  2ABH A;  4DXB A;  5ISU A;  4DLD A;  2XXP A;  4NED A;  2G93 A;  3G7W A;  3TEL A;  4QHQ A;  2RKM A;  1POT A;  2UXA A;  1MPD A;  2E1S A;  2PT2 A;  3KJ7 A;  2Y7I A;  4GL0 A;  4LAT A;  4DCX A;  4IY6 A;  2GFE A;  2F78 A;  1ZU0 A;  1MXX A;  4G68 B;  3S9M C;  5F7V A;  3OOA A;  5CI5 A;  1FTO A;  1LAH E;  1F9B A;  4KHZ E;  4U4S A;  3SEV A;  5DVF A;  5ICQ A;  3EPE A;  4THI A;  4OHN A;  3FUZ A;  3JV9 A;  3OO7 A;  3M3F A;  4OFO A;  5TP9 B;  3E3K A;  3IO6 A;  1QKA A;  2VOZ A;  3KGC A;  4POW A;  4MH5 A;  5I57 B;  5AA2 A;  4HCY A;  4ZE8 A;  3O9P A;  1NH8 A;  5F1Q A;  5JEI A;  4F22 A;  4KCC A;  4YKK A;  3EN3 A;  1AH5 A;  3RNN A;  3FD3 A;  1XC1 A;  1LBB A;  2OJT A;  4C1T A;  1MXU A;  2AL4 A;  1JEU A;  1QKB A;  3TTN A;  1MPC A;  3P7I A;  4PFT A;  2NXO A;  3TKD A;  1Y1Z A;  1SYI A;  2DP8 A;  3N26 A;  2QL3 A;  3QUF A;  5KDT A;  4QFL A;  1PDA A;  4JWX A;  4IO4 A;  3TTM A;  3K1P A;  3FVO A;  1N3X A;  3O6G A;  5DT6 A;  1J1N A;  2QS4 A;  3UP9 A;  4GOT A;  1OVB A;  3PMW A;  2XXW A;  4JSO A;  1MQH A;  2A5S A;  2ZNS A;  1Y4T A;  4I62 A;  4YKI A;  2A5T B;  3VXB A;  2F7B A;  3PD9 A;  3TMG A;  3FJM A;  5FHO A;  2ALU A;  4FEB A;  2DVC A;  4ZZE A;  2Q88 A;  1B3L A;  2CMO A;  5A5X B;  3EF7 A;  4BDL A;  1MY1 A;  1ELJ A;  5H8Q A;  4BDO A;  1BLF A;  1MY4 A;  2Y7P A;  4R75 A;  2AIX A;  3C31 A;  1BIY A;  3OSQ A;  3KFM A;  3PPQ A;  3UOR A;  4ZEF A;  3FVN A;  1DSN A;  1B7H A;  4GF8 A;  3S2V A;  3UK4 A;  2M8C A;  4JWY A;  4NTL A;  5EHM A;  1N76 A;  1B5H A;  4WKM A;  3PUW E;  1MG1 A;  4GWO A;  2OBG A;  3V89 B;  4ZEB A;  4IO3 A;  4AQ4 A;  1MH3 A;  3KZG A;  2P2A A;  2ONR A;  4NE4 A;  3VXC A;  1A7L A;  1DPE A;  3E4R A;  5AA1 A;  5CMC A;  4E0X A;  4JDF A;  1MY0 A;  1A8F A;  3G3H A;  1LFG A;  4HS7 A;  3OO6 A;  4FED A;  2OLB A;  1XVY A;  1LBC A;  3R7X A;  4IB2 A;  3CSB A;  3R26 A;  3HST A;  3IL1 B;  5M2V A;  4YB6 A;  3Q25 A;  4EF2 A;  5CMM A;  2ZYK A;  4ONY A;  4ELQ A;  5IAI A;  1EZO A;  4F19 A;  2ZYO A;  1N7W A;  3MP1 A;  5L8D A;  3IOR A;  1WDN A;  3TAJ A;  4ND9 A;  1D4N A;  1O63 A;  1H44 A;  4YKJ A;  2P1S A;  4OES A;  3DP4 A;  2F34 A;  3U72 A;  2O68 A;  1OQH A;  4KFQ A;  5KDT B;  1MY2 A;  1M5F A;  4EQ7 A;  3Q27 A;  2VGQ A;  2QS1 A;  1Y3Q A;  2ZYN A;  3CVG A;  4FEC A;  4MFI A;  3H6W A;  3PV0 E;  1ATG A;  1N7X A;  5TU0 A;  1MQJ A;  2H25 A;  4EQ9 A;  3USD A;  5EHS A;  5HPQ A;  4YMA A;  4LZ5 A;  1A54 A;  2ZYM A;  4QFO A;  2UVG A;  4H6D A;  5K2Y A;  2AL5 A;  1GTK A;  5CM6 A;  5ICT A;  4IO7 A;  1H3D A;  2DE3 A;  3OEN A;  3FAT A;  1PEB A;  2F6G A;  5H8Q B;  2RC7 A;  5J1D A;  1B2H A;  4F1U A;  4H65 A;  4ISU A;  1I6A A;  3K6X A;  3AXF A;  1R9L A;  4F39 A;  3PPO A;  3KG2 A;  1UIU A;  2Y7K A;  3THI A;  1URG A;  3VVE A;  3C36 A;  4GRK A;  3V8X B;  1RYX A;  4LZ7 A;  3T93 B;  4I9D A;  4PP0 A;  3A3C A;  5DEX A;  2DVZ A;  3QXM A;  3KN8 A;  5DVJ A;  1Y3P A;  3CRB A;  3FXU A;  3IR1 A;  4JWO A;  1MS7 A;  3PMX A;  3MWB A;  3TDJ A;  1HSJ A;  1IXG A;  1LB8 A;  1PBP A;  3U8Q A;  4GD5 A;  1I69 A;  1MXZ A;  1NFT A;  3VDF A;  1YPN A;  2DWA A;  2UYE A;  3N6U A;  1M5E A;  4LZ8 A;  2NVU B;  1ZLQ A;  1B1X A;  4ELO A;  1R9Q A;  2HQ0 A;  4LA9 A;  1YCJ A;  1VFE A;  5TP9 A;  3IK6 B;  5I2N A;  3MVX A;  4Q8R A;  1P1O A;  4FIM A;  1XHY A;  1IIT A;  1A8E A;  3OO9 A;  4RK2 A;  4I8C A;  1B46 A;  1SDX A;  5I57 A;  1A40 A;  3CFZ A;  2UYF A;  3LUY A;  5CRY A;  1MRP A;  3OSR A;  3PUY E;  2NUV A;  1LAX A;  5TPA B;  2H98 A;  1D3K A;  4R74 A;  1LCT A;  1MDQ A;  3H03 A;  4KYE A;  2Q2C A;  5AA2 D;  1B3F A;  1B0H A;  3M3K A;  2Q2A A;  5CMB A;  3H7M A;  3I5O A;  4IGT A;  5KZT A;  3DP8 A;  1R6Z A;  2PYY A;  3IAZ A;  4F18 A;  5HBC A;  3H6U A;  2XX8 A;  4FOR A;  2HAU A;  3K1N A;  3MUQ A;  2A5T A;  3M8U A;  3RGY A;  2XXH A;  4NMY A;  1UTB A;  1OLC A;  2I4C A;  3IX1 A;  3K6W A;  3K0V A;  4R6Y A;  3K02 A;  2OCU A;  1ZBM A;  2H5Y A;  3B6Q A;  2F8D A;  3C32 A;  4L17 A;  2V84 A;  2ONK E;  3IB1 A;  5FHM A;  1XT8 A;  1YTV A;  3DLN A;  1O64 A;  4JSD A;  5DEX B;  2ESN A;  2XXR A;  3KSJ A;  1QUI A;  1SW2 A;  4U22 A;  3FV2 A;  4AB5 A;  1GGG A;  1B7U A;  4HTG A;  4KI0 E;  3KJT A;  3T22 A;  3K6U A;  3KEI A;  5I59 B;  1B6H A;  2XX7 A;  2DE4 A;  2Z23 A;  1JNF A;  1QUK A;  4YAH X;  4X1D A;  1B52 A;  4R9G A;  3OO8 A;  4QSE A;  1OMP A;  4OFJ A;  1OLA A;  3JYR A;  2X26 A;  4R6K A;  4ELP A;  5AA3 A;  3TEP A;  5I2N B;  4EDP A;  1TXF A;  4YU0 A;  4PFU A;  5AE4 A;  1N3W A;  4TLM B;  2XX9 A;  4H67 A;  2O51 A;  2DSF A;  1ZJL A;  3U93 A;  2VP1 A;  3C33 A;  1B4H A;  3OEL A;  3QAX A;  5LOM A;  2QJE A;  3IOU A;  3L6G A;  3A09 A;  4G8N A;  1SW4 A;  3HN0 A;  1SQY A;  4G2Z A;  2QS2 A;  4GLI A;  4P0I A;  5BUU A;  1SBP A;  2FYI A;  3O28 A;  1SI0 A;  1B1H A;  3N94 A;  2I49 A;  1H76 A;  1IUD A;  3LR1 A;  5DTB A;  1DPP A;  4HCW A;  4Q30 B;  4KCD A;  4N07 A;  4YB7 A;  4NF8 B;  4ESX A;  3TCG A;  5H8S A;  1MQI A;  3TZA A;  4IO6 A;  1QW0 A;  2Z8D A;  1MY3 A;  3EHS A;  3N5L A;  3FIR A;  4ZE9 A;  1Z7N E;  2O69 A;  1MM6 A;  1IXH A;  5H8H B;  3GBA A;  1JW5 A;  2DE2 A;  3ILT B;  4BDM A;  2XXI A;  2F7C A;  2HZL A;  5BWJ A;  1UTB B;  2B3B A;  3DM0 A;  1A99 A;  3KBR A;  1URS A;  4H8J A;  3F11 A;  4G4P A;  2F97 A;  3U92 A;  1LB9 A;  1P1N A;  1O7T A;  2HAV A; 
#chains in the Genus database with same CATH topology
 2ZMB A;  4GQO A;  3HHG A;  1B05 A;  1A55 A;  5JK4 A;  3PGF A;  2GRV A;  3RPL B;  4QRZ A;  4N8G A;  1LBV A;  4OWD A;  1LFI A;  3VVD A;  4YZZ A;  2DQV A;  2ZZV A;  3RT6 B;  4MLQ A;  1Y4C A;  3V83 A;  2PBW A;  3SES A;  3RPW A;  2O84 X;  2Z8F A;  3L6H A;  4X48 A;  3VV5 A;  3IJX B;  5T3J A;  4BLA A;  1LST A;  1XS5 A;  1JET A;  4MJO A;  1FCK A;  4O94 A;  2QSX A;  2X7P A;  3KBZ A;  3K2D A;  3Q28 A;  1Y9U A;  4OQO A;  5L9S A;  3S9E A;  2HZK A;  1RKM A;  3SKP A;  4MF3 A;  4N6P A;  5FHN A;  1CE2 A;  4F1V A;  4ZDM A;  2FNC A;  1SD3 A;  1YAE A;  3KOT A;  3BBR A;  5EQ8 A;  2R9J A;  1FTJ A;  4QFK A;  5I2K A;  3JZJ A;  2O7I A;  2YLN A;  4TOZ A;  3OD7 A;  2OWT A;  4XXU A;  1SYH A;  2H99 A;  1JP4 A;  4M1V A;  5H8N A;  3QSL A;  3IOV A;  1XOC A;  5CMK A;  1Q1K A;  5IZ3 A;  1LFH A;  4X8R A;  5TPA A;  2CZH A;  2G29 A;  3TQL A;  2UVI A;  2F5X A;  1FSA A;  4LUB A;  3MVZ A;  3QYT A;  4WED A;  2DYX A;  4G68 C;  3TOD A;  4QSC A;  3KN3 A;  1ZTY A;  3KN7 A;  4EUO A;  1RDX A;  3B6W A;  1AOV A;  4P11 A;  5KCJ B;  4R2F A;  4MIJ A;  3N6T A;  3H6T A;  2Q9T A;  4NF5 A;  1TT1 A;  1OQG A;  3KC0 A;  1Y20 A;  1BTJ A;  4RY1 A;  4ZED A;  4OVP A;  3SEW A;  3S9L C;  2RC9 A;  1NV4 A;  4O3C A;  3MJN A;  3T66 A;  1IXC A;  2R71 A;  1B40 A;  3G3K A;  4GX3 A;  3PUX E;  4N6D A;  3MPL A;  4ECF A;  3BFT A;  2Q89 A;  2DS9 A;  3SEU A;  3UN6 A;  4ZZA A;  5JTY B;  4XKR A;  3ILU B;  5LTC A;  3E79 A;  4PF6 A;  3C4M A;  5ELV A;  1DK4 A;  4KD5 A;  2XD2 A;  4PF8 A;  4N6K A;  3E9X A;  4F3G A;  1FPE A;  3KSX A;  3D4C A;  4N81 A;  2QVR A;  5DW8 A;  1NL5 A;  1GV8 A;  5DVI A;  4R73 A;  3MP6 A;  1SW5 A;  3O6I A;  4OVS A;  1IZ1 A;  2CEX A;  1S50 A;  3HV1 A;  4UAC A;  1QUJ A;  1AL3 A;  4RPO A;  5I59 A;  2DOJ A;  3LBS A;  1NUW A;  3TPA A;  3WAF A;  3T9H B;  2Z8E A;  3MVY A;  2X7Q A;  4DXC A;  4U1Z A;  1QVS A;  4PDH A;  4F2Q A;  5I84 A;  1HSE A;  5I56 B;  2XXX A;  4C0R A;  3BIG A;  4MX6 A;  4RYA A;  2RIN A;  5I2K B;  1B3H A;  1MXV A;  4IO2 A;  3EHU A;  5L9M A;  3I6V A;  3FZV A;  4G8H A;  1ANF A;  2QMW A;  3W9V A;  1QGX A;  4LON B;  4OYV A;  1LGB C;  1FTK A;  5H8N B;  1P1W A;  3RLF E;  1FQD A;  1EZP A;  2XWO A;  3K6V A;  3HCQ A;  3OXN A;  3S4U A;  3G3J A;  3QMF A;  2V93 A;  2XHD A;  2P3V A;  2Q8M A;  1OVT A;  4RJZ A;  2V3Q A;  3B7D A;  4GX4 A;  5DYH A;  4Z0I A;  5ET5 A;  2XXT A;  4ZEC A;  1L5T A;  4U21 A;  3PMV A;  3TCF A;  4FE8 A;  2F35 A;  4MBP A;  1HSL A;  1NV7 A;  1UQW A;  1SVX B;  1FRP A;  3K4U A;  3VE1 B;  3IOT A;  4H46 A;  1OIB A;  3RYD A;  3IO4 A;  3O2A A;  4NF5 B;  1FTM A;  2OWZ A;  2Y5K A;  2QRY A;  3CI8 A;  4LQ5 A;  3UA8 A;  2I58 A;  5I3S A;  3IB2 A;  4U4X A;  1B3E A;  4NF8 A;  1GR2 A;  1DMB A;  2O1L A;  2L5V A;  3ZKK A;  3E13 X;  4GWW A;  4ESW A;  3FVG A;  1IQ7 A;  1WVJ A;  4QXD A;  5B70 A;  1B7Z A;  1SW1 A;  1B58 A;  3FGS A;  1N84 A;  2B65 A;  4RPN A;  4XIG Q;  5H8H A;  1RYO A;  4YMB A;  4R72 A;  3TFL A;  2HXR A;  3I3V A;  4KPT A;  2QS3 A;  3CG1 A;  4MEV A;  4RNS A;  4PE5 B;  3RN8 A;  3HO7 A;  1UTH B;  2F36 A;  4NF6 A;  1JQF A;  3DEL B;  3ECR A;  1FPL A;  4GX6 A;  1PBQ A;  4EXK A;  4YB5 A;  3H06 B;  3BFU A;  2CZL A;  2WYK A;  4JXI A;  4OFL A;  2WBD A;  1NH7 A;  1JVY A;  1LLS A;  4U23 A;  4N13 A;  3U65 A;  3U1O A;  1DTZ A;  2P0S A;  2WKY A;  5IZZ A;  1D9Y A;  3PUV E;  1M5D A;  3IJO B;  2IA4 A;  2XXV A;  4R2B A;  4MLV A;  2O6A A;  3T96 B;  3ZSF A;  4U1O A;  2CEY A;  2I0B A;  4POX A;  4F31 B;  1PB8 A;  1NKX A;  1IEJ A;  1FTL A;  5H8F B;  4DI4 B;  4GVO A;  4H5F A;  2Q8J A;  1DCU A;  1NNK A;  4NAP A;  1NV5 A;  3O97 A;  3EHT A;  4OA4 A;  1KZ8 A;  3GXA A;  4R6H A;  3BKI B;  2F3D A;  2GH9 A;  1H43 A;  4GWY A;  3CFX A;  1FQB A;  1MXY A;  1LCF A;  1PC3 A;  3SZP A;  4JB7 A;  1IIW A;  1P1U A;  1US4 A;  2PT1 A;  1S7Y A;  1ZMG A;  3QUJ A;  4OEN A;  2DWH A;  1CB6 A;  3TTR A;  2I3V A;  2H9B A;  4TQU Q;  1JVX A;  4OAN A;  2JJK A;  4K3F A;  1USY H;  1SI1 A;  3FVK A;  4IO5 A;  2REJ A;  3MZ9 A;  2VHA A;  1EH3 A;  1AMF A;  4DZ1 A;  2XWK A;  3D4G A;  3MP8 A;  1EYK A;  2NOO A;  4H5G A;  4ELR A;  3SEY A;  4EF1 A;  2IEE A;  2I6E A;  4R9F A;  1H45 A;  3BIH A;  2THI A;  1N04 A;  4WEP A;  2W7Y A;  3LC8 A;  2WBB A;  3V5A A;  1MXW A;  1Z7M E;  2UVJ A;  4KYS A;  5IKB A;  2ZNT A;  1EZ9 A;  2R6G E;  1FBD A;  3FJG A;  4GXS B;  4JBZ A;  3MC2 A;  2YJP A;  2CZI A;  2XWV A;  4FJP A;  4H0W A;  3CIJ A;  3G3I A;  4P47 A;  1DOT A;  2D5W A;  1ZIU A;  1N0T A;  1NV6 A;  3VLU A;  4QFN A;  3FBP A;  4LVQ A;  3TTK A;  3U94 A;  2NWJ A;  1JEV A;  4O7I A;  3TCH A;  1YZ0 A;  5KCJ A;  1B5J A;  1YYZ A;  1NNF A;  4QSD A;  4IR8 A;  4ZS9 A;  1I6Q A;  4RXL A;  1VSO A;  4OVJ A;  1JW1 A;  2BJJ X;  3LSL A;  2PX1 A;  3W15 C;  4OMB A;  3C35 A;  5FTI A;  4XTC Q;  2RCA A;  2HCA A;  5ITO A;  2Z22 A;  1Q35 A;  2DWI A;  1FBG A;  5IGA A;  3CFL A;  3K00 A;  5CBR A;  3Q29 A;  4F3B A;  4NF6 B;  1M5C A;  3RY3 A;  4FAT A;  1TWY A;  5JTY A;  4PTK A;  1Y1M A;  4U2R A;  2DXR A;  5I58 A;  4P3L A;  3SER A;  1USY E;  5A5L A;  5IM2 A;  3TQW A;  3VLW A;  4X1B A;  4ZEI A;  2HXW A;  1SPI A;  4F3P A;  4H1X A;  3RTF B;  4BDN A;  2UVH A;  2DWJ A;  4P56 A;  1D9V A;  2F6P A;  5J16 A;  4PFW A;  1FQE A;  3TTL A;  1S9T A;  2FIE A;  3GZG A;  3CG3 A;  4O7M A;  4GL8 A;  2HEU A;  3T0J A;  1VR5 A;  1I6B A;  4AB6 A;  1IME A;  5AA4 A;  3OEK A;  2I48 A;  1TFD A;  3K01 A;  4RK9 A;  4F29 A;  3MZ1 A;  3QIM A;  5HM4 B;  1DTG A;  1NUX A;  2XA5 A;  5EQ7 A;  4GIZ A;  1QJM A;  1BKA A;  2Y5L A;  4PQJ A;  4UA8 A;  4BDR A;  4DE8 A;  4HE2 A;  1MQD A;  3OMB A;  1POY 1;  4G77 A;  3A29 A;  1P99 A;  3RTW B;  5L9O A;  4YKP A;  1AWB A;  2PMS A;  5I56 A;  3ODB A;  2HFB A;  2KQZ A;  4HXV A;  1KWH A;  1NMU A;  1US5 A;  1NNT A;  4XF5 A;  2XXU A;  3EQ1 A;  2RF1 A;  3HHF A;  4GXA A;  2AYS A;  3SEX A;  3HPI A;  3UGW A;  3RT8 A;  2RCB A;  4PFR A;  1FQC A;  3C34 A;  5AA2 B;  5EYF A;  1JW4 A;  2B3F A;  2WYP A;  1FBC A;  3D1R A;  4DDD A;  3FXR A;  2I4B A;  3VLV A;  4I1D A;  3PPN A;  3UIF A;  4LN5 A;  1PB7 A;  4GWU A;  2VT5 A;  4NG7 A;  1FPK A;  3FV1 A;  3VVF A;  3GBB A;  1MQG A;  4ZEK A;  1P1Q A;  4PAI A;  4QBA A;  4C1U A;  3KOS A;  4BDQ A;  5ET6 A;  2V3U A;  2MKZ A;  1MH4 A;  4OER A;  2XXQ A;  3H6V A;  3PD8 A;  3G3F A;  1LAG E;  4O3A A;  1FJ6 A;  3ZS6 A;  4XKQ A;  4OEV A;  2FA7 A;  1MM7 A;  1B3G A;  1TFA A;  2ANJ A;  1B51 A;  2Y7R A;  4PAF A;  4I40 A;  2QPQ A;  4GBW A;  4FAJ A;  4E0W A;  2VPN A;  4KYD A;  4Q0C A;  2YPN A;  4OVQ A;  1NI9 A;  2VD3 A;  5CC2 A;  2XXY A;  1BP5 A;  4OVR A;  3MPK A;  5CBS A;  1FW0 A;  3A3U A;  3H3G A;  2Y7W A;  3H4Z A;  1IMC A;  2DXY A;  1IXI A;  1NUY A;  3IB0 A;  4NF4 A;  5ET8 A;  1PB9 A;  4N91 A;  5I58 B;  3LSX A;  2REG A;  2VD2 A;  1UTH A;  5B7D A;  2QMX A;  4P1E A;  2GHA A;  4QF9 A;  4DXU A;  3MVW A;  4N4U A;  3ONM A;  1VFD A;  1B32 A;  5FTH A;  1VE4 A;  3MAM A;  3QK6 A;  1XVX A;  5I7I A;  4DIG A;  4DCY A;  3O29 A;  2ZXT A;  1B0L A;  4RA1 A;  4PE3 A;  2H4I A;  3M3L A;  3RQT A;  1WOD A;  2RC8 A;  5AA4 B;  4OZ9 A;  4QFP A;  3MBP A;  4H8I A;  3PPR A;  5H8F A;  2B4L A;  3FAS A;  3LSF B;  3MQ9 A;  1INP A;  2PVU A;  1GVC A;  4LQ2 A;  2XD3 A;  3CSG A;  3PU5 A;  5I5P A;  4UAB A;  4G61 A;  4OEU A;  4G68 A;  2V3T A;  1B4Z A;  1AIV A;  4OXV A;  3GLB A;  2Q74 A;  4F1Y A;  3FXQ A;  4X9T A;  3T9V A;  2V25 A;  2Y84 A;  3Q26 A;  4JVD A;  4P8B A;  4TLL B;  2OZZ A;  1B9J A;  4NWD A;  3OEM A;  4KQP A;  4GBV A;  1MPB A;  2F7A A;  3T9X B;  4IY5 A;  4LP2 B;  4EXL A;  2DDK A;  5K2X A;  3K1M A;  2O7U A;  1FPB A;  3CR9 A;  3T9U A;  3G3G A;  4HW8 A;  3LSW A;  1DBZ A;  4IGR A;  2PCR A;  3FJ7 A;  1NV3 A;  2LAO A;  3O6H A;  1FQA A;  1M5B A;  3SET A;  4AS4 A;  4PC9 A;  2FIX A;  1UIV A;  3VFJ A;  4PFY A;  4GWS A;  1Y3N A;  3W9W A;  1II5 A;  1B5I A;  3B6T A;  3DP6 A;  4Q5T A;  4PFB A;  4WXJ A;  3RUM A;  3WAE A;  4NF0 A;  2OWS A;  1LAF E;  1QUL A;  4PGN A;  3PUZ E;  3EKI A;  2KLF A;  4XKN A;  4F2O A;  4O3B A;  1T0K A;  1D9Q A;  2I3W A;  2D21 A;  1FQF A;  2ZNU A;  4P0G A;  3SDF A;  1URD A;  3TUS A;  3PPP A;  2ONS A;  3S9N C;  2I0C A;  2GHB A;  3C9H A;  4M4G A;  1XI6 A;  2E0S A;  4G8M A;  3MW0 A;  4OET A;  4FBP A;  4KR5 A;  1ZKB A;  4NF4 B;  3O66 A;  4YIC A;  1MDP 1;  2QVU A;  4GFR A;  3MZB A;  1NNP A;  4PET A;  4XKP A;  4NWC A;  3ZKL A;  2OK2 A;  1EU8 A;  3R6U A;  3IOW A;  4Z7E A;  4F3S A;  5A5X A;  4EQB A;  5ITP A;  1LBY A;  1R1N A;  2QVV A;  3TYH A;  2D3I A;  1FPI A;  4OTE A;  2O1M A;  1NV1 A;  2ABH A;  4DXB A;  5ISU A;  4MNP A;  4DLD A;  4GWZ A;  2XXP A;  1IMD A;  4NED A;  1NUZ A;  2G93 A;  3G7W A;  4GWX A;  3TEL A;  4QHQ A;  2RKM A;  1POT A;  2UXA A;  1MPD A;  2E1S A;  2PT2 A;  3KJ7 A;  2Y7I A;  4GL0 A;  4LAT A;  4DCX A;  4IY6 A;  4HE0 A;  2GFE A;  2F78 A;  4JVC A;  1ZU0 A;  1MXX A;  4G68 B;  3S9M C;  5F7V A;  3OOA A;  5CI5 A;  1FTO A;  1LAH E;  1F9B A;  4KHZ E;  4U4S A;  3SEV A;  5DVF A;  5ICQ A;  3EPE A;  4THI A;  4OHN A;  3FUZ A;  3JV9 A;  3OO7 A;  3M3F A;  4OFO A;  5TP9 B;  1K9Y A;  3E3K A;  3IO6 A;  1QKA A;  2VOZ A;  5ESY A;  3KGC A;  4HE1 A;  4POW A;  4MH5 A;  5I57 B;  5AA2 A;  4HCY A;  4ZE8 A;  3O9P A;  1NH8 A;  5F1Q A;  5JEI A;  1G0H A;  4F22 A;  4KCC A;  4YKK A;  3EN3 A;  1AH5 A;  3RNN A;  3FD3 A;  1XC1 A;  1LBB A;  2OJT A;  4NHB A;  4C1T A;  1NV2 A;  1MXU A;  2AL4 A;  1JEU A;  1QKB A;  4PAK A;  3TTN A;  1MPC A;  3P7I A;  4PFT A;  2NXO A;  3TKD A;  1Y1Z A;  1LBX A;  1SYI A;  2DP8 A;  3N26 A;  2QL3 A;  2R8T A;  3QUF A;  5KDT A;  4QFL A;  1PDA A;  4JWX A;  4IO4 A;  3TTM A;  1G0I A;  3K1P A;  3T1B A;  3FVO A;  1N3X A;  2V4C A;  3O6G A;  5DT6 A;  1J1N A;  2QS4 A;  5EYH A;  3UP9 A;  4GOT A;  1OVB A;  3PMW A;  4MCO A;  2XXW A;  4JSO A;  1MQH A;  2A5S A;  2ZNS A;  1Y4T A;  4I62 A;  4N17 A;  4YKI A;  2A5T B;  1BK4 A;  3VXB A;  2F7B A;  3PD9 A;  4MMP A;  3TMG A;  3MYU A;  3FJM A;  5FHO A;  2ALU A;  4FEB A;  2BJI A;  2DVC A;  4ZZE A;  2Q88 A;  1B3L A;  4O8M A;  2CMO A;  5A5X B;  3EF7 A;  4BDL A;  1MY1 A;  1ELJ A;  5H8Q A;  4BDO A;  1BLF A;  1MY4 A;  2Y7P A;  4R75 A;  2AIX A;  3C31 A;  2PFY A;  1BIY A;  3OSQ A;  4NN3 A;  3KFM A;  3PPQ A;  2CZK A;  3FXB A;  3UOR A;  3HFU A;  4P1L A;  4ZEF A;  3FVN A;  1DSN A;  1B7H A;  4GF8 A;  3S2V A;  3UK4 A;  2M8C A;  4JWY A;  4NTL A;  5EHM A;  1N76 A;  2XWI A;  1Q9D A;  3PTY A;  1B5H A;  4WKM A;  3PUW E;  4MNI A;  1MG1 A;  5LDZ A;  4MNC A;  1FTA A;  4GWO A;  2OBG A;  3V89 B;  4ZEB A;  1LEV A;  2VPO A;  4IO3 A;  4AQ4 A;  1MH3 A;  3KZG A;  2P2A A;  2ONR A;  1LBZ A;  4NE4 A;  3VXC A;  5EQ9 A;  1A7L A;  4MHF A;  1DPE A;  3E4R A;  5AA1 A;  1YXI A;  2P3N A;  5CMC A;  4E0X A;  4JDF A;  1MY0 A;  1A8F A;  3G3H A;  1LFG A;  4HS7 A;  3OO6 A;  4FED A;  2OLB A;  1XVY A;  1LBC A;  4XEQ A;  3R7X A;  4IB2 A;  3CSB A;  3R26 A;  3HST A;  3IL1 B;  5M2V A;  4YB6 A;  3Q25 A;  1VDW A;  4EF2 A;  5CMM A;  2ZYK A;  4ONY A;  4ELQ A;  5IAI A;  1EZO A;  4F19 A;  2ZYO A;  1N7W A;  1FBE A;  2B4M A;  3MP1 A;  5L8D A;  3IOR A;  1FJ9 A;  1WDN A;  3TAJ A;  4ND9 A;  1D4N A;  1O63 A;  1H44 A;  4YKJ A;  2P1S A;  4OES A;  1K9Z A;  3DP4 A;  2F34 A;  3U72 A;  2O68 A;  2HHM A;  1OQH A;  4KFQ A;  5KDT B;  1MY2 A;  4PBQ A;  1M5F A;  4EQ7 A;  3E78 A;  3Q27 A;  2VGQ A;  2QS1 A;  1Y3Q A;  4AS5 A;  2ZYN A;  3CVG A;  4FEC A;  4MFI A;  3H6W A;  3PV0 E;  1ATG A;  4PCD A;  1N7X A;  5TU0 A;  1MQJ A;  2H25 A;  4EQ9 A;  3USD A;  5EHS A;  5HPQ A;  4YMA A;  3GYY A;  4LZ5 A;  5IZ1 A;  1A54 A;  2ZYM A;  4I3Y A;  4PGP A;  4QFO A;  4DI3 D;  2UVG A;  4H6D A;  5K2Y A;  4KXP A;  1IMF A;  2AL5 A;  1GTK A;  1FPJ A;  5CM6 A;  5ICT A;  4IO7 A;  1H3D A;  2DE3 A;  3OEN A;  3FAT A;  1FPG A;  1PEB A;  2F6G A;  5H8Q B;  2RC7 A;  5J1D A;  1IMA A;  1B2H A;  4F1U A;  4H65 A;  4ISU A;  4OVT A;  1I6A A;  3K6X A;  4MAG A;  3AXF A;  1R9L A;  4F39 A;  3PPO A;  3KG2 A;  3B50 A;  1UIU A;  2Y7K A;  3THI A;  2WX9 A;  1LBW A;  1URG A;  3VVE A;  2FHY A;  3C36 A;  4GRK A;  4NX1 A;  3V8X B;  1RYX A;  4LZ7 A;  3T93 B;  4I9D A;  4PP0 A;  3A3C A;  5DEX A;  2DVZ A;  3QXM A;  3KN8 A;  5DVJ A;  1Y3P A;  3CRB A;  3FXU A;  4PDD A;  3IR1 A;  4JWO A;  1MS7 A;  3PMX A;  5FBP A;  3MWB A;  3TDJ A;  1HSJ A;  1IXG A;  1LB8 A;  1PBP A;  3U8Q A;  4GD5 A;  1I69 A;  1MXZ A;  1NFT A;  3VDF A;  1YPN A;  4PBH A;  2DWA A;  2UYE A;  3N6U A;  1M5E A;  4LZ8 A;  2GQ1 A;  2NVU B;  1ZLQ A;  1B1X A;  4ELO A;  1R9Q A;  2HQ0 A;  4PFI A;  1FPD A;  4LA9 A;  1YCJ A;  1VFE A;  5TP9 A;  3IK6 B;  5I2N A;  3MVX A;  4Q8R A;  1P1O A;  4FIM A;  2ZZX A;  1XHY A;  1IIT A;  1A8E A;  3OO9 A;  4RK2 A;  4I8C A;  1B46 A;  1SDX A;  5I57 A;  1A40 A;  3CFZ A;  3LV0 A;  2UYF A;  3LUY A;  5CRY A;  1MRP A;  3OSR A;  4N15 A;  3PUY E;  3B8B A;  4P9K A;  5IZ3 B;  2NUV A;  1LAX A;  5TPA B;  3IFA A;  2H98 A;  1D3K A;  4R74 A;  1LCT A;  2PFZ A;  1RDZ A;  1MDQ A;  3H03 A;  4KYE A;  2Q2C A;  5AA2 D;  1B3F A;  1B0H A;  3KC1 A;  3M3K A;  1RDY A;  2Q2A A;  5CMB A;  3H7M A;  3I5O A;  4IGT A;  3ROJ A;  2KR0 A;  5KZT A;  3DP8 A;  1R6Z A;  2PYY A;  5EYG A;  3IAZ A;  4F18 A;  5HBC A;  3H6U A;  2XX8 A;  4FOR A;  4X04 A;  2HAU A;  3K1N A;  3MUQ A;  2A5T A;  1FBF A;  3M8U A;  4JVI A;  3RGY A;  2XXH A;  4NMY A;  1UTB A;  1OLC A;  2I4C A;  3IX1 A;  3K6W A;  3K0V A;  5EQA A;  4R6Y A;  1KA0 A;  3K02 A;  2OCU A;  1ZBM A;  2H5Y A;  3B6Q A;  2F8D A;  2FVZ A;  3C32 A;  4L17 A;  2V84 A;  2ONK E;  3IB1 A;  5FHM A;  1XT8 A;  1YTV A;  3DLN A;  4XFE A;  1O64 A;  4JSD A;  5DEX B;  2ESN A;  1IMB A;  1FBP A;  2XXR A;  3KSJ A;  1QUI A;  1SW2 A;  4U22 A;  2FBP A;  3FV2 A;  4AB5 A;  1GGG A;  1B7U A;  2QFL A;  4HTG A;  4KI0 E;  3KJT A;  3T22 A;  3K6U A;  3RPL A;  3KEI A;  5I59 B;  1B6H A;  2XX7 A;  2OX3 A;  2DE4 A;  2Z23 A;  1EYJ A;  1JNF A;  1QUK A;  2ZZW A;  4YAH X;  4X1D A;  1B52 A;  3ISP A;  4R9G A;  3OO8 A;  4QSE A;  1OMP A;  4OFJ A;  1OLA A;  3JYR A;  2X26 A;  4R6K A;  4ELP A;  5AA3 A;  3TEP A;  5I2N B;  4EDP A;  1TXF A;  4YU0 A;  4PFU A;  5AE4 A;  1N3W A;  4I3E A;  4TLM B;  2XX9 A;  4H67 A;  2O51 A;  4NQ8 A;  2DSF A;  3IFC A;  1ZJL A;  3U93 A;  2VP1 A;  3C33 A;  1NV0 A;  1B4H A;  3OEL A;  3QAX A;  5LOM A;  2QJE A;  3IOU A;  3L6G A;  3A09 A;  4G8N A;  1SW4 A;  2WEF A;  3HN0 A;  1SQY A;  4G2Z A;  2QS2 A;  3LUZ A;  4GLI A;  4P0I A;  5BUU A;  1SBP A;  2FYI A;  2HPG A;  3O28 A;  1SI0 A;  1B1H A;  3N94 A;  2I49 A;  1H76 A;  5F24 A;  1IUD A;  3LR1 A;  1CNQ A;  5DTB A;  1DPP A;  4HCW A;  4Q30 B;  1KA1 A;  1FPF A;  4KCD A;  4N07 A;  4YB7 A;  4NF8 B;  4ESX A;  4H45 A;  3TCG A;  5H8S A;  2F3B A;  1MQI A;  3TZA A;  4IO6 A;  1QW0 A;  2Z8D A;  1MY3 A;  3EHS A;  4NGU A;  3N5L A;  3FIR A;  4ZE9 A;  1Z7N E;  2O69 A;  1MM6 A;  1IXH A;  5H8H B;  5ET7 A;  4N8Y A;  1FBH A;  3GBA A;  1JW5 A;  2DE2 A;  3ILT B;  4BDM A;  2XXI A;  2F7C A;  2HZL A;  5BWJ A;  1UTB B;  1EYI A;  2B3B A;  3DM0 A;  3MST A;  1A99 A;  3KBR A;  3CHG A;  1URS A;  4H8J A;  2XXK A;  3F11 A;  4G4P A;  2F97 A;  3U92 A;  1LB9 A;  1P1N A;  1O7T A;  2HAV A;  3NOH A; 
#chains in the Genus database with same CATH homology
 2ZMB A;  4GQO A;  3HHG A;  1B05 A;  1A55 A;  5JK4 A;  3PGF A;  2GRV A;  4QRZ A;  4OWD A;  1LFI A;  3VVD A;  4YZZ A;  2DQV A;  3RT6 B;  4MLQ A;  1Y4C A;  3V83 A;  2PBW A;  3SES A;  3RPW A;  2O84 X;  2Z8F A;  3L6H A;  4X48 A;  3VV5 A;  3IJX B;  4BLA A;  1LST A;  1XS5 A;  1JET A;  1FCK A;  2QSX A;  2X7P A;  3K2D A;  3Q28 A;  1Y9U A;  4OQO A;  5L9S A;  3S9E A;  2HZK A;  1RKM A;  3SKP A;  4MF3 A;  4N6P A;  5FHN A;  1CE2 A;  4F1V A;  4ZDM A;  2FNC A;  1SD3 A;  1YAE A;  3KOT A;  3BBR A;  2R9J A;  1FTJ A;  4QFK A;  5I2K A;  3JZJ A;  2O7I A;  2YLN A;  4TOZ A;  3OD7 A;  2OWT A;  4XXU A;  1SYH A;  2H99 A;  4M1V A;  5H8N A;  3QSL A;  3IOV A;  1XOC A;  5CMK A;  1Q1K A;  1LFH A;  5TPA A;  2G29 A;  3TQL A;  2UVI A;  2F5X A;  4LUB A;  3MVZ A;  3QYT A;  4WED A;  2DYX A;  4G68 C;  3TOD A;  4QSC A;  3KN3 A;  1ZTY A;  3KN7 A;  4EUO A;  3B6W A;  1AOV A;  4P11 A;  5KCJ B;  4R2F A;  3N6T A;  3H6T A;  2Q9T A;  4NF5 A;  1TT1 A;  1OQG A;  1Y20 A;  1BTJ A;  4RY1 A;  4ZED A;  3SEW A;  3S9L C;  2RC9 A;  4O3C A;  3MJN A;  3T66 A;  1IXC A;  2R71 A;  1B40 A;  3G3K A;  3PUX E;  3MPL A;  4ECF A;  3BFT A;  2Q89 A;  2DS9 A;  3SEU A;  3UN6 A;  4ZZA A;  5JTY B;  4XKR A;  3ILU B;  3C4M A;  5ELV A;  4KD5 A;  2XD2 A;  3E9X A;  4F3G A;  3KSX A;  3D4C A;  1NL5 A;  1GV8 A;  5DVI A;  4R73 A;  3MP6 A;  1SW5 A;  3O6I A;  1IZ1 A;  1S50 A;  3HV1 A;  4UAC A;  1QUJ A;  1AL3 A;  4RPO A;  5I59 A;  2DOJ A;  3LBS A;  3TPA A;  3WAF A;  3T9H B;  2Z8E A;  3MVY A;  2X7Q A;  4DXC A;  4U1Z A;  1QVS A;  4F2Q A;  5I84 A;  1HSE A;  5I56 B;  2XXX A;  4C0R A;  4RYA A;  2RIN A;  5I2K B;  1B3H A;  1MXV A;  4IO2 A;  3EHU A;  5L9M A;  3I6V A;  3FZV A;  4G8H A;  1ANF A;  2QMW A;  3W9V A;  4LON B;  4OYV A;  1LGB C;  1FTK A;  5H8N B;  1P1W A;  3RLF E;  1FQD A;  1EZP A;  3K6V A;  3HCQ A;  3OXN A;  3S4U A;  3G3J A;  2V93 A;  2XHD A;  1OVT A;  4RJZ A;  2V3Q A;  3B7D A;  5DYH A;  4Z0I A;  2XXT A;  4ZEC A;  1L5T A;  4U21 A;  3PMV A;  3TCF A;  4FE8 A;  2F35 A;  4MBP A;  1HSL A;  1UQW A;  1SVX B;  3K4U A;  3VE1 B;  3IOT A;  1OIB A;  3IO4 A;  3O2A A;  4NF5 B;  1FTM A;  2QRY A;  3CI8 A;  4LQ5 A;  3UA8 A;  2I58 A;  3IB2 A;  4U4X A;  1B3E A;  4NF8 A;  1GR2 A;  1DMB A;  2O1L A;  3ZKK A;  3E13 X;  4ESW A;  3FVG A;  1IQ7 A;  1WVJ A;  5B70 A;  1B7Z A;  1SW1 A;  1B58 A;  3FGS A;  1N84 A;  2B65 A;  4RPN A;  4XIG Q;  5H8H A;  1RYO A;  4YMB A;  4R72 A;  3TFL A;  3I3V A;  4KPT A;  2QS3 A;  3CG1 A;  4RNS A;  4PE5 B;  3RN8 A;  3HO7 A;  1UTH B;  2F36 A;  4NF6 A;  1JQF A;  3DEL B;  3ECR A;  1PBQ A;  4EXK A;  4YB5 A;  3H06 B;  3BFU A;  2CZL A;  4OFL A;  4JXI A;  1NH7 A;  1JVY A;  1LLS A;  4U23 A;  4N13 A;  3U1O A;  1DTZ A;  2P0S A;  2WKY A;  1D9Y A;  3PUV E;  1M5D A;  3IJO B;  2IA4 A;  2XXV A;  4R2B A;  4MLV A;  2O6A A;  3T96 B;  3ZSF A;  4U1O A;  2I0B A;  4POX A;  4F31 B;  1PB8 A;  1NKX A;  1IEJ A;  1FTL A;  5H8F B;  4GVO A;  4H5F A;  2Q8J A;  1NNK A;  3O97 A;  3EHT A;  3GXA A;  4R6H A;  3BKI B;  2GH9 A;  1H43 A;  3CFX A;  1FQB A;  1MXY A;  1LCF A;  1PC3 A;  4JB7 A;  1IIW A;  1P1U A;  1US4 A;  2PT1 A;  1S7Y A;  1ZMG A;  3QUJ A;  4OEN A;  2DWH A;  1CB6 A;  3TTR A;  2I3V A;  2H9B A;  4TQU Q;  1JVX A;  4K3F A;  1USY H;  1SI1 A;  3FVK A;  4IO5 A;  2REJ A;  3MZ9 A;  2VHA A;  1EH3 A;  1AMF A;  4DZ1 A;  3D4G A;  3MP8 A;  2NOO A;  4H5G A;  4ELR A;  3SEY A;  4EF1 A;  2IEE A;  2I6E A;  4R9F A;  1H45 A;  4WEP A;  2THI A;  1N04 A;  2W7Y A;  3LC8 A;  3V5A A;  1MXW A;  1Z7M E;  2UVJ A;  4KYS A;  5IKB A;  2ZNT A;  1EZ9 A;  2R6G E;  3FJG A;  4GXS B;  4JBZ A;  3MC2 A;  2YJP A;  4FJP A;  4H0W A;  3CIJ A;  3G3I A;  1DOT A;  2D5W A;  1ZIU A;  1N0T A;  3VLU A;  4QFN A;  4LVQ A;  3U94 A;  3TTK A;  2NWJ A;  1JEV A;  3TCH A;  5KCJ A;  1B5J A;  1NNF A;  4QSD A;  4ZS9 A;  1I6Q A;  4RXL A;  1VSO A;  4OVJ A;  1JW1 A;  2BJJ X;  3LSL A;  2PX1 A;  3W15 C;  4OMB A;  3C35 A;  5FTI A;  4XTC Q;  2RCA A;  2HCA A;  5ITO A;  2Z22 A;  1Q35 A;  2DWI A;  3CFL A;  3K00 A;  5CBR A;  3Q29 A;  4F3B A;  4NF6 B;  1M5C A;  3RY3 A;  4FAT A;  1TWY A;  5JTY A;  1Y1M A;  4U2R A;  2DXR A;  5I58 A;  3SER A;  1USY E;  3TQW A;  3VLW A;  4X1B A;  4ZEI A;  2HXW A;  4F3P A;  4H1X A;  3RTF B;  4BDN A;  2UVH A;  2DWJ A;  1D9V A;  2F6P A;  4PFW A;  1FQE A;  3TTL A;  1S9T A;  3GZG A;  3CG3 A;  4GL8 A;  2HEU A;  1VR5 A;  1I6B A;  4AB6 A;  5AA4 A;  3OEK A;  2I48 A;  1TFD A;  3K01 A;  4RK9 A;  4F29 A;  3MZ1 A;  3QIM A;  5HM4 B;  1DTG A;  4GIZ A;  1QJM A;  1BKA A;  4PQJ A;  4UA8 A;  4BDR A;  4DE8 A;  1MQD A;  3OMB A;  1POY 1;  4G77 A;  1P99 A;  3RTW B;  5L9O A;  4YKP A;  2PMS A;  5I56 A;  3ODB A;  2HFB A;  1KWH A;  1NMU A;  1US5 A;  1NNT A;  2XXU A;  3EQ1 A;  2RF1 A;  3HHF A;  4GXA A;  2AYS A;  3SEX A;  3HPI A;  3UGW A;  3RT8 A;  2RCB A;  1FQC A;  3C34 A;  5AA2 B;  5EYF A;  1JW4 A;  2B3F A;  4DDD A;  3FXR A;  2I4B A;  3VLV A;  4I1D A;  3PPN A;  3UIF A;  1PB7 A;  3FV1 A;  3VVF A;  3GBB A;  1MQG A;  4ZEK A;  1P1Q A;  4C1U A;  3KOS A;  4BDQ A;  2V3U A;  1MH4 A;  4OER A;  2XXQ A;  3H6V A;  3PD8 A;  3G3F A;  1LAG E;  4O3A A;  3ZS6 A;  4XKQ A;  4OEV A;  2FA7 A;  1MM7 A;  1B3G A;  1TFA A;  2ANJ A;  1B51 A;  2Y7R A;  2QPQ A;  4FAJ A;  4E0W A;  4KYD A;  4Q0C A;  2YPN A;  2VD3 A;  5CC2 A;  2XXY A;  1BP5 A;  3MPK A;  5CBS A;  1FW0 A;  3A3U A;  3H3G A;  2Y7W A;  3H4Z A;  2DXY A;  1IXI A;  3IB0 A;  4NF4 A;  1PB9 A;  5I58 B;  3LSX A;  2REG A;  2VD2 A;  1UTH A;  5B7D A;  2QMX A;  2GHA A;  4QF9 A;  4DXU A;  3MVW A;  3ONM A;  1VFD A;  1B32 A;  5FTH A;  1VE4 A;  3MAM A;  3QK6 A;  1XVX A;  4DIG A;  4DCY A;  3O29 A;  2ZXT A;  1B0L A;  4RA1 A;  2H4I A;  3M3L A;  3RQT A;  1WOD A;  2RC8 A;  5AA4 B;  4OZ9 A;  4QFP A;  3MBP A;  4H8I A;  3PPR A;  5H8F A;  3FAS A;  3LSF B;  3MQ9 A;  2PVU A;  1GVC A;  4LQ2 A;  2XD3 A;  3CSG A;  3PU5 A;  4OEU A;  4G68 A;  2V3T A;  1B4Z A;  1AIV A;  4OXV A;  3GLB A;  4F1Y A;  3FXQ A;  4X9T A;  3T9V A;  2V25 A;  2Y84 A;  3Q26 A;  4TLL B;  2OZZ A;  1B9J A;  4NWD A;  3OEM A;  4KQP A;  1MPB A;  2F7A A;  3T9X B;  4IY5 A;  4LP2 B;  4EXL A;  5K2X A;  3K1M A;  2O7U A;  3CR9 A;  3T9U A;  3G3G A;  4HW8 A;  3LSW A;  4IGR A;  3FJ7 A;  2LAO A;  3O6H A;  1FQA A;  1M5B A;  3SET A;  1UIV A;  3VFJ A;  4PFY A;  1Y3N A;  3W9W A;  1II5 A;  1B5I A;  3B6T A;  3DP6 A;  4Q5T A;  4WXJ A;  3RUM A;  3WAE A;  2OWS A;  1LAF E;  1QUL A;  3PUZ E;  2KLF A;  4XKN A;  4F2O A;  4O3B A;  1T0K A;  2I3W A;  2D21 A;  1FQF A;  2ZNU A;  4P0G A;  3SDF A;  1URD A;  3TUS A;  3PPP A;  2ONS A;  3S9N C;  2I0C A;  2GHB A;  3C9H A;  4M4G A;  2E0S A;  4G8M A;  3MW0 A;  4OET A;  4KR5 A;  1ZKB A;  4NF4 B;  3O66 A;  4YIC A;  1MDP 1;  4GFR A;  3MZB A;  1NNP A;  4PET A;  4XKP A;  4NWC A;  3ZKL A;  2OK2 A;  1EU8 A;  3R6U A;  3IOW A;  4Z7E A;  4F3S A;  5A5X A;  4EQB A;  5ITP A;  1R1N A;  3TYH A;  2D3I A;  4OTE A;  2O1M A;  2ABH A;  4DXB A;  5ISU A;  4DLD A;  2XXP A;  4NED A;  2G93 A;  3G7W A;  3TEL A;  4QHQ A;  2RKM A;  1POT A;  2UXA A;  1MPD A;  2E1S A;  2PT2 A;  3KJ7 A;  2Y7I A;  4GL0 A;  4LAT A;  4DCX A;  4IY6 A;  2GFE A;  2F78 A;  1ZU0 A;  1MXX A;  4G68 B;  3S9M C;  5F7V A;  3OOA A;  5CI5 A;  1FTO A;  1LAH E;  1F9B A;  4KHZ E;  4U4S A;  3SEV A;  5DVF A;  5ICQ A;  3EPE A;  4THI A;  4OHN A;  3FUZ A;  3JV9 A;  3OO7 A;  3M3F A;  4OFO A;  5TP9 B;  3E3K A;  3IO6 A;  1QKA A;  2VOZ A;  3KGC A;  4POW A;  4MH5 A;  5I57 B;  5AA2 A;  4HCY A;  4ZE8 A;  3O9P A;  1NH8 A;  5F1Q A;  5JEI A;  4F22 A;  4KCC A;  4YKK A;  3EN3 A;  1AH5 A;  3RNN A;  3FD3 A;  1XC1 A;  1LBB A;  2OJT A;  4C1T A;  1MXU A;  2AL4 A;  1JEU A;  1QKB A;  3TTN A;  1MPC A;  3P7I A;  4PFT A;  2NXO A;  3TKD A;  1Y1Z A;  1SYI A;  2DP8 A;  3N26 A;  2QL3 A;  3QUF A;  5KDT A;  4QFL A;  1PDA A;  4JWX A;  4IO4 A;  3TTM A;  3K1P A;  3FVO A;  1N3X A;  3O6G A;  5DT6 A;  1J1N A;  2QS4 A;  3UP9 A;  4GOT A;  1OVB A;  3PMW A;  2XXW A;  4JSO A;  1MQH A;  2A5S A;  2ZNS A;  1Y4T A;  4I62 A;  4YKI A;  2A5T B;  3VXB A;  2F7B A;  3PD9 A;  3TMG A;  3FJM A;  5FHO A;  2ALU A;  4FEB A;  2DVC A;  4ZZE A;  2Q88 A;  1B3L A;  2CMO A;  5A5X B;  3EF7 A;  4BDL A;  1MY1 A;  1ELJ A;  5H8Q A;  4BDO A;  1BLF A;  1MY4 A;  2Y7P A;  4R75 A;  2AIX A;  3C31 A;  1BIY A;  3OSQ A;  3KFM A;  3PPQ A;  3UOR A;  4ZEF A;  3FVN A;  1DSN A;  1B7H A;  4GF8 A;  3S2V A;  3UK4 A;  2M8C A;  4JWY A;  4NTL A;  5EHM A;  1N76 A;  1B5H A;  4WKM A;  3PUW E;  1MG1 A;  4GWO A;  2OBG A;  3V89 B;  4ZEB A;  4IO3 A;  4AQ4 A;  1MH3 A;  3KZG A;  2P2A A;  2ONR A;  4NE4 A;  3VXC A;  1A7L A;  1DPE A;  3E4R A;  5AA1 A;  5CMC A;  4E0X A;  4JDF A;  1MY0 A;  1A8F A;  3G3H A;  1LFG A;  4HS7 A;  3OO6 A;  4FED A;  2OLB A;  1XVY A;  1LBC A;  3R7X A;  4IB2 A;  3CSB A;  3R26 A;  3HST A;  3IL1 B;  5M2V A;  4YB6 A;  3Q25 A;  4EF2 A;  5CMM A;  2ZYK A;  4ONY A;  4ELQ A;  5IAI A;  1EZO A;  4F19 A;  2ZYO A;  1N7W A;  3MP1 A;  5L8D A;  3IOR A;  1WDN A;  3TAJ A;  4ND9 A;  1D4N A;  1O63 A;  1H44 A;  4YKJ A;  2P1S A;  4OES A;  3DP4 A;  2F34 A;  3U72 A;  2O68 A;  1OQH A;  4KFQ A;  5KDT B;  1MY2 A;  1M5F A;  4EQ7 A;  3Q27 A;  2VGQ A;  2QS1 A;  1Y3Q A;  2ZYN A;  3CVG A;  4FEC A;  4MFI A;  3H6W A;  3PV0 E;  1ATG A;  1N7X A;  5TU0 A;  1MQJ A;  2H25 A;  4EQ9 A;  3USD A;  5EHS A;  5HPQ A;  4YMA A;  4LZ5 A;  1A54 A;  2ZYM A;  4QFO A;  2UVG A;  4H6D A;  5K2Y A;  2AL5 A;  1GTK A;  5CM6 A;  5ICT A;  4IO7 A;  1H3D A;  2DE3 A;  3OEN A;  3FAT A;  1PEB A;  2F6G A;  5H8Q B;  2RC7 A;  5J1D A;  1B2H A;  4F1U A;  4H65 A;  4ISU A;  1I6A A;  3K6X A;  3AXF A;  1R9L A;  4F39 A;  3PPO A;  3KG2 A;  1UIU A;  2Y7K A;  3THI A;  1URG A;  3VVE A;  3C36 A;  4GRK A;  3V8X B;  1RYX A;  4LZ7 A;  3T93 B;  4I9D A;  4PP0 A;  3A3C A;  5DEX A;  2DVZ A;  3QXM A;  3KN8 A;  5DVJ A;  1Y3P A;  3CRB A;  3FXU A;  3IR1 A;  4JWO A;  1MS7 A;  3PMX A;  3MWB A;  3TDJ A;  1HSJ A;  1IXG A;  1LB8 A;  1PBP A;  3U8Q A;  4GD5 A;  1I69 A;  1MXZ A;  1NFT A;  3VDF A;  1YPN A;  2DWA A;  2UYE A;  3N6U A;  1M5E A;  4LZ8 A;  2NVU B;  1ZLQ A;  1B1X A;  4ELO A;  1R9Q A;  2HQ0 A;  4LA9 A;  1YCJ A;  1VFE A;  5TP9 A;  3IK6 B;  5I2N A;  3MVX A;  4Q8R A;  1P1O A;  4FIM A;  1XHY A;  1IIT A;  1A8E A;  3OO9 A;  4RK2 A;  4I8C A;  1B46 A;  1SDX A;  5I57 A;  1A40 A;  3CFZ A;  2UYF A;  3LUY A;  5CRY A;  1MRP A;  3OSR A;  3PUY E;  2NUV A;  1LAX A;  5TPA B;  2H98 A;  1D3K A;  4R74 A;  1LCT A;  1MDQ A;  3H03 A;  4KYE A;  2Q2C A;  5AA2 D;  1B3F A;  1B0H A;  3M3K A;  2Q2A A;  5CMB A;  3H7M A;  3I5O A;  4IGT A;  5KZT A;  3DP8 A;  1R6Z A;  2PYY A;  3IAZ A;  4F18 A;  5HBC A;  3H6U A;  2XX8 A;  4FOR A;  2HAU A;  3K1N A;  3MUQ A;  2A5T A;  3M8U A;  3RGY A;  2XXH A;  4NMY A;  1UTB A;  1OLC A;  2I4C A;  3IX1 A;  3K6W A;  3K0V A;  4R6Y A;  3K02 A;  2OCU A;  1ZBM A;  2H5Y A;  3B6Q A;  2F8D A;  3C32 A;  4L17 A;  2V84 A;  2ONK E;  3IB1 A;  5FHM A;  1XT8 A;  1YTV A;  3DLN A;  1O64 A;  4JSD A;  5DEX B;  2ESN A;  2XXR A;  3KSJ A;  1QUI A;  1SW2 A;  4U22 A;  3FV2 A;  4AB5 A;  1GGG A;  1B7U A;  4HTG A;  4KI0 E;  3KJT A;  3T22 A;  3K6U A;  3KEI A;  5I59 B;  1B6H A;  2XX7 A;  2DE4 A;  2Z23 A;  1JNF A;  1QUK A;  4YAH X;  4X1D A;  1B52 A;  4R9G A;  3OO8 A;  4QSE A;  1OMP A;  4OFJ A;  1OLA A;  3JYR A;  2X26 A;  4R6K A;  4ELP A;  5AA3 A;  3TEP A;  5I2N B;  4EDP A;  1TXF A;  4YU0 A;  4PFU A;  5AE4 A;  1N3W A;  4TLM B;  2XX9 A;  4H67 A;  2O51 A;  2DSF A;  1ZJL A;  3U93 A;  2VP1 A;  3C33 A;  1B4H A;  3OEL A;  3QAX A;  5LOM A;  2QJE A;  3IOU A;  3L6G A;  3A09 A;  4G8N A;  1SW4 A;  3HN0 A;  1SQY A;  4G2Z A;  2QS2 A;  4GLI A;  4P0I A;  5BUU A;  1SBP A;  2FYI A;  3O28 A;  1SI0 A;  1B1H A;  3N94 A;  2I49 A;  1H76 A;  1IUD A;  3LR1 A;  5DTB A;  1DPP A;  4HCW A;  4Q30 B;  4KCD A;  4N07 A;  4YB7 A;  4NF8 B;  4ESX A;  3TCG A;  5H8S A;  1MQI A;  3TZA A;  4IO6 A;  1QW0 A;  2Z8D A;  1MY3 A;  3EHS A;  3N5L A;  3FIR A;  4ZE9 A;  1Z7N E;  2O69 A;  1MM6 A;  1IXH A;  5H8H B;  3GBA A;  1JW5 A;  2DE2 A;  3ILT B;  4BDM A;  2XXI A;  2F7C A;  2HZL A;  5BWJ A;  1UTB B;  2B3B A;  3DM0 A;  1A99 A;  3KBR A;  1URS A;  4H8J A;  3F11 A;  4G4P A;  2F97 A;  3U92 A;  1LB9 A;  1P1N A;  1O7T A;  2HAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...