2O69A

Crystal structure of haemophilus influenzae n193l mutant fbpa
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALILNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-utilization periplasmic protein
publication title The role of the synergistic phosphate anion in iron transport by the periplasmic iron-binding protein from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
total genus 111
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o69A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o69A02
3K1MA 4QFNA 5L9MA 5TPAA 5DT6A 3FD3A 3TTMA 5KZTA 4NE4A 1QKAA 3SDFA 3HO7A 3SEVA 1N3WA 3E9XA 3ILUB 3VVDA 4KHZE 3MUQA 1B7UA 4Z7EA 3H7MA 1USYH 4LQ5A 4PQJA 5I2NB 1TWYA 3QXMA 3CRBA 3TZAA 2D21A 4H67A 3V5AA 3CVGA 3C32A 5DEXA 1M5EA 1NMUA 2V93A 1IXIA 2GHBA 2ZYOA 5I57B 1IXCA 2DXYA 4F3PA 1ZKBA 3KSXA 4OEVA 3KGCA 1YPNA 3SEWA 1YAEA 2H4IA 2XXVA 3E13X 1Z7ME 1I6QA 4QSDA 4QF9A 1Y20A 2DWAA 2XXXA 3MQ9A 1UTHA 4HTGA 1LFHA 1P1NA 1LB8A 4NF6A 5A5XB 1B05A 4P0GA 4PFWA 3T9HB 1M5CA 4NF4A 1S50A 3FVNA 4DLDA 1MS7A 1ZTYA 4ZECA 3TMGA 1PEBA 1ZJLA 2DE4A 2O7IA 4EF2A 2ZYMA 2X26A 2DP8A 1I69A 3VXCA 3V83A 3D4GA 4M1VA 5F7VA 2CZLA 1B40A 1LCFA 2H9BA 4GQOA 2RC9A 1XC1A 2DXRA 3PUYE 3W9VA 4ISUA 4PFTA 1Y3NA 2P1SA 4H5FA 4NF8B 4X1DA 3VE1B 1A55A 2RF1A 4NMYA 2ONSA 3N6TA 2RKMA 4KYEA 1MXXA 3QAXA 4BDLA 4GFRA 4PETA 1B4HA 4RK2A 3M8UA 1N7XA 2V84A 5L9SA 3EF7A 5F1QA 1URGA 4F2QA 4OZ9A 3IB2A 3H06B 3RN8A 1MQJA 4KD5A 1PBPA 1LAXA 2P2AA 3OD7A 4PFYA 1NH7A 2HXWA 5TU0A 4EF1A 4IO6A 3ZSFA 1IEJA 3K1NA 3OELA 4IO2A 2D3IA 5ITPA 5I2NA 3MWBA 3RY3A 3PUVE 1US4A 3IJOB 5EHSA 1MH4A 4F18A 4OERA 3VVFA 2XXUA 1R6ZA 3R6UA 2GFEA 4F39A 1XS5A 4BDRA 1MQIA 3DP6A 3K4UA 5DTBA 2QS4A 2ONRA 3FVOA 3PPOA 3TTRA 5I57A 3H03A 1US5A 4ND9A 3FATA 2F35A 4R2FA 1LFIA 3FVGA 2XD3A 1P1WA 1M5BA 3C4MA 4DZ1A 1D9VA 3E3KA 4MLQA 3B6QA 1LLSA 1ZBMA 1IXGA 2I0BA 4I1DA 3O29A 4HS7A 2F8DA 2OWTA 2Y7RA 1JEUA 4BDMA 4GL0A 1RKMA 1DTGA 3OEKA 1BLFA 3IOWA 5CI5A 3PPRA 3N5LA 3O6HA 1URSA 3QIMA 1GV8A 3JZJA 5A5XA 2A5TB 4MLVA 3G3GA 2ESNA 1NNTA 2O68A 3S9MC 4DE8A 3OO7A 1B3HA 2M8CA 1SW5A 3K00A 1D4NA 1Y1MA 5ICTA 3THIA 3HHGA 2XXRA 1QUIA 5HBCA 1NFTA 4FORA 1JVYA 4R74A 1LAHE 1GGGA 1B46A 3PD9A 2UVGA 5H8FB 4H0WA 3K0VA 2Z8EA 4FAJA 3FUZA 1QW0A 3MPLA 4FEDA 4N6PA 1HSJA 3TYHA 4OFJA 3G7WA 2RCBA 1ZMGA 5B70A 4NF8A 3K6UA 3PUXE 1QULA 1EH3A 4HCWA 1Y3PA 4U21A 1JEVA 1L5TA 5KCJB 5TP9A 1N76A 4THIA 2RC8A 3A09A 1H76A 4O3BA 1AIVA 1SYIA 3HN0A 3IOUA 3PV0E 4KYDA 2HEUA 3G3IA 2PMSA 1MXYA 3U94A 2UVIA 1D9YA 4DCXA 2I4BA 2OZZA 2R6GE 4DXUA 3S9LC 2ALUA 5CMMA 2V3QA 1LCTA 4FEBA 3IJXB 3O6IA 1MPCA 2X7QA 3HV1A 3KOTA 1AMFA 4F22A 5BUUA 1WVJA 1IZ1A 4DIGA 3M3KA 1M5DA 1JW4A 2H25A 4M4GA 4MF3A 4NTLA 3N26A 2Z23A 4BDNA 4YKIA 5FHMA 3LR1A 3VLVA 5DEXB 1LGBC 4QRZA 2CMOA 1UIUA 3KZGA 2PVUA 4JB7A 3SEYA 2HZLA 3LBSA 3P7IA 4ELOA 5H8QB 3O28A 4BDQA 4F1VA 1EZ9A 1B0HA 2DE2A 2AIXA 3S4UA 3F11A 1LB9A 1UIVA 1MH3A 5AA4B 2Y84A 4KCDA 2PBWA 2A5TA 4R75A 3PMWA 1PB7A 1UTHB 1D3KA 2QMWA 3FJ7A 2VD2A 4FATA 4H6DA 1B51A 3KEIA 1IIWA 5I84A 4YMBA 4GXAA 2Q2AA 3MP6A 3TCHA 3ECRA 5H8FA 1II5A 4U1OA 1QJMA 2PYYA 3HCQA 2VGQA 3TAJA 3CSGA 3IO6A 4EUOA 4TQUQ 4YKKA 5L8DA 1MM6A 3C35A 3WAFA 1GTKA 1MPBA 4ELQA 4I9DA 4OFOA 4R6KA 1B9JA 3U92A 3OOAA 3LSWA 5AA2B 4P11A 1RYXA 4WKMA 1SW2A 2HCAA 5DVIA 5KCJA 5H8HB 2GRVA 5ITOA 4OVJA 1JW5A 1CE2A 1CB6A 1PC3A 3TTKA 4O3AA 3PPQA 3ZS6A 2UVJA 2PX1A 1MXUA 4IO5A 5CMBA 4LUBA 2QRYA 2NXOA 3KSJA 4ZEDA 4G8NA 1LFGA 1IUDA 1NH8A 2O6AA 1R9QA 1MDQA 1B6HA 4TLMB 1PDAA 2F7CA 1EZOA 2DE3A 4EQBA 4NWDA 1MPDA 3GZGA 3Q26A 3TKDA 4ZDMA 3FVKA 1FW0A 2UXAA 3LSXA 1HSEA 2ABHA 2O84X 3EHUA 3FXUA 4MFIA 2O7UA 2W7YA 5CC2A 1MQDA 4U4XA 2RCAA 3EN3A 4ZEBA 2DWJA 2NOOA 2D5WA 3MVWA 3TQWA 4E0WA 5H8QA 1YTVA 3TCFA 1MXVA 1NKXA 4QFLA 4E0XA 5AA2D 3T66A 1H3DA 5FHOA 1N84A 4H8IA 3R26A 1EU8A 1OVBA 5AA4A 1OQHA 2XX9A 4LZ5A 4RYAA 1URDA 2I3WA 4G4PA 1SW1A 2O1LA 3RPWA 1B3LA 3SKPA 1Y3QA 3IORA 2ZNTA 2F7AA 1USYE 3CFXA 5CM6A 4RA1A 4OMBA 4AB6A 4F31B 3PMXA 1J1NA 1A54A 1IQ7A 4IGRA 3DLNA 1FTJA 1DMBA 5CBRA 1A8FA 1LSTA 2VD3A 1MRPA 2Y7PA 4UACA 2FA7A 4G2ZA 4H1XA 4XKNA 3M3FA 2V25A 3PMVA 3H6WA 2I6EA 3VFJA 5AA2A 4O3CA 5H8SA 2AL5A 3GLBA 2XXYA 5H8HA 2UVHA 1AOVA 1VFEA 5J1DA 1OQGA 3RUMA 4Z0IA 2QS2A 2I49A 4JSOA 1BIYA 1R1NA 1MDP1 4LONB 5TP9B 2KLFA 4F1YA 1B1HA 4YKPA 1A40A 4ZEFA 3HSTA 1S9TA 2OK2A 2VP1A 1SD3A 1OLCA 4ZE9A 1DOTA 3BBRA 3E4RA 3B7DA 1QVSA 2ONKE 5K2YA 1POTA 1TXFA 5I59B 2I0CA 1I6BA 1O63A 3QYTA 1MY3A 1B2HA 3CI8A 4LVQA 4G77A 4U22A 4JXIA 2Q88A 1B52A 4G68C 2IEEA 4LZ7A 5DYHA 4GD5A 3VV5A 3O2AA 3HHFA 2R9JA 3FIRA 3TTLA 2FYIA 5EHMA 3IR1A 1VFDA 3T96B 3MZ1A 4WEPA 2YPNA 2B3BA 1FQDA 1SQYA 3LC8A 1FQAA 2R71A 4JDFA 4LA9A 1B3GA 2HAVA 3RGYA 1MG1A 2F78A 3OO9A 4N13A 4QSEA 1N3XA 5JTYB 1VR5A 2VOZA 3GBAA 2XXHA 3OENA 4PFUA 2I3VA 1F9BA 1DTZA 4G8HA 3H6TA 4XKPA 3VXBA 2DVZA 3ONMA 4LATA 2PT2A 4IB2A 3TODA 2F97A 1B7ZA 3KN7A 1MM7A 3USDA 1FTOA 4R9GA 2O1MA 3FV2A 1P1OA 4F29A 5JK4A 1HSLA 3PD8A 3DM0A 4YKJA 3ODBA 3OO8A 1FCKA 3MVZA 4XTCQ 4C1TA 1UTBB 2ANJA 2YLNA 3ZKKA 1H43A 1OVTA 3IL1B 3QUFA 5ISUA 4ELPA 2ZXTA 5I58B 3MVYA 1Z7NE 3UP9A 4RXLA 4U1ZA 5I2KA 2UYFA 2Q8JA 4TLLB 4TOZA 2B3FA 2X7PA 5ELVA 4OFLA 2H5YA 4ZS9A 1QKBA 4FJPA 2UYEA 3DP8A 3H6VA 4P0IA 4F3GA 4R9FA 4K3FA 5I59A 1AH5A 2QMXA 3T9XB 5DVFA 1SVXB 5JEIA 2AYSA 4RNSA 3H4ZA 1MY4A 2NVUB 2F5XA 2F36A 4GL8A 5IAIA 4JSDA 3LSLA 3FASA 2Q9TA 5CRYA 4YB7A 4ELRA 3SEXA 3SERA 1PBQA 4QFKA 1O7TA 3C34A 2Y7WA 4OQOA 3OMBA 3V8XB 1BP5A 5EYFA 4F1UA 3C9HA 1N0TA 2Q89A 2V3UA 3G3FA 1JETA 4POWA 4RK9A 2Z8DA 3U1OA 4EXLA 3CFZA 4YMAA 1ATGA 1RYOA 1LBCA 3W15C 4ZZAA 2RC7A 2REGA 2QPQA 3O9PA 5JTYA 3G3KA 4R2BA 4QFOA 2OJTA 1WODA 4OYVA 1P1UA 1B7HA 5FTIA 3FGSA 3IOTA 1B4ZA 5BWJA 1B3FA 4OENA 5AA3A 4KFQA 3LUYA 4NF5A 4HW8A 3K6XA 4R6YA 3D4CA 4R73A 2I48A 1MXZA 1LAGE 3MVXA 1VSOA 3I5OA 3O97A 1XOCA 2RINA 1B3EA 1A99A 3VLUA 1YCJA 1OIBA 2F6GA 1QUJA 4OESA 2OWSA 2OLBA 1UTBA 4IGTA 1Y1ZA 4OTEA 1T0KA 2NUVA 4DXBA 4KR5A 4GRKA 4PP0A 4X9TA 3HPIA 5HPQA 5I58A 4XKRA 3A3UA 1MY2A 3AXFA 1B58A 2HFBA 3PU5A 4YB6A 4RY1A 3IB1A 1DSNA 1H45A 3RTWB 5LOMA 4EXKA 1SI0A 3FXQA 2HQ0A 1Q1KA 2DOJA 4DCYA 3DP4A 5I56A 4H65A 2Y7KA 3MW0A 2O51A 4OXVA 1B5IA 2VHAA 1MQGA 3QK6A 4R6HA 2I4CA 2XXIA 3Q28A 2B65A 3C33A 3UIFA 4GVOA 2H99A 3Q27A 1S7YA 1FQEA 2XXTA 4OWDA 1PB9A 3H6UA 3L6HA 2DYXA 2DWIA 1B32A 1KWHA 3IOVA 2THIA 1BKAA 2O69A 4KQPA 4R72A 1AL3A 3Q29A 3CG1A 5AE4A 2BJJX 5AA1A 5HM4B 3KFMA 3KJTA 1B1XA 3IK6B 2AL4A 2P0SA 1NL5A 5FTHA 4RPNA 3UA8A 4H8JA 3M3LA 1M5FA 3GBBA 2YJPA 3PPNA 5DVJA 3KG2A 4UA8A 3MBPA 2I58A 2F34A 3B6WA 4NWCA 3QUJA 1GVCA 1NNPA 3FJGA 4PE5B 2XHDA 2ZMBA 1O64A 4YB5A 3TQLA 1B0LA 3ILTB 4IO4A 4EDPA 3I3VA 1LAFE 3MJNA 3TDJA 4OHNA 5CMCA 3TCGA 2ZNSA 1I6AA 3PUZE 4F3SA 3TPAA 3UN6A 1DPEA 4QSCA 3BFUA 4C1UA 2HZKA 1EZPA 3MZBA 1N04A 3CSBA 4YICA 4LZ8A 4NEDA 3FZVA 1GR2A 2HAUA 3SETA 3BKIB 3RLFE 2F6PA 5I2KB 4IO3A 4JWYA 2QSXA 1ZLQA 3PUWE 3V89B 1VE4A 3S2VA 4IY6A 1Y4TA 4GOTA 2E1SA 1FTLA 3K2DA 3SEUA 2DS9A 3G3HA 2OBGA 3LSFB 3K02A 1MQHA 3MZ9A 3MP8A 5M2VA 5KDTB 3IO4A 4G68B 4JBZA 1DPPA 3MPKA 3UGWA 1SW4A 1POY1 4F19A 1XVYA 4KPTA 3U93A 4OEUA 4HCYA 4QFPA 1ANFA 1P99A 2ZYNA 3TTNA 3MP1A 3T93B 2Z8FA 3TFLA 3IB0A 1FTKA 4YZZA 4EQ9A 3RTFB 3T9UA 3KBRA 3CG3A 3MAMA 3VVEA 1NNFA 1ELJA 4GF8A 1JQFA 4XKQA 2QJEA 4U2RA 2DWHA 5FHNA 3EHTA 4X48A 2IA4A 3QSLA 1NNKA 5CBSA 3TELA 4IY5A 3VDFA 1B5HA 3T22A 4ONYA 5K2XA 4BLAA 1TT1A 4POXA 3EHSA 1ZIUA 3O6GA 2LAOA 1OMPA 1SDXA 2XXQA 3KOSA 3Q25A 3DELB 4NF5B 4F3BA 1ZU0A 3K01A 3WAEA 2DSFA 4LP2B 2QL3A 1MXWA 3TEPA 4Q0CA 4Q8RA 4G8MA 2XXPA 1Y4CA 2DQVA 1SBPA 3S9EA 4KCCA 3R7XA 4X1BA 3OSRA 1H44A 2V3TA 3G3JA 3ZKLA 4RPOA 1JW1A 1XHYA 3B6TA 4Q30B 1TFAA 5H8NB 3MC2A 3N6UA 2QS3A 1LBBA 3OEMA 3C36A 4KYSA 3UORA 4DXCA 4ZE8A 1MY1A 1WDNA 4JWOA 3KJ7A 3RT8A 3TUSA 3KN8A 4ZZEA 4KI0E 4H5GA 3K6VA 1R9LA 3C31A 3K1PA 4ECFA 1P1QA 2H98A 4FE8A 2XXWA 3FV1A 1JNFA 2XD2A 1XVXA 4I8CA 1PB8A 2G93A 5I56B 3OSQA 5TPAB 5CMKA 3CR9A 5KDTA 2NWJA 4G68A 4U23A 4EQ7A 1FQBA 1FQFA 4WXJA 3O66A 4L17A 3S9NC 4MBPA 3EQ1A 1FTMA 4YU0A 4GLIA 3SESA 3EPEA 4IO7A 4AQ4A 1XT8A 2FNCA 2GH9A 3RT6B 1FQCA 2XX8A 5B7DA 3PGFA 3CIJA 2OCUA 4XIGQ 2E0SA 4Q5TA 3I6VA 4AB5A 3PPPA 4QHQA 3T9VA 3K6WA 5IKBA 2Q2CA 3KN3A 3L6GA 4YAHX 1A7LA 1Q35A 4DDDA 2G29A 2XX7A 2Z22A 1JVXA 2QS1A 5ICQA 4ESWA 3GXAA 4GXSB 4F2OA 4FECA 4C0RA 4GWOA 1N7WA 3JYRA 4BDOA 1BTJA 4GIZA 3OXNA 2REJA 3H3GA 3IAZA 3UK4A 2ZNUA 4NF6B 2F7BA 2Y7IA 2PT1A 4NF4B 4WEDA 2ZYKA 3OO6A 1B5JA 3RNNA 4N07A 4ZEKA 1MY0A 1SYHA 3N94A 4XXUA 4ESXA 3IX1A 4U4SA 4LQ2A 4MH5A 1SI1A 3U8QA 2DVCA 1A8EA 4JWXA 5H8NA 3BFTA 1IXHA 3FJMA 4I62A 3JV9A 4RJZA 1IITA 3CFLA 1Y9UA 2WKYA 1TFDA 3VLWA 3U72A 3W9WA 1OLAA 2A5SA 3A3CA 3RQTA 1QUKA 4OETA 4ZEIA 5L9OA 3FXRA 1UQWA 4FIMA 2GHAA
chains in the Genus database with same CATH superfamily
3K1MA 1FSAA 4QFNA 5L9MA 5TPAA 4N91A 3E78A 5DT6A 2FHYA 3FD3A 3TTMA 5KZTA 4NE4A 1QKAA 3SDFA 1XI6A 3HO7A 3U65A 3SEVA 1N3WA 3E9XA 3ILUB 3VVDA 4KHZE 3MUQA 1B7UA 4Z7EA 3H7MA 1USYH 4LQ5A 4PQJA 5I2NB 1FPLA 1TWYA 3QXMA 3CRBA 3TZAA 2QVVA 2JJKA 2D21A 4H67A 3FXBA 3V5AA 3CVGA 3C32A 2XWVA 5DEXA 1M5EA 1NMUA 2V93A 1IXIA 2GHBA 2ZYOA 4JVCA 5I57B 1EYIA 1IXCA 4MX6A 2DXYA 4F3PA 1ZKBA 3KSXA 1FJ9A 4OEVA 3KGCA 1YPNA 3SEWA 1YAEA 2XXKA 2H4IA 2XXVA 3E13X 1Z7ME 1I6QA 3T0JA 4QSDA 1NV1A 1Y20A 4QF9A 2DWAA 2XXXA 3MQ9A 1UTHA 4HTGA 1LFHA 1P1NA 1LB8A 4NF6A 5A5XB 1B05A 4P0GA 4PFWA 3T9HB 1M5CA 4NF4A 1S50A 3FVNA 4DLDA 2ZZXA 1MS7A 1ZTYA 2XA5A 4HXVA 4ZECA 4O8MA 3TMGA 1PEBA 1ZJLA 2DE4A 2O7IA 4EF2A 2ZYMA 2X26A 4OVQA 2DP8A 1I69A 3VXCA 3V83A 5IZ1A 2PFZA 1K9YA 3D4GA 4M1VA 5F7VA 2CZLA 1B40A 1LCFA 2H9BA 4GQOA 2RC9A 1XC1A 2DXRA 3PUYE 3W9VA 4ISUA 4PFTA 1Y3NA 2P1SA 4H5FA 1SPIA 4OA4A 4NF8B 4X1DA 4GBWA 3VE1B 1A55A 2RF1A 4NMYA 2ONSA 3N6TA 2RKMA 4KYEA 1MXXA 3QAXA 4BDLA 4GWZA 4GFRA 4PETA 1B4HA 4RK2A 3M8UA 4OVTA 1N7XA 2CEXA 2V84A 5L9SA 3EF7A 5F1QA 1URGA 1NV5A 4N81A 4F2QA 4OZ9A 3IB2A 3H06B 1FPEA 3RN8A 1MQJA 4KD5A 1PBPA 4NN3A 1LAXA 2P2AA 4HE2A 3OD7A 4PFYA 1NH7A 2HXWA 1FPDA 5TU0A 4EF1A 4IO6A 3ZSFA 1IEJA 3K1NA 3OELA 4IO2A 2D3IA 5ITPA 1JP4A 5I2NA 3MWBA 4I40A 3RY3A 3PUVE 1US4A 3IJOB 5EHSA 2HHMA 1MH4A 4F18A 2WEFA 4OERA 3VVFA 2XXUA 1R6ZA 3R6UA 2GFEA 4F39A 3IFAA 1XS5A 4QXDA 4BDRA 1MQIA 3DP6A 3K4UA 1LBYA 5DTBA 2QS4A 2ONRA 3FVOA 3PPOA 3TTRA 5I57A 3H03A 1US5A 1NUZA 4ND9A 3FATA 2F35A 4R2FA 4LN5A 1LFIA 4OANA 4P1LA 3FVGA 2XD3A 1P1WA 1M5BA 3C4MA 4DZ1A 1D9VA 3E3KA 4MLQA 3B6QA 1LLSA 1IXGA 1ZBMA 2I0BA 4I1DA 3O29A 4MHFA 4HS7A 2F8DA 2OWTA 2Y7RA 1JEUA 4BDMA 4GL0A 1K9ZA 1RKMA 1DTGA 3OEKA 1BLFA 3IOWA 5CI5A 3PPRA 3N5LA 3O6HA 1URSA 2Q74A 3QIMA 1GV8A 3JZJA 5A5XA 2A5TB 4MLVA 3G3GA 2ESNA 4PCDA 1NNTA 2O68A 3S9MC 4DE8A 1KZ8A 3OO7A 4O7IA 1B3HA 1EYKA 2M8CA 1SW5A 3K00A 1D4NA 1Y1MA 5ICTA 1INPA 2KQZA 3THIA 3HHGA 4OVPA 2XXRA 1QUIA 4O94A 5HBCA 1NFTA 4FORA 4P47A 1JVYA 1DK4A 4I3YA 4R74A 1LAHE 1GGGA 1B46A 3PD9A 2UVGA 5H8FB 4H0WA 3K0VA 2Z8EA 4FAJA 3FUZA 3KC1A 1G0IA 1QW0A 3MPLA 4FEDA 4N6PA 1HSJA 3TYHA 4OFJA 3G7WA 2RCBA 1ZMGA 5ET8A 5B70A 4NF8A 3K6UA 3PUXE 1NV6A 1QULA 5T3JA 1EH3A 4MJOA 4HCWA 1Y3PA 4U21A 4NQ8A 3GYYA 4HE0A 1JEVA 1L5TA 5KCJB 5TP9A 1N76A 4THIA 2RC8A 2GQ1A 3A09A 1H76A 5F24A 5IZ3A 4O3BA 1AIVA 1SYIA 3HN0A 3IOUA 3PV0E 4KYDA 3CHGA 1FBGA 2HEUA 3G3IA 2PMSA 4JVDA 1MXYA 3U94A 2UVIA 1D9YA 4PDHA 4DCXA 2I4BA 4P3LA 2OZZA 2R6GE 4DXUA 3S9LC 2ALUA 5CMMA 2HXRA 2V3QA 1LCTA 4FEBA 3IJXB 3O6IA 1MPCA 2X7QA 3HV1A 3KOTA 1AMFA 4F22A 5BUUA 1WVJA 4QBAA 1IZ1A 4DIGA 3M3KA 1M5DA 3LUZA 1JW4A 2FIXA 1IMFA 2H25A 4IR8A 4M4GA 3LV0A 4MF3A 4NTLA 3N26A 2Z23A 4BDNA 4YKIA 3LR1A 5FHMA 3VLVA 5DEXB 1LGBC 4QRZA 2CMOA 1UIUA 3KZGA 2PVUA 4JB7A 4MCOA 3SEYA 2HZLA 3LBSA 3P7IA 4ELOA 1VDWA 2B4LA 5H8QB 3O28A 4BDQA 4F1VA 1EZ9A 1B0HA 2DE2A 2AIXA 3S4UA 1NUYA 3F11A 1LB9A 1UIVA 1MH3A 5AA4B 2Y84A 4KCDA 2PBWA 2A5TA 4R75A 3PMWA 1PB7A 1UTHB 1D3KA 2QMWA 3FJ7A 2VD2A 4FATA 4H6DA 1B51A 2WX9A 2VPNA 3KEIA 2VT5A 1IIWA 5I84A 4YMBA 3RYDA 4GXAA 2Q8MA 2Q2AA 3MP6A 3TCHA 3ECRA 5H8FA 1II5A 3ISPA 4U1OA 1QJMA 2PYYA 4X8RA 3HCQA 2VGQA 3TAJA 3CSGA 3BIHA 3IO6A 4EUOA 4TQUQ 4YKKA 5L8DA 1IMEA 1FPKA 1MM6A 3C35A 3WAFA 1GTKA 2WYKA 4GWWA 5EQ9A 1MPBA 2ZZWA 4ELQA 4I9DA 4OFOA 4R6KA 1B9JA 3U92A 3OOAA 3LSWA 5AA2B 4P11A 1RYXA 4WKMA 1SW2A 2HCAA 5DVIA 1Q9DA 4P8BA 5IM2A 5KCJA 5H8HB 2GRVA 5ITOA 4OVJA 1JW5A 2P3VA 1KA0A 5ET5A 1CE2A 1CB6A 1FBFA 1PC3A 3TTKA 4O3AA 3PPQA 3ZS6A 2UVJA 2PX1A 1MXUA 3NOHA 4IO5A 2R8TA 5CMBA 2CZHA 4MAGA 4LUBA 2QRYA 2NXOA 3KSJA 4ZEDA 5A5LA 4G8NA 4PF8A 1LFGA 1IUDA 1NH8A 2O6AA 1R9QA 3HFUA 1MDQA 1B6HA 4TLMB 1PDAA 1QGXA 2F7CA 1EZOA 2DE3A 4EQBA 4NWDA 1MPDA 3GZGA 3Q26A 5I3SA 3TKDA 4GX6A 4ZDMA 5J16A 3FVKA 1FW0A 2UXAA 3LSXA 1HSEA 2ABHA 4UABA 4H45A 2O84X 3EHUA 3FXUA 4MFIA 2O7UA 2W7YA 5CC2A 1MQDA 4U4XA 2RCAA 3EN3A 4ZEBA 2DWJA 2NOOA 2D5WA 3MVWA 3TQWA 4E0WA 5H8QA 1YTVA 3TCFA 1MXVA 1NKXA 4FBPA 4QFLA 4E0XA 1DCUA 5AA2D 3T66A 1H3DA 4N8YA 5FHOA 1N84A 4H8IA 3R26A 1EU8A 1OVBA 2WBDA 5AA4A 1OQHA 2XX9A 4LZ5A 3KC0A 5ET7A 4RYAA 1URDA 3E79A 2I3WA 2HPGA 4XEQA 4G4PA 1SW1A 2O1LA 3RPWA 1B3LA 3SKPA 1Y3QA 3IORA 2ZNTA 1DBZA 2F7AA 4AS5A 1USYE 3CFXA 5CM6A 2QVRA 4RA1A 4OMBA 1NV2A 4AB6A 4F31B 3PMXA 1J1NA 3RPLB 1A54A 1IQ7A 4IGRA 1LBZA 4PC9A 3DLNA 1FTJA 1DMBA 5CBRA 1A8FA 1LSTA 4KXPA 2VD3A 1MRPA 2Y7PA 5EYGA 4UACA 2FA7A 4G2ZA 4H1XA 4XKNA 3M3FA 2V25A 3PMVA 3H6WA 2I6EA 3VFJA 5AA2A 4O3CA 5H8SA 2AL5A 3GLBA 1FPJA 2XXYA 5H8HA 4GBVA 4DI3D 2UVHA 1AOVA 1VFEA 5J1DA 1OQGA 4MNIA 4Z0IA 3RUMA 2QS2A 2I49A 4JSOA 1BIYA 1R1NA 1MDP1 4LONB 4GWSA 5TP9B 2KLFA 5ESYA 4F1YA 1B1HA 4YKPA 1A40A 4ZEFA 5IZ3B 3IFCA 3HSTA 1S9TA 2OK2A 2VP1A 1SD3A 1OLCA 4ZE9A 4MMPA 1DOTA 3BBRA 3E4RA 3B7DA 1QVSA 2ONKE 4MIJA 4PAFA 5K2YA 1POTA 1TXFA 5I59B 2I0CA 1I6BA 1O63A 4NGUA 3QYTA 1MY3A 3EKIA 1B2HA 3CI8A 4LVQA 4G77A 4U22A 4JXIA 2Q88A 1B52A 4G68C 4PGNA 2IEEA 4LZ7A 5DYHA 4GD5A 4PFRA 3VV5A 2B4MA 3O2AA 4HE1A 5FBPA 3HHFA 2R9JA 3FIRA 3TTLA 1RDXA 2FYIA 5EHMA 3IR1A 1VFDA 3T96B 3MZ1A 4WEPA 3MSTA 2YPNA 2B3BA 1FQDA 1SQYA 4NG7A 3LC8A 1FQAA 2R71A 4JDFA 4LA9A 1B3GA 2HAVA 3RGYA 1RDZA 1MG1A 2F78A 4NX1A 2MKZA 3OO9A 4N13A 4QSEA 1N3XA 5JTYB 1VR5A 2VOZA 3GBAA 2XWIA 2XXHA 3OENA 4PFUA 2I3VA 1F9BA 1DTZA 4OVRA 4G8HA 3H6TA 3RPLA 4XKPA 3VXBA 2DVZA 3ONMA 4LATA 2PT2A 4IB2A 3TODA 2F97A 2OWZA 1B7ZA 3KN7A 1IMAA 1MM7A 3USDA 1FTOA 4R9GA 2O1MA 3FV2A 1P1OA 2QFLA 4F29A 5JK4A 1HSLA 3PD8A 3DM0A 4YKJA 3ODBA 3OO8A 1FCKA 3MVZA 2ZZVA 4XTCQ 1FPBA 2DDKA 4C1TA 1UTBB 2ANJA 2YLNA 3ZKKA 1H43A 1OVTA 3IL1B 3QUFA 5ISUA 4ELPA 2ZXTA 1FPIA 5I58B 3MVYA 1Z7NE 3UP9A 4RXLA 4U1ZA 5I2KA 2UYFA 2Q8JA 4TLLB 4TOZA 2B3FA 2X7PA 5ELVA 4OFLA 4GX4A 2H5YA 4ZS9A 1QKBA 1YYZA 4FJPA 2UYEA 3DP8A 3H6VA 4P0IA 4MNPA 4F3GA 4R9FA 4K3FA 5I59A 1AH5A 2QMXA 3T9XB 5DVFA 1SVXB 5JEIA 2AYSA 4RNSA 1AWBA 1FRPA 1MY4A 3H4ZA 2NVUB 2F5XA 2F36A 4GL8A 5IAIA 4PFBA 4JSDA 3LSLA 3FASA 2Q9TA 5LDZA 5CRYA 4N6KA 4YB7A 4ELRA 4PFIA 3SEXA 3SERA 1PBQA 4QFKA 1O7TA 2WYPA 3C34A 2Y7WA 4OQOA 3OMBA 3T1BA 3V8XB 1BP5A 5EYFA 4F1UA 3C9HA 1N0TA 2Q89A 2V3UA 2XWKA 1JETA 3G3FA 4PAKA 3SZPA 4POWA 4MNCA 4RK9A 2Z8DA 3U1OA 4EXLA 3CFZA 5IZZA 4YMAA 1ATGA 1RYOA 1LBCA 3W15C 4ZZAA 2RC7A 2REGA 2QPQA 1YZ0A 3O9PA 5JTYA 3G3KA 4R2BA 4QFOA 2OJTA 1WODA 4OYVA 1P1UA 1B7HA 5FTIA 1FJ6A 3FGSA 3IOTA 2L5VA 1B4ZA 5BWJA 1B3FA 4OENA 4PF6A 5AA3A 4KFQA 3LUYA 4NF5A 1NV3A 4HW8A 3K6XA 4R6YA 3D4CA 4R73A 2I48A 1FBPA 1MXZA 1LAGE 3MVXA 1VSOA 3I5OA 3O97A 1XOCA 2RINA 1B3EA 4P9KA 5I7IA 1A99A 2FIEA 1YXIA 3VLUA 1YCJA 1OIBA 2F6GA 1QUJA 4OESA 2OWSA 2OLBA 1UTBA 4IGTA 1Y1ZA 4OTEA 1T0KA 5DW8A 5EQ7A 4PBQA 2NUVA 4DXBA 4KR5A 4GRKA 1LBXA 4PP0A 4X9TA 3HPIA 5HPQA 5I58A 4XKRA 1FBEA 3A3UA 1MY2A 3AXFA 1B58A 2PFYA 2HFBA 3PU5A 4YB6A 4RY1A 1FTAA 3IB1A 1DSNA 1H45A 2F3DA 3RTWB 5LOMA 4EXKA 1SI0A 3FXQA 2HQ0A 4XFEA 1Q1KA 2DOJA 4DCYA 3DP4A 5I56A 4H65A 2Y7KA 4N8GA 3MW0A 2O51A 4OXVA 1B5IA 2VHAA 1MQGA 5EYHA 3QK6A 4R6HA 4I3EA 2I4CA 2XXIA 3Q28A 2B65A 2FBPA 3C33A 3UIFA 4GVOA 2H99A 3Q27A 1S7YA 1FQEA 2XXTA 1D9QA 4OWDA 1PB9A 3D1RA 3H6UA 3L6HA 2DYXA 2DWIA 1B32A 4NAPA 1KWHA 3IOVA 2THIA 1BKAA 2O69A 4OVSA 4KQPA 4R72A 1AL3A 3Q29A 3CG1A 5AE4A 2BJJX 5AA1A 5HM4B 3KFMA 3MYUA 3KJTA 1B1XA 3IK6B 2AL4A 2P0SA 5EQ8A 1NL5A 5FTHA 4AS4A 4N17A 4P1EA 4RPNA 3UA8A 4H8JA 2CEYA 3M3LA 1M5FA 2PCRA 2Y5LA 3GBBA 4JVIA 2YJPA 3PPNA 5DVJA 3KG2A 4UA8A 4PE3A 3MBPA 2I58A 2F34A 3B6WA 4NWCA 3QUJA 1GVCA 1NNPA 3FJGA 4PE5B 2XHDA 2ZMBA 1O64A 4YB5A 3TQLA 1B0LA 3ILTB 4IO4A 4EDPA 3I3VA 1LAFE 3MJNA 3TDJA 4OHNA 5CMCA 3TCGA 2ZNSA 1I6AA 3PUZE 4F3SA 3TPAA 1G0HA 3UN6A 1DPEA 4QSCA 3BFUA 4C1UA 2HZKA 1LEVA 1EZPA 3MZBA 1N04A 3CSBA 4YICA 1KA1A 4LZ8A 5IGAA 4NEDA 3FZVA 1FPFA 1NUXA 1GR2A 2HAUA 3SETA 3BKIB 3RLFE 2F6PA 5I2KB 4IO3A 4JWYA 2QSXA 4XF5A 1ZLQA 3PUWE 3V89B 3BIGA 1VE4A 3ROJA 3S2VA 4IY6A 1Y4TA 4GOTA 2E1SA 1FBHA 1FTLA 3K2DA 3B8BA 3SEUA 2DS9A 3G3HA 5ET6A 2OBGA 3LSFB 3QMFA 3K02A 1MQHA 4PAIA 3MZ9A 3MP8A 5M2VA 5KDTB 3IO4A 4G68B 4G61A 4JBZA 1DPPA 3MPKA 3UGWA 1SW4A 1POY1 4F19A 2F3BA 1XVYA 4KPTA 3U93A 4OEUA 4HCYA 4QFPA 1NV0A 1ANFA 1P99A 2ZYNA 3TTNA 3MP1A 3T93B 2Z8FA 2CZIA 3TFLA 3IB0A 1FTKA 3PTYA 4YZZA 3RTFB 4EQ9A 1RDYA 3T9UA 3KBRA 3CG3A 3MAMA 3VVEA 1FBCA 1NNFA 1ELJA 2P3NA 4GF8A 1JQFA 4N6DA 5I5PA 4XKQA 2QJEA 4U2RA 2DWHA 5FHNA 3EHTA 2FVZA 4X48A 4NF0A 2IA4A 3QSLA 1NNKA 5CBSA 3TELA 4IY5A 3VDFA 1B5HA 3T22A 3KBZA 4ONYA 5K2XA 1EYJA 4BLAA 1TT1A 4POXA 2QVUA 3EHSA 1ZIUA 3FBPA 3O6GA 2LAOA 1OMPA 1SDXA 2XXQA 3KOSA 3Q25A 3DELB 4NF5B 4F3BA 1ZU0A 3K01A 3WAEA 2DSFA 4LP2B 1CNQA 2QL3A 1MXWA 3TEPA 4Q0CA 4Q8RA 4G8MA 2XXPA 1Y4CA 2DQVA 1SBPA 3S9EA 2Y5KA 1NUWA 4KCCA 3R7XA 4X1BA 3OSRA 1H44A 2V3TA 3G3JA 1NV4A 3ZKLA 4RPOA 1JW1A 1XHYA 3B6TA 4Q30B 1TFAA 5H8NB 1IMDA 3MC2A 4GWYA 1LBWA 3N6UA 4MEVA 2QS3A 1LBBA 2BJIA 3OEMA 3C36A 4KYSA 3UORA 4DXCA 4ZE8A 1MY1A 1WDNA 4JWOA 3KJ7A 3RT8A 3TUSA 3KN8A 4ZZEA 4GWXA 4KI0E 4H5GA 3K6VA 4P56A 1R9LA 3C31A 3K1PA 4ECFA 1P1QA 4GWUA 2H98A 4FE8A 2XXWA 3FV1A 1JNFA 2XD2A 1XVXA 4I8CA 2VPOA 3A29A 1PB8A 2G93A 5I56B 4H46A 3OSQA 5TPAB 5CMKA 3CR9A 5KDTA 2NWJA 4G68A 4U23A 4EQ7A 1FQBA 1FQFA 4NHBA 4WXJA 3O66A 4L17A 3S9NC 2XWOA 4MBPA 3EQ1A 1FTMA 1LBVA 4YU0A 4GLIA 3SESA 3EPEA 4IO7A 2OX3A 5LTCA 4AQ4A 1XT8A 2FNCA 2GH9A 3RT6B 1FQCA 2XX8A 4PDDA 5B7DA 3PGFA 3CIJA 2OCUA 4XIGQ 1BK4A 2CZKA 1IMBA 2E0SA 4Q5TA 3I6VA 4AB5A 3PPPA 4QHQA 1FBDA 3T9VA 4DI4B 3K6WA 4PTKA 5IKBA 4N15A 2Q2CA 3KN3A 3L6GA 2WBBA 4N4UA 4YAHX 4O7MA 1A7LA 5EQAA 1Q35A 4DDDA 2G29A 2XX7A 2Z22A 1JVXA 2QS1A 5ICQA 4ESWA 3GXAA 4GXSB 4F2OA 4FECA 4C0RA 4GWOA 1N7WA 3JYRA 4BDOA 1BTJA 1NI9A 4GIZA 3OXNA 2REJA 2V4CA 3H3GA 3IAZA 3B50A 3UK4A 2ZNUA 4NF6B 2F7BA 2Y7IA 2PT1A 4NF4B 4WEDA 1IMCA 2ZYKA 3OO6A 4PGPA 1B5JA 3RNNA 4N07A 4ZEKA 1MY0A 1SYHA 3N94A 4XXUA 4ESXA 3IX1A 4U4SA 4LQ2A 4MH5A 4GX3A 1SI1A 3U8QA 2DVCA 1FPGA 1A8EA 4JWXA 5H8NA 3BFTA 1IXHA 3FJMA 4I62A 3JV9A 4RJZA 4PBHA 1IITA 3CFLA 1Y9UA 2WKYA 1TFDA 3VLWA 3U72A 4X04A 1NV7A 3W9WA 1OLAA 2A5SA 3A3CA 3RQTA 1QUKA 4OETA 4ZEIA 5L9OA 3FXRA 2KR0A 1UQWA 4FIMA 2GHAA
chains in the Genus database with same CATH topology
3K1MA 4QFNA 5L9MA 5TPAA 5DT6A 3FD3A 3TTMA 5KZTA 4NE4A 1QKAA 3SDFA 3HO7A 3SEVA 1N3WA 3E9XA 3ILUB 3VVDA 4KHZE 3MUQA 1B7UA 4Z7EA 3H7MA 1USYH 4LQ5A 4PQJA 5I2NB 1TWYA 3QXMA 3CRBA 3TZAA 2D21A 4H67A 3V5AA 3CVGA 3C32A 5DEXA 1M5EA 1NMUA 2V93A 1IXIA 2GHBA 2ZYOA 5I57B 1IXCA 2DXYA 4F3PA 1ZKBA 3KSXA 4OEVA 3KGCA 1YPNA 3SEWA 1YAEA 2H4IA 2XXVA 3E13X 1Z7ME 1I6QA 4QSDA 4QF9A 1Y20A 2DWAA 2XXXA 3MQ9A 1UTHA 4HTGA 1LFHA 1P1NA 1LB8A 4NF6A 5A5XB 1B05A 4P0GA 4PFWA 3T9HB 1M5CA 4NF4A 1S50A 3FVNA 4DLDA 1MS7A 1ZTYA 4ZECA 3TMGA 1PEBA 1ZJLA 2DE4A 2O7IA 4EF2A 2ZYMA 2X26A 2DP8A 1I69A 3VXCA 3V83A 3D4GA 4M1VA 5F7VA 2CZLA 1B40A 1LCFA 2H9BA 4GQOA 2RC9A 1XC1A 2DXRA 3PUYE 3W9VA 4ISUA 4PFTA 1Y3NA 2P1SA 4H5FA 4NF8B 4X1DA 3VE1B 1A55A 2RF1A 4NMYA 2ONSA 3N6TA 2RKMA 4KYEA 1MXXA 3QAXA 4BDLA 4GFRA 4PETA 1B4HA 4RK2A 3M8UA 1N7XA 2V84A 5L9SA 3EF7A 5F1QA 1URGA 4F2QA 4OZ9A 3IB2A 3H06B 3RN8A 1MQJA 4KD5A 1PBPA 1LAXA 2P2AA 3OD7A 4PFYA 1NH7A 2HXWA 5TU0A 4EF1A 4IO6A 3ZSFA 1IEJA 3K1NA 3OELA 4IO2A 2D3IA 5ITPA 5I2NA 3MWBA 3RY3A 3PUVE 1US4A 3IJOB 5EHSA 1MH4A 4F18A 4OERA 3VVFA 2XXUA 1R6ZA 3R6UA 2GFEA 4F39A 1XS5A 4BDRA 1MQIA 3DP6A 3K4UA 5DTBA 2QS4A 2ONRA 3FVOA 3PPOA 3TTRA 5I57A 3H03A 1US5A 4ND9A 3FATA 2F35A 4R2FA 1LFIA 3FVGA 2XD3A 1P1WA 1M5BA 3C4MA 4DZ1A 1D9VA 3E3KA 4MLQA 3B6QA 1LLSA 1ZBMA 1IXGA 2I0BA 4I1DA 3O29A 4HS7A 2F8DA 2OWTA 2Y7RA 1JEUA 4BDMA 4GL0A 1RKMA 1DTGA 3OEKA 1BLFA 3IOWA 5CI5A 3PPRA 3N5LA 3O6HA 1URSA 3QIMA 1GV8A 3JZJA 5A5XA 2A5TB 4MLVA 3G3GA 2ESNA 1NNTA 2O68A 3S9MC 4DE8A 3OO7A 1B3HA 2M8CA 1SW5A 3K00A 1D4NA 1Y1MA 5ICTA 3THIA 3HHGA 2XXRA 1QUIA 5HBCA 1NFTA 4FORA 1JVYA 4R74A 1LAHE 1GGGA 1B46A 3PD9A 2UVGA 5H8FB 4H0WA 3K0VA 2Z8EA 4FAJA 3FUZA 1QW0A 3MPLA 4FEDA 4N6PA 1HSJA 3TYHA 4OFJA 3G7WA 2RCBA 1ZMGA 5B70A 4NF8A 3K6UA 3PUXE 1QULA 1EH3A 4HCWA 1Y3PA 4U21A 1JEVA 1L5TA 5KCJB 5TP9A 1N76A 4THIA 2RC8A 3A09A 1H76A 4O3BA 1AIVA 1SYIA 3HN0A 3IOUA 3PV0E 4KYDA 2HEUA 3G3IA 2PMSA 1MXYA 3U94A 2UVIA 1D9YA 4DCXA 2I4BA 2OZZA 2R6GE 4DXUA 3S9LC 2ALUA 5CMMA 2V3QA 1LCTA 4FEBA 3IJXB 3O6IA 1MPCA 2X7QA 3HV1A 3KOTA 1AMFA 4F22A 5BUUA 1WVJA 1IZ1A 4DIGA 3M3KA 1M5DA 1JW4A 2H25A 4M4GA 4MF3A 4NTLA 3N26A 2Z23A 4BDNA 4YKIA 5FHMA 3LR1A 3VLVA 5DEXB 1LGBC 4QRZA 2CMOA 1UIUA 3KZGA 2PVUA 4JB7A 3SEYA 2HZLA 3LBSA 3P7IA 4ELOA 5H8QB 3O28A 4BDQA 4F1VA 1EZ9A 1B0HA 2DE2A 2AIXA 3S4UA 3F11A 1LB9A 1UIVA 1MH3A 5AA4B 2Y84A 4KCDA 2PBWA 2A5TA 4R75A 3PMWA 1PB7A 1UTHB 1D3KA 2QMWA 3FJ7A 2VD2A 4FATA 4H6DA 1B51A 3KEIA 1IIWA 5I84A 4YMBA 4GXAA 2Q2AA 3MP6A 3TCHA 3ECRA 5H8FA 1II5A 4U1OA 1QJMA 2PYYA 3HCQA 2VGQA 3TAJA 3CSGA 3IO6A 4EUOA 4TQUQ 4YKKA 5L8DA 1MM6A 3C35A 3WAFA 1GTKA 1MPBA 4ELQA 4I9DA 4OFOA 4R6KA 1B9JA 3U92A 3OOAA 3LSWA 5AA2B 4P11A 1RYXA 4WKMA 1SW2A 2HCAA 5DVIA 5KCJA 5H8HB 2GRVA 5ITOA 4OVJA 1JW5A 1CE2A 1CB6A 1PC3A 3TTKA 4O3AA 3PPQA 3ZS6A 2UVJA 2PX1A 1MXUA 4IO5A 5CMBA 4LUBA 2QRYA 2NXOA 3KSJA 4ZEDA 4G8NA 1LFGA 1IUDA 1NH8A 2O6AA 1R9QA 1MDQA 1B6HA 4TLMB 1PDAA 2F7CA 1EZOA 2DE3A 4EQBA 4NWDA 1MPDA 3GZGA 3Q26A 3TKDA 4ZDMA 3FVKA 1FW0A 2UXAA 3LSXA 1HSEA 2ABHA 2O84X 3EHUA 3FXUA 4MFIA 2O7UA 2W7YA 5CC2A 1MQDA 4U4XA 2RCAA 3EN3A 4ZEBA 2DWJA 2NOOA 2D5WA 3MVWA 3TQWA 4E0WA 5H8QA 1YTVA 3TCFA 1MXVA 1NKXA 4QFLA 4E0XA 5AA2D 3T66A 1H3DA 5FHOA 1N84A 4H8IA 3R26A 1EU8A 1OVBA 5AA4A 1OQHA 2XX9A 4LZ5A 4RYAA 1URDA 2I3WA 4G4PA 1SW1A 2O1LA 3RPWA 1B3LA 3SKPA 1Y3QA 3IORA 2ZNTA 2F7AA 1USYE 3CFXA 5CM6A 4RA1A 4OMBA 4AB6A 4F31B 3PMXA 1J1NA 1A54A 1IQ7A 4IGRA 3DLNA 1FTJA 1DMBA 5CBRA 1A8FA 1LSTA 2VD3A 1MRPA 2Y7PA 4UACA 2FA7A 4G2ZA 4H1XA 4XKNA 3M3FA 2V25A 3PMVA 3H6WA 2I6EA 3VFJA 5AA2A 4O3CA 5H8SA 2AL5A 3GLBA 2XXYA 5H8HA 2UVHA 1AOVA 1VFEA 5J1DA 1OQGA 3RUMA 4Z0IA 2QS2A 2I49A 4JSOA 1BIYA 1R1NA 1MDP1 4LONB 5TP9B 2KLFA 4F1YA 1B1HA 4YKPA 1A40A 4ZEFA 3HSTA 1S9TA 2OK2A 2VP1A 1SD3A 1OLCA 4ZE9A 1DOTA 3BBRA 3E4RA 3B7DA 1QVSA 2ONKE 5K2YA 1POTA 1TXFA 5I59B 2I0CA 1I6BA 1O63A 3QYTA 1MY3A 1B2HA 3CI8A 4LVQA 4G77A 4U22A 4JXIA 2Q88A 1B52A 4G68C 2IEEA 4LZ7A 5DYHA 4GD5A 3VV5A 3O2AA 3HHFA 2R9JA 3FIRA 3TTLA 2FYIA 5EHMA 3IR1A 1VFDA 3T96B 3MZ1A 4WEPA 2YPNA 2B3BA 1FQDA 1SQYA 3LC8A 1FQAA 2R71A 4JDFA 4LA9A 1B3GA 2HAVA 3RGYA 1MG1A 2F78A 3OO9A 4N13A 4QSEA 1N3XA 5JTYB 1VR5A 2VOZA 3GBAA 2XXHA 3OENA 4PFUA 2I3VA 1F9BA 1DTZA 4G8HA 3H6TA 4XKPA 3VXBA 2DVZA 3ONMA 4LATA 2PT2A 4IB2A 3TODA 2F97A 1B7ZA 3KN7A 1MM7A 3USDA 1FTOA 4R9GA 2O1MA 3FV2A 1P1OA 4F29A 5JK4A 1HSLA 3PD8A 3DM0A 4YKJA 3ODBA 3OO8A 1FCKA 3MVZA 4XTCQ 4C1TA 1UTBB 2ANJA 2YLNA 3ZKKA 1H43A 1OVTA 3IL1B 3QUFA 5ISUA 4ELPA 2ZXTA 5I58B 3MVYA 1Z7NE 3UP9A 4RXLA 4U1ZA 5I2KA 2UYFA 2Q8JA 4TLLB 4TOZA 2B3FA 2X7PA 5ELVA 4OFLA 2H5YA 4ZS9A 1QKBA 4FJPA 2UYEA 3DP8A 3H6VA 4P0IA 4F3GA 4R9FA 4K3FA 5I59A 1AH5A 2QMXA 3T9XB 5DVFA 1SVXB 5JEIA 2AYSA 4RNSA 3H4ZA 1MY4A 2NVUB 2F5XA 2F36A 4GL8A 5IAIA 4JSDA 3LSLA 3FASA 2Q9TA 5CRYA 4YB7A 4ELRA 3SEXA 3SERA 1PBQA 4QFKA 1O7TA 3C34A 2Y7WA 4OQOA 3OMBA 3V8XB 1BP5A 5EYFA 4F1UA 3C9HA 1N0TA 2Q89A 2V3UA 3G3FA 1JETA 4POWA 4RK9A 2Z8DA 3U1OA 4EXLA 3CFZA 4YMAA 1ATGA 1RYOA 1LBCA 3W15C 4ZZAA 2RC7A 2REGA 2QPQA 3O9PA 5JTYA 3G3KA 4R2BA 4QFOA 2OJTA 1WODA 4OYVA 1P1UA 1B7HA 5FTIA 3FGSA 3IOTA 1B4ZA 5BWJA 1B3FA 4OENA 5AA3A 4KFQA 3LUYA 4NF5A 4HW8A 3K6XA 4R6YA 3D4CA 4R73A 2I48A 1MXZA 1LAGE 3MVXA 1VSOA 3I5OA 3O97A 1XOCA 2RINA 1B3EA 1A99A 3VLUA 1YCJA 1OIBA 2F6GA 1QUJA 4OESA 2OWSA 2OLBA 1UTBA 4IGTA 1Y1ZA 4OTEA 1T0KA 2NUVA 4DXBA 4KR5A 4GRKA 4PP0A 4X9TA 3HPIA 5HPQA 5I58A 4XKRA 3A3UA 1MY2A 3AXFA 1B58A 2HFBA 3PU5A 4YB6A 4RY1A 3IB1A 1DSNA 1H45A 3RTWB 5LOMA 4EXKA 1SI0A 3FXQA 2HQ0A 1Q1KA 2DOJA 4DCYA 3DP4A 5I56A 4H65A 2Y7KA 3MW0A 2O51A 4OXVA 1B5IA 2VHAA 1MQGA 3QK6A 4R6HA 2I4CA 2XXIA 3Q28A 2B65A 3C33A 3UIFA 4GVOA 2H99A 3Q27A 1S7YA 1FQEA 2XXTA 4OWDA 1PB9A 3H6UA 3L6HA 2DYXA 2DWIA 1B32A 1KWHA 3IOVA 2THIA 1BKAA 2O69A 4KQPA 4R72A 1AL3A 3Q29A 3CG1A 5AE4A 2BJJX 5AA1A 5HM4B 3KFMA 3KJTA 1B1XA 3IK6B 2AL4A 2P0SA 1NL5A 5FTHA 4RPNA 3UA8A 4H8JA 3M3LA 1M5FA 3GBBA 2YJPA 3PPNA 5DVJA 3KG2A 4UA8A 3MBPA 2I58A 2F34A 3B6WA 4NWCA 3QUJA 1GVCA 1NNPA 3FJGA 4PE5B 2XHDA 2ZMBA 1O64A 4YB5A 3TQLA 1B0LA 3ILTB 4IO4A 4EDPA 3I3VA 1LAFE 3MJNA 3TDJA 4OHNA 5CMCA 3TCGA 2ZNSA 1I6AA 3PUZE 4F3SA 3TPAA 3UN6A 1DPEA 4QSCA 3BFUA 4C1UA 2HZKA 1EZPA 3MZBA 1N04A 3CSBA 4YICA 4LZ8A 4NEDA 3FZVA 1GR2A 2HAUA 3SETA 3BKIB 3RLFE 2F6PA 5I2KB 4IO3A 4JWYA 2QSXA 1ZLQA 3PUWE 3V89B 1VE4A 3S2VA 4IY6A 1Y4TA 4GOTA 2E1SA 1FTLA 3K2DA 3SEUA 2DS9A 3G3HA 2OBGA 3LSFB 3K02A 1MQHA 3MZ9A 3MP8A 5M2VA 5KDTB 3IO4A 4G68B 4JBZA 1DPPA 3MPKA 3UGWA 1SW4A 1POY1 4F19A 1XVYA 4KPTA 3U93A 4OEUA 4HCYA 4QFPA 1ANFA 1P99A 2ZYNA 3TTNA 3MP1A 3T93B 2Z8FA 3TFLA 3IB0A 1FTKA 4YZZA 4EQ9A 3RTFB 3T9UA 3KBRA 3CG3A 3MAMA 3VVEA 1NNFA 1ELJA 4GF8A 1JQFA 4XKQA 2QJEA 4U2RA 2DWHA 5FHNA 3EHTA 4X48A 2IA4A 3QSLA 1NNKA 5CBSA 3TELA 4IY5A 3VDFA 1B5HA 3T22A 4ONYA 5K2XA 4BLAA 1TT1A 4POXA 3EHSA 1ZIUA 3O6GA 2LAOA 1OMPA 1SDXA 2XXQA 3KOSA 3Q25A 3DELB 4NF5B 4F3BA 1ZU0A 3K01A 3WAEA 2DSFA 4LP2B 2QL3A 1MXWA 3TEPA 4Q0CA 4Q8RA 4G8MA 2XXPA 1Y4CA 2DQVA 1SBPA 3S9EA 4KCCA 3R7XA 4X1BA 3OSRA 1H44A 2V3TA 3G3JA 3ZKLA 4RPOA 1JW1A 1XHYA 3B6TA 4Q30B 1TFAA 5H8NB 3MC2A 3N6UA 2QS3A 1LBBA 3OEMA 3C36A 4KYSA 3UORA 4DXCA 4ZE8A 1MY1A 1WDNA 4JWOA 3KJ7A 3RT8A 3TUSA 3KN8A 4ZZEA 4KI0E 4H5GA 3K6VA 1R9LA 3C31A 3K1PA 4ECFA 1P1QA 2H98A 4FE8A 2XXWA 3FV1A 1JNFA 2XD2A 1XVXA 4I8CA 1PB8A 2G93A 5I56B 3OSQA 5TPAB 5CMKA 3CR9A 5KDTA 2NWJA 4G68A 4U23A 4EQ7A 1FQBA 1FQFA 4WXJA 3O66A 4L17A 3S9NC 4MBPA 3EQ1A 1FTMA 4YU0A 4GLIA 3SESA 3EPEA 4IO7A 4AQ4A 1XT8A 2FNCA 2GH9A 3RT6B 1FQCA 2XX8A 5B7DA 3PGFA 3CIJA 2OCUA 4XIGQ 2E0SA 4Q5TA 3I6VA 4AB5A 3PPPA 4QHQA 3T9VA 3K6WA 5IKBA 2Q2CA 3KN3A 3L6GA 4YAHX 1A7LA 1Q35A 4DDDA 2G29A 2XX7A 2Z22A 1JVXA 2QS1A 5ICQA 4ESWA 3GXAA 4GXSB 4F2OA 4FECA 4C0RA 4GWOA 1N7WA 3JYRA 4BDOA 1BTJA 4GIZA 3OXNA 2REJA 3H3GA 3IAZA 3UK4A 2ZNUA 4NF6B 2F7BA 2Y7IA 2PT1A 4NF4B 4WEDA 2ZYKA 3OO6A 1B5JA 3RNNA 4N07A 4ZEKA 1MY0A 1SYHA 3N94A 4XXUA 4ESXA 3IX1A 4U4SA 4LQ2A 4MH5A 1SI1A 3U8QA 2DVCA 1A8EA 4JWXA 5H8NA 3BFTA 1IXHA 3FJMA 4I62A 3JV9A 4RJZA 1IITA 3CFLA 1Y9UA 2WKYA 1TFDA 3VLWA 3U72A 3W9WA 1OLAA 2A5SA 3A3CA 3RQTA 1QUKA 4OETA 4ZEIA 5L9OA 3FXRA 1UQWA 4FIMA 2GHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1M A;  4QFN A;  5L9M A;  5TPA A;  5DT6 A;  3FD3 A;  3TTM A;  5KZT A;  4NE4 A;  1QKA A;  3SDF A;  3HO7 A;  3SEV A;  1N3W A;  3E9X A;  3ILU B;  3VVD A;  4KHZ E;  3MUQ A;  1B7U A;  4Z7E A;  3H7M A;  1USY H;  4LQ5 A;  4PQJ A;  5I2N B;  1TWY A;  3QXM A;  3CRB A;  3TZA A;  2D21 A;  4H67 A;  3V5A A;  3CVG A;  3C32 A;  5DEX A;  1M5E A;  1NMU A;  2V93 A;  1IXI A;  2GHB A;  2ZYO A;  5I57 B;  1IXC A;  2DXY A;  4F3P A;  1ZKB A;  3KSX A;  4OEV A;  3KGC A;  1YPN A;  3SEW A;  1YAE A;  2H4I A;  2XXV A;  3E13 X;  1Z7M E;  1I6Q A;  4QSD A;  4QF9 A;  1Y20 A;  2DWA A;  2XXX A;  3MQ9 A;  1UTH A;  4HTG A;  1LFH A;  1P1N A;  1LB8 A;  4NF6 A;  5A5X B;  1B05 A;  4P0G A;  4PFW A;  3T9H B;  1M5C A;  4NF4 A;  1S50 A;  3FVN A;  4DLD A;  1MS7 A;  1ZTY A;  4ZEC A;  3TMG A;  1PEB A;  1ZJL A;  2DE4 A;  2O7I A;  4EF2 A;  2ZYM A;  2X26 A;  2DP8 A;  1I69 A;  3VXC A;  3V83 A;  3D4G A;  4M1V A;  5F7V A;  2CZL A;  1B40 A;  1LCF A;  2H9B A;  4GQO A;  2RC9 A;  1XC1 A;  2DXR A;  3PUY E;  3W9V A;  4ISU A;  4PFT A;  1Y3N A;  2P1S A;  4H5F A;  4NF8 B;  4X1D A;  3VE1 B;  1A55 A;  2RF1 A;  4NMY A;  2ONS A;  3N6T A;  2RKM A;  4KYE A;  1MXX A;  3QAX A;  4BDL A;  4GFR A;  4PET A;  1B4H A;  4RK2 A;  3M8U A;  1N7X A;  2V84 A;  5L9S A;  3EF7 A;  5F1Q A;  1URG A;  4F2Q A;  4OZ9 A;  3IB2 A;  3H06 B;  3RN8 A;  1MQJ A;  4KD5 A;  1PBP A;  1LAX A;  2P2A A;  3OD7 A;  4PFY A;  1NH7 A;  2HXW A;  5TU0 A;  4EF1 A;  4IO6 A;  3ZSF A;  1IEJ A;  3K1N A;  3OEL A;  4IO2 A;  2D3I A;  5ITP A;  5I2N A;  3MWB A;  3RY3 A;  3PUV E;  1US4 A;  3IJO B;  5EHS A;  1MH4 A;  4F18 A;  4OER A;  3VVF A;  2XXU A;  1R6Z A;  3R6U A;  2GFE A;  4F39 A;  1XS5 A;  4BDR A;  1MQI A;  3DP6 A;  3K4U A;  5DTB A;  2QS4 A;  2ONR A;  3FVO A;  3PPO A;  3TTR A;  5I57 A;  3H03 A;  1US5 A;  4ND9 A;  3FAT A;  2F35 A;  4R2F A;  1LFI A;  3FVG A;  2XD3 A;  1P1W A;  1M5B A;  3C4M A;  4DZ1 A;  1D9V A;  3E3K A;  4MLQ A;  3B6Q A;  1LLS A;  1ZBM A;  1IXG A;  2I0B A;  4I1D A;  3O29 A;  4HS7 A;  2F8D A;  2OWT A;  2Y7R A;  1JEU A;  4BDM A;  4GL0 A;  1RKM A;  1DTG A;  3OEK A;  1BLF A;  3IOW A;  5CI5 A;  3PPR A;  3N5L A;  3O6H A;  1URS A;  3QIM A;  1GV8 A;  3JZJ A;  5A5X A;  2A5T B;  4MLV A;  3G3G A;  2ESN A;  1NNT A;  2O68 A;  3S9M C;  4DE8 A;  3OO7 A;  1B3H A;  2M8C A;  1SW5 A;  3K00 A;  1D4N A;  1Y1M A;  5ICT A;  3THI A;  3HHG A;  2XXR A;  1QUI A;  5HBC A;  1NFT A;  4FOR A;  1JVY A;  4R74 A;  1LAH E;  1GGG A;  1B46 A;  3PD9 A;  2UVG A;  5H8F B;  4H0W A;  3K0V A;  2Z8E A;  4FAJ A;  3FUZ A;  1QW0 A;  3MPL A;  4FED A;  4N6P A;  1HSJ A;  3TYH A;  4OFJ A;  3G7W A;  2RCB A;  1ZMG A;  5B70 A;  4NF8 A;  3K6U A;  3PUX E;  1QUL A;  1EH3 A;  4HCW A;  1Y3P A;  4U21 A;  1JEV A;  1L5T A;  5KCJ B;  5TP9 A;  1N76 A;  4THI A;  2RC8 A;  3A09 A;  1H76 A;  4O3B A;  1AIV A;  1SYI A;  3HN0 A;  3IOU A;  3PV0 E;  4KYD A;  2HEU A;  3G3I A;  2PMS A;  1MXY A;  3U94 A;  2UVI A;  1D9Y A;  4DCX A;  2I4B A;  2OZZ A;  2R6G E;  4DXU A;  3S9L C;  2ALU A;  5CMM A;  2V3Q A;  1LCT A;  4FEB A;  3IJX B;  3O6I A;  1MPC A;  2X7Q A;  3HV1 A;  3KOT A;  1AMF A;  4F22 A;  5BUU A;  1WVJ A;  1IZ1 A;  4DIG A;  3M3K A;  1M5D A;  1JW4 A;  2H25 A;  4M4G A;  4MF3 A;  4NTL A;  3N26 A;  2Z23 A;  4BDN A;  4YKI A;  5FHM A;  3LR1 A;  3VLV A;  5DEX B;  1LGB C;  4QRZ A;  2CMO A;  1UIU A;  3KZG A;  2PVU A;  4JB7 A;  3SEY A;  2HZL A;  3LBS A;  3P7I A;  4ELO A;  5H8Q B;  3O28 A;  4BDQ A;  4F1V A;  1EZ9 A;  1B0H A;  2DE2 A;  2AIX A;  3S4U A;  3F11 A;  1LB9 A;  1UIV A;  1MH3 A;  5AA4 B;  2Y84 A;  4KCD A;  2PBW A;  2A5T A;  4R75 A;  3PMW A;  1PB7 A;  1UTH B;  1D3K A;  2QMW A;  3FJ7 A;  2VD2 A;  4FAT A;  4H6D A;  1B51 A;  3KEI A;  1IIW A;  5I84 A;  4YMB A;  4GXA A;  2Q2A A;  3MP6 A;  3TCH A;  3ECR A;  5H8F A;  1II5 A;  4U1O A;  1QJM A;  2PYY A;  3HCQ A;  2VGQ A;  3TAJ A;  3CSG A;  3IO6 A;  4EUO A;  4TQU Q;  4YKK A;  5L8D A;  1MM6 A;  3C35 A;  3WAF A;  1GTK A;  1MPB A;  4ELQ A;  4I9D A;  4OFO A;  4R6K A;  1B9J A;  3U92 A;  3OOA A;  3LSW A;  5AA2 B;  4P11 A;  1RYX A;  4WKM A;  1SW2 A;  2HCA A;  5DVI A;  5KCJ A;  5H8H B;  2GRV A;  5ITO A;  4OVJ A;  1JW5 A;  1CE2 A;  1CB6 A;  1PC3 A;  3TTK A;  4O3A A;  3PPQ A;  3ZS6 A;  2UVJ A;  2PX1 A;  1MXU A;  4IO5 A;  5CMB A;  4LUB A;  2QRY A;  2NXO A;  3KSJ A;  4ZED A;  4G8N A;  1LFG A;  1IUD A;  1NH8 A;  2O6A A;  1R9Q A;  1MDQ A;  1B6H A;  4TLM B;  1PDA A;  2F7C A;  1EZO A;  2DE3 A;  4EQB A;  4NWD A;  1MPD A;  3GZG A;  3Q26 A;  3TKD A;  4ZDM A;  3FVK A;  1FW0 A;  2UXA A;  3LSX A;  1HSE A;  2ABH A;  2O84 X;  3EHU A;  3FXU A;  4MFI A;  2O7U A;  2W7Y A;  5CC2 A;  1MQD A;  4U4X A;  2RCA A;  3EN3 A;  4ZEB A;  2DWJ A;  2NOO A;  2D5W A;  3MVW A;  3TQW A;  4E0W A;  5H8Q A;  1YTV A;  3TCF A;  1MXV A;  1NKX A;  4QFL A;  4E0X A;  5AA2 D;  3T66 A;  1H3D A;  5FHO A;  1N84 A;  4H8I A;  3R26 A;  1EU8 A;  1OVB A;  5AA4 A;  1OQH A;  2XX9 A;  4LZ5 A;  4RYA A;  1URD A;  2I3W A;  4G4P A;  1SW1 A;  2O1L A;  3RPW A;  1B3L A;  3SKP A;  1Y3Q A;  3IOR A;  2ZNT A;  2F7A A;  1USY E;  3CFX A;  5CM6 A;  4RA1 A;  4OMB A;  4AB6 A;  4F31 B;  3PMX A;  1J1N A;  1A54 A;  1IQ7 A;  4IGR A;  3DLN A;  1FTJ A;  1DMB A;  5CBR A;  1A8F A;  1LST A;  2VD3 A;  1MRP A;  2Y7P A;  4UAC A;  2FA7 A;  4G2Z A;  4H1X A;  4XKN A;  3M3F A;  2V25 A;  3PMV A;  3H6W A;  2I6E A;  3VFJ A;  5AA2 A;  4O3C A;  5H8S A;  2AL5 A;  3GLB A;  2XXY A;  5H8H A;  2UVH A;  1AOV A;  1VFE A;  5J1D A;  1OQG A;  3RUM A;  4Z0I A;  2QS2 A;  2I49 A;  4JSO A;  1BIY A;  1R1N A;  1MDP 1;  4LON B;  5TP9 B;  2KLF A;  4F1Y A;  1B1H A;  4YKP A;  1A40 A;  4ZEF A;  3HST A;  1S9T A;  2OK2 A;  2VP1 A;  1SD3 A;  1OLC A;  4ZE9 A;  1DOT A;  3BBR A;  3E4R A;  3B7D A;  1QVS A;  2ONK E;  5K2Y A;  1POT A;  1TXF A;  5I59 B;  2I0C A;  1I6B A;  1O63 A;  3QYT A;  1MY3 A;  1B2H A;  3CI8 A;  4LVQ A;  4G77 A;  4U22 A;  4JXI A;  2Q88 A;  1B52 A;  4G68 C;  2IEE A;  4LZ7 A;  5DYH A;  4GD5 A;  3VV5 A;  3O2A A;  3HHF A;  2R9J A;  3FIR A;  3TTL A;  2FYI A;  5EHM A;  3IR1 A;  1VFD A;  3T96 B;  3MZ1 A;  4WEP A;  2YPN A;  2B3B A;  1FQD A;  1SQY A;  3LC8 A;  1FQA A;  2R71 A;  4JDF A;  4LA9 A;  1B3G A;  2HAV A;  3RGY A;  1MG1 A;  2F78 A;  3OO9 A;  4N13 A;  4QSE A;  1N3X A;  5JTY B;  1VR5 A;  2VOZ A;  3GBA A;  2XXH A;  3OEN A;  4PFU A;  2I3V A;  1F9B A;  1DTZ A;  4G8H A;  3H6T A;  4XKP A;  3VXB A;  2DVZ A;  3ONM A;  4LAT A;  2PT2 A;  4IB2 A;  3TOD A;  2F97 A;  1B7Z A;  3KN7 A;  1MM7 A;  3USD A;  1FTO A;  4R9G A;  2O1M A;  3FV2 A;  1P1O A;  4F29 A;  5JK4 A;  1HSL A;  3PD8 A;  3DM0 A;  4YKJ A;  3ODB A;  3OO8 A;  1FCK A;  3MVZ A;  4XTC Q;  4C1T A;  1UTB B;  2ANJ A;  2YLN A;  3ZKK A;  1H43 A;  1OVT A;  3IL1 B;  3QUF A;  5ISU A;  4ELP A;  2ZXT A;  5I58 B;  3MVY A;  1Z7N E;  3UP9 A;  4RXL A;  4U1Z A;  5I2K A;  2UYF A;  2Q8J A;  4TLL B;  4TOZ A;  2B3F A;  2X7P A;  5ELV A;  4OFL A;  2H5Y A;  4ZS9 A;  1QKB A;  4FJP A;  2UYE A;  3DP8 A;  3H6V A;  4P0I A;  4F3G A;  4R9F A;  4K3F A;  5I59 A;  1AH5 A;  2QMX A;  3T9X B;  5DVF A;  1SVX B;  5JEI A;  2AYS A;  4RNS A;  3H4Z A;  1MY4 A;  2NVU B;  2F5X A;  2F36 A;  4GL8 A;  5IAI A;  4JSD A;  3LSL A;  3FAS A;  2Q9T A;  5CRY A;  4YB7 A;  4ELR A;  3SEX A;  3SER A;  1PBQ A;  4QFK A;  1O7T A;  3C34 A;  2Y7W A;  4OQO A;  3OMB A;  3V8X B;  1BP5 A;  5EYF A;  4F1U A;  3C9H A;  1N0T A;  2Q89 A;  2V3U A;  3G3F A;  1JET A;  4POW A;  4RK9 A;  2Z8D A;  3U1O A;  4EXL A;  3CFZ A;  4YMA A;  1ATG A;  1RYO A;  1LBC A;  3W15 C;  4ZZA A;  2RC7 A;  2REG A;  2QPQ A;  3O9P A;  5JTY A;  3G3K A;  4R2B A;  4QFO A;  2OJT A;  1WOD A;  4OYV A;  1P1U A;  1B7H A;  5FTI A;  3FGS A;  3IOT A;  1B4Z A;  5BWJ A;  1B3F A;  4OEN A;  5AA3 A;  4KFQ A;  3LUY A;  4NF5 A;  4HW8 A;  3K6X A;  4R6Y A;  3D4C A;  4R73 A;  2I48 A;  1MXZ A;  1LAG E;  3MVX A;  1VSO A;  3I5O A;  3O97 A;  1XOC A;  2RIN A;  1B3E A;  1A99 A;  3VLU A;  1YCJ A;  1OIB A;  2F6G A;  1QUJ A;  4OES A;  2OWS A;  2OLB A;  1UTB A;  4IGT A;  1Y1Z A;  4OTE A;  1T0K A;  2NUV A;  4DXB A;  4KR5 A;  4GRK A;  4PP0 A;  4X9T A;  3HPI A;  5HPQ A;  5I58 A;  4XKR A;  3A3U A;  1MY2 A;  3AXF A;  1B58 A;  2HFB A;  3PU5 A;  4YB6 A;  4RY1 A;  3IB1 A;  1DSN A;  1H45 A;  3RTW B;  5LOM A;  4EXK A;  1SI0 A;  3FXQ A;  2HQ0 A;  1Q1K A;  2DOJ A;  4DCY A;  3DP4 A;  5I56 A;  4H65 A;  2Y7K A;  3MW0 A;  2O51 A;  4OXV A;  1B5I A;  2VHA A;  1MQG A;  3QK6 A;  4R6H A;  2I4C A;  2XXI A;  3Q28 A;  2B65 A;  3C33 A;  3UIF A;  4GVO A;  2H99 A;  3Q27 A;  1S7Y A;  1FQE A;  2XXT A;  4OWD A;  1PB9 A;  3H6U A;  3L6H A;  2DYX A;  2DWI A;  1B32 A;  1KWH A;  3IOV A;  2THI A;  1BKA A;  2O69 A;  4KQP A;  4R72 A;  1AL3 A;  3Q29 A;  3CG1 A;  5AE4 A;  2BJJ X;  5AA1 A;  5HM4 B;  3KFM A;  3KJT A;  1B1X A;  3IK6 B;  2AL4 A;  2P0S A;  1NL5 A;  5FTH A;  4RPN A;  3UA8 A;  4H8J A;  3M3L A;  1M5F A;  3GBB A;  2YJP A;  3PPN A;  5DVJ A;  3KG2 A;  4UA8 A;  3MBP A;  2I58 A;  2F34 A;  3B6W A;  4NWC A;  3QUJ A;  1GVC A;  1NNP A;  3FJG A;  4PE5 B;  2XHD A;  2ZMB A;  1O64 A;  4YB5 A;  3TQL A;  1B0L A;  3ILT B;  4IO4 A;  4EDP A;  3I3V A;  1LAF E;  3MJN A;  3TDJ A;  4OHN A;  5CMC A;  3TCG A;  2ZNS A;  1I6A A;  3PUZ E;  4F3S A;  3TPA A;  3UN6 A;  1DPE A;  4QSC A;  3BFU A;  4C1U A;  2HZK A;  1EZP A;  3MZB A;  1N04 A;  3CSB A;  4YIC A;  4LZ8 A;  4NED A;  3FZV A;  1GR2 A;  2HAU A;  3SET A;  3BKI B;  3RLF E;  2F6P A;  5I2K B;  4IO3 A;  4JWY A;  2QSX A;  1ZLQ A;  3PUW E;  3V89 B;  1VE4 A;  3S2V A;  4IY6 A;  1Y4T A;  4GOT A;  2E1S A;  1FTL A;  3K2D A;  3SEU A;  2DS9 A;  3G3H A;  2OBG A;  3LSF B;  3K02 A;  1MQH A;  3MZ9 A;  3MP8 A;  5M2V A;  5KDT B;  3IO4 A;  4G68 B;  4JBZ A;  1DPP A;  3MPK A;  3UGW A;  1SW4 A;  1POY 1;  4F19 A;  1XVY A;  4KPT A;  3U93 A;  4OEU A;  4HCY A;  4QFP A;  1ANF A;  1P99 A;  2ZYN A;  3TTN A;  3MP1 A;  3T93 B;  2Z8F A;  3TFL A;  3IB0 A;  1FTK A;  4YZZ A;  4EQ9 A;  3RTF B;  3T9U A;  3KBR A;  3CG3 A;  3MAM A;  3VVE A;  1NNF A;  1ELJ A;  4GF8 A;  1JQF A;  4XKQ A;  2QJE A;  4U2R A;  2DWH A;  5FHN A;  3EHT A;  4X48 A;  2IA4 A;  3QSL A;  1NNK A;  5CBS A;  3TEL A;  4IY5 A;  3VDF A;  1B5H A;  3T22 A;  4ONY A;  5K2X A;  4BLA A;  1TT1 A;  4POX A;  3EHS A;  1ZIU A;  3O6G A;  2LAO A;  1OMP A;  1SDX A;  2XXQ A;  3KOS A;  3Q25 A;  3DEL B;  4NF5 B;  4F3B A;  1ZU0 A;  3K01 A;  3WAE A;  2DSF A;  4LP2 B;  2QL3 A;  1MXW A;  3TEP A;  4Q0C A;  4Q8R A;  4G8M A;  2XXP A;  1Y4C A;  2DQV A;  1SBP A;  3S9E A;  4KCC A;  3R7X A;  4X1B A;  3OSR A;  1H44 A;  2V3T A;  3G3J A;  3ZKL A;  4RPO A;  1JW1 A;  1XHY A;  3B6T A;  4Q30 B;  1TFA A;  5H8N B;  3MC2 A;  3N6U A;  2QS3 A;  1LBB A;  3OEM A;  3C36 A;  4KYS A;  3UOR A;  4DXC A;  4ZE8 A;  1MY1 A;  1WDN A;  4JWO A;  3KJ7 A;  3RT8 A;  3TUS A;  3KN8 A;  4ZZE A;  4KI0 E;  4H5G A;  3K6V A;  1R9L A;  3C31 A;  3K1P A;  4ECF A;  1P1Q A;  2H98 A;  4FE8 A;  2XXW A;  3FV1 A;  1JNF A;  2XD2 A;  1XVX A;  4I8C A;  1PB8 A;  2G93 A;  5I56 B;  3OSQ A;  5TPA B;  5CMK A;  3CR9 A;  5KDT A;  2NWJ A;  4G68 A;  4U23 A;  4EQ7 A;  1FQB A;  1FQF A;  4WXJ A;  3O66 A;  4L17 A;  3S9N C;  4MBP A;  3EQ1 A;  1FTM A;  4YU0 A;  4GLI A;  3SES A;  3EPE A;  4IO7 A;  4AQ4 A;  1XT8 A;  2FNC A;  2GH9 A;  3RT6 B;  1FQC A;  2XX8 A;  5B7D A;  3PGF A;  3CIJ A;  2OCU A;  4XIG Q;  2E0S A;  4Q5T A;  3I6V A;  4AB5 A;  3PPP A;  4QHQ A;  3T9V A;  3K6W A;  5IKB A;  2Q2C A;  3KN3 A;  3L6G A;  4YAH X;  1A7L A;  1Q35 A;  4DDD A;  2G29 A;  2XX7 A;  2Z22 A;  1JVX A;  2QS1 A;  5ICQ A;  4ESW A;  3GXA A;  4GXS B;  4F2O A;  4FEC A;  4C0R A;  4GWO A;  1N7W A;  3JYR A;  4BDO A;  1BTJ A;  4GIZ A;  3OXN A;  2REJ A;  3H3G A;  3IAZ A;  3UK4 A;  2ZNU A;  4NF6 B;  2F7B A;  2Y7I A;  2PT1 A;  4NF4 B;  4WED A;  2ZYK A;  3OO6 A;  1B5J A;  3RNN A;  4N07 A;  4ZEK A;  1MY0 A;  1SYH A;  3N94 A;  4XXU A;  4ESX A;  3IX1 A;  4U4S A;  4LQ2 A;  4MH5 A;  1SI1 A;  3U8Q A;  2DVC A;  1A8E A;  4JWX A;  5H8N A;  3BFT A;  1IXH A;  3FJM A;  4I62 A;  3JV9 A;  4RJZ A;  1IIT A;  3CFL A;  1Y9U A;  2WKY A;  1TFD A;  3VLW A;  3U72 A;  3W9W A;  1OLA A;  2A5S A;  3A3C A;  3RQT A;  1QUK A;  4OET A;  4ZEI A;  5L9O A;  3FXR A;  1UQW A;  4FIM A;  2GHA A; 
#chains in the Genus database with same CATH topology
 3K1M A;  1FSA A;  4QFN A;  5L9M A;  5TPA A;  4N91 A;  3E78 A;  5DT6 A;  2FHY A;  3FD3 A;  3TTM A;  5KZT A;  4NE4 A;  1QKA A;  3SDF A;  1XI6 A;  3HO7 A;  3U65 A;  3SEV A;  1N3W A;  3E9X A;  3ILU B;  3VVD A;  4KHZ E;  3MUQ A;  1B7U A;  4Z7E A;  3H7M A;  1USY H;  4LQ5 A;  4PQJ A;  5I2N B;  1FPL A;  1TWY A;  3QXM A;  3CRB A;  3TZA A;  2QVV A;  2JJK A;  2D21 A;  4H67 A;  3FXB A;  3V5A A;  3CVG A;  3C32 A;  2XWV A;  5DEX A;  1M5E A;  1NMU A;  2V93 A;  1IXI A;  2GHB A;  2ZYO A;  4JVC A;  5I57 B;  1EYI A;  1IXC A;  4MX6 A;  2DXY A;  4F3P A;  1ZKB A;  3KSX A;  1FJ9 A;  4OEV A;  3KGC A;  1YPN A;  3SEW A;  1YAE A;  2XXK A;  2H4I A;  2XXV A;  3E13 X;  1Z7M E;  1I6Q A;  3T0J A;  4QSD A;  1NV1 A;  1Y20 A;  4QF9 A;  2DWA A;  2XXX A;  3MQ9 A;  1UTH A;  4HTG A;  1LFH A;  1P1N A;  1LB8 A;  4NF6 A;  5A5X B;  1B05 A;  4P0G A;  4PFW A;  3T9H B;  1M5C A;  4NF4 A;  1S50 A;  3FVN A;  4DLD A;  2ZZX A;  1MS7 A;  1ZTY A;  2XA5 A;  4HXV A;  4ZEC A;  4O8M A;  3TMG A;  1PEB A;  1ZJL A;  2DE4 A;  2O7I A;  4EF2 A;  2ZYM A;  2X26 A;  4OVQ A;  2DP8 A;  1I69 A;  3VXC A;  3V83 A;  5IZ1 A;  2PFZ A;  1K9Y A;  3D4G A;  4M1V A;  5F7V A;  2CZL A;  1B40 A;  1LCF A;  2H9B A;  4GQO A;  2RC9 A;  1XC1 A;  2DXR A;  3PUY E;  3W9V A;  4ISU A;  4PFT A;  1Y3N A;  2P1S A;  4H5F A;  1SPI A;  4OA4 A;  4NF8 B;  4X1D A;  4GBW A;  3VE1 B;  1A55 A;  2RF1 A;  4NMY A;  2ONS A;  3N6T A;  2RKM A;  4KYE A;  1MXX A;  3QAX A;  4BDL A;  4GWZ A;  4GFR A;  4PET A;  1B4H A;  4RK2 A;  3M8U A;  4OVT A;  1N7X A;  2CEX A;  2V84 A;  5L9S A;  3EF7 A;  5F1Q A;  1URG A;  1NV5 A;  4N81 A;  4F2Q A;  4OZ9 A;  3IB2 A;  3H06 B;  1FPE A;  3RN8 A;  1MQJ A;  4KD5 A;  1PBP A;  4NN3 A;  1LAX A;  2P2A A;  4HE2 A;  3OD7 A;  4PFY A;  1NH7 A;  2HXW A;  1FPD A;  5TU0 A;  4EF1 A;  4IO6 A;  3ZSF A;  1IEJ A;  3K1N A;  3OEL A;  4IO2 A;  2D3I A;  5ITP A;  1JP4 A;  5I2N A;  3MWB A;  4I40 A;  3RY3 A;  3PUV E;  1US4 A;  3IJO B;  5EHS A;  2HHM A;  1MH4 A;  4F18 A;  2WEF A;  4OER A;  3VVF A;  2XXU A;  1R6Z A;  3R6U A;  2GFE A;  4F39 A;  3IFA A;  1XS5 A;  4QXD A;  4BDR A;  1MQI A;  3DP6 A;  3K4U A;  1LBY A;  5DTB A;  2QS4 A;  2ONR A;  3FVO A;  3PPO A;  3TTR A;  5I57 A;  3H03 A;  1US5 A;  1NUZ A;  4ND9 A;  3FAT A;  2F35 A;  4R2F A;  4LN5 A;  1LFI A;  4OAN A;  4P1L A;  3FVG A;  2XD3 A;  1P1W A;  1M5B A;  3C4M A;  4DZ1 A;  1D9V A;  3E3K A;  4MLQ A;  3B6Q A;  1LLS A;  1IXG A;  1ZBM A;  2I0B A;  4I1D A;  3O29 A;  4MHF A;  4HS7 A;  2F8D A;  2OWT A;  2Y7R A;  1JEU A;  4BDM A;  4GL0 A;  1K9Z A;  1RKM A;  1DTG A;  3OEK A;  1BLF A;  3IOW A;  5CI5 A;  3PPR A;  3N5L A;  3O6H A;  1URS A;  2Q74 A;  3QIM A;  1GV8 A;  3JZJ A;  5A5X A;  2A5T B;  4MLV A;  3G3G A;  2ESN A;  4PCD A;  1NNT A;  2O68 A;  3S9M C;  4DE8 A;  1KZ8 A;  3OO7 A;  4O7I A;  1B3H A;  1EYK A;  2M8C A;  1SW5 A;  3K00 A;  1D4N A;  1Y1M A;  5ICT A;  1INP A;  2KQZ A;  3THI A;  3HHG A;  4OVP A;  2XXR A;  1QUI A;  4O94 A;  5HBC A;  1NFT A;  4FOR A;  4P47 A;  1JVY A;  1DK4 A;  4I3Y A;  4R74 A;  1LAH E;  1GGG A;  1B46 A;  3PD9 A;  2UVG A;  5H8F B;  4H0W A;  3K0V A;  2Z8E A;  4FAJ A;  3FUZ A;  3KC1 A;  1G0I A;  1QW0 A;  3MPL A;  4FED A;  4N6P A;  1HSJ A;  3TYH A;  4OFJ A;  3G7W A;  2RCB A;  1ZMG A;  5ET8 A;  5B70 A;  4NF8 A;  3K6U A;  3PUX E;  1NV6 A;  1QUL A;  5T3J A;  1EH3 A;  4MJO A;  4HCW A;  1Y3P A;  4U21 A;  4NQ8 A;  3GYY A;  4HE0 A;  1JEV A;  1L5T A;  5KCJ B;  5TP9 A;  1N76 A;  4THI A;  2RC8 A;  2GQ1 A;  3A09 A;  1H76 A;  5F24 A;  5IZ3 A;  4O3B A;  1AIV A;  1SYI A;  3HN0 A;  3IOU A;  3PV0 E;  4KYD A;  3CHG A;  1FBG A;  2HEU A;  3G3I A;  2PMS A;  4JVD A;  1MXY A;  3U94 A;  2UVI A;  1D9Y A;  4PDH A;  4DCX A;  2I4B A;  4P3L A;  2OZZ A;  2R6G E;  4DXU A;  3S9L C;  2ALU A;  5CMM A;  2HXR A;  2V3Q A;  1LCT A;  4FEB A;  3IJX B;  3O6I A;  1MPC A;  2X7Q A;  3HV1 A;  3KOT A;  1AMF A;  4F22 A;  5BUU A;  1WVJ A;  4QBA A;  1IZ1 A;  4DIG A;  3M3K A;  1M5D A;  3LUZ A;  1JW4 A;  2FIX A;  1IMF A;  2H25 A;  4IR8 A;  4M4G A;  3LV0 A;  4MF3 A;  4NTL A;  3N26 A;  2Z23 A;  4BDN A;  4YKI A;  3LR1 A;  5FHM A;  3VLV A;  5DEX B;  1LGB C;  4QRZ A;  2CMO A;  1UIU A;  3KZG A;  2PVU A;  4JB7 A;  4MCO A;  3SEY A;  2HZL A;  3LBS A;  3P7I A;  4ELO A;  1VDW A;  2B4L A;  5H8Q B;  3O28 A;  4BDQ A;  4F1V A;  1EZ9 A;  1B0H A;  2DE2 A;  2AIX A;  3S4U A;  1NUY A;  3F11 A;  1LB9 A;  1UIV A;  1MH3 A;  5AA4 B;  2Y84 A;  4KCD A;  2PBW A;  2A5T A;  4R75 A;  3PMW A;  1PB7 A;  1UTH B;  1D3K A;  2QMW A;  3FJ7 A;  2VD2 A;  4FAT A;  4H6D A;  1B51 A;  2WX9 A;  2VPN A;  3KEI A;  2VT5 A;  1IIW A;  5I84 A;  4YMB A;  3RYD A;  4GXA A;  2Q8M A;  2Q2A A;  3MP6 A;  3TCH A;  3ECR A;  5H8F A;  1II5 A;  3ISP A;  4U1O A;  1QJM A;  2PYY A;  4X8R A;  3HCQ A;  2VGQ A;  3TAJ A;  3CSG A;  3BIH A;  3IO6 A;  4EUO A;  4TQU Q;  4YKK A;  5L8D A;  1IME A;  1FPK A;  1MM6 A;  3C35 A;  3WAF A;  1GTK A;  2WYK A;  4GWW A;  5EQ9 A;  1MPB A;  2ZZW A;  4ELQ A;  4I9D A;  4OFO A;  4R6K A;  1B9J A;  3U92 A;  3OOA A;  3LSW A;  5AA2 B;  4P11 A;  1RYX A;  4WKM A;  1SW2 A;  2HCA A;  5DVI A;  1Q9D A;  4P8B A;  5IM2 A;  5KCJ A;  5H8H B;  2GRV A;  5ITO A;  4OVJ A;  1JW5 A;  2P3V A;  1KA0 A;  5ET5 A;  1CE2 A;  1CB6 A;  1FBF A;  1PC3 A;  3TTK A;  4O3A A;  3PPQ A;  3ZS6 A;  2UVJ A;  2PX1 A;  1MXU A;  3NOH A;  4IO5 A;  2R8T A;  5CMB A;  2CZH A;  4MAG A;  4LUB A;  2QRY A;  2NXO A;  3KSJ A;  4ZED A;  5A5L A;  4G8N A;  4PF8 A;  1LFG A;  1IUD A;  1NH8 A;  2O6A A;  1R9Q A;  3HFU A;  1MDQ A;  1B6H A;  4TLM B;  1PDA A;  1QGX A;  2F7C A;  1EZO A;  2DE3 A;  4EQB A;  4NWD A;  1MPD A;  3GZG A;  3Q26 A;  5I3S A;  3TKD A;  4GX6 A;  4ZDM A;  5J16 A;  3FVK A;  1FW0 A;  2UXA A;  3LSX A;  1HSE A;  2ABH A;  4UAB A;  4H45 A;  2O84 X;  3EHU A;  3FXU A;  4MFI A;  2O7U A;  2W7Y A;  5CC2 A;  1MQD A;  4U4X A;  2RCA A;  3EN3 A;  4ZEB A;  2DWJ A;  2NOO A;  2D5W A;  3MVW A;  3TQW A;  4E0W A;  5H8Q A;  1YTV A;  3TCF A;  1MXV A;  1NKX A;  4FBP A;  4QFL A;  4E0X A;  1DCU A;  5AA2 D;  3T66 A;  1H3D A;  4N8Y A;  5FHO A;  1N84 A;  4H8I A;  3R26 A;  1EU8 A;  1OVB A;  2WBD A;  5AA4 A;  1OQH A;  2XX9 A;  4LZ5 A;  3KC0 A;  5ET7 A;  4RYA A;  1URD A;  3E79 A;  2I3W A;  2HPG A;  4XEQ A;  4G4P A;  1SW1 A;  2O1L A;  3RPW A;  1B3L A;  3SKP A;  1Y3Q A;  3IOR A;  2ZNT A;  1DBZ A;  2F7A A;  4AS5 A;  1USY E;  3CFX A;  5CM6 A;  2QVR A;  4RA1 A;  4OMB A;  1NV2 A;  4AB6 A;  4F31 B;  3PMX A;  1J1N A;  3RPL B;  1A54 A;  1IQ7 A;  4IGR A;  1LBZ A;  4PC9 A;  3DLN A;  1FTJ A;  1DMB A;  5CBR A;  1A8F A;  1LST A;  4KXP A;  2VD3 A;  1MRP A;  2Y7P A;  5EYG A;  4UAC A;  2FA7 A;  4G2Z A;  4H1X A;  4XKN A;  3M3F A;  2V25 A;  3PMV A;  3H6W A;  2I6E A;  3VFJ A;  5AA2 A;  4O3C A;  5H8S A;  2AL5 A;  3GLB A;  1FPJ A;  2XXY A;  5H8H A;  4GBV A;  4DI3 D;  2UVH A;  1AOV A;  1VFE A;  5J1D A;  1OQG A;  4MNI A;  4Z0I A;  3RUM A;  2QS2 A;  2I49 A;  4JSO A;  1BIY A;  1R1N A;  1MDP 1;  4LON B;  4GWS A;  5TP9 B;  2KLF A;  5ESY A;  4F1Y A;  1B1H A;  4YKP A;  1A40 A;  4ZEF A;  5IZ3 B;  3IFC A;  3HST A;  1S9T A;  2OK2 A;  2VP1 A;  1SD3 A;  1OLC A;  4ZE9 A;  4MMP A;  1DOT A;  3BBR A;  3E4R A;  3B7D A;  1QVS A;  2ONK E;  4MIJ A;  4PAF A;  5K2Y A;  1POT A;  1TXF A;  5I59 B;  2I0C A;  1I6B A;  1O63 A;  4NGU A;  3QYT A;  1MY3 A;  3EKI A;  1B2H A;  3CI8 A;  4LVQ A;  4G77 A;  4U22 A;  4JXI A;  2Q88 A;  1B52 A;  4G68 C;  4PGN A;  2IEE A;  4LZ7 A;  5DYH A;  4GD5 A;  4PFR A;  3VV5 A;  2B4M A;  3O2A A;  4HE1 A;  5FBP A;  3HHF A;  2R9J A;  3FIR A;  3TTL A;  1RDX A;  2FYI A;  5EHM A;  3IR1 A;  1VFD A;  3T96 B;  3MZ1 A;  4WEP A;  3MST A;  2YPN A;  2B3B A;  1FQD A;  1SQY A;  4NG7 A;  3LC8 A;  1FQA A;  2R71 A;  4JDF A;  4LA9 A;  1B3G A;  2HAV A;  3RGY A;  1RDZ A;  1MG1 A;  2F78 A;  4NX1 A;  2MKZ A;  3OO9 A;  4N13 A;  4QSE A;  1N3X A;  5JTY B;  1VR5 A;  2VOZ A;  3GBA A;  2XWI A;  2XXH A;  3OEN A;  4PFU A;  2I3V A;  1F9B A;  1DTZ A;  4OVR A;  4G8H A;  3H6T A;  3RPL A;  4XKP A;  3VXB A;  2DVZ A;  3ONM A;  4LAT A;  2PT2 A;  4IB2 A;  3TOD A;  2F97 A;  2OWZ A;  1B7Z A;  3KN7 A;  1IMA A;  1MM7 A;  3USD A;  1FTO A;  4R9G A;  2O1M A;  3FV2 A;  1P1O A;  2QFL A;  4F29 A;  5JK4 A;  1HSL A;  3PD8 A;  3DM0 A;  4YKJ A;  3ODB A;  3OO8 A;  1FCK A;  3MVZ A;  2ZZV A;  4XTC Q;  1FPB A;  2DDK A;  4C1T A;  1UTB B;  2ANJ A;  2YLN A;  3ZKK A;  1H43 A;  1OVT A;  3IL1 B;  3QUF A;  5ISU A;  4ELP A;  2ZXT A;  1FPI A;  5I58 B;  3MVY A;  1Z7N E;  3UP9 A;  4RXL A;  4U1Z A;  5I2K A;  2UYF A;  2Q8J A;  4TLL B;  4TOZ A;  2B3F A;  2X7P A;  5ELV A;  4OFL A;  4GX4 A;  2H5Y A;  4ZS9 A;  1QKB A;  1YYZ A;  4FJP A;  2UYE A;  3DP8 A;  3H6V A;  4P0I A;  4MNP A;  4F3G A;  4R9F A;  4K3F A;  5I59 A;  1AH5 A;  2QMX A;  3T9X B;  5DVF A;  1SVX B;  5JEI A;  2AYS A;  4RNS A;  1AWB A;  1FRP A;  1MY4 A;  3H4Z A;  2NVU B;  2F5X A;  2F36 A;  4GL8 A;  5IAI A;  4PFB A;  4JSD A;  3LSL A;  3FAS A;  2Q9T A;  5LDZ A;  5CRY A;  4N6K A;  4YB7 A;  4ELR A;  4PFI A;  3SEX A;  3SER A;  1PBQ A;  4QFK A;  1O7T A;  2WYP A;  3C34 A;  2Y7W A;  4OQO A;  3OMB A;  3T1B A;  3V8X B;  1BP5 A;  5EYF A;  4F1U A;  3C9H A;  1N0T A;  2Q89 A;  2V3U A;  2XWK A;  1JET A;  3G3F A;  4PAK A;  3SZP A;  4POW A;  4MNC A;  4RK9 A;  2Z8D A;  3U1O A;  4EXL A;  3CFZ A;  5IZZ A;  4YMA A;  1ATG A;  1RYO A;  1LBC A;  3W15 C;  4ZZA A;  2RC7 A;  2REG A;  2QPQ A;  1YZ0 A;  3O9P A;  5JTY A;  3G3K A;  4R2B A;  4QFO A;  2OJT A;  1WOD A;  4OYV A;  1P1U A;  1B7H A;  5FTI A;  1FJ6 A;  3FGS A;  3IOT A;  2L5V A;  1B4Z A;  5BWJ A;  1B3F A;  4OEN A;  4PF6 A;  5AA3 A;  4KFQ A;  3LUY A;  4NF5 A;  1NV3 A;  4HW8 A;  3K6X A;  4R6Y A;  3D4C A;  4R73 A;  2I48 A;  1FBP A;  1MXZ A;  1LAG E;  3MVX A;  1VSO A;  3I5O A;  3O97 A;  1XOC A;  2RIN A;  1B3E A;  4P9K A;  5I7I A;  1A99 A;  2FIE A;  1YXI A;  3VLU A;  1YCJ A;  1OIB A;  2F6G A;  1QUJ A;  4OES A;  2OWS A;  2OLB A;  1UTB A;  4IGT A;  1Y1Z A;  4OTE A;  1T0K A;  5DW8 A;  5EQ7 A;  4PBQ A;  2NUV A;  4DXB A;  4KR5 A;  4GRK A;  1LBX A;  4PP0 A;  4X9T A;  3HPI A;  5HPQ A;  5I58 A;  4XKR A;  1FBE A;  3A3U A;  1MY2 A;  3AXF A;  1B58 A;  2PFY A;  2HFB A;  3PU5 A;  4YB6 A;  4RY1 A;  1FTA A;  3IB1 A;  1DSN A;  1H45 A;  2F3D A;  3RTW B;  5LOM A;  4EXK A;  1SI0 A;  3FXQ A;  2HQ0 A;  4XFE A;  1Q1K A;  2DOJ A;  4DCY A;  3DP4 A;  5I56 A;  4H65 A;  2Y7K A;  4N8G A;  3MW0 A;  2O51 A;  4OXV A;  1B5I A;  2VHA A;  1MQG A;  5EYH A;  3QK6 A;  4R6H A;  4I3E A;  2I4C A;  2XXI A;  3Q28 A;  2B65 A;  2FBP A;  3C33 A;  3UIF A;  4GVO A;  2H99 A;  3Q27 A;  1S7Y A;  1FQE A;  2XXT A;  1D9Q A;  4OWD A;  1PB9 A;  3D1R A;  3H6U A;  3L6H A;  2DYX A;  2DWI A;  1B32 A;  4NAP A;  1KWH A;  3IOV A;  2THI A;  1BKA A;  2O69 A;  4OVS A;  4KQP A;  4R72 A;  1AL3 A;  3Q29 A;  3CG1 A;  5AE4 A;  2BJJ X;  5AA1 A;  5HM4 B;  3KFM A;  3MYU A;  3KJT A;  1B1X A;  3IK6 B;  2AL4 A;  2P0S A;  5EQ8 A;  1NL5 A;  5FTH A;  4AS4 A;  4N17 A;  4P1E A;  4RPN A;  3UA8 A;  4H8J A;  2CEY A;  3M3L A;  1M5F A;  2PCR A;  2Y5L A;  3GBB A;  4JVI A;  2YJP A;  3PPN A;  5DVJ A;  3KG2 A;  4UA8 A;  4PE3 A;  3MBP A;  2I58 A;  2F34 A;  3B6W A;  4NWC A;  3QUJ A;  1GVC A;  1NNP A;  3FJG A;  4PE5 B;  2XHD A;  2ZMB A;  1O64 A;  4YB5 A;  3TQL A;  1B0L A;  3ILT B;  4IO4 A;  4EDP A;  3I3V A;  1LAF E;  3MJN A;  3TDJ A;  4OHN A;  5CMC A;  3TCG A;  2ZNS A;  1I6A A;  3PUZ E;  4F3S A;  3TPA A;  1G0H A;  3UN6 A;  1DPE A;  4QSC A;  3BFU A;  4C1U A;  2HZK A;  1LEV A;  1EZP A;  3MZB A;  1N04 A;  3CSB A;  4YIC A;  1KA1 A;  4LZ8 A;  5IGA A;  4NED A;  3FZV A;  1FPF A;  1NUX A;  1GR2 A;  2HAU A;  3SET A;  3BKI B;  3RLF E;  2F6P A;  5I2K B;  4IO3 A;  4JWY A;  2QSX A;  4XF5 A;  1ZLQ A;  3PUW E;  3V89 B;  3BIG A;  1VE4 A;  3ROJ A;  3S2V A;  4IY6 A;  1Y4T A;  4GOT A;  2E1S A;  1FBH A;  1FTL A;  3K2D A;  3B8B A;  3SEU A;  2DS9 A;  3G3H A;  5ET6 A;  2OBG A;  3LSF B;  3QMF A;  3K02 A;  1MQH A;  4PAI A;  3MZ9 A;  3MP8 A;  5M2V A;  5KDT B;  3IO4 A;  4G68 B;  4G61 A;  4JBZ A;  1DPP A;  3MPK A;  3UGW A;  1SW4 A;  1POY 1;  4F19 A;  2F3B A;  1XVY A;  4KPT A;  3U93 A;  4OEU A;  4HCY A;  4QFP A;  1NV0 A;  1ANF A;  1P99 A;  2ZYN A;  3TTN A;  3MP1 A;  3T93 B;  2Z8F A;  2CZI A;  3TFL A;  3IB0 A;  1FTK A;  3PTY A;  4YZZ A;  3RTF B;  4EQ9 A;  1RDY A;  3T9U A;  3KBR A;  3CG3 A;  3MAM A;  3VVE A;  1FBC A;  1NNF A;  1ELJ A;  2P3N A;  4GF8 A;  1JQF A;  4N6D A;  5I5P A;  4XKQ A;  2QJE A;  4U2R A;  2DWH A;  5FHN A;  3EHT A;  2FVZ A;  4X48 A;  4NF0 A;  2IA4 A;  3QSL A;  1NNK A;  5CBS A;  3TEL A;  4IY5 A;  3VDF A;  1B5H A;  3T22 A;  3KBZ A;  4ONY A;  5K2X A;  1EYJ A;  4BLA A;  1TT1 A;  4POX A;  2QVU A;  3EHS A;  1ZIU A;  3FBP A;  3O6G A;  2LAO A;  1OMP A;  1SDX A;  2XXQ A;  3KOS A;  3Q25 A;  3DEL B;  4NF5 B;  4F3B A;  1ZU0 A;  3K01 A;  3WAE A;  2DSF A;  4LP2 B;  1CNQ A;  2QL3 A;  1MXW A;  3TEP A;  4Q0C A;  4Q8R A;  4G8M A;  2XXP A;  1Y4C A;  2DQV A;  1SBP A;  3S9E A;  2Y5K A;  1NUW A;  4KCC A;  3R7X A;  4X1B A;  3OSR A;  1H44 A;  2V3T A;  3G3J A;  1NV4 A;  3ZKL A;  4RPO A;  1JW1 A;  1XHY A;  3B6T A;  4Q30 B;  1TFA A;  5H8N B;  1IMD A;  3MC2 A;  4GWY A;  1LBW A;  3N6U A;  4MEV A;  2QS3 A;  1LBB A;  2BJI A;  3OEM A;  3C36 A;  4KYS A;  3UOR A;  4DXC A;  4ZE8 A;  1MY1 A;  1WDN A;  4JWO A;  3KJ7 A;  3RT8 A;  3TUS A;  3KN8 A;  4ZZE A;  4GWX A;  4KI0 E;  4H5G A;  3K6V A;  4P56 A;  1R9L A;  3C31 A;  3K1P A;  4ECF A;  1P1Q A;  4GWU A;  2H98 A;  4FE8 A;  2XXW A;  3FV1 A;  1JNF A;  2XD2 A;  1XVX A;  4I8C A;  2VPO A;  3A29 A;  1PB8 A;  2G93 A;  5I56 B;  4H46 A;  3OSQ A;  5TPA B;  5CMK A;  3CR9 A;  5KDT A;  2NWJ A;  4G68 A;  4U23 A;  4EQ7 A;  1FQB A;  1FQF A;  4NHB A;  4WXJ A;  3O66 A;  4L17 A;  3S9N C;  2XWO A;  4MBP A;  3EQ1 A;  1FTM A;  1LBV A;  4YU0 A;  4GLI A;  3SES A;  3EPE A;  4IO7 A;  2OX3 A;  5LTC A;  4AQ4 A;  1XT8 A;  2FNC A;  2GH9 A;  3RT6 B;  1FQC A;  2XX8 A;  4PDD A;  5B7D A;  3PGF A;  3CIJ A;  2OCU A;  4XIG Q;  1BK4 A;  2CZK A;  1IMB A;  2E0S A;  4Q5T A;  3I6V A;  4AB5 A;  3PPP A;  4QHQ A;  1FBD A;  3T9V A;  4DI4 B;  3K6W A;  4PTK A;  5IKB A;  4N15 A;  2Q2C A;  3KN3 A;  3L6G A;  2WBB A;  4N4U A;  4YAH X;  4O7M A;  1A7L A;  5EQA A;  1Q35 A;  4DDD A;  2G29 A;  2XX7 A;  2Z22 A;  1JVX A;  2QS1 A;  5ICQ A;  4ESW A;  3GXA A;  4GXS B;  4F2O A;  4FEC A;  4C0R A;  4GWO A;  1N7W A;  3JYR A;  4BDO A;  1BTJ A;  1NI9 A;  4GIZ A;  3OXN A;  2REJ A;  2V4C A;  3H3G A;  3IAZ A;  3B50 A;  3UK4 A;  2ZNU A;  4NF6 B;  2F7B A;  2Y7I A;  2PT1 A;  4NF4 B;  4WED A;  1IMC A;  2ZYK A;  3OO6 A;  4PGP A;  1B5J A;  3RNN A;  4N07 A;  4ZEK A;  1MY0 A;  1SYH A;  3N94 A;  4XXU A;  4ESX A;  3IX1 A;  4U4S A;  4LQ2 A;  4MH5 A;  4GX3 A;  1SI1 A;  3U8Q A;  2DVC A;  1FPG A;  1A8E A;  4JWX A;  5H8N A;  3BFT A;  1IXH A;  3FJM A;  4I62 A;  3JV9 A;  4RJZ A;  4PBH A;  1IIT A;  3CFL A;  1Y9U A;  2WKY A;  1TFD A;  3VLW A;  3U72 A;  4X04 A;  1NV7 A;  3W9W A;  1OLA A;  2A5S A;  3A3C A;  3RQT A;  1QUK A;  4OET A;  4ZEI A;  5L9O A;  3FXR A;  2KR0 A;  1UQW A;  4FIM A;  2GHA A; 
#chains in the Genus database with same CATH homology
 3K1M A;  4QFN A;  5L9M A;  5TPA A;  5DT6 A;  3FD3 A;  3TTM A;  5KZT A;  4NE4 A;  1QKA A;  3SDF A;  3HO7 A;  3SEV A;  1N3W A;  3E9X A;  3ILU B;  3VVD A;  4KHZ E;  3MUQ A;  1B7U A;  4Z7E A;  3H7M A;  1USY H;  4LQ5 A;  4PQJ A;  5I2N B;  1TWY A;  3QXM A;  3CRB A;  3TZA A;  2D21 A;  4H67 A;  3V5A A;  3CVG A;  3C32 A;  5DEX A;  1M5E A;  1NMU A;  2V93 A;  1IXI A;  2GHB A;  2ZYO A;  5I57 B;  1IXC A;  2DXY A;  4F3P A;  1ZKB A;  3KSX A;  4OEV A;  3KGC A;  1YPN A;  3SEW A;  1YAE A;  2H4I A;  2XXV A;  3E13 X;  1Z7M E;  1I6Q A;  4QSD A;  4QF9 A;  1Y20 A;  2DWA A;  2XXX A;  3MQ9 A;  1UTH A;  4HTG A;  1LFH A;  1P1N A;  1LB8 A;  4NF6 A;  5A5X B;  1B05 A;  4P0G A;  4PFW A;  3T9H B;  1M5C A;  4NF4 A;  1S50 A;  3FVN A;  4DLD A;  1MS7 A;  1ZTY A;  4ZEC A;  3TMG A;  1PEB A;  1ZJL A;  2DE4 A;  2O7I A;  4EF2 A;  2ZYM A;  2X26 A;  2DP8 A;  1I69 A;  3VXC A;  3V83 A;  3D4G A;  4M1V A;  5F7V A;  2CZL A;  1B40 A;  1LCF A;  2H9B A;  4GQO A;  2RC9 A;  1XC1 A;  2DXR A;  3PUY E;  3W9V A;  4ISU A;  4PFT A;  1Y3N A;  2P1S A;  4H5F A;  4NF8 B;  4X1D A;  3VE1 B;  1A55 A;  2RF1 A;  4NMY A;  2ONS A;  3N6T A;  2RKM A;  4KYE A;  1MXX A;  3QAX A;  4BDL A;  4GFR A;  4PET A;  1B4H A;  4RK2 A;  3M8U A;  1N7X A;  2V84 A;  5L9S A;  3EF7 A;  5F1Q A;  1URG A;  4F2Q A;  4OZ9 A;  3IB2 A;  3H06 B;  3RN8 A;  1MQJ A;  4KD5 A;  1PBP A;  1LAX A;  2P2A A;  3OD7 A;  4PFY A;  1NH7 A;  2HXW A;  5TU0 A;  4EF1 A;  4IO6 A;  3ZSF A;  1IEJ A;  3K1N A;  3OEL A;  4IO2 A;  2D3I A;  5ITP A;  5I2N A;  3MWB A;  3RY3 A;  3PUV E;  1US4 A;  3IJO B;  5EHS A;  1MH4 A;  4F18 A;  4OER A;  3VVF A;  2XXU A;  1R6Z A;  3R6U A;  2GFE A;  4F39 A;  1XS5 A;  4BDR A;  1MQI A;  3DP6 A;  3K4U A;  5DTB A;  2QS4 A;  2ONR A;  3FVO A;  3PPO A;  3TTR A;  5I57 A;  3H03 A;  1US5 A;  4ND9 A;  3FAT A;  2F35 A;  4R2F A;  1LFI A;  3FVG A;  2XD3 A;  1P1W A;  1M5B A;  3C4M A;  4DZ1 A;  1D9V A;  3E3K A;  4MLQ A;  3B6Q A;  1LLS A;  1ZBM A;  1IXG A;  2I0B A;  4I1D A;  3O29 A;  4HS7 A;  2F8D A;  2OWT A;  2Y7R A;  1JEU A;  4BDM A;  4GL0 A;  1RKM A;  1DTG A;  3OEK A;  1BLF A;  3IOW A;  5CI5 A;  3PPR A;  3N5L A;  3O6H A;  1URS A;  3QIM A;  1GV8 A;  3JZJ A;  5A5X A;  2A5T B;  4MLV A;  3G3G A;  2ESN A;  1NNT A;  2O68 A;  3S9M C;  4DE8 A;  3OO7 A;  1B3H A;  2M8C A;  1SW5 A;  3K00 A;  1D4N A;  1Y1M A;  5ICT A;  3THI A;  3HHG A;  2XXR A;  1QUI A;  5HBC A;  1NFT A;  4FOR A;  1JVY A;  4R74 A;  1LAH E;  1GGG A;  1B46 A;  3PD9 A;  2UVG A;  5H8F B;  4H0W A;  3K0V A;  2Z8E A;  4FAJ A;  3FUZ A;  1QW0 A;  3MPL A;  4FED A;  4N6P A;  1HSJ A;  3TYH A;  4OFJ A;  3G7W A;  2RCB A;  1ZMG A;  5B70 A;  4NF8 A;  3K6U A;  3PUX E;  1QUL A;  1EH3 A;  4HCW A;  1Y3P A;  4U21 A;  1JEV A;  1L5T A;  5KCJ B;  5TP9 A;  1N76 A;  4THI A;  2RC8 A;  3A09 A;  1H76 A;  4O3B A;  1AIV A;  1SYI A;  3HN0 A;  3IOU A;  3PV0 E;  4KYD A;  2HEU A;  3G3I A;  2PMS A;  1MXY A;  3U94 A;  2UVI A;  1D9Y A;  4DCX A;  2I4B A;  2OZZ A;  2R6G E;  4DXU A;  3S9L C;  2ALU A;  5CMM A;  2V3Q A;  1LCT A;  4FEB A;  3IJX B;  3O6I A;  1MPC A;  2X7Q A;  3HV1 A;  3KOT A;  1AMF A;  4F22 A;  5BUU A;  1WVJ A;  1IZ1 A;  4DIG A;  3M3K A;  1M5D A;  1JW4 A;  2H25 A;  4M4G A;  4MF3 A;  4NTL A;  3N26 A;  2Z23 A;  4BDN A;  4YKI A;  5FHM A;  3LR1 A;  3VLV A;  5DEX B;  1LGB C;  4QRZ A;  2CMO A;  1UIU A;  3KZG A;  2PVU A;  4JB7 A;  3SEY A;  2HZL A;  3LBS A;  3P7I A;  4ELO A;  5H8Q B;  3O28 A;  4BDQ A;  4F1V A;  1EZ9 A;  1B0H A;  2DE2 A;  2AIX A;  3S4U A;  3F11 A;  1LB9 A;  1UIV A;  1MH3 A;  5AA4 B;  2Y84 A;  4KCD A;  2PBW A;  2A5T A;  4R75 A;  3PMW A;  1PB7 A;  1UTH B;  1D3K A;  2QMW A;  3FJ7 A;  2VD2 A;  4FAT A;  4H6D A;  1B51 A;  3KEI A;  1IIW A;  5I84 A;  4YMB A;  4GXA A;  2Q2A A;  3MP6 A;  3TCH A;  3ECR A;  5H8F A;  1II5 A;  4U1O A;  1QJM A;  2PYY A;  3HCQ A;  2VGQ A;  3TAJ A;  3CSG A;  3IO6 A;  4EUO A;  4TQU Q;  4YKK A;  5L8D A;  1MM6 A;  3C35 A;  3WAF A;  1GTK A;  1MPB A;  4ELQ A;  4I9D A;  4OFO A;  4R6K A;  1B9J A;  3U92 A;  3OOA A;  3LSW A;  5AA2 B;  4P11 A;  1RYX A;  4WKM A;  1SW2 A;  2HCA A;  5DVI A;  5KCJ A;  5H8H B;  2GRV A;  5ITO A;  4OVJ A;  1JW5 A;  1CE2 A;  1CB6 A;  1PC3 A;  3TTK A;  4O3A A;  3PPQ A;  3ZS6 A;  2UVJ A;  2PX1 A;  1MXU A;  4IO5 A;  5CMB A;  4LUB A;  2QRY A;  2NXO A;  3KSJ A;  4ZED A;  4G8N A;  1LFG A;  1IUD A;  1NH8 A;  2O6A A;  1R9Q A;  1MDQ A;  1B6H A;  4TLM B;  1PDA A;  2F7C A;  1EZO A;  2DE3 A;  4EQB A;  4NWD A;  1MPD A;  3GZG A;  3Q26 A;  3TKD A;  4ZDM A;  3FVK A;  1FW0 A;  2UXA A;  3LSX A;  1HSE A;  2ABH A;  2O84 X;  3EHU A;  3FXU A;  4MFI A;  2O7U A;  2W7Y A;  5CC2 A;  1MQD A;  4U4X A;  2RCA A;  3EN3 A;  4ZEB A;  2DWJ A;  2NOO A;  2D5W A;  3MVW A;  3TQW A;  4E0W A;  5H8Q A;  1YTV A;  3TCF A;  1MXV A;  1NKX A;  4QFL A;  4E0X A;  5AA2 D;  3T66 A;  1H3D A;  5FHO A;  1N84 A;  4H8I A;  3R26 A;  1EU8 A;  1OVB A;  5AA4 A;  1OQH A;  2XX9 A;  4LZ5 A;  4RYA A;  1URD A;  2I3W A;  4G4P A;  1SW1 A;  2O1L A;  3RPW A;  1B3L A;  3SKP A;  1Y3Q A;  3IOR A;  2ZNT A;  2F7A A;  1USY E;  3CFX A;  5CM6 A;  4RA1 A;  4OMB A;  4AB6 A;  4F31 B;  3PMX A;  1J1N A;  1A54 A;  1IQ7 A;  4IGR A;  3DLN A;  1FTJ A;  1DMB A;  5CBR A;  1A8F A;  1LST A;  2VD3 A;  1MRP A;  2Y7P A;  4UAC A;  2FA7 A;  4G2Z A;  4H1X A;  4XKN A;  3M3F A;  2V25 A;  3PMV A;  3H6W A;  2I6E A;  3VFJ A;  5AA2 A;  4O3C A;  5H8S A;  2AL5 A;  3GLB A;  2XXY A;  5H8H A;  2UVH A;  1AOV A;  1VFE A;  5J1D A;  1OQG A;  3RUM A;  4Z0I A;  2QS2 A;  2I49 A;  4JSO A;  1BIY A;  1R1N A;  1MDP 1;  4LON B;  5TP9 B;  2KLF A;  4F1Y A;  1B1H A;  4YKP A;  1A40 A;  4ZEF A;  3HST A;  1S9T A;  2OK2 A;  2VP1 A;  1SD3 A;  1OLC A;  4ZE9 A;  1DOT A;  3BBR A;  3E4R A;  3B7D A;  1QVS A;  2ONK E;  5K2Y A;  1POT A;  1TXF A;  5I59 B;  2I0C A;  1I6B A;  1O63 A;  3QYT A;  1MY3 A;  1B2H A;  3CI8 A;  4LVQ A;  4G77 A;  4U22 A;  4JXI A;  2Q88 A;  1B52 A;  4G68 C;  2IEE A;  4LZ7 A;  5DYH A;  4GD5 A;  3VV5 A;  3O2A A;  3HHF A;  2R9J A;  3FIR A;  3TTL A;  2FYI A;  5EHM A;  3IR1 A;  1VFD A;  3T96 B;  3MZ1 A;  4WEP A;  2YPN A;  2B3B A;  1FQD A;  1SQY A;  3LC8 A;  1FQA A;  2R71 A;  4JDF A;  4LA9 A;  1B3G A;  2HAV A;  3RGY A;  1MG1 A;  2F78 A;  3OO9 A;  4N13 A;  4QSE A;  1N3X A;  5JTY B;  1VR5 A;  2VOZ A;  3GBA A;  2XXH A;  3OEN A;  4PFU A;  2I3V A;  1F9B A;  1DTZ A;  4G8H A;  3H6T A;  4XKP A;  3VXB A;  2DVZ A;  3ONM A;  4LAT A;  2PT2 A;  4IB2 A;  3TOD A;  2F97 A;  1B7Z A;  3KN7 A;  1MM7 A;  3USD A;  1FTO A;  4R9G A;  2O1M A;  3FV2 A;  1P1O A;  4F29 A;  5JK4 A;  1HSL A;  3PD8 A;  3DM0 A;  4YKJ A;  3ODB A;  3OO8 A;  1FCK A;  3MVZ A;  4XTC Q;  4C1T A;  1UTB B;  2ANJ A;  2YLN A;  3ZKK A;  1H43 A;  1OVT A;  3IL1 B;  3QUF A;  5ISU A;  4ELP A;  2ZXT A;  5I58 B;  3MVY A;  1Z7N E;  3UP9 A;  4RXL A;  4U1Z A;  5I2K A;  2UYF A;  2Q8J A;  4TLL B;  4TOZ A;  2B3F A;  2X7P A;  5ELV A;  4OFL A;  2H5Y A;  4ZS9 A;  1QKB A;  4FJP A;  2UYE A;  3DP8 A;  3H6V A;  4P0I A;  4F3G A;  4R9F A;  4K3F A;  5I59 A;  1AH5 A;  2QMX A;  3T9X B;  5DVF A;  1SVX B;  5JEI A;  2AYS A;  4RNS A;  3H4Z A;  1MY4 A;  2NVU B;  2F5X A;  2F36 A;  4GL8 A;  5IAI A;  4JSD A;  3LSL A;  3FAS A;  2Q9T A;  5CRY A;  4YB7 A;  4ELR A;  3SEX A;  3SER A;  1PBQ A;  4QFK A;  1O7T A;  3C34 A;  2Y7W A;  4OQO A;  3OMB A;  3V8X B;  1BP5 A;  5EYF A;  4F1U A;  3C9H A;  1N0T A;  2Q89 A;  2V3U A;  3G3F A;  1JET A;  4POW A;  4RK9 A;  2Z8D A;  3U1O A;  4EXL A;  3CFZ A;  4YMA A;  1ATG A;  1RYO A;  1LBC A;  3W15 C;  4ZZA A;  2RC7 A;  2REG A;  2QPQ A;  3O9P A;  5JTY A;  3G3K A;  4R2B A;  4QFO A;  2OJT A;  1WOD A;  4OYV A;  1P1U A;  1B7H A;  5FTI A;  3FGS A;  3IOT A;  1B4Z A;  5BWJ A;  1B3F A;  4OEN A;  5AA3 A;  4KFQ A;  3LUY A;  4NF5 A;  4HW8 A;  3K6X A;  4R6Y A;  3D4C A;  4R73 A;  2I48 A;  1MXZ A;  1LAG E;  3MVX A;  1VSO A;  3I5O A;  3O97 A;  1XOC A;  2RIN A;  1B3E A;  1A99 A;  3VLU A;  1YCJ A;  1OIB A;  2F6G A;  1QUJ A;  4OES A;  2OWS A;  2OLB A;  1UTB A;  4IGT A;  1Y1Z A;  4OTE A;  1T0K A;  2NUV A;  4DXB A;  4KR5 A;  4GRK A;  4PP0 A;  4X9T A;  3HPI A;  5HPQ A;  5I58 A;  4XKR A;  3A3U A;  1MY2 A;  3AXF A;  1B58 A;  2HFB A;  3PU5 A;  4YB6 A;  4RY1 A;  3IB1 A;  1DSN A;  1H45 A;  3RTW B;  5LOM A;  4EXK A;  1SI0 A;  3FXQ A;  2HQ0 A;  1Q1K A;  2DOJ A;  4DCY A;  3DP4 A;  5I56 A;  4H65 A;  2Y7K A;  3MW0 A;  2O51 A;  4OXV A;  1B5I A;  2VHA A;  1MQG A;  3QK6 A;  4R6H A;  2I4C A;  2XXI A;  3Q28 A;  2B65 A;  3C33 A;  3UIF A;  4GVO A;  2H99 A;  3Q27 A;  1S7Y A;  1FQE A;  2XXT A;  4OWD A;  1PB9 A;  3H6U A;  3L6H A;  2DYX A;  2DWI A;  1B32 A;  1KWH A;  3IOV A;  2THI A;  1BKA A;  2O69 A;  4KQP A;  4R72 A;  1AL3 A;  3Q29 A;  3CG1 A;  5AE4 A;  2BJJ X;  5AA1 A;  5HM4 B;  3KFM A;  3KJT A;  1B1X A;  3IK6 B;  2AL4 A;  2P0S A;  1NL5 A;  5FTH A;  4RPN A;  3UA8 A;  4H8J A;  3M3L A;  1M5F A;  3GBB A;  2YJP A;  3PPN A;  5DVJ A;  3KG2 A;  4UA8 A;  3MBP A;  2I58 A;  2F34 A;  3B6W A;  4NWC A;  3QUJ A;  1GVC A;  1NNP A;  3FJG A;  4PE5 B;  2XHD A;  2ZMB A;  1O64 A;  4YB5 A;  3TQL A;  1B0L A;  3ILT B;  4IO4 A;  4EDP A;  3I3V A;  1LAF E;  3MJN A;  3TDJ A;  4OHN A;  5CMC A;  3TCG A;  2ZNS A;  1I6A A;  3PUZ E;  4F3S A;  3TPA A;  3UN6 A;  1DPE A;  4QSC A;  3BFU A;  4C1U A;  2HZK A;  1EZP A;  3MZB A;  1N04 A;  3CSB A;  4YIC A;  4LZ8 A;  4NED A;  3FZV A;  1GR2 A;  2HAU A;  3SET A;  3BKI B;  3RLF E;  2F6P A;  5I2K B;  4IO3 A;  4JWY A;  2QSX A;  1ZLQ A;  3PUW E;  3V89 B;  1VE4 A;  3S2V A;  4IY6 A;  1Y4T A;  4GOT A;  2E1S A;  1FTL A;  3K2D A;  3SEU A;  2DS9 A;  3G3H A;  2OBG A;  3LSF B;  3K02 A;  1MQH A;  3MZ9 A;  3MP8 A;  5M2V A;  5KDT B;  3IO4 A;  4G68 B;  4JBZ A;  1DPP A;  3MPK A;  3UGW A;  1SW4 A;  1POY 1;  4F19 A;  1XVY A;  4KPT A;  3U93 A;  4OEU A;  4HCY A;  4QFP A;  1ANF A;  1P99 A;  2ZYN A;  3TTN A;  3MP1 A;  3T93 B;  2Z8F A;  3TFL A;  3IB0 A;  1FTK A;  4YZZ A;  4EQ9 A;  3RTF B;  3T9U A;  3KBR A;  3CG3 A;  3MAM A;  3VVE A;  1NNF A;  1ELJ A;  4GF8 A;  1JQF A;  4XKQ A;  2QJE A;  4U2R A;  2DWH A;  5FHN A;  3EHT A;  4X48 A;  2IA4 A;  3QSL A;  1NNK A;  5CBS A;  3TEL A;  4IY5 A;  3VDF A;  1B5H A;  3T22 A;  4ONY A;  5K2X A;  4BLA A;  1TT1 A;  4POX A;  3EHS A;  1ZIU A;  3O6G A;  2LAO A;  1OMP A;  1SDX A;  2XXQ A;  3KOS A;  3Q25 A;  3DEL B;  4NF5 B;  4F3B A;  1ZU0 A;  3K01 A;  3WAE A;  2DSF A;  4LP2 B;  2QL3 A;  1MXW A;  3TEP A;  4Q0C A;  4Q8R A;  4G8M A;  2XXP A;  1Y4C A;  2DQV A;  1SBP A;  3S9E A;  4KCC A;  3R7X A;  4X1B A;  3OSR A;  1H44 A;  2V3T A;  3G3J A;  3ZKL A;  4RPO A;  1JW1 A;  1XHY A;  3B6T A;  4Q30 B;  1TFA A;  5H8N B;  3MC2 A;  3N6U A;  2QS3 A;  1LBB A;  3OEM A;  3C36 A;  4KYS A;  3UOR A;  4DXC A;  4ZE8 A;  1MY1 A;  1WDN A;  4JWO A;  3KJ7 A;  3RT8 A;  3TUS A;  3KN8 A;  4ZZE A;  4KI0 E;  4H5G A;  3K6V A;  1R9L A;  3C31 A;  3K1P A;  4ECF A;  1P1Q A;  2H98 A;  4FE8 A;  2XXW A;  3FV1 A;  1JNF A;  2XD2 A;  1XVX A;  4I8C A;  1PB8 A;  2G93 A;  5I56 B;  3OSQ A;  5TPA B;  5CMK A;  3CR9 A;  5KDT A;  2NWJ A;  4G68 A;  4U23 A;  4EQ7 A;  1FQB A;  1FQF A;  4WXJ A;  3O66 A;  4L17 A;  3S9N C;  4MBP A;  3EQ1 A;  1FTM A;  4YU0 A;  4GLI A;  3SES A;  3EPE A;  4IO7 A;  4AQ4 A;  1XT8 A;  2FNC A;  2GH9 A;  3RT6 B;  1FQC A;  2XX8 A;  5B7D A;  3PGF A;  3CIJ A;  2OCU A;  4XIG Q;  2E0S A;  4Q5T A;  3I6V A;  4AB5 A;  3PPP A;  4QHQ A;  3T9V A;  3K6W A;  5IKB A;  2Q2C A;  3KN3 A;  3L6G A;  4YAH X;  1A7L A;  1Q35 A;  4DDD A;  2G29 A;  2XX7 A;  2Z22 A;  1JVX A;  2QS1 A;  5ICQ A;  4ESW A;  3GXA A;  4GXS B;  4F2O A;  4FEC A;  4C0R A;  4GWO A;  1N7W A;  3JYR A;  4BDO A;  1BTJ A;  4GIZ A;  3OXN A;  2REJ A;  3H3G A;  3IAZ A;  3UK4 A;  2ZNU A;  4NF6 B;  2F7B A;  2Y7I A;  2PT1 A;  4NF4 B;  4WED A;  2ZYK A;  3OO6 A;  1B5J A;  3RNN A;  4N07 A;  4ZEK A;  1MY0 A;  1SYH A;  3N94 A;  4XXU A;  4ESX A;  3IX1 A;  4U4S A;  4LQ2 A;  4MH5 A;  1SI1 A;  3U8Q A;  2DVC A;  1A8E A;  4JWX A;  5H8N A;  3BFT A;  1IXH A;  3FJM A;  4I62 A;  3JV9 A;  4RJZ A;  1IIT A;  3CFL A;  1Y9U A;  2WKY A;  1TFD A;  3VLW A;  3U72 A;  3W9W A;  1OLA A;  2A5S A;  3A3C A;  3RQT A;  1QUK A;  4OET A;  4ZEI A;  5L9O A;  3FXR A;  1UQW A;  4FIM A;  2GHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...