1SI1A

Crystal structure of mannheimia haemolytica ferric iron-binding protein a in an open conformation
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
316
structure length
316
Chain Sequence
ANEVNVYSYRQPYLIEPMLKNFEKDTGIKVNIIFADKGLVDRVKQEGELSPADVLLTVDISRVMEIVNADLAQKIDSKVLEKNIPAQFRDSNDQWFGLTTRARVIYTSKDRVGKLPAGFDYLDLAKPEYKGKVCVRSGKNSYNVSLFAAMIEHYGIEKTKAFLEGLKANLARKPQGGDRDQVKAIKEGICDYSIGNSYYYGKMLDDEKQKSWAEAAIINFPSGEHGTHKNISGVVIAKHSPNKANAVKLIEYLSGEKAQGLYAELNHEYPVKEGIEPSAIVKGWGTFKSDTIKLEDIAKNYEAALKLVDEVKFDDF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords iron binding protein FbpA
publication title Structural basis for iron binding and release by a novel class of periplasmic iron-binding proteins found in gram-negative pathogens.
pubmed doi rcsb
source organism Mannheimia haemolytica
molecule tags Metal binding protein
total genus 126
structure length 316
sequence length 316
ec nomenclature
pdb deposition date 2004-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1si1A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1si1A02
2XXYA 2F36A 3SEXA 1D9YA 1B6HA 2ZYMA 4BDQA 3SESA 1FQBA 1Y4CA 4IGTA 1Y9UA 2A5TA 1DPEA 2AL5A 4LATA 1BLFA 4G77A 5AA4A 2XXXA 3PPOA 3H6VA 4QFLA 4POXA 5I58B 1VSOA 4F2QA 1SW5A 1PB9A 3I5OA 4LQ5A 3FASA 5I56B 5DT6A 2X7QA 5CRYA 4AB5A 1MPBA 4M4GA 4JBZA 1QUJA 4DXBA 4IO3A 3HHFA 5B7DA 1YCJA 3D4GA 5TPAB 2VD2A 4H8JA 2HAVA 4EXLA 3CSGA 4GD5A 2X26A 3TQWA 4ND9A 3GZGA 1LAGE 4TLLB 4LZ8A 1LFHA 3T9VA 4NF6A 3T96B 3KBRA 3KN3A 2HEUA 4GVOA 1H43A 2O69A 3R7XA 4KHZE 2ONRA 3JYRA 4FAJA 2QRYA 2UVGA 5EHSA 3SEVA 4ZEBA 1MPDA 2PYYA 2R6GE 3DLNA 4TQUQ 4YKJA 4OESA 3O66A 4OFLA 1XOCA 2HZLA 2OBGA 4X1BA 2O7IA 1JEVA 1MY3A 4QFOA 2GH9A 4F3GA 3RTFB 5I57A 4JB7A 4F3BA 3TMGA 2OCUA 3DM0A 3IK6B 4YKKA 2NWJA 4PFWA 3PD9A 4E0WA 4AQ4A 1US4A 3KG2A 3M3LA 2Q89A 3SEWA 3AXFA 1NNFA 2I4BA 2Y84A 3TUSA 3G3KA 4U1ZA 4YB7A 3TCFA 4E0XA 2Q88A 4ONYA 4UA8A 2DP8A 1MXUA 1MH3A 2O84X 1IUDA 3GXAA 3IJOB 3C35A 2BJJX 1SD3A 3QYTA 2O68A 5IAIA 3FVOA 1Y4TA 3O2AA 4U2RA 1B5HA 4DZ1A 4NF8B 2ZMBA 3RT6B 1GVCA 3MVZA 2OZZA 1VE4A 4MLVA 3CFZA 2ANJA 4ZZAA 4Q8RA 2OJTA 4RXLA 3MC2A 5HPQA 4GQOA 3SETA 5K2XA 2HZKA 3QIMA 4GWOA 5H8FA 4H6DA 3C33A 1LAFE 4R6KA 3IOUA 5EHMA 3EHTA 3RGYA 3SKPA 3H6UA 5H8NA 1EZ9A 1Z7NE 1P1UA 3EHSA 3FJMA 1NH7A 3LSLA 1EU8A 3H6TA 2DQVA 5ITOA 2I3VA 1TT1A 3K6XA 4TOZA 5CC2A 2V3QA 2PVUA 1KWHA 3MP1A 3OEKA 1A54A 2O1MA 5ICQA 3SEUA 2PMSA 5DVFA 3ECRA 1NKXA 2XX8A 3RNNA 3U94A 4XKPA 2E1SA 4QRZA 1B3HA 2B3BA 2H5YA 4QFKA 3IB2A 3IOTA 2ZNSA 4MH5A 3Q27A 3U92A 1ZTYA 1FTKA 4G68B 3IAZA 3FVNA 2ESNA 3EF7A 4LONB 4OFOA 4WKMA 3O9PA 1N76A 4DIGA 4LQ2A 2IEEA 4DXUA 4MBPA 2DXYA 1MDP1 4GXAA 3WAFA 2I48A 5BWJA 2DWJA 2XXHA 4ECFA 1TWYA 1FQAA 5EYFA 2X7PA 1PC3A 1MQHA 4DLDA 2Z22A 4G68C 3PUYE 3ONMA 1S50A 2DE4A 3U8QA 3PMWA 3EN3A 3FV1A 2I58A 3QK6A 4F1UA 5I59B 1B05A 5JTYA 3U72A 1B51A 4R2BA 2XD3A 3K02A 1P1QA 1B5JA 4N13A 5KDTB 2HQ0A 1A7LA 4WEPA 4OEVA 1EH3A 1WVJA 4P0IA 5FHMA 2R9JA 3M3FA 3TYHA 1LBCA 1B3LA 3KGCA 4I9DA 4JWXA 2Q8JA 3TTLA 2AL4A 5I2NB 4TLMB 3BFTA 1O64A 2P1SA 5KZTA 2I6EA 1J1NA 4QHQA 2VHAA 3OOAA 3L6GA 3QAXA 1SYIA 3UGWA 4X9TA 1XHYA 2REGA 4IB2A 2NVUB 1ELJA 4ZZEA 4ZDMA 3H03A 1QUIA 3H7MA 1B32A 4GFRA 4ZEKA 4GOTA 3ILTB 4MF3A 3EHUA 4NTLA 2A5TB 3FXQA 2UYFA 4OERA 2OLBA 1MXVA 5AA4B 4OTEA 1Z7ME 1JNFA 4POWA 5B70A 3PPQA 4HCWA 3K01A 2Q9TA 5A5XA 3P7IA 2AYSA 4OHNA 5M2VA 2ZNUA 3PPRA 2VOZA 3PUVE 4EQBA 2F35A 3K6UA 3VVEA 1IQ7A 1FW0A 4ELQA 4IGRA 4IY6A 3B6TA 2PBWA 3M3KA 1B4ZA 5TP9A 3V83A 3MP8A 3PMXA 1AMFA 2Y7KA 3W9VA 2YLNA 3HPIA 3HCQA 4NF6B 2Q2CA 1XVYA 4KYEA 3ODBA 3IB0A 4QSCA 4KPTA 4OZ9A 1URGA 1H45A 4GRKA 2THIA 1VFDA 2D5WA 4H5FA 3CRBA 1VR5A 3LUYA 3QUJA 2RKMA 3BFUA 3L6HA 3FXRA 4F1VA 5AA2D 3LR1A 5I57B 3OO8A 2NOOA 4GL8A 1D9VA 1OQHA 2V25A 4PE5B 1I6AA 5KCJA 2UYEA 5L9SA 3G3FA 4HCYA 1SW2A 4NWCA 4PFYA 1PB8A 5TU0A 1M5EA 2RC7A 4U22A 4IO2A 4ZEFA 3V8XB 1LAHE 1EZOA 3F11A 3UORA 4WEDA 1A8FA 1OIBA 1FQDA 4BDOA 4GXSB 4FEDA 1IITA 3FD3A 1M5FA 1N3WA 4ISUA 4NWDA 4OMBA 4Z7EA 1N7XA 1MXYA 1URSA 3K1NA 3B6WA 5AA2B 3PUWE 4YZZA 3TZAA 4YMBA 4FATA 2ZXTA 1URDA 4NF4A 3TELA 4F2OA 4HTGA 3PV0E 4F3SA 2O1LA 1M5BA 4DCXA 3DP8A 2OWSA 1BKAA 5H8FB 4YKIA 1QUKA 1IXCA 1NH8A 1XVXA 1XS5A 3K6VA 3UK4A 5L9OA 4YICA 1N0TA 2QPQA 4OVJA 5H8NB 3KEIA 4GIZA 4I62A 2H9BA 3IO4A 1EZPA 5JEIA 2DSFA 2F7CA 5J1DA 2XD2A 1XT8A 2GRVA 3PGFA 3LSXA 4RJZA 2V3TA 3E4RA 1TFAA 3MP6A 3T9XB 1LSTA 2I0BA 3MPKA 3TTMA 2D21A 1UIUA 1MQDA 1B1XA 3TAJA 4LZ7A 2ABHA 2F97A 4OENA 4KQPA 1LFGA 1AH5A 2PT2A 1JW4A 4Q30B 1UIVA 2GFEA 5H8HA 4KYSA 3RTWB 3FV2A 3MQ9A 2XX9A 4BDNA 1DTGA 4MLQA 3WAEA 4U4XA 3KSJA 2LAOA 1GV8A 3VVDA 1B5IA 3S9MC 3LSWA 1RYOA 3E9XA 4F39A 1B7UA 1DMBA 1LGBC 4YU0A 4U4SA 4NE4A 1NL5A 3A09A 2DVZA 4EXKA 3TTKA 3IOWA 3PMVA 1OVBA 1B46A 4ESXA 1UTBA 2PX1A 1N7WA 4NEDA 5CM6A 5BUUA 1QULA 5JTYB 3VXCA 2ZYOA 1F9BA 1RKMA 3K4UA 4KR5A 1ZJLA 5CMBA 1YAEA 3HV1A 3O6GA 1JVYA 4YMAA 1POY1 1NNPA 1A8EA 3DELB 4XTCQ 1P1OA 3B7DA 2PT1A 4DXCA 1VFEA 4YKPA 2O6AA 4LA9A 1SI0A 2DXRA 4HS7A 3USDA 5I2KA 4G8HA 3S9EA 5DEXA 4QFPA 4OXVA 4DCYA 1D3KA 2QS2A 1IZ1A 1FTMA 3OD7A 2D3IA 2XXTA 3VDFA 3IB1A 5H8QA 4R74A 3O97A 1YPNA 3SDFA 2ALUA 3PD8A 1BP5A 4BLAA 3IO6A 1T0KA 3PUZE 3A3CA 1PEBA 4ZS9A 3RLFE 3C9HA 2WKYA 4PETA 4JXIA 4PQJA 1LB9A 4R6HA 2H99A 4GLIA 2H4IA 3IOVA 1QJMA 5A5XB 3KZGA 1B0HA 2P0SA 2DE2A 4G2ZA 3OSQA 1AIVA 3TTRA 1DSNA 1PB7A 2OWTA 1UTHA 4R73A 4F18A 2F7AA 1LBBA 1FTOA 4JSDA 4KFQA 3HO7A 5TP9B 4IO5A 2QL3A 3KJTA 3FJ7A 2QS3A 3D4CA 2YPNA 3V5AA 1JW1A 4F3PA 3IX1A 4FJPA 3KN8A 3VVFA 1POTA 3CSBA 2F5XA 1B9JA 3TCHA 2Y7RA 3OENA 3S2VA 3V89B 1FQEA 1WDNA 2YJPA 4YB6A 3GLBA 1LLSA 1IEJA 2O51A 2RC9A 2GHBA 3MVYA 2UVHA 3S4UA 4X48A 4YAHX 5DVJA 4OETA 4G4PA 3FVGA 3GBBA 1ZKBA 3VXBA 5KCJB 2Z23A 5F7VA 2NUVA 3OEMA 1H76A 5DTBA 2XXIA 1ATGA 2HCAA 3S9NC 4KCCA 3DP6A 3K6WA 5L9MA 1MY2A 1CE2A 2DWAA 1O7TA 3MVWA 3R6UA 1RYXA 4H0WA 5CMCA 4QSDA 4ZEDA 3PPNA 2RC8A 3EQ1A 3IORA 2OK2A 2V84A 1P1WA 1B3EA 4QFNA 1UQWA 3CFLA 1DTZA 1MG1A 2F6PA 2XXPA 3RT8A 4R75A 1B58A 3FIRA 4NF4B 1Y1MA 2M8CA 4ELOA 2UXAA 1IXHA 3MZBA 3Q25A 1Y3NA 1B2HA 2Q2AA 2DWIA 3K00A 3H6WA 2FYIA 3RPWA 1PDAA 1Y3PA 1R6ZA 4ELRA 1Q35A 3Q28A 3W15C 3MZ9A 1OMPA 1NMUA 3FUZA 3T93B 3RY3A 2W7YA 3N26A 1GGGA 1LCTA 3HHGA 2AIXA 1NFTA 2FNCA 4R6YA 2QSXA 4ZEIA 4BDMA 1S9TA 5ELVA 1SW4A 4IO7A 1D4NA 3VLUA 4I1DA 3FVKA 1MQIA 1NNTA 1WODA 1JW5A 1P1NA 3MVXA 2HAUA 4OWDA 3KFMA 1Y1ZA 1R9LA 4IY5A 2DOJA 3OELA 1A99A 4EUOA 3FJGA 3H4ZA 1MM6A 1ANFA 4R72A 3MW0A 5AE4A 4DDDA 4XKNA 4QSEA 1LB8A 3JZJA 5FHOA 3OO6A 1LFIA 2G29A 4R9GA 4XXUA 2F6GA 5H8HB 1USYE 5H8SA 3OSRA 3HN0A 1MXXA 1MS7A 2XXRA 4EF1A 1ZU0A 4F31B 2XXUA 1OQGA 2HXWA 3CG1A 2F34A 3C31A 4F1YA 4K3FA 1OLCA 1R9QA 5AA1A 1MY0A 1A40A 3MPLA 3ZKKA 4Z0IA 1SYHA 3K0VA 3VLVA 1SQYA 3IL1B 2Z8DA 3ZS6A 3K1PA 4O3BA 5HBCA 1UTBB 1JVXA 3K1MA 1B4HA 3VFJA 1I69A 5AA3A 4WXJA 4Q5TA 4ELPA 4NMYA 4C1TA 1QKBA 2Z8FA 2XX7A 3PUXE 3G3IA 5HM4B 4O3CA 3E13X 4EQ7A 1HSJA 1N04A 4N07A 3O6HA 4PFTA 2B65A 1MQJA 2HFBA 1IXIA 4G8NA 1HSLA 2UVIA 3IJXB 1Y20A 1JEUA 4I8CA 3DP4A 3T9HB 3O29A 1B3GA 4U21A 3O6IA 3G3JA 4LP2B 5LOMA 2DYXA 5CI5A 1Y3QA 4LVQA 2I3WA 3CVGA 5I2KB 5DEXB 1GTKA 3GBAA 2RCAA 4BDRA 5H8QB 3TFLA 3I3VA 2R71A 3OO7A 4UACA 1SW1A 4LZ5A 3BBRA 3ZKLA 2XXQA 3RUMA 4FEBA 4R2FA 2F7BA 4NF5A 1JETA 5CMKA 3SERA 4DE8A 3KOTA 2FA7A 1CB6A 3U93A 4JWYA 4C1UA 1H44A 1AOVA 4O3AA 1I6BA 1IIWA 3KSXA 1FTJA 3VLWA 3UN6A 1US5A 1MQGA 1MXWA 1B1HA 3VE1B 4GL0A 2QJEA 1UTHB 4P11A 1H3DA 1B7ZA 1PBQA 3OMBA 1QW0A 4P0GA 4MFIA 1B40A 2RCBA 2CZLA 1MPCA 4XKQA 5I58A 2XXWA 4ZE9A 4ZECA 3MZ1A 3MBPA 1P99A 3T9UA 1BIYA 3SEYA 3FGSA 1II5A 1R1NA 1MH4A 3QUFA 4N6PA 2CMOA 5I56A 3N6TA 2QMWA 2RF1A 3FATA 4H67A 3TQLA 3MAMA 5CBSA 1MDQA 1MXZA 3KN7A 2DE3A 2H98A 1FQCA 1O63A 4ZE8A 3TTNA 5AA2A 3G3GA 4BDLA 4KCDA 2ZYKA 4KD5A 5TPAA 3KOSA 2V93A 1JQFA 2ONKE 2Y7PA 1HSEA 1MY4A 5L8DA 1OLAA 5I84A 2IA4A 1FTLA 4PFUA 2Z8EA 1SBPA 4JDFA 1IXGA 5CBRA 4YB5A 3N6UA 5IKBA 2GHAA 5JK4A 4OFJA 1ZIUA 2XHDA 1LAXA 3VV5A 3UIFA 4F22A 3E3KA 3RN8A 2VP1A 3THIA 2Y7WA 3QXMA 4GF8A 4RK2A 4OQOA 3KJ7A 1BTJA 5F1QA 3HSTA 4JWOA 4RK9A 3N94A 4XIGQ 4H8IA 5DVIA 1YTVA 4RPNA 1B3FA 3MUQA 1M5CA 3EPEA 4FORA 4IO6A 3TCGA 3IR1A 3CR9A 4R9FA 3M8UA 4RNSA 1B0LA 2B3FA 5ICTA 1OVTA 3G3HA 1AL3A 1Q1KA 2DVCA 2UVJA 4KYDA 2VD3A 3A3UA 1ZMGA 2DS9A 4G8MA 4EF2A 5K2YA 5ITPA 2Y7IA 4FECA 3RQTA 1SVXB 4U1OA 4NF8A 4OEUA 3T22A 2I4CA 5DYHA 3UA8A 3C4MA 3OO9A 4F29A 3C36A 2I49A 4OYVA 1ZBMA 1TXFA 1N84A 5ISUA 1I6QA 3LC8A 3C34A 3ILUB 3Q26A 1PBPA 4M1VA 5FTIA 2VGQA 3FZVA 4AB6A 4U23A 4FIMA 4EQ9A 4RPOA 2QS4A 3I6VA 2RINA 3PPPA 3W9WA 4XKRA 2E0SA 4L17A 2G93A 3QSLA 2P2AA 4H65A 3FXUA 3MJNA 1SI1A 3LSFB 3TDJA 1GR2A 1ZLQA 1DOTA 3LBSA 4FE8A 5FHNA 2DWHA 4C0RA 1USYH 2KLFA 3ZSFA 3R26A 4PP0A 2F8DA 4H5GA 4F19A 2NXOA 1L5TA 2QS1A 3Q29A 5CMMA 3TKDA 1B52A 4G68A 1XC1A 3B6QA 4HW8A 1A55A 3CIJA 4IO4A 2H25A 3CFXA 1QVSA 3JV9A 2F78A 2ONSA 4H1XA 1S7YA 3O28A 1N3XA 3OXNA 1QKAA 2QMXA 2V3UA 1DPPA 4JSOA 1MRPA 1M5DA 3TPAA 4ESWA 3UP9A 3BKIB 3PU5A 3H06B 4THIA 2A5SA 3C32A 1SDXA 1MM7A 3TEPA 5I59A 4LUBA 3N5LA 1TFDA 3H3GA 4RY1A 4EDPA 2ZYNA 5KDTA 1NNKA 3MWBA 2I0CA 3U1OA 1FCKA 4KI0E 4QF9A 2O7UA 4RA1A 3T66A 1B7HA 4NF5B 4Q0CA 3K2DA 2REJA 5I2NA 2ZNTA 4RYAA 3S9LC 3CI8A 4X1DA 5FTHA 1LCFA 3G7WA 3TODA 1MY1A 1FQFA 3CG3A 2XXVA
chains in the Genus database with same CATH superfamily
2XXYA 4XEQA 2F36A 3SEXA 1D9YA 4JVCA 1B6HA 4XF5A 4PBQA 2ZYMA 4BDQA 3SESA 1FQBA 1Y4CA 4IGTA 1Y9UA 2A5TA 1DPEA 2AL5A 3A29A 4LATA 1BLFA 4GBWA 4G77A 5AA4A 2XXXA 3PPOA 3H6VA 4QFLA 4POXA 5I58B 4PF8A 1VSOA 4F2QA 2QVUA 1SW5A 1IMBA 4NQ8A 1PB9A 3I5OA 4LQ5A 3FASA 5I56B 5DT6A 2X7QA 5CRYA 4AB5A 1MPBA 4M4GA 5EQ7A 4JBZA 1QUJA 4DXBA 4IO3A 3HHFA 5B7DA 1YCJA 3D4GA 5TPAB 2VD2A 4H8JA 5J16A 2HAVA 4EXLA 3CSGA 4GD5A 2X26A 3TQWA 4ND9A 3GZGA 1LAGE 4TLLB 2R8TA 4LZ8A 1LFHA 3T9VA 4NF6A 3T96B 3KBRA 3KN3A 2OWZA 2HEUA 4GVOA 1YYZA 1H43A 2P3NA 4X04A 2O69A 2FBPA 4KHZE 3R7XA 2ONRA 4PE3A 3JYRA 4FAJA 2QRYA 2UVGA 4OVTA 5EHSA 5EQ9A 3SEVA 4ZEBA 1MPDA 2HXRA 2PYYA 2R6GE 3DLNA 4TQUQ 4YKJA 4OESA 3O66A 1FTAA 3IFCA 4OFLA 5IZZA 1XOCA 2HZLA 4QBAA 2OBGA 4X1BA 2O7IA 1NV5A 1JEVA 4PGPA 4O7MA 1MY3A 4QFOA 2GH9A 4F3GA 4PDHA 3RTFB 5I57A 4JB7A 4F3BA 3TMGA 2OCUA 3DM0A 3IK6B 4YKKA 2NWJA 4PFWA 3PD9A 4GX3A 4E0WA 4AQ4A 1EYJA 1US4A 3KG2A 3M3LA 2Q89A 3SEWA 3AXFA 1NNFA 2I4BA 2Y84A 3TUSA 3G3KA 4U1ZA 4YB7A 3TCFA 4E0XA 2Q88A 4ONYA 4UA8A 2DP8A 1MXUA 1MH3A 1KA0A 2O84X 1IUDA 3T0JA 3GXAA 3IJOB 3C35A 2BJJX 1SD3A 3QYTA 2O68A 5IAIA 3FVOA 1Y4TA 3O2AA 4U2RA 4MNPA 1B5HA 4DZ1A 4NF8B 1YXIA 2ZMBA 3RT6B 5DW8A 1GVCA 3MVZA 2OZZA 1VE4A 4MLVA 3CFZA 2ANJA 4ZZAA 4Q8RA 2OJTA 4RXLA 3MC2A 5F24A 5HPQA 1FBEA 4GQOA 3SETA 5K2XA 2HZKA 4PCDA 3QIMA 4GWOA 5H8FA 4H6DA 3C33A 1LAFE 4R6KA 3IOUA 5EHMA 3EHTA 3RGYA 3SKPA 3H6UA 5H8NA 1EZ9A 1Z7NE 5I3SA 1P1UA 4HE2A 3EHSA 3FJMA 1NH7A 4N6DA 3LSLA 1EU8A 3H6TA 4DI3D 2DQVA 5ITOA 4O94A 2I3VA 1TT1A 3K6XA 4TOZA 5CC2A 2V3QA 2PVUA 1KWHA 3MP1A 3OEKA 1A54A 2O1MA 2XWKA 3SEUA 5ICQA 2WYKA 2PMSA 5DVFA 4NAPA 3ECRA 1NKXA 2XX8A 5ET5A 3RNNA 3U94A 4XKPA 2ZZWA 2E1SA 4QRZA 1B3HA 2B3BA 2H5YA 4QFKA 3IB2A 3IOTA 2ZNSA 4MH5A 3Q27A 3U92A 1ZTYA 3E78A 1FTKA 4G68B 3IAZA 1QGXA 3FVNA 2ESNA 3EF7A 3FXBA 4LONB 4QXDA 4OFOA 4WKMA 3O9PA 1N76A 4DIGA 4LQ2A 2IEEA 4DXUA 4MBPA 2DXYA 1MDP1 4GXAA 3WAFA 2I48A 5BWJA 2DWJA 2XXHA 4ECFA 1TWYA 1FQAA 5EYFA 2DDKA 1K9YA 2X7PA 1PC3A 1MQHA 4DLDA 2Z22A 4N8YA 4G68C 3PUYE 3ROJA 3ONMA 1S50A 2DE4A 3U8QA 3PMWA 3EN3A 3FV1A 5IM2A 2I58A 1RDZA 3QK6A 4F1UA 5I59B 1B05A 5JTYA 3U72A 2QVVA 1B51A 4R2BA 2XD3A 3K02A 1P1QA 2F3BA 1B5JA 4N13A 5KDTB 2P3VA 2HQ0A 1A7LA 4WEPA 4OEVA 1EH3A 1WVJA 4GWYA 4P0IA 1FJ6A 5FHMA 4P3LA 2R9JA 3M3FA 3TYHA 1LBCA 1B3LA 3KGCA 4I9DA 4JWXA 2Q8JA 3TTLA 2AL4A 5I2NB 4TLMB 3BFTA 1O64A 2P1SA 5KZTA 4GBVA 2I6EA 4MCOA 1J1NA 4QHQA 2VHAA 3OOAA 3L6GA 1NV2A 3QAXA 1SYIA 3UGWA 4X9TA 3E79A 1XHYA 2REGA 4IB2A 2NVUB 1ELJA 4ZZEA 4ZDMA 3H03A 1QUIA 3H7MA 1B32A 4GFRA 4ZEKA 4GOTA 3ILTB 4MF3A 3EHUA 4NTLA 2A5TB 3FXQA 2UYFA 4OERA 2OLBA 1MXVA 5AA4B 4OTEA 1Z7ME 1JNFA 2QFLA 4POWA 5B70A 3PPQA 4HCWA 3K01A 2Q9TA 5A5XA 3P7IA 1JP4A 2AYSA 1FJ9A 4OHNA 5M2VA 2ZNUA 3PPRA 2VOZA 3PUVE 4EQBA 2Q74A 2F35A 3K6UA 3VVEA 1IQ7A 1FW0A 4ELQA 4IGRA 4IY6A 3B6TA 2L5VA 2PBWA 3M3KA 1B4ZA 5TP9A 3V83A 2JJKA 3MP8A 3PMXA 1AMFA 2Y7KA 3W9VA 2YLNA 3HPIA 3HCQA 4NF6B 1LBWA 1NV7A 2Q2CA 1XVYA 4KYEA 1LBXA 3ODBA 3IB0A 4QSCA 4KPTA 4N91A 4OZ9A 1URGA 1H45A 1EYIA 4GRKA 5I7IA 2THIA 4AS5A 1VFDA 2D5WA 3B50A 4H5FA 3CRBA 1VR5A 3LUYA 3QUJA 2RKMA 3BFUA 3L6HA 3FXRA 4F1VA 5AA2D 4PFIA 3LR1A 5I57B 3OO8A 2NOOA 1IMEA 4GL8A 1D9VA 1OQHA 2V25A 4PE5B 1I6AA 5KCJA 2UYEA 5L9SA 3G3FA 1RDYA 4HCYA 1SW2A 4NWCA 4PFYA 1PB8A 5TU0A 2ZZXA 1M5EA 5IZ3A 2RC7A 3KC0A 4MNIA 4U22A 1BK4A 4IO2A 4ZEFA 3V8XB 1LAHE 1EZOA 3D1RA 1NV4A 2CEYA 3F11A 3UORA 4WEDA 1A8FA 1OIBA 1FQDA 2WBDA 4BDOA 4GXSB 1FBCA 4FEDA 1IITA 3FD3A 1M5FA 1N3WA 4ISUA 4NWDA 4OMBA 4Z7EA 4NN3A 1N7XA 1MXYA 1URSA 3K1NA 3B6WA 5AA2B 3PUWE 4YZZA 3TZAA 4YMBA 4FATA 2ZXTA 1URDA 4NF4A 3TELA 4F2OA 1CNQA 3B8BA 4HTGA 3PV0E 4F3SA 2O1LA 1M5BA 4DCXA 3DP8A 2OWSA 1BKAA 5H8FB 4YKIA 4P1EA 1QUKA 1IXCA 1NH8A 1XVXA 1XS5A 3K6VA 3UK4A 5L9OA 4YICA 1N0TA 2QPQA 4OVJA 5H8NB 3KEIA 2PFYA 2HPGA 4MIJA 4N15A 1NV3A 4GIZA 4I62A 2H9BA 3IO4A 1EZPA 5JEIA 2DSFA 2F7CA 1FPGA 3BIGA 5J1DA 2XD2A 4MX6A 1XT8A 4I3EA 2GRVA 3PGFA 3LSXA 4IR8A 4RJZA 2V3TA 3E4RA 4MJOA 1FBDA 1TFAA 3MP6A 3T9XB 1LSTA 2I0BA 3MPKA 3TTMA 2D21A 1UIUA 1D9QA 1MQDA 4OA4A 4PBHA 1B1XA 3TAJA 4LZ7A 1FPKA 2ABHA 2F97A 4OENA 2XA5A 4KQPA 1LFGA 1AH5A 2PT2A 1JW4A 4PFBA 4Q30B 1UIVA 1DCUA 2GFEA 5H8HA 4PC9A 4KYSA 3RTWB 3FV2A 1LEVA 4MAGA 3MQ9A 2XX9A 4BDNA 1DTGA 4MLQA 3WAEA 4U4XA 3KSJA 2LAOA 5A5LA 1GV8A 4P8BA 1B5IA 3VVDA 3S9MC 3LSWA 1RYOA 3E9XA 4F39A 1B7UA 1DMBA 1LGBC 4YU0A 4U4SA 4NE4A 1NL5A 3A09A 2DVZA 4EXKA 3TTKA 3PTYA 3IOWA 3PMVA 1OVBA 1B46A 4ESXA 1UTBA 2PX1A 1N7WA 4NEDA 5CM6A 5BUUA 1FBPA 5LTCA 1QULA 5JTYB 3VXCA 1G0IA 2ZYOA 4O8MA 1F9BA 1RKMA 3K4UA 4KR5A 1ZJLA 5CMBA 1YAEA 3HV1A 3O6GA 1JVYA 4YMAA 1POY1 1NNPA 1A8EA 3DELB 4XTCQ 1P1OA 3B7DA 2PT1A 4DXCA 1VFEA 3RYDA 4YKPA 4HE0A 2O6AA 4LA9A 1SI0A 2DXRA 4HS7A 3USDA 1KA1A 5I2KA 4G8HA 3S9EA 5DEXA 4QFPA 4OXVA 4DCYA 1AWBA 1D3KA 2QS2A 1IZ1A 1FTMA 3OD7A 2D3IA 4NF0A 2XXTA 2VPOA 3VDFA 2BJIA 3IB1A 5H8QA 4R74A 1FPDA 3O97A 1YPNA 3SDFA 2ALUA 3PD8A 1BP5A 3IO6A 4BLAA 1T0KA 3PUZE 3A3CA 1PEBA 4ZS9A 3RLFE 3C9HA 2WKYA 4PETA 4JXIA 4PQJA 1LB9A 4R6HA 4OANA 2H99A 4GLIA 5FBPA 1FPFA 2H4IA 1NUXA 3IOVA 1QJMA 5A5XB 4N4UA 3KZGA 5ESYA 1B0HA 2P0SA 2DE2A 4G2ZA 3OSQA 2FIXA 4GWXA 1AIVA 3TTRA 5IZ1A 1DSNA 1PB7A 2OWTA 1UTHA 4R73A 4F18A 2F7AA 1LBBA 1FTOA 4JSDA 4KFQA 3HO7A 3U65A 4DI4B 5TP9B 4IO5A 2QL3A 5ET6A 3KJTA 3FJ7A 3KBZA 2QS3A 3D4CA 2YPNA 3V5AA 1JW1A 4F3PA 3IX1A 2CZHA 5LDZA 4FJPA 3KN8A 3VVFA 1POTA 3CSBA 2F5XA 1B9JA 3TCHA 2Y7RA 3OENA 3S2VA 3V89B 1FQEA 1WDNA 2YJPA 4YB6A 4HXVA 3GLBA 1LLSA 1IEJA 2O51A 4MMPA 2RC9A 1NV0A 4O7IA 2FVZA 2GHBA 3MVYA 2UVHA 3S4UA 4X48A 4YAHX 5DVJA 2XWOA 1NUWA 4OETA 4G4PA 3FVGA 3GBBA 1ZKBA 3VXBA 5KCJB 2Z23A 5F7VA 2NUVA 1FRPA 2GQ1A 3OEMA 1H76A 5IZ3B 4P1LA 5DTBA 2XXIA 1ATGA 2HCAA 2XWIA 4KCCA 3S9NC 3MSTA 4OVPA 4MHFA 4GWSA 2OX3A 3DP6A 1VDWA 3K6WA 5L9MA 1MY2A 1CE2A 2DWAA 1O7TA 3MVWA 3R6UA 1RYXA 4PAFA 4H0WA 4NG7A 4MNCA 5CMCA 4QSDA 4ZEDA 3PPNA 2RC8A 3EQ1A 2WBBA 2PFZA 3IORA 2OK2A 2V84A 1P1WA 1B3EA 4QFNA 1UQWA 3CFLA 1DTZA 4I3YA 1MG1A 2F6PA 2XXPA 3RT8A 2XWVA 4R75A 1B58A 3FIRA 4NF4B 1Y1MA 2M8CA 4ELOA 3MYUA 2UXAA 1IXHA 3MZBA 3Q25A 1Y3NA 1B2HA 4OVRA 5EQAA 4N81A 1FPBA 2VT5A 2Q2AA 2DWIA 3K00A 3H6WA 2FYIA 3RPWA 1PDAA 1Y3PA 4NX1A 1R6ZA 4ELRA 1Q35A 3Q28A 3W15C 3MZ9A 1OMPA 1NMUA 3FUZA 2WYPA 3T93B 3RY3A 4OVSA 2W7YA 3N26A 1GGGA 4JVDA 1LBYA 3LUZA 1LCTA 3HHGA 2AIXA 1NFTA 4N8GA 2FNCA 4GWZA 4R6YA 2QSXA 4ZEIA 4BDMA 1S9TA 5ELVA 1SW4A 4IO7A 1D4NA 3VLUA 2MKZA 4I1DA 3FVKA 1MQIA 1NNTA 1WODA 1SPIA 1JW5A 1P1NA 4GWUA 3MVXA 2HAUA 4OWDA 3KFMA 1Y1ZA 1R9LA 4IY5A 2DOJA 4G61A 3OELA 1A99A 4EUOA 3FJGA 3H4ZA 1MM6A 1ANFA 1EYKA 2Q8MA 4R72A 3MW0A 5AE4A 4DDDA 4XKNA 4QSEA 1LB8A 3JZJA 5FHOA 3OO6A 1LFIA 2G29A 4R9GA 4XXUA 2F6GA 5H8HB 1USYE 5H8SA 3OSRA 3HN0A 1MXXA 1MS7A 2XXRA 4EF1A 2B4MA 1ZU0A 4F31B 2XXUA 1OQGA 2HXWA 3CG1A 2F34A 3C31A 4F1YA 2B4LA 4K3FA 1OLCA 1R9QA 5AA1A 1KZ8A 1MY0A 1A40A 3MPLA 3ZKKA 4Z0IA 1SYHA 3K0VA 4AS4A 3VLVA 1SQYA 3IL1B 2Z8DA 3ZS6A 2HHMA 3K1PA 4O3BA 5HBCA 1UTBB 1JVXA 3K1MA 1B4HA 3VFJA 1I69A 4N6KA 5AA3A 4WXJA 4PFRA 5EYGA 4Q5TA 4ELPA 4NMYA 4C1TA 1QKBA 2KR0A 2Z8FA 2XX7A 3PUXE 3G3IA 5HM4B 4O3CA 1FPIA 3E13X 4EQ7A 1HSJA 1G0HA 1N04A 4N07A 4GWWA 3O6HA 4PFTA 2B65A 1MQJA 2HFBA 1FPJA 1IXIA 4G8NA 2CZIA 4PAKA 2CEXA 1HSLA 2UVIA 3IJXB 1Y20A 1JEUA 4I8CA 3DP4A 3T9HB 3O29A 3T1BA 1B3GA 4U21A 3O6IA 3G3JA 4LP2B 5LOMA 1XI6A 2DYXA 2Y5LA 5CI5A 1Y3QA 4LVQA 3IFAA 2I3WA 3CVGA 5I2KB 3ISPA 5DEXB 1YZ0A 2FIEA 1GTKA 3GBAA 3LV0A 2RCAA 5H8QB 3TFLA 4BDRA 3I3VA 2R71A 3OO7A 4UACA 1SW1A 4LZ5A 3BBRA 3FBPA 3ZKLA 2XXQA 3RUMA 4FEBA 3CHGA 4R2FA 2F7BA 4NF5A 4GX6A 1JETA 5CMKA 3SERA 4DE8A 3KOTA 2FA7A 1CB6A 4JVIA 3U93A 4JWYA 4C1UA 1H44A 3EKIA 1AOVA 3RPLA 4O3AA 1I6BA 4PGNA 1IIWA 3KSXA 2F3DA 1FTJA 3VLWA 2QVRA 3KC1A 3UN6A 1US5A 1MQGA 3GYYA 1MXWA 1FPLA 1B1HA 1Q9DA 3VE1B 4GL0A 4H46A 5ET8A 2QJEA 1UTHB 4P11A 1H3DA 2CZKA 1B7ZA 1PBQA 3OMBA 1QW0A 4X8RA 4P0GA 4MFIA 1B40A 2RCBA 2CZLA 1MPCA 4KXPA 4XKQA 5I58A 2XXWA 5I5PA 4ZE9A 4ZECA 4XFEA 1IMAA 3MZ1A 3MBPA 1P99A 3T9UA 1BIYA 3SEYA 3FGSA 1II5A 1R1NA 1MH4A 3QUFA 4N6PA 4PTKA 2CMOA 5I56A 3N6TA 2QMWA 2RF1A 3FATA 4H67A 3TQLA 3MAMA 5CBSA 1MDQA 1MXZA 3KN7A 2DE3A 2H98A 1FQCA 1O63A 4ZE8A 3TTNA 5AA2A 3G3GA 4BDLA 1IMDA 4KCDA 2ZYKA 4KD5A 5TPAA 3KOSA 2V93A 1JQFA 2ONKE 2WX9A 2Y7PA 1FSAA 1HSEA 4I40A 1MY4A 5L8DA 1OLAA 5ET7A 4PF6A 5I84A 2IA4A 1FTLA 4PFUA 2Z8EA 1SBPA 4JDFA 1IXGA 5CBRA 4YB5A 3N6UA 5IKBA 2GHAA 5JK4A 4OFJA 1ZIUA 2XHDA 5EQ8A 4NGUA 1LAXA 4OVQA 3VV5A 3UIFA 2FHYA 4F22A 3E3KA 3RN8A 2VP1A 3THIA 2Y7WA 3QXMA 4GF8A 4RK2A 4OQOA 3KJ7A 1BTJA 5F1QA 3HSTA 4JWOA 4RK9A 3N94A 4XIGQ 4H8IA 5DVIA 1YTVA 4RPNA 5EYHA 1B3FA 1NUZA 3MUQA 1M5CA 3EPEA 4FORA 4IO6A 3TCGA 3SZPA 1FBFA 1FPEA 3IR1A 4P47A 3CR9A 4R9FA 3M8UA 4RNSA 1B0LA 2B3FA 5ICTA 1OVTA 3G3HA 1AL3A 1Q1KA 2DVCA 2UVJA 2KQZA 4KYDA 2VD3A 3A3UA 4N17A 1ZMGA 2DS9A 4G8MA 4EF2A 5K2YA 5ITPA 2Y7IA 4FECA 3RQTA 4GX4A 1SVXB 4U1OA 4NF8A 4OEUA 3T22A 2I4CA 5DYHA 3UA8A 3C4MA 3OO9A 3BIHA 4F29A 3C36A 2I49A 4OYVA 1ZBMA 1TXFA 1NV6A 4P9KA 1N84A 5ISUA 1I6QA 3LC8A 3C34A 3ILUB 1NUYA 3Q26A 1FBGA 1PBPA 3HFUA 4M1VA 2PCRA 3QMFA 5FTIA 2VGQA 3FZVA 4FBPA 4AB6A 4U23A 4FIMA 4EQ9A 4RPOA 2QS4A 3I6VA 2RINA 3PPPA 3W9WA 4XKRA 2E0SA 1IMCA 4L17A 2G93A 3QSLA 2P2AA 1INPA 4H65A 3FXUA 3MJNA 1SI1A 3LSFB 3TDJA 1GR2A 1ZLQA 1DOTA 3LBSA 1IMFA 4FE8A 5IGAA 1NI9A 5FHNA 2DWHA 4C0RA 1USYH 2KLFA 3ZSFA 3R26A 4PP0A 2F8DA 4H5GA 4F19A 4MEVA 2NXOA 1L5TA 2QS1A 2VPNA 3Q29A 5CMMA 3TKDA 2Y5KA 1B52A 4G68A 1XC1A 3B6QA 4HW8A 1A55A 3CIJA 4IO4A 2H25A 3CFXA 1NV1A 1QVSA 3JV9A 2F78A 5T3JA 2ONSA 4UABA 4H1XA 1K9ZA 1S7YA 3O28A 1N3XA 3OXNA 1QKAA 2QMXA 4HE1A 2V3UA 1DPPA 4JSOA 1MRPA 1M5DA 3TPAA 4ESWA 3UP9A 2XXKA 3NOHA 3BKIB 3PU5A 3H06B 4THIA 2A5SA 4PDDA 1LBVA 3C32A 1FBHA 2WEFA 1SDXA 1MM7A 3TEPA 2V4CA 4H45A 5I59A 4LUBA 3N5LA 1TFDA 3H3GA 4PAIA 4RY1A 4EDPA 4LN5A 2ZYNA 5KDTA 1NNKA 3MWBA 1LBZA 2I0CA 3U1OA 1FCKA 4KI0E 4QF9A 2O7UA 4RA1A 3T66A 4P56A 4NHBA 1B7HA 4NF5B 4Q0CA 2ZZVA 3K2DA 2REJA 5I2NA 2ZNTA 4RYAA 3S9LC 1RDXA 3CI8A 4X1DA 1DK4A 5FTHA 3RPLB 1LCFA 3G7WA 3TODA 1DBZA 1MY1A 1FQFA 3CG3A 2XXVA
chains in the Genus database with same CATH topology
2XXYA 2F36A 3SEXA 1D9YA 1B6HA 2ZYMA 4BDQA 3SESA 1FQBA 1Y4CA 4IGTA 1Y9UA 2A5TA 1DPEA 2AL5A 4LATA 1BLFA 4G77A 5AA4A 2XXXA 3PPOA 3H6VA 4QFLA 4POXA 5I58B 1VSOA 4F2QA 1SW5A 1PB9A 3I5OA 4LQ5A 3FASA 5I56B 5DT6A 2X7QA 5CRYA 4AB5A 1MPBA 4M4GA 4JBZA 1QUJA 4DXBA 4IO3A 3HHFA 5B7DA 1YCJA 3D4GA 5TPAB 2VD2A 4H8JA 2HAVA 4EXLA 3CSGA 4GD5A 2X26A 3TQWA 4ND9A 3GZGA 1LAGE 4TLLB 4LZ8A 1LFHA 3T9VA 4NF6A 3T96B 3KBRA 3KN3A 2HEUA 4GVOA 1H43A 2O69A 3R7XA 4KHZE 2ONRA 3JYRA 4FAJA 2QRYA 2UVGA 5EHSA 3SEVA 4ZEBA 1MPDA 2PYYA 2R6GE 3DLNA 4TQUQ 4YKJA 4OESA 3O66A 4OFLA 1XOCA 2HZLA 2OBGA 4X1BA 2O7IA 1JEVA 1MY3A 4QFOA 2GH9A 4F3GA 3RTFB 5I57A 4JB7A 4F3BA 3TMGA 2OCUA 3DM0A 3IK6B 4YKKA 2NWJA 4PFWA 3PD9A 4E0WA 4AQ4A 1US4A 3KG2A 3M3LA 2Q89A 3SEWA 3AXFA 1NNFA 2I4BA 2Y84A 3TUSA 3G3KA 4U1ZA 4YB7A 3TCFA 4E0XA 2Q88A 4ONYA 4UA8A 2DP8A 1MXUA 1MH3A 2O84X 1IUDA 3GXAA 3IJOB 3C35A 2BJJX 1SD3A 3QYTA 2O68A 5IAIA 3FVOA 1Y4TA 3O2AA 4U2RA 1B5HA 4DZ1A 4NF8B 2ZMBA 3RT6B 1GVCA 3MVZA 2OZZA 1VE4A 4MLVA 3CFZA 2ANJA 4ZZAA 4Q8RA 2OJTA 4RXLA 3MC2A 5HPQA 4GQOA 3SETA 5K2XA 2HZKA 3QIMA 4GWOA 5H8FA 4H6DA 3C33A 1LAFE 4R6KA 3IOUA 5EHMA 3EHTA 3RGYA 3SKPA 3H6UA 5H8NA 1EZ9A 1Z7NE 1P1UA 3EHSA 3FJMA 1NH7A 3LSLA 1EU8A 3H6TA 2DQVA 5ITOA 2I3VA 1TT1A 3K6XA 4TOZA 5CC2A 2V3QA 2PVUA 1KWHA 3MP1A 3OEKA 1A54A 2O1MA 5ICQA 3SEUA 2PMSA 5DVFA 3ECRA 1NKXA 2XX8A 3RNNA 3U94A 4XKPA 2E1SA 4QRZA 1B3HA 2B3BA 2H5YA 4QFKA 3IB2A 3IOTA 2ZNSA 4MH5A 3Q27A 3U92A 1ZTYA 1FTKA 4G68B 3IAZA 3FVNA 2ESNA 3EF7A 4LONB 4OFOA 4WKMA 3O9PA 1N76A 4DIGA 4LQ2A 2IEEA 4DXUA 4MBPA 2DXYA 1MDP1 4GXAA 3WAFA 2I48A 5BWJA 2DWJA 2XXHA 4ECFA 1TWYA 1FQAA 5EYFA 2X7PA 1PC3A 1MQHA 4DLDA 2Z22A 4G68C 3PUYE 3ONMA 1S50A 2DE4A 3U8QA 3PMWA 3EN3A 3FV1A 2I58A 3QK6A 4F1UA 5I59B 1B05A 5JTYA 3U72A 1B51A 4R2BA 2XD3A 3K02A 1P1QA 1B5JA 4N13A 5KDTB 2HQ0A 1A7LA 4WEPA 4OEVA 1EH3A 1WVJA 4P0IA 5FHMA 2R9JA 3M3FA 3TYHA 1LBCA 1B3LA 3KGCA 4I9DA 4JWXA 2Q8JA 3TTLA 2AL4A 5I2NB 4TLMB 3BFTA 1O64A 2P1SA 5KZTA 2I6EA 1J1NA 4QHQA 2VHAA 3OOAA 3L6GA 3QAXA 1SYIA 3UGWA 4X9TA 1XHYA 2REGA 4IB2A 2NVUB 1ELJA 4ZZEA 4ZDMA 3H03A 1QUIA 3H7MA 1B32A 4GFRA 4ZEKA 4GOTA 3ILTB 4MF3A 3EHUA 4NTLA 2A5TB 3FXQA 2UYFA 4OERA 2OLBA 1MXVA 5AA4B 4OTEA 1Z7ME 1JNFA 4POWA 5B70A 3PPQA 4HCWA 3K01A 2Q9TA 5A5XA 3P7IA 2AYSA 4OHNA 5M2VA 2ZNUA 3PPRA 2VOZA 3PUVE 4EQBA 2F35A 3K6UA 3VVEA 1IQ7A 1FW0A 4ELQA 4IGRA 4IY6A 3B6TA 2PBWA 3M3KA 1B4ZA 5TP9A 3V83A 3MP8A 3PMXA 1AMFA 2Y7KA 3W9VA 2YLNA 3HPIA 3HCQA 4NF6B 2Q2CA 1XVYA 4KYEA 3ODBA 3IB0A 4QSCA 4KPTA 4OZ9A 1URGA 1H45A 4GRKA 2THIA 1VFDA 2D5WA 4H5FA 3CRBA 1VR5A 3LUYA 3QUJA 2RKMA 3BFUA 3L6HA 3FXRA 4F1VA 5AA2D 3LR1A 5I57B 3OO8A 2NOOA 4GL8A 1D9VA 1OQHA 2V25A 4PE5B 1I6AA 5KCJA 2UYEA 5L9SA 3G3FA 4HCYA 1SW2A 4NWCA 4PFYA 1PB8A 5TU0A 1M5EA 2RC7A 4U22A 4IO2A 4ZEFA 3V8XB 1LAHE 1EZOA 3F11A 3UORA 4WEDA 1A8FA 1OIBA 1FQDA 4BDOA 4GXSB 4FEDA 1IITA 3FD3A 1M5FA 1N3WA 4ISUA 4NWDA 4OMBA 4Z7EA 1N7XA 1MXYA 1URSA 3K1NA 3B6WA 5AA2B 3PUWE 4YZZA 3TZAA 4YMBA 4FATA 2ZXTA 1URDA 4NF4A 3TELA 4F2OA 4HTGA 3PV0E 4F3SA 2O1LA 1M5BA 4DCXA 3DP8A 2OWSA 1BKAA 5H8FB 4YKIA 1QUKA 1IXCA 1NH8A 1XVXA 1XS5A 3K6VA 3UK4A 5L9OA 4YICA 1N0TA 2QPQA 4OVJA 5H8NB 3KEIA 4GIZA 4I62A 2H9BA 3IO4A 1EZPA 5JEIA 2DSFA 2F7CA 5J1DA 2XD2A 1XT8A 2GRVA 3PGFA 3LSXA 4RJZA 2V3TA 3E4RA 1TFAA 3MP6A 3T9XB 1LSTA 2I0BA 3MPKA 3TTMA 2D21A 1UIUA 1MQDA 1B1XA 3TAJA 4LZ7A 2ABHA 2F97A 4OENA 4KQPA 1LFGA 1AH5A 2PT2A 1JW4A 4Q30B 1UIVA 2GFEA 5H8HA 4KYSA 3RTWB 3FV2A 3MQ9A 2XX9A 4BDNA 1DTGA 4MLQA 3WAEA 4U4XA 3KSJA 2LAOA 1GV8A 3VVDA 1B5IA 3S9MC 3LSWA 1RYOA 3E9XA 4F39A 1B7UA 1DMBA 1LGBC 4YU0A 4U4SA 4NE4A 1NL5A 3A09A 2DVZA 4EXKA 3TTKA 3IOWA 3PMVA 1OVBA 1B46A 4ESXA 1UTBA 2PX1A 1N7WA 4NEDA 5CM6A 5BUUA 1QULA 5JTYB 3VXCA 2ZYOA 1F9BA 1RKMA 3K4UA 4KR5A 1ZJLA 5CMBA 1YAEA 3HV1A 3O6GA 1JVYA 4YMAA 1POY1 1NNPA 1A8EA 3DELB 4XTCQ 1P1OA 3B7DA 2PT1A 4DXCA 1VFEA 4YKPA 2O6AA 4LA9A 1SI0A 2DXRA 4HS7A 3USDA 5I2KA 4G8HA 3S9EA 5DEXA 4QFPA 4OXVA 4DCYA 1D3KA 2QS2A 1IZ1A 1FTMA 3OD7A 2D3IA 2XXTA 3VDFA 3IB1A 5H8QA 4R74A 3O97A 1YPNA 3SDFA 2ALUA 3PD8A 1BP5A 4BLAA 3IO6A 1T0KA 3PUZE 3A3CA 1PEBA 4ZS9A 3RLFE 3C9HA 2WKYA 4PETA 4JXIA 4PQJA 1LB9A 4R6HA 2H99A 4GLIA 2H4IA 3IOVA 1QJMA 5A5XB 3KZGA 1B0HA 2P0SA 2DE2A 4G2ZA 3OSQA 1AIVA 3TTRA 1DSNA 1PB7A 2OWTA 1UTHA 4R73A 4F18A 2F7AA 1LBBA 1FTOA 4JSDA 4KFQA 3HO7A 5TP9B 4IO5A 2QL3A 3KJTA 3FJ7A 2QS3A 3D4CA 2YPNA 3V5AA 1JW1A 4F3PA 3IX1A 4FJPA 3KN8A 3VVFA 1POTA 3CSBA 2F5XA 1B9JA 3TCHA 2Y7RA 3OENA 3S2VA 3V89B 1FQEA 1WDNA 2YJPA 4YB6A 3GLBA 1LLSA 1IEJA 2O51A 2RC9A 2GHBA 3MVYA 2UVHA 3S4UA 4X48A 4YAHX 5DVJA 4OETA 4G4PA 3FVGA 3GBBA 1ZKBA 3VXBA 5KCJB 2Z23A 5F7VA 2NUVA 3OEMA 1H76A 5DTBA 2XXIA 1ATGA 2HCAA 3S9NC 4KCCA 3DP6A 3K6WA 5L9MA 1MY2A 1CE2A 2DWAA 1O7TA 3MVWA 3R6UA 1RYXA 4H0WA 5CMCA 4QSDA 4ZEDA 3PPNA 2RC8A 3EQ1A 3IORA 2OK2A 2V84A 1P1WA 1B3EA 4QFNA 1UQWA 3CFLA 1DTZA 1MG1A 2F6PA 2XXPA 3RT8A 4R75A 1B58A 3FIRA 4NF4B 1Y1MA 2M8CA 4ELOA 2UXAA 1IXHA 3MZBA 3Q25A 1Y3NA 1B2HA 2Q2AA 2DWIA 3K00A 3H6WA 2FYIA 3RPWA 1PDAA 1Y3PA 1R6ZA 4ELRA 1Q35A 3Q28A 3W15C 3MZ9A 1OMPA 1NMUA 3FUZA 3T93B 3RY3A 2W7YA 3N26A 1GGGA 1LCTA 3HHGA 2AIXA 1NFTA 2FNCA 4R6YA 2QSXA 4ZEIA 4BDMA 1S9TA 5ELVA 1SW4A 4IO7A 1D4NA 3VLUA 4I1DA 3FVKA 1MQIA 1NNTA 1WODA 1JW5A 1P1NA 3MVXA 2HAUA 4OWDA 3KFMA 1Y1ZA 1R9LA 4IY5A 2DOJA 3OELA 1A99A 4EUOA 3FJGA 3H4ZA 1MM6A 1ANFA 4R72A 3MW0A 5AE4A 4DDDA 4XKNA 4QSEA 1LB8A 3JZJA 5FHOA 3OO6A 1LFIA 2G29A 4R9GA 4XXUA 2F6GA 5H8HB 1USYE 5H8SA 3OSRA 3HN0A 1MXXA 1MS7A 2XXRA 4EF1A 1ZU0A 4F31B 2XXUA 1OQGA 2HXWA 3CG1A 2F34A 3C31A 4F1YA 4K3FA 1OLCA 1R9QA 5AA1A 1MY0A 1A40A 3MPLA 3ZKKA 4Z0IA 1SYHA 3K0VA 3VLVA 1SQYA 3IL1B 2Z8DA 3ZS6A 3K1PA 4O3BA 5HBCA 1UTBB 1JVXA 3K1MA 1B4HA 3VFJA 1I69A 5AA3A 4WXJA 4Q5TA 4ELPA 4NMYA 4C1TA 1QKBA 2Z8FA 2XX7A 3PUXE 3G3IA 5HM4B 4O3CA 3E13X 4EQ7A 1HSJA 1N04A 4N07A 3O6HA 4PFTA 2B65A 1MQJA 2HFBA 1IXIA 4G8NA 1HSLA 2UVIA 3IJXB 1Y20A 1JEUA 4I8CA 3DP4A 3T9HB 3O29A 1B3GA 4U21A 3O6IA 3G3JA 4LP2B 5LOMA 2DYXA 5CI5A 1Y3QA 4LVQA 2I3WA 3CVGA 5I2KB 5DEXB 1GTKA 3GBAA 2RCAA 4BDRA 5H8QB 3TFLA 3I3VA 2R71A 3OO7A 4UACA 1SW1A 4LZ5A 3BBRA 3ZKLA 2XXQA 3RUMA 4FEBA 4R2FA 2F7BA 4NF5A 1JETA 5CMKA 3SERA 4DE8A 3KOTA 2FA7A 1CB6A 3U93A 4JWYA 4C1UA 1H44A 1AOVA 4O3AA 1I6BA 1IIWA 3KSXA 1FTJA 3VLWA 3UN6A 1US5A 1MQGA 1MXWA 1B1HA 3VE1B 4GL0A 2QJEA 1UTHB 4P11A 1H3DA 1B7ZA 1PBQA 3OMBA 1QW0A 4P0GA 4MFIA 1B40A 2RCBA 2CZLA 1MPCA 4XKQA 5I58A 2XXWA 4ZE9A 4ZECA 3MZ1A 3MBPA 1P99A 3T9UA 1BIYA 3SEYA 3FGSA 1II5A 1R1NA 1MH4A 3QUFA 4N6PA 2CMOA 5I56A 3N6TA 2QMWA 2RF1A 3FATA 4H67A 3TQLA 3MAMA 5CBSA 1MDQA 1MXZA 3KN7A 2DE3A 2H98A 1FQCA 1O63A 4ZE8A 3TTNA 5AA2A 3G3GA 4BDLA 4KCDA 2ZYKA 4KD5A 5TPAA 3KOSA 2V93A 1JQFA 2ONKE 2Y7PA 1HSEA 1MY4A 5L8DA 1OLAA 5I84A 2IA4A 1FTLA 4PFUA 2Z8EA 1SBPA 4JDFA 1IXGA 5CBRA 4YB5A 3N6UA 5IKBA 2GHAA 5JK4A 4OFJA 1ZIUA 2XHDA 1LAXA 3VV5A 3UIFA 4F22A 3E3KA 3RN8A 2VP1A 3THIA 2Y7WA 3QXMA 4GF8A 4RK2A 4OQOA 3KJ7A 1BTJA 5F1QA 3HSTA 4JWOA 4RK9A 3N94A 4XIGQ 4H8IA 5DVIA 1YTVA 4RPNA 1B3FA 3MUQA 1M5CA 3EPEA 4FORA 4IO6A 3TCGA 3IR1A 3CR9A 4R9FA 3M8UA 4RNSA 1B0LA 2B3FA 5ICTA 1OVTA 3G3HA 1AL3A 1Q1KA 2DVCA 2UVJA 4KYDA 2VD3A 3A3UA 1ZMGA 2DS9A 4G8MA 4EF2A 5K2YA 5ITPA 2Y7IA 4FECA 3RQTA 1SVXB 4U1OA 4NF8A 4OEUA 3T22A 2I4CA 5DYHA 3UA8A 3C4MA 3OO9A 4F29A 3C36A 2I49A 4OYVA 1ZBMA 1TXFA 1N84A 5ISUA 1I6QA 3LC8A 3C34A 3ILUB 3Q26A 1PBPA 4M1VA 5FTIA 2VGQA 3FZVA 4AB6A 4U23A 4FIMA 4EQ9A 4RPOA 2QS4A 3I6VA 2RINA 3PPPA 3W9WA 4XKRA 2E0SA 4L17A 2G93A 3QSLA 2P2AA 4H65A 3FXUA 3MJNA 1SI1A 3LSFB 3TDJA 1GR2A 1ZLQA 1DOTA 3LBSA 4FE8A 5FHNA 2DWHA 4C0RA 1USYH 2KLFA 3ZSFA 3R26A 4PP0A 2F8DA 4H5GA 4F19A 2NXOA 1L5TA 2QS1A 3Q29A 5CMMA 3TKDA 1B52A 4G68A 1XC1A 3B6QA 4HW8A 1A55A 3CIJA 4IO4A 2H25A 3CFXA 1QVSA 3JV9A 2F78A 2ONSA 4H1XA 1S7YA 3O28A 1N3XA 3OXNA 1QKAA 2QMXA 2V3UA 1DPPA 4JSOA 1MRPA 1M5DA 3TPAA 4ESWA 3UP9A 3BKIB 3PU5A 3H06B 4THIA 2A5SA 3C32A 1SDXA 1MM7A 3TEPA 5I59A 4LUBA 3N5LA 1TFDA 3H3GA 4RY1A 4EDPA 2ZYNA 5KDTA 1NNKA 3MWBA 2I0CA 3U1OA 1FCKA 4KI0E 4QF9A 2O7UA 4RA1A 3T66A 1B7HA 4NF5B 4Q0CA 3K2DA 2REJA 5I2NA 2ZNTA 4RYAA 3S9LC 3CI8A 4X1DA 5FTHA 1LCFA 3G7WA 3TODA 1MY1A 1FQFA 3CG3A 2XXVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXY A;  2F36 A;  3SEX A;  1D9Y A;  1B6H A;  2ZYM A;  4BDQ A;  3SES A;  1FQB A;  1Y4C A;  4IGT A;  1Y9U A;  2A5T A;  1DPE A;  2AL5 A;  4LAT A;  1BLF A;  4G77 A;  5AA4 A;  2XXX A;  3PPO A;  3H6V A;  4QFL A;  4POX A;  5I58 B;  1VSO A;  4F2Q A;  1SW5 A;  1PB9 A;  3I5O A;  4LQ5 A;  3FAS A;  5I56 B;  5DT6 A;  2X7Q A;  5CRY A;  4AB5 A;  1MPB A;  4M4G A;  4JBZ A;  1QUJ A;  4DXB A;  4IO3 A;  3HHF A;  5B7D A;  1YCJ A;  3D4G A;  5TPA B;  2VD2 A;  4H8J A;  2HAV A;  4EXL A;  3CSG A;  4GD5 A;  2X26 A;  3TQW A;  4ND9 A;  3GZG A;  1LAG E;  4TLL B;  4LZ8 A;  1LFH A;  3T9V A;  4NF6 A;  3T96 B;  3KBR A;  3KN3 A;  2HEU A;  4GVO A;  1H43 A;  2O69 A;  3R7X A;  4KHZ E;  2ONR A;  3JYR A;  4FAJ A;  2QRY A;  2UVG A;  5EHS A;  3SEV A;  4ZEB A;  1MPD A;  2PYY A;  2R6G E;  3DLN A;  4TQU Q;  4YKJ A;  4OES A;  3O66 A;  4OFL A;  1XOC A;  2HZL A;  2OBG A;  4X1B A;  2O7I A;  1JEV A;  1MY3 A;  4QFO A;  2GH9 A;  4F3G A;  3RTF B;  5I57 A;  4JB7 A;  4F3B A;  3TMG A;  2OCU A;  3DM0 A;  3IK6 B;  4YKK A;  2NWJ A;  4PFW A;  3PD9 A;  4E0W A;  4AQ4 A;  1US4 A;  3KG2 A;  3M3L A;  2Q89 A;  3SEW A;  3AXF A;  1NNF A;  2I4B A;  2Y84 A;  3TUS A;  3G3K A;  4U1Z A;  4YB7 A;  3TCF A;  4E0X A;  2Q88 A;  4ONY A;  4UA8 A;  2DP8 A;  1MXU A;  1MH3 A;  2O84 X;  1IUD A;  3GXA A;  3IJO B;  3C35 A;  2BJJ X;  1SD3 A;  3QYT A;  2O68 A;  5IAI A;  3FVO A;  1Y4T A;  3O2A A;  4U2R A;  1B5H A;  4DZ1 A;  4NF8 B;  2ZMB A;  3RT6 B;  1GVC A;  3MVZ A;  2OZZ A;  1VE4 A;  4MLV A;  3CFZ A;  2ANJ A;  4ZZA A;  4Q8R A;  2OJT A;  4RXL A;  3MC2 A;  5HPQ A;  4GQO A;  3SET A;  5K2X A;  2HZK A;  3QIM A;  4GWO A;  5H8F A;  4H6D A;  3C33 A;  1LAF E;  4R6K A;  3IOU A;  5EHM A;  3EHT A;  3RGY A;  3SKP A;  3H6U A;  5H8N A;  1EZ9 A;  1Z7N E;  1P1U A;  3EHS A;  3FJM A;  1NH7 A;  3LSL A;  1EU8 A;  3H6T A;  2DQV A;  5ITO A;  2I3V A;  1TT1 A;  3K6X A;  4TOZ A;  5CC2 A;  2V3Q A;  2PVU A;  1KWH A;  3MP1 A;  3OEK A;  1A54 A;  2O1M A;  5ICQ A;  3SEU A;  2PMS A;  5DVF A;  3ECR A;  1NKX A;  2XX8 A;  3RNN A;  3U94 A;  4XKP A;  2E1S A;  4QRZ A;  1B3H A;  2B3B A;  2H5Y A;  4QFK A;  3IB2 A;  3IOT A;  2ZNS A;  4MH5 A;  3Q27 A;  3U92 A;  1ZTY A;  1FTK A;  4G68 B;  3IAZ A;  3FVN A;  2ESN A;  3EF7 A;  4LON B;  4OFO A;  4WKM A;  3O9P A;  1N76 A;  4DIG A;  4LQ2 A;  2IEE A;  4DXU A;  4MBP A;  2DXY A;  1MDP 1;  4GXA A;  3WAF A;  2I48 A;  5BWJ A;  2DWJ A;  2XXH A;  4ECF A;  1TWY A;  1FQA A;  5EYF A;  2X7P A;  1PC3 A;  1MQH A;  4DLD A;  2Z22 A;  4G68 C;  3PUY E;  3ONM A;  1S50 A;  2DE4 A;  3U8Q A;  3PMW A;  3EN3 A;  3FV1 A;  2I58 A;  3QK6 A;  4F1U A;  5I59 B;  1B05 A;  5JTY A;  3U72 A;  1B51 A;  4R2B A;  2XD3 A;  3K02 A;  1P1Q A;  1B5J A;  4N13 A;  5KDT B;  2HQ0 A;  1A7L A;  4WEP A;  4OEV A;  1EH3 A;  1WVJ A;  4P0I A;  5FHM A;  2R9J A;  3M3F A;  3TYH A;  1LBC A;  1B3L A;  3KGC A;  4I9D A;  4JWX A;  2Q8J A;  3TTL A;  2AL4 A;  5I2N B;  4TLM B;  3BFT A;  1O64 A;  2P1S A;  5KZT A;  2I6E A;  1J1N A;  4QHQ A;  2VHA A;  3OOA A;  3L6G A;  3QAX A;  1SYI A;  3UGW A;  4X9T A;  1XHY A;  2REG A;  4IB2 A;  2NVU B;  1ELJ A;  4ZZE A;  4ZDM A;  3H03 A;  1QUI A;  3H7M A;  1B32 A;  4GFR A;  4ZEK A;  4GOT A;  3ILT B;  4MF3 A;  3EHU A;  4NTL A;  2A5T B;  3FXQ A;  2UYF A;  4OER A;  2OLB A;  1MXV A;  5AA4 B;  4OTE A;  1Z7M E;  1JNF A;  4POW A;  5B70 A;  3PPQ A;  4HCW A;  3K01 A;  2Q9T A;  5A5X A;  3P7I A;  2AYS A;  4OHN A;  5M2V A;  2ZNU A;  3PPR A;  2VOZ A;  3PUV E;  4EQB A;  2F35 A;  3K6U A;  3VVE A;  1IQ7 A;  1FW0 A;  4ELQ A;  4IGR A;  4IY6 A;  3B6T A;  2PBW A;  3M3K A;  1B4Z A;  5TP9 A;  3V83 A;  3MP8 A;  3PMX A;  1AMF A;  2Y7K A;  3W9V A;  2YLN A;  3HPI A;  3HCQ A;  4NF6 B;  2Q2C A;  1XVY A;  4KYE A;  3ODB A;  3IB0 A;  4QSC A;  4KPT A;  4OZ9 A;  1URG A;  1H45 A;  4GRK A;  2THI A;  1VFD A;  2D5W A;  4H5F A;  3CRB A;  1VR5 A;  3LUY A;  3QUJ A;  2RKM A;  3BFU A;  3L6H A;  3FXR A;  4F1V A;  5AA2 D;  3LR1 A;  5I57 B;  3OO8 A;  2NOO A;  4GL8 A;  1D9V A;  1OQH A;  2V25 A;  4PE5 B;  1I6A A;  5KCJ A;  2UYE A;  5L9S A;  3G3F A;  4HCY A;  1SW2 A;  4NWC A;  4PFY A;  1PB8 A;  5TU0 A;  1M5E A;  2RC7 A;  4U22 A;  4IO2 A;  4ZEF A;  3V8X B;  1LAH E;  1EZO A;  3F11 A;  3UOR A;  4WED A;  1A8F A;  1OIB A;  1FQD A;  4BDO A;  4GXS B;  4FED A;  1IIT A;  3FD3 A;  1M5F A;  1N3W A;  4ISU A;  4NWD A;  4OMB A;  4Z7E A;  1N7X A;  1MXY A;  1URS A;  3K1N A;  3B6W A;  5AA2 B;  3PUW E;  4YZZ A;  3TZA A;  4YMB A;  4FAT A;  2ZXT A;  1URD A;  4NF4 A;  3TEL A;  4F2O A;  4HTG A;  3PV0 E;  4F3S A;  2O1L A;  1M5B A;  4DCX A;  3DP8 A;  2OWS A;  1BKA A;  5H8F B;  4YKI A;  1QUK A;  1IXC A;  1NH8 A;  1XVX A;  1XS5 A;  3K6V A;  3UK4 A;  5L9O A;  4YIC A;  1N0T A;  2QPQ A;  4OVJ A;  5H8N B;  3KEI A;  4GIZ A;  4I62 A;  2H9B A;  3IO4 A;  1EZP A;  5JEI A;  2DSF A;  2F7C A;  5J1D A;  2XD2 A;  1XT8 A;  2GRV A;  3PGF A;  3LSX A;  4RJZ A;  2V3T A;  3E4R A;  1TFA A;  3MP6 A;  3T9X B;  1LST A;  2I0B A;  3MPK A;  3TTM A;  2D21 A;  1UIU A;  1MQD A;  1B1X A;  3TAJ A;  4LZ7 A;  2ABH A;  2F97 A;  4OEN A;  4KQP A;  1LFG A;  1AH5 A;  2PT2 A;  1JW4 A;  4Q30 B;  1UIV A;  2GFE A;  5H8H A;  4KYS A;  3RTW B;  3FV2 A;  3MQ9 A;  2XX9 A;  4BDN A;  1DTG A;  4MLQ A;  3WAE A;  4U4X A;  3KSJ A;  2LAO A;  1GV8 A;  3VVD A;  1B5I A;  3S9M C;  3LSW A;  1RYO A;  3E9X A;  4F39 A;  1B7U A;  1DMB A;  1LGB C;  4YU0 A;  4U4S A;  4NE4 A;  1NL5 A;  3A09 A;  2DVZ A;  4EXK A;  3TTK A;  3IOW A;  3PMV A;  1OVB A;  1B46 A;  4ESX A;  1UTB A;  2PX1 A;  1N7W A;  4NED A;  5CM6 A;  5BUU A;  1QUL A;  5JTY B;  3VXC A;  2ZYO A;  1F9B A;  1RKM A;  3K4U A;  4KR5 A;  1ZJL A;  5CMB A;  1YAE A;  3HV1 A;  3O6G A;  1JVY A;  4YMA A;  1POY 1;  1NNP A;  1A8E A;  3DEL B;  4XTC Q;  1P1O A;  3B7D A;  2PT1 A;  4DXC A;  1VFE A;  4YKP A;  2O6A A;  4LA9 A;  1SI0 A;  2DXR A;  4HS7 A;  3USD A;  5I2K A;  4G8H A;  3S9E A;  5DEX A;  4QFP A;  4OXV A;  4DCY A;  1D3K A;  2QS2 A;  1IZ1 A;  1FTM A;  3OD7 A;  2D3I A;  2XXT A;  3VDF A;  3IB1 A;  5H8Q A;  4R74 A;  3O97 A;  1YPN A;  3SDF A;  2ALU A;  3PD8 A;  1BP5 A;  4BLA A;  3IO6 A;  1T0K A;  3PUZ E;  3A3C A;  1PEB A;  4ZS9 A;  3RLF E;  3C9H A;  2WKY A;  4PET A;  4JXI A;  4PQJ A;  1LB9 A;  4R6H A;  2H99 A;  4GLI A;  2H4I A;  3IOV A;  1QJM A;  5A5X B;  3KZG A;  1B0H A;  2P0S A;  2DE2 A;  4G2Z A;  3OSQ A;  1AIV A;  3TTR A;  1DSN A;  1PB7 A;  2OWT A;  1UTH A;  4R73 A;  4F18 A;  2F7A A;  1LBB A;  1FTO A;  4JSD A;  4KFQ A;  3HO7 A;  5TP9 B;  4IO5 A;  2QL3 A;  3KJT A;  3FJ7 A;  2QS3 A;  3D4C A;  2YPN A;  3V5A A;  1JW1 A;  4F3P A;  3IX1 A;  4FJP A;  3KN8 A;  3VVF A;  1POT A;  3CSB A;  2F5X A;  1B9J A;  3TCH A;  2Y7R A;  3OEN A;  3S2V A;  3V89 B;  1FQE A;  1WDN A;  2YJP A;  4YB6 A;  3GLB A;  1LLS A;  1IEJ A;  2O51 A;  2RC9 A;  2GHB A;  3MVY A;  2UVH A;  3S4U A;  4X48 A;  4YAH X;  5DVJ A;  4OET A;  4G4P A;  3FVG A;  3GBB A;  1ZKB A;  3VXB A;  5KCJ B;  2Z23 A;  5F7V A;  2NUV A;  3OEM A;  1H76 A;  5DTB A;  2XXI A;  1ATG A;  2HCA A;  3S9N C;  4KCC A;  3DP6 A;  3K6W A;  5L9M A;  1MY2 A;  1CE2 A;  2DWA A;  1O7T A;  3MVW A;  3R6U A;  1RYX A;  4H0W A;  5CMC A;  4QSD A;  4ZED A;  3PPN A;  2RC8 A;  3EQ1 A;  3IOR A;  2OK2 A;  2V84 A;  1P1W A;  1B3E A;  4QFN A;  1UQW A;  3CFL A;  1DTZ A;  1MG1 A;  2F6P A;  2XXP A;  3RT8 A;  4R75 A;  1B58 A;  3FIR A;  4NF4 B;  1Y1M A;  2M8C A;  4ELO A;  2UXA A;  1IXH A;  3MZB A;  3Q25 A;  1Y3N A;  1B2H A;  2Q2A A;  2DWI A;  3K00 A;  3H6W A;  2FYI A;  3RPW A;  1PDA A;  1Y3P A;  1R6Z A;  4ELR A;  1Q35 A;  3Q28 A;  3W15 C;  3MZ9 A;  1OMP A;  1NMU A;  3FUZ A;  3T93 B;  3RY3 A;  2W7Y A;  3N26 A;  1GGG A;  1LCT A;  3HHG A;  2AIX A;  1NFT A;  2FNC A;  4R6Y A;  2QSX A;  4ZEI A;  4BDM A;  1S9T A;  5ELV A;  1SW4 A;  4IO7 A;  1D4N A;  3VLU A;  4I1D A;  3FVK A;  1MQI A;  1NNT A;  1WOD A;  1JW5 A;  1P1N A;  3MVX A;  2HAU A;  4OWD A;  3KFM A;  1Y1Z A;  1R9L A;  4IY5 A;  2DOJ A;  3OEL A;  1A99 A;  4EUO A;  3FJG A;  3H4Z A;  1MM6 A;  1ANF A;  4R72 A;  3MW0 A;  5AE4 A;  4DDD A;  4XKN A;  4QSE A;  1LB8 A;  3JZJ A;  5FHO A;  3OO6 A;  1LFI A;  2G29 A;  4R9G A;  4XXU A;  2F6G A;  5H8H B;  1USY E;  5H8S A;  3OSR A;  3HN0 A;  1MXX A;  1MS7 A;  2XXR A;  4EF1 A;  1ZU0 A;  4F31 B;  2XXU A;  1OQG A;  2HXW A;  3CG1 A;  2F34 A;  3C31 A;  4F1Y A;  4K3F A;  1OLC A;  1R9Q A;  5AA1 A;  1MY0 A;  1A40 A;  3MPL A;  3ZKK A;  4Z0I A;  1SYH A;  3K0V A;  3VLV A;  1SQY A;  3IL1 B;  2Z8D A;  3ZS6 A;  3K1P A;  4O3B A;  5HBC A;  1UTB B;  1JVX A;  3K1M A;  1B4H A;  3VFJ A;  1I69 A;  5AA3 A;  4WXJ A;  4Q5T A;  4ELP A;  4NMY A;  4C1T A;  1QKB A;  2Z8F A;  2XX7 A;  3PUX E;  3G3I A;  5HM4 B;  4O3C A;  3E13 X;  4EQ7 A;  1HSJ A;  1N04 A;  4N07 A;  3O6H A;  4PFT A;  2B65 A;  1MQJ A;  2HFB A;  1IXI A;  4G8N A;  1HSL A;  2UVI A;  3IJX B;  1Y20 A;  1JEU A;  4I8C A;  3DP4 A;  3T9H B;  3O29 A;  1B3G A;  4U21 A;  3O6I A;  3G3J A;  4LP2 B;  5LOM A;  2DYX A;  5CI5 A;  1Y3Q A;  4LVQ A;  2I3W A;  3CVG A;  5I2K B;  5DEX B;  1GTK A;  3GBA A;  2RCA A;  4BDR A;  5H8Q B;  3TFL A;  3I3V A;  2R71 A;  3OO7 A;  4UAC A;  1SW1 A;  4LZ5 A;  3BBR A;  3ZKL A;  2XXQ A;  3RUM A;  4FEB A;  4R2F A;  2F7B A;  4NF5 A;  1JET A;  5CMK A;  3SER A;  4DE8 A;  3KOT A;  2FA7 A;  1CB6 A;  3U93 A;  4JWY A;  4C1U A;  1H44 A;  1AOV A;  4O3A A;  1I6B A;  1IIW A;  3KSX A;  1FTJ A;  3VLW A;  3UN6 A;  1US5 A;  1MQG A;  1MXW A;  1B1H A;  3VE1 B;  4GL0 A;  2QJE A;  1UTH B;  4P11 A;  1H3D A;  1B7Z A;  1PBQ A;  3OMB A;  1QW0 A;  4P0G A;  4MFI A;  1B40 A;  2RCB A;  2CZL A;  1MPC A;  4XKQ A;  5I58 A;  2XXW A;  4ZE9 A;  4ZEC A;  3MZ1 A;  3MBP A;  1P99 A;  3T9U A;  1BIY A;  3SEY A;  3FGS A;  1II5 A;  1R1N A;  1MH4 A;  3QUF A;  4N6P A;  2CMO A;  5I56 A;  3N6T A;  2QMW A;  2RF1 A;  3FAT A;  4H67 A;  3TQL A;  3MAM A;  5CBS A;  1MDQ A;  1MXZ A;  3KN7 A;  2DE3 A;  2H98 A;  1FQC A;  1O63 A;  4ZE8 A;  3TTN A;  5AA2 A;  3G3G A;  4BDL A;  4KCD A;  2ZYK A;  4KD5 A;  5TPA A;  3KOS A;  2V93 A;  1JQF A;  2ONK E;  2Y7P A;  1HSE A;  1MY4 A;  5L8D A;  1OLA A;  5I84 A;  2IA4 A;  1FTL A;  4PFU A;  2Z8E A;  1SBP A;  4JDF A;  1IXG A;  5CBR A;  4YB5 A;  3N6U A;  5IKB A;  2GHA A;  5JK4 A;  4OFJ A;  1ZIU A;  2XHD A;  1LAX A;  3VV5 A;  3UIF A;  4F22 A;  3E3K A;  3RN8 A;  2VP1 A;  3THI A;  2Y7W A;  3QXM A;  4GF8 A;  4RK2 A;  4OQO A;  3KJ7 A;  1BTJ A;  5F1Q A;  3HST A;  4JWO A;  4RK9 A;  3N94 A;  4XIG Q;  4H8I A;  5DVI A;  1YTV A;  4RPN A;  1B3F A;  3MUQ A;  1M5C A;  3EPE A;  4FOR A;  4IO6 A;  3TCG A;  3IR1 A;  3CR9 A;  4R9F A;  3M8U A;  4RNS A;  1B0L A;  2B3F A;  5ICT A;  1OVT A;  3G3H A;  1AL3 A;  1Q1K A;  2DVC A;  2UVJ A;  4KYD A;  2VD3 A;  3A3U A;  1ZMG A;  2DS9 A;  4G8M A;  4EF2 A;  5K2Y A;  5ITP A;  2Y7I A;  4FEC A;  3RQT A;  1SVX B;  4U1O A;  4NF8 A;  4OEU A;  3T22 A;  2I4C A;  5DYH A;  3UA8 A;  3C4M A;  3OO9 A;  4F29 A;  3C36 A;  2I49 A;  4OYV A;  1ZBM A;  1TXF A;  1N84 A;  5ISU A;  1I6Q A;  3LC8 A;  3C34 A;  3ILU B;  3Q26 A;  1PBP A;  4M1V A;  5FTI A;  2VGQ A;  3FZV A;  4AB6 A;  4U23 A;  4FIM A;  4EQ9 A;  4RPO A;  2QS4 A;  3I6V A;  2RIN A;  3PPP A;  3W9W A;  4XKR A;  2E0S A;  4L17 A;  2G93 A;  3QSL A;  2P2A A;  4H65 A;  3FXU A;  3MJN A;  1SI1 A;  3LSF B;  3TDJ A;  1GR2 A;  1ZLQ A;  1DOT A;  3LBS A;  4FE8 A;  5FHN A;  2DWH A;  4C0R A;  1USY H;  2KLF A;  3ZSF A;  3R26 A;  4PP0 A;  2F8D A;  4H5G A;  4F19 A;  2NXO A;  1L5T A;  2QS1 A;  3Q29 A;  5CMM A;  3TKD A;  1B52 A;  4G68 A;  1XC1 A;  3B6Q A;  4HW8 A;  1A55 A;  3CIJ A;  4IO4 A;  2H25 A;  3CFX A;  1QVS A;  3JV9 A;  2F78 A;  2ONS A;  4H1X A;  1S7Y A;  3O28 A;  1N3X A;  3OXN A;  1QKA A;  2QMX A;  2V3U A;  1DPP A;  4JSO A;  1MRP A;  1M5D A;  3TPA A;  4ESW A;  3UP9 A;  3BKI B;  3PU5 A;  3H06 B;  4THI A;  2A5S A;  3C32 A;  1SDX A;  1MM7 A;  3TEP A;  5I59 A;  4LUB A;  3N5L A;  1TFD A;  3H3G A;  4RY1 A;  4EDP A;  2ZYN A;  5KDT A;  1NNK A;  3MWB A;  2I0C A;  3U1O A;  1FCK A;  4KI0 E;  4QF9 A;  2O7U A;  4RA1 A;  3T66 A;  1B7H A;  4NF5 B;  4Q0C A;  3K2D A;  2REJ A;  5I2N A;  2ZNT A;  4RYA A;  3S9L C;  3CI8 A;  4X1D A;  5FTH A;  1LCF A;  3G7W A;  3TOD A;  1MY1 A;  1FQF A;  3CG3 A;  2XXV A; 
#chains in the Genus database with same CATH topology
 2XXY A;  4XEQ A;  2F36 A;  3SEX A;  1D9Y A;  4JVC A;  1B6H A;  4XF5 A;  4PBQ A;  2ZYM A;  4BDQ A;  3SES A;  1FQB A;  1Y4C A;  4IGT A;  1Y9U A;  2A5T A;  1DPE A;  2AL5 A;  3A29 A;  4LAT A;  1BLF A;  4GBW A;  4G77 A;  5AA4 A;  2XXX A;  3PPO A;  3H6V A;  4QFL A;  4POX A;  5I58 B;  4PF8 A;  1VSO A;  4F2Q A;  2QVU A;  1SW5 A;  1IMB A;  4NQ8 A;  1PB9 A;  3I5O A;  4LQ5 A;  3FAS A;  5I56 B;  5DT6 A;  2X7Q A;  5CRY A;  4AB5 A;  1MPB A;  4M4G A;  5EQ7 A;  4JBZ A;  1QUJ A;  4DXB A;  4IO3 A;  3HHF A;  5B7D A;  1YCJ A;  3D4G A;  5TPA B;  2VD2 A;  4H8J A;  5J16 A;  2HAV A;  4EXL A;  3CSG A;  4GD5 A;  2X26 A;  3TQW A;  4ND9 A;  3GZG A;  1LAG E;  4TLL B;  2R8T A;  4LZ8 A;  1LFH A;  3T9V A;  4NF6 A;  3T96 B;  3KBR A;  3KN3 A;  2OWZ A;  2HEU A;  4GVO A;  1YYZ A;  1H43 A;  2P3N A;  4X04 A;  2O69 A;  2FBP A;  4KHZ E;  3R7X A;  2ONR A;  4PE3 A;  3JYR A;  4FAJ A;  2QRY A;  2UVG A;  4OVT A;  5EHS A;  5EQ9 A;  3SEV A;  4ZEB A;  1MPD A;  2HXR A;  2PYY A;  2R6G E;  3DLN A;  4TQU Q;  4YKJ A;  4OES A;  3O66 A;  1FTA A;  3IFC A;  4OFL A;  5IZZ A;  1XOC A;  2HZL A;  4QBA A;  2OBG A;  4X1B A;  2O7I A;  1NV5 A;  1JEV A;  4PGP A;  4O7M A;  1MY3 A;  4QFO A;  2GH9 A;  4F3G A;  4PDH A;  3RTF B;  5I57 A;  4JB7 A;  4F3B A;  3TMG A;  2OCU A;  3DM0 A;  3IK6 B;  4YKK A;  2NWJ A;  4PFW A;  3PD9 A;  4GX3 A;  4E0W A;  4AQ4 A;  1EYJ A;  1US4 A;  3KG2 A;  3M3L A;  2Q89 A;  3SEW A;  3AXF A;  1NNF A;  2I4B A;  2Y84 A;  3TUS A;  3G3K A;  4U1Z A;  4YB7 A;  3TCF A;  4E0X A;  2Q88 A;  4ONY A;  4UA8 A;  2DP8 A;  1MXU A;  1MH3 A;  1KA0 A;  2O84 X;  1IUD A;  3T0J A;  3GXA A;  3IJO B;  3C35 A;  2BJJ X;  1SD3 A;  3QYT A;  2O68 A;  5IAI A;  3FVO A;  1Y4T A;  3O2A A;  4U2R A;  4MNP A;  1B5H A;  4DZ1 A;  4NF8 B;  1YXI A;  2ZMB A;  3RT6 B;  5DW8 A;  1GVC A;  3MVZ A;  2OZZ A;  1VE4 A;  4MLV A;  3CFZ A;  2ANJ A;  4ZZA A;  4Q8R A;  2OJT A;  4RXL A;  3MC2 A;  5F24 A;  5HPQ A;  1FBE A;  4GQO A;  3SET A;  5K2X A;  2HZK A;  4PCD A;  3QIM A;  4GWO A;  5H8F A;  4H6D A;  3C33 A;  1LAF E;  4R6K A;  3IOU A;  5EHM A;  3EHT A;  3RGY A;  3SKP A;  3H6U A;  5H8N A;  1EZ9 A;  1Z7N E;  5I3S A;  1P1U A;  4HE2 A;  3EHS A;  3FJM A;  1NH7 A;  4N6D A;  3LSL A;  1EU8 A;  3H6T A;  4DI3 D;  2DQV A;  5ITO A;  4O94 A;  2I3V A;  1TT1 A;  3K6X A;  4TOZ A;  5CC2 A;  2V3Q A;  2PVU A;  1KWH A;  3MP1 A;  3OEK A;  1A54 A;  2O1M A;  2XWK A;  3SEU A;  5ICQ A;  2WYK A;  2PMS A;  5DVF A;  4NAP A;  3ECR A;  1NKX A;  2XX8 A;  5ET5 A;  3RNN A;  3U94 A;  4XKP A;  2ZZW A;  2E1S A;  4QRZ A;  1B3H A;  2B3B A;  2H5Y A;  4QFK A;  3IB2 A;  3IOT A;  2ZNS A;  4MH5 A;  3Q27 A;  3U92 A;  1ZTY A;  3E78 A;  1FTK A;  4G68 B;  3IAZ A;  1QGX A;  3FVN A;  2ESN A;  3EF7 A;  3FXB A;  4LON B;  4QXD A;  4OFO A;  4WKM A;  3O9P A;  1N76 A;  4DIG A;  4LQ2 A;  2IEE A;  4DXU A;  4MBP A;  2DXY A;  1MDP 1;  4GXA A;  3WAF A;  2I48 A;  5BWJ A;  2DWJ A;  2XXH A;  4ECF A;  1TWY A;  1FQA A;  5EYF A;  2DDK A;  1K9Y A;  2X7P A;  1PC3 A;  1MQH A;  4DLD A;  2Z22 A;  4N8Y A;  4G68 C;  3PUY E;  3ROJ A;  3ONM A;  1S50 A;  2DE4 A;  3U8Q A;  3PMW A;  3EN3 A;  3FV1 A;  5IM2 A;  2I58 A;  1RDZ A;  3QK6 A;  4F1U A;  5I59 B;  1B05 A;  5JTY A;  3U72 A;  2QVV A;  1B51 A;  4R2B A;  2XD3 A;  3K02 A;  1P1Q A;  2F3B A;  1B5J A;  4N13 A;  5KDT B;  2P3V A;  2HQ0 A;  1A7L A;  4WEP A;  4OEV A;  1EH3 A;  1WVJ A;  4GWY A;  4P0I A;  1FJ6 A;  5FHM A;  4P3L A;  2R9J A;  3M3F A;  3TYH A;  1LBC A;  1B3L A;  3KGC A;  4I9D A;  4JWX A;  2Q8J A;  3TTL A;  2AL4 A;  5I2N B;  4TLM B;  3BFT A;  1O64 A;  2P1S A;  5KZT A;  4GBV A;  2I6E A;  4MCO A;  1J1N A;  4QHQ A;  2VHA A;  3OOA A;  3L6G A;  1NV2 A;  3QAX A;  1SYI A;  3UGW A;  4X9T A;  3E79 A;  1XHY A;  2REG A;  4IB2 A;  2NVU B;  1ELJ A;  4ZZE A;  4ZDM A;  3H03 A;  1QUI A;  3H7M A;  1B32 A;  4GFR A;  4ZEK A;  4GOT A;  3ILT B;  4MF3 A;  3EHU A;  4NTL A;  2A5T B;  3FXQ A;  2UYF A;  4OER A;  2OLB A;  1MXV A;  5AA4 B;  4OTE A;  1Z7M E;  1JNF A;  2QFL A;  4POW A;  5B70 A;  3PPQ A;  4HCW A;  3K01 A;  2Q9T A;  5A5X A;  3P7I A;  1JP4 A;  2AYS A;  1FJ9 A;  4OHN A;  5M2V A;  2ZNU A;  3PPR A;  2VOZ A;  3PUV E;  4EQB A;  2Q74 A;  2F35 A;  3K6U A;  3VVE A;  1IQ7 A;  1FW0 A;  4ELQ A;  4IGR A;  4IY6 A;  3B6T A;  2L5V A;  2PBW A;  3M3K A;  1B4Z A;  5TP9 A;  3V83 A;  2JJK A;  3MP8 A;  3PMX A;  1AMF A;  2Y7K A;  3W9V A;  2YLN A;  3HPI A;  3HCQ A;  4NF6 B;  1LBW A;  1NV7 A;  2Q2C A;  1XVY A;  4KYE A;  1LBX A;  3ODB A;  3IB0 A;  4QSC A;  4KPT A;  4N91 A;  4OZ9 A;  1URG A;  1H45 A;  1EYI A;  4GRK A;  5I7I A;  2THI A;  4AS5 A;  1VFD A;  2D5W A;  3B50 A;  4H5F A;  3CRB A;  1VR5 A;  3LUY A;  3QUJ A;  2RKM A;  3BFU A;  3L6H A;  3FXR A;  4F1V A;  5AA2 D;  4PFI A;  3LR1 A;  5I57 B;  3OO8 A;  2NOO A;  1IME A;  4GL8 A;  1D9V A;  1OQH A;  2V25 A;  4PE5 B;  1I6A A;  5KCJ A;  2UYE A;  5L9S A;  3G3F A;  1RDY A;  4HCY A;  1SW2 A;  4NWC A;  4PFY A;  1PB8 A;  5TU0 A;  2ZZX A;  1M5E A;  5IZ3 A;  2RC7 A;  3KC0 A;  4MNI A;  4U22 A;  1BK4 A;  4IO2 A;  4ZEF A;  3V8X B;  1LAH E;  1EZO A;  3D1R A;  1NV4 A;  2CEY A;  3F11 A;  3UOR A;  4WED A;  1A8F A;  1OIB A;  1FQD A;  2WBD A;  4BDO A;  4GXS B;  1FBC A;  4FED A;  1IIT A;  3FD3 A;  1M5F A;  1N3W A;  4ISU A;  4NWD A;  4OMB A;  4Z7E A;  4NN3 A;  1N7X A;  1MXY A;  1URS A;  3K1N A;  3B6W A;  5AA2 B;  3PUW E;  4YZZ A;  3TZA A;  4YMB A;  4FAT A;  2ZXT A;  1URD A;  4NF4 A;  3TEL A;  4F2O A;  1CNQ A;  3B8B A;  4HTG A;  3PV0 E;  4F3S A;  2O1L A;  1M5B A;  4DCX A;  3DP8 A;  2OWS A;  1BKA A;  5H8F B;  4YKI A;  4P1E A;  1QUK A;  1IXC A;  1NH8 A;  1XVX A;  1XS5 A;  3K6V A;  3UK4 A;  5L9O A;  4YIC A;  1N0T A;  2QPQ A;  4OVJ A;  5H8N B;  3KEI A;  2PFY A;  2HPG A;  4MIJ A;  4N15 A;  1NV3 A;  4GIZ A;  4I62 A;  2H9B A;  3IO4 A;  1EZP A;  5JEI A;  2DSF A;  2F7C A;  1FPG A;  3BIG A;  5J1D A;  2XD2 A;  4MX6 A;  1XT8 A;  4I3E A;  2GRV A;  3PGF A;  3LSX A;  4IR8 A;  4RJZ A;  2V3T A;  3E4R A;  4MJO A;  1FBD A;  1TFA A;  3MP6 A;  3T9X B;  1LST A;  2I0B A;  3MPK A;  3TTM A;  2D21 A;  1UIU A;  1D9Q A;  1MQD A;  4OA4 A;  4PBH A;  1B1X A;  3TAJ A;  4LZ7 A;  1FPK A;  2ABH A;  2F97 A;  4OEN A;  2XA5 A;  4KQP A;  1LFG A;  1AH5 A;  2PT2 A;  1JW4 A;  4PFB A;  4Q30 B;  1UIV A;  1DCU A;  2GFE A;  5H8H A;  4PC9 A;  4KYS A;  3RTW B;  3FV2 A;  1LEV A;  4MAG A;  3MQ9 A;  2XX9 A;  4BDN A;  1DTG A;  4MLQ A;  3WAE A;  4U4X A;  3KSJ A;  2LAO A;  5A5L A;  1GV8 A;  4P8B A;  1B5I A;  3VVD A;  3S9M C;  3LSW A;  1RYO A;  3E9X A;  4F39 A;  1B7U A;  1DMB A;  1LGB C;  4YU0 A;  4U4S A;  4NE4 A;  1NL5 A;  3A09 A;  2DVZ A;  4EXK A;  3TTK A;  3PTY A;  3IOW A;  3PMV A;  1OVB A;  1B46 A;  4ESX A;  1UTB A;  2PX1 A;  1N7W A;  4NED A;  5CM6 A;  5BUU A;  1FBP A;  5LTC A;  1QUL A;  5JTY B;  3VXC A;  1G0I A;  2ZYO A;  4O8M A;  1F9B A;  1RKM A;  3K4U A;  4KR5 A;  1ZJL A;  5CMB A;  1YAE A;  3HV1 A;  3O6G A;  1JVY A;  4YMA A;  1POY 1;  1NNP A;  1A8E A;  3DEL B;  4XTC Q;  1P1O A;  3B7D A;  2PT1 A;  4DXC A;  1VFE A;  3RYD A;  4YKP A;  4HE0 A;  2O6A A;  4LA9 A;  1SI0 A;  2DXR A;  4HS7 A;  3USD A;  1KA1 A;  5I2K A;  4G8H A;  3S9E A;  5DEX A;  4QFP A;  4OXV A;  4DCY A;  1AWB A;  1D3K A;  2QS2 A;  1IZ1 A;  1FTM A;  3OD7 A;  2D3I A;  4NF0 A;  2XXT A;  2VPO A;  3VDF A;  2BJI A;  3IB1 A;  5H8Q A;  4R74 A;  1FPD A;  3O97 A;  1YPN A;  3SDF A;  2ALU A;  3PD8 A;  1BP5 A;  3IO6 A;  4BLA A;  1T0K A;  3PUZ E;  3A3C A;  1PEB A;  4ZS9 A;  3RLF E;  3C9H A;  2WKY A;  4PET A;  4JXI A;  4PQJ A;  1LB9 A;  4R6H A;  4OAN A;  2H99 A;  4GLI A;  5FBP A;  1FPF A;  2H4I A;  1NUX A;  3IOV A;  1QJM A;  5A5X B;  4N4U A;  3KZG A;  5ESY A;  1B0H A;  2P0S A;  2DE2 A;  4G2Z A;  3OSQ A;  2FIX A;  4GWX A;  1AIV A;  3TTR A;  5IZ1 A;  1DSN A;  1PB7 A;  2OWT A;  1UTH A;  4R73 A;  4F18 A;  2F7A A;  1LBB A;  1FTO A;  4JSD A;  4KFQ A;  3HO7 A;  3U65 A;  4DI4 B;  5TP9 B;  4IO5 A;  2QL3 A;  5ET6 A;  3KJT A;  3FJ7 A;  3KBZ A;  2QS3 A;  3D4C A;  2YPN A;  3V5A A;  1JW1 A;  4F3P A;  3IX1 A;  2CZH A;  5LDZ A;  4FJP A;  3KN8 A;  3VVF A;  1POT A;  3CSB A;  2F5X A;  1B9J A;  3TCH A;  2Y7R A;  3OEN A;  3S2V A;  3V89 B;  1FQE A;  1WDN A;  2YJP A;  4YB6 A;  4HXV A;  3GLB A;  1LLS A;  1IEJ A;  2O51 A;  4MMP A;  2RC9 A;  1NV0 A;  4O7I A;  2FVZ A;  2GHB A;  3MVY A;  2UVH A;  3S4U A;  4X48 A;  4YAH X;  5DVJ A;  2XWO A;  1NUW A;  4OET A;  4G4P A;  3FVG A;  3GBB A;  1ZKB A;  3VXB A;  5KCJ B;  2Z23 A;  5F7V A;  2NUV A;  1FRP A;  2GQ1 A;  3OEM A;  1H76 A;  5IZ3 B;  4P1L A;  5DTB A;  2XXI A;  1ATG A;  2HCA A;  2XWI A;  4KCC A;  3S9N C;  3MST A;  4OVP A;  4MHF A;  4GWS A;  2OX3 A;  3DP6 A;  1VDW A;  3K6W A;  5L9M A;  1MY2 A;  1CE2 A;  2DWA A;  1O7T A;  3MVW A;  3R6U A;  1RYX A;  4PAF A;  4H0W A;  4NG7 A;  4MNC A;  5CMC A;  4QSD A;  4ZED A;  3PPN A;  2RC8 A;  3EQ1 A;  2WBB A;  2PFZ A;  3IOR A;  2OK2 A;  2V84 A;  1P1W A;  1B3E A;  4QFN A;  1UQW A;  3CFL A;  1DTZ A;  4I3Y A;  1MG1 A;  2F6P A;  2XXP A;  3RT8 A;  2XWV A;  4R75 A;  1B58 A;  3FIR A;  4NF4 B;  1Y1M A;  2M8C A;  4ELO A;  3MYU A;  2UXA A;  1IXH A;  3MZB A;  3Q25 A;  1Y3N A;  1B2H A;  4OVR A;  5EQA A;  4N81 A;  1FPB A;  2VT5 A;  2Q2A A;  2DWI A;  3K00 A;  3H6W A;  2FYI A;  3RPW A;  1PDA A;  1Y3P A;  4NX1 A;  1R6Z A;  4ELR A;  1Q35 A;  3Q28 A;  3W15 C;  3MZ9 A;  1OMP A;  1NMU A;  3FUZ A;  2WYP A;  3T93 B;  3RY3 A;  4OVS A;  2W7Y A;  3N26 A;  1GGG A;  4JVD A;  1LBY A;  3LUZ A;  1LCT A;  3HHG A;  2AIX A;  1NFT A;  4N8G A;  2FNC A;  4GWZ A;  4R6Y A;  2QSX A;  4ZEI A;  4BDM A;  1S9T A;  5ELV A;  1SW4 A;  4IO7 A;  1D4N A;  3VLU A;  2MKZ A;  4I1D A;  3FVK A;  1MQI A;  1NNT A;  1WOD A;  1SPI A;  1JW5 A;  1P1N A;  4GWU A;  3MVX A;  2HAU A;  4OWD A;  3KFM A;  1Y1Z A;  1R9L A;  4IY5 A;  2DOJ A;  4G61 A;  3OEL A;  1A99 A;  4EUO A;  3FJG A;  3H4Z A;  1MM6 A;  1ANF A;  1EYK A;  2Q8M A;  4R72 A;  3MW0 A;  5AE4 A;  4DDD A;  4XKN A;  4QSE A;  1LB8 A;  3JZJ A;  5FHO A;  3OO6 A;  1LFI A;  2G29 A;  4R9G A;  4XXU A;  2F6G A;  5H8H B;  1USY E;  5H8S A;  3OSR A;  3HN0 A;  1MXX A;  1MS7 A;  2XXR A;  4EF1 A;  2B4M A;  1ZU0 A;  4F31 B;  2XXU A;  1OQG A;  2HXW A;  3CG1 A;  2F34 A;  3C31 A;  4F1Y A;  2B4L A;  4K3F A;  1OLC A;  1R9Q A;  5AA1 A;  1KZ8 A;  1MY0 A;  1A40 A;  3MPL A;  3ZKK A;  4Z0I A;  1SYH A;  3K0V A;  4AS4 A;  3VLV A;  1SQY A;  3IL1 B;  2Z8D A;  3ZS6 A;  2HHM A;  3K1P A;  4O3B A;  5HBC A;  1UTB B;  1JVX A;  3K1M A;  1B4H A;  3VFJ A;  1I69 A;  4N6K A;  5AA3 A;  4WXJ A;  4PFR A;  5EYG A;  4Q5T A;  4ELP A;  4NMY A;  4C1T A;  1QKB A;  2KR0 A;  2Z8F A;  2XX7 A;  3PUX E;  3G3I A;  5HM4 B;  4O3C A;  1FPI A;  3E13 X;  4EQ7 A;  1HSJ A;  1G0H A;  1N04 A;  4N07 A;  4GWW A;  3O6H A;  4PFT A;  2B65 A;  1MQJ A;  2HFB A;  1FPJ A;  1IXI A;  4G8N A;  2CZI A;  4PAK A;  2CEX A;  1HSL A;  2UVI A;  3IJX B;  1Y20 A;  1JEU A;  4I8C A;  3DP4 A;  3T9H B;  3O29 A;  3T1B A;  1B3G A;  4U21 A;  3O6I A;  3G3J A;  4LP2 B;  5LOM A;  1XI6 A;  2DYX A;  2Y5L A;  5CI5 A;  1Y3Q A;  4LVQ A;  3IFA A;  2I3W A;  3CVG A;  5I2K B;  3ISP A;  5DEX B;  1YZ0 A;  2FIE A;  1GTK A;  3GBA A;  3LV0 A;  2RCA A;  5H8Q B;  3TFL A;  4BDR A;  3I3V A;  2R71 A;  3OO7 A;  4UAC A;  1SW1 A;  4LZ5 A;  3BBR A;  3FBP A;  3ZKL A;  2XXQ A;  3RUM A;  4FEB A;  3CHG A;  4R2F A;  2F7B A;  4NF5 A;  4GX6 A;  1JET A;  5CMK A;  3SER A;  4DE8 A;  3KOT A;  2FA7 A;  1CB6 A;  4JVI A;  3U93 A;  4JWY A;  4C1U A;  1H44 A;  3EKI A;  1AOV A;  3RPL A;  4O3A A;  1I6B A;  4PGN A;  1IIW A;  3KSX A;  2F3D A;  1FTJ A;  3VLW A;  2QVR A;  3KC1 A;  3UN6 A;  1US5 A;  1MQG A;  3GYY A;  1MXW A;  1FPL A;  1B1H A;  1Q9D A;  3VE1 B;  4GL0 A;  4H46 A;  5ET8 A;  2QJE A;  1UTH B;  4P11 A;  1H3D A;  2CZK A;  1B7Z A;  1PBQ A;  3OMB A;  1QW0 A;  4X8R A;  4P0G A;  4MFI A;  1B40 A;  2RCB A;  2CZL A;  1MPC A;  4KXP A;  4XKQ A;  5I58 A;  2XXW A;  5I5P A;  4ZE9 A;  4ZEC A;  4XFE A;  1IMA A;  3MZ1 A;  3MBP A;  1P99 A;  3T9U A;  1BIY A;  3SEY A;  3FGS A;  1II5 A;  1R1N A;  1MH4 A;  3QUF A;  4N6P A;  4PTK A;  2CMO A;  5I56 A;  3N6T A;  2QMW A;  2RF1 A;  3FAT A;  4H67 A;  3TQL A;  3MAM A;  5CBS A;  1MDQ A;  1MXZ A;  3KN7 A;  2DE3 A;  2H98 A;  1FQC A;  1O63 A;  4ZE8 A;  3TTN A;  5AA2 A;  3G3G A;  4BDL A;  1IMD A;  4KCD A;  2ZYK A;  4KD5 A;  5TPA A;  3KOS A;  2V93 A;  1JQF A;  2ONK E;  2WX9 A;  2Y7P A;  1FSA A;  1HSE A;  4I40 A;  1MY4 A;  5L8D A;  1OLA A;  5ET7 A;  4PF6 A;  5I84 A;  2IA4 A;  1FTL A;  4PFU A;  2Z8E A;  1SBP A;  4JDF A;  1IXG A;  5CBR A;  4YB5 A;  3N6U A;  5IKB A;  2GHA A;  5JK4 A;  4OFJ A;  1ZIU A;  2XHD A;  5EQ8 A;  4NGU A;  1LAX A;  4OVQ A;  3VV5 A;  3UIF A;  2FHY A;  4F22 A;  3E3K A;  3RN8 A;  2VP1 A;  3THI A;  2Y7W A;  3QXM A;  4GF8 A;  4RK2 A;  4OQO A;  3KJ7 A;  1BTJ A;  5F1Q A;  3HST A;  4JWO A;  4RK9 A;  3N94 A;  4XIG Q;  4H8I A;  5DVI A;  1YTV A;  4RPN A;  5EYH A;  1B3F A;  1NUZ A;  3MUQ A;  1M5C A;  3EPE A;  4FOR A;  4IO6 A;  3TCG A;  3SZP A;  1FBF A;  1FPE A;  3IR1 A;  4P47 A;  3CR9 A;  4R9F A;  3M8U A;  4RNS A;  1B0L A;  2B3F A;  5ICT A;  1OVT A;  3G3H A;  1AL3 A;  1Q1K A;  2DVC A;  2UVJ A;  2KQZ A;  4KYD A;  2VD3 A;  3A3U A;  4N17 A;  1ZMG A;  2DS9 A;  4G8M A;  4EF2 A;  5K2Y A;  5ITP A;  2Y7I A;  4FEC A;  3RQT A;  4GX4 A;  1SVX B;  4U1O A;  4NF8 A;  4OEU A;  3T22 A;  2I4C A;  5DYH A;  3UA8 A;  3C4M A;  3OO9 A;  3BIH A;  4F29 A;  3C36 A;  2I49 A;  4OYV A;  1ZBM A;  1TXF A;  1NV6 A;  4P9K A;  1N84 A;  5ISU A;  1I6Q A;  3LC8 A;  3C34 A;  3ILU B;  1NUY A;  3Q26 A;  1FBG A;  1PBP A;  3HFU A;  4M1V A;  2PCR A;  3QMF A;  5FTI A;  2VGQ A;  3FZV A;  4FBP A;  4AB6 A;  4U23 A;  4FIM A;  4EQ9 A;  4RPO A;  2QS4 A;  3I6V A;  2RIN A;  3PPP A;  3W9W A;  4XKR A;  2E0S A;  1IMC A;  4L17 A;  2G93 A;  3QSL A;  2P2A A;  1INP A;  4H65 A;  3FXU A;  3MJN A;  1SI1 A;  3LSF B;  3TDJ A;  1GR2 A;  1ZLQ A;  1DOT A;  3LBS A;  1IMF A;  4FE8 A;  5IGA A;  1NI9 A;  5FHN A;  2DWH A;  4C0R A;  1USY H;  2KLF A;  3ZSF A;  3R26 A;  4PP0 A;  2F8D A;  4H5G A;  4F19 A;  4MEV A;  2NXO A;  1L5T A;  2QS1 A;  2VPN A;  3Q29 A;  5CMM A;  3TKD A;  2Y5K A;  1B52 A;  4G68 A;  1XC1 A;  3B6Q A;  4HW8 A;  1A55 A;  3CIJ A;  4IO4 A;  2H25 A;  3CFX A;  1NV1 A;  1QVS A;  3JV9 A;  2F78 A;  5T3J A;  2ONS A;  4UAB A;  4H1X A;  1K9Z A;  1S7Y A;  3O28 A;  1N3X A;  3OXN A;  1QKA A;  2QMX A;  4HE1 A;  2V3U A;  1DPP A;  4JSO A;  1MRP A;  1M5D A;  3TPA A;  4ESW A;  3UP9 A;  2XXK A;  3NOH A;  3BKI B;  3PU5 A;  3H06 B;  4THI A;  2A5S A;  4PDD A;  1LBV A;  3C32 A;  1FBH A;  2WEF A;  1SDX A;  1MM7 A;  3TEP A;  2V4C A;  4H45 A;  5I59 A;  4LUB A;  3N5L A;  1TFD A;  3H3G A;  4PAI A;  4RY1 A;  4EDP A;  4LN5 A;  2ZYN A;  5KDT A;  1NNK A;  3MWB A;  1LBZ A;  2I0C A;  3U1O A;  1FCK A;  4KI0 E;  4QF9 A;  2O7U A;  4RA1 A;  3T66 A;  4P56 A;  4NHB A;  1B7H A;  4NF5 B;  4Q0C A;  2ZZV A;  3K2D A;  2REJ A;  5I2N A;  2ZNT A;  4RYA A;  3S9L C;  1RDX A;  3CI8 A;  4X1D A;  1DK4 A;  5FTH A;  3RPL B;  1LCF A;  3G7W A;  3TOD A;  1DBZ A;  1MY1 A;  1FQF A;  3CG3 A;  2XXV A; 
#chains in the Genus database with same CATH homology
 2XXY A;  2F36 A;  3SEX A;  1D9Y A;  1B6H A;  2ZYM A;  4BDQ A;  3SES A;  1FQB A;  1Y4C A;  4IGT A;  1Y9U A;  2A5T A;  1DPE A;  2AL5 A;  4LAT A;  1BLF A;  4G77 A;  5AA4 A;  2XXX A;  3PPO A;  3H6V A;  4QFL A;  4POX A;  5I58 B;  1VSO A;  4F2Q A;  1SW5 A;  1PB9 A;  3I5O A;  4LQ5 A;  3FAS A;  5I56 B;  5DT6 A;  2X7Q A;  5CRY A;  4AB5 A;  1MPB A;  4M4G A;  4JBZ A;  1QUJ A;  4DXB A;  4IO3 A;  3HHF A;  5B7D A;  1YCJ A;  3D4G A;  5TPA B;  2VD2 A;  4H8J A;  2HAV A;  4EXL A;  3CSG A;  4GD5 A;  2X26 A;  3TQW A;  4ND9 A;  3GZG A;  1LAG E;  4TLL B;  4LZ8 A;  1LFH A;  3T9V A;  4NF6 A;  3T96 B;  3KBR A;  3KN3 A;  2HEU A;  4GVO A;  1H43 A;  2O69 A;  3R7X A;  4KHZ E;  2ONR A;  3JYR A;  4FAJ A;  2QRY A;  2UVG A;  5EHS A;  3SEV A;  4ZEB A;  1MPD A;  2PYY A;  2R6G E;  3DLN A;  4TQU Q;  4YKJ A;  4OES A;  3O66 A;  4OFL A;  1XOC A;  2HZL A;  2OBG A;  4X1B A;  2O7I A;  1JEV A;  1MY3 A;  4QFO A;  2GH9 A;  4F3G A;  3RTF B;  5I57 A;  4JB7 A;  4F3B A;  3TMG A;  2OCU A;  3DM0 A;  3IK6 B;  4YKK A;  2NWJ A;  4PFW A;  3PD9 A;  4E0W A;  4AQ4 A;  1US4 A;  3KG2 A;  3M3L A;  2Q89 A;  3SEW A;  3AXF A;  1NNF A;  2I4B A;  2Y84 A;  3TUS A;  3G3K A;  4U1Z A;  4YB7 A;  3TCF A;  4E0X A;  2Q88 A;  4ONY A;  4UA8 A;  2DP8 A;  1MXU A;  1MH3 A;  2O84 X;  1IUD A;  3GXA A;  3IJO B;  3C35 A;  2BJJ X;  1SD3 A;  3QYT A;  2O68 A;  5IAI A;  3FVO A;  1Y4T A;  3O2A A;  4U2R A;  1B5H A;  4DZ1 A;  4NF8 B;  2ZMB A;  3RT6 B;  1GVC A;  3MVZ A;  2OZZ A;  1VE4 A;  4MLV A;  3CFZ A;  2ANJ A;  4ZZA A;  4Q8R A;  2OJT A;  4RXL A;  3MC2 A;  5HPQ A;  4GQO A;  3SET A;  5K2X A;  2HZK A;  3QIM A;  4GWO A;  5H8F A;  4H6D A;  3C33 A;  1LAF E;  4R6K A;  3IOU A;  5EHM A;  3EHT A;  3RGY A;  3SKP A;  3H6U A;  5H8N A;  1EZ9 A;  1Z7N E;  1P1U A;  3EHS A;  3FJM A;  1NH7 A;  3LSL A;  1EU8 A;  3H6T A;  2DQV A;  5ITO A;  2I3V A;  1TT1 A;  3K6X A;  4TOZ A;  5CC2 A;  2V3Q A;  2PVU A;  1KWH A;  3MP1 A;  3OEK A;  1A54 A;  2O1M A;  5ICQ A;  3SEU A;  2PMS A;  5DVF A;  3ECR A;  1NKX A;  2XX8 A;  3RNN A;  3U94 A;  4XKP A;  2E1S A;  4QRZ A;  1B3H A;  2B3B A;  2H5Y A;  4QFK A;  3IB2 A;  3IOT A;  2ZNS A;  4MH5 A;  3Q27 A;  3U92 A;  1ZTY A;  1FTK A;  4G68 B;  3IAZ A;  3FVN A;  2ESN A;  3EF7 A;  4LON B;  4OFO A;  4WKM A;  3O9P A;  1N76 A;  4DIG A;  4LQ2 A;  2IEE A;  4DXU A;  4MBP A;  2DXY A;  1MDP 1;  4GXA A;  3WAF A;  2I48 A;  5BWJ A;  2DWJ A;  2XXH A;  4ECF A;  1TWY A;  1FQA A;  5EYF A;  2X7P A;  1PC3 A;  1MQH A;  4DLD A;  2Z22 A;  4G68 C;  3PUY E;  3ONM A;  1S50 A;  2DE4 A;  3U8Q A;  3PMW A;  3EN3 A;  3FV1 A;  2I58 A;  3QK6 A;  4F1U A;  5I59 B;  1B05 A;  5JTY A;  3U72 A;  1B51 A;  4R2B A;  2XD3 A;  3K02 A;  1P1Q A;  1B5J A;  4N13 A;  5KDT B;  2HQ0 A;  1A7L A;  4WEP A;  4OEV A;  1EH3 A;  1WVJ A;  4P0I A;  5FHM A;  2R9J A;  3M3F A;  3TYH A;  1LBC A;  1B3L A;  3KGC A;  4I9D A;  4JWX A;  2Q8J A;  3TTL A;  2AL4 A;  5I2N B;  4TLM B;  3BFT A;  1O64 A;  2P1S A;  5KZT A;  2I6E A;  1J1N A;  4QHQ A;  2VHA A;  3OOA A;  3L6G A;  3QAX A;  1SYI A;  3UGW A;  4X9T A;  1XHY A;  2REG A;  4IB2 A;  2NVU B;  1ELJ A;  4ZZE A;  4ZDM A;  3H03 A;  1QUI A;  3H7M A;  1B32 A;  4GFR A;  4ZEK A;  4GOT A;  3ILT B;  4MF3 A;  3EHU A;  4NTL A;  2A5T B;  3FXQ A;  2UYF A;  4OER A;  2OLB A;  1MXV A;  5AA4 B;  4OTE A;  1Z7M E;  1JNF A;  4POW A;  5B70 A;  3PPQ A;  4HCW A;  3K01 A;  2Q9T A;  5A5X A;  3P7I A;  2AYS A;  4OHN A;  5M2V A;  2ZNU A;  3PPR A;  2VOZ A;  3PUV E;  4EQB A;  2F35 A;  3K6U A;  3VVE A;  1IQ7 A;  1FW0 A;  4ELQ A;  4IGR A;  4IY6 A;  3B6T A;  2PBW A;  3M3K A;  1B4Z A;  5TP9 A;  3V83 A;  3MP8 A;  3PMX A;  1AMF A;  2Y7K A;  3W9V A;  2YLN A;  3HPI A;  3HCQ A;  4NF6 B;  2Q2C A;  1XVY A;  4KYE A;  3ODB A;  3IB0 A;  4QSC A;  4KPT A;  4OZ9 A;  1URG A;  1H45 A;  4GRK A;  2THI A;  1VFD A;  2D5W A;  4H5F A;  3CRB A;  1VR5 A;  3LUY A;  3QUJ A;  2RKM A;  3BFU A;  3L6H A;  3FXR A;  4F1V A;  5AA2 D;  3LR1 A;  5I57 B;  3OO8 A;  2NOO A;  4GL8 A;  1D9V A;  1OQH A;  2V25 A;  4PE5 B;  1I6A A;  5KCJ A;  2UYE A;  5L9S A;  3G3F A;  4HCY A;  1SW2 A;  4NWC A;  4PFY A;  1PB8 A;  5TU0 A;  1M5E A;  2RC7 A;  4U22 A;  4IO2 A;  4ZEF A;  3V8X B;  1LAH E;  1EZO A;  3F11 A;  3UOR A;  4WED A;  1A8F A;  1OIB A;  1FQD A;  4BDO A;  4GXS B;  4FED A;  1IIT A;  3FD3 A;  1M5F A;  1N3W A;  4ISU A;  4NWD A;  4OMB A;  4Z7E A;  1N7X A;  1MXY A;  1URS A;  3K1N A;  3B6W A;  5AA2 B;  3PUW E;  4YZZ A;  3TZA A;  4YMB A;  4FAT A;  2ZXT A;  1URD A;  4NF4 A;  3TEL A;  4F2O A;  4HTG A;  3PV0 E;  4F3S A;  2O1L A;  1M5B A;  4DCX A;  3DP8 A;  2OWS A;  1BKA A;  5H8F B;  4YKI A;  1QUK A;  1IXC A;  1NH8 A;  1XVX A;  1XS5 A;  3K6V A;  3UK4 A;  5L9O A;  4YIC A;  1N0T A;  2QPQ A;  4OVJ A;  5H8N B;  3KEI A;  4GIZ A;  4I62 A;  2H9B A;  3IO4 A;  1EZP A;  5JEI A;  2DSF A;  2F7C A;  5J1D A;  2XD2 A;  1XT8 A;  2GRV A;  3PGF A;  3LSX A;  4RJZ A;  2V3T A;  3E4R A;  1TFA A;  3MP6 A;  3T9X B;  1LST A;  2I0B A;  3MPK A;  3TTM A;  2D21 A;  1UIU A;  1MQD A;  1B1X A;  3TAJ A;  4LZ7 A;  2ABH A;  2F97 A;  4OEN A;  4KQP A;  1LFG A;  1AH5 A;  2PT2 A;  1JW4 A;  4Q30 B;  1UIV A;  2GFE A;  5H8H A;  4KYS A;  3RTW B;  3FV2 A;  3MQ9 A;  2XX9 A;  4BDN A;  1DTG A;  4MLQ A;  3WAE A;  4U4X A;  3KSJ A;  2LAO A;  1GV8 A;  3VVD A;  1B5I A;  3S9M C;  3LSW A;  1RYO A;  3E9X A;  4F39 A;  1B7U A;  1DMB A;  1LGB C;  4YU0 A;  4U4S A;  4NE4 A;  1NL5 A;  3A09 A;  2DVZ A;  4EXK A;  3TTK A;  3IOW A;  3PMV A;  1OVB A;  1B46 A;  4ESX A;  1UTB A;  2PX1 A;  1N7W A;  4NED A;  5CM6 A;  5BUU A;  1QUL A;  5JTY B;  3VXC A;  2ZYO A;  1F9B A;  1RKM A;  3K4U A;  4KR5 A;  1ZJL A;  5CMB A;  1YAE A;  3HV1 A;  3O6G A;  1JVY A;  4YMA A;  1POY 1;  1NNP A;  1A8E A;  3DEL B;  4XTC Q;  1P1O A;  3B7D A;  2PT1 A;  4DXC A;  1VFE A;  4YKP A;  2O6A A;  4LA9 A;  1SI0 A;  2DXR A;  4HS7 A;  3USD A;  5I2K A;  4G8H A;  3S9E A;  5DEX A;  4QFP A;  4OXV A;  4DCY A;  1D3K A;  2QS2 A;  1IZ1 A;  1FTM A;  3OD7 A;  2D3I A;  2XXT A;  3VDF A;  3IB1 A;  5H8Q A;  4R74 A;  3O97 A;  1YPN A;  3SDF A;  2ALU A;  3PD8 A;  1BP5 A;  4BLA A;  3IO6 A;  1T0K A;  3PUZ E;  3A3C A;  1PEB A;  4ZS9 A;  3RLF E;  3C9H A;  2WKY A;  4PET A;  4JXI A;  4PQJ A;  1LB9 A;  4R6H A;  2H99 A;  4GLI A;  2H4I A;  3IOV A;  1QJM A;  5A5X B;  3KZG A;  1B0H A;  2P0S A;  2DE2 A;  4G2Z A;  3OSQ A;  1AIV A;  3TTR A;  1DSN A;  1PB7 A;  2OWT A;  1UTH A;  4R73 A;  4F18 A;  2F7A A;  1LBB A;  1FTO A;  4JSD A;  4KFQ A;  3HO7 A;  5TP9 B;  4IO5 A;  2QL3 A;  3KJT A;  3FJ7 A;  2QS3 A;  3D4C A;  2YPN A;  3V5A A;  1JW1 A;  4F3P A;  3IX1 A;  4FJP A;  3KN8 A;  3VVF A;  1POT A;  3CSB A;  2F5X A;  1B9J A;  3TCH A;  2Y7R A;  3OEN A;  3S2V A;  3V89 B;  1FQE A;  1WDN A;  2YJP A;  4YB6 A;  3GLB A;  1LLS A;  1IEJ A;  2O51 A;  2RC9 A;  2GHB A;  3MVY A;  2UVH A;  3S4U A;  4X48 A;  4YAH X;  5DVJ A;  4OET A;  4G4P A;  3FVG A;  3GBB A;  1ZKB A;  3VXB A;  5KCJ B;  2Z23 A;  5F7V A;  2NUV A;  3OEM A;  1H76 A;  5DTB A;  2XXI A;  1ATG A;  2HCA A;  3S9N C;  4KCC A;  3DP6 A;  3K6W A;  5L9M A;  1MY2 A;  1CE2 A;  2DWA A;  1O7T A;  3MVW A;  3R6U A;  1RYX A;  4H0W A;  5CMC A;  4QSD A;  4ZED A;  3PPN A;  2RC8 A;  3EQ1 A;  3IOR A;  2OK2 A;  2V84 A;  1P1W A;  1B3E A;  4QFN A;  1UQW A;  3CFL A;  1DTZ A;  1MG1 A;  2F6P A;  2XXP A;  3RT8 A;  4R75 A;  1B58 A;  3FIR A;  4NF4 B;  1Y1M A;  2M8C A;  4ELO A;  2UXA A;  1IXH A;  3MZB A;  3Q25 A;  1Y3N A;  1B2H A;  2Q2A A;  2DWI A;  3K00 A;  3H6W A;  2FYI A;  3RPW A;  1PDA A;  1Y3P A;  1R6Z A;  4ELR A;  1Q35 A;  3Q28 A;  3W15 C;  3MZ9 A;  1OMP A;  1NMU A;  3FUZ A;  3T93 B;  3RY3 A;  2W7Y A;  3N26 A;  1GGG A;  1LCT A;  3HHG A;  2AIX A;  1NFT A;  2FNC A;  4R6Y A;  2QSX A;  4ZEI A;  4BDM A;  1S9T A;  5ELV A;  1SW4 A;  4IO7 A;  1D4N A;  3VLU A;  4I1D A;  3FVK A;  1MQI A;  1NNT A;  1WOD A;  1JW5 A;  1P1N A;  3MVX A;  2HAU A;  4OWD A;  3KFM A;  1Y1Z A;  1R9L A;  4IY5 A;  2DOJ A;  3OEL A;  1A99 A;  4EUO A;  3FJG A;  3H4Z A;  1MM6 A;  1ANF A;  4R72 A;  3MW0 A;  5AE4 A;  4DDD A;  4XKN A;  4QSE A;  1LB8 A;  3JZJ A;  5FHO A;  3OO6 A;  1LFI A;  2G29 A;  4R9G A;  4XXU A;  2F6G A;  5H8H B;  1USY E;  5H8S A;  3OSR A;  3HN0 A;  1MXX A;  1MS7 A;  2XXR A;  4EF1 A;  1ZU0 A;  4F31 B;  2XXU A;  1OQG A;  2HXW A;  3CG1 A;  2F34 A;  3C31 A;  4F1Y A;  4K3F A;  1OLC A;  1R9Q A;  5AA1 A;  1MY0 A;  1A40 A;  3MPL A;  3ZKK A;  4Z0I A;  1SYH A;  3K0V A;  3VLV A;  1SQY A;  3IL1 B;  2Z8D A;  3ZS6 A;  3K1P A;  4O3B A;  5HBC A;  1UTB B;  1JVX A;  3K1M A;  1B4H A;  3VFJ A;  1I69 A;  5AA3 A;  4WXJ A;  4Q5T A;  4ELP A;  4NMY A;  4C1T A;  1QKB A;  2Z8F A;  2XX7 A;  3PUX E;  3G3I A;  5HM4 B;  4O3C A;  3E13 X;  4EQ7 A;  1HSJ A;  1N04 A;  4N07 A;  3O6H A;  4PFT A;  2B65 A;  1MQJ A;  2HFB A;  1IXI A;  4G8N A;  1HSL A;  2UVI A;  3IJX B;  1Y20 A;  1JEU A;  4I8C A;  3DP4 A;  3T9H B;  3O29 A;  1B3G A;  4U21 A;  3O6I A;  3G3J A;  4LP2 B;  5LOM A;  2DYX A;  5CI5 A;  1Y3Q A;  4LVQ A;  2I3W A;  3CVG A;  5I2K B;  5DEX B;  1GTK A;  3GBA A;  2RCA A;  4BDR A;  5H8Q B;  3TFL A;  3I3V A;  2R71 A;  3OO7 A;  4UAC A;  1SW1 A;  4LZ5 A;  3BBR A;  3ZKL A;  2XXQ A;  3RUM A;  4FEB A;  4R2F A;  2F7B A;  4NF5 A;  1JET A;  5CMK A;  3SER A;  4DE8 A;  3KOT A;  2FA7 A;  1CB6 A;  3U93 A;  4JWY A;  4C1U A;  1H44 A;  1AOV A;  4O3A A;  1I6B A;  1IIW A;  3KSX A;  1FTJ A;  3VLW A;  3UN6 A;  1US5 A;  1MQG A;  1MXW A;  1B1H A;  3VE1 B;  4GL0 A;  2QJE A;  1UTH B;  4P11 A;  1H3D A;  1B7Z A;  1PBQ A;  3OMB A;  1QW0 A;  4P0G A;  4MFI A;  1B40 A;  2RCB A;  2CZL A;  1MPC A;  4XKQ A;  5I58 A;  2XXW A;  4ZE9 A;  4ZEC A;  3MZ1 A;  3MBP A;  1P99 A;  3T9U A;  1BIY A;  3SEY A;  3FGS A;  1II5 A;  1R1N A;  1MH4 A;  3QUF A;  4N6P A;  2CMO A;  5I56 A;  3N6T A;  2QMW A;  2RF1 A;  3FAT A;  4H67 A;  3TQL A;  3MAM A;  5CBS A;  1MDQ A;  1MXZ A;  3KN7 A;  2DE3 A;  2H98 A;  1FQC A;  1O63 A;  4ZE8 A;  3TTN A;  5AA2 A;  3G3G A;  4BDL A;  4KCD A;  2ZYK A;  4KD5 A;  5TPA A;  3KOS A;  2V93 A;  1JQF A;  2ONK E;  2Y7P A;  1HSE A;  1MY4 A;  5L8D A;  1OLA A;  5I84 A;  2IA4 A;  1FTL A;  4PFU A;  2Z8E A;  1SBP A;  4JDF A;  1IXG A;  5CBR A;  4YB5 A;  3N6U A;  5IKB A;  2GHA A;  5JK4 A;  4OFJ A;  1ZIU A;  2XHD A;  1LAX A;  3VV5 A;  3UIF A;  4F22 A;  3E3K A;  3RN8 A;  2VP1 A;  3THI A;  2Y7W A;  3QXM A;  4GF8 A;  4RK2 A;  4OQO A;  3KJ7 A;  1BTJ A;  5F1Q A;  3HST A;  4JWO A;  4RK9 A;  3N94 A;  4XIG Q;  4H8I A;  5DVI A;  1YTV A;  4RPN A;  1B3F A;  3MUQ A;  1M5C A;  3EPE A;  4FOR A;  4IO6 A;  3TCG A;  3IR1 A;  3CR9 A;  4R9F A;  3M8U A;  4RNS A;  1B0L A;  2B3F A;  5ICT A;  1OVT A;  3G3H A;  1AL3 A;  1Q1K A;  2DVC A;  2UVJ A;  4KYD A;  2VD3 A;  3A3U A;  1ZMG A;  2DS9 A;  4G8M A;  4EF2 A;  5K2Y A;  5ITP A;  2Y7I A;  4FEC A;  3RQT A;  1SVX B;  4U1O A;  4NF8 A;  4OEU A;  3T22 A;  2I4C A;  5DYH A;  3UA8 A;  3C4M A;  3OO9 A;  4F29 A;  3C36 A;  2I49 A;  4OYV A;  1ZBM A;  1TXF A;  1N84 A;  5ISU A;  1I6Q A;  3LC8 A;  3C34 A;  3ILU B;  3Q26 A;  1PBP A;  4M1V A;  5FTI A;  2VGQ A;  3FZV A;  4AB6 A;  4U23 A;  4FIM A;  4EQ9 A;  4RPO A;  2QS4 A;  3I6V A;  2RIN A;  3PPP A;  3W9W A;  4XKR A;  2E0S A;  4L17 A;  2G93 A;  3QSL A;  2P2A A;  4H65 A;  3FXU A;  3MJN A;  1SI1 A;  3LSF B;  3TDJ A;  1GR2 A;  1ZLQ A;  1DOT A;  3LBS A;  4FE8 A;  5FHN A;  2DWH A;  4C0R A;  1USY H;  2KLF A;  3ZSF A;  3R26 A;  4PP0 A;  2F8D A;  4H5G A;  4F19 A;  2NXO A;  1L5T A;  2QS1 A;  3Q29 A;  5CMM A;  3TKD A;  1B52 A;  4G68 A;  1XC1 A;  3B6Q A;  4HW8 A;  1A55 A;  3CIJ A;  4IO4 A;  2H25 A;  3CFX A;  1QVS A;  3JV9 A;  2F78 A;  2ONS A;  4H1X A;  1S7Y A;  3O28 A;  1N3X A;  3OXN A;  1QKA A;  2QMX A;  2V3U A;  1DPP A;  4JSO A;  1MRP A;  1M5D A;  3TPA A;  4ESW A;  3UP9 A;  3BKI B;  3PU5 A;  3H06 B;  4THI A;  2A5S A;  3C32 A;  1SDX A;  1MM7 A;  3TEP A;  5I59 A;  4LUB A;  3N5L A;  1TFD A;  3H3G A;  4RY1 A;  4EDP A;  2ZYN A;  5KDT A;  1NNK A;  3MWB A;  2I0C A;  3U1O A;  1FCK A;  4KI0 E;  4QF9 A;  2O7U A;  4RA1 A;  3T66 A;  1B7H A;  4NF5 B;  4Q0C A;  3K2D A;  2REJ A;  5I2N A;  2ZNT A;  4RYA A;  3S9L C;  3CI8 A;  4X1D A;  5FTH A;  1LCF A;  3G7W A;  3TOD A;  1MY1 A;  1FQF A;  3CG3 A;  2XXV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...