2O69A

Crystal structure of haemophilus influenzae n193l mutant fbpa
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALILNYYWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The role of the synergistic phosphate anion in iron transport by the periplasmic iron-binding protein from Haemophilus influenzae.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
total genus 111
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2006-12-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o69A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o69A02
4HTGA 5DTBA 3H6VA 1TWYA 3G3HA 1LAGE 3L6GA 4NF6A 4R9GA 4RNSA 2DOJA 3EPEA 4IO4A 2NWJA 1QKAA 2FA7A 2Y7WA 4MH5A 4DCYA 5I2NB 1UTHA 1MH3A 1FCKA 3IL1B 1JQFA 1YTVA 1UTBB 2E1SA 5H8FA 3AXFA 4TLLB 2O7UA 3PUYE 4WEDA 1D9VA 2G29A 4KI0E 4JWXA 3TQWA 1Q1KA 1EZ9A 1MXUA 1XVYA 4NF4B 2THIA 3FATA 2VOZA 4U1ZA 1TFDA 1YPNA 1ZTYA 1MXWA 3T9UA 5KCJB 1IXHA 1SVXB 3IB0A 4OWDA 2QRYA 3O28A 4Z0IA 2F7AA 3O66A 2F34A 3SEXA 4F22A 5L8DA 1LLSA 3KJTA 5AA4B 1UQWA 1NFTA 2DE2A 5EHMA 5KCJA 4POWA 4IGRA 1Y1ZA 2OJTA 4F1UA 4JWOA 1R6ZA 4DLDA 1MY0A 2G93A 4JB7A 4ELOA 3Q28A 3DP6A 4YKJA 1MXYA 2E0SA 4NWCA 1LGBC 1LFIA 3KN3A 3Q25A 4ONYA 4QFLA 3TKDA 4ESWA 5ISUA 1WDNA 2Y84A 4LQ2A 2UVGA 4Q0CA 2NXOA 3TEPA 3C35A 1JW1A 2R71A 4BLAA 5DVJA 3DP4A 1B5HA 4DDDA 1HSEA 1OLAA 2F5XA 2R9JA 4IB2A 5H8HB 4EQ9A 2F78A 3G7WA 1TFAA 3GZGA 2D21A 4OQOA 4HS7A 4F3BA 3IO4A 2GHAA 5CC2A 4U1OA 1B3EA 1VFDA 2ONRA 2XXWA 3T93B 4LVQA 3H6WA 4KPTA 2XXRA 1B51A 3C4MA 3IK6B 2X7PA 3E4RA 4M1VA 3RUMA 4DCXA 5AA2D 5JEIA 3T9HB 3TTMA 2ABHA 3VLUA 4MF3A 3N6TA 3PD8A 2M8CA 4LZ5A 4PFYA 3QUJA 1QUIA 4XTCQ 5A5XB 3A3UA 1MXVA 1PBQA 1JNFA 1SDXA 2I0CA 4YICA 4M4GA 4GLIA 4F1YA 1PEBA 1I6BA 2QMXA 3MZ1A 2XHDA 3UIFA 3ZS6A 1B3FA 1UTBA 3MUQA 5H8FB 1H43A 3OO6A 4EDPA 1D3KA 4GIZA 4O3CA 1GV8A 2Z23A 1B7UA 3PD9A 3IORA 3PU5A 1L5TA 5BWJA 3H3GA 3JYRA 1T0KA 3MZ9A 1O64A 1IITA 4C1TA 5HBCA 1Z7ME 1NKXA 1M5DA 1PDAA 3IB2A 5B70A 2ZYNA 4NF5B 1IXGA 3RY3A 3DELB 2OBGA 5ELVA 4BDMA 4YMBA 4I8CA 1I6AA 2R6GE 2O6AA 2QS4A 2V84A 4YU0A 3V5AA 2H5YA 3C31A 2UVJA 3KN8A 4PFUA 3T9XB 4BDLA 4ZE9A 2H4IA 3C9HA 3PPQA 2ZNTA 3FUZA 4JXIA 4NF5A 2FNCA 3K02A 4KYEA 4PQJA 3ECRA 3FVGA 4WKMA 4F19A 1QUJA 1NH7A 2XXHA 5K2YA 1B1XA 4LP2B 1MY1A 4U21A 1A7LA 2A5SA 1BKAA 3F11A 5HPQA 1MXZA 1LB8A 3H7MA 2D3IA 2AL5A 1ATGA 3CI8A 3ILUB 4YB5A 3VVEA 5HM4B 4OERA 3S9LC 3IB1A 3FJGA 3OO7A 3RQTA 5JK4A 4R2BA 4XKNA 3FXQA 3MP1A 5FTIA 4G4PA 3VE1B 1FQAA 1JEVA 2KLFA 1S7YA 5AA4A 4P0GA 3HV1A 3O2AA 3OOAA 4OFJA 5LOMA 3S9NC 3MC2A 4AB5A 1USYH 1B3HA 2VHAA 3O29A 1Y3PA 4RPOA 4G8NA 3UP9A 4XKRA 3BBRA 2UXAA 3HN0A 1D4NA 1OVBA 1OVTA 1II5A 3MBPA 4ZS9A 3FJ7A 4OXVA 5I59B 1ANFA 1MQDA 1SI1A 1TXFA 1Y20A 2RC7A 3IJXB 4GL0A 4IO2A 4ND9A 1Y4TA 3DM0A 2O69A 2O84X 1J1NA 2Q88A 3EHSA 3KSJA 3MQ9A 3QYTA 4H5GA 4H5FA 4LATA 2I58A 3GLBA 3A09A 5DYHA 4ZE8A 5EYFA 4X1BA 3RPWA 5I56A 2QL3A 3SEVA 3MVZA 2ONKE 4FAJA 5TU0A 4ZDMA 1B3LA 2HZKA 4QFPA 3ZSFA 3THIA 4BDOA 4HW8A 3MVWA 1POTA 4IGTA 1B6HA 1PB7A 3FASA 3TYHA 2HAUA 2REJA 3CSBA 3M3FA 3QIMA 1MS7A 2O1LA 1MXXA 3R26A 4FORA 2BJJX 5CRYA 4IY6A 3U72A 1PB9A 4U23A 1B7HA 2P1SA 4R6HA 1HSLA 3TCFA 3C32A 3ZKLA 3LBSA 3C33A 1VE4A 1PC3A 5H8SA 4BDNA 4RK2A 1POY1 3VLVA 4DXBA 4NF6B 4POXA 1FTMA 1H3DA 4L17A 3USDA 3K6VA 4OFOA 5FHNA 4F3PA 2UVHA 4GXSB 3L6HA 5I56B 1QVSA 4K3FA 4O3BA 4OENA 3RTWB 3W9VA 1FQCA 3EN3A 4NE4A 3S9MC 4X9TA 1NNPA 2OWTA 4DXUA 3BFTA 3FV1A 2UYFA 2I4CA 4R9FA 3TMGA 2CZLA 3UGWA 4H8IA 2OK2A 2YJPA 4FE8A 3FJMA 3K6WA 3UK4A 1MY4A 1N3XA 3A3CA 4WEPA 5H8NB 3U94A 2IA4A 2RC8A 2DSFA 2F8DA 4EUOA 3MVYA 3OMBA 3RT8A 3MZBA 3PUVE 4ELPA 4GQOA 2XXPA 1AL3A 3GBBA 3N6UA 1O63A 1B3GA 1MQJA 3MP6A 4XIGQ 3I6VA 1SBPA 2Z8FA 4ISUA 3SERA 1Z7NE 3OO8A 4F3SA 4BDQA 5I59A 4RA1A 3K1NA 1XOCA 5CI5A 3K00A 1MDP1 3VFJA 3EQ1A 4LZ7A 4QFKA 4OEUA 5DEXB 1O7TA 4GF8A 4JSDA 3SEYA 2I3VA 1FTJA 1IXIA 3U1OA 5AA1A 4PP0A 2HZLA 2ZMBA 1FTLA 4IY5A 4QSEA 2PX1A 5DVIA 4I1DA 2ESNA 3KZGA 3R6UA 2Z8EA 4XKPA 2Q8JA 4QRZA 5ICQA 1LBCA 1OQGA 3IOUA 1PBPA 1AIVA 2RKMA 5KDTA 4UACA 1A55A 4IO6A 5M2VA 2P2AA 2DWJA 1Y1MA 1B7ZA 3W15C 3H06B 3O6GA 2QPQA 4XXUA 4JDFA 1B40A 2RCBA 1R1NA 3K6UA 3MPKA 3QAXA 1I6QA 3G3GA 2H25A 1US5A 3MJNA 4YB7A 1MDQA 3E3KA 3D4CA 4DZ1A 4R6YA 1ZU0A 4ZEBA 4DIGA 4OHNA 4E0WA 1H76A 5CM6A 5KZTA 3HHFA 1RYXA 1QW0A 2NVUB 1NH8A 2ONSA 3H6UA 3TQLA 3WAEA 2GH9A 2NOOA 5CMBA 4JWYA 1MM6A 3CFZA 1Y9UA 1SW1A 5CBSA 3V8XB 4KD5A 4PFTA 3TUSA 5H8HA 1DTZA 4F29A 4YKKA 4P0IA 1KWHA 1LAXA 1XT8A 2QSXA 2VGQA 4NF4A 2O68A 3N94A 4R73A 2HAVA 4GWOA 1A54A 4LQ5A 3T96B 2ANJA 5TP9A 3TPAA 3S9EA 4HCWA 2RCAA 1MY3A 5KDTB 1ZMGA 3TODA 1QJMA 1A99A 2ALUA 2DWIA 4RXLA 4ZZEA 4F3GA 1LSTA 4MLQA 2LAOA 1JVYA 1SW5A 3CG1A 3G3JA 3I3VA 4H65A 1GR2A 4QFNA 3RGYA 1GGGA 3M3LA 4LONB 3T66A 5L9OA 4ZEKA 1P1QA 1A40A 3UA8A 1P99A 1MM7A 3OO9A 2V3QA 4G68A 3IOWA 1BP5A 4I62A 3CR9A 3FIRA 4FECA 4G8MA 2I4BA 4F31B 1N04A 2B3BA 4QF9A 1SW4A 3VXCA 4H8JA 1URDA 1URSA 1I69A 1LFGA 4G68B 4ZEIA 3FVKA 4THIA 3TTNA 3PMVA 1UTHB 1DPEA 2XXIA 4OYVA 1JW4A 3KEIA 3H03A 4R75A 4F39A 1FQFA 3IX1A 1ZJLA 2OCUA 2PVUA 4ESXA 1M5BA 3CFLA 2DQVA 3ODBA 3E13X 3MAMA 3V83A 4OETA 4QFOA 2RF1A 3PUWE 3B7DA 2H98A 2ZNUA 1N84A 1OQHA 4H0WA 3FVNA 3PV0E 2Z8DA 3OXNA 3Q26A 4TQUQ 1ZLQA 5J1DA 4FEDA 1JEUA 3SETA 4H6DA 2HQ0A 3MVXA 1JETA 5I2KA 4R2FA 5EHSA 3RN8A 4QSDA 2AIXA 3JZJA 1BLFA 3TTRA 1MPCA 5AA2A 1CE2A 2XXYA 2XX8A 2DXYA 1LAFE 2F7CA 2VD2A 2X26A 1B9JA 2Q9TA 1HSJA 4RYAA 4WXJA 5AA2B 3B6TA 3LR1A 4F1VA 1MY2A 3S4UA 3VLWA 3T9VA 4EF2A 4F2QA 1DTGA 1DSNA 1M5CA 2F35A 2I0BA 3RNNA 2V3TA 3FD3A 3KN7A 1BTJA 3B6QA 4OVJA 3SESA 1P1NA 1M5EA 1SW2A 4NEDA 3GBAA 1VSOA 3K1MA 4I9DA 3U92A 5A5XA 2PT1A 1RYOA 3TELA 3ONMA 4IO3A 1USYE 3FXRA 4KCCA 1XVXA 2Y7KA 4KCDA 2UVIA 1B46A 2DWHA 1Y3NA 4RY1A 4DXCA 1H45A 2O1MA 3EF7A 3PPPA 2PYYA 4GD5A 1B2HA 4ZEFA 3SEUA 2Q2AA 2UYEA 4U2RA 1AOVA 3KOSA 4QSCA 1ELJA 3LUYA 4OESA 4Q5TA 1NMUA 1IIWA 2I3WA 5AE4A 1VFEA 2DS9A 3TZAA 3PUZE 1B5IA 4TLMB 3KOTA 2XX7A 1SQYA 1B5JA 1US4A 3IJOB 3QK6A 1B4ZA 4DE8A 2F97A 2Q89A 5TPAA 5CMKA 5I57B 1MPBA 4KYSA 2F7BA 4QHQA 4H1XA 1B0HA 4KQPA 4GOTA 2HFBA 1WODA 2ZYOA 3K01A 3T22A 3EHUA 1LBBA 4U4XA 3QSLA 3Q29A 5BUUA 4GRKA 1B05A 3O97A 2QS3A 4KHZE 4NMYA 2DXRA 4UA8A 5L9SA 4GVOA 3G3IA 1DPPA 1B1HA 1SYHA 2A5TA 2DVCA 3HCQA 3P7IA 3PPNA 5CMCA 1YAEA 2OLBA 2XXXA 3TCGA 1N76A 1M5FA 1Y4CA 1BIYA 2DE4A 1FQBA 3CVGA 5DVFA 3U93A 1NNTA 3LSLA 4NF8B 1NNKA 4ECFA 2O51A 3MP8A 4OTEA 5I2KB 2A5TB 4OMBA 4BDRA 5I84A 2XXUA 4KR5A 2RC9A 3K1PA 3MWBA 4O3AA 1H44A 3LSXA 3KG2A 3SEWA 2DWAA 3I5OA 2QS2A 3ZKKA 5DT6A 4JSOA 1EU8A 4OEVA 4YZZA 3M8UA 3HPIA 3TTLA 2YLNA 1MQHA 4PFWA 4GFRA 3BKIB 5H8NA 5I57A 1S9TA 1Y3QA 3FGSA 1P1UA 1RKMA 1UIUA 3KSXA 2PMSA 4XKQA 1N7WA 4N6PA 4FIMA 3CRBA 4ELRA 4IO7A 1SYIA 2V25A 4PETA 4F2OA 5JTYA 1IUDA 2GHBA 3K4UA 5L9MA 4U22A 5TPAB 2ZNSA 4NWDA 1MQIA 3K6XA 3MW0A 3FVOA 3B6WA 2ZXTA 1N3WA 1XHYA 4NF8A 2Q2CA 1IZ1A 3CFXA 3O9PA 5CMMA 4E0XA 1XS5A 3IOTA 1SI0A 3PPOA 4LA9A 1FTOA 5I58B 4R74A 1R9LA 3IO6A 4Q30B 4G77A 4GXAA 2H99A 3TAJA 1A8FA 1MH4A 1QKBA 3FXUA 3JV9A 4NTLA 1P1WA 3EHTA 4FJPA 3VXBA 3PMWA 4MFIA 5I58A 1SD3A 3N5LA 3D4GA 2Y7RA 3LC8A 4ZZAA 4ELQA 4X1DA 3VVDA 3FZVA 2ZYMA 3O6IA 1DMBA 1TT1A 3MPLA 1AMFA 2AL4A 2O7IA 5FHOA 2GFEA 4G8HA 5ITOA 3CSGA 2GRVA 4R6KA 3VV5A 3KGCA 3H6TA 4RK9A 5TP9B 3OELA 1A8EA 3SKPA 2ZYKA 3LSWA 5CBRA 2V3UA 1Q35A 4EQBA 1MQGA 2V93A 1MRPA 1OLCA 2X7QA 3HO7A 3UORA 3S2VA 3QXMA 2B65A 2NUVA 1UIVA 3U8QA 4EQ7A 2RINA 3OENA 1FW0A 3RLFE 3OEKA 2PBWA 2Y7IA 5IKBA 2AYSA 5I2NA 4F18A 2I48A 1B52A 2I49A 1IQ7A 3WAFA 2OWSA 4U4SA 1EZPA 3RT6B 1CB6A 1QULA 1EZOA 4ZEDA 3CG3A 4YAHX 1B32A 5FHMA 1WVJA 4KFQA 5ICTA 2B3FA 5K2XA 1N0TA 4RJZA 2XXTA 2Y7PA 4G68C 3FV2A 4EXLA 1FQEA 2YPNA 2DE3A 4N13A 4RPNA 4YB6A 2FYIA 3R7XA 3SDFA 3N26A 1GVCA 3C34A 3W9WA 3Q27A 2QS1A 3HSTA 2VD3A 3O6HA 4YKPA 2IEEA 4P11A 3E9XA 1P1OA 4C1UA 1B0LA 2HCAA 1XC1A 2D5WA 1OIBA 2DYXA 2XD3A 2W7YA 3PUXE 2F6PA 4OFLA 3GXAA 5B7DA 1DOTA 4C0RA 2XX9A 1N7XA 3IOVA 2F6GA 3TDJA 1PB8A 1ZIUA 1D9YA 1EH3A 2PT2A 4HCYA 1ZKBA 4AQ4A 4LZ8A 1AH5A 1S50A 2XXQA 3DLNA 4X48A 1MG1A 3OD7A 2I6EA 3QUFA 1LCTA 3K2DA 2REGA 1LAHE 5H8QA 3BFUA 3KFMA 3DP8A 4LUBA 5AA3A 2OZZA 1IEJA 1NL5A 3K0VA 5JTYB 1MPDA 2QMWA 1GTKA 4MLVA 1OMPA 4PE5B 1VR5A 3PPRA 3V89B 3TCHA 1QUKA 3LSFB 2DP8A 5F7VA 1NNFA 2XD2A 3KBRA 1URGA 1B4HA 3ILTB 1LB9A 2HEUA 4MBPA 5FTHA 4Q8RA 1IXCA 2H9BA 5IAIA 4KYDA 3OEMA 2P0SA 3VVFA 3PMXA 1B58A 1FQDA 2DVZA 4EF1A 2Z22A 3G3FA 3M3KA 3TTKA 4ZECA 4G2ZA 1R9QA 2QJEA 3VDFA 4AB6A 1F9BA 4GL8A 4H67A 4TOZA 4YMAA 2XXVA 3G3KA 4YKIA 2VP1A 3OSRA 5DEXA 2F36A 1ZBMA 3C36A 3IAZA 3PGFA 4IO5A 4EXKA 1YCJA 4FATA 4OZ9A 3HHGA 2HXWA 5ITPA 1JW5A 1LCFA 4JBZA 5H8QB 4Z7EA 4N07A 1LFHA 3KJ7A 1FTKA 3IR1A 1JVXA 3OSQA 3CIJA 3RTFB 4FEBA 5F1QA 3H4ZA 4R72A 3UN6A 3TFLA 2CMOA 2WKYA
chains in the Genus database with same CATH superfamily
4I40A 5DW8A 4R9GA 1FSAA 1QKAA 2Y7WA 5I2NB 4X8RA 2E1SA 1YTVA 1UTBB 3AXFA 2O7UA 5IZ1A 1Q1KA 1RDYA 1EZ9A 1MXUA 2VOZA 1SVXB 5AA4B 1NI9A 2DE2A 2OJTA 4F1UA 1R6ZA 1MY0A 5FBPA 3DP6A 4YKJA 1LFIA 3Q25A 3TEPA 1FPKA 3KC1A 1JW1A 1HSEA 1OLAA 3G7WA 1FPDA 4F3BA 3IO4A 1JP4A 1VFDA 3H6WA 2BJIA 3VLUA 3PD8A 4LZ5A 3QUJA 3LV0A 1PBQA 1JNFA 2I0CA 4GLIA 1D3KA 5BWJA 3PU5A 3H3GA 3JYRA 3MZ9A 2P3NA 2CZIA 1IXGA 2B4MA 1I6AA 2R6GE 2QS4A 3C31A 4BDLA 3PPQA 3K02A 4PQJA 4F19A 1QUJA 1NH7A 2CZHA 2P3VA 1B1XA 1MY1A 3F11A 4O7MA 1LB8A 1KZ8A 1ATGA 3VVEA 3FJGA 5EQAA 4PF6A 5JK4A 3HFUA 3FXQA 5FTIA 3VE1B 4G4PA 5AA4A 4P0GA 3BIHA 3S9NC 2VHAA 1Y3PA 4MAGA 1DBZA 2MKZA 3BBRA 4MNPA 3FJ7A 1ANFA 2RC7A 3QYTA 4LVQA 4H5GA 4H5FA 4ZE8A 5EYFA 1FBHA 2QL3A 4QFPA 3MVWA 4IGTA 2HAUA 2REJA 3RYDA 2O1LA 4FORA 4IY6A 1B7HA 4OVQA 3ZKLA 1VDWA 4RK2A 4DXBA 1FTMA 3K6VA 1QVSA 3W9VA 1FQCA 3S9MC 1IMBA 4H8IA 1MY4A 3A3CA 2RC8A 2DSFA 1AL3A 1MQJA 3MP6A 3I6VA 4ISUA 4F3SA 3GYYA 1CNQA 5CI5A 1MDP1 4LZ7A 4O7IA 1NV3A 2KR0A 1O7TA 4P9KA 4GF8A 4JSDA 4QSEA 2ZMBA 4PAIA 5DVIA 2WYPA 2Z8EA 3E79A 5ICQA 5KDTA 4UACA 1A55A 1Y1MA 3W15C 3QAXA 1R1NA 1I6QA 3HHFA 3TQLA 4HE1A 1Y9UA 5CBSA 3TUSA 1A54A 5TP9A 1NV2A 2ALUA 1SW5A 1G0HA 4LONB 4ZEKA 1P1QA 1A40A 1P99A 4G68A 5JEIA 4F31B 1N04A 4QF9A 4H8JA 1I69A 2XXIA 2KQZA 1M5BA 3ODBA 2RF1A 3PUWE 3FVNA 3Q26A 1ZLQA 4FEDA 5EHSA 3RN8A 4PE3A 2AIXA 1CE2A 1LAFE 2F7CA 4RYAA 1FPGA 4F1VA 3S4UA 1XI6A 1DSNA 2V3TA 4OVJA 3SESA 1BTJA 1P1NA 4PAFA 1VSOA 3K1MA 3U92A 4JVCA 3FXRA 4KCDA 2Y7KA 4DXCA 3A29A 1H45A 2O1MA 1B2HA 2WEFA 4QSCA 4OESA 4Q5TA 2DS9A 3PUZE 4GWYA 1B4ZA 2XXKA 4DE8A 2Q89A 5CMKA 4GOTA 2HFBA 4U4XA 3Q29A 4UA8A 2DXRA 4GVOA 3G3IA 1DPPA 4DDDA 2OLBA 1M5FA 5DVFA 4NF8B 1NNKA 3MP8A 4BDRA 3RPLB 3K1PA 3MWBA 4NAPA 1H44A 5DT6A 3B50A 4OEVA 3BKIB 2L5VA 1N7WA 4N6PA 4ELRA 4IO7A 1SYIA 2V25A 4PETA 1IUDA 4NN3A 4U22A 2Q2CA 3O9PA 5CMMA 1XS5A 4LA9A 4PGNA 1FTOA 2QFLA 1R9LA 1NUYA 4GXAA 3TAJA 1MH4A 2HXRA 3JV9A 3EHTA 3PMWA 3D4GA 2Y7RA 4ELQA 3VVDA 3FZVA 2ZYMA 1DMBA 1TT1A 3MPLA 1AMFA 2O7IA 4G8HA 3CSGA 4R6KA 2FIXA 1A8EA 2V3UA 1Q35A 4EQBA 5EQ7A 3UORA 3S2VA 2RINA 4I3YA 2AYSA 2VPNA 1CB6A 4ZEDA 4YAHX 1WVJA 4KFQA 5K2XA 5ET6A 2XXTA 2DE3A 4YB6A 2FYIA 3Q27A 3O6HA 4YKPA 2IEEA 4C1UA 1B0LA 2HCAA 4OFLA 1OIBA 2F6PA 1N7XA 3TDJA 1ZIUA 1EH3A 4HCYA 1MG1A 1LCTA 3BFUA 5AA3A 1NL5A 2GQ1A 1MPDA 2QMWA 4PE5B 1VR5A 2PCRA 3LSFB 1URGA 1B4HA 5IAIA 1IXCA 3B8BA 3VVFA 4P8BA 2Z22A 4ZECA 2QJEA 3FBPA 1F9BA 5DEXA 2F36A 3IAZA 4IO5A 1LCFA 2WX9A 1FPBA 1FTKA 1Y4TA 3H6VA 4MEVA 4IO4A 2NWJA 4MH5A 1FPJA 1MH3A 5H8FA 2G29A 4KI0E 4JWXA 1IMDA 3TQWA 4N4UA 5ET7A 1ZTYA 1IXHA 3IB0A 2QRYA 5L8DA 4N15A 5KCJA 2QVVA 1Y1ZA 4FBPA 4DLDA 4ELOA 1MXYA 4N6KA 2E0SA 3TKDA 1WDNA 4Q0CA 4PBHA 5DVJA 3DP4A 2R9JA 4EQ9A 1TFAA 3GZGA 4HS7A 2GHAA 5CC2A 4U1OA 1B3EA 1FBCA 2XXWA 4KPTA 2XXRA 3E4RA 4M1VA 3RUMA 5AA2D 5IM2A 4MF3A 2M8CA 4PFYA 2FIEA 1QUIA 3A3UA 1SDXA 4XFEA 4M4GA 1PEBA 1I6BA 2QMXA 3QMFA 5H8FB 3MUQA 1H43A 4GIZA 1GV8A 1L5TA 4AS4A 1NUXA 4C1TA 1D9QA 1NKXA 3IB2A 4BDMA 4PFUA 3T9XB 2H4IA 3C9HA 3RPLA 4NF0A 2FNCA 1IMFA 1QGXA 5K2YA 2A5SA 1MXZA 3H7MA 2D3IA 3OO7A 3RQTA 4XKNA 2B4LA 1JEVA 1S7YA 3HV1A 4RPOA 3O29A 4G8NA 4XKRA 3ROJA 2UXAA 1OVBA 1OVTA 4ZS9A 4OXVA 4GL0A 1TXFA 4ZZEA 4IO2A 3IJXB 2O69A 2O84X 1J1NA 3KSJA 1NV1A 5TPAA 3RPWA 2I58A 3SEVA 3MVZA 4HW8A 1POTA 1B6HA 3BIGA 1FPLA 1MS7A 5CRYA 1PB9A 4U23A 2P1SA 4R6HA 3TCFA 1FPEA 1VE4A 5H8SA 4GXSB 3L6HA 4OENA 3RTWB 4X9TA 2OWTA 3BFTA 3FV1A 3UGWA 3TMGA 2CZLA 2OK2A 4FE8A 4PAKA 2F8DA 4NG7A 2Y5LA 1NV6A 3MZBA 4GQOA 2XXPA 1SBPA 2Z8FA 1Z7NE 3OO8A 5I59A 4RA1A 3K1NA 2VT5A 3EQ1A 1IXIA 5AA1A 1YZ0A 4I1DA 2ESNA 1B7ZA 3ISPA 3H06B 4XXUA 4JDFA 4RNSA 2RCBA 4YB7A 3G3GA 4E0WA 5KZTA 1QW0A 2NVUB 1NH8A 4JWYA 3CFZA 1SW1A 4G61A 1YXIA 4P0IA 4NF4A 2QSXA 3N94A 4NGUA 3T96B 3TPAA 4PDDA 1MY3A 1QJMA 1A99A 2DWIA 4RXLA 4N6DA 3I3VA 5I7IA 3T66A 1MM7A 2V3QA 2PFYA 4GWZA 3CR9A 2I4BA 1URSA 1LFGA 3TTNA 1DK4A 3PMVA 4QXDA 2OWZA 3MAMA 4OETA 2ZNUA 3PV0E 2Z8DA 4TQUQ 5J1DA 3MVXA 5I2KA 4QSDA 3JZJA 5AA2A 2WBBA 3VLWA 1FBFA 3B6QA 4NEDA 1EYIA 4GD5A 1LEVA 2UYEA 1AOVA 5AE4A 1IIWA 2I3WA 1VFEA 3TZAA 4TLMB 3KOTA 1US4A 3IJOB 3QK6A 4JVIA 4H46A 1B0HA 2ZZXA 1WODA 5ESYA 5BUUA 2QS3A 1LFHA 1SYHA 3HCQA 1YAEA 2XXXA 3CVGA 2DE4A 4ECFA 3LSLA 4OMBA 2RC9A 4O3AA 3I5OA 4GBWA 4PFWA 5H8NA 1UIUA 2PMSA 4XKQA 3KBZA 4F2OA 2ZZWA 3MW0A 3CFXA 1IZ1A 3PPOA 1LBXA 4PF8A 1P1WA 3VXBA 5I58A 1SD3A 3KC0A 4OVRA 3O6IA 2XWOA 1INPA 5ITOA 2GRVA 3VV5A 3KGCA 1RDZA 1MQGA 1MRPA 1OLCA 4EQ7A 2PBWA 5I2NA 4F18A 1LBWA 2I48A 2OWSA 1EZOA 4PBQA 4RJZA 4G68C 3FV2A 4EXLA 4XF5A 1FQEA 3SDFA 5IZ3A 3N26A 1GVCA 3C34A 2VD3A 2D5WA 3IOVA 1D9YA 3NOHA 3K2DA 5LDZA 2REGA 5H8QA 4LUBA 3K0VA 4MLVA 1OMPA 3V89B 3TCHA 2DP8A 1NNFA 2XD2A 4F1YA 2HEUA 4KYDA 2P0SA 1B58A 3G3FA 3VDFA 3E78A 4H67A 4TOZA 2XXVA 3PGFA 3C36A 3HHGA 5ITPA 1JW5A 4Z7EA 4N07A 3RTFB 3OSQA 3CIJA 4FEBA 3TFLA 5ELVA 2WKYA 4HTGA 4PCDA 1TWYA 1LAGE 3L6GA 3EPEA 1FJ9A 4DCYA 1UTHA 3IL1B 4TLLB 3PUYE 4WEDA 1D9VA 1XVYA 2THIA 3FATA 4U1ZA 1YPNA 1MXWA 3T9UA 4Z0IA 3O66A 2F34A 1LLSA 3KJTA 1UQWA 2PFZA 4POWA 4IGRA 4JWOA 2G93A 3EKIA 4NWCA 2DDKA 4ONYA 4MNCA 3C35A 4BLAA 1B5HA 5H8HB 2F5XA 4IB2A 4OQOA 1RDXA 2ONRA 3C4MA 4DCXA 4XTCQ 3T0JA 4YICA 3MZ1A 3ZS6A 2XHDA 1UTBA 3PD9A 3IORA 1FTAA 5HBCA 1PDAA 2Q8MA 2ZYNA 4NF5B 3RY3A 5B70A 2OBGA 4I8CA 2O6AA 2CEYA 2H5YA 2UVJA 4JVDA 2ZNTA 4NF5A 4JXIA 4KYEA 3ECRA 3FVGA 4LP2B 1A7LA 1BKAA 5HPQA 3ILUB 3S9LC 4YB5A 1NV0A 4OERA 3IB1A 4R2BA 5LOMA 3O2AA 3MC2A 4AB5A 1USYH 1B3HA 3UP9A 4HE2A 3HN0A 5EQ8A 1D4NA 1IMEA 1LBYA 1FBDA 1Y20A 2F3DA 1FBGA 3DM0A 2Q88A 3MQ9A 4LATA 3A09A 5DYHA 5J16A 4ZDMA 1FPIA 3FASA 3QIMA 3CSBA 4O94A 1EYJA 3U72A 3C32A 4P47A 2V4CA 1POY1 4GWWA 4PTKA 4DI3D 3USDA 4LN5A 5I56B 4K3FA 3EN3A 1KA0A 3FJMA 3K6WA 5H8NB 1N3XA 4WEPA 2IA4A 1DCUA 4EUOA 4ELPA 3GBBA 3N6UA 4NQ8A 1O63A 4XIGQ 4PFRA 4KXPA 1XOCA 4QBAA 4OEUA 2I3VA 1FTJA 1Q9DA 2HZLA 4IY5A 4XKPA 2Q8JA 4QRZA 1LBCA 3IOUA 1PBPA 5M2VA 4IO6A 2P2AA 2DWJA 2QPQA 1B40A 1US5A 3E3KA 3D4CA 1ZU0A 1H76A 4P56A 5CM6A 1RYXA 2R8TA 3H6UA 2GH9A 2NOOA 5CMBA 4KD5A 4PFTA 2XWKA 1YYZA 1DTZA 4F29A 4YKKA 1LAXA 2O68A 4GWOA 4HCWA 5F24A 1ZMGA 4F3GA 1LSTA 1NV4A 1JVYA 3G3JA 3CG1A 4H65A 3RGYA 1GGGA 3M3LA 3UA8A 3FIRA 4FECA 4G8MA 3VXCA 1SW4A 5T3JA 4G68B 3FVKA 4N81A 3KEIA 4F39A 1FQFA 3CFLA 2DQVA 3E13X 3V83A 2H98A 1OQHA 4H0WA 1K9ZA 3OXNA 2F3BA 4H6DA 1JETA 4GX3A 4P3LA 4R2FA 1FRPA 2XX8A 1B9JA 2Q9TA 4WXJA 3B6TA 3T9VA 4F2QA 1DTGA 1M5CA 2I0BA 3KN7A 3FD3A 4PC9A 1RYOA 3ONMA 1USYE 4KCCA 1XVXA 1B46A 3PPPA 4ZEFA 4U2RA 3LUYA 4N8GA 1B5IA 2XX7A 1SQYA 3IFAA 5EQ9A 4KYSA 4QHQA 4KQPA 2ZYOA 3EHUA 1B05A 3O97A 4KHZE 4HE0A 4NMYA 5L9SA 1B1HA 2DVCA 3P7IA 3PPNA 5CMCA 1Y4CA 4P1LA 5I84A 2XXUA 4KR5A 3ZKKA 2QS2A 1BK4A 4JSOA 4I3EA 3M8UA 1MQHA 5I57A 4GWSA 1P1UA 1RKMA 4OA4A 3CRBA 4H45A 3K4UA 2ZNSA 3B6WA 4MIJA 1N3WA 5I5PA 2XA5A 4E0XA 3IOTA 4R74A 2H99A 1A8FA 1QKBA 4MFIA 3LC8A 4ZZAA 2AL4A 1NV5A 2XWIA 2GFEA 3H6TA 4RK9A 5TP9B 3OELA 3U65A 5EYGA 3LSWA 5CBRA 4PFBA 2V93A 4OANA 2X7QA 3HO7A 4MJOA 2B65A 2NUVA 4OVTA 4GX6A 2Y7IA 5I3SA 1B52A 1IQ7A 4U4SA 1EZPA 1QULA 4PGPA 3CG3A 5FHMA 1B32A 5ICTA 3R7XA 2QS1A 1XC1A 2XD3A 2DYXA 2HHMA 3PUXE 5B7DA 2XX9A 2WBDA 2PT2A 1ZKBA 4AQ4A 4LZ8A 1AH5A 1S50A 2XXQA 4X48A 1NUZA 1IMCA 3OD7A 1NUWA 3KFMA 3PPRA 4GBVA 4MBPA 1LB9A 5FTHA 3PMXA 1FQDA 3M3KA 3TTKA 3LUZA 4G2ZA 4AB6A 4GL8A 5A5LA 1FBEA 4YKIA 4FATA 4OZ9A 4UABA 5H8QB 2OX3A 3SZPA 5F1QA 3H4ZA 4R72A 5ET5A 3MYUA 5DTBA 3G3HA 4N17A 4NF6A 2DOJA 2FA7A 1IMAA 1FCKA 1JQFA 4NF4B 3IFCA 1TFDA 5KCJB 4OWDA 5EYHA 3O28A 2F7AA 3SEXA 4F22A 4AS5A 1NFTA 5EHMA 4NHBA 4JB7A 3Q28A 1LGBC 4QFLA 3KN3A 5ISUA 4ESWA 1AWBA 2Y84A 4LQ2A 2UVGA 2NXOA 2R71A 2JJKA 2F78A 2QVRA 2D21A 3T93B 1B51A 3IK6B 2X7PA 3T9HB 3TTMA 2ABHA 3N6TA 5A5XB 1MXVA 2FVZA 3T1BA 3UIFA 1B3FA 3OO6A 4EDPA 4PFIA 4O3CA 2Z23A 1B7UA 1T0KA 1O64A 1IITA 1Z7ME 1M5DA 3DELB 4YMBA 4YU0A 3V5AA 2V84A 3KN8A 4ZE9A 1G0IA 3FUZA 4WKMA 2XXHA 4U21A 4GWXA 2AL5A 3CI8A 4PDHA 5HM4B 3MP1A 1FQAA 2KLFA 1KA1A 3OOAA 4OFJA 3MBPA 1II5A 5I59B 1MQDA 4ND9A 1SI1A 3EHSA 5IGAA 3GLBA 5I56A 4X1BA 4FAJA 2ONKE 5TU0A 3ZSFA 1B3LA 2HZKA 4BDOA 3THIA 2XWVA 1PB7A 1K9YA 3TYHA 3M3FA 3R26A 1MXXA 2BJJX 1HSLA 3LBSA 3C33A 4BDNA 1PC3A 4MHFA 3VLVA 4NF6B 4POXA 1H3DA 4L17A 4OFOA 5FHNA 4F3PA 2UVHA 4O3BA 4NE4A 1NNPA 4DXUA 2QVUA 2UYFA 2I4CA 4R9FA 4MMPA 2YJPA 3UK4A 3U94A 5ET8A 3MVYA 3OMBA 3RT8A 3PUVE 1B3GA 3SERA 4GWUA 4BDQA 3PTYA 3K00A 3VFJA 4QFKA 5DEXB 4MNIA 3SEYA 3U1OA 4PP0A 1FTLA 2PX1A 3KZGA 3R6UA 5IZZA 1AIVA 1OQGA 2RKMA 4GX4A 3O6GA 4O8MA 3K6UA 3MPKA 2H25A 3MJNA 1MDQA 4DZ1A 4R6YA 4ZEBA 4DIGA 4OHNA 4X04A 2ONSA 3WAEA 1MM6A 4NX1A 4P1EA 3V8XB 4MCOA 5H8HA 2FHYA 1KWHA 2VGQA 1XT8A 4R73A 2HAVA 4LQ5A 2ANJA 3S9EA 2RCAA 5KDTB 2Q74A 3TODA 4MLQA 2LAOA 4QFNA 1GR2A 5L9OA 3OO9A 3IOWA 4I62A 1BP5A 2B3BA 1FBPA 1URDA 4ZEIA 4THIA 1UTHB 1DPEA 4OYVA 1JW4A 3H03A 4R75A 3CHGA 3IX1A 1ZJLA 2OCUA 2PVUA 4ESXA 4QFOA 3B7DA 1N84A 1JEUA 3SETA 2HQ0A 4XEQA 3TTRA 1BLFA 2HPGA 1MPCA 2XXYA 2DXYA 4DI4B 2VD2A 2X26A 1HSJA 5AA2B 3LR1A 1MY2A 4EF2A 1FJ6A 2F35A 3RNNA 1M5EA 1SW2A 3GBAA 4I9DA 5A5XA 2PT1A 3TELA 4IO3A 4RY1A 2UVIA 2DWHA 1Y3NA 1EYKA 3EF7A 2PYYA 3SEUA 2Q2AA 3KOSA 1ELJA 1NMUA 3D1RA 4HXVA 1B5JA 2F97A 5I57B 1MPBA 2F7BA 2WYKA 2FBPA 4H1XA 4IR8A 3K01A 3T22A 1LBBA 2ZZVA 3QSLA 4GRKA 2A5TA 3U8QA 3TCGA 1N76A 4N91A 1BIYA 1FQBA 3U93A 1NNTA 2O51A 4OTEA 5I2KB 2A5TB 2CEXA 3LSXA 1LBVA 3KG2A 3SEWA 2DWAA 1EU8A 4YZZA 3HPIA 3TTLA 2YLNA 4GFRA 1S9TA 1Y3QA 3FGSA 3KSXA 2CZKA 4FIMA 5IZ3B 5LTCA 5JTYA 2GHBA 5L9MA 5TPAB 4NWDA 1MQIA 3K6XA 3FVOA 2ZXTA 1XHYA 1NV7A 4NF8A 1SI0A 5I58B 3IO6A 4Q30B 4G77A 3FXUA 4NTLA 4FJPA 3N5LA 4X1DA 3FXBA 3MSTA 5FHOA 2VPOA 3SKPA 2ZYKA 4MX6A 3QXMA 1UIVA 3OENA 1FW0A 3RLFE 3OEKA 5IKBA 2I49A 3WAFA 3RT6B 2B3FA 1N0TA 2Y7PA 2YPNA 4N13A 4RPNA 1SPIA 3W9WA 3HSTA 4P11A 3E9XA 1P1OA 1LBZA 2W7YA 3GXAA 1DOTA 4C0RA 2F6GA 1PB8A 3DLNA 2I6EA 2Y5KA 3QUFA 4N8YA 1LAHE 3DP8A 2OZZA 1IEJA 5JTYB 1GTKA 1QUKA 5F7VA 3KBRA 3ILTB 4Q8RA 2H9BA 3OEMA 4OVPA 2DVZA 1R9QA 4YMAA 1FPFA 3G3KA 2VP1A 3OSRA 4OVSA 1ZBMA 4EXKA 1YCJA 2HXWA 4JBZA 3KJ7A 4EF1A 3IR1A 1JVXA 3UN6A 2CMOA
chains in the Genus database with same CATH topology
4HTGA 5DTBA 3H6VA 1TWYA 3G3HA 1LAGE 3L6GA 4NF6A 4R9GA 4RNSA 2DOJA 3EPEA 4IO4A 2NWJA 1QKAA 2FA7A 2Y7WA 4MH5A 4DCYA 5I2NB 1UTHA 1MH3A 1FCKA 3IL1B 1JQFA 1YTVA 1UTBB 2E1SA 5H8FA 3AXFA 4TLLB 2O7UA 3PUYE 4WEDA 1D9VA 2G29A 4KI0E 4JWXA 3TQWA 1Q1KA 1EZ9A 1MXUA 1XVYA 4NF4B 2THIA 3FATA 2VOZA 4U1ZA 1TFDA 1YPNA 1ZTYA 1MXWA 3T9UA 5KCJB 1IXHA 1SVXB 3IB0A 4OWDA 2QRYA 3O28A 4Z0IA 2F7AA 3O66A 2F34A 3SEXA 4F22A 5L8DA 1LLSA 3KJTA 5AA4B 1UQWA 1NFTA 2DE2A 5EHMA 5KCJA 4POWA 4IGRA 1Y1ZA 2OJTA 4F1UA 4JWOA 1R6ZA 4DLDA 1MY0A 2G93A 4JB7A 4ELOA 3Q28A 3DP6A 4YKJA 1MXYA 2E0SA 4NWCA 1LGBC 1LFIA 3KN3A 3Q25A 4ONYA 4QFLA 3TKDA 4ESWA 5ISUA 1WDNA 2Y84A 4LQ2A 2UVGA 4Q0CA 2NXOA 3TEPA 3C35A 1JW1A 2R71A 4BLAA 5DVJA 3DP4A 1B5HA 4DDDA 1HSEA 1OLAA 2F5XA 2R9JA 4IB2A 5H8HB 4EQ9A 2F78A 3G7WA 1TFAA 3GZGA 2D21A 4OQOA 4HS7A 4F3BA 3IO4A 2GHAA 5CC2A 4U1OA 1B3EA 1VFDA 2ONRA 2XXWA 3T93B 4LVQA 3H6WA 4KPTA 2XXRA 1B51A 3C4MA 3IK6B 2X7PA 3E4RA 4M1VA 3RUMA 4DCXA 5AA2D 5JEIA 3T9HB 3TTMA 2ABHA 3VLUA 4MF3A 3N6TA 3PD8A 2M8CA 4LZ5A 4PFYA 3QUJA 1QUIA 4XTCQ 5A5XB 3A3UA 1MXVA 1PBQA 1JNFA 1SDXA 2I0CA 4YICA 4M4GA 4GLIA 4F1YA 1PEBA 1I6BA 2QMXA 3MZ1A 2XHDA 3UIFA 3ZS6A 1B3FA 1UTBA 3MUQA 5H8FB 1H43A 3OO6A 4EDPA 1D3KA 4GIZA 4O3CA 1GV8A 2Z23A 1B7UA 3PD9A 3IORA 3PU5A 1L5TA 5BWJA 3H3GA 3JYRA 1T0KA 3MZ9A 1O64A 1IITA 4C1TA 5HBCA 1Z7ME 1NKXA 1M5DA 1PDAA 3IB2A 5B70A 2ZYNA 4NF5B 1IXGA 3RY3A 3DELB 2OBGA 5ELVA 4BDMA 4YMBA 4I8CA 1I6AA 2R6GE 2O6AA 2QS4A 2V84A 4YU0A 3V5AA 2H5YA 3C31A 2UVJA 3KN8A 4PFUA 3T9XB 4BDLA 4ZE9A 2H4IA 3C9HA 3PPQA 2ZNTA 3FUZA 4JXIA 4NF5A 2FNCA 3K02A 4KYEA 4PQJA 3ECRA 3FVGA 4WKMA 4F19A 1QUJA 1NH7A 2XXHA 5K2YA 1B1XA 4LP2B 1MY1A 4U21A 1A7LA 2A5SA 1BKAA 3F11A 5HPQA 1MXZA 1LB8A 3H7MA 2D3IA 2AL5A 1ATGA 3CI8A 3ILUB 4YB5A 3VVEA 5HM4B 4OERA 3S9LC 3IB1A 3FJGA 3OO7A 3RQTA 5JK4A 4R2BA 4XKNA 3FXQA 3MP1A 5FTIA 4G4PA 3VE1B 1FQAA 1JEVA 2KLFA 1S7YA 5AA4A 4P0GA 3HV1A 3O2AA 3OOAA 4OFJA 5LOMA 3S9NC 3MC2A 4AB5A 1USYH 1B3HA 2VHAA 3O29A 1Y3PA 4RPOA 4G8NA 3UP9A 4XKRA 3BBRA 2UXAA 3HN0A 1D4NA 1OVBA 1OVTA 1II5A 3MBPA 4ZS9A 3FJ7A 4OXVA 5I59B 1ANFA 1MQDA 1SI1A 1TXFA 1Y20A 2RC7A 3IJXB 4GL0A 4IO2A 4ND9A 1Y4TA 3DM0A 2O69A 2O84X 1J1NA 2Q88A 3EHSA 3KSJA 3MQ9A 3QYTA 4H5GA 4H5FA 4LATA 2I58A 3GLBA 3A09A 5DYHA 4ZE8A 5EYFA 4X1BA 3RPWA 5I56A 2QL3A 3SEVA 3MVZA 2ONKE 4FAJA 5TU0A 4ZDMA 1B3LA 2HZKA 4QFPA 3ZSFA 3THIA 4BDOA 4HW8A 3MVWA 1POTA 4IGTA 1B6HA 1PB7A 3FASA 3TYHA 2HAUA 2REJA 3CSBA 3M3FA 3QIMA 1MS7A 2O1LA 1MXXA 3R26A 4FORA 2BJJX 5CRYA 4IY6A 3U72A 1PB9A 4U23A 1B7HA 2P1SA 4R6HA 1HSLA 3TCFA 3C32A 3ZKLA 3LBSA 3C33A 1VE4A 1PC3A 5H8SA 4BDNA 4RK2A 1POY1 3VLVA 4DXBA 4NF6B 4POXA 1FTMA 1H3DA 4L17A 3USDA 3K6VA 4OFOA 5FHNA 4F3PA 2UVHA 4GXSB 3L6HA 5I56B 1QVSA 4K3FA 4O3BA 4OENA 3RTWB 3W9VA 1FQCA 3EN3A 4NE4A 3S9MC 4X9TA 1NNPA 2OWTA 4DXUA 3BFTA 3FV1A 2UYFA 2I4CA 4R9FA 3TMGA 2CZLA 3UGWA 4H8IA 2OK2A 2YJPA 4FE8A 3FJMA 3K6WA 3UK4A 1MY4A 1N3XA 3A3CA 4WEPA 5H8NB 3U94A 2IA4A 2RC8A 2DSFA 2F8DA 4EUOA 3MVYA 3OMBA 3RT8A 3MZBA 3PUVE 4ELPA 4GQOA 2XXPA 1AL3A 3GBBA 3N6UA 1O63A 1B3GA 1MQJA 3MP6A 4XIGQ 3I6VA 1SBPA 2Z8FA 4ISUA 3SERA 1Z7NE 3OO8A 4F3SA 4BDQA 5I59A 4RA1A 3K1NA 1XOCA 5CI5A 3K00A 1MDP1 3VFJA 3EQ1A 4LZ7A 4QFKA 4OEUA 5DEXB 1O7TA 4GF8A 4JSDA 3SEYA 2I3VA 1FTJA 1IXIA 3U1OA 5AA1A 4PP0A 2HZLA 2ZMBA 1FTLA 4IY5A 4QSEA 2PX1A 5DVIA 4I1DA 2ESNA 3KZGA 3R6UA 2Z8EA 4XKPA 2Q8JA 4QRZA 5ICQA 1LBCA 1OQGA 3IOUA 1PBPA 1AIVA 2RKMA 5KDTA 4UACA 1A55A 4IO6A 5M2VA 2P2AA 2DWJA 1Y1MA 1B7ZA 3W15C 3H06B 3O6GA 2QPQA 4XXUA 4JDFA 1B40A 2RCBA 1R1NA 3K6UA 3MPKA 3QAXA 1I6QA 3G3GA 2H25A 1US5A 3MJNA 4YB7A 1MDQA 3E3KA 3D4CA 4DZ1A 4R6YA 1ZU0A 4ZEBA 4DIGA 4OHNA 4E0WA 1H76A 5CM6A 5KZTA 3HHFA 1RYXA 1QW0A 2NVUB 1NH8A 2ONSA 3H6UA 3TQLA 3WAEA 2GH9A 2NOOA 5CMBA 4JWYA 1MM6A 3CFZA 1Y9UA 1SW1A 5CBSA 3V8XB 4KD5A 4PFTA 3TUSA 5H8HA 1DTZA 4F29A 4YKKA 4P0IA 1KWHA 1LAXA 1XT8A 2QSXA 2VGQA 4NF4A 2O68A 3N94A 4R73A 2HAVA 4GWOA 1A54A 4LQ5A 3T96B 2ANJA 5TP9A 3TPAA 3S9EA 4HCWA 2RCAA 1MY3A 5KDTB 1ZMGA 3TODA 1QJMA 1A99A 2ALUA 2DWIA 4RXLA 4ZZEA 4F3GA 1LSTA 4MLQA 2LAOA 1JVYA 1SW5A 3CG1A 3G3JA 3I3VA 4H65A 1GR2A 4QFNA 3RGYA 1GGGA 3M3LA 4LONB 3T66A 5L9OA 4ZEKA 1P1QA 1A40A 3UA8A 1P99A 1MM7A 3OO9A 2V3QA 4G68A 3IOWA 1BP5A 4I62A 3CR9A 3FIRA 4FECA 4G8MA 2I4BA 4F31B 1N04A 2B3BA 4QF9A 1SW4A 3VXCA 4H8JA 1URDA 1URSA 1I69A 1LFGA 4G68B 4ZEIA 3FVKA 4THIA 3TTNA 3PMVA 1UTHB 1DPEA 2XXIA 4OYVA 1JW4A 3KEIA 3H03A 4R75A 4F39A 1FQFA 3IX1A 1ZJLA 2OCUA 2PVUA 4ESXA 1M5BA 3CFLA 2DQVA 3ODBA 3E13X 3MAMA 3V83A 4OETA 4QFOA 2RF1A 3PUWE 3B7DA 2H98A 2ZNUA 1N84A 1OQHA 4H0WA 3FVNA 3PV0E 2Z8DA 3OXNA 3Q26A 4TQUQ 1ZLQA 5J1DA 4FEDA 1JEUA 3SETA 4H6DA 2HQ0A 3MVXA 1JETA 5I2KA 4R2FA 5EHSA 3RN8A 4QSDA 2AIXA 3JZJA 1BLFA 3TTRA 1MPCA 5AA2A 1CE2A 2XXYA 2XX8A 2DXYA 1LAFE 2F7CA 2VD2A 2X26A 1B9JA 2Q9TA 1HSJA 4RYAA 4WXJA 5AA2B 3B6TA 3LR1A 4F1VA 1MY2A 3S4UA 3VLWA 3T9VA 4EF2A 4F2QA 1DTGA 1DSNA 1M5CA 2F35A 2I0BA 3RNNA 2V3TA 3FD3A 3KN7A 1BTJA 3B6QA 4OVJA 3SESA 1P1NA 1M5EA 1SW2A 4NEDA 3GBAA 1VSOA 3K1MA 4I9DA 3U92A 5A5XA 2PT1A 1RYOA 3TELA 3ONMA 4IO3A 1USYE 3FXRA 4KCCA 1XVXA 2Y7KA 4KCDA 2UVIA 1B46A 2DWHA 1Y3NA 4RY1A 4DXCA 1H45A 2O1MA 3EF7A 3PPPA 2PYYA 4GD5A 1B2HA 4ZEFA 3SEUA 2Q2AA 2UYEA 4U2RA 1AOVA 3KOSA 4QSCA 1ELJA 3LUYA 4OESA 4Q5TA 1NMUA 1IIWA 2I3WA 5AE4A 1VFEA 2DS9A 3TZAA 3PUZE 1B5IA 4TLMB 3KOTA 2XX7A 1SQYA 1B5JA 1US4A 3IJOB 3QK6A 1B4ZA 4DE8A 2F97A 2Q89A 5TPAA 5CMKA 5I57B 1MPBA 4KYSA 2F7BA 4QHQA 4H1XA 1B0HA 4KQPA 4GOTA 2HFBA 1WODA 2ZYOA 3K01A 3T22A 3EHUA 1LBBA 4U4XA 3QSLA 3Q29A 5BUUA 4GRKA 1B05A 3O97A 2QS3A 4KHZE 4NMYA 2DXRA 4UA8A 5L9SA 4GVOA 3G3IA 1DPPA 1B1HA 1SYHA 2A5TA 2DVCA 3HCQA 3P7IA 3PPNA 5CMCA 1YAEA 2OLBA 2XXXA 3TCGA 1N76A 1M5FA 1Y4CA 1BIYA 2DE4A 1FQBA 3CVGA 5DVFA 3U93A 1NNTA 3LSLA 4NF8B 1NNKA 4ECFA 2O51A 3MP8A 4OTEA 5I2KB 2A5TB 4OMBA 4BDRA 5I84A 2XXUA 4KR5A 2RC9A 3K1PA 3MWBA 4O3AA 1H44A 3LSXA 3KG2A 3SEWA 2DWAA 3I5OA 2QS2A 3ZKKA 5DT6A 4JSOA 1EU8A 4OEVA 4YZZA 3M8UA 3HPIA 3TTLA 2YLNA 1MQHA 4PFWA 4GFRA 3BKIB 5H8NA 5I57A 1S9TA 1Y3QA 3FGSA 1P1UA 1RKMA 1UIUA 3KSXA 2PMSA 4XKQA 1N7WA 4N6PA 4FIMA 3CRBA 4ELRA 4IO7A 1SYIA 2V25A 4PETA 4F2OA 5JTYA 1IUDA 2GHBA 3K4UA 5L9MA 4U22A 5TPAB 2ZNSA 4NWDA 1MQIA 3K6XA 3MW0A 3FVOA 3B6WA 2ZXTA 1N3WA 1XHYA 4NF8A 2Q2CA 1IZ1A 3CFXA 3O9PA 5CMMA 4E0XA 1XS5A 3IOTA 1SI0A 3PPOA 4LA9A 1FTOA 5I58B 4R74A 1R9LA 3IO6A 4Q30B 4G77A 4GXAA 2H99A 3TAJA 1A8FA 1MH4A 1QKBA 3FXUA 3JV9A 4NTLA 1P1WA 3EHTA 4FJPA 3VXBA 3PMWA 4MFIA 5I58A 1SD3A 3N5LA 3D4GA 2Y7RA 3LC8A 4ZZAA 4ELQA 4X1DA 3VVDA 3FZVA 2ZYMA 3O6IA 1DMBA 1TT1A 3MPLA 1AMFA 2AL4A 2O7IA 5FHOA 2GFEA 4G8HA 5ITOA 3CSGA 2GRVA 4R6KA 3VV5A 3KGCA 3H6TA 4RK9A 5TP9B 3OELA 1A8EA 3SKPA 2ZYKA 3LSWA 5CBRA 2V3UA 1Q35A 4EQBA 1MQGA 2V93A 1MRPA 1OLCA 2X7QA 3HO7A 3UORA 3S2VA 3QXMA 2B65A 2NUVA 1UIVA 3U8QA 4EQ7A 2RINA 3OENA 1FW0A 3RLFE 3OEKA 2PBWA 2Y7IA 5IKBA 2AYSA 5I2NA 4F18A 2I48A 1B52A 2I49A 1IQ7A 3WAFA 2OWSA 4U4SA 1EZPA 3RT6B 1CB6A 1QULA 1EZOA 4ZEDA 3CG3A 4YAHX 1B32A 5FHMA 1WVJA 4KFQA 5ICTA 2B3FA 5K2XA 1N0TA 4RJZA 2XXTA 2Y7PA 4G68C 3FV2A 4EXLA 1FQEA 2YPNA 2DE3A 4N13A 4RPNA 4YB6A 2FYIA 3R7XA 3SDFA 3N26A 1GVCA 3C34A 3W9WA 3Q27A 2QS1A 3HSTA 2VD3A 3O6HA 4YKPA 2IEEA 4P11A 3E9XA 1P1OA 4C1UA 1B0LA 2HCAA 1XC1A 2D5WA 1OIBA 2DYXA 2XD3A 2W7YA 3PUXE 2F6PA 4OFLA 3GXAA 5B7DA 1DOTA 4C0RA 2XX9A 1N7XA 3IOVA 2F6GA 3TDJA 1PB8A 1ZIUA 1D9YA 1EH3A 2PT2A 4HCYA 1ZKBA 4AQ4A 4LZ8A 1AH5A 1S50A 2XXQA 3DLNA 4X48A 1MG1A 3OD7A 2I6EA 3QUFA 1LCTA 3K2DA 2REGA 1LAHE 5H8QA 3BFUA 3KFMA 3DP8A 4LUBA 5AA3A 2OZZA 1IEJA 1NL5A 3K0VA 5JTYB 1MPDA 2QMWA 1GTKA 4MLVA 1OMPA 4PE5B 1VR5A 3PPRA 3V89B 3TCHA 1QUKA 3LSFB 2DP8A 5F7VA 1NNFA 2XD2A 3KBRA 1URGA 1B4HA 3ILTB 1LB9A 2HEUA 4MBPA 5FTHA 4Q8RA 1IXCA 2H9BA 5IAIA 4KYDA 3OEMA 2P0SA 3VVFA 3PMXA 1B58A 1FQDA 2DVZA 4EF1A 2Z22A 3G3FA 3M3KA 3TTKA 4ZECA 4G2ZA 1R9QA 2QJEA 3VDFA 4AB6A 1F9BA 4GL8A 4H67A 4TOZA 4YMAA 2XXVA 3G3KA 4YKIA 2VP1A 3OSRA 5DEXA 2F36A 1ZBMA 3C36A 3IAZA 3PGFA 4IO5A 4EXKA 1YCJA 4FATA 4OZ9A 3HHGA 2HXWA 5ITPA 1JW5A 1LCFA 4JBZA 5H8QB 4Z7EA 4N07A 1LFHA 3KJ7A 1FTKA 3IR1A 1JVXA 3OSQA 3CIJA 3RTFB 4FEBA 5F1QA 3H4ZA 4R72A 3UN6A 3TFLA 2CMOA 2WKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HTG A;  5DTB A;  3H6V A;  1TWY A;  3G3H A;  1LAG E;  3L6G A;  4NF6 A;  4R9G A;  4RNS A;  2DOJ A;  3EPE A;  4IO4 A;  2NWJ A;  1QKA A;  2FA7 A;  2Y7W A;  4MH5 A;  4DCY A;  5I2N B;  1UTH A;  1MH3 A;  1FCK A;  3IL1 B;  1JQF A;  1YTV A;  1UTB B;  2E1S A;  5H8F A;  3AXF A;  4TLL B;  2O7U A;  3PUY E;  4WED A;  1D9V A;  2G29 A;  4KI0 E;  4JWX A;  3TQW A;  1Q1K A;  1EZ9 A;  1MXU A;  1XVY A;  4NF4 B;  2THI A;  3FAT A;  2VOZ A;  4U1Z A;  1TFD A;  1YPN A;  1ZTY A;  1MXW A;  3T9U A;  5KCJ B;  1IXH A;  1SVX B;  3IB0 A;  4OWD A;  2QRY A;  3O28 A;  4Z0I A;  2F7A A;  3O66 A;  2F34 A;  3SEX A;  4F22 A;  5L8D A;  1LLS A;  3KJT A;  5AA4 B;  1UQW A;  1NFT A;  2DE2 A;  5EHM A;  5KCJ A;  4POW A;  4IGR A;  1Y1Z A;  2OJT A;  4F1U A;  4JWO A;  1R6Z A;  4DLD A;  1MY0 A;  2G93 A;  4JB7 A;  4ELO A;  3Q28 A;  3DP6 A;  4YKJ A;  1MXY A;  2E0S A;  4NWC A;  1LGB C;  1LFI A;  3KN3 A;  3Q25 A;  4ONY A;  4QFL A;  3TKD A;  4ESW A;  5ISU A;  1WDN A;  2Y84 A;  4LQ2 A;  2UVG A;  4Q0C A;  2NXO A;  3TEP A;  3C35 A;  1JW1 A;  2R71 A;  4BLA A;  5DVJ A;  3DP4 A;  1B5H A;  4DDD A;  1HSE A;  1OLA A;  2F5X A;  2R9J A;  4IB2 A;  5H8H B;  4EQ9 A;  2F78 A;  3G7W A;  1TFA A;  3GZG A;  2D21 A;  4OQO A;  4HS7 A;  4F3B A;  3IO4 A;  2GHA A;  5CC2 A;  4U1O A;  1B3E A;  1VFD A;  2ONR A;  2XXW A;  3T93 B;  4LVQ A;  3H6W A;  4KPT A;  2XXR A;  1B51 A;  3C4M A;  3IK6 B;  2X7P A;  3E4R A;  4M1V A;  3RUM A;  4DCX A;  5AA2 D;  5JEI A;  3T9H B;  3TTM A;  2ABH A;  3VLU A;  4MF3 A;  3N6T A;  3PD8 A;  2M8C A;  4LZ5 A;  4PFY A;  3QUJ A;  1QUI A;  4XTC Q;  5A5X B;  3A3U A;  1MXV A;  1PBQ A;  1JNF A;  1SDX A;  2I0C A;  4YIC A;  4M4G A;  4GLI A;  4F1Y A;  1PEB A;  1I6B A;  2QMX A;  3MZ1 A;  2XHD A;  3UIF A;  3ZS6 A;  1B3F A;  1UTB A;  3MUQ A;  5H8F B;  1H43 A;  3OO6 A;  4EDP A;  1D3K A;  4GIZ A;  4O3C A;  1GV8 A;  2Z23 A;  1B7U A;  3PD9 A;  3IOR A;  3PU5 A;  1L5T A;  5BWJ A;  3H3G A;  3JYR A;  1T0K A;  3MZ9 A;  1O64 A;  1IIT A;  4C1T A;  5HBC A;  1Z7M E;  1NKX A;  1M5D A;  1PDA A;  3IB2 A;  5B70 A;  2ZYN A;  4NF5 B;  1IXG A;  3RY3 A;  3DEL B;  2OBG A;  5ELV A;  4BDM A;  4YMB A;  4I8C A;  1I6A A;  2R6G E;  2O6A A;  2QS4 A;  2V84 A;  4YU0 A;  3V5A A;  2H5Y A;  3C31 A;  2UVJ A;  3KN8 A;  4PFU A;  3T9X B;  4BDL A;  4ZE9 A;  2H4I A;  3C9H A;  3PPQ A;  2ZNT A;  3FUZ A;  4JXI A;  4NF5 A;  2FNC A;  3K02 A;  4KYE A;  4PQJ A;  3ECR A;  3FVG A;  4WKM A;  4F19 A;  1QUJ A;  1NH7 A;  2XXH A;  5K2Y A;  1B1X A;  4LP2 B;  1MY1 A;  4U21 A;  1A7L A;  2A5S A;  1BKA A;  3F11 A;  5HPQ A;  1MXZ A;  1LB8 A;  3H7M A;  2D3I A;  2AL5 A;  1ATG A;  3CI8 A;  3ILU B;  4YB5 A;  3VVE A;  5HM4 B;  4OER A;  3S9L C;  3IB1 A;  3FJG A;  3OO7 A;  3RQT A;  5JK4 A;  4R2B A;  4XKN A;  3FXQ A;  3MP1 A;  5FTI A;  4G4P A;  3VE1 B;  1FQA A;  1JEV A;  2KLF A;  1S7Y A;  5AA4 A;  4P0G A;  3HV1 A;  3O2A A;  3OOA A;  4OFJ A;  5LOM A;  3S9N C;  3MC2 A;  4AB5 A;  1USY H;  1B3H A;  2VHA A;  3O29 A;  1Y3P A;  4RPO A;  4G8N A;  3UP9 A;  4XKR A;  3BBR A;  2UXA A;  3HN0 A;  1D4N A;  1OVB A;  1OVT A;  1II5 A;  3MBP A;  4ZS9 A;  3FJ7 A;  4OXV A;  5I59 B;  1ANF A;  1MQD A;  1SI1 A;  1TXF A;  1Y20 A;  2RC7 A;  3IJX B;  4GL0 A;  4IO2 A;  4ND9 A;  1Y4T A;  3DM0 A;  2O69 A;  2O84 X;  1J1N A;  2Q88 A;  3EHS A;  3KSJ A;  3MQ9 A;  3QYT A;  4H5G A;  4H5F A;  4LAT A;  2I58 A;  3GLB A;  3A09 A;  5DYH A;  4ZE8 A;  5EYF A;  4X1B A;  3RPW A;  5I56 A;  2QL3 A;  3SEV A;  3MVZ A;  2ONK E;  4FAJ A;  5TU0 A;  4ZDM A;  1B3L A;  2HZK A;  4QFP A;  3ZSF A;  3THI A;  4BDO A;  4HW8 A;  3MVW A;  1POT A;  4IGT A;  1B6H A;  1PB7 A;  3FAS A;  3TYH A;  2HAU A;  2REJ A;  3CSB A;  3M3F A;  3QIM A;  1MS7 A;  2O1L A;  1MXX A;  3R26 A;  4FOR A;  2BJJ X;  5CRY A;  4IY6 A;  3U72 A;  1PB9 A;  4U23 A;  1B7H A;  2P1S A;  4R6H A;  1HSL A;  3TCF A;  3C32 A;  3ZKL A;  3LBS A;  3C33 A;  1VE4 A;  1PC3 A;  5H8S A;  4BDN A;  4RK2 A;  1POY 1;  3VLV A;  4DXB A;  4NF6 B;  4POX A;  1FTM A;  1H3D A;  4L17 A;  3USD A;  3K6V A;  4OFO A;  5FHN A;  4F3P A;  2UVH A;  4GXS B;  3L6H A;  5I56 B;  1QVS A;  4K3F A;  4O3B A;  4OEN A;  3RTW B;  3W9V A;  1FQC A;  3EN3 A;  4NE4 A;  3S9M C;  4X9T A;  1NNP A;  2OWT A;  4DXU A;  3BFT A;  3FV1 A;  2UYF A;  2I4C A;  4R9F A;  3TMG A;  2CZL A;  3UGW A;  4H8I A;  2OK2 A;  2YJP A;  4FE8 A;  3FJM A;  3K6W A;  3UK4 A;  1MY4 A;  1N3X A;  3A3C A;  4WEP A;  5H8N B;  3U94 A;  2IA4 A;  2RC8 A;  2DSF A;  2F8D A;  4EUO A;  3MVY A;  3OMB A;  3RT8 A;  3MZB A;  3PUV E;  4ELP A;  4GQO A;  2XXP A;  1AL3 A;  3GBB A;  3N6U A;  1O63 A;  1B3G A;  1MQJ A;  3MP6 A;  4XIG Q;  3I6V A;  1SBP A;  2Z8F A;  4ISU A;  3SER A;  1Z7N E;  3OO8 A;  4F3S A;  4BDQ A;  5I59 A;  4RA1 A;  3K1N A;  1XOC A;  5CI5 A;  3K00 A;  1MDP 1;  3VFJ A;  3EQ1 A;  4LZ7 A;  4QFK A;  4OEU A;  5DEX B;  1O7T A;  4GF8 A;  4JSD A;  3SEY A;  2I3V A;  1FTJ A;  1IXI A;  3U1O A;  5AA1 A;  4PP0 A;  2HZL A;  2ZMB A;  1FTL A;  4IY5 A;  4QSE A;  2PX1 A;  5DVI A;  4I1D A;  2ESN A;  3KZG A;  3R6U A;  2Z8E A;  4XKP A;  2Q8J A;  4QRZ A;  5ICQ A;  1LBC A;  1OQG A;  3IOU A;  1PBP A;  1AIV A;  2RKM A;  5KDT A;  4UAC A;  1A55 A;  4IO6 A;  5M2V A;  2P2A A;  2DWJ A;  1Y1M A;  1B7Z A;  3W15 C;  3H06 B;  3O6G A;  2QPQ A;  4XXU A;  4JDF A;  1B40 A;  2RCB A;  1R1N A;  3K6U A;  3MPK A;  3QAX A;  1I6Q A;  3G3G A;  2H25 A;  1US5 A;  3MJN A;  4YB7 A;  1MDQ A;  3E3K A;  3D4C A;  4DZ1 A;  4R6Y A;  1ZU0 A;  4ZEB A;  4DIG A;  4OHN A;  4E0W A;  1H76 A;  5CM6 A;  5KZT A;  3HHF A;  1RYX A;  1QW0 A;  2NVU B;  1NH8 A;  2ONS A;  3H6U A;  3TQL A;  3WAE A;  2GH9 A;  2NOO A;  5CMB A;  4JWY A;  1MM6 A;  3CFZ A;  1Y9U A;  1SW1 A;  5CBS A;  3V8X B;  4KD5 A;  4PFT A;  3TUS A;  5H8H A;  1DTZ A;  4F29 A;  4YKK A;  4P0I A;  1KWH A;  1LAX A;  1XT8 A;  2QSX A;  2VGQ A;  4NF4 A;  2O68 A;  3N94 A;  4R73 A;  2HAV A;  4GWO A;  1A54 A;  4LQ5 A;  3T96 B;  2ANJ A;  5TP9 A;  3TPA A;  3S9E A;  4HCW A;  2RCA A;  1MY3 A;  5KDT B;  1ZMG A;  3TOD A;  1QJM A;  1A99 A;  2ALU A;  2DWI A;  4RXL A;  4ZZE A;  4F3G A;  1LST A;  4MLQ A;  2LAO A;  1JVY A;  1SW5 A;  3CG1 A;  3G3J A;  3I3V A;  4H65 A;  1GR2 A;  4QFN A;  3RGY A;  1GGG A;  3M3L A;  4LON B;  3T66 A;  5L9O A;  4ZEK A;  1P1Q A;  1A40 A;  3UA8 A;  1P99 A;  1MM7 A;  3OO9 A;  2V3Q A;  4G68 A;  3IOW A;  1BP5 A;  4I62 A;  3CR9 A;  3FIR A;  4FEC A;  4G8M A;  2I4B A;  4F31 B;  1N04 A;  2B3B A;  4QF9 A;  1SW4 A;  3VXC A;  4H8J A;  1URD A;  1URS A;  1I69 A;  1LFG A;  4G68 B;  4ZEI A;  3FVK A;  4THI A;  3TTN A;  3PMV A;  1UTH B;  1DPE A;  2XXI A;  4OYV A;  1JW4 A;  3KEI A;  3H03 A;  4R75 A;  4F39 A;  1FQF A;  3IX1 A;  1ZJL A;  2OCU A;  2PVU A;  4ESX A;  1M5B A;  3CFL A;  2DQV A;  3ODB A;  3E13 X;  3MAM A;  3V83 A;  4OET A;  4QFO A;  2RF1 A;  3PUW E;  3B7D A;  2H98 A;  2ZNU A;  1N84 A;  1OQH A;  4H0W A;  3FVN A;  3PV0 E;  2Z8D A;  3OXN A;  3Q26 A;  4TQU Q;  1ZLQ A;  5J1D A;  4FED A;  1JEU A;  3SET A;  4H6D A;  2HQ0 A;  3MVX A;  1JET A;  5I2K A;  4R2F A;  5EHS A;  3RN8 A;  4QSD A;  2AIX A;  3JZJ A;  1BLF A;  3TTR A;  1MPC A;  5AA2 A;  1CE2 A;  2XXY A;  2XX8 A;  2DXY A;  1LAF E;  2F7C A;  2VD2 A;  2X26 A;  1B9J A;  2Q9T A;  1HSJ A;  4RYA A;  4WXJ A;  5AA2 B;  3B6T A;  3LR1 A;  4F1V A;  1MY2 A;  3S4U A;  3VLW A;  3T9V A;  4EF2 A;  4F2Q A;  1DTG A;  1DSN A;  1M5C A;  2F35 A;  2I0B A;  3RNN A;  2V3T A;  3FD3 A;  3KN7 A;  1BTJ A;  3B6Q A;  4OVJ A;  3SES A;  1P1N A;  1M5E A;  1SW2 A;  4NED A;  3GBA A;  1VSO A;  3K1M A;  4I9D A;  3U92 A;  5A5X A;  2PT1 A;  1RYO A;  3TEL A;  3ONM A;  4IO3 A;  1USY E;  3FXR A;  4KCC A;  1XVX A;  2Y7K A;  4KCD A;  2UVI A;  1B46 A;  2DWH A;  1Y3N A;  4RY1 A;  4DXC A;  1H45 A;  2O1M A;  3EF7 A;  3PPP A;  2PYY A;  4GD5 A;  1B2H A;  4ZEF A;  3SEU A;  2Q2A A;  2UYE A;  4U2R A;  1AOV A;  3KOS A;  4QSC A;  1ELJ A;  3LUY A;  4OES A;  4Q5T A;  1NMU A;  1IIW A;  2I3W A;  5AE4 A;  1VFE A;  2DS9 A;  3TZA A;  3PUZ E;  1B5I A;  4TLM B;  3KOT A;  2XX7 A;  1SQY A;  1B5J A;  1US4 A;  3IJO B;  3QK6 A;  1B4Z A;  4DE8 A;  2F97 A;  2Q89 A;  5TPA A;  5CMK A;  5I57 B;  1MPB A;  4KYS A;  2F7B A;  4QHQ A;  4H1X A;  1B0H A;  4KQP A;  4GOT A;  2HFB A;  1WOD A;  2ZYO A;  3K01 A;  3T22 A;  3EHU A;  1LBB A;  4U4X A;  3QSL A;  3Q29 A;  5BUU A;  4GRK A;  1B05 A;  3O97 A;  2QS3 A;  4KHZ E;  4NMY A;  2DXR A;  4UA8 A;  5L9S A;  4GVO A;  3G3I A;  1DPP A;  1B1H A;  1SYH A;  2A5T A;  2DVC A;  3HCQ A;  3P7I A;  3PPN A;  5CMC A;  1YAE A;  2OLB A;  2XXX A;  3TCG A;  1N76 A;  1M5F A;  1Y4C A;  1BIY A;  2DE4 A;  1FQB A;  3CVG A;  5DVF A;  3U93 A;  1NNT A;  3LSL A;  4NF8 B;  1NNK A;  4ECF A;  2O51 A;  3MP8 A;  4OTE A;  5I2K B;  2A5T B;  4OMB A;  4BDR A;  5I84 A;  2XXU A;  4KR5 A;  2RC9 A;  3K1P A;  3MWB A;  4O3A A;  1H44 A;  3LSX A;  3KG2 A;  3SEW A;  2DWA A;  3I5O A;  2QS2 A;  3ZKK A;  5DT6 A;  4JSO A;  1EU8 A;  4OEV A;  4YZZ A;  3M8U A;  3HPI A;  3TTL A;  2YLN A;  1MQH A;  4PFW A;  4GFR A;  3BKI B;  5H8N A;  5I57 A;  1S9T A;  1Y3Q A;  3FGS A;  1P1U A;  1RKM A;  1UIU A;  3KSX A;  2PMS A;  4XKQ A;  1N7W A;  4N6P A;  4FIM A;  3CRB A;  4ELR A;  4IO7 A;  1SYI A;  2V25 A;  4PET A;  4F2O A;  5JTY A;  1IUD A;  2GHB A;  3K4U A;  5L9M A;  4U22 A;  5TPA B;  2ZNS A;  4NWD A;  1MQI A;  3K6X A;  3MW0 A;  3FVO A;  3B6W A;  2ZXT A;  1N3W A;  1XHY A;  4NF8 A;  2Q2C A;  1IZ1 A;  3CFX A;  3O9P A;  5CMM A;  4E0X A;  1XS5 A;  3IOT A;  1SI0 A;  3PPO A;  4LA9 A;  1FTO A;  5I58 B;  4R74 A;  1R9L A;  3IO6 A;  4Q30 B;  4G77 A;  4GXA A;  2H99 A;  3TAJ A;  1A8F A;  1MH4 A;  1QKB A;  3FXU A;  3JV9 A;  4NTL A;  1P1W A;  3EHT A;  4FJP A;  3VXB A;  3PMW A;  4MFI A;  5I58 A;  1SD3 A;  3N5L A;  3D4G A;  2Y7R A;  3LC8 A;  4ZZA A;  4ELQ A;  4X1D A;  3VVD A;  3FZV A;  2ZYM A;  3O6I A;  1DMB A;  1TT1 A;  3MPL A;  1AMF A;  2AL4 A;  2O7I A;  5FHO A;  2GFE A;  4G8H A;  5ITO A;  3CSG A;  2GRV A;  4R6K A;  3VV5 A;  3KGC A;  3H6T A;  4RK9 A;  5TP9 B;  3OEL A;  1A8E A;  3SKP A;  2ZYK A;  3LSW A;  5CBR A;  2V3U A;  1Q35 A;  4EQB A;  1MQG A;  2V93 A;  1MRP A;  1OLC A;  2X7Q A;  3HO7 A;  3UOR A;  3S2V A;  3QXM A;  2B65 A;  2NUV A;  1UIV A;  3U8Q A;  4EQ7 A;  2RIN A;  3OEN A;  1FW0 A;  3RLF E;  3OEK A;  2PBW A;  2Y7I A;  5IKB A;  2AYS A;  5I2N A;  4F18 A;  2I48 A;  1B52 A;  2I49 A;  1IQ7 A;  3WAF A;  2OWS A;  4U4S A;  1EZP A;  3RT6 B;  1CB6 A;  1QUL A;  1EZO A;  4ZED A;  3CG3 A;  4YAH X;  1B32 A;  5FHM A;  1WVJ A;  4KFQ A;  5ICT A;  2B3F A;  5K2X A;  1N0T A;  4RJZ A;  2XXT A;  2Y7P A;  4G68 C;  3FV2 A;  4EXL A;  1FQE A;  2YPN A;  2DE3 A;  4N13 A;  4RPN A;  4YB6 A;  2FYI A;  3R7X A;  3SDF A;  3N26 A;  1GVC A;  3C34 A;  3W9W A;  3Q27 A;  2QS1 A;  3HST A;  2VD3 A;  3O6H A;  4YKP A;  2IEE A;  4P11 A;  3E9X A;  1P1O A;  4C1U A;  1B0L A;  2HCA A;  1XC1 A;  2D5W A;  1OIB A;  2DYX A;  2XD3 A;  2W7Y A;  3PUX E;  2F6P A;  4OFL A;  3GXA A;  5B7D A;  1DOT A;  4C0R A;  2XX9 A;  1N7X A;  3IOV A;  2F6G A;  3TDJ A;  1PB8 A;  1ZIU A;  1D9Y A;  1EH3 A;  2PT2 A;  4HCY A;  1ZKB A;  4AQ4 A;  4LZ8 A;  1AH5 A;  1S50 A;  2XXQ A;  3DLN A;  4X48 A;  1MG1 A;  3OD7 A;  2I6E A;  3QUF A;  1LCT A;  3K2D A;  2REG A;  1LAH E;  5H8Q A;  3BFU A;  3KFM A;  3DP8 A;  4LUB A;  5AA3 A;  2OZZ A;  1IEJ A;  1NL5 A;  3K0V A;  5JTY B;  1MPD A;  2QMW A;  1GTK A;  4MLV A;  1OMP A;  4PE5 B;  1VR5 A;  3PPR A;  3V89 B;  3TCH A;  1QUK A;  3LSF B;  2DP8 A;  5F7V A;  1NNF A;  2XD2 A;  3KBR A;  1URG A;  1B4H A;  3ILT B;  1LB9 A;  2HEU A;  4MBP A;  5FTH A;  4Q8R A;  1IXC A;  2H9B A;  5IAI A;  4KYD A;  3OEM A;  2P0S A;  3VVF A;  3PMX A;  1B58 A;  1FQD A;  2DVZ A;  4EF1 A;  2Z22 A;  3G3F A;  3M3K A;  3TTK A;  4ZEC A;  4G2Z A;  1R9Q A;  2QJE A;  3VDF A;  4AB6 A;  1F9B A;  4GL8 A;  4H67 A;  4TOZ A;  4YMA A;  2XXV A;  3G3K A;  4YKI A;  2VP1 A;  3OSR A;  5DEX A;  2F36 A;  1ZBM A;  3C36 A;  3IAZ A;  3PGF A;  4IO5 A;  4EXK A;  1YCJ A;  4FAT A;  4OZ9 A;  3HHG A;  2HXW A;  5ITP A;  1JW5 A;  1LCF A;  4JBZ A;  5H8Q B;  4Z7E A;  4N07 A;  1LFH A;  3KJ7 A;  1FTK A;  3IR1 A;  1JVX A;  3OSQ A;  3CIJ A;  3RTF B;  4FEB A;  5F1Q A;  3H4Z A;  4R72 A;  3UN6 A;  3TFL A;  2CMO A;  2WKY A; 
#chains in the Genus database with same CATH topology
 4I40 A;  5DW8 A;  4R9G A;  1FSA A;  1QKA A;  2Y7W A;  5I2N B;  4X8R A;  2E1S A;  1YTV A;  1UTB B;  3AXF A;  2O7U A;  5IZ1 A;  1Q1K A;  1RDY A;  1EZ9 A;  1MXU A;  2VOZ A;  1SVX B;  5AA4 B;  1NI9 A;  2DE2 A;  2OJT A;  4F1U A;  1R6Z A;  1MY0 A;  5FBP A;  3DP6 A;  4YKJ A;  1LFI A;  3Q25 A;  3TEP A;  1FPK A;  3KC1 A;  1JW1 A;  1HSE A;  1OLA A;  3G7W A;  1FPD A;  4F3B A;  3IO4 A;  1JP4 A;  1VFD A;  3H6W A;  2BJI A;  3VLU A;  3PD8 A;  4LZ5 A;  3QUJ A;  3LV0 A;  1PBQ A;  1JNF A;  2I0C A;  4GLI A;  1D3K A;  5BWJ A;  3PU5 A;  3H3G A;  3JYR A;  3MZ9 A;  2P3N A;  2CZI A;  1IXG A;  2B4M A;  1I6A A;  2R6G E;  2QS4 A;  3C31 A;  4BDL A;  3PPQ A;  3K02 A;  4PQJ A;  4F19 A;  1QUJ A;  1NH7 A;  2CZH A;  2P3V A;  1B1X A;  1MY1 A;  3F11 A;  4O7M A;  1LB8 A;  1KZ8 A;  1ATG A;  3VVE A;  3FJG A;  5EQA A;  4PF6 A;  5JK4 A;  3HFU A;  3FXQ A;  5FTI A;  3VE1 B;  4G4P A;  5AA4 A;  4P0G A;  3BIH A;  3S9N C;  2VHA A;  1Y3P A;  4MAG A;  1DBZ A;  2MKZ A;  3BBR A;  4MNP A;  3FJ7 A;  1ANF A;  2RC7 A;  3QYT A;  4LVQ A;  4H5G A;  4H5F A;  4ZE8 A;  5EYF A;  1FBH A;  2QL3 A;  4QFP A;  3MVW A;  4IGT A;  2HAU A;  2REJ A;  3RYD A;  2O1L A;  4FOR A;  4IY6 A;  1B7H A;  4OVQ A;  3ZKL A;  1VDW A;  4RK2 A;  4DXB A;  1FTM A;  3K6V A;  1QVS A;  3W9V A;  1FQC A;  3S9M C;  1IMB A;  4H8I A;  1MY4 A;  3A3C A;  2RC8 A;  2DSF A;  1AL3 A;  1MQJ A;  3MP6 A;  3I6V A;  4ISU A;  4F3S A;  3GYY A;  1CNQ A;  5CI5 A;  1MDP 1;  4LZ7 A;  4O7I A;  1NV3 A;  2KR0 A;  1O7T A;  4P9K A;  4GF8 A;  4JSD A;  4QSE A;  2ZMB A;  4PAI A;  5DVI A;  2WYP A;  2Z8E A;  3E79 A;  5ICQ A;  5KDT A;  4UAC A;  1A55 A;  1Y1M A;  3W15 C;  3QAX A;  1R1N A;  1I6Q A;  3HHF A;  3TQL A;  4HE1 A;  1Y9U A;  5CBS A;  3TUS A;  1A54 A;  5TP9 A;  1NV2 A;  2ALU A;  1SW5 A;  1G0H A;  4LON B;  4ZEK A;  1P1Q A;  1A40 A;  1P99 A;  4G68 A;  5JEI A;  4F31 B;  1N04 A;  4QF9 A;  4H8J A;  1I69 A;  2XXI A;  2KQZ A;  1M5B A;  3ODB A;  2RF1 A;  3PUW E;  3FVN A;  3Q26 A;  1ZLQ A;  4FED A;  5EHS A;  3RN8 A;  4PE3 A;  2AIX A;  1CE2 A;  1LAF E;  2F7C A;  4RYA A;  1FPG A;  4F1V A;  3S4U A;  1XI6 A;  1DSN A;  2V3T A;  4OVJ A;  3SES A;  1BTJ A;  1P1N A;  4PAF A;  1VSO A;  3K1M A;  3U92 A;  4JVC A;  3FXR A;  4KCD A;  2Y7K A;  4DXC A;  3A29 A;  1H45 A;  2O1M A;  1B2H A;  2WEF A;  4QSC A;  4OES A;  4Q5T A;  2DS9 A;  3PUZ E;  4GWY A;  1B4Z A;  2XXK A;  4DE8 A;  2Q89 A;  5CMK A;  4GOT A;  2HFB A;  4U4X A;  3Q29 A;  4UA8 A;  2DXR A;  4GVO A;  3G3I A;  1DPP A;  4DDD A;  2OLB A;  1M5F A;  5DVF A;  4NF8 B;  1NNK A;  3MP8 A;  4BDR A;  3RPL B;  3K1P A;  3MWB A;  4NAP A;  1H44 A;  5DT6 A;  3B50 A;  4OEV A;  3BKI B;  2L5V A;  1N7W A;  4N6P A;  4ELR A;  4IO7 A;  1SYI A;  2V25 A;  4PET A;  1IUD A;  4NN3 A;  4U22 A;  2Q2C A;  3O9P A;  5CMM A;  1XS5 A;  4LA9 A;  4PGN A;  1FTO A;  2QFL A;  1R9L A;  1NUY A;  4GXA A;  3TAJ A;  1MH4 A;  2HXR A;  3JV9 A;  3EHT A;  3PMW A;  3D4G A;  2Y7R A;  4ELQ A;  3VVD A;  3FZV A;  2ZYM A;  1DMB A;  1TT1 A;  3MPL A;  1AMF A;  2O7I A;  4G8H A;  3CSG A;  4R6K A;  2FIX A;  1A8E A;  2V3U A;  1Q35 A;  4EQB A;  5EQ7 A;  3UOR A;  3S2V A;  2RIN A;  4I3Y A;  2AYS A;  2VPN A;  1CB6 A;  4ZED A;  4YAH X;  1WVJ A;  4KFQ A;  5K2X A;  5ET6 A;  2XXT A;  2DE3 A;  4YB6 A;  2FYI A;  3Q27 A;  3O6H A;  4YKP A;  2IEE A;  4C1U A;  1B0L A;  2HCA A;  4OFL A;  1OIB A;  2F6P A;  1N7X A;  3TDJ A;  1ZIU A;  1EH3 A;  4HCY A;  1MG1 A;  1LCT A;  3BFU A;  5AA3 A;  1NL5 A;  2GQ1 A;  1MPD A;  2QMW A;  4PE5 B;  1VR5 A;  2PCR A;  3LSF B;  1URG A;  1B4H A;  5IAI A;  1IXC A;  3B8B A;  3VVF A;  4P8B A;  2Z22 A;  4ZEC A;  2QJE A;  3FBP A;  1F9B A;  5DEX A;  2F36 A;  3IAZ A;  4IO5 A;  1LCF A;  2WX9 A;  1FPB A;  1FTK A;  1Y4T A;  3H6V A;  4MEV A;  4IO4 A;  2NWJ A;  4MH5 A;  1FPJ A;  1MH3 A;  5H8F A;  2G29 A;  4KI0 E;  4JWX A;  1IMD A;  3TQW A;  4N4U A;  5ET7 A;  1ZTY A;  1IXH A;  3IB0 A;  2QRY A;  5L8D A;  4N15 A;  5KCJ A;  2QVV A;  1Y1Z A;  4FBP A;  4DLD A;  4ELO A;  1MXY A;  4N6K A;  2E0S A;  3TKD A;  1WDN A;  4Q0C A;  4PBH A;  5DVJ A;  3DP4 A;  2R9J A;  4EQ9 A;  1TFA A;  3GZG A;  4HS7 A;  2GHA A;  5CC2 A;  4U1O A;  1B3E A;  1FBC A;  2XXW A;  4KPT A;  2XXR A;  3E4R A;  4M1V A;  3RUM A;  5AA2 D;  5IM2 A;  4MF3 A;  2M8C A;  4PFY A;  2FIE A;  1QUI A;  3A3U A;  1SDX A;  4XFE A;  4M4G A;  1PEB A;  1I6B A;  2QMX A;  3QMF A;  5H8F B;  3MUQ A;  1H43 A;  4GIZ A;  1GV8 A;  1L5T A;  4AS4 A;  1NUX A;  4C1T A;  1D9Q A;  1NKX A;  3IB2 A;  4BDM A;  4PFU A;  3T9X B;  2H4I A;  3C9H A;  3RPL A;  4NF0 A;  2FNC A;  1IMF A;  1QGX A;  5K2Y A;  2A5S A;  1MXZ A;  3H7M A;  2D3I A;  3OO7 A;  3RQT A;  4XKN A;  2B4L A;  1JEV A;  1S7Y A;  3HV1 A;  4RPO A;  3O29 A;  4G8N A;  4XKR A;  3ROJ A;  2UXA A;  1OVB A;  1OVT A;  4ZS9 A;  4OXV A;  4GL0 A;  1TXF A;  4ZZE A;  4IO2 A;  3IJX B;  2O69 A;  2O84 X;  1J1N A;  3KSJ A;  1NV1 A;  5TPA A;  3RPW A;  2I58 A;  3SEV A;  3MVZ A;  4HW8 A;  1POT A;  1B6H A;  3BIG A;  1FPL A;  1MS7 A;  5CRY A;  1PB9 A;  4U23 A;  2P1S A;  4R6H A;  3TCF A;  1FPE A;  1VE4 A;  5H8S A;  4GXS B;  3L6H A;  4OEN A;  3RTW B;  4X9T A;  2OWT A;  3BFT A;  3FV1 A;  3UGW A;  3TMG A;  2CZL A;  2OK2 A;  4FE8 A;  4PAK A;  2F8D A;  4NG7 A;  2Y5L A;  1NV6 A;  3MZB A;  4GQO A;  2XXP A;  1SBP A;  2Z8F A;  1Z7N E;  3OO8 A;  5I59 A;  4RA1 A;  3K1N A;  2VT5 A;  3EQ1 A;  1IXI A;  5AA1 A;  1YZ0 A;  4I1D A;  2ESN A;  1B7Z A;  3ISP A;  3H06 B;  4XXU A;  4JDF A;  4RNS A;  2RCB A;  4YB7 A;  3G3G A;  4E0W A;  5KZT A;  1QW0 A;  2NVU B;  1NH8 A;  4JWY A;  3CFZ A;  1SW1 A;  4G61 A;  1YXI A;  4P0I A;  4NF4 A;  2QSX A;  3N94 A;  4NGU A;  3T96 B;  3TPA A;  4PDD A;  1MY3 A;  1QJM A;  1A99 A;  2DWI A;  4RXL A;  4N6D A;  3I3V A;  5I7I A;  3T66 A;  1MM7 A;  2V3Q A;  2PFY A;  4GWZ A;  3CR9 A;  2I4B A;  1URS A;  1LFG A;  3TTN A;  1DK4 A;  3PMV A;  4QXD A;  2OWZ A;  3MAM A;  4OET A;  2ZNU A;  3PV0 E;  2Z8D A;  4TQU Q;  5J1D A;  3MVX A;  5I2K A;  4QSD A;  3JZJ A;  5AA2 A;  2WBB A;  3VLW A;  1FBF A;  3B6Q A;  4NED A;  1EYI A;  4GD5 A;  1LEV A;  2UYE A;  1AOV A;  5AE4 A;  1IIW A;  2I3W A;  1VFE A;  3TZA A;  4TLM B;  3KOT A;  1US4 A;  3IJO B;  3QK6 A;  4JVI A;  4H46 A;  1B0H A;  2ZZX A;  1WOD A;  5ESY A;  5BUU A;  2QS3 A;  1LFH A;  1SYH A;  3HCQ A;  1YAE A;  2XXX A;  3CVG A;  2DE4 A;  4ECF A;  3LSL A;  4OMB A;  2RC9 A;  4O3A A;  3I5O A;  4GBW A;  4PFW A;  5H8N A;  1UIU A;  2PMS A;  4XKQ A;  3KBZ A;  4F2O A;  2ZZW A;  3MW0 A;  3CFX A;  1IZ1 A;  3PPO A;  1LBX A;  4PF8 A;  1P1W A;  3VXB A;  5I58 A;  1SD3 A;  3KC0 A;  4OVR A;  3O6I A;  2XWO A;  1INP A;  5ITO A;  2GRV A;  3VV5 A;  3KGC A;  1RDZ A;  1MQG A;  1MRP A;  1OLC A;  4EQ7 A;  2PBW A;  5I2N A;  4F18 A;  1LBW A;  2I48 A;  2OWS A;  1EZO A;  4PBQ A;  4RJZ A;  4G68 C;  3FV2 A;  4EXL A;  4XF5 A;  1FQE A;  3SDF A;  5IZ3 A;  3N26 A;  1GVC A;  3C34 A;  2VD3 A;  2D5W A;  3IOV A;  1D9Y A;  3NOH A;  3K2D A;  5LDZ A;  2REG A;  5H8Q A;  4LUB A;  3K0V A;  4MLV A;  1OMP A;  3V89 B;  3TCH A;  2DP8 A;  1NNF A;  2XD2 A;  4F1Y A;  2HEU A;  4KYD A;  2P0S A;  1B58 A;  3G3F A;  3VDF A;  3E78 A;  4H67 A;  4TOZ A;  2XXV A;  3PGF A;  3C36 A;  3HHG A;  5ITP A;  1JW5 A;  4Z7E A;  4N07 A;  3RTF B;  3OSQ A;  3CIJ A;  4FEB A;  3TFL A;  5ELV A;  2WKY A;  4HTG A;  4PCD A;  1TWY A;  1LAG E;  3L6G A;  3EPE A;  1FJ9 A;  4DCY A;  1UTH A;  3IL1 B;  4TLL B;  3PUY E;  4WED A;  1D9V A;  1XVY A;  2THI A;  3FAT A;  4U1Z A;  1YPN A;  1MXW A;  3T9U A;  4Z0I A;  3O66 A;  2F34 A;  1LLS A;  3KJT A;  1UQW A;  2PFZ A;  4POW A;  4IGR A;  4JWO A;  2G93 A;  3EKI A;  4NWC A;  2DDK A;  4ONY A;  4MNC A;  3C35 A;  4BLA A;  1B5H A;  5H8H B;  2F5X A;  4IB2 A;  4OQO A;  1RDX A;  2ONR A;  3C4M A;  4DCX A;  4XTC Q;  3T0J A;  4YIC A;  3MZ1 A;  3ZS6 A;  2XHD A;  1UTB A;  3PD9 A;  3IOR A;  1FTA A;  5HBC A;  1PDA A;  2Q8M A;  2ZYN A;  4NF5 B;  3RY3 A;  5B70 A;  2OBG A;  4I8C A;  2O6A A;  2CEY A;  2H5Y A;  2UVJ A;  4JVD A;  2ZNT A;  4NF5 A;  4JXI A;  4KYE A;  3ECR A;  3FVG A;  4LP2 B;  1A7L A;  1BKA A;  5HPQ A;  3ILU B;  3S9L C;  4YB5 A;  1NV0 A;  4OER A;  3IB1 A;  4R2B A;  5LOM A;  3O2A A;  3MC2 A;  4AB5 A;  1USY H;  1B3H A;  3UP9 A;  4HE2 A;  3HN0 A;  5EQ8 A;  1D4N A;  1IME A;  1LBY A;  1FBD A;  1Y20 A;  2F3D A;  1FBG A;  3DM0 A;  2Q88 A;  3MQ9 A;  4LAT A;  3A09 A;  5DYH A;  5J16 A;  4ZDM A;  1FPI A;  3FAS A;  3QIM A;  3CSB A;  4O94 A;  1EYJ A;  3U72 A;  3C32 A;  4P47 A;  2V4C A;  1POY 1;  4GWW A;  4PTK A;  4DI3 D;  3USD A;  4LN5 A;  5I56 B;  4K3F A;  3EN3 A;  1KA0 A;  3FJM A;  3K6W A;  5H8N B;  1N3X A;  4WEP A;  2IA4 A;  1DCU A;  4EUO A;  4ELP A;  3GBB A;  3N6U A;  4NQ8 A;  1O63 A;  4XIG Q;  4PFR A;  4KXP A;  1XOC A;  4QBA A;  4OEU A;  2I3V A;  1FTJ A;  1Q9D A;  2HZL A;  4IY5 A;  4XKP A;  2Q8J A;  4QRZ A;  1LBC A;  3IOU A;  1PBP A;  5M2V A;  4IO6 A;  2P2A A;  2DWJ A;  2QPQ A;  1B40 A;  1US5 A;  3E3K A;  3D4C A;  1ZU0 A;  1H76 A;  4P56 A;  5CM6 A;  1RYX A;  2R8T A;  3H6U A;  2GH9 A;  2NOO A;  5CMB A;  4KD5 A;  4PFT A;  2XWK A;  1YYZ A;  1DTZ A;  4F29 A;  4YKK A;  1LAX A;  2O68 A;  4GWO A;  4HCW A;  5F24 A;  1ZMG A;  4F3G A;  1LST A;  1NV4 A;  1JVY A;  3G3J A;  3CG1 A;  4H65 A;  3RGY A;  1GGG A;  3M3L A;  3UA8 A;  3FIR A;  4FEC A;  4G8M A;  3VXC A;  1SW4 A;  5T3J A;  4G68 B;  3FVK A;  4N81 A;  3KEI A;  4F39 A;  1FQF A;  3CFL A;  2DQV A;  3E13 X;  3V83 A;  2H98 A;  1OQH A;  4H0W A;  1K9Z A;  3OXN A;  2F3B A;  4H6D A;  1JET A;  4GX3 A;  4P3L A;  4R2F A;  1FRP A;  2XX8 A;  1B9J A;  2Q9T A;  4WXJ A;  3B6T A;  3T9V A;  4F2Q A;  1DTG A;  1M5C A;  2I0B A;  3KN7 A;  3FD3 A;  4PC9 A;  1RYO A;  3ONM A;  1USY E;  4KCC A;  1XVX A;  1B46 A;  3PPP A;  4ZEF A;  4U2R A;  3LUY A;  4N8G A;  1B5I A;  2XX7 A;  1SQY A;  3IFA A;  5EQ9 A;  4KYS A;  4QHQ A;  4KQP A;  2ZYO A;  3EHU A;  1B05 A;  3O97 A;  4KHZ E;  4HE0 A;  4NMY A;  5L9S A;  1B1H A;  2DVC A;  3P7I A;  3PPN A;  5CMC A;  1Y4C A;  4P1L A;  5I84 A;  2XXU A;  4KR5 A;  3ZKK A;  2QS2 A;  1BK4 A;  4JSO A;  4I3E A;  3M8U A;  1MQH A;  5I57 A;  4GWS A;  1P1U A;  1RKM A;  4OA4 A;  3CRB A;  4H45 A;  3K4U A;  2ZNS A;  3B6W A;  4MIJ A;  1N3W A;  5I5P A;  2XA5 A;  4E0X A;  3IOT A;  4R74 A;  2H99 A;  1A8F A;  1QKB A;  4MFI A;  3LC8 A;  4ZZA A;  2AL4 A;  1NV5 A;  2XWI A;  2GFE A;  3H6T A;  4RK9 A;  5TP9 B;  3OEL A;  3U65 A;  5EYG A;  3LSW A;  5CBR A;  4PFB A;  2V93 A;  4OAN A;  2X7Q A;  3HO7 A;  4MJO A;  2B65 A;  2NUV A;  4OVT A;  4GX6 A;  2Y7I A;  5I3S A;  1B52 A;  1IQ7 A;  4U4S A;  1EZP A;  1QUL A;  4PGP A;  3CG3 A;  5FHM A;  1B32 A;  5ICT A;  3R7X A;  2QS1 A;  1XC1 A;  2XD3 A;  2DYX A;  2HHM A;  3PUX E;  5B7D A;  2XX9 A;  2WBD A;  2PT2 A;  1ZKB A;  4AQ4 A;  4LZ8 A;  1AH5 A;  1S50 A;  2XXQ A;  4X48 A;  1NUZ A;  1IMC A;  3OD7 A;  1NUW A;  3KFM A;  3PPR A;  4GBV A;  4MBP A;  1LB9 A;  5FTH A;  3PMX A;  1FQD A;  3M3K A;  3TTK A;  3LUZ A;  4G2Z A;  4AB6 A;  4GL8 A;  5A5L A;  1FBE A;  4YKI A;  4FAT A;  4OZ9 A;  4UAB A;  5H8Q B;  2OX3 A;  3SZP A;  5F1Q A;  3H4Z A;  4R72 A;  5ET5 A;  3MYU A;  5DTB A;  3G3H A;  4N17 A;  4NF6 A;  2DOJ A;  2FA7 A;  1IMA A;  1FCK A;  1JQF A;  4NF4 B;  3IFC A;  1TFD A;  5KCJ B;  4OWD A;  5EYH A;  3O28 A;  2F7A A;  3SEX A;  4F22 A;  4AS5 A;  1NFT A;  5EHM A;  4NHB A;  4JB7 A;  3Q28 A;  1LGB C;  4QFL A;  3KN3 A;  5ISU A;  4ESW A;  1AWB A;  2Y84 A;  4LQ2 A;  2UVG A;  2NXO A;  2R71 A;  2JJK A;  2F78 A;  2QVR A;  2D21 A;  3T93 B;  1B51 A;  3IK6 B;  2X7P A;  3T9H B;  3TTM A;  2ABH A;  3N6T A;  5A5X B;  1MXV A;  2FVZ A;  3T1B A;  3UIF A;  1B3F A;  3OO6 A;  4EDP A;  4PFI A;  4O3C A;  2Z23 A;  1B7U A;  1T0K A;  1O64 A;  1IIT A;  1Z7M E;  1M5D A;  3DEL B;  4YMB A;  4YU0 A;  3V5A A;  2V84 A;  3KN8 A;  4ZE9 A;  1G0I A;  3FUZ A;  4WKM A;  2XXH A;  4U21 A;  4GWX A;  2AL5 A;  3CI8 A;  4PDH A;  5HM4 B;  3MP1 A;  1FQA A;  2KLF A;  1KA1 A;  3OOA A;  4OFJ A;  3MBP A;  1II5 A;  5I59 B;  1MQD A;  4ND9 A;  1SI1 A;  3EHS A;  5IGA A;  3GLB A;  5I56 A;  4X1B A;  4FAJ A;  2ONK E;  5TU0 A;  3ZSF A;  1B3L A;  2HZK A;  4BDO A;  3THI A;  2XWV A;  1PB7 A;  1K9Y A;  3TYH A;  3M3F A;  3R26 A;  1MXX A;  2BJJ X;  1HSL A;  3LBS A;  3C33 A;  4BDN A;  1PC3 A;  4MHF A;  3VLV A;  4NF6 B;  4POX A;  1H3D A;  4L17 A;  4OFO A;  5FHN A;  4F3P A;  2UVH A;  4O3B A;  4NE4 A;  1NNP A;  4DXU A;  2QVU A;  2UYF A;  2I4C A;  4R9F A;  4MMP A;  2YJP A;  3UK4 A;  3U94 A;  5ET8 A;  3MVY A;  3OMB A;  3RT8 A;  3PUV E;  1B3G A;  3SER A;  4GWU A;  4BDQ A;  3PTY A;  3K00 A;  3VFJ A;  4QFK A;  5DEX B;  4MNI A;  3SEY A;  3U1O A;  4PP0 A;  1FTL A;  2PX1 A;  3KZG A;  3R6U A;  5IZZ A;  1AIV A;  1OQG A;  2RKM A;  4GX4 A;  3O6G A;  4O8M A;  3K6U A;  3MPK A;  2H25 A;  3MJN A;  1MDQ A;  4DZ1 A;  4R6Y A;  4ZEB A;  4DIG A;  4OHN A;  4X04 A;  2ONS A;  3WAE A;  1MM6 A;  4NX1 A;  4P1E A;  3V8X B;  4MCO A;  5H8H A;  2FHY A;  1KWH A;  2VGQ A;  1XT8 A;  4R73 A;  2HAV A;  4LQ5 A;  2ANJ A;  3S9E A;  2RCA A;  5KDT B;  2Q74 A;  3TOD A;  4MLQ A;  2LAO A;  4QFN A;  1GR2 A;  5L9O A;  3OO9 A;  3IOW A;  4I62 A;  1BP5 A;  2B3B A;  1FBP A;  1URD A;  4ZEI A;  4THI A;  1UTH B;  1DPE A;  4OYV A;  1JW4 A;  3H03 A;  4R75 A;  3CHG A;  3IX1 A;  1ZJL A;  2OCU A;  2PVU A;  4ESX A;  4QFO A;  3B7D A;  1N84 A;  1JEU A;  3SET A;  2HQ0 A;  4XEQ A;  3TTR A;  1BLF A;  2HPG A;  1MPC A;  2XXY A;  2DXY A;  4DI4 B;  2VD2 A;  2X26 A;  1HSJ A;  5AA2 B;  3LR1 A;  1MY2 A;  4EF2 A;  1FJ6 A;  2F35 A;  3RNN A;  1M5E A;  1SW2 A;  3GBA A;  4I9D A;  5A5X A;  2PT1 A;  3TEL A;  4IO3 A;  4RY1 A;  2UVI A;  2DWH A;  1Y3N A;  1EYK A;  3EF7 A;  2PYY A;  3SEU A;  2Q2A A;  3KOS A;  1ELJ A;  1NMU A;  3D1R A;  4HXV A;  1B5J A;  2F97 A;  5I57 B;  1MPB A;  2F7B A;  2WYK A;  2FBP A;  4H1X A;  4IR8 A;  3K01 A;  3T22 A;  1LBB A;  2ZZV A;  3QSL A;  4GRK A;  2A5T A;  3U8Q A;  3TCG A;  1N76 A;  4N91 A;  1BIY A;  1FQB A;  3U93 A;  1NNT A;  2O51 A;  4OTE A;  5I2K B;  2A5T B;  2CEX A;  3LSX A;  1LBV A;  3KG2 A;  3SEW A;  2DWA A;  1EU8 A;  4YZZ A;  3HPI A;  3TTL A;  2YLN A;  4GFR A;  1S9T A;  1Y3Q A;  3FGS A;  3KSX A;  2CZK A;  4FIM A;  5IZ3 B;  5LTC A;  5JTY A;  2GHB A;  5L9M A;  5TPA B;  4NWD A;  1MQI A;  3K6X A;  3FVO A;  2ZXT A;  1XHY A;  1NV7 A;  4NF8 A;  1SI0 A;  5I58 B;  3IO6 A;  4Q30 B;  4G77 A;  3FXU A;  4NTL A;  4FJP A;  3N5L A;  4X1D A;  3FXB A;  3MST A;  5FHO A;  2VPO A;  3SKP A;  2ZYK A;  4MX6 A;  3QXM A;  1UIV A;  3OEN A;  1FW0 A;  3RLF E;  3OEK A;  5IKB A;  2I49 A;  3WAF A;  3RT6 B;  2B3F A;  1N0T A;  2Y7P A;  2YPN A;  4N13 A;  4RPN A;  1SPI A;  3W9W A;  3HST A;  4P11 A;  3E9X A;  1P1O A;  1LBZ A;  2W7Y A;  3GXA A;  1DOT A;  4C0R A;  2F6G A;  1PB8 A;  3DLN A;  2I6E A;  2Y5K A;  3QUF A;  4N8Y A;  1LAH E;  3DP8 A;  2OZZ A;  1IEJ A;  5JTY B;  1GTK A;  1QUK A;  5F7V A;  3KBR A;  3ILT B;  4Q8R A;  2H9B A;  3OEM A;  4OVP A;  2DVZ A;  1R9Q A;  4YMA A;  1FPF A;  3G3K A;  2VP1 A;  3OSR A;  4OVS A;  1ZBM A;  4EXK A;  1YCJ A;  2HXW A;  4JBZ A;  3KJ7 A;  4EF1 A;  3IR1 A;  1JVX A;  3UN6 A;  2CMO A; 
#chains in the Genus database with same CATH homology
 4HTG A;  5DTB A;  3H6V A;  1TWY A;  3G3H A;  1LAG E;  3L6G A;  4NF6 A;  4R9G A;  4RNS A;  2DOJ A;  3EPE A;  4IO4 A;  2NWJ A;  1QKA A;  2FA7 A;  2Y7W A;  4MH5 A;  4DCY A;  5I2N B;  1UTH A;  1MH3 A;  1FCK A;  3IL1 B;  1JQF A;  1YTV A;  1UTB B;  2E1S A;  5H8F A;  3AXF A;  4TLL B;  2O7U A;  3PUY E;  4WED A;  1D9V A;  2G29 A;  4KI0 E;  4JWX A;  3TQW A;  1Q1K A;  1EZ9 A;  1MXU A;  1XVY A;  4NF4 B;  2THI A;  3FAT A;  2VOZ A;  4U1Z A;  1TFD A;  1YPN A;  1ZTY A;  1MXW A;  3T9U A;  5KCJ B;  1IXH A;  1SVX B;  3IB0 A;  4OWD A;  2QRY A;  3O28 A;  4Z0I A;  2F7A A;  3O66 A;  2F34 A;  3SEX A;  4F22 A;  5L8D A;  1LLS A;  3KJT A;  5AA4 B;  1UQW A;  1NFT A;  2DE2 A;  5EHM A;  5KCJ A;  4POW A;  4IGR A;  1Y1Z A;  2OJT A;  4F1U A;  4JWO A;  1R6Z A;  4DLD A;  1MY0 A;  2G93 A;  4JB7 A;  4ELO A;  3Q28 A;  3DP6 A;  4YKJ A;  1MXY A;  2E0S A;  4NWC A;  1LGB C;  1LFI A;  3KN3 A;  3Q25 A;  4ONY A;  4QFL A;  3TKD A;  4ESW A;  5ISU A;  1WDN A;  2Y84 A;  4LQ2 A;  2UVG A;  4Q0C A;  2NXO A;  3TEP A;  3C35 A;  1JW1 A;  2R71 A;  4BLA A;  5DVJ A;  3DP4 A;  1B5H A;  4DDD A;  1HSE A;  1OLA A;  2F5X A;  2R9J A;  4IB2 A;  5H8H B;  4EQ9 A;  2F78 A;  3G7W A;  1TFA A;  3GZG A;  2D21 A;  4OQO A;  4HS7 A;  4F3B A;  3IO4 A;  2GHA A;  5CC2 A;  4U1O A;  1B3E A;  1VFD A;  2ONR A;  2XXW A;  3T93 B;  4LVQ A;  3H6W A;  4KPT A;  2XXR A;  1B51 A;  3C4M A;  3IK6 B;  2X7P A;  3E4R A;  4M1V A;  3RUM A;  4DCX A;  5AA2 D;  5JEI A;  3T9H B;  3TTM A;  2ABH A;  3VLU A;  4MF3 A;  3N6T A;  3PD8 A;  2M8C A;  4LZ5 A;  4PFY A;  3QUJ A;  1QUI A;  4XTC Q;  5A5X B;  3A3U A;  1MXV A;  1PBQ A;  1JNF A;  1SDX A;  2I0C A;  4YIC A;  4M4G A;  4GLI A;  4F1Y A;  1PEB A;  1I6B A;  2QMX A;  3MZ1 A;  2XHD A;  3UIF A;  3ZS6 A;  1B3F A;  1UTB A;  3MUQ A;  5H8F B;  1H43 A;  3OO6 A;  4EDP A;  1D3K A;  4GIZ A;  4O3C A;  1GV8 A;  2Z23 A;  1B7U A;  3PD9 A;  3IOR A;  3PU5 A;  1L5T A;  5BWJ A;  3H3G A;  3JYR A;  1T0K A;  3MZ9 A;  1O64 A;  1IIT A;  4C1T A;  5HBC A;  1Z7M E;  1NKX A;  1M5D A;  1PDA A;  3IB2 A;  5B70 A;  2ZYN A;  4NF5 B;  1IXG A;  3RY3 A;  3DEL B;  2OBG A;  5ELV A;  4BDM A;  4YMB A;  4I8C A;  1I6A A;  2R6G E;  2O6A A;  2QS4 A;  2V84 A;  4YU0 A;  3V5A A;  2H5Y A;  3C31 A;  2UVJ A;  3KN8 A;  4PFU A;  3T9X B;  4BDL A;  4ZE9 A;  2H4I A;  3C9H A;  3PPQ A;  2ZNT A;  3FUZ A;  4JXI A;  4NF5 A;  2FNC A;  3K02 A;  4KYE A;  4PQJ A;  3ECR A;  3FVG A;  4WKM A;  4F19 A;  1QUJ A;  1NH7 A;  2XXH A;  5K2Y A;  1B1X A;  4LP2 B;  1MY1 A;  4U21 A;  1A7L A;  2A5S A;  1BKA A;  3F11 A;  5HPQ A;  1MXZ A;  1LB8 A;  3H7M A;  2D3I A;  2AL5 A;  1ATG A;  3CI8 A;  3ILU B;  4YB5 A;  3VVE A;  5HM4 B;  4OER A;  3S9L C;  3IB1 A;  3FJG A;  3OO7 A;  3RQT A;  5JK4 A;  4R2B A;  4XKN A;  3FXQ A;  3MP1 A;  5FTI A;  4G4P A;  3VE1 B;  1FQA A;  1JEV A;  2KLF A;  1S7Y A;  5AA4 A;  4P0G A;  3HV1 A;  3O2A A;  3OOA A;  4OFJ A;  5LOM A;  3S9N C;  3MC2 A;  4AB5 A;  1USY H;  1B3H A;  2VHA A;  3O29 A;  1Y3P A;  4RPO A;  4G8N A;  3UP9 A;  4XKR A;  3BBR A;  2UXA A;  3HN0 A;  1D4N A;  1OVB A;  1OVT A;  1II5 A;  3MBP A;  4ZS9 A;  3FJ7 A;  4OXV A;  5I59 B;  1ANF A;  1MQD A;  1SI1 A;  1TXF A;  1Y20 A;  2RC7 A;  3IJX B;  4GL0 A;  4IO2 A;  4ND9 A;  1Y4T A;  3DM0 A;  2O69 A;  2O84 X;  1J1N A;  2Q88 A;  3EHS A;  3KSJ A;  3MQ9 A;  3QYT A;  4H5G A;  4H5F A;  4LAT A;  2I58 A;  3GLB A;  3A09 A;  5DYH A;  4ZE8 A;  5EYF A;  4X1B A;  3RPW A;  5I56 A;  2QL3 A;  3SEV A;  3MVZ A;  2ONK E;  4FAJ A;  5TU0 A;  4ZDM A;  1B3L A;  2HZK A;  4QFP A;  3ZSF A;  3THI A;  4BDO A;  4HW8 A;  3MVW A;  1POT A;  4IGT A;  1B6H A;  1PB7 A;  3FAS A;  3TYH A;  2HAU A;  2REJ A;  3CSB A;  3M3F A;  3QIM A;  1MS7 A;  2O1L A;  1MXX A;  3R26 A;  4FOR A;  2BJJ X;  5CRY A;  4IY6 A;  3U72 A;  1PB9 A;  4U23 A;  1B7H A;  2P1S A;  4R6H A;  1HSL A;  3TCF A;  3C32 A;  3ZKL A;  3LBS A;  3C33 A;  1VE4 A;  1PC3 A;  5H8S A;  4BDN A;  4RK2 A;  1POY 1;  3VLV A;  4DXB A;  4NF6 B;  4POX A;  1FTM A;  1H3D A;  4L17 A;  3USD A;  3K6V A;  4OFO A;  5FHN A;  4F3P A;  2UVH A;  4GXS B;  3L6H A;  5I56 B;  1QVS A;  4K3F A;  4O3B A;  4OEN A;  3RTW B;  3W9V A;  1FQC A;  3EN3 A;  4NE4 A;  3S9M C;  4X9T A;  1NNP A;  2OWT A;  4DXU A;  3BFT A;  3FV1 A;  2UYF A;  2I4C A;  4R9F A;  3TMG A;  2CZL A;  3UGW A;  4H8I A;  2OK2 A;  2YJP A;  4FE8 A;  3FJM A;  3K6W A;  3UK4 A;  1MY4 A;  1N3X A;  3A3C A;  4WEP A;  5H8N B;  3U94 A;  2IA4 A;  2RC8 A;  2DSF A;  2F8D A;  4EUO A;  3MVY A;  3OMB A;  3RT8 A;  3MZB A;  3PUV E;  4ELP A;  4GQO A;  2XXP A;  1AL3 A;  3GBB A;  3N6U A;  1O63 A;  1B3G A;  1MQJ A;  3MP6 A;  4XIG Q;  3I6V A;  1SBP A;  2Z8F A;  4ISU A;  3SER A;  1Z7N E;  3OO8 A;  4F3S A;  4BDQ A;  5I59 A;  4RA1 A;  3K1N A;  1XOC A;  5CI5 A;  3K00 A;  1MDP 1;  3VFJ A;  3EQ1 A;  4LZ7 A;  4QFK A;  4OEU A;  5DEX B;  1O7T A;  4GF8 A;  4JSD A;  3SEY A;  2I3V A;  1FTJ A;  1IXI A;  3U1O A;  5AA1 A;  4PP0 A;  2HZL A;  2ZMB A;  1FTL A;  4IY5 A;  4QSE A;  2PX1 A;  5DVI A;  4I1D A;  2ESN A;  3KZG A;  3R6U A;  2Z8E A;  4XKP A;  2Q8J A;  4QRZ A;  5ICQ A;  1LBC A;  1OQG A;  3IOU A;  1PBP A;  1AIV A;  2RKM A;  5KDT A;  4UAC A;  1A55 A;  4IO6 A;  5M2V A;  2P2A A;  2DWJ A;  1Y1M A;  1B7Z A;  3W15 C;  3H06 B;  3O6G A;  2QPQ A;  4XXU A;  4JDF A;  1B40 A;  2RCB A;  1R1N A;  3K6U A;  3MPK A;  3QAX A;  1I6Q A;  3G3G A;  2H25 A;  1US5 A;  3MJN A;  4YB7 A;  1MDQ A;  3E3K A;  3D4C A;  4DZ1 A;  4R6Y A;  1ZU0 A;  4ZEB A;  4DIG A;  4OHN A;  4E0W A;  1H76 A;  5CM6 A;  5KZT A;  3HHF A;  1RYX A;  1QW0 A;  2NVU B;  1NH8 A;  2ONS A;  3H6U A;  3TQL A;  3WAE A;  2GH9 A;  2NOO A;  5CMB A;  4JWY A;  1MM6 A;  3CFZ A;  1Y9U A;  1SW1 A;  5CBS A;  3V8X B;  4KD5 A;  4PFT A;  3TUS A;  5H8H A;  1DTZ A;  4F29 A;  4YKK A;  4P0I A;  1KWH A;  1LAX A;  1XT8 A;  2QSX A;  2VGQ A;  4NF4 A;  2O68 A;  3N94 A;  4R73 A;  2HAV A;  4GWO A;  1A54 A;  4LQ5 A;  3T96 B;  2ANJ A;  5TP9 A;  3TPA A;  3S9E A;  4HCW A;  2RCA A;  1MY3 A;  5KDT B;  1ZMG A;  3TOD A;  1QJM A;  1A99 A;  2ALU A;  2DWI A;  4RXL A;  4ZZE A;  4F3G A;  1LST A;  4MLQ A;  2LAO A;  1JVY A;  1SW5 A;  3CG1 A;  3G3J A;  3I3V A;  4H65 A;  1GR2 A;  4QFN A;  3RGY A;  1GGG A;  3M3L A;  4LON B;  3T66 A;  5L9O A;  4ZEK A;  1P1Q A;  1A40 A;  3UA8 A;  1P99 A;  1MM7 A;  3OO9 A;  2V3Q A;  4G68 A;  3IOW A;  1BP5 A;  4I62 A;  3CR9 A;  3FIR A;  4FEC A;  4G8M A;  2I4B A;  4F31 B;  1N04 A;  2B3B A;  4QF9 A;  1SW4 A;  3VXC A;  4H8J A;  1URD A;  1URS A;  1I69 A;  1LFG A;  4G68 B;  4ZEI A;  3FVK A;  4THI A;  3TTN A;  3PMV A;  1UTH B;  1DPE A;  2XXI A;  4OYV A;  1JW4 A;  3KEI A;  3H03 A;  4R75 A;  4F39 A;  1FQF A;  3IX1 A;  1ZJL A;  2OCU A;  2PVU A;  4ESX A;  1M5B A;  3CFL A;  2DQV A;  3ODB A;  3E13 X;  3MAM A;  3V83 A;  4OET A;  4QFO A;  2RF1 A;  3PUW E;  3B7D A;  2H98 A;  2ZNU A;  1N84 A;  1OQH A;  4H0W A;  3FVN A;  3PV0 E;  2Z8D A;  3OXN A;  3Q26 A;  4TQU Q;  1ZLQ A;  5J1D A;  4FED A;  1JEU A;  3SET A;  4H6D A;  2HQ0 A;  3MVX A;  1JET A;  5I2K A;  4R2F A;  5EHS A;  3RN8 A;  4QSD A;  2AIX A;  3JZJ A;  1BLF A;  3TTR A;  1MPC A;  5AA2 A;  1CE2 A;  2XXY A;  2XX8 A;  2DXY A;  1LAF E;  2F7C A;  2VD2 A;  2X26 A;  1B9J A;  2Q9T A;  1HSJ A;  4RYA A;  4WXJ A;  5AA2 B;  3B6T A;  3LR1 A;  4F1V A;  1MY2 A;  3S4U A;  3VLW A;  3T9V A;  4EF2 A;  4F2Q A;  1DTG A;  1DSN A;  1M5C A;  2F35 A;  2I0B A;  3RNN A;  2V3T A;  3FD3 A;  3KN7 A;  1BTJ A;  3B6Q A;  4OVJ A;  3SES A;  1P1N A;  1M5E A;  1SW2 A;  4NED A;  3GBA A;  1VSO A;  3K1M A;  4I9D A;  3U92 A;  5A5X A;  2PT1 A;  1RYO A;  3TEL A;  3ONM A;  4IO3 A;  1USY E;  3FXR A;  4KCC A;  1XVX A;  2Y7K A;  4KCD A;  2UVI A;  1B46 A;  2DWH A;  1Y3N A;  4RY1 A;  4DXC A;  1H45 A;  2O1M A;  3EF7 A;  3PPP A;  2PYY A;  4GD5 A;  1B2H A;  4ZEF A;  3SEU A;  2Q2A A;  2UYE A;  4U2R A;  1AOV A;  3KOS A;  4QSC A;  1ELJ A;  3LUY A;  4OES A;  4Q5T A;  1NMU A;  1IIW A;  2I3W A;  5AE4 A;  1VFE A;  2DS9 A;  3TZA A;  3PUZ E;  1B5I A;  4TLM B;  3KOT A;  2XX7 A;  1SQY A;  1B5J A;  1US4 A;  3IJO B;  3QK6 A;  1B4Z A;  4DE8 A;  2F97 A;  2Q89 A;  5TPA A;  5CMK A;  5I57 B;  1MPB A;  4KYS A;  2F7B A;  4QHQ A;  4H1X A;  1B0H A;  4KQP A;  4GOT A;  2HFB A;  1WOD A;  2ZYO A;  3K01 A;  3T22 A;  3EHU A;  1LBB A;  4U4X A;  3QSL A;  3Q29 A;  5BUU A;  4GRK A;  1B05 A;  3O97 A;  2QS3 A;  4KHZ E;  4NMY A;  2DXR A;  4UA8 A;  5L9S A;  4GVO A;  3G3I A;  1DPP A;  1B1H A;  1SYH A;  2A5T A;  2DVC A;  3HCQ A;  3P7I A;  3PPN A;  5CMC A;  1YAE A;  2OLB A;  2XXX A;  3TCG A;  1N76 A;  1M5F A;  1Y4C A;  1BIY A;  2DE4 A;  1FQB A;  3CVG A;  5DVF A;  3U93 A;  1NNT A;  3LSL A;  4NF8 B;  1NNK A;  4ECF A;  2O51 A;  3MP8 A;  4OTE A;  5I2K B;  2A5T B;  4OMB A;  4BDR A;  5I84 A;  2XXU A;  4KR5 A;  2RC9 A;  3K1P A;  3MWB A;  4O3A A;  1H44 A;  3LSX A;  3KG2 A;  3SEW A;  2DWA A;  3I5O A;  2QS2 A;  3ZKK A;  5DT6 A;  4JSO A;  1EU8 A;  4OEV A;  4YZZ A;  3M8U A;  3HPI A;  3TTL A;  2YLN A;  1MQH A;  4PFW A;  4GFR A;  3BKI B;  5H8N A;  5I57 A;  1S9T A;  1Y3Q A;  3FGS A;  1P1U A;  1RKM A;  1UIU A;  3KSX A;  2PMS A;  4XKQ A;  1N7W A;  4N6P A;  4FIM A;  3CRB A;  4ELR A;  4IO7 A;  1SYI A;  2V25 A;  4PET A;  4F2O A;  5JTY A;  1IUD A;  2GHB A;  3K4U A;  5L9M A;  4U22 A;  5TPA B;  2ZNS A;  4NWD A;  1MQI A;  3K6X A;  3MW0 A;  3FVO A;  3B6W A;  2ZXT A;  1N3W A;  1XHY A;  4NF8 A;  2Q2C A;  1IZ1 A;  3CFX A;  3O9P A;  5CMM A;  4E0X A;  1XS5 A;  3IOT A;  1SI0 A;  3PPO A;  4LA9 A;  1FTO A;  5I58 B;  4R74 A;  1R9L A;  3IO6 A;  4Q30 B;  4G77 A;  4GXA A;  2H99 A;  3TAJ A;  1A8F A;  1MH4 A;  1QKB A;  3FXU A;  3JV9 A;  4NTL A;  1P1W A;  3EHT A;  4FJP A;  3VXB A;  3PMW A;  4MFI A;  5I58 A;  1SD3 A;  3N5L A;  3D4G A;  2Y7R A;  3LC8 A;  4ZZA A;  4ELQ A;  4X1D A;  3VVD A;  3FZV A;  2ZYM A;  3O6I A;  1DMB A;  1TT1 A;  3MPL A;  1AMF A;  2AL4 A;  2O7I A;  5FHO A;  2GFE A;  4G8H A;  5ITO A;  3CSG A;  2GRV A;  4R6K A;  3VV5 A;  3KGC A;  3H6T A;  4RK9 A;  5TP9 B;  3OEL A;  1A8E A;  3SKP A;  2ZYK A;  3LSW A;  5CBR A;  2V3U A;  1Q35 A;  4EQB A;  1MQG A;  2V93 A;  1MRP A;  1OLC A;  2X7Q A;  3HO7 A;  3UOR A;  3S2V A;  3QXM A;  2B65 A;  2NUV A;  1UIV A;  3U8Q A;  4EQ7 A;  2RIN A;  3OEN A;  1FW0 A;  3RLF E;  3OEK A;  2PBW A;  2Y7I A;  5IKB A;  2AYS A;  5I2N A;  4F18 A;  2I48 A;  1B52 A;  2I49 A;  1IQ7 A;  3WAF A;  2OWS A;  4U4S A;  1EZP A;  3RT6 B;  1CB6 A;  1QUL A;  1EZO A;  4ZED A;  3CG3 A;  4YAH X;  1B32 A;  5FHM A;  1WVJ A;  4KFQ A;  5ICT A;  2B3F A;  5K2X A;  1N0T A;  4RJZ A;  2XXT A;  2Y7P A;  4G68 C;  3FV2 A;  4EXL A;  1FQE A;  2YPN A;  2DE3 A;  4N13 A;  4RPN A;  4YB6 A;  2FYI A;  3R7X A;  3SDF A;  3N26 A;  1GVC A;  3C34 A;  3W9W A;  3Q27 A;  2QS1 A;  3HST A;  2VD3 A;  3O6H A;  4YKP A;  2IEE A;  4P11 A;  3E9X A;  1P1O A;  4C1U A;  1B0L A;  2HCA A;  1XC1 A;  2D5W A;  1OIB A;  2DYX A;  2XD3 A;  2W7Y A;  3PUX E;  2F6P A;  4OFL A;  3GXA A;  5B7D A;  1DOT A;  4C0R A;  2XX9 A;  1N7X A;  3IOV A;  2F6G A;  3TDJ A;  1PB8 A;  1ZIU A;  1D9Y A;  1EH3 A;  2PT2 A;  4HCY A;  1ZKB A;  4AQ4 A;  4LZ8 A;  1AH5 A;  1S50 A;  2XXQ A;  3DLN A;  4X48 A;  1MG1 A;  3OD7 A;  2I6E A;  3QUF A;  1LCT A;  3K2D A;  2REG A;  1LAH E;  5H8Q A;  3BFU A;  3KFM A;  3DP8 A;  4LUB A;  5AA3 A;  2OZZ A;  1IEJ A;  1NL5 A;  3K0V A;  5JTY B;  1MPD A;  2QMW A;  1GTK A;  4MLV A;  1OMP A;  4PE5 B;  1VR5 A;  3PPR A;  3V89 B;  3TCH A;  1QUK A;  3LSF B;  2DP8 A;  5F7V A;  1NNF A;  2XD2 A;  3KBR A;  1URG A;  1B4H A;  3ILT B;  1LB9 A;  2HEU A;  4MBP A;  5FTH A;  4Q8R A;  1IXC A;  2H9B A;  5IAI A;  4KYD A;  3OEM A;  2P0S A;  3VVF A;  3PMX A;  1B58 A;  1FQD A;  2DVZ A;  4EF1 A;  2Z22 A;  3G3F A;  3M3K A;  3TTK A;  4ZEC A;  4G2Z A;  1R9Q A;  2QJE A;  3VDF A;  4AB6 A;  1F9B A;  4GL8 A;  4H67 A;  4TOZ A;  4YMA A;  2XXV A;  3G3K A;  4YKI A;  2VP1 A;  3OSR A;  5DEX A;  2F36 A;  1ZBM A;  3C36 A;  3IAZ A;  3PGF A;  4IO5 A;  4EXK A;  1YCJ A;  4FAT A;  4OZ9 A;  3HHG A;  2HXW A;  5ITP A;  1JW5 A;  1LCF A;  4JBZ A;  5H8Q B;  4Z7E A;  4N07 A;  1LFH A;  3KJ7 A;  1FTK A;  3IR1 A;  1JVX A;  3OSQ A;  3CIJ A;  3RTF B;  4FEB A;  5F1Q A;  3H4Z A;  4R72 A;  3UN6 A;  3TFL A;  2CMO A;  2WKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...