2O69A

Crystal structure of haemophilus influenzae n193l mutant fbpa
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALILNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
publication title The role of the synergistic phosphate anion in iron transport by the periplasmic iron-binding protein from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 111
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o69A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o69A02
1IQ7A 3OO6A 2GHBA 2O7IA 3IOUA 2ESNA 5I84A 4P0GA 4LONB 2AL4A 4UACA 3MC2A 4FORA 1WODA 1NNKA 4GF8A 3W15C 3I5OA 2ZYNA 1OLCA 4YB7A 4JDFA 2IEEA 4DCXA 4H1XA 2VD3A 3OO7A 4FE8A 3VDFA 4ZEDA 5AA2A 3S9MC 4RPOA 4L17A 2O1MA 4QFLA 2DWIA 2PMSA 3EQ1A 4IO7A 4H6DA 1PBQA 1LBCA 4OHNA 1OQHA 3IOVA 3WAFA 3OEMA 1OVTA 4KR5A 2P2AA 3TTMA 2REJA 2ZNUA 4KYEA 1AH5A 5TU0A 1DSNA 1FQBA 4Q30B 4YU0A 1QW0A 5DEXA 4H8IA 2DXYA 2I6EA 3T9VA 1LFGA 2F6PA 1H3DA 3K00A 4RYAA 4ESXA 3RTFB 4AQ4A 1JW1A 3U1OA 2I58A 2NUVA 4JBZA 3KN8A 3LC8A 2O1LA 2QS2A 2B65A 2QRYA 5CM6A 1FQFA 5ITPA 1IIWA 4TQUQ 4LUBA 1B0HA 4EQBA 1B2HA 3CG3A 2Y7WA 3P7IA 3RQTA 4M1VA 3B7DA 1QKAA 3HN0A 3Q28A 3PV0E 5CI5A 4OWDA 3L6GA 5AA1A 2ZMBA 1N7XA 1BKAA 1T0KA 1FTKA 5F1QA 3E3KA 3HSTA 1XT8A 3PUZE 3FVOA 2DWJA 3IO4A 5I57B 4FEBA 4OMBA 3FUZA 1Y1ZA 2O84X 3SEVA 3SERA 3JYRA 4QF9A 4YKPA 1PEBA 1ZIUA 4FATA 4IY5A 1N3WA 3EHTA 3PUYE 3TCHA 2HQ0A 2OWTA 1MY1A 1LBBA 1GV8A 3Q27A 1VFDA 4GLIA 1MH4A 1OQGA 1DPPA 4IGTA 4NF8B 2XXRA 2UYFA 1A7LA 4PFYA 3T9UA 5I59B 2RC9A 2VGQA 3FV1A 5HPQA 3SETA 2F78A 4ZEIA 3RY3A 3Q29A 4ELRA 1VR5A 2NWJA 3CFLA 1QULA 1JEVA 5EYFA 2FYIA 1O63A 3MZ1A 1R6ZA 3FVGA 1XOCA 1R1NA 4QHQA 3U93A 4U22A 2OJTA 4G4PA 3N26A 1USYH 1NNTA 1MQHA 4ZE9A 4U23A 2F7BA 5I57A 2Y7IA 4H5FA 1H43A 2XX8A 1XVXA 4Q0CA 4ZZEA 4I9DA 4R6YA 2I0CA 1LGBC 4GVOA 1B0LA 2X26A 2B3BA 3B6QA 3G3HA 2YLNA 4G2ZA 3PMWA 4G8MA 2XXWA 3W9WA 4F1UA 5HM4B 3RT8A 3FJGA 4F3GA 2DS9A 3V8XB 4OENA 1QJMA 4ZEKA 5I59A 2DSFA 4JSOA 4KQPA 3KBRA 4RPNA 3HPIA 4R73A 3TTLA 2XHDA 4F1YA 3TUSA 2OK2A 1N04A 3K02A 4BDRA 5H8NB 2FA7A 4C1TA 1Y4TA 4BDMA 1B46A 2V84A 3SKPA 3SEUA 4QSDA 3BBRA 1TFAA 5CMKA 5L9MA 2O6AA 1SW1A 2PX1A 2F8DA 2G29A 5FHOA 3TTRA 3TELA 5LOMA 3FASA 2QL3A 2VHAA 3T96B 1URGA 3L6HA 1H44A 1Y4CA 4ZDMA 3MQ9A 4RY1A 4LZ7A 2AL5A 4H8JA 4RA1A 4DXBA 1B5IA 2CMOA 3C36A 3C35A 2HEUA 3PPPA 3LR1A 4IO2A 5FTHA 2E0SA 1JETA 2QS4A 2O51A 1LCFA 3LSWA 4DXUA 4JWXA 4NTLA 3LSXA 1NNFA 1EZOA 2VOZA 2A5TB 1USYE 1VFEA 3C4MA 1D4NA 1MXUA 1POY1 2IA4A 1B05A 1H45A 2O69A 4OFOA 3KFMA 3EF7A 3OXNA 1JVXA 3HO7A 3GBBA 1OMPA 1QVSA 3O66A 3PD8A 4G68B 5H8QB 4NF6B 3CVGA 1US4A 3MP1A 4QFPA 1UIVA 3VLUA 3E13X 4HW8A 1SBPA 3TCFA 2UVJA 4XXUA 5ICQA 2GHAA 4NF4A 4OVJA 5H8HB 3KGCA 1AOVA 1B3LA 4LQ5A 1D9VA 5ELVA 4C1UA 1PB9A 2F7CA 5TP9B 3V5AA 4ESWA 3TDJA 3VVEA 1JQFA 1FQCA 1US5A 3QAXA 3HV1A 4ONYA 4ECFA 1IUDA 3IB0A 1IZ1A 3HHFA 1QUKA 1BTJA 1DPEA 4HCYA 2B3FA 4LQ2A 2DE2A 1FW0A 3T9HB 5I2KB 3RNNA 1IXGA 2ZNSA 4EQ9A 2P1SA 3TEPA 3FXUA 1RYXA 5CMBA 3R7XA 4P11A 1WVJA 1MM6A 3A3CA 1SYHA 4ELPA 4MLQA 4BDQA 4F39A 3QSLA 2VD2A 3D4CA 4NMYA 4GXSB 4YICA 4OETA 2A5TA 2D21A 3ZS6A 3TFLA 4IO3A 4DZ1A 2HXWA 2V3QA 2I4CA 4QSCA 4GOTA 5DYHA 2HCAA 3SESA 1GTKA 3HHGA 1N3XA 1Y3PA 1MXVA 5A5XB 3TODA 4OTEA 4FAJA 2Q2CA 3V83A 1LCTA 1LAXA 4H0WA 1LFIA 4YKJA 4XKQA 3MP6A 4G68A 4ELOA 1P1UA 1HSJA 2F7AA 2DVZA 3MUQA 4JSDA 3KJ7A 1Y9UA 4K3FA 2OLBA 3KSJA 3LSLA 3OSRA 5H8HA 4RNSA 4IGRA 5ITOA 3OO9A 1FTJA 3IL1B 3KEIA 3V89B 1OLAA 1ZTYA 1FQAA 4F19A 1PBPA 3OD7A 1SW2A 1FQDA 3QUFA 4PFUA 3TMGA 3GLBA 2QS1A 2HFBA 4KCCA 2D3IA 3K0VA 2H9BA 1CB6A 1MXWA 1PB7A 3IAZA 3BFUA 5J1DA 4NWCA 1HSEA 1IEJA 1S50A 2Z22A 2PYYA 2Z8DA 1UTHB 5CMCA 3QXMA 3TQWA 1AL3A 4LA9A 3ZSFA 5CMMA 1NL5A 4ZE8A 1MXXA 3E4RA 3K1MA 3O28A 3DM0A 1ZJLA 3HCQA 3UN6A 4R74A 3PUWE 2F6GA 3C33A 1MXYA 2XXXA 4GFRA 2Y7RA 3EHSA 4Z7EA 2XXTA 5FHMA 3O6GA 4MF3A 3SEXA 4MBPA 4EF1A 4BDNA 5I58B 3MZ9A 1O64A 4TLLB 3VVFA 5B7DA 2YJPA 3MP8A 4EXKA 4NEDA 3S9EA 5F7VA 4MLVA 4RXLA 3G3FA 1S9TA 4EXLA 2E1SA 1Z7ME 3SDFA 3THIA 3K6WA 4POWA 3CSGA 2Z23A 1F9BA 1FTLA 3KOSA 5H8SA 2PT2A 1MQDA 4GWOA 1ZKBA 3QK6A 3H6TA 4NE4A 3H03A 5KCJB 5KDTB 2XXVA 3USDA 3ZKKA 4KD5A 4JWOA 2OWSA 3DP8A 2W7YA 4GL8A 1NKXA 1YAEA 3MAMA 4DDDA 1TXFA 1M5EA 2AIXA 4XKRA 3G3GA 2Y7PA 3MVYA 1B1XA 1B40A 4FEDA 1UTHA 4LZ5A 1N76A 5DTBA 4F29A 1LLSA 4XTCQ 4HS7A 4TLMB 3FV2A 5BWJA 2HZKA 4HCWA 1N84A 4U4XA 3R6UA 4NF5B 1MQGA 2V25A 4IO6A 3KSXA 2BJJX 1GR2A 1QKBA 1NMUA 1SYIA 5DVFA 4EF2A 1A40A 4H65A 5H8FB 2R71A 4PFWA 4O3AA 1M5BA 2XD3A 1IITA 2ANJA 3U72A 5I58A 4UA8A 2DE3A 3BKIB 2OZZA 2QJEA 2ZXTA 3FGSA 2KLFA 3EHUA 3PPNA 4LP2B 4R75A 5K2YA 3UK4A 1MM7A 3G7WA 2Y84A 3OOAA 3FVKA 2PBWA 5L9SA 3QUJA 4G77A 3K4UA 5CRYA 3U8QA 3CFZA 1IXCA 4WEPA 1MXZA 3U92A 1DMBA 4C0RA 5KDTA 3T93B 3ODBA 4OEUA 2GFEA 1Q1KA 1II5A 1QUJA 1Y3QA 1UTBB 1D9YA 4U21A 4YB5A 3OENA 4PE5B 3DP4A 3CFXA 2UVHA 3CSBA 2O7UA 2ALUA 4OFLA 1R9LA 1N7WA 4I8CA 3LSFB 4NF8A 3RUMA 1XHYA 1P1OA 3PPQA 1CE2A 4YB6A 2ZYOA 3CR9A 1JW4A 2Q8JA 1BLFA 3MVXA 2Z8EA 4F2QA 1ZMGA 3CRBA 3TTNA 5KZTA 4Q5TA 4QFOA 4GD5A 3ONMA 4F3PA 5IAIA 4DLDA 2ZYMA 3C31A 4XKNA 1WDNA 5JEIA 3DP6A 3EN3A 5H8FA 2VP1A 3Q25A 4ZS9A 1A8EA 3MWBA 3S4UA 2HZLA 2RKMA 2NOOA 1ANFA 1FTOA 1PDAA 2I3VA 3C9HA 2FNCA 4G68C 1A55A 4GIZA 4KHZE 4ELQA 3H6UA 3PMXA 3H3GA 5TPAB 3ILTB 3IO6A 3KJTA 4EDPA 3UA8A 4WXJA 1B6HA 4QFKA 2F36A 2QSXA 1IXHA 4NWDA 3H06B 3C32A 3IJXB 5FHNA 3FVNA 4BLAA 2XD2A 3IK6B 4LVQA 3O9PA 3PU5A 1BIYA 4O3CA 1LAFE 1L5TA 5L9OA 2G93A 4DCYA 2ONKE 2RINA 1MH3A 1B4HA 3OO8A 3G3KA 3CIJA 1UTBA 3PPRA 4IO5A 2XXQA 4Z0IA 3TKDA 4F3SA 5CC2A 3B6TA 3I6VA 1MY3A 1NFTA 4IB2A 3WAEA 1A54A 2I0BA 4X48A 4F1VA 2PT1A 3DLNA 1NH8A 1RYOA 3TPAA 5M2VA 2F97A 4DIGA 3TTKA 2M8CA 5EHSA 5H8NA 4DXCA 2YPNA 3AXFA 1LFHA 2F34A 3ZKLA 3QIMA 1B58A 1MPCA 1NH7A 1GGGA 1MPDA 3N5LA 4OQOA 4PQJA 3A09A 1FTMA 3FJ7A 2NVUB 5CBSA 4MFIA 3H6VA 2PVUA 2H5YA 3N6UA 3RGYA 3M8UA 1Y20A 1UQWA 3EPEA 2F35A 1VE4A 5TPAA 3IORA 3VLVA 5AE4A 5CBRA 2DP8A 4F31B 3C34A 3O97A 4PP0A 3N94A 3SEWA 2DVCA 4R72A 1D3KA 3M3FA 3RPWA 3OMBA 4H67A 2QPQA 3S2VA 1JW5A 3B6WA 4THIA 3FD3A 5AA2D 3IJOB 4RJZA 3KG2A 2F5XA 1I69A 2LAOA 4XKPA 2DWAA 5H8QA 1DTGA 2D5WA 4NF6A 2DOJA 3N6TA 3W9VA 1BP5A 2NXOA 5L8DA 3FZVA 2THIA 1J1NA 4X1BA 1B7HA 4R9FA 3SEYA 1B1HA 1LB9A 3MVWA 4H5GA 3GBAA 1GVCA 1M5CA 1I6QA 3GXAA 1URDA 4BDLA 4OESA 4LZ8A 4DE8A 3H4ZA 5TP9A 3TYHA 1MDQA 1B3FA 1N0TA 1P1QA 4ZEBA 3FXQA 1LB8A 1KWHA 3BFTA 1Q35A 4OFJA 3IB1A 5I2KA 3O2AA 3K2DA 3ECRA 3PD9A 4KCDA 1JNFA 1Z7NE 1S7YA 3T66A 1YCJA 4KYSA 2ONSA 3O29A 2XX7A 3T22A 2ABHA 3D4GA 3LBSA 2HAVA 4WKMA 3IB2A 4FIMA 1XC1A 2I48A 1ELJA 2WKYA 4OXVA 3ILUB 5DVJA 5A5XA 4ND9A 5I56B 1POTA 3RN8A 1TWYA 2CZLA 1OIBA 2UYEA 4LATA 4RK9A 1MQJA 5ICTA 2H4IA 3O6IA 1MDP1 1HSLA 4WEDA 3KOTA 1FCKA 5BUUA 2GRVA 4YAHX 3LUYA 3QYTA 3TAJA 1QUIA 3MPKA 2H25A 1RKMA 1EZ9A 2RCBA 3MBPA 4PETA 5B70A 3K6UA 4R6KA 1AIVA 3KN7A 3VLWA 1DTZA 4N13A 1PB8A 5DVIA 2ZYKA 2A5SA 3KZGA 3JV9A 5JTYB 1B5HA 2XXUA 4JXIA 4M4GA 2REGA 5DT6A 1MY2A 3K1PA 4XIGQ 2Y7KA 4FJPA 3G3IA 1OVBA 2V93A 5IKBA 3IOWA 3VXBA 1LAGE 2I3WA 1MPBA 4EQ7A 4F3BA 1NNPA 3CG1A 1YPNA 1A99A 1I6AA 2Z8FA 4E0XA 1IXIA 4ZECA 5AA3A 2QS3A 4OYVA 4AB5A 2XXIA 4X9TA 5I56A 3TZAA 1B4ZA 3RLFE 1URSA 1R9QA 4GRKA 3K1NA 4U2RA 5EHMA 1SI0A 4I62A 4TOZA 4R2FA 2GH9A 1JEUA 2UVIA 2DE4A 1JVYA 4YKKA 3DELB 5KCJA 2V3UA 3M3KA 4N6PA 1Y3NA 2QMXA 4F22A 1SD3A 1XS5A 3U94A 2Q88A 1AMFA 4X1DA 2OBGA 4GXAA 2RC7A 3K6VA 3CI8A 3RT6B 1SVXB 2I4BA 2HAUA 4JB7A 1SI1A 1P1NA 3IX1A 1ZBMA 3MZBA 1SQYA 4R2BA 3UIFA 1ZLQA 3VE1B 3UORA 4I1DA 2X7PA 4NF5A 5JTYA 4RK2A 5JK4A 4YMAA 1B3EA 4OERA 2P0SA 3Q26A 4AB6A 5AA4B 1H76A 2Q89A 4OZ9A 3PUVE 1SW4A 1I6BA 4P0IA 4NF4B 3PMVA 1EH3A 4R6HA 1B9JA 2DXRA 3MPLA 1MS7A 2OCUA 2R9JA 4FECA 1PC3A 4KYDA 2H98A 4ZEFA 4JWYA 1B32A 1P1WA 4KPTA 1MQIA 2QMWA 3RTWB 5I2NB 1FQEA 4G8HA 1XVYA 2DWHA 3MJNA 3E9XA 1LAHE 4ZZAA 3FJMA 2V3TA 3K01A 1VSOA 2R6GE 1EU8A 3A3UA 1ZU0A 1TT1A 1B3GA 2ONRA 2RCAA 2DQVA 1P99A 4GL0A 2XXYA 2RC8A 1MG1A 3VXCA 1UIUA 1YTVA 3I3VA 3H6WA 4YKIA 5HBCA 3TCGA 4KI0E 4BDOA 4F2OA 5FTIA 4ISUA 4EUOA 1EZPA 1B7UA 4N07A 3VVDA 1B3HA 1Y1MA 3FATA 3IOTA 1MY4A 2ZNTA 1DOTA 4KFQA 2UVGA 1A8FA 4U1ZA 1SDXA 2X7QA 1B51A 3FXRA 3KN3A 4R9GA 3MW0A 5AA2B 5AA4A 2RF1A 4GQOA 1TFDA 1ATGA 4E0WA 1B5JA 3H7MA 3PGFA 4OEVA 4MH5A 3O6HA 3PPOA 4U1OA 1B52A 1MRPA 5K2XA 3IR1A 1B7ZA 2XX9A 4IO4A 4U4SA 4YZZA 4QRZA 4G8NA 1M5DA 4QFNA 2AYSA 1O7TA 3K6XA 5I2NA 2XXHA 3M3LA 5DEXB 1MY0A 3S9NC 2XXPA 4QSEA 2I49A 4YMBA 2O68A 4HTGA 4F18A 4Q8RA 4O3BA 3FIRA 1M5FA 2Q2AA 2H99A 2Q9TA 4IY6A 1SW5A 2UXAA 3OEKA 3VFJA 4POXA 3MVZA 5ISUA 3S9LC 2DYXA 1LSTA 3OSQA 3GZGA 3TQLA 3VV5A 3OELA 3T9XB 4PFTA 3JZJA 3R26A 3UGWA 3G3JA 3F11A 3PUXE 3UP9A
chains in the Genus database with same CATH superfamily
1IQ7A 2PFYA 2GQ1A 3OO6A 2GHBA 4O7IA 2O7IA 3IOUA 2ESNA 5I84A 4P0GA 4LONB 2AL4A 4UACA 4MIJA 3MC2A 4FORA 1WODA 4AS5A 1NNKA 4GF8A 3W15C 3I5OA 2ZYNA 5EQ9A 1NI9A 1OLCA 4YB7A 4JDFA 4GWXA 1EYIA 2IEEA 3HFUA 4DCXA 4H1XA 4OVQA 1RDYA 2VD3A 2MKZA 3OO7A 4FE8A 3VDFA 4ZEDA 5AA2A 4P1EA 3S9MC 4RPOA 4L17A 2O1MA 4QFLA 2DWIA 2OWZA 4JVDA 2FIXA 2PMSA 3EQ1A 4IO7A 4H6DA 1PBQA 1LBCA 4OHNA 1OQHA 3IOVA 3WAFA 3OEMA 1OVTA 4KR5A 2P2AA 3TTMA 2REJA 4MHFA 2ZNUA 4KYEA 1AH5A 5TU0A 1DSNA 1FQBA 4Q30B 4OVSA 2OX3A 4YU0A 1QW0A 5DEXA 4H8IA 2DXYA 2I6EA 3T9VA 1LFGA 2F6PA 1H3DA 3K00A 4UABA 4RYAA 4ESXA 3RTFB 4AQ4A 1JW1A 3U1OA 2I58A 2NUVA 4JBZA 3KN8A 3LC8A 2O1LA 2QS2A 2B65A 2QRYA 3FBPA 5CM6A 5ET5A 1FQFA 5ITPA 1IIWA 4OVRA 4TQUQ 4N15A 4LUBA 1B0HA 4EQBA 1B2HA 4PBHA 3CG3A 2QVVA 2Y7WA 3P7IA 3RQTA 2HHMA 4M1VA 3B7DA 1QKAA 3HN0A 3Q28A 3E79A 3PV0E 3E78A 5CI5A 4OWDA 3L6GA 5AA1A 2ZMBA 1N7XA 1BKAA 4P8BA 1T0KA 2FHYA 1FTKA 4N4UA 5F1QA 3E3KA 3HSTA 4XFEA 1KA0A 1XT8A 3PUZE 5EQ8A 3FVOA 2DWJA 3IO4A 5I57B 4FEBA 4OMBA 3FUZA 1Y1ZA 2O84X 3SEVA 3SERA 5J16A 3JYRA 4QF9A 4YKPA 4MJOA 1PEBA 1ZIUA 4FATA 4IY5A 1N3WA 3EHTA 4LN5A 3PUYE 4H45A 3TCHA 2HQ0A 2OWTA 1MY1A 1LBBA 1GV8A 3Q27A 2B4MA 1VFDA 2HPGA 4GLIA 1MH4A 1OQGA 1DPPA 4GWSA 4IGTA 4NF8B 2XXRA 2UYFA 1A7LA 4PFYA 3T9UA 5I59B 2RC9A 2VGQA 1VDWA 2WX9A 3FV1A 4PF6A 5HPQA 3SETA 2F78A 2VPOA 4ZEIA 3RY3A 3Q29A 2Y5LA 4ELRA 1VR5A 3QMFA 2NWJA 3CFLA 1QULA 4OVTA 1JEVA 5EYFA 2FYIA 3B50A 1O63A 3MZ1A 1R6ZA 4I3YA 3FVGA 1XOCA 4OANA 1NUZA 1R1NA 4QHQA 3U93A 4U22A 2OJTA 4G4PA 1BK4A 3N26A 1USYH 1Q9DA 1NNTA 1MQHA 4ZE9A 1SPIA 1FPBA 4U23A 2F7BA 5I57A 2Y7IA 4H5FA 4X04A 1H43A 2XX8A 1XVXA 4Q0CA 4ZZEA 4I9DA 4R6YA 5LTCA 2KR0A 2I0CA 4MEVA 1LGBC 4GVOA 1B0LA 5IGAA 2X26A 2B3BA 3B6QA 3G3HA 2YLNA 4G2ZA 3PMWA 4G8MA 2XXWA 3W9WA 4F1UA 5HM4B 3RT8A 3FJGA 4F3GA 2DS9A 3V8XB 4OENA 1QJMA 1FBCA 2FIEA 4ZEKA 5I59A 2DSFA 4JSOA 4MNIA 4NGUA 4KQPA 3KBRA 4RPNA 3HPIA 4R73A 3TTLA 1IMEA 2XHDA 4F1YA 3TUSA 2QVUA 2OK2A 1FPGA 1N04A 3K02A 4BDRA 5H8NB 1FPEA 2FA7A 4C1TA 1Y4TA 4BDMA 1B46A 2V84A 3SKPA 3SEUA 4QSDA 1JP4A 3BBRA 2JJKA 1TFAA 5CMKA 4QBAA 5L9MA 2O6AA 1SW1A 2PX1A 2F3BA 2F8DA 2G29A 1G0HA 5FHOA 3TTRA 3TELA 5LOMA 3FASA 3IFAA 4NG7A 3NOHA 2QL3A 2VHAA 3T96B 1URGA 3L6HA 1H44A 1QGXA 1Y4CA 4ZDMA 3MQ9A 2L5VA 4RY1A 4LZ7A 4MAGA 2AL5A 2PFZA 3SZPA 4H8JA 3RYDA 1RDZA 4NQ8A 4RA1A 4DXBA 1B5IA 2CMOA 3C36A 3C35A 2HEUA 3PPPA 3LR1A 4IO2A 4PAIA 5FTHA 2E0SA 4GWWA 1JETA 2QS4A 2XWKA 2O51A 1LCFA 3LSWA 4DXUA 4JWXA 4NTLA 3LSXA 1NNFA 1EZOA 3FXBA 2VOZA 2A5TB 1USYE 4MX6A 2V4CA 1VFEA 3C4MA 1D4NA 3GYYA 1MXUA 1POY1 2IA4A 1B05A 1H45A 2O69A 4OFOA 3KFMA 3EF7A 3OXNA 1JVXA 4N8GA 2XWIA 3HO7A 3GBBA 1OMPA 1QVSA 4PFBA 3O66A 3PD8A 4G68B 5H8QB 4NF6B 3CVGA 1YXIA 1US4A 3MP1A 4QFPA 1UIVA 3VLUA 3E13X 4HW8A 1NV6A 1SBPA 3TCFA 2UVJA 4XXUA 5ICQA 2GHAA 4NF4A 4OVJA 5H8HB 3KGCA 1AOVA 1B3LA 4LQ5A 1D9VA 5ELVA 4C1UA 3MYUA 1FPDA 1PB9A 2F7CA 5TP9B 2BJIA 3V5AA 4ESWA 2FBPA 4JVCA 3TDJA 1FBFA 3VVEA 1JQFA 1FQCA 1US5A 3QAXA 3HV1A 4ONYA 4ECFA 1IUDA 3IB0A 3CHGA 1IZ1A 3HHFA 1QUKA 1BTJA 1DPEA 4HCYA 4LQ2A 2B3FA 3LV0A 4GWYA 2DE2A 1FSAA 5ET7A 2CEYA 1FW0A 3T9HB 5I2KB 3RNNA 1IXGA 2ZNSA 4EQ9A 2P1SA 5EYHA 3TEPA 3FXUA 1RYXA 5CMBA 3R7XA 4P11A 1WVJA 1MM6A 3A3CA 1SYHA 1FPFA 4ELPA 4MLQA 4BDQA 4F39A 4MCOA 3QSLA 2VD2A 3D4CA 1LBVA 4NMYA 4GXSB 4YICA 4OETA 2A5TA 4N81A 2D21A 4O94A 3ZS6A 3TFLA 4IO3A 4DZ1A 2HXWA 4PGNA 2V3QA 2I4CA 1LBXA 4QSCA 4GOTA 5DYHA 2HCAA 3SESA 2CZKA 1GTKA 3HHGA 1N3XA 1Y3PA 1MXVA 5A5XB 3TODA 4OTEA 4FAJA 2Q2CA 3V83A 1LCTA 1LAXA 4H0WA 1LFIA 4YKJA 4XKQA 3MP6A 4G68A 4ELOA 1P1UA 1HSJA 2F7AA 2DVZA 3MUQA 4JSDA 3KJ7A 1Y9UA 4K3FA 5LDZA 2OLBA 3KSJA 3ROJA 3LSLA 3OSRA 5H8HA 4RNSA 4IGRA 5ITOA 3OO9A 1FTJA 3IL1B 3KEIA 3V89B 5IZ3B 1OLAA 1ZTYA 1FQAA 4F19A 1PBPA 3OD7A 1SW2A 1FQDA 3QUFA 4PFUA 3TMGA 3GLBA 2QS1A 2HFBA 4KCCA 2D3IA 3K0VA 2H9BA 1CB6A 1MXWA 1PB7A 3IAZA 3BFUA 2B4LA 5J1DA 4NWCA 1HSEA 1IEJA 1S50A 2Z22A 5I3SA 2PYYA 2Z8DA 1UTHB 5CMCA 3QXMA 4X8RA 3TQWA 1AL3A 4LA9A 3ZSFA 1FJ6A 5CMMA 1NL5A 4ZE8A 1MXXA 3E4RA 3K1MA 3O28A 3DM0A 1ZJLA 3HCQA 3UN6A 4R74A 3PUWE 2F6GA 3C33A 4PAKA 1MXYA 1IMAA 2XXXA 4OVPA 4GFRA 2Y7RA 3EHSA 3PTYA 4Z7EA 2XXTA 5FHMA 3O6GA 1FPJA 4MF3A 3SEXA 4MBPA 4EF1A 4BDNA 5I58B 1CNQA 3MZ9A 1DK4A 1O64A 4TLLB 3VVFA 2XA5A 5B7DA 2YJPA 3MP8A 4EXKA 4NEDA 3S9EA 5F7VA 4MLVA 1NV0A 4RXLA 3G3FA 1S9TA 4EXLA 2E1SA 1Z7ME 3SDFA 3THIA 2WBDA 3K6WA 4POWA 3CSGA 2Z23A 1F9BA 5I5PA 1FTLA 3KOSA 5H8SA 2PT2A 1MQDA 4GWOA 1ZKBA 2VPNA 4PCDA 3QK6A 4G61A 3H6TA 4NE4A 3H03A 5KCJB 5KDTB 2XXVA 3USDA 3ZKKA 2Y5KA 4KD5A 1K9ZA 4JWOA 5EYGA 2OWSA 3DP8A 2W7YA 4GL8A 1NKXA 1YAEA 3MAMA 4DDDA 1TXFA 1M5EA 2AIXA 4XKRA 3G3GA 2Y7PA 3MVYA 3LUZA 1B1XA 1B40A 4FEDA 1UTHA 4P1LA 4LZ5A 1N76A 5DTBA 4F29A 1LLSA 4XTCQ 4HS7A 4TLMB 3FV2A 2CZIA 5BWJA 4GX6A 2HZKA 2R8TA 4HCWA 1N84A 4U4XA 3R6UA 4NF5B 1MQGA 2V25A 4IO6A 3KSXA 2BJJX 1QKBA 1GR2A 1NMUA 1SYIA 5DVFA 4EF2A 1A40A 4H65A 5H8FB 2R71A 4PFWA 4O3AA 1M5BA 3A29A 2XD3A 1IITA 2ANJA 3U72A 5I58A 4UA8A 4XF5A 2DE3A 3BKIB 2OZZA 2QJEA 4H46A 2ZXTA 3FGSA 2KLFA 3EHUA 4PF8A 3PPNA 4LP2B 4R75A 5K2YA 2PCRA 3UK4A 3BIGA 1MM7A 3G7WA 2Y84A 3OOAA 3FVKA 2PBWA 1G0IA 5L9SA 3QUJA 4G77A 3K4UA 5CRYA 4FBPA 3U8QA 3CFZA 1IXCA 4WEPA 1MXZA 3U92A 1DMBA 1NUWA 4C0RA 5KDTA 3T93B 3ODBA 3U65A 4OEUA 2GFEA 1Q1KA 1II5A 1QUJA 1Y3QA 1UTBB 1D9YA 4U21A 4YB5A 3OENA 4PE5B 3DP4A 3CFXA 2UVHA 3CSBA 5IM2A 2O7UA 4NX1A 2ALUA 4OFLA 1R9LA 1N7WA 4I8CA 3LSFB 4NF8A 3RUMA 1XHYA 1P1OA 3PPQA 1CE2A 4YB6A 1KA1A 2ZYOA 3CR9A 4N17A 1NV3A 1JW4A 2Q8JA 1BLFA 3MVXA 2Z8EA 4F2QA 5EQ7A 1ZMGA 3CRBA 3TTNA 5KZTA 4Q5TA 4QFOA 4GD5A 3ONMA 4F3PA 5IAIA 4HXVA 4DLDA 4I40A 2ZYMA 3C31A 4XKNA 1WDNA 2ZZXA 5JEIA 3DP6A 3EN3A 3T1BA 5H8FA 2VP1A 1IMDA 3Q25A 4I3EA 4ZS9A 1A8EA 3MWBA 3S4UA 2HZLA 2RKMA 2NOOA 1ANFA 1IMBA 1FTOA 1PDAA 5F24A 2I3VA 3C9HA 4O7MA 2FNCA 4G68C 1A55A 4GIZA 1NV7A 1NV4A 4KHZE 4ELQA 3H6UA 3PMXA 3H3GA 5TPAB 2CEXA 2DDKA 3ILTB 3IO6A 3KJTA 4EDPA 3UA8A 4WXJA 1B6HA 4QFKA 2F36A 2QSXA 1IXHA 4NWDA 3H06B 3C32A 3IJXB 5FHNA 3FVNA 4BLAA 2XD2A 3IK6B 4GWZA 4LVQA 3O9PA 3PU5A 1BIYA 4O3CA 1LAFE 1L5TA 2QVRA 5L9OA 2G93A 2WBBA 4DCYA 2ONKE 2RINA 3MSTA 4PGPA 1MH3A 2ZZWA 4PDDA 1B4HA 3OO8A 3G3KA 3CIJA 1UTBA 3PPRA 4IO5A 2XXQA 4Z0IA 4OA4A 3TKDA 4F3SA 1XI6A 5CC2A 3B6TA 3I6VA 1LEVA 1MY3A 1IMCA 1NFTA 4IB2A 3WAEA 4IR8A 1A54A 1FBPA 2I0BA 4X48A 4F1VA 2PT1A 3DLNA 3D1RA 1NH8A 1RYOA 3TPAA 1FPLA 5M2VA 2F97A 4DIGA 3TTKA 2M8CA 5EHSA 5H8NA 4DXCA 2YPNA 4MNCA 3AXFA 1LFHA 4NHBA 2F34A 3ZKLA 3QIMA 1B58A 1MPCA 1FJ9A 1NH7A 1GGGA 1MPDA 3N5LA 4OQOA 3IFCA 4PQJA 3A09A 1FTMA 3FJ7A 4PTKA 2NVUB 5CBSA 4MFIA 3H6VA 2PVUA 2H5YA 3N6UA 3RGYA 3M8UA 1Y20A 1UQWA 3EPEA 4PBQA 3KBZA 2F35A 1VE4A 5TPAA 4MNPA 4PAFA 3IORA 3VLVA 5AE4A 5CBRA 4N6KA 1LBYA 2DP8A 4NN3A 4F31B 3C34A 3O97A 4P56A 4PP0A 3N94A 3SEWA 2DVCA 4R72A 1D3KA 3M3FA 3RPWA 3OMBA 4AS4A 4H67A 2QPQA 4DI3D 3S2VA 1JW5A 3B6WA 4THIA 3FD3A 5AA2D 3IJOB 4RJZA 3KG2A 1FBDA 1NV2A 2F5XA 1I69A 1AWBA 5FBPA 2LAOA 4XKPA 2DWAA 1NUYA 5H8QA 1DTGA 2D5WA 4NF6A 2DOJA 3N6TA 3W9VA 1BP5A 2NXOA 5L8DA 3FZVA 2THIA 1J1NA 4X1BA 1B7HA 4R9FA 3SEYA 1B1HA 1LB9A 3MVWA 4H5GA 3GBAA 1GVCA 1M5CA 1I6QA 3GXAA 1URDA 4BDLA 4OESA 4LZ8A 4DE8A 3H4ZA 5TP9A 5I7IA 3TYHA 1MDQA 1B3FA 1N0TA 4N91A 1P1QA 4ZEBA 3FXQA 1LB8A 1KWHA 5T3JA 3BFTA 1Q35A 4OFJA 2XWVA 3IB1A 5I2KA 3RPLB 3O2AA 3K2DA 2P3NA 3EKIA 3ECRA 3PD9A 5EQAA 4KCDA 1JNFA 1RDXA 4MMPA 1Z7NE 1S7YA 3T66A 1YCJA 4KYSA 1IMFA 2ONSA 2XXKA 3O29A 2XX7A 1YZ0A 2QFLA 4P3LA 5ET8A 3T22A 2ABHA 3D4GA 3LBSA 2HAVA 4WKMA 3IB2A 4FIMA 1XC1A 2I48A 1ELJA 2WKYA 4OXVA 3ILUB 5DVJA 5A5XA 1FPKA 4ND9A 5I56B 5DW8A 1POTA 3RN8A 1TWYA 2CZLA 1OIBA 2XWOA 2UYEA 4NF0A 4LATA 4RK9A 1MQJA 5ICTA 2H4IA 1DBZA 2F3DA 3O6IA 1MDP1 1HSLA 5IZ3A 4WEDA 3KOTA 1FCKA 4P9KA 5BUUA 2GRVA 4YAHX 3LUYA 3QYTA 4PDHA 3TAJA 1QUIA 4P47A 3MPKA 2H25A 1RKMA 1EZ9A 2RCBA 3MBPA 4HE1A 1FBEA 4PETA 2VT5A 3K6UA 5B70A 4R6KA 1INPA 1AIVA 3KN7A 3VLWA 2WYKA 5ET6A 1DTZA 4N13A 1PB8A 5DVIA 2ZYKA 4NAPA 3RPLA 2A5SA 3KZGA 4GWUA 3JV9A 5JTYB 1B5HA 2XXUA 4XEQA 4JXIA 4O8MA 4M4GA 4PFRA 4GBVA 4N8YA 2REGA 5DT6A 1MY2A 3K1PA 4XIGQ 2Y7KA 4FJPA 3G3IA 1OVBA 2V93A 5IKBA 3IOWA 3VXBA 1LAGE 2I3WA 1MPBA 4N6DA 4EQ7A 2P3VA 4F3BA 1NNPA 3CG1A 1YPNA 4PE3A 1A99A 1I6AA 2Z8FA 4E0XA 1IXIA 4ZECA 5AA3A 2QS3A 4OYVA 4AB5A 2XXIA 4X9TA 5I56A 3TZAA 1B4ZA 3RLFE 5IZ1A 1URSA 1R9QA 4GRKA 3K1NA 4U2RA 1D9QA 5EHMA 2KQZA 1SI0A 4I62A 4TOZA 4R2FA 2GH9A 4GX4A 1JEUA 1FBHA 1YYZA 2UVIA 1FPIA 2DE4A 1JVYA 4YKKA 3DELB 5KCJA 1LBWA 2V3UA 3M3KA 4N6PA 1Y3NA 2QMXA 4F22A 1SD3A 1XS5A 3U94A 2Q88A 2WEFA 1AMFA 1K9YA 4X1DA 2OBGA 3T0JA 4GXAA 2RC7A 3K6VA 3ISPA 3CI8A 3RT6B 1SVXB 2I4BA 2HAUA 3B8BA 4JB7A 1SI1A 1P1NA 3IX1A 1ZBMA 3MZBA 1SQYA 1DCUA 4R2BA 2FVZA 3UIFA 1ZLQA 3VE1B 3UORA 4I1DA 2X7PA 4NF5A 5JTYA 4RK2A 5JK4A 4YMAA 1B3EA 4OERA 2P0SA 3Q26A 4AB6A 5AA4B 4GX3A 1H76A 2Q89A 4OZ9A 3PUVE 1SW4A 1I6BA 4P0IA 4NF4B 3KC1A 3PMVA 1EH3A 4R6HA 1B9JA 2DXRA 3MPLA 1MS7A 2OCUA 2R9JA 4KXPA 4FECA 1PC3A 4JVIA 4KYDA 2H98A 4ZEFA 4JWYA 1B32A 1P1WA 4KPTA 1MQIA 2QMWA 5IZZA 3RTWB 5I2NB 2HXRA 1FQEA 1NV5A 4G8HA 1XVYA 2DWHA 3MJNA 3E9XA 1LAHE 4DI4B 4ZZAA 3FJMA 2V3TA 3K01A 1LBZA 2Q74A 1VSOA 2R6GE 1EU8A 3A3UA 1ZU0A 1TT1A 1B3GA 2ONRA 2RCAA 2DQVA 1P99A 4GBWA 4GL0A 2XXYA 2RC8A 4HE0A 1MG1A 3VXCA 1UIUA 1NV1A 1FBGA 1YTVA 3I3VA 3H6WA 4YKIA 5HBCA 3TCGA 4KI0E 4BDOA 4F2OA 5FTIA 4ISUA 4EUOA 1FTAA 1EZPA 1B7UA 4N07A 3VVDA 1B3HA 1Y1MA 3FATA 3IOTA 1MY4A 2ZNTA 4QXDA 4PFIA 1DOTA 4KFQA 2UVGA 1A8FA 4U1ZA 1SDXA 2X7QA 1B51A 3FXRA 3KN3A 4R9GA 3MW0A 5A5LA 5AA2B 4HE2A 5AA4A 2RF1A 4GQOA 1TFDA 4PC9A 1ATGA 4E0WA 1B5JA 3H7MA 3PGFA 4OEVA 4MH5A 3O6HA 3PPOA 4U1OA 1B52A 1MRPA 5K2XA 3IR1A 1B7ZA 2XX9A 4IO4A 4U4SA 2CZHA 4YZZA 4QRZA 4G8NA 1M5DA 4QFNA 2AYSA 1O7TA 3K6XA 1FRPA 3BIHA 5I2NA 2Q8MA 2XXHA 3M3LA 5DEXB 1MY0A 3S9NC 2XXPA 3KC0A 4QSEA 2I49A 4YMBA 2O68A 4HTGA 4F18A 4Q8RA 4O3BA 3FIRA 1M5FA 2Q2AA 2H99A 2Q9TA 4IY6A 1SW5A 2UXAA 3OEKA 3VFJA 4POXA 5ESYA 3MVZA 2ZZVA 5ISUA 3S9LC 2WYPA 1KZ8A 2DYXA 1LSTA 3OSQA 3GZGA 1NUXA 1EYKA 1EYJA 3TQLA 3VV5A 3OELA 3T9XB 4PFTA 3JZJA 3R26A 3UGWA 3G3JA 3F11A 3PUXE 3UP9A
chains in the Genus database with same CATH topology
1IQ7A 3OO6A 2GHBA 2O7IA 3IOUA 2ESNA 5I84A 4P0GA 4LONB 2AL4A 4UACA 3MC2A 4FORA 1WODA 1NNKA 4GF8A 3W15C 3I5OA 2ZYNA 1OLCA 4YB7A 4JDFA 2IEEA 4DCXA 4H1XA 2VD3A 3OO7A 4FE8A 3VDFA 4ZEDA 5AA2A 3S9MC 4RPOA 4L17A 2O1MA 4QFLA 2DWIA 2PMSA 3EQ1A 4IO7A 4H6DA 1PBQA 1LBCA 4OHNA 1OQHA 3IOVA 3WAFA 3OEMA 1OVTA 4KR5A 2P2AA 3TTMA 2REJA 2ZNUA 4KYEA 1AH5A 5TU0A 1DSNA 1FQBA 4Q30B 4YU0A 1QW0A 5DEXA 4H8IA 2DXYA 2I6EA 3T9VA 1LFGA 2F6PA 1H3DA 3K00A 4RYAA 4ESXA 3RTFB 4AQ4A 1JW1A 3U1OA 2I58A 2NUVA 4JBZA 3KN8A 3LC8A 2O1LA 2QS2A 2B65A 2QRYA 5CM6A 1FQFA 5ITPA 1IIWA 4TQUQ 4LUBA 1B0HA 4EQBA 1B2HA 3CG3A 2Y7WA 3P7IA 3RQTA 4M1VA 3B7DA 1QKAA 3HN0A 3Q28A 3PV0E 5CI5A 4OWDA 3L6GA 5AA1A 2ZMBA 1N7XA 1BKAA 1T0KA 1FTKA 5F1QA 3E3KA 3HSTA 1XT8A 3PUZE 3FVOA 2DWJA 3IO4A 5I57B 4FEBA 4OMBA 3FUZA 1Y1ZA 2O84X 3SEVA 3SERA 3JYRA 4QF9A 4YKPA 1PEBA 1ZIUA 4FATA 4IY5A 1N3WA 3EHTA 3PUYE 3TCHA 2HQ0A 2OWTA 1MY1A 1LBBA 1GV8A 3Q27A 1VFDA 4GLIA 1MH4A 1OQGA 1DPPA 4IGTA 4NF8B 2XXRA 2UYFA 1A7LA 4PFYA 3T9UA 5I59B 2RC9A 2VGQA 3FV1A 5HPQA 3SETA 2F78A 4ZEIA 3RY3A 3Q29A 4ELRA 1VR5A 2NWJA 3CFLA 1QULA 1JEVA 5EYFA 2FYIA 1O63A 3MZ1A 1R6ZA 3FVGA 1XOCA 1R1NA 4QHQA 3U93A 4U22A 2OJTA 4G4PA 3N26A 1USYH 1NNTA 1MQHA 4ZE9A 4U23A 2F7BA 5I57A 2Y7IA 4H5FA 1H43A 2XX8A 1XVXA 4Q0CA 4ZZEA 4I9DA 4R6YA 2I0CA 1LGBC 4GVOA 1B0LA 2X26A 2B3BA 3B6QA 3G3HA 2YLNA 4G2ZA 3PMWA 4G8MA 2XXWA 3W9WA 4F1UA 5HM4B 3RT8A 3FJGA 4F3GA 2DS9A 3V8XB 4OENA 1QJMA 4ZEKA 5I59A 2DSFA 4JSOA 4KQPA 3KBRA 4RPNA 3HPIA 4R73A 3TTLA 2XHDA 4F1YA 3TUSA 2OK2A 1N04A 3K02A 4BDRA 5H8NB 2FA7A 4C1TA 1Y4TA 4BDMA 1B46A 2V84A 3SKPA 3SEUA 4QSDA 3BBRA 1TFAA 5CMKA 5L9MA 2O6AA 1SW1A 2PX1A 2F8DA 2G29A 5FHOA 3TTRA 3TELA 5LOMA 3FASA 2QL3A 2VHAA 3T96B 1URGA 3L6HA 1H44A 1Y4CA 4ZDMA 3MQ9A 4RY1A 4LZ7A 2AL5A 4H8JA 4RA1A 4DXBA 1B5IA 2CMOA 3C36A 3C35A 2HEUA 3PPPA 3LR1A 4IO2A 5FTHA 2E0SA 1JETA 2QS4A 2O51A 1LCFA 3LSWA 4DXUA 4JWXA 4NTLA 3LSXA 1NNFA 1EZOA 2VOZA 2A5TB 1USYE 1VFEA 3C4MA 1D4NA 1MXUA 1POY1 2IA4A 1B05A 1H45A 2O69A 4OFOA 3KFMA 3EF7A 3OXNA 1JVXA 3HO7A 3GBBA 1OMPA 1QVSA 3O66A 3PD8A 4G68B 5H8QB 4NF6B 3CVGA 1US4A 3MP1A 4QFPA 1UIVA 3VLUA 3E13X 4HW8A 1SBPA 3TCFA 2UVJA 4XXUA 5ICQA 2GHAA 4NF4A 4OVJA 5H8HB 3KGCA 1AOVA 1B3LA 4LQ5A 1D9VA 5ELVA 4C1UA 1PB9A 2F7CA 5TP9B 3V5AA 4ESWA 3TDJA 3VVEA 1JQFA 1FQCA 1US5A 3QAXA 3HV1A 4ONYA 4ECFA 1IUDA 3IB0A 1IZ1A 3HHFA 1QUKA 1BTJA 1DPEA 4HCYA 2B3FA 4LQ2A 2DE2A 1FW0A 3T9HB 5I2KB 3RNNA 1IXGA 2ZNSA 4EQ9A 2P1SA 3TEPA 3FXUA 1RYXA 5CMBA 3R7XA 4P11A 1WVJA 1MM6A 3A3CA 1SYHA 4ELPA 4MLQA 4BDQA 4F39A 3QSLA 2VD2A 3D4CA 4NMYA 4GXSB 4YICA 4OETA 2A5TA 2D21A 3ZS6A 3TFLA 4IO3A 4DZ1A 2HXWA 2V3QA 2I4CA 4QSCA 4GOTA 5DYHA 2HCAA 3SESA 1GTKA 3HHGA 1N3XA 1Y3PA 1MXVA 5A5XB 3TODA 4OTEA 4FAJA 2Q2CA 3V83A 1LCTA 1LAXA 4H0WA 1LFIA 4YKJA 4XKQA 3MP6A 4G68A 4ELOA 1P1UA 1HSJA 2F7AA 2DVZA 3MUQA 4JSDA 3KJ7A 1Y9UA 4K3FA 2OLBA 3KSJA 3LSLA 3OSRA 5H8HA 4RNSA 4IGRA 5ITOA 3OO9A 1FTJA 3IL1B 3KEIA 3V89B 1OLAA 1ZTYA 1FQAA 4F19A 1PBPA 3OD7A 1SW2A 1FQDA 3QUFA 4PFUA 3TMGA 3GLBA 2QS1A 2HFBA 4KCCA 2D3IA 3K0VA 2H9BA 1CB6A 1MXWA 1PB7A 3IAZA 3BFUA 5J1DA 4NWCA 1HSEA 1IEJA 1S50A 2Z22A 2PYYA 2Z8DA 1UTHB 5CMCA 3QXMA 3TQWA 1AL3A 4LA9A 3ZSFA 5CMMA 1NL5A 4ZE8A 1MXXA 3E4RA 3K1MA 3O28A 3DM0A 1ZJLA 3HCQA 3UN6A 4R74A 3PUWE 2F6GA 3C33A 1MXYA 2XXXA 4GFRA 2Y7RA 3EHSA 4Z7EA 2XXTA 5FHMA 3O6GA 4MF3A 3SEXA 4MBPA 4EF1A 4BDNA 5I58B 3MZ9A 1O64A 4TLLB 3VVFA 5B7DA 2YJPA 3MP8A 4EXKA 4NEDA 3S9EA 5F7VA 4MLVA 4RXLA 3G3FA 1S9TA 4EXLA 2E1SA 1Z7ME 3SDFA 3THIA 3K6WA 4POWA 3CSGA 2Z23A 1F9BA 1FTLA 3KOSA 5H8SA 2PT2A 1MQDA 4GWOA 1ZKBA 3QK6A 3H6TA 4NE4A 3H03A 5KCJB 5KDTB 2XXVA 3USDA 3ZKKA 4KD5A 4JWOA 2OWSA 3DP8A 2W7YA 4GL8A 1NKXA 1YAEA 3MAMA 4DDDA 1TXFA 1M5EA 2AIXA 4XKRA 3G3GA 2Y7PA 3MVYA 1B1XA 1B40A 4FEDA 1UTHA 4LZ5A 1N76A 5DTBA 4F29A 1LLSA 4XTCQ 4HS7A 4TLMB 3FV2A 5BWJA 2HZKA 4HCWA 1N84A 4U4XA 3R6UA 4NF5B 1MQGA 2V25A 4IO6A 3KSXA 2BJJX 1GR2A 1QKBA 1NMUA 1SYIA 5DVFA 4EF2A 1A40A 4H65A 5H8FB 2R71A 4PFWA 4O3AA 1M5BA 2XD3A 1IITA 2ANJA 3U72A 5I58A 4UA8A 2DE3A 3BKIB 2OZZA 2QJEA 2ZXTA 3FGSA 2KLFA 3EHUA 3PPNA 4LP2B 4R75A 5K2YA 3UK4A 1MM7A 3G7WA 2Y84A 3OOAA 3FVKA 2PBWA 5L9SA 3QUJA 4G77A 3K4UA 5CRYA 3U8QA 3CFZA 1IXCA 4WEPA 1MXZA 3U92A 1DMBA 4C0RA 5KDTA 3T93B 3ODBA 4OEUA 2GFEA 1Q1KA 1II5A 1QUJA 1Y3QA 1UTBB 1D9YA 4U21A 4YB5A 3OENA 4PE5B 3DP4A 3CFXA 2UVHA 3CSBA 2O7UA 2ALUA 4OFLA 1R9LA 1N7WA 4I8CA 3LSFB 4NF8A 3RUMA 1XHYA 1P1OA 3PPQA 1CE2A 4YB6A 2ZYOA 3CR9A 1JW4A 2Q8JA 1BLFA 3MVXA 2Z8EA 4F2QA 1ZMGA 3CRBA 3TTNA 5KZTA 4Q5TA 4QFOA 4GD5A 3ONMA 4F3PA 5IAIA 4DLDA 2ZYMA 3C31A 4XKNA 1WDNA 5JEIA 3DP6A 3EN3A 5H8FA 2VP1A 3Q25A 4ZS9A 1A8EA 3MWBA 3S4UA 2HZLA 2RKMA 2NOOA 1ANFA 1FTOA 1PDAA 2I3VA 3C9HA 2FNCA 4G68C 1A55A 4GIZA 4KHZE 4ELQA 3H6UA 3PMXA 3H3GA 5TPAB 3ILTB 3IO6A 3KJTA 4EDPA 3UA8A 4WXJA 1B6HA 4QFKA 2F36A 2QSXA 1IXHA 4NWDA 3H06B 3C32A 3IJXB 5FHNA 3FVNA 4BLAA 2XD2A 3IK6B 4LVQA 3O9PA 3PU5A 1BIYA 4O3CA 1LAFE 1L5TA 5L9OA 2G93A 4DCYA 2ONKE 2RINA 1MH3A 1B4HA 3OO8A 3G3KA 3CIJA 1UTBA 3PPRA 4IO5A 2XXQA 4Z0IA 3TKDA 4F3SA 5CC2A 3B6TA 3I6VA 1MY3A 1NFTA 4IB2A 3WAEA 1A54A 2I0BA 4X48A 4F1VA 2PT1A 3DLNA 1NH8A 1RYOA 3TPAA 5M2VA 2F97A 4DIGA 3TTKA 2M8CA 5EHSA 5H8NA 4DXCA 2YPNA 3AXFA 1LFHA 2F34A 3ZKLA 3QIMA 1B58A 1MPCA 1NH7A 1GGGA 1MPDA 3N5LA 4OQOA 4PQJA 3A09A 1FTMA 3FJ7A 2NVUB 5CBSA 4MFIA 3H6VA 2PVUA 2H5YA 3N6UA 3RGYA 3M8UA 1Y20A 1UQWA 3EPEA 2F35A 1VE4A 5TPAA 3IORA 3VLVA 5AE4A 5CBRA 2DP8A 4F31B 3C34A 3O97A 4PP0A 3N94A 3SEWA 2DVCA 4R72A 1D3KA 3M3FA 3RPWA 3OMBA 4H67A 2QPQA 3S2VA 1JW5A 3B6WA 4THIA 3FD3A 5AA2D 3IJOB 4RJZA 3KG2A 2F5XA 1I69A 2LAOA 4XKPA 2DWAA 5H8QA 1DTGA 2D5WA 4NF6A 2DOJA 3N6TA 3W9VA 1BP5A 2NXOA 5L8DA 3FZVA 2THIA 1J1NA 4X1BA 1B7HA 4R9FA 3SEYA 1B1HA 1LB9A 3MVWA 4H5GA 3GBAA 1GVCA 1M5CA 1I6QA 3GXAA 1URDA 4BDLA 4OESA 4LZ8A 4DE8A 3H4ZA 5TP9A 3TYHA 1MDQA 1B3FA 1N0TA 1P1QA 4ZEBA 3FXQA 1LB8A 1KWHA 3BFTA 1Q35A 4OFJA 3IB1A 5I2KA 3O2AA 3K2DA 3ECRA 3PD9A 4KCDA 1JNFA 1Z7NE 1S7YA 3T66A 1YCJA 4KYSA 2ONSA 3O29A 2XX7A 3T22A 2ABHA 3D4GA 3LBSA 2HAVA 4WKMA 3IB2A 4FIMA 1XC1A 2I48A 1ELJA 2WKYA 4OXVA 3ILUB 5DVJA 5A5XA 4ND9A 5I56B 1POTA 3RN8A 1TWYA 2CZLA 1OIBA 2UYEA 4LATA 4RK9A 1MQJA 5ICTA 2H4IA 3O6IA 1MDP1 1HSLA 4WEDA 3KOTA 1FCKA 5BUUA 2GRVA 4YAHX 3LUYA 3QYTA 3TAJA 1QUIA 3MPKA 2H25A 1RKMA 1EZ9A 2RCBA 3MBPA 4PETA 5B70A 3K6UA 4R6KA 1AIVA 3KN7A 3VLWA 1DTZA 4N13A 1PB8A 5DVIA 2ZYKA 2A5SA 3KZGA 3JV9A 5JTYB 1B5HA 2XXUA 4JXIA 4M4GA 2REGA 5DT6A 1MY2A 3K1PA 4XIGQ 2Y7KA 4FJPA 3G3IA 1OVBA 2V93A 5IKBA 3IOWA 3VXBA 1LAGE 2I3WA 1MPBA 4EQ7A 4F3BA 1NNPA 3CG1A 1YPNA 1A99A 1I6AA 2Z8FA 4E0XA 1IXIA 4ZECA 5AA3A 2QS3A 4OYVA 4AB5A 2XXIA 4X9TA 5I56A 3TZAA 1B4ZA 3RLFE 1URSA 1R9QA 4GRKA 3K1NA 4U2RA 5EHMA 1SI0A 4I62A 4TOZA 4R2FA 2GH9A 1JEUA 2UVIA 2DE4A 1JVYA 4YKKA 3DELB 5KCJA 2V3UA 3M3KA 4N6PA 1Y3NA 2QMXA 4F22A 1SD3A 1XS5A 3U94A 2Q88A 1AMFA 4X1DA 2OBGA 4GXAA 2RC7A 3K6VA 3CI8A 3RT6B 1SVXB 2I4BA 2HAUA 4JB7A 1SI1A 1P1NA 3IX1A 1ZBMA 3MZBA 1SQYA 4R2BA 3UIFA 1ZLQA 3VE1B 3UORA 4I1DA 2X7PA 4NF5A 5JTYA 4RK2A 5JK4A 4YMAA 1B3EA 4OERA 2P0SA 3Q26A 4AB6A 5AA4B 1H76A 2Q89A 4OZ9A 3PUVE 1SW4A 1I6BA 4P0IA 4NF4B 3PMVA 1EH3A 4R6HA 1B9JA 2DXRA 3MPLA 1MS7A 2OCUA 2R9JA 4FECA 1PC3A 4KYDA 2H98A 4ZEFA 4JWYA 1B32A 1P1WA 4KPTA 1MQIA 2QMWA 3RTWB 5I2NB 1FQEA 4G8HA 1XVYA 2DWHA 3MJNA 3E9XA 1LAHE 4ZZAA 3FJMA 2V3TA 3K01A 1VSOA 2R6GE 1EU8A 3A3UA 1ZU0A 1TT1A 1B3GA 2ONRA 2RCAA 2DQVA 1P99A 4GL0A 2XXYA 2RC8A 1MG1A 3VXCA 1UIUA 1YTVA 3I3VA 3H6WA 4YKIA 5HBCA 3TCGA 4KI0E 4BDOA 4F2OA 5FTIA 4ISUA 4EUOA 1EZPA 1B7UA 4N07A 3VVDA 1B3HA 1Y1MA 3FATA 3IOTA 1MY4A 2ZNTA 1DOTA 4KFQA 2UVGA 1A8FA 4U1ZA 1SDXA 2X7QA 1B51A 3FXRA 3KN3A 4R9GA 3MW0A 5AA2B 5AA4A 2RF1A 4GQOA 1TFDA 1ATGA 4E0WA 1B5JA 3H7MA 3PGFA 4OEVA 4MH5A 3O6HA 3PPOA 4U1OA 1B52A 1MRPA 5K2XA 3IR1A 1B7ZA 2XX9A 4IO4A 4U4SA 4YZZA 4QRZA 4G8NA 1M5DA 4QFNA 2AYSA 1O7TA 3K6XA 5I2NA 2XXHA 3M3LA 5DEXB 1MY0A 3S9NC 2XXPA 4QSEA 2I49A 4YMBA 2O68A 4HTGA 4F18A 4Q8RA 4O3BA 3FIRA 1M5FA 2Q2AA 2H99A 2Q9TA 4IY6A 1SW5A 2UXAA 3OEKA 3VFJA 4POXA 3MVZA 5ISUA 3S9LC 2DYXA 1LSTA 3OSQA 3GZGA 3TQLA 3VV5A 3OELA 3T9XB 4PFTA 3JZJA 3R26A 3UGWA 3G3JA 3F11A 3PUXE 3UP9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IQ7 A;  3OO6 A;  2GHB A;  2O7I A;  3IOU A;  2ESN A;  5I84 A;  4P0G A;  4LON B;  2AL4 A;  4UAC A;  3MC2 A;  4FOR A;  1WOD A;  1NNK A;  4GF8 A;  3W15 C;  3I5O A;  2ZYN A;  1OLC A;  4YB7 A;  4JDF A;  2IEE A;  4DCX A;  4H1X A;  2VD3 A;  3OO7 A;  4FE8 A;  3VDF A;  4ZED A;  5AA2 A;  3S9M C;  4RPO A;  4L17 A;  2O1M A;  4QFL A;  2DWI A;  2PMS A;  3EQ1 A;  4IO7 A;  4H6D A;  1PBQ A;  1LBC A;  4OHN A;  1OQH A;  3IOV A;  3WAF A;  3OEM A;  1OVT A;  4KR5 A;  2P2A A;  3TTM A;  2REJ A;  2ZNU A;  4KYE A;  1AH5 A;  5TU0 A;  1DSN A;  1FQB A;  4Q30 B;  4YU0 A;  1QW0 A;  5DEX A;  4H8I A;  2DXY A;  2I6E A;  3T9V A;  1LFG A;  2F6P A;  1H3D A;  3K00 A;  4RYA A;  4ESX A;  3RTF B;  4AQ4 A;  1JW1 A;  3U1O A;  2I58 A;  2NUV A;  4JBZ A;  3KN8 A;  3LC8 A;  2O1L A;  2QS2 A;  2B65 A;  2QRY A;  5CM6 A;  1FQF A;  5ITP A;  1IIW A;  4TQU Q;  4LUB A;  1B0H A;  4EQB A;  1B2H A;  3CG3 A;  2Y7W A;  3P7I A;  3RQT A;  4M1V A;  3B7D A;  1QKA A;  3HN0 A;  3Q28 A;  3PV0 E;  5CI5 A;  4OWD A;  3L6G A;  5AA1 A;  2ZMB A;  1N7X A;  1BKA A;  1T0K A;  1FTK A;  5F1Q A;  3E3K A;  3HST A;  1XT8 A;  3PUZ E;  3FVO A;  2DWJ A;  3IO4 A;  5I57 B;  4FEB A;  4OMB A;  3FUZ A;  1Y1Z A;  2O84 X;  3SEV A;  3SER A;  3JYR A;  4QF9 A;  4YKP A;  1PEB A;  1ZIU A;  4FAT A;  4IY5 A;  1N3W A;  3EHT A;  3PUY E;  3TCH A;  2HQ0 A;  2OWT A;  1MY1 A;  1LBB A;  1GV8 A;  3Q27 A;  1VFD A;  4GLI A;  1MH4 A;  1OQG A;  1DPP A;  4IGT A;  4NF8 B;  2XXR A;  2UYF A;  1A7L A;  4PFY A;  3T9U A;  5I59 B;  2RC9 A;  2VGQ A;  3FV1 A;  5HPQ A;  3SET A;  2F78 A;  4ZEI A;  3RY3 A;  3Q29 A;  4ELR A;  1VR5 A;  2NWJ A;  3CFL A;  1QUL A;  1JEV A;  5EYF A;  2FYI A;  1O63 A;  3MZ1 A;  1R6Z A;  3FVG A;  1XOC A;  1R1N A;  4QHQ A;  3U93 A;  4U22 A;  2OJT A;  4G4P A;  3N26 A;  1USY H;  1NNT A;  1MQH A;  4ZE9 A;  4U23 A;  2F7B A;  5I57 A;  2Y7I A;  4H5F A;  1H43 A;  2XX8 A;  1XVX A;  4Q0C A;  4ZZE A;  4I9D A;  4R6Y A;  2I0C A;  1LGB C;  4GVO A;  1B0L A;  2X26 A;  2B3B A;  3B6Q A;  3G3H A;  2YLN A;  4G2Z A;  3PMW A;  4G8M A;  2XXW A;  3W9W A;  4F1U A;  5HM4 B;  3RT8 A;  3FJG A;  4F3G A;  2DS9 A;  3V8X B;  4OEN A;  1QJM A;  4ZEK A;  5I59 A;  2DSF A;  4JSO A;  4KQP A;  3KBR A;  4RPN A;  3HPI A;  4R73 A;  3TTL A;  2XHD A;  4F1Y A;  3TUS A;  2OK2 A;  1N04 A;  3K02 A;  4BDR A;  5H8N B;  2FA7 A;  4C1T A;  1Y4T A;  4BDM A;  1B46 A;  2V84 A;  3SKP A;  3SEU A;  4QSD A;  3BBR A;  1TFA A;  5CMK A;  5L9M A;  2O6A A;  1SW1 A;  2PX1 A;  2F8D A;  2G29 A;  5FHO A;  3TTR A;  3TEL A;  5LOM A;  3FAS A;  2QL3 A;  2VHA A;  3T96 B;  1URG A;  3L6H A;  1H44 A;  1Y4C A;  4ZDM A;  3MQ9 A;  4RY1 A;  4LZ7 A;  2AL5 A;  4H8J A;  4RA1 A;  4DXB A;  1B5I A;  2CMO A;  3C36 A;  3C35 A;  2HEU A;  3PPP A;  3LR1 A;  4IO2 A;  5FTH A;  2E0S A;  1JET A;  2QS4 A;  2O51 A;  1LCF A;  3LSW A;  4DXU A;  4JWX A;  4NTL A;  3LSX A;  1NNF A;  1EZO A;  2VOZ A;  2A5T B;  1USY E;  1VFE A;  3C4M A;  1D4N A;  1MXU A;  1POY 1;  2IA4 A;  1B05 A;  1H45 A;  2O69 A;  4OFO A;  3KFM A;  3EF7 A;  3OXN A;  1JVX A;  3HO7 A;  3GBB A;  1OMP A;  1QVS A;  3O66 A;  3PD8 A;  4G68 B;  5H8Q B;  4NF6 B;  3CVG A;  1US4 A;  3MP1 A;  4QFP A;  1UIV A;  3VLU A;  3E13 X;  4HW8 A;  1SBP A;  3TCF A;  2UVJ A;  4XXU A;  5ICQ A;  2GHA A;  4NF4 A;  4OVJ A;  5H8H B;  3KGC A;  1AOV A;  1B3L A;  4LQ5 A;  1D9V A;  5ELV A;  4C1U A;  1PB9 A;  2F7C A;  5TP9 B;  3V5A A;  4ESW A;  3TDJ A;  3VVE A;  1JQF A;  1FQC A;  1US5 A;  3QAX A;  3HV1 A;  4ONY A;  4ECF A;  1IUD A;  3IB0 A;  1IZ1 A;  3HHF A;  1QUK A;  1BTJ A;  1DPE A;  4HCY A;  2B3F A;  4LQ2 A;  2DE2 A;  1FW0 A;  3T9H B;  5I2K B;  3RNN A;  1IXG A;  2ZNS A;  4EQ9 A;  2P1S A;  3TEP A;  3FXU A;  1RYX A;  5CMB A;  3R7X A;  4P11 A;  1WVJ A;  1MM6 A;  3A3C A;  1SYH A;  4ELP A;  4MLQ A;  4BDQ A;  4F39 A;  3QSL A;  2VD2 A;  3D4C A;  4NMY A;  4GXS B;  4YIC A;  4OET A;  2A5T A;  2D21 A;  3ZS6 A;  3TFL A;  4IO3 A;  4DZ1 A;  2HXW A;  2V3Q A;  2I4C A;  4QSC A;  4GOT A;  5DYH A;  2HCA A;  3SES A;  1GTK A;  3HHG A;  1N3X A;  1Y3P A;  1MXV A;  5A5X B;  3TOD A;  4OTE A;  4FAJ A;  2Q2C A;  3V83 A;  1LCT A;  1LAX A;  4H0W A;  1LFI A;  4YKJ A;  4XKQ A;  3MP6 A;  4G68 A;  4ELO A;  1P1U A;  1HSJ A;  2F7A A;  2DVZ A;  3MUQ A;  4JSD A;  3KJ7 A;  1Y9U A;  4K3F A;  2OLB A;  3KSJ A;  3LSL A;  3OSR A;  5H8H A;  4RNS A;  4IGR A;  5ITO A;  3OO9 A;  1FTJ A;  3IL1 B;  3KEI A;  3V89 B;  1OLA A;  1ZTY A;  1FQA A;  4F19 A;  1PBP A;  3OD7 A;  1SW2 A;  1FQD A;  3QUF A;  4PFU A;  3TMG A;  3GLB A;  2QS1 A;  2HFB A;  4KCC A;  2D3I A;  3K0V A;  2H9B A;  1CB6 A;  1MXW A;  1PB7 A;  3IAZ A;  3BFU A;  5J1D A;  4NWC A;  1HSE A;  1IEJ A;  1S50 A;  2Z22 A;  2PYY A;  2Z8D A;  1UTH B;  5CMC A;  3QXM A;  3TQW A;  1AL3 A;  4LA9 A;  3ZSF A;  5CMM A;  1NL5 A;  4ZE8 A;  1MXX A;  3E4R A;  3K1M A;  3O28 A;  3DM0 A;  1ZJL A;  3HCQ A;  3UN6 A;  4R74 A;  3PUW E;  2F6G A;  3C33 A;  1MXY A;  2XXX A;  4GFR A;  2Y7R A;  3EHS A;  4Z7E A;  2XXT A;  5FHM A;  3O6G A;  4MF3 A;  3SEX A;  4MBP A;  4EF1 A;  4BDN A;  5I58 B;  3MZ9 A;  1O64 A;  4TLL B;  3VVF A;  5B7D A;  2YJP A;  3MP8 A;  4EXK A;  4NED A;  3S9E A;  5F7V A;  4MLV A;  4RXL A;  3G3F A;  1S9T A;  4EXL A;  2E1S A;  1Z7M E;  3SDF A;  3THI A;  3K6W A;  4POW A;  3CSG A;  2Z23 A;  1F9B A;  1FTL A;  3KOS A;  5H8S A;  2PT2 A;  1MQD A;  4GWO A;  1ZKB A;  3QK6 A;  3H6T A;  4NE4 A;  3H03 A;  5KCJ B;  5KDT B;  2XXV A;  3USD A;  3ZKK A;  4KD5 A;  4JWO A;  2OWS A;  3DP8 A;  2W7Y A;  4GL8 A;  1NKX A;  1YAE A;  3MAM A;  4DDD A;  1TXF A;  1M5E A;  2AIX A;  4XKR A;  3G3G A;  2Y7P A;  3MVY A;  1B1X A;  1B40 A;  4FED A;  1UTH A;  4LZ5 A;  1N76 A;  5DTB A;  4F29 A;  1LLS A;  4XTC Q;  4HS7 A;  4TLM B;  3FV2 A;  5BWJ A;  2HZK A;  4HCW A;  1N84 A;  4U4X A;  3R6U A;  4NF5 B;  1MQG A;  2V25 A;  4IO6 A;  3KSX A;  2BJJ X;  1GR2 A;  1QKB A;  1NMU A;  1SYI A;  5DVF A;  4EF2 A;  1A40 A;  4H65 A;  5H8F B;  2R71 A;  4PFW A;  4O3A A;  1M5B A;  2XD3 A;  1IIT A;  2ANJ A;  3U72 A;  5I58 A;  4UA8 A;  2DE3 A;  3BKI B;  2OZZ A;  2QJE A;  2ZXT A;  3FGS A;  2KLF A;  3EHU A;  3PPN A;  4LP2 B;  4R75 A;  5K2Y A;  3UK4 A;  1MM7 A;  3G7W A;  2Y84 A;  3OOA A;  3FVK A;  2PBW A;  5L9S A;  3QUJ A;  4G77 A;  3K4U A;  5CRY A;  3U8Q A;  3CFZ A;  1IXC A;  4WEP A;  1MXZ A;  3U92 A;  1DMB A;  4C0R A;  5KDT A;  3T93 B;  3ODB A;  4OEU A;  2GFE A;  1Q1K A;  1II5 A;  1QUJ A;  1Y3Q A;  1UTB B;  1D9Y A;  4U21 A;  4YB5 A;  3OEN A;  4PE5 B;  3DP4 A;  3CFX A;  2UVH A;  3CSB A;  2O7U A;  2ALU A;  4OFL A;  1R9L A;  1N7W A;  4I8C A;  3LSF B;  4NF8 A;  3RUM A;  1XHY A;  1P1O A;  3PPQ A;  1CE2 A;  4YB6 A;  2ZYO A;  3CR9 A;  1JW4 A;  2Q8J A;  1BLF A;  3MVX A;  2Z8E A;  4F2Q A;  1ZMG A;  3CRB A;  3TTN A;  5KZT A;  4Q5T A;  4QFO A;  4GD5 A;  3ONM A;  4F3P A;  5IAI A;  4DLD A;  2ZYM A;  3C31 A;  4XKN A;  1WDN A;  5JEI A;  3DP6 A;  3EN3 A;  5H8F A;  2VP1 A;  3Q25 A;  4ZS9 A;  1A8E A;  3MWB A;  3S4U A;  2HZL A;  2RKM A;  2NOO A;  1ANF A;  1FTO A;  1PDA A;  2I3V A;  3C9H A;  2FNC A;  4G68 C;  1A55 A;  4GIZ A;  4KHZ E;  4ELQ A;  3H6U A;  3PMX A;  3H3G A;  5TPA B;  3ILT B;  3IO6 A;  3KJT A;  4EDP A;  3UA8 A;  4WXJ A;  1B6H A;  4QFK A;  2F36 A;  2QSX A;  1IXH A;  4NWD A;  3H06 B;  3C32 A;  3IJX B;  5FHN A;  3FVN A;  4BLA A;  2XD2 A;  3IK6 B;  4LVQ A;  3O9P A;  3PU5 A;  1BIY A;  4O3C A;  1LAF E;  1L5T A;  5L9O A;  2G93 A;  4DCY A;  2ONK E;  2RIN A;  1MH3 A;  1B4H A;  3OO8 A;  3G3K A;  3CIJ A;  1UTB A;  3PPR A;  4IO5 A;  2XXQ A;  4Z0I A;  3TKD A;  4F3S A;  5CC2 A;  3B6T A;  3I6V A;  1MY3 A;  1NFT A;  4IB2 A;  3WAE A;  1A54 A;  2I0B A;  4X48 A;  4F1V A;  2PT1 A;  3DLN A;  1NH8 A;  1RYO A;  3TPA A;  5M2V A;  2F97 A;  4DIG A;  3TTK A;  2M8C A;  5EHS A;  5H8N A;  4DXC A;  2YPN A;  3AXF A;  1LFH A;  2F34 A;  3ZKL A;  3QIM A;  1B58 A;  1MPC A;  1NH7 A;  1GGG A;  1MPD A;  3N5L A;  4OQO A;  4PQJ A;  3A09 A;  1FTM A;  3FJ7 A;  2NVU B;  5CBS A;  4MFI A;  3H6V A;  2PVU A;  2H5Y A;  3N6U A;  3RGY A;  3M8U A;  1Y20 A;  1UQW A;  3EPE A;  2F35 A;  1VE4 A;  5TPA A;  3IOR A;  3VLV A;  5AE4 A;  5CBR A;  2DP8 A;  4F31 B;  3C34 A;  3O97 A;  4PP0 A;  3N94 A;  3SEW A;  2DVC A;  4R72 A;  1D3K A;  3M3F A;  3RPW A;  3OMB A;  4H67 A;  2QPQ A;  3S2V A;  1JW5 A;  3B6W A;  4THI A;  3FD3 A;  5AA2 D;  3IJO B;  4RJZ A;  3KG2 A;  2F5X A;  1I69 A;  2LAO A;  4XKP A;  2DWA A;  5H8Q A;  1DTG A;  2D5W A;  4NF6 A;  2DOJ A;  3N6T A;  3W9V A;  1BP5 A;  2NXO A;  5L8D A;  3FZV A;  2THI A;  1J1N A;  4X1B A;  1B7H A;  4R9F A;  3SEY A;  1B1H A;  1LB9 A;  3MVW A;  4H5G A;  3GBA A;  1GVC A;  1M5C A;  1I6Q A;  3GXA A;  1URD A;  4BDL A;  4OES A;  4LZ8 A;  4DE8 A;  3H4Z A;  5TP9 A;  3TYH A;  1MDQ A;  1B3F A;  1N0T A;  1P1Q A;  4ZEB A;  3FXQ A;  1LB8 A;  1KWH A;  3BFT A;  1Q35 A;  4OFJ A;  3IB1 A;  5I2K A;  3O2A A;  3K2D A;  3ECR A;  3PD9 A;  4KCD A;  1JNF A;  1Z7N E;  1S7Y A;  3T66 A;  1YCJ A;  4KYS A;  2ONS A;  3O29 A;  2XX7 A;  3T22 A;  2ABH A;  3D4G A;  3LBS A;  2HAV A;  4WKM A;  3IB2 A;  4FIM A;  1XC1 A;  2I48 A;  1ELJ A;  2WKY A;  4OXV A;  3ILU B;  5DVJ A;  5A5X A;  4ND9 A;  5I56 B;  1POT A;  3RN8 A;  1TWY A;  2CZL A;  1OIB A;  2UYE A;  4LAT A;  4RK9 A;  1MQJ A;  5ICT A;  2H4I A;  3O6I A;  1MDP 1;  1HSL A;  4WED A;  3KOT A;  1FCK A;  5BUU A;  2GRV A;  4YAH X;  3LUY A;  3QYT A;  3TAJ A;  1QUI A;  3MPK A;  2H25 A;  1RKM A;  1EZ9 A;  2RCB A;  3MBP A;  4PET A;  5B70 A;  3K6U A;  4R6K A;  1AIV A;  3KN7 A;  3VLW A;  1DTZ A;  4N13 A;  1PB8 A;  5DVI A;  2ZYK A;  2A5S A;  3KZG A;  3JV9 A;  5JTY B;  1B5H A;  2XXU A;  4JXI A;  4M4G A;  2REG A;  5DT6 A;  1MY2 A;  3K1P A;  4XIG Q;  2Y7K A;  4FJP A;  3G3I A;  1OVB A;  2V93 A;  5IKB A;  3IOW A;  3VXB A;  1LAG E;  2I3W A;  1MPB A;  4EQ7 A;  4F3B A;  1NNP A;  3CG1 A;  1YPN A;  1A99 A;  1I6A A;  2Z8F A;  4E0X A;  1IXI A;  4ZEC A;  5AA3 A;  2QS3 A;  4OYV A;  4AB5 A;  2XXI A;  4X9T A;  5I56 A;  3TZA A;  1B4Z A;  3RLF E;  1URS A;  1R9Q A;  4GRK A;  3K1N A;  4U2R A;  5EHM A;  1SI0 A;  4I62 A;  4TOZ A;  4R2F A;  2GH9 A;  1JEU A;  2UVI A;  2DE4 A;  1JVY A;  4YKK A;  3DEL B;  5KCJ A;  2V3U A;  3M3K A;  4N6P A;  1Y3N A;  2QMX A;  4F22 A;  1SD3 A;  1XS5 A;  3U94 A;  2Q88 A;  1AMF A;  4X1D A;  2OBG A;  4GXA A;  2RC7 A;  3K6V A;  3CI8 A;  3RT6 B;  1SVX B;  2I4B A;  2HAU A;  4JB7 A;  1SI1 A;  1P1N A;  3IX1 A;  1ZBM A;  3MZB A;  1SQY A;  4R2B A;  3UIF A;  1ZLQ A;  3VE1 B;  3UOR A;  4I1D A;  2X7P A;  4NF5 A;  5JTY A;  4RK2 A;  5JK4 A;  4YMA A;  1B3E A;  4OER A;  2P0S A;  3Q26 A;  4AB6 A;  5AA4 B;  1H76 A;  2Q89 A;  4OZ9 A;  3PUV E;  1SW4 A;  1I6B A;  4P0I A;  4NF4 B;  3PMV A;  1EH3 A;  4R6H A;  1B9J A;  2DXR A;  3MPL A;  1MS7 A;  2OCU A;  2R9J A;  4FEC A;  1PC3 A;  4KYD A;  2H98 A;  4ZEF A;  4JWY A;  1B32 A;  1P1W A;  4KPT A;  1MQI A;  2QMW A;  3RTW B;  5I2N B;  1FQE A;  4G8H A;  1XVY A;  2DWH A;  3MJN A;  3E9X A;  1LAH E;  4ZZA A;  3FJM A;  2V3T A;  3K01 A;  1VSO A;  2R6G E;  1EU8 A;  3A3U A;  1ZU0 A;  1TT1 A;  1B3G A;  2ONR A;  2RCA A;  2DQV A;  1P99 A;  4GL0 A;  2XXY A;  2RC8 A;  1MG1 A;  3VXC A;  1UIU A;  1YTV A;  3I3V A;  3H6W A;  4YKI A;  5HBC A;  3TCG A;  4KI0 E;  4BDO A;  4F2O A;  5FTI A;  4ISU A;  4EUO A;  1EZP A;  1B7U A;  4N07 A;  3VVD A;  1B3H A;  1Y1M A;  3FAT A;  3IOT A;  1MY4 A;  2ZNT A;  1DOT A;  4KFQ A;  2UVG A;  1A8F A;  4U1Z A;  1SDX A;  2X7Q A;  1B51 A;  3FXR A;  3KN3 A;  4R9G A;  3MW0 A;  5AA2 B;  5AA4 A;  2RF1 A;  4GQO A;  1TFD A;  1ATG A;  4E0W A;  1B5J A;  3H7M A;  3PGF A;  4OEV A;  4MH5 A;  3O6H A;  3PPO A;  4U1O A;  1B52 A;  1MRP A;  5K2X A;  3IR1 A;  1B7Z A;  2XX9 A;  4IO4 A;  4U4S A;  4YZZ A;  4QRZ A;  4G8N A;  1M5D A;  4QFN A;  2AYS A;  1O7T A;  3K6X A;  5I2N A;  2XXH A;  3M3L A;  5DEX B;  1MY0 A;  3S9N C;  2XXP A;  4QSE A;  2I49 A;  4YMB A;  2O68 A;  4HTG A;  4F18 A;  4Q8R A;  4O3B A;  3FIR A;  1M5F A;  2Q2A A;  2H99 A;  2Q9T A;  4IY6 A;  1SW5 A;  2UXA A;  3OEK A;  3VFJ A;  4POX A;  3MVZ A;  5ISU A;  3S9L C;  2DYX A;  1LST A;  3OSQ A;  3GZG A;  3TQL A;  3VV5 A;  3OEL A;  3T9X B;  4PFT A;  3JZJ A;  3R26 A;  3UGW A;  3G3J A;  3F11 A;  3PUX E;  3UP9 A; 
#chains in the Genus database with same CATH topology
 1IQ7 A;  2PFY A;  2GQ1 A;  3OO6 A;  2GHB A;  4O7I A;  2O7I A;  3IOU A;  2ESN A;  5I84 A;  4P0G A;  4LON B;  2AL4 A;  4UAC A;  4MIJ A;  3MC2 A;  4FOR A;  1WOD A;  4AS5 A;  1NNK A;  4GF8 A;  3W15 C;  3I5O A;  2ZYN A;  5EQ9 A;  1NI9 A;  1OLC A;  4YB7 A;  4JDF A;  4GWX A;  1EYI A;  2IEE A;  3HFU A;  4DCX A;  4H1X A;  4OVQ A;  1RDY A;  2VD3 A;  2MKZ A;  3OO7 A;  4FE8 A;  3VDF A;  4ZED A;  5AA2 A;  4P1E A;  3S9M C;  4RPO A;  4L17 A;  2O1M A;  4QFL A;  2DWI A;  2OWZ A;  4JVD A;  2FIX A;  2PMS A;  3EQ1 A;  4IO7 A;  4H6D A;  1PBQ A;  1LBC A;  4OHN A;  1OQH A;  3IOV A;  3WAF A;  3OEM A;  1OVT A;  4KR5 A;  2P2A A;  3TTM A;  2REJ A;  4MHF A;  2ZNU A;  4KYE A;  1AH5 A;  5TU0 A;  1DSN A;  1FQB A;  4Q30 B;  4OVS A;  2OX3 A;  4YU0 A;  1QW0 A;  5DEX A;  4H8I A;  2DXY A;  2I6E A;  3T9V A;  1LFG A;  2F6P A;  1H3D A;  3K00 A;  4UAB A;  4RYA A;  4ESX A;  3RTF B;  4AQ4 A;  1JW1 A;  3U1O A;  2I58 A;  2NUV A;  4JBZ A;  3KN8 A;  3LC8 A;  2O1L A;  2QS2 A;  2B65 A;  2QRY A;  3FBP A;  5CM6 A;  5ET5 A;  1FQF A;  5ITP A;  1IIW A;  4OVR A;  4TQU Q;  4N15 A;  4LUB A;  1B0H A;  4EQB A;  1B2H A;  4PBH A;  3CG3 A;  2QVV A;  2Y7W A;  3P7I A;  3RQT A;  2HHM A;  4M1V A;  3B7D A;  1QKA A;  3HN0 A;  3Q28 A;  3E79 A;  3PV0 E;  3E78 A;  5CI5 A;  4OWD A;  3L6G A;  5AA1 A;  2ZMB A;  1N7X A;  1BKA A;  4P8B A;  1T0K A;  2FHY A;  1FTK A;  4N4U A;  5F1Q A;  3E3K A;  3HST A;  4XFE A;  1KA0 A;  1XT8 A;  3PUZ E;  5EQ8 A;  3FVO A;  2DWJ A;  3IO4 A;  5I57 B;  4FEB A;  4OMB A;  3FUZ A;  1Y1Z A;  2O84 X;  3SEV A;  3SER A;  5J16 A;  3JYR A;  4QF9 A;  4YKP A;  4MJO A;  1PEB A;  1ZIU A;  4FAT A;  4IY5 A;  1N3W A;  3EHT A;  4LN5 A;  3PUY E;  4H45 A;  3TCH A;  2HQ0 A;  2OWT A;  1MY1 A;  1LBB A;  1GV8 A;  3Q27 A;  2B4M A;  1VFD A;  2HPG A;  4GLI A;  1MH4 A;  1OQG A;  1DPP A;  4GWS A;  4IGT A;  4NF8 B;  2XXR A;  2UYF A;  1A7L A;  4PFY A;  3T9U A;  5I59 B;  2RC9 A;  2VGQ A;  1VDW A;  2WX9 A;  3FV1 A;  4PF6 A;  5HPQ A;  3SET A;  2F78 A;  2VPO A;  4ZEI A;  3RY3 A;  3Q29 A;  2Y5L A;  4ELR A;  1VR5 A;  3QMF A;  2NWJ A;  3CFL A;  1QUL A;  4OVT A;  1JEV A;  5EYF A;  2FYI A;  3B50 A;  1O63 A;  3MZ1 A;  1R6Z A;  4I3Y A;  3FVG A;  1XOC A;  4OAN A;  1NUZ A;  1R1N A;  4QHQ A;  3U93 A;  4U22 A;  2OJT A;  4G4P A;  1BK4 A;  3N26 A;  1USY H;  1Q9D A;  1NNT A;  1MQH A;  4ZE9 A;  1SPI A;  1FPB A;  4U23 A;  2F7B A;  5I57 A;  2Y7I A;  4H5F A;  4X04 A;  1H43 A;  2XX8 A;  1XVX A;  4Q0C A;  4ZZE A;  4I9D A;  4R6Y A;  5LTC A;  2KR0 A;  2I0C A;  4MEV A;  1LGB C;  4GVO A;  1B0L A;  5IGA A;  2X26 A;  2B3B A;  3B6Q A;  3G3H A;  2YLN A;  4G2Z A;  3PMW A;  4G8M A;  2XXW A;  3W9W A;  4F1U A;  5HM4 B;  3RT8 A;  3FJG A;  4F3G A;  2DS9 A;  3V8X B;  4OEN A;  1QJM A;  1FBC A;  2FIE A;  4ZEK A;  5I59 A;  2DSF A;  4JSO A;  4MNI A;  4NGU A;  4KQP A;  3KBR A;  4RPN A;  3HPI A;  4R73 A;  3TTL A;  1IME A;  2XHD A;  4F1Y A;  3TUS A;  2QVU A;  2OK2 A;  1FPG A;  1N04 A;  3K02 A;  4BDR A;  5H8N B;  1FPE A;  2FA7 A;  4C1T A;  1Y4T A;  4BDM A;  1B46 A;  2V84 A;  3SKP A;  3SEU A;  4QSD A;  1JP4 A;  3BBR A;  2JJK A;  1TFA A;  5CMK A;  4QBA A;  5L9M A;  2O6A A;  1SW1 A;  2PX1 A;  2F3B A;  2F8D A;  2G29 A;  1G0H A;  5FHO A;  3TTR A;  3TEL A;  5LOM A;  3FAS A;  3IFA A;  4NG7 A;  3NOH A;  2QL3 A;  2VHA A;  3T96 B;  1URG A;  3L6H A;  1H44 A;  1QGX A;  1Y4C A;  4ZDM A;  3MQ9 A;  2L5V A;  4RY1 A;  4LZ7 A;  4MAG A;  2AL5 A;  2PFZ A;  3SZP A;  4H8J A;  3RYD A;  1RDZ A;  4NQ8 A;  4RA1 A;  4DXB A;  1B5I A;  2CMO A;  3C36 A;  3C35 A;  2HEU A;  3PPP A;  3LR1 A;  4IO2 A;  4PAI A;  5FTH A;  2E0S A;  4GWW A;  1JET A;  2QS4 A;  2XWK A;  2O51 A;  1LCF A;  3LSW A;  4DXU A;  4JWX A;  4NTL A;  3LSX A;  1NNF A;  1EZO A;  3FXB A;  2VOZ A;  2A5T B;  1USY E;  4MX6 A;  2V4C A;  1VFE A;  3C4M A;  1D4N A;  3GYY A;  1MXU A;  1POY 1;  2IA4 A;  1B05 A;  1H45 A;  2O69 A;  4OFO A;  3KFM A;  3EF7 A;  3OXN A;  1JVX A;  4N8G A;  2XWI A;  3HO7 A;  3GBB A;  1OMP A;  1QVS A;  4PFB A;  3O66 A;  3PD8 A;  4G68 B;  5H8Q B;  4NF6 B;  3CVG A;  1YXI A;  1US4 A;  3MP1 A;  4QFP A;  1UIV A;  3VLU A;  3E13 X;  4HW8 A;  1NV6 A;  1SBP A;  3TCF A;  2UVJ A;  4XXU A;  5ICQ A;  2GHA A;  4NF4 A;  4OVJ A;  5H8H B;  3KGC A;  1AOV A;  1B3L A;  4LQ5 A;  1D9V A;  5ELV A;  4C1U A;  3MYU A;  1FPD A;  1PB9 A;  2F7C A;  5TP9 B;  2BJI A;  3V5A A;  4ESW A;  2FBP A;  4JVC A;  3TDJ A;  1FBF A;  3VVE A;  1JQF A;  1FQC A;  1US5 A;  3QAX A;  3HV1 A;  4ONY A;  4ECF A;  1IUD A;  3IB0 A;  3CHG A;  1IZ1 A;  3HHF A;  1QUK A;  1BTJ A;  1DPE A;  4HCY A;  4LQ2 A;  2B3F A;  3LV0 A;  4GWY A;  2DE2 A;  1FSA A;  5ET7 A;  2CEY A;  1FW0 A;  3T9H B;  5I2K B;  3RNN A;  1IXG A;  2ZNS A;  4EQ9 A;  2P1S A;  5EYH A;  3TEP A;  3FXU A;  1RYX A;  5CMB A;  3R7X A;  4P11 A;  1WVJ A;  1MM6 A;  3A3C A;  1SYH A;  1FPF A;  4ELP A;  4MLQ A;  4BDQ A;  4F39 A;  4MCO A;  3QSL A;  2VD2 A;  3D4C A;  1LBV A;  4NMY A;  4GXS B;  4YIC A;  4OET A;  2A5T A;  4N81 A;  2D21 A;  4O94 A;  3ZS6 A;  3TFL A;  4IO3 A;  4DZ1 A;  2HXW A;  4PGN A;  2V3Q A;  2I4C A;  1LBX A;  4QSC A;  4GOT A;  5DYH A;  2HCA A;  3SES A;  2CZK A;  1GTK A;  3HHG A;  1N3X A;  1Y3P A;  1MXV A;  5A5X B;  3TOD A;  4OTE A;  4FAJ A;  2Q2C A;  3V83 A;  1LCT A;  1LAX A;  4H0W A;  1LFI A;  4YKJ A;  4XKQ A;  3MP6 A;  4G68 A;  4ELO A;  1P1U A;  1HSJ A;  2F7A A;  2DVZ A;  3MUQ A;  4JSD A;  3KJ7 A;  1Y9U A;  4K3F A;  5LDZ A;  2OLB A;  3KSJ A;  3ROJ A;  3LSL A;  3OSR A;  5H8H A;  4RNS A;  4IGR A;  5ITO A;  3OO9 A;  1FTJ A;  3IL1 B;  3KEI A;  3V89 B;  5IZ3 B;  1OLA A;  1ZTY A;  1FQA A;  4F19 A;  1PBP A;  3OD7 A;  1SW2 A;  1FQD A;  3QUF A;  4PFU A;  3TMG A;  3GLB A;  2QS1 A;  2HFB A;  4KCC A;  2D3I A;  3K0V A;  2H9B A;  1CB6 A;  1MXW A;  1PB7 A;  3IAZ A;  3BFU A;  2B4L A;  5J1D A;  4NWC A;  1HSE A;  1IEJ A;  1S50 A;  2Z22 A;  5I3S A;  2PYY A;  2Z8D A;  1UTH B;  5CMC A;  3QXM A;  4X8R A;  3TQW A;  1AL3 A;  4LA9 A;  3ZSF A;  1FJ6 A;  5CMM A;  1NL5 A;  4ZE8 A;  1MXX A;  3E4R A;  3K1M A;  3O28 A;  3DM0 A;  1ZJL A;  3HCQ A;  3UN6 A;  4R74 A;  3PUW E;  2F6G A;  3C33 A;  4PAK A;  1MXY A;  1IMA A;  2XXX A;  4OVP A;  4GFR A;  2Y7R A;  3EHS A;  3PTY A;  4Z7E A;  2XXT A;  5FHM A;  3O6G A;  1FPJ A;  4MF3 A;  3SEX A;  4MBP A;  4EF1 A;  4BDN A;  5I58 B;  1CNQ A;  3MZ9 A;  1DK4 A;  1O64 A;  4TLL B;  3VVF A;  2XA5 A;  5B7D A;  2YJP A;  3MP8 A;  4EXK A;  4NED A;  3S9E A;  5F7V A;  4MLV A;  1NV0 A;  4RXL A;  3G3F A;  1S9T A;  4EXL A;  2E1S A;  1Z7M E;  3SDF A;  3THI A;  2WBD A;  3K6W A;  4POW A;  3CSG A;  2Z23 A;  1F9B A;  5I5P A;  1FTL A;  3KOS A;  5H8S A;  2PT2 A;  1MQD A;  4GWO A;  1ZKB A;  2VPN A;  4PCD A;  3QK6 A;  4G61 A;  3H6T A;  4NE4 A;  3H03 A;  5KCJ B;  5KDT B;  2XXV A;  3USD A;  3ZKK A;  2Y5K A;  4KD5 A;  1K9Z A;  4JWO A;  5EYG A;  2OWS A;  3DP8 A;  2W7Y A;  4GL8 A;  1NKX A;  1YAE A;  3MAM A;  4DDD A;  1TXF A;  1M5E A;  2AIX A;  4XKR A;  3G3G A;  2Y7P A;  3MVY A;  3LUZ A;  1B1X A;  1B40 A;  4FED A;  1UTH A;  4P1L A;  4LZ5 A;  1N76 A;  5DTB A;  4F29 A;  1LLS A;  4XTC Q;  4HS7 A;  4TLM B;  3FV2 A;  2CZI A;  5BWJ A;  4GX6 A;  2HZK A;  2R8T A;  4HCW A;  1N84 A;  4U4X A;  3R6U A;  4NF5 B;  1MQG A;  2V25 A;  4IO6 A;  3KSX A;  2BJJ X;  1QKB A;  1GR2 A;  1NMU A;  1SYI A;  5DVF A;  4EF2 A;  1A40 A;  4H65 A;  5H8F B;  2R71 A;  4PFW A;  4O3A A;  1M5B A;  3A29 A;  2XD3 A;  1IIT A;  2ANJ A;  3U72 A;  5I58 A;  4UA8 A;  4XF5 A;  2DE3 A;  3BKI B;  2OZZ A;  2QJE A;  4H46 A;  2ZXT A;  3FGS A;  2KLF A;  3EHU A;  4PF8 A;  3PPN A;  4LP2 B;  4R75 A;  5K2Y A;  2PCR A;  3UK4 A;  3BIG A;  1MM7 A;  3G7W A;  2Y84 A;  3OOA A;  3FVK A;  2PBW A;  1G0I A;  5L9S A;  3QUJ A;  4G77 A;  3K4U A;  5CRY A;  4FBP A;  3U8Q A;  3CFZ A;  1IXC A;  4WEP A;  1MXZ A;  3U92 A;  1DMB A;  1NUW A;  4C0R A;  5KDT A;  3T93 B;  3ODB A;  3U65 A;  4OEU A;  2GFE A;  1Q1K A;  1II5 A;  1QUJ A;  1Y3Q A;  1UTB B;  1D9Y A;  4U21 A;  4YB5 A;  3OEN A;  4PE5 B;  3DP4 A;  3CFX A;  2UVH A;  3CSB A;  5IM2 A;  2O7U A;  4NX1 A;  2ALU A;  4OFL A;  1R9L A;  1N7W A;  4I8C A;  3LSF B;  4NF8 A;  3RUM A;  1XHY A;  1P1O A;  3PPQ A;  1CE2 A;  4YB6 A;  1KA1 A;  2ZYO A;  3CR9 A;  4N17 A;  1NV3 A;  1JW4 A;  2Q8J A;  1BLF A;  3MVX A;  2Z8E A;  4F2Q A;  5EQ7 A;  1ZMG A;  3CRB A;  3TTN A;  5KZT A;  4Q5T A;  4QFO A;  4GD5 A;  3ONM A;  4F3P A;  5IAI A;  4HXV A;  4DLD A;  4I40 A;  2ZYM A;  3C31 A;  4XKN A;  1WDN A;  2ZZX A;  5JEI A;  3DP6 A;  3EN3 A;  3T1B A;  5H8F A;  2VP1 A;  1IMD A;  3Q25 A;  4I3E A;  4ZS9 A;  1A8E A;  3MWB A;  3S4U A;  2HZL A;  2RKM A;  2NOO A;  1ANF A;  1IMB A;  1FTO A;  1PDA A;  5F24 A;  2I3V A;  3C9H A;  4O7M A;  2FNC A;  4G68 C;  1A55 A;  4GIZ A;  1NV7 A;  1NV4 A;  4KHZ E;  4ELQ A;  3H6U A;  3PMX A;  3H3G A;  5TPA B;  2CEX A;  2DDK A;  3ILT B;  3IO6 A;  3KJT A;  4EDP A;  3UA8 A;  4WXJ A;  1B6H A;  4QFK A;  2F36 A;  2QSX A;  1IXH A;  4NWD A;  3H06 B;  3C32 A;  3IJX B;  5FHN A;  3FVN A;  4BLA A;  2XD2 A;  3IK6 B;  4GWZ A;  4LVQ A;  3O9P A;  3PU5 A;  1BIY A;  4O3C A;  1LAF E;  1L5T A;  2QVR A;  5L9O A;  2G93 A;  2WBB A;  4DCY A;  2ONK E;  2RIN A;  3MST A;  4PGP A;  1MH3 A;  2ZZW A;  4PDD A;  1B4H A;  3OO8 A;  3G3K A;  3CIJ A;  1UTB A;  3PPR A;  4IO5 A;  2XXQ A;  4Z0I A;  4OA4 A;  3TKD A;  4F3S A;  1XI6 A;  5CC2 A;  3B6T A;  3I6V A;  1LEV A;  1MY3 A;  1IMC A;  1NFT A;  4IB2 A;  3WAE A;  4IR8 A;  1A54 A;  1FBP A;  2I0B A;  4X48 A;  4F1V A;  2PT1 A;  3DLN A;  3D1R A;  1NH8 A;  1RYO A;  3TPA A;  1FPL A;  5M2V A;  2F97 A;  4DIG A;  3TTK A;  2M8C A;  5EHS A;  5H8N A;  4DXC A;  2YPN A;  4MNC A;  3AXF A;  1LFH A;  4NHB A;  2F34 A;  3ZKL A;  3QIM A;  1B58 A;  1MPC A;  1FJ9 A;  1NH7 A;  1GGG A;  1MPD A;  3N5L A;  4OQO A;  3IFC A;  4PQJ A;  3A09 A;  1FTM A;  3FJ7 A;  4PTK A;  2NVU B;  5CBS A;  4MFI A;  3H6V A;  2PVU A;  2H5Y A;  3N6U A;  3RGY A;  3M8U A;  1Y20 A;  1UQW A;  3EPE A;  4PBQ A;  3KBZ A;  2F35 A;  1VE4 A;  5TPA A;  4MNP A;  4PAF A;  3IOR A;  3VLV A;  5AE4 A;  5CBR A;  4N6K A;  1LBY A;  2DP8 A;  4NN3 A;  4F31 B;  3C34 A;  3O97 A;  4P56 A;  4PP0 A;  3N94 A;  3SEW A;  2DVC A;  4R72 A;  1D3K A;  3M3F A;  3RPW A;  3OMB A;  4AS4 A;  4H67 A;  2QPQ A;  4DI3 D;  3S2V A;  1JW5 A;  3B6W A;  4THI A;  3FD3 A;  5AA2 D;  3IJO B;  4RJZ A;  3KG2 A;  1FBD A;  1NV2 A;  2F5X A;  1I69 A;  1AWB A;  5FBP A;  2LAO A;  4XKP A;  2DWA A;  1NUY A;  5H8Q A;  1DTG A;  2D5W A;  4NF6 A;  2DOJ A;  3N6T A;  3W9V A;  1BP5 A;  2NXO A;  5L8D A;  3FZV A;  2THI A;  1J1N A;  4X1B A;  1B7H A;  4R9F A;  3SEY A;  1B1H A;  1LB9 A;  3MVW A;  4H5G A;  3GBA A;  1GVC A;  1M5C A;  1I6Q A;  3GXA A;  1URD A;  4BDL A;  4OES A;  4LZ8 A;  4DE8 A;  3H4Z A;  5TP9 A;  5I7I A;  3TYH A;  1MDQ A;  1B3F A;  1N0T A;  4N91 A;  1P1Q A;  4ZEB A;  3FXQ A;  1LB8 A;  1KWH A;  5T3J A;  3BFT A;  1Q35 A;  4OFJ A;  2XWV A;  3IB1 A;  5I2K A;  3RPL B;  3O2A A;  3K2D A;  2P3N A;  3EKI A;  3ECR A;  3PD9 A;  5EQA A;  4KCD A;  1JNF A;  1RDX A;  4MMP A;  1Z7N E;  1S7Y A;  3T66 A;  1YCJ A;  4KYS A;  1IMF A;  2ONS A;  2XXK A;  3O29 A;  2XX7 A;  1YZ0 A;  2QFL A;  4P3L A;  5ET8 A;  3T22 A;  2ABH A;  3D4G A;  3LBS A;  2HAV A;  4WKM A;  3IB2 A;  4FIM A;  1XC1 A;  2I48 A;  1ELJ A;  2WKY A;  4OXV A;  3ILU B;  5DVJ A;  5A5X A;  1FPK A;  4ND9 A;  5I56 B;  5DW8 A;  1POT A;  3RN8 A;  1TWY A;  2CZL A;  1OIB A;  2XWO A;  2UYE A;  4NF0 A;  4LAT A;  4RK9 A;  1MQJ A;  5ICT A;  2H4I A;  1DBZ A;  2F3D A;  3O6I A;  1MDP 1;  1HSL A;  5IZ3 A;  4WED A;  3KOT A;  1FCK A;  4P9K A;  5BUU A;  2GRV A;  4YAH X;  3LUY A;  3QYT A;  4PDH A;  3TAJ A;  1QUI A;  4P47 A;  3MPK A;  2H25 A;  1RKM A;  1EZ9 A;  2RCB A;  3MBP A;  4HE1 A;  1FBE A;  4PET A;  2VT5 A;  3K6U A;  5B70 A;  4R6K A;  1INP A;  1AIV A;  3KN7 A;  3VLW A;  2WYK A;  5ET6 A;  1DTZ A;  4N13 A;  1PB8 A;  5DVI A;  2ZYK A;  4NAP A;  3RPL A;  2A5S A;  3KZG A;  4GWU A;  3JV9 A;  5JTY B;  1B5H A;  2XXU A;  4XEQ A;  4JXI A;  4O8M A;  4M4G A;  4PFR A;  4GBV A;  4N8Y A;  2REG A;  5DT6 A;  1MY2 A;  3K1P A;  4XIG Q;  2Y7K A;  4FJP A;  3G3I A;  1OVB A;  2V93 A;  5IKB A;  3IOW A;  3VXB A;  1LAG E;  2I3W A;  1MPB A;  4N6D A;  4EQ7 A;  2P3V A;  4F3B A;  1NNP A;  3CG1 A;  1YPN A;  4PE3 A;  1A99 A;  1I6A A;  2Z8F A;  4E0X A;  1IXI A;  4ZEC A;  5AA3 A;  2QS3 A;  4OYV A;  4AB5 A;  2XXI A;  4X9T A;  5I56 A;  3TZA A;  1B4Z A;  3RLF E;  5IZ1 A;  1URS A;  1R9Q A;  4GRK A;  3K1N A;  4U2R A;  1D9Q A;  5EHM A;  2KQZ A;  1SI0 A;  4I62 A;  4TOZ A;  4R2F A;  2GH9 A;  4GX4 A;  1JEU A;  1FBH A;  1YYZ A;  2UVI A;  1FPI A;  2DE4 A;  1JVY A;  4YKK A;  3DEL B;  5KCJ A;  1LBW A;  2V3U A;  3M3K A;  4N6P A;  1Y3N A;  2QMX A;  4F22 A;  1SD3 A;  1XS5 A;  3U94 A;  2Q88 A;  2WEF A;  1AMF A;  1K9Y A;  4X1D A;  2OBG A;  3T0J A;  4GXA A;  2RC7 A;  3K6V A;  3ISP A;  3CI8 A;  3RT6 B;  1SVX B;  2I4B A;  2HAU A;  3B8B A;  4JB7 A;  1SI1 A;  1P1N A;  3IX1 A;  1ZBM A;  3MZB A;  1SQY A;  1DCU A;  4R2B A;  2FVZ A;  3UIF A;  1ZLQ A;  3VE1 B;  3UOR A;  4I1D A;  2X7P A;  4NF5 A;  5JTY A;  4RK2 A;  5JK4 A;  4YMA A;  1B3E A;  4OER A;  2P0S A;  3Q26 A;  4AB6 A;  5AA4 B;  4GX3 A;  1H76 A;  2Q89 A;  4OZ9 A;  3PUV E;  1SW4 A;  1I6B A;  4P0I A;  4NF4 B;  3KC1 A;  3PMV A;  1EH3 A;  4R6H A;  1B9J A;  2DXR A;  3MPL A;  1MS7 A;  2OCU A;  2R9J A;  4KXP A;  4FEC A;  1PC3 A;  4JVI A;  4KYD A;  2H98 A;  4ZEF A;  4JWY A;  1B32 A;  1P1W A;  4KPT A;  1MQI A;  2QMW A;  5IZZ A;  3RTW B;  5I2N B;  2HXR A;  1FQE A;  1NV5 A;  4G8H A;  1XVY A;  2DWH A;  3MJN A;  3E9X A;  1LAH E;  4DI4 B;  4ZZA A;  3FJM A;  2V3T A;  3K01 A;  1LBZ A;  2Q74 A;  1VSO A;  2R6G E;  1EU8 A;  3A3U A;  1ZU0 A;  1TT1 A;  1B3G A;  2ONR A;  2RCA A;  2DQV A;  1P99 A;  4GBW A;  4GL0 A;  2XXY A;  2RC8 A;  4HE0 A;  1MG1 A;  3VXC A;  1UIU A;  1NV1 A;  1FBG A;  1YTV A;  3I3V A;  3H6W A;  4YKI A;  5HBC A;  3TCG A;  4KI0 E;  4BDO A;  4F2O A;  5FTI A;  4ISU A;  4EUO A;  1FTA A;  1EZP A;  1B7U A;  4N07 A;  3VVD A;  1B3H A;  1Y1M A;  3FAT A;  3IOT A;  1MY4 A;  2ZNT A;  4QXD A;  4PFI A;  1DOT A;  4KFQ A;  2UVG A;  1A8F A;  4U1Z A;  1SDX A;  2X7Q A;  1B51 A;  3FXR A;  3KN3 A;  4R9G A;  3MW0 A;  5A5L A;  5AA2 B;  4HE2 A;  5AA4 A;  2RF1 A;  4GQO A;  1TFD A;  4PC9 A;  1ATG A;  4E0W A;  1B5J A;  3H7M A;  3PGF A;  4OEV A;  4MH5 A;  3O6H A;  3PPO A;  4U1O A;  1B52 A;  1MRP A;  5K2X A;  3IR1 A;  1B7Z A;  2XX9 A;  4IO4 A;  4U4S A;  2CZH A;  4YZZ A;  4QRZ A;  4G8N A;  1M5D A;  4QFN A;  2AYS A;  1O7T A;  3K6X A;  1FRP A;  3BIH A;  5I2N A;  2Q8M A;  2XXH A;  3M3L A;  5DEX B;  1MY0 A;  3S9N C;  2XXP A;  3KC0 A;  4QSE A;  2I49 A;  4YMB A;  2O68 A;  4HTG A;  4F18 A;  4Q8R A;  4O3B A;  3FIR A;  1M5F A;  2Q2A A;  2H99 A;  2Q9T A;  4IY6 A;  1SW5 A;  2UXA A;  3OEK A;  3VFJ A;  4POX A;  5ESY A;  3MVZ A;  2ZZV A;  5ISU A;  3S9L C;  2WYP A;  1KZ8 A;  2DYX A;  1LST A;  3OSQ A;  3GZG A;  1NUX A;  1EYK A;  1EYJ A;  3TQL A;  3VV5 A;  3OEL A;  3T9X B;  4PFT A;  3JZJ A;  3R26 A;  3UGW A;  3G3J A;  3F11 A;  3PUX E;  3UP9 A; 
#chains in the Genus database with same CATH homology
 1IQ7 A;  3OO6 A;  2GHB A;  2O7I A;  3IOU A;  2ESN A;  5I84 A;  4P0G A;  4LON B;  2AL4 A;  4UAC A;  3MC2 A;  4FOR A;  1WOD A;  1NNK A;  4GF8 A;  3W15 C;  3I5O A;  2ZYN A;  1OLC A;  4YB7 A;  4JDF A;  2IEE A;  4DCX A;  4H1X A;  2VD3 A;  3OO7 A;  4FE8 A;  3VDF A;  4ZED A;  5AA2 A;  3S9M C;  4RPO A;  4L17 A;  2O1M A;  4QFL A;  2DWI A;  2PMS A;  3EQ1 A;  4IO7 A;  4H6D A;  1PBQ A;  1LBC A;  4OHN A;  1OQH A;  3IOV A;  3WAF A;  3OEM A;  1OVT A;  4KR5 A;  2P2A A;  3TTM A;  2REJ A;  2ZNU A;  4KYE A;  1AH5 A;  5TU0 A;  1DSN A;  1FQB A;  4Q30 B;  4YU0 A;  1QW0 A;  5DEX A;  4H8I A;  2DXY A;  2I6E A;  3T9V A;  1LFG A;  2F6P A;  1H3D A;  3K00 A;  4RYA A;  4ESX A;  3RTF B;  4AQ4 A;  1JW1 A;  3U1O A;  2I58 A;  2NUV A;  4JBZ A;  3KN8 A;  3LC8 A;  2O1L A;  2QS2 A;  2B65 A;  2QRY A;  5CM6 A;  1FQF A;  5ITP A;  1IIW A;  4TQU Q;  4LUB A;  1B0H A;  4EQB A;  1B2H A;  3CG3 A;  2Y7W A;  3P7I A;  3RQT A;  4M1V A;  3B7D A;  1QKA A;  3HN0 A;  3Q28 A;  3PV0 E;  5CI5 A;  4OWD A;  3L6G A;  5AA1 A;  2ZMB A;  1N7X A;  1BKA A;  1T0K A;  1FTK A;  5F1Q A;  3E3K A;  3HST A;  1XT8 A;  3PUZ E;  3FVO A;  2DWJ A;  3IO4 A;  5I57 B;  4FEB A;  4OMB A;  3FUZ A;  1Y1Z A;  2O84 X;  3SEV A;  3SER A;  3JYR A;  4QF9 A;  4YKP A;  1PEB A;  1ZIU A;  4FAT A;  4IY5 A;  1N3W A;  3EHT A;  3PUY E;  3TCH A;  2HQ0 A;  2OWT A;  1MY1 A;  1LBB A;  1GV8 A;  3Q27 A;  1VFD A;  4GLI A;  1MH4 A;  1OQG A;  1DPP A;  4IGT A;  4NF8 B;  2XXR A;  2UYF A;  1A7L A;  4PFY A;  3T9U A;  5I59 B;  2RC9 A;  2VGQ A;  3FV1 A;  5HPQ A;  3SET A;  2F78 A;  4ZEI A;  3RY3 A;  3Q29 A;  4ELR A;  1VR5 A;  2NWJ A;  3CFL A;  1QUL A;  1JEV A;  5EYF A;  2FYI A;  1O63 A;  3MZ1 A;  1R6Z A;  3FVG A;  1XOC A;  1R1N A;  4QHQ A;  3U93 A;  4U22 A;  2OJT A;  4G4P A;  3N26 A;  1USY H;  1NNT A;  1MQH A;  4ZE9 A;  4U23 A;  2F7B A;  5I57 A;  2Y7I A;  4H5F A;  1H43 A;  2XX8 A;  1XVX A;  4Q0C A;  4ZZE A;  4I9D A;  4R6Y A;  2I0C A;  1LGB C;  4GVO A;  1B0L A;  2X26 A;  2B3B A;  3B6Q A;  3G3H A;  2YLN A;  4G2Z A;  3PMW A;  4G8M A;  2XXW A;  3W9W A;  4F1U A;  5HM4 B;  3RT8 A;  3FJG A;  4F3G A;  2DS9 A;  3V8X B;  4OEN A;  1QJM A;  4ZEK A;  5I59 A;  2DSF A;  4JSO A;  4KQP A;  3KBR A;  4RPN A;  3HPI A;  4R73 A;  3TTL A;  2XHD A;  4F1Y A;  3TUS A;  2OK2 A;  1N04 A;  3K02 A;  4BDR A;  5H8N B;  2FA7 A;  4C1T A;  1Y4T A;  4BDM A;  1B46 A;  2V84 A;  3SKP A;  3SEU A;  4QSD A;  3BBR A;  1TFA A;  5CMK A;  5L9M A;  2O6A A;  1SW1 A;  2PX1 A;  2F8D A;  2G29 A;  5FHO A;  3TTR A;  3TEL A;  5LOM A;  3FAS A;  2QL3 A;  2VHA A;  3T96 B;  1URG A;  3L6H A;  1H44 A;  1Y4C A;  4ZDM A;  3MQ9 A;  4RY1 A;  4LZ7 A;  2AL5 A;  4H8J A;  4RA1 A;  4DXB A;  1B5I A;  2CMO A;  3C36 A;  3C35 A;  2HEU A;  3PPP A;  3LR1 A;  4IO2 A;  5FTH A;  2E0S A;  1JET A;  2QS4 A;  2O51 A;  1LCF A;  3LSW A;  4DXU A;  4JWX A;  4NTL A;  3LSX A;  1NNF A;  1EZO A;  2VOZ A;  2A5T B;  1USY E;  1VFE A;  3C4M A;  1D4N A;  1MXU A;  1POY 1;  2IA4 A;  1B05 A;  1H45 A;  2O69 A;  4OFO A;  3KFM A;  3EF7 A;  3OXN A;  1JVX A;  3HO7 A;  3GBB A;  1OMP A;  1QVS A;  3O66 A;  3PD8 A;  4G68 B;  5H8Q B;  4NF6 B;  3CVG A;  1US4 A;  3MP1 A;  4QFP A;  1UIV A;  3VLU A;  3E13 X;  4HW8 A;  1SBP A;  3TCF A;  2UVJ A;  4XXU A;  5ICQ A;  2GHA A;  4NF4 A;  4OVJ A;  5H8H B;  3KGC A;  1AOV A;  1B3L A;  4LQ5 A;  1D9V A;  5ELV A;  4C1U A;  1PB9 A;  2F7C A;  5TP9 B;  3V5A A;  4ESW A;  3TDJ A;  3VVE A;  1JQF A;  1FQC A;  1US5 A;  3QAX A;  3HV1 A;  4ONY A;  4ECF A;  1IUD A;  3IB0 A;  1IZ1 A;  3HHF A;  1QUK A;  1BTJ A;  1DPE A;  4HCY A;  2B3F A;  4LQ2 A;  2DE2 A;  1FW0 A;  3T9H B;  5I2K B;  3RNN A;  1IXG A;  2ZNS A;  4EQ9 A;  2P1S A;  3TEP A;  3FXU A;  1RYX A;  5CMB A;  3R7X A;  4P11 A;  1WVJ A;  1MM6 A;  3A3C A;  1SYH A;  4ELP A;  4MLQ A;  4BDQ A;  4F39 A;  3QSL A;  2VD2 A;  3D4C A;  4NMY A;  4GXS B;  4YIC A;  4OET A;  2A5T A;  2D21 A;  3ZS6 A;  3TFL A;  4IO3 A;  4DZ1 A;  2HXW A;  2V3Q A;  2I4C A;  4QSC A;  4GOT A;  5DYH A;  2HCA A;  3SES A;  1GTK A;  3HHG A;  1N3X A;  1Y3P A;  1MXV A;  5A5X B;  3TOD A;  4OTE A;  4FAJ A;  2Q2C A;  3V83 A;  1LCT A;  1LAX A;  4H0W A;  1LFI A;  4YKJ A;  4XKQ A;  3MP6 A;  4G68 A;  4ELO A;  1P1U A;  1HSJ A;  2F7A A;  2DVZ A;  3MUQ A;  4JSD A;  3KJ7 A;  1Y9U A;  4K3F A;  2OLB A;  3KSJ A;  3LSL A;  3OSR A;  5H8H A;  4RNS A;  4IGR A;  5ITO A;  3OO9 A;  1FTJ A;  3IL1 B;  3KEI A;  3V89 B;  1OLA A;  1ZTY A;  1FQA A;  4F19 A;  1PBP A;  3OD7 A;  1SW2 A;  1FQD A;  3QUF A;  4PFU A;  3TMG A;  3GLB A;  2QS1 A;  2HFB A;  4KCC A;  2D3I A;  3K0V A;  2H9B A;  1CB6 A;  1MXW A;  1PB7 A;  3IAZ A;  3BFU A;  5J1D A;  4NWC A;  1HSE A;  1IEJ A;  1S50 A;  2Z22 A;  2PYY A;  2Z8D A;  1UTH B;  5CMC A;  3QXM A;  3TQW A;  1AL3 A;  4LA9 A;  3ZSF A;  5CMM A;  1NL5 A;  4ZE8 A;  1MXX A;  3E4R A;  3K1M A;  3O28 A;  3DM0 A;  1ZJL A;  3HCQ A;  3UN6 A;  4R74 A;  3PUW E;  2F6G A;  3C33 A;  1MXY A;  2XXX A;  4GFR A;  2Y7R A;  3EHS A;  4Z7E A;  2XXT A;  5FHM A;  3O6G A;  4MF3 A;  3SEX A;  4MBP A;  4EF1 A;  4BDN A;  5I58 B;  3MZ9 A;  1O64 A;  4TLL B;  3VVF A;  5B7D A;  2YJP A;  3MP8 A;  4EXK A;  4NED A;  3S9E A;  5F7V A;  4MLV A;  4RXL A;  3G3F A;  1S9T A;  4EXL A;  2E1S A;  1Z7M E;  3SDF A;  3THI A;  3K6W A;  4POW A;  3CSG A;  2Z23 A;  1F9B A;  1FTL A;  3KOS A;  5H8S A;  2PT2 A;  1MQD A;  4GWO A;  1ZKB A;  3QK6 A;  3H6T A;  4NE4 A;  3H03 A;  5KCJ B;  5KDT B;  2XXV A;  3USD A;  3ZKK A;  4KD5 A;  4JWO A;  2OWS A;  3DP8 A;  2W7Y A;  4GL8 A;  1NKX A;  1YAE A;  3MAM A;  4DDD A;  1TXF A;  1M5E A;  2AIX A;  4XKR A;  3G3G A;  2Y7P A;  3MVY A;  1B1X A;  1B40 A;  4FED A;  1UTH A;  4LZ5 A;  1N76 A;  5DTB A;  4F29 A;  1LLS A;  4XTC Q;  4HS7 A;  4TLM B;  3FV2 A;  5BWJ A;  2HZK A;  4HCW A;  1N84 A;  4U4X A;  3R6U A;  4NF5 B;  1MQG A;  2V25 A;  4IO6 A;  3KSX A;  2BJJ X;  1GR2 A;  1QKB A;  1NMU A;  1SYI A;  5DVF A;  4EF2 A;  1A40 A;  4H65 A;  5H8F B;  2R71 A;  4PFW A;  4O3A A;  1M5B A;  2XD3 A;  1IIT A;  2ANJ A;  3U72 A;  5I58 A;  4UA8 A;  2DE3 A;  3BKI B;  2OZZ A;  2QJE A;  2ZXT A;  3FGS A;  2KLF A;  3EHU A;  3PPN A;  4LP2 B;  4R75 A;  5K2Y A;  3UK4 A;  1MM7 A;  3G7W A;  2Y84 A;  3OOA A;  3FVK A;  2PBW A;  5L9S A;  3QUJ A;  4G77 A;  3K4U A;  5CRY A;  3U8Q A;  3CFZ A;  1IXC A;  4WEP A;  1MXZ A;  3U92 A;  1DMB A;  4C0R A;  5KDT A;  3T93 B;  3ODB A;  4OEU A;  2GFE A;  1Q1K A;  1II5 A;  1QUJ A;  1Y3Q A;  1UTB B;  1D9Y A;  4U21 A;  4YB5 A;  3OEN A;  4PE5 B;  3DP4 A;  3CFX A;  2UVH A;  3CSB A;  2O7U A;  2ALU A;  4OFL A;  1R9L A;  1N7W A;  4I8C A;  3LSF B;  4NF8 A;  3RUM A;  1XHY A;  1P1O A;  3PPQ A;  1CE2 A;  4YB6 A;  2ZYO A;  3CR9 A;  1JW4 A;  2Q8J A;  1BLF A;  3MVX A;  2Z8E A;  4F2Q A;  1ZMG A;  3CRB A;  3TTN A;  5KZT A;  4Q5T A;  4QFO A;  4GD5 A;  3ONM A;  4F3P A;  5IAI A;  4DLD A;  2ZYM A;  3C31 A;  4XKN A;  1WDN A;  5JEI A;  3DP6 A;  3EN3 A;  5H8F A;  2VP1 A;  3Q25 A;  4ZS9 A;  1A8E A;  3MWB A;  3S4U A;  2HZL A;  2RKM A;  2NOO A;  1ANF A;  1FTO A;  1PDA A;  2I3V A;  3C9H A;  2FNC A;  4G68 C;  1A55 A;  4GIZ A;  4KHZ E;  4ELQ A;  3H6U A;  3PMX A;  3H3G A;  5TPA B;  3ILT B;  3IO6 A;  3KJT A;  4EDP A;  3UA8 A;  4WXJ A;  1B6H A;  4QFK A;  2F36 A;  2QSX A;  1IXH A;  4NWD A;  3H06 B;  3C32 A;  3IJX B;  5FHN A;  3FVN A;  4BLA A;  2XD2 A;  3IK6 B;  4LVQ A;  3O9P A;  3PU5 A;  1BIY A;  4O3C A;  1LAF E;  1L5T A;  5L9O A;  2G93 A;  4DCY A;  2ONK E;  2RIN A;  1MH3 A;  1B4H A;  3OO8 A;  3G3K A;  3CIJ A;  1UTB A;  3PPR A;  4IO5 A;  2XXQ A;  4Z0I A;  3TKD A;  4F3S A;  5CC2 A;  3B6T A;  3I6V A;  1MY3 A;  1NFT A;  4IB2 A;  3WAE A;  1A54 A;  2I0B A;  4X48 A;  4F1V A;  2PT1 A;  3DLN A;  1NH8 A;  1RYO A;  3TPA A;  5M2V A;  2F97 A;  4DIG A;  3TTK A;  2M8C A;  5EHS A;  5H8N A;  4DXC A;  2YPN A;  3AXF A;  1LFH A;  2F34 A;  3ZKL A;  3QIM A;  1B58 A;  1MPC A;  1NH7 A;  1GGG A;  1MPD A;  3N5L A;  4OQO A;  4PQJ A;  3A09 A;  1FTM A;  3FJ7 A;  2NVU B;  5CBS A;  4MFI A;  3H6V A;  2PVU A;  2H5Y A;  3N6U A;  3RGY A;  3M8U A;  1Y20 A;  1UQW A;  3EPE A;  2F35 A;  1VE4 A;  5TPA A;  3IOR A;  3VLV A;  5AE4 A;  5CBR A;  2DP8 A;  4F31 B;  3C34 A;  3O97 A;  4PP0 A;  3N94 A;  3SEW A;  2DVC A;  4R72 A;  1D3K A;  3M3F A;  3RPW A;  3OMB A;  4H67 A;  2QPQ A;  3S2V A;  1JW5 A;  3B6W A;  4THI A;  3FD3 A;  5AA2 D;  3IJO B;  4RJZ A;  3KG2 A;  2F5X A;  1I69 A;  2LAO A;  4XKP A;  2DWA A;  5H8Q A;  1DTG A;  2D5W A;  4NF6 A;  2DOJ A;  3N6T A;  3W9V A;  1BP5 A;  2NXO A;  5L8D A;  3FZV A;  2THI A;  1J1N A;  4X1B A;  1B7H A;  4R9F A;  3SEY A;  1B1H A;  1LB9 A;  3MVW A;  4H5G A;  3GBA A;  1GVC A;  1M5C A;  1I6Q A;  3GXA A;  1URD A;  4BDL A;  4OES A;  4LZ8 A;  4DE8 A;  3H4Z A;  5TP9 A;  3TYH A;  1MDQ A;  1B3F A;  1N0T A;  1P1Q A;  4ZEB A;  3FXQ A;  1LB8 A;  1KWH A;  3BFT A;  1Q35 A;  4OFJ A;  3IB1 A;  5I2K A;  3O2A A;  3K2D A;  3ECR A;  3PD9 A;  4KCD A;  1JNF A;  1Z7N E;  1S7Y A;  3T66 A;  1YCJ A;  4KYS A;  2ONS A;  3O29 A;  2XX7 A;  3T22 A;  2ABH A;  3D4G A;  3LBS A;  2HAV A;  4WKM A;  3IB2 A;  4FIM A;  1XC1 A;  2I48 A;  1ELJ A;  2WKY A;  4OXV A;  3ILU B;  5DVJ A;  5A5X A;  4ND9 A;  5I56 B;  1POT A;  3RN8 A;  1TWY A;  2CZL A;  1OIB A;  2UYE A;  4LAT A;  4RK9 A;  1MQJ A;  5ICT A;  2H4I A;  3O6I A;  1MDP 1;  1HSL A;  4WED A;  3KOT A;  1FCK A;  5BUU A;  2GRV A;  4YAH X;  3LUY A;  3QYT A;  3TAJ A;  1QUI A;  3MPK A;  2H25 A;  1RKM A;  1EZ9 A;  2RCB A;  3MBP A;  4PET A;  5B70 A;  3K6U A;  4R6K A;  1AIV A;  3KN7 A;  3VLW A;  1DTZ A;  4N13 A;  1PB8 A;  5DVI A;  2ZYK A;  2A5S A;  3KZG A;  3JV9 A;  5JTY B;  1B5H A;  2XXU A;  4JXI A;  4M4G A;  2REG A;  5DT6 A;  1MY2 A;  3K1P A;  4XIG Q;  2Y7K A;  4FJP A;  3G3I A;  1OVB A;  2V93 A;  5IKB A;  3IOW A;  3VXB A;  1LAG E;  2I3W A;  1MPB A;  4EQ7 A;  4F3B A;  1NNP A;  3CG1 A;  1YPN A;  1A99 A;  1I6A A;  2Z8F A;  4E0X A;  1IXI A;  4ZEC A;  5AA3 A;  2QS3 A;  4OYV A;  4AB5 A;  2XXI A;  4X9T A;  5I56 A;  3TZA A;  1B4Z A;  3RLF E;  1URS A;  1R9Q A;  4GRK A;  3K1N A;  4U2R A;  5EHM A;  1SI0 A;  4I62 A;  4TOZ A;  4R2F A;  2GH9 A;  1JEU A;  2UVI A;  2DE4 A;  1JVY A;  4YKK A;  3DEL B;  5KCJ A;  2V3U A;  3M3K A;  4N6P A;  1Y3N A;  2QMX A;  4F22 A;  1SD3 A;  1XS5 A;  3U94 A;  2Q88 A;  1AMF A;  4X1D A;  2OBG A;  4GXA A;  2RC7 A;  3K6V A;  3CI8 A;  3RT6 B;  1SVX B;  2I4B A;  2HAU A;  4JB7 A;  1SI1 A;  1P1N A;  3IX1 A;  1ZBM A;  3MZB A;  1SQY A;  4R2B A;  3UIF A;  1ZLQ A;  3VE1 B;  3UOR A;  4I1D A;  2X7P A;  4NF5 A;  5JTY A;  4RK2 A;  5JK4 A;  4YMA A;  1B3E A;  4OER A;  2P0S A;  3Q26 A;  4AB6 A;  5AA4 B;  1H76 A;  2Q89 A;  4OZ9 A;  3PUV E;  1SW4 A;  1I6B A;  4P0I A;  4NF4 B;  3PMV A;  1EH3 A;  4R6H A;  1B9J A;  2DXR A;  3MPL A;  1MS7 A;  2OCU A;  2R9J A;  4FEC A;  1PC3 A;  4KYD A;  2H98 A;  4ZEF A;  4JWY A;  1B32 A;  1P1W A;  4KPT A;  1MQI A;  2QMW A;  3RTW B;  5I2N B;  1FQE A;  4G8H A;  1XVY A;  2DWH A;  3MJN A;  3E9X A;  1LAH E;  4ZZA A;  3FJM A;  2V3T A;  3K01 A;  1VSO A;  2R6G E;  1EU8 A;  3A3U A;  1ZU0 A;  1TT1 A;  1B3G A;  2ONR A;  2RCA A;  2DQV A;  1P99 A;  4GL0 A;  2XXY A;  2RC8 A;  1MG1 A;  3VXC A;  1UIU A;  1YTV A;  3I3V A;  3H6W A;  4YKI A;  5HBC A;  3TCG A;  4KI0 E;  4BDO A;  4F2O A;  5FTI A;  4ISU A;  4EUO A;  1EZP A;  1B7U A;  4N07 A;  3VVD A;  1B3H A;  1Y1M A;  3FAT A;  3IOT A;  1MY4 A;  2ZNT A;  1DOT A;  4KFQ A;  2UVG A;  1A8F A;  4U1Z A;  1SDX A;  2X7Q A;  1B51 A;  3FXR A;  3KN3 A;  4R9G A;  3MW0 A;  5AA2 B;  5AA4 A;  2RF1 A;  4GQO A;  1TFD A;  1ATG A;  4E0W A;  1B5J A;  3H7M A;  3PGF A;  4OEV A;  4MH5 A;  3O6H A;  3PPO A;  4U1O A;  1B52 A;  1MRP A;  5K2X A;  3IR1 A;  1B7Z A;  2XX9 A;  4IO4 A;  4U4S A;  4YZZ A;  4QRZ A;  4G8N A;  1M5D A;  4QFN A;  2AYS A;  1O7T A;  3K6X A;  5I2N A;  2XXH A;  3M3L A;  5DEX B;  1MY0 A;  3S9N C;  2XXP A;  4QSE A;  2I49 A;  4YMB A;  2O68 A;  4HTG A;  4F18 A;  4Q8R A;  4O3B A;  3FIR A;  1M5F A;  2Q2A A;  2H99 A;  2Q9T A;  4IY6 A;  1SW5 A;  2UXA A;  3OEK A;  3VFJ A;  4POX A;  3MVZ A;  5ISU A;  3S9L C;  2DYX A;  1LST A;  3OSQ A;  3GZG A;  3TQL A;  3VV5 A;  3OEL A;  3T9X B;  4PFT A;  3JZJ A;  3R26 A;  3UGW A;  3G3J A;  3F11 A;  3PUX E;  3UP9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...