3UIFA

Crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
330
structure length
330
Chain Sequence
b'VEDLKVVRIASVATNVGGKTVYAGSASLVVNGAFPEELRKQGIKVEWVPAAMASVGPVINEGFASGKIDFGIYGDLPPIILNASKPTVQLVAPWGTTSNSYLVVPKNSTAKSIKDLKGKKIALHRGRPWELAFSNLLQSEGLTFKDFKIVNVNPQVGAAALASGTVDGFFSLFDSYILEDRGVGKIIWSTKTAPVDWKLMGGVWARNDFVKQNPEITQAIVTAYLKSVHWVAQDENKETYIREYSNKIYPESVNRREYDQDNVSWRQRWSPLYDVALQEHYRKAVAYAQASGLTRTQADVQQMLNPHFVATALKELKLEGFWTPNAENLY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sulfonate ABC transporter, periplasmic sulfonate-binding pro
publication title CRYSTAL STRUCTURE OF putative sulfonate ABC transporter, periplasmic sulfonate-binding protein SsuA from Methylobacillus flagellatus KT
rcsb
source organism Methylobacillus flagellatus
molecule tags Transport protein
total genus 111
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3uifA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3uifA01
3MP8A 5I2NB 3TCFA 2H9BA 4OEUA 4XTCQ 1AOVA 3WAEA 5AA1A 3LC8A 2R9JA 3TODA 3SEUA 3PPPA 4YZZA 3HN0A 1Z7NE 3TCGA 4GQOA 2Q89A 1XS5A 3EQ1A 3LR1A 4DCXA 3O6HA 2RCAA 5H8FA 4RA1A 4G8HA 2RC9A 3ONMA 4WEPA 1XHYA 1Y3QA 5AA2D 2XXIA 1MXUA 1EZ9A 5FHNA 1A8FA 4NF6A 4F18A 3MBPA 2CMOA 1DSNA 3H6UA 2FA7A 5CMBA 2HFBA 3MP1A 5CMCA 1B3FA 3QIMA 2DVCA 5I58B 4HTGA 1DPEA 2A5TB 4LP2B 5I56A 4JWOA 2UVJA 3UK4A 4OENA 2QS2A 4R72A 2QS4A 3VLUA 1N3WA 5CI5A 2CZLA 1B3LA 2ZYMA 1LAHE 3JYRA 1PBPA 5AE4A 2VD2A 3PMXA 4U1ZA 2I0BA 3HHGA 3FJ7A 4R75A 4N07A 3FXQA 5AA4B 3K02A 1MQHA 3FV1A 3QUJA 3DM0A 4IGRA 1XVYA 1MQJA 4KCDA 4P0GA 3UORA 2UVIA 1NL5A 1ZBMA 4F1VA 3EN3A 4JDFA 3N26A 2AL5A 3KJ7A 4POXA 2QMWA 4PFYA 4KCCA 1OLCA 3O29A 3U8QA 3VV5A 3IB0A 2LAOA 2Q2CA 1FQFA 5JTYB 4OZ9A 4ZEBA 4IGTA 5H8NB 2ZYNA 5KDTB 3UN6A 3FJGA 2Y7RA 5ICTA 4AQ4A 1LCFA 1UTBA 3FV2A 4GD5A 4H8IA 5IAIA 1ZU0A 5KZTA 1DMBA 4GLIA 2VOZA 4RPNA 3EHUA 2E1SA 1O64A 4H67A 3S9MC 1LFGA 4FECA 4F2QA 1SI0A 2XHDA 1SYHA 1N7XA 4P0IA 5DEXB 4NE4A 4ECFA 3IJOB 2ANJA 3VDFA 5ITOA 2VGQA 3A09A 4U23A 2HEUA 3N6UA 4OWDA 4DCYA 1P99A 3QSLA 3SERA 1B5HA 1PEBA 4F1YA 1H76A 1A54A 4LZ7A 3TELA 3TYHA 2H4IA 3LSFB 4MBPA 1MXYA 2AIXA 4LZ5A 4GL0A 1AIVA 2RF1A 2D21A 3S2VA 4EDPA 3M3KA 2V3UA 2DE3A 4I1DA 4R2BA 4EF1A 3SEXA 3H6WA 4QF9A 2I49A 5M2VA 4KPTA 2OZZA 4H65A 2RCBA 3IOTA 1MM7A 3RT6B 3TQWA 1DTGA 3KGCA 3P7IA 1PC3A 4F31B 5B7DA 5HM4B 3RTFB 1XOCA 2UVHA 4OTEA 3DELB 2REJA 2XD3A 2AL4A 5H8NA 5KDTA 3H03A 4GRKA 3BFTA 1PB7A 3IL1B 4LATA 3T9UA 4IO5A 3B6QA 1P1QA 3Q29A 1QVSA 4U2RA 4OMBA 3U1OA 3GBAA 1URSA 1OVTA 2OWTA 2DVZA 3O28A 1LAFE 3PUVE 4IO6A 1Y3PA 3BBRA 4OETA 4GXAA 1USYH 1M5CA 2O1LA 3PD8A 4JWYA 3W9VA 2P2AA 2ZYOA 4IY6A 4N6PA 3CG1A 2REGA 4LZ8A 1JEUA 4QRZA 4F3PA 4YKJA 2OCUA 1N3XA 4YAHX 3LSXA 5ELVA 3RNNA 3HHFA 4PFTA 4BLAA 1XVXA 3PUYE 1QUIA 1N7WA 3USDA 3TDJA 3ZSFA 2ONRA 4WKMA 4XKQA 4Q8RA 4BDMA 1MY1A 4YU0A 1FTMA 1A7LA 2G93A 2RINA 3HPIA 5H8QB 4FORA 5ICQA 4QFPA 5EHMA 1B46A 3T9XB 1B0LA 5CBRA 2B3FA 1MY2A 3FZVA 4GF8A 3JZJA 1URDA 3SDFA 4G8NA 3PPOA 2B3BA 2DWAA 5JK4A 2E0SA 5TP9B 3MP6A 1LFIA 1M5DA 3AXFA 1UIUA 1TFAA 3S4UA 4OYVA 5A5XA 3E9XA 4RPOA 4L17A 4RJZA 2GRVA 2PVUA 1ZTYA 5DTBA 3CFZA 5FHOA 2HXWA 3BFUA 4XIGQ 3MUQA 2F35A 2RC7A 1FQEA 4YICA 4DE8A 2XXRA 3QYTA 2R71A 5HBCA 5DVFA 3UP9A 4OFJA 1QW0A 2QRYA 1B40A 2Y7KA 4U4SA 4G68A 3EPEA 3MWBA 3G7WA 1JVXA 2UYFA 4Z0IA 1F9BA 4KD5A 3DP6A 5TPAB 4O3CA 4G2ZA 2OK2A 1US4A 1JNFA 1Y1MA 3PUXE 5FTHA 4OQOA 1BIYA 1FQAA 1YTVA 4ZS9A 5KCJB 4GL8A 5CMKA 3TFLA 3C36A 1MXVA 1PBQA 4MFIA 5F1QA 2GH9A 3OO7A 3OO8A 1MY4A 4X1DA 5AA3A 1ZKBA 1R9LA 3V89B 3GXAA 4RXLA 5H8SA 1MDP1 1B7HA 1SYIA 2YPNA 3OSRA 2I4CA 4FE8A 4XKPA 2V93A 1ZLQA 4IO7A 3JV9A 3U94A 4TLLB 2AYSA 2OWSA 4EUOA 3EHTA 3S9EA 1LB8A 3G3JA 2H25A 3TTRA 5CMMA 5J1DA 5LOMA 1MQGA 4MLVA 3TTKA 1VR5A 3I3VA 2XXYA 5I84A 3G3KA 1AH5A 3KSXA 2M8CA 3IO4A 3R7XA 2HAVA 1BKAA 2F6PA 1B1XA 1SW4A 4MH5A 3KN8A 2RC8A 1D3KA 4GOTA 3N5LA 4AB6A 4JWXA 4LQ2A 4WXJA 4N13A 1D4NA 1UTHB 4JSOA 4DXUA 5L8DA 3FVOA 4GIZA 3G3IA 2Y7IA 1QKAA 4NF5A 1YAEA 2P0SA 1O63A 2DWJA 2PT2A 3K6XA 4PP0A 3G3FA 3FGSA 1XT8A 5L9SA 4PETA 2D3IA 2P1SA 2PMSA 1DOTA 1IZ1A 3DP4A 1NFTA 4JSDA 4NWDA 2QS1A 3B7DA 1N0TA 1IQ7A 2OLBA 2ZMBA 3QK6A 3TUSA 3QAXA 4I8CA 2Q88A 4RNSA 2F5XA 3O6IA 2KLFA 4ELOA 4QSEA 3VE1B 4NF4B 3PUZE 4YB7A 1EH3A 1M5FA 3E13X 5I2KB 2NWJA 3CFLA 3V5AA 4XXUA 4ZZEA 1N84A 1A99A 4F19A 2IEEA 1SI1A 3LSLA 5B70A 1LB9A 5I2NA 3V83A 1AL3A 2DP8A 4ZEIA 3O66A 2Z23A 4DXBA 1QKBA 1NNKA 5BUUA 2NOOA 4YKPA 1ZJLA 2VHAA 2Q2AA 1TWYA 3VVDA 1PB9A 1I69A 1JW5A 4G8MA 3TKDA 2THIA 1LBCA 4GWOA 5DT6A 3OSQA 3MAMA 4OESA 1B5JA 4XKRA 1BTJA 1YPNA 3BKIB 1P1UA 1RKMA 3OD7A 1IXCA 1P1WA 3MVWA 3Q27A 5CBSA 4KYEA 1VFDA 2IA4A 1H43A 1N76A 2O7UA 4KHZE 3MZ1A 4H8JA 3K0VA 1HSLA 5I58A 1LCTA 1TXFA 4ZE9A 2A5TA 5I59B 4POWA 1Y4CA 4JB7A 1L5TA 1Y3NA 2V25A 4ELQA 1EZOA 4KI0E 2NUVA 4O3BA 4YMAA 2QSXA 4R74A 2I4BA 3MPLA 1KWHA 3H7MA 3RTWB 3E3KA 5K2YA 1IXHA 1PB8A 4G4PA 3W15C 2ZNUA 4BDLA 3CSGA 5AA2B 4E0XA 2F7BA 4ISUA 3ILTB 3VVFA 1B5IA 3D4GA 4YMBA 1WODA 4DIGA 1MPCA 3I5OA 4NF4A 4U22A 3RGYA 4FJPA 5AA4A 3RQTA 1H45A 1GVCA 2PBWA 4Q30B 3C34A 1LLSA 3K2DA 3TPAA 1B3EA 2DE4A 5I57B 2PYYA 3MVXA 4R6KA 4LVQA 1UIVA 1R9QA 4KFQA 1JW4A 1QUKA 3K00A 1B05A 2I3WA 3K6VA 4BDOA 4AB5A 3Q28A 4UACA 2FNCA 4R6HA 4F22A 3O6GA 3T22A 4EF2A 4ZEKA 3IX1A 1EU8A 3OENA 4R73A 2F97A 3W9WA 1I6AA 2XX7A 2Y84A 5JTYA 2ABHA 2O6AA 4C1UA 4FEBA 2Z8FA 4JBZA 3KSJA 2ZXTA 1QULA 1XC1A 3RY3A 3IB1A 1OIBA 3FVGA 3K6UA 3H6TA 3SETA 4K3FA 2ONKE 4R2FA 2I58A 1ATGA 3OOAA 1B1HA 1R1NA 1J1NA 4GFRA 4FATA 1JETA 3K1MA 3O97A 1NH8A 3FVNA 4HCWA 1P1NA 4G77A 3OELA 3KG2A 4H5GA 3VXBA 5DEXA 2O1MA 3O9PA 3C32A 2XXWA 2F8DA 3V8XB 3MW0A 4FIMA 4R6YA 1MXXA 4JXIA 4F1UA 4QFLA 4H5FA 1IEJA 3FASA 2ONSA 4RYAA 1MPBA 2Y7PA 3TZAA 5CRYA 2PX1A 2D5WA 3LSWA 3CFXA 5DYHA 1ZMGA 2R6GE 4TOZA 1JQFA 4DZ1A 1MDQA 2B65A 1VSOA 3CSBA 1RYXA 3Q26A 3CRBA 3WAFA 1FQBA 3VVEA 4THIA 3RN8A 1IXIA 1VFEA 2ZNTA 1LBBA 3DP8A 3MQ9A 3QXMA 2QL3A 1S50A 3PGFA 1SW1A 4M4GA 2DXRA 3OO6A 4LUBA 4MLQA 1LGBC 1OLAA 2XX9A 4U21A 2H99A 3KOSA 4C0RA 5H8HB 3TCHA 1GGGA 4DLDA 2G29A 1GTKA 1B0HA 3KOTA 1B2HA 3CI8A 3LBSA 5ISUA 3M3LA 4LA9A 1D9YA 2W7YA 3O2AA 3C9HA 5BWJA 1SDXA 3TTMA 1LAGE 1QUJA 1DPPA 4X1BA 4F39A 4F3GA 2ALUA 3M8UA 5FHMA 1M5BA 1US5A 5EYFA 2NVUB 3K1PA 1S9TA 5CC2A 2XXPA 1NMUA 4NF6B 3MJNA 1SD3A 4QFOA 3R6UA 2ESNA 1HSJA 3IK6B 3K1NA 1POTA 2XXXA 3F11A 1MG1A 1NNPA 4NF8B 4BDRA 4IB2A 4TLMB 2F34A 1SW5A 1Y4TA 3RLFE 5I56B 1LSTA 3UGWA 2HQ0A 3PUWE 4OFLA 5CM6A 3RT8A 3EHSA 5H8QA 3FXUA 1MPDA 1B3GA 1TFDA 2F36A 4OXVA 3L6HA 2F6GA 3H3GA 2FYIA 2H98A 1H3DA 3OEKA 4FAJA 1JW1A 2OJTA 3D4CA 4H6DA 3IORA 1SQYA 4IO4A 5TP9A 4ZZAA 3T96B 2I6EA 3TQLA 2XXQA 1NKXA 3Q25A 1Z7ME 2F78A 5DVJA 3MZBA 4Z7EA 4KYDA 3FUZA 4E0WA 3H6VA 4I9DA 2YLNA 4ZEDA 5IKBA 3C35A 3SEWA 3I6VA 3PU5A 2DSFA 1FTLA 1EZPA 3GZGA 3SEVA 1B51A 2GHBA 3K4UA 3VLVA 1B4HA 1B6HA 2ZYKA 5L9MA 2O51A 1URGA 3THIA 1SVXB 1UTBB 1A40A 3IOWA 2PT1A 4UA8A 5TPAA 1A55A 2F7CA 2XD2A 1D9VA 3ODBA 4IO2A 2BJJX 3SKPA 4KQPA 5KCJA 2H5YA 1FQCA 2GHAA 1FQDA 2QJEA 5TU0A 4BDQA 4NF8A 3G3GA 3IOVA 2DWHA 3L6GA 3S9LC 1Y20A 3DLNA 1LFHA 3PPNA 3CR9A 4QFNA 2V3TA 1QJMA 4EXKA 3TEPA 3PD9A 1Q35A 2WKYA 3OO9A 1IITA 2DOJA 1B58A 2DYXA 3FIRA 4ZEFA 3MPKA 3K6WA 1POY1 4DDDA 4M1VA 2I48A 1BLFA 1OQGA 1Y9UA 4I62A 1P1OA 2DWIA 3FXRA 2UYEA 1Y1ZA 3HCQA 3PPRA 4BDNA 4X48A 3A3UA 4KYSA 3HV1A 2ZNSA 4ESXA 1SBPA 3FVKA 1B4ZA 3GBBA 4ESWA 3ZKKA 2NXOA 1AMFA 4X9TA 1BP5A 1OQHA 3PMWA 3QUFA 4ONYA 1GR2A 2XXUA 3TMGA 3SESA 1MQIA 1UTHA 1NNFA 4IY5A 3HSTA 3KJTA 5DVIA 1ELJA 4NTLA 1HSEA 3S9NC 2HZLA 2O69A 3KZGA 1M5EA 4NMYA 3T93B 3U93A 3IAZA 3VXCA 1O7TA 3RPWA 1B7UA 3FD3A 1I6BA 3KN3A 2OBGA 4FEDA 3CIJA 4IO3A 3T66A 4QHQA 2RKMA 3A3CA 4YB6A 4OEVA 4MF3A 4ND9A 4ELPA 1WVJA 4PQJA 5I2KA 3VFJA 3EF7A 2VD3A 3IOUA 4LONB 4YB5A 2DXYA 2DS9A 3C31A 4F3BA 3E4RA 1B9JA 2QS3A 3UIFA 4P11A 2DE2A 2XXVA 4OHNA 1MH4A 4PE5B 5K2XA 1JVYA 4EXLA 3ZS6A 4Q5TA 3U72A 3U92A 3H06B 1SW2A 4OERA 4WEDA 3RUMA 4F29A 1FW0A 1MY3A 5JEIA 3B6TA 4H0WA 1OVBA 1PDAA 1ZIUA 2UXAA 3T9VA 1FTOA 3H4ZA 3R26A 5A5XB 4RK2A 3MC2A 1IUDA 4U4XA 4EQ7A 1TT1A 2YJPA 4LQ5A 3T9HB 3LUYA 3SEYA 2GFEA 4ZDMA 2X7QA 1CB6A 4O3AA 1LAXA 5F7VA 3FJMA 1B52A 4GXSB 4U1OA 1MH3A 3GLBA 5I59A 1B7ZA 1FCKA 4Q0CA 1YCJA 1WDNA 1N04A 2V3QA 1OMPA 3G3HA 1RYOA 4G68B 2O68A 2F7AA 3ILUB 2X26A 5AA2A 3M3FA 1MQDA 1T0KA 3N6TA 4EQ9A 3MVYA 1VE4A 3C33A 2UVGA 2Z8EA 1MY0A 4F2OA 3OXNA 5ITPA 4ZE8A 3KN7A 2Q8JA 5I57A 3IO6A 1IXGA 2HZKA 2HCAA 4KR5A 4YKKA 2HAUA 3PMVA 1MM6A 3PV0E 3KEIA 4ELRA 4RK9A 4TQUQ 4YKIA 3N94A 3UA8A 1A8EA 1MRPA 2X7PA 4F3SA 3K01A 1S7YA 2Z22A 3ZKLA 3TTLA 1II5A 4RY1A 2VP1A 1H44A 4HCYA 1FTJA 4ZECA 2Z8DA 4DXCA 3FATA 4QSCA 3MVZA 4NEDA 3IJXB 5H8FB 4GVOA 3B6WA 1IIWA 4R9FA 3PPQA 1DTZA 5L9OA 1JEVA 1MXZA 3IB2A 4QFKA 4G68C 4OVJA 4PFUA 1MS7A 3VLWA 5HPQA 3HO7A 4H1XA 5EHSA 4QSDA 4R9GA 1MXWA 3KBRA 1UQWA 3TTNA 3CVGA 4NF5B 1NH7A 4NWCA 2QMXA 3ECRA 1GV8A 1CE2A 1B32A 3TAJA 4HW8A 4XKNA 1NNTA 4C1TA 2XX8A 3IR1A 2A5SA 1USYE 2Y7WA 4HS7A 5FTIA 2V84A 2Q9TA 3MZ9A 2XXTA 2O7IA 2XXHA 3OEMA 1FTKA 1R6ZA 2I0CA 3KFMA 3OMBA 2QPQA 2O84X 4OFOA 2I3VA 2DQVA 1I6QA 3CG3A 4EQBA 1ANFA 1Q1KA 5H8HA 3C4MA 1B3HA 4PFWA
chains in the Genus database with same CATH superfamily
3MP8A 5I2NB 3TCFA 4N17A 5IGAA 2H9BA 4OEUA 1FBDA 4XTCQ 1AOVA 3WAEA 2WYKA 1IMEA 5AA1A 4OVRA 3LC8A 2R9JA 3TODA 3SEUA 3PPPA 4YZZA 3HN0A 1Z7NE 3TCGA 1JP4A 1INPA 4GQOA 2Q89A 1XS5A 3EQ1A 3LR1A 4I40A 4DCXA 2WBDA 3O6HA 2OX3A 2RCAA 5H8FA 4RA1A 4G8HA 2RC9A 3ONMA 4WEPA 4GWSA 1XHYA 1Y3QA 5AA2D 2XXIA 1MXUA 1FPFA 1EZ9A 5FHNA 1A8FA 4NF6A 4F18A 3MBPA 4NQ8A 2CMOA 1DSNA 3H6UA 2FA7A 4P56A 5CMBA 4OVSA 2HFBA 3MP1A 5CMCA 3IFCA 1B3FA 3QIMA 2DVCA 2ZZWA 5I58B 4HTGA 1DPEA 2A5TB 4LP2B 3LV0A 2PFYA 5I56A 4JWOA 2UVJA 2GQ1A 3UK4A 4OENA 2QS2A 4R72A 2Y5KA 2QS4A 3VLUA 1N3WA 3E78A 5CI5A 1NV7A 1B3LA 2CZLA 2ZYMA 1LAHE 2XWOA 3JYRA 1PBPA 5AE4A 2VD2A 3PMXA 4U1ZA 2I0BA 3HHGA 3FJ7A 4R75A 4N07A 3FXQA 5AA4B 4IR8A 3K02A 1MQHA 3FV1A 4NF0A 3QUJA 3DM0A 4IGRA 1XVYA 1FPIA 1MQJA 4KCDA 4P0GA 3UORA 2UVIA 1NL5A 3ROJA 1EYJA 1ZBMA 4F1VA 3EN3A 4JDFA 3N26A 2AL5A 3KJ7A 4POXA 2QMWA 4PFYA 4KCCA 1OLCA 5IZZA 2DDKA 3O29A 4N4UA 3U8QA 1FJ6A 3VV5A 2L5VA 3IB0A 2LAOA 2Q2CA 1FQFA 5JTYB 4OZ9A 4DI3D 4ZEBA 4IGTA 2B4MA 5H8NB 2ZYNA 5KDTB 3UN6A 3FJGA 2Y7RA 5ICTA 4AQ4A 1NUXA 1LCFA 1NUZA 1UTBA 3FV2A 4GD5A 4H8IA 5IAIA 1ZU0A 5KZTA 1DMBA 4GLIA 4O8MA 2VOZA 4RPNA 3B8BA 3EHUA 2E1SA 1O64A 4H67A 3S9MC 2QVRA 1LFGA 4FECA 1SI0A 2XHDA 4F2QA 1SYHA 2Q74A 4P0IA 1N7XA 5DEXB 4GX4A 4G61A 2ZZVA 4NE4A 4ECFA 3IJOB 2ANJA 4GBVA 3VDFA 5ITOA 2VGQA 3A09A 4U23A 2HEUA 3N6UA 4OWDA 4DCYA 1P99A 3QSLA 3SERA 1B5HA 1PEBA 4F1YA 1Q9DA 1H76A 1A54A 4LZ7A 3TELA 3TYHA 2H4IA 3LSFB 4MBPA 1MXYA 2AIXA 1LBZA 4LZ5A 4GL0A 1AIVA 2RF1A 2D21A 3S2VA 4EDPA 3M3KA 2V3UA 2DE3A 4I1DA 4R2BA 5ESYA 4EF1A 3SEXA 3H6WA 3T0JA 4QF9A 2I49A 5M2VA 4KPTA 2OZZA 4H65A 2RCBA 3IOTA 1MM7A 3RT6B 3TQWA 4P9KA 1DTGA 3KGCA 3P7IA 1PC3A 4F31B 5B7DA 4PAIA 5HM4B 3RTFB 1XOCA 2UVHA 2VPOA 4OTEA 3DELB 5I5PA 2REJA 2XD3A 2AL4A 5H8NA 5KDTA 3H03A 4GRKA 3BFTA 1FJ9A 1PB7A 3IL1B 4LATA 3T9UA 4IO5A 3B6QA 1P1QA 3Q29A 1QVSA 1FSAA 4U2RA 4OMBA 3U1OA 3GBAA 1URSA 1OVTA 2OWTA 2DVZA 4PE3A 3O28A 1LAFE 4P1LA 3PUVE 4IO6A 3RPLB 1Y3PA 3BBRA 5IM2A 4OETA 4GXAA 1USYH 1M5CA 2O1LA 4JWYA 3PD8A 3W9VA 2P2AA 1NUYA 2ZYOA 4IY6A 3CG1A 4N6PA 2REGA 4LZ8A 1JEUA 4QRZA 4F3PA 4YKJA 2OCUA 2XXKA 1N3XA 4YAHX 3LSXA 5ELVA 2FHYA 3RNNA 3HHFA 4PFTA 4BLAA 4MHFA 1XVXA 3PUYE 1QUIA 1N7WA 3USDA 4MMPA 3TDJA 3ZSFA 2ONRA 1LEVA 4WKMA 4XKQA 4Q8RA 4BDMA 1MY1A 1NV6A 4YU0A 1FTMA 1A7LA 2G93A 2RINA 4PF8A 3HPIA 5H8QB 4FORA 5ICQA 4QFPA 5EHMA 1B46A 4GWZA 3T9XB 1B0LA 5CBRA 2B3FA 1MY2A 3FZVA 4GF8A 3JZJA 1LBYA 1URDA 3EKIA 3SDFA 4G8NA 3PPOA 2B3BA 2DWAA 5JK4A 4PCDA 2E0SA 4N15A 5TP9B 3MP6A 1LFIA 1M5DA 3AXFA 1UIUA 4QXDA 1TFAA 3S4UA 2PFZA 4OYVA 5A5XA 3IFAA 3E9XA 4RPOA 2VT5A 4L17A 4RJZA 2GRVA 2PVUA 4P3LA 1ZTYA 5DTBA 3CFZA 5FHOA 1FRPA 2HXWA 3BFUA 4XIGQ 1FPEA 3MUQA 4GBWA 1YYZA 5I7IA 2F35A 2RC7A 1FQEA 4YICA 4DE8A 2XXRA 3QYTA 2R71A 5HBCA 4PC9A 5DVFA 3UP9A 4OFJA 1QW0A 2QRYA 1B40A 2Y7KA 4U4SA 4G68A 3EPEA 3MWBA 3G7WA 1JVXA 2UYFA 4Z0IA 1F9BA 4KD5A 3DP6A 5TPAB 4O3CA 4G2ZA 2OK2A 1US4A 1JNFA 1Y1MA 3PUXE 5FTHA 4OQOA 1BIYA 1FQAA 1YTVA 4XEQA 4ZS9A 4GL8A 4JVCA 5KCJB 4MEVA 5CMKA 5EYGA 3TFLA 3C36A 1MXVA 1PBQA 4MFIA 5F1QA 2GH9A 3OO7A 3OO8A 1KZ8A 2R8TA 1MY4A 4X1DA 5AA3A 1ZKBA 4O94A 2CZKA 1R9LA 3V89B 3GXAA 4RXLA 5H8SA 1MDP1 1B7HA 1SYIA 5IZ3A 2YPNA 3OSRA 2I4CA 4FE8A 4XKPA 2V93A 1ZLQA 3T1BA 4IO7A 3JV9A 3U94A 4TLLB 2AYSA 2OWSA 4EUOA 2HHMA 3EHTA 3S9EA 1LB8A 3G3JA 4H45A 2H25A 3TTRA 5CMMA 5J1DA 5LOMA 4GWXA 1MQGA 4MLVA 3TTKA 1VR5A 3I3VA 2XXYA 5I84A 3G3KA 4MNCA 1AH5A 3KSXA 2M8CA 4GWUA 3IO4A 3R7XA 2HAVA 1BKAA 2F6PA 1B1XA 1SW4A 4MH5A 3KN8A 2RC8A 1D3KA 2CEXA 4GOTA 3N5LA 4MCOA 4AB6A 4JWXA 4LQ2A 4WXJA 4N13A 1D4NA 1UTHB 4JSOA 4DXUA 5L8DA 3FVOA 4GIZA 4H46A 3G3IA 2Y7IA 1QKAA 4PDHA 4NF5A 1YAEA 2P0SA 1O63A 2DWJA 2Q8MA 2PT2A 3K6XA 4PP0A 3G3FA 3FGSA 1XT8A 5L9SA 4PETA 5ET8A 4PAKA 2D3IA 2P1SA 2PMSA 1DOTA 1IZ1A 3DP4A 1NFTA 4JSDA 4NWDA 2QS1A 3B7DA 2BJIA 1N0TA 1IQ7A 2OLBA 4OVQA 2ZMBA 2WBBA 3QK6A 4N6DA 3TUSA 3QAXA 1SPIA 4I8CA 4QBAA 2Q88A 1FPKA 2CZIA 4RNSA 4DI4B 2F5XA 3O6IA 2KLFA 4ELOA 4QSEA 3VE1B 4NF4B 3PUZE 4YB7A 1EH3A 1M5FA 3E13X 5I2KB 2NWJA 3CFLA 3V5AA 2KR0A 4XXUA 4ZZEA 5LDZA 1N84A 1A99A 2XWVA 4F19A 4JVDA 2IEEA 1SI1A 3LSLA 5B70A 4OVTA 1LB9A 5I2NA 3V83A 1AL3A 2DP8A 4ZEIA 3O66A 1IMAA 2Z23A 4DXBA 1QKBA 1NNKA 5BUUA 2NOOA 4YKPA 1ZJLA 4PBHA 2VHAA 4AS4A 2Q2AA 4FBPA 1TWYA 3VVDA 5ET5A 1PB9A 1I69A 1JW5A 5DW8A 5EQ7A 4G8MA 3TKDA 2THIA 1LBCA 4I3YA 4N91A 4GWOA 5DT6A 3OSQA 3MAMA 1DK4A 4OESA 3BIGA 1B5JA 4XKRA 1BTJA 5T3JA 1YPNA 3BKIB 1P1UA 1K9YA 1RKMA 3OD7A 1IXCA 1P1WA 3MVWA 4NGUA 3Q27A 5EYHA 2XWIA 5CBSA 4KYEA 1VFDA 2IA4A 1H43A 1N76A 4KHZE 2O7UA 1IMFA 3MZ1A 4H8JA 3K0VA 1HSLA 5I58A 1LCTA 1TXFA 4ZE9A 2A5TA 1RDYA 4POWA 1Y4CA 5I59B 4JB7A 1L5TA 1Y3NA 2V25A 5A5LA 4ELQA 1EZOA 4KI0E 2NUVA 4O3BA 4YMAA 2QSXA 4R74A 2I4BA 4I3EA 1YZ0A 3MPLA 1KWHA 3H7MA 3RTWB 3E3KA 5K2YA 1IXHA 1PB8A 4G4PA 2FIEA 2ZNUA 3W15C 4BDLA 3CSGA 5AA2B 4E0XA 2F7BA 4ISUA 3ILTB 3VVFA 1B5IA 3D4GA 4YMBA 1WODA 4DIGA 1MPCA 3I5OA 3U65A 4NF4A 4U22A 3RGYA 4FJPA 5AA4A 3RQTA 1H45A 1GVCA 2PBWA 4PF6A 4Q30B 3C34A 1LLSA 3K2DA 3TPAA 1FPJA 2CZHA 1B3EA 2CEYA 2DE4A 5I57B 2PYYA 3MVXA 4R6KA 4LVQA 1UIVA 1R9QA 4KFQA 1JW4A 2PCRA 1QUKA 3K00A 1B05A 2I3WA 3K6VA 4BDOA 4AB5A 3Q28A 4UACA 2FNCA 4PFRA 1FBGA 4MIJA 4R6HA 4F22A 3O6GA 3T22A 4EF2A 4ZEKA 4NN3A 3IX1A 1EU8A 3OENA 4R73A 2F97A 3W9WA 1I6AA 5ET7A 2XX7A 2Y84A 5JTYA 2ABHA 2O6AA 4C1UA 1FBFA 2Z8FA 4FEBA 3PTYA 4JBZA 3KSJA 2ZXTA 1QULA 1RDZA 4XFEA 1XC1A 3RY3A 3IB1A 1OIBA 3FVGA 3K6UA 3H6TA 3SETA 4K3FA 2ONKE 4P1EA 4R2FA 3ISPA 5EQAA 2I58A 1ATGA 4N8GA 3OOAA 1B1HA 2B4LA 1R1NA 1J1NA 4GFRA 4FATA 4NG7A 1JETA 3K1MA 3O97A 1NH8A 3FVNA 4HCWA 1P1NA 4G77A 3OELA 4AS5A 3HFUA 3KG2A 4H5GA 3VXBA 5DEXA 2O1MA 3O9PA 3C32A 2WYPA 2XXWA 2F8DA 3V8XB 3MW0A 4FIMA 4R6YA 1MXXA 4JXIA 4F1UA 4QFLA 4GX6A 1IEJA 3FASA 4H5FA 4MNIA 2ONSA 4RYAA 1MPBA 2Y7PA 3TZAA 5CRYA 2PX1A 2D5WA 2HXRA 3LSWA 3CFXA 5DYHA 2MKZA 1ZMGA 2R6GE 4TOZA 1JQFA 1LBXA 4DZ1A 1MDQA 2B65A 1VSOA 3CSBA 1RYXA 3Q26A 3CRBA 3WAFA 1FQBA 3FBPA 4THIA 3VVEA 3RN8A 1IXIA 1VFEA 2ZNTA 1LBBA 4PGNA 3DP8A 3MQ9A 3QXMA 2QL3A 1S50A 3PGFA 2F3DA 1SW1A 4M4GA 2DXRA 3OO6A 4LUBA 4O7IA 5LTCA 4MLQA 1LGBC 1OLAA 2XX9A 4HE2A 4U21A 1IMDA 2H99A 3KOSA 4C0RA 5H8HB 3TCHA 1GGGA 4DLDA 1LBVA 3E79A 2G29A 1GTKA 1B0HA 3KOTA 1B2HA 1NV1A 3CI8A 3LBSA 5ISUA 3M3LA 4LA9A 4MJOA 4PGPA 1D9YA 3LUZA 2W7YA 3O2AA 3D1RA 3C9HA 3RYDA 3RPLA 5BWJA 1SDXA 3TTMA 1LAGE 1QUJA 1DPPA 4X1BA 4F39A 2ZZXA 4F3GA 2ALUA 3M8UA 5FHMA 4PAFA 1M5BA 1US5A 1EYIA 5EYFA 2NVUB 3SZPA 3K1PA 1S9TA 5CC2A 2XXPA 1NMUA 4GWYA 4NF6B 3MJNA 1SD3A 4QFOA 3R6UA 2ESNA 1HSJA 3IK6B 3K1NA 1POTA 2XXXA 3F11A 1MG1A 1IMCA 1NNPA 4NF8B 4BDRA 4IB2A 4TLMB 2F34A 1SW5A 1Y4TA 3RLFE 3KC0A 5I56B 1LSTA 3UGWA 2HQ0A 3PUWE 4OFLA 5CM6A 5ET6A 3RT8A 4OA4A 3EHSA 5H8QA 3FXUA 1MPDA 1B3GA 1TFDA 2F36A 4OXVA 3L6HA 2FIXA 2F6GA 3H3GA 2FYIA 2H98A 1H3DA 3OEKA 4FAJA 3KC1A 1JW1A 2OJTA 2XA5A 3D4CA 4H6DA 3IORA 1G0IA 1NV4A 1SQYA 4IO4A 5TP9A 4P8BA 4ZZAA 3T96B 3FXBA 2I6EA 4OANA 3TQLA 2XXQA 1NKXA 3Q25A 1Z7ME 2F78A 5DVJA 3MZBA 4Z7EA 4KYDA 4HXVA 3FUZA 4E0WA 3H6VA 4I9DA 2YLNA 1DBZA 4ZEDA 5IKBA 3C35A 3SEWA 3I6VA 3PU5A 2DSFA 1FTLA 2P3NA 1EZPA 4MAGA 3GZGA 2QVVA 3SEVA 1B51A 2GHBA 3K4UA 3VLVA 1B4HA 1B6HA 2ZYKA 5L9MA 2O51A 4XF5A 1URGA 3THIA 1SVXB 1UTBB 4MNPA 1A40A 3IOWA 2PT1A 2OWZA 4UA8A 5TPAA 2WEFA 1A55A 2F7CA 2XD2A 1D9VA 3ODBA 4IO2A 2BJJX 4N8YA 3SKPA 4KQPA 5KCJA 2H5YA 1FQCA 1IMBA 2GHAA 1FQDA 2QJEA 2WX9A 1NV0A 5TU0A 4BDQA 4NF8A 3G3GA 3IOVA 2DWHA 3L6GA 3S9LC 1Y20A 3DLNA 1FPBA 1LFHA 3PPNA 3CR9A 5IZ1A 4QFNA 2V3TA 1QJMA 4EXKA 3TEPA 4NHBA 1XI6A 3PD9A 3BIHA 1Q35A 2WKYA 3OO9A 1IITA 3MYUA 2DOJA 1B58A 2DYXA 3FIRA 4ZEFA 3MPKA 3MSTA 2XWKA 3K6WA 1POY1 4DDDA 4M1VA 2I48A 1BLFA 1FTAA 1OQGA 1Y9UA 4I62A 1P1OA 2DWIA 3FXRA 2UYEA 1Y1ZA 3HCQA 3PPRA 4BDNA 4X48A 3A3UA 1FBCA 4KYSA 3HV1A 2ZNSA 4ESXA 1SBPA 3FVKA 1B4ZA 3GBBA 5EQ8A 4ESWA 2Y5LA 3ZKKA 2NXOA 1AMFA 4X9TA 1BP5A 1OQHA 3PMWA 3QUFA 4ONYA 1GR2A 2XXUA 3TMGA 1QGXA 3SESA 1MQIA 1UTHA 1NNFA 4IY5A 3HSTA 1CNQA 3KJTA 5DVIA 1KA0A 1ELJA 4NTLA 1HSEA 3S9NC 1G0HA 2HZLA 2O69A 3KZGA 1M5EA 4NMYA 3T93B 3U93A 3IAZA 1NV5A 3VXCA 1NI9A 1O7TA 3RPWA 1B7UA 3FD3A 1I6BA 3KN3A 2OBGA 4FEDA 3CIJA 4IO3A 3T66A 1AWBA 3A29A 4QHQA 2FVZA 2RKMA 3A3CA 4YB6A 4GWWA 1NV2A 4OEVA 4MF3A 4ND9A 4ELPA 1WVJA 4PQJA 5I2KA 1FBEA 3VFJA 4HE0A 3EF7A 2VD3A 3IOUA 4LONB 5I3SA 4YB5A 1BK4A 2DXYA 2DS9A 3C31A 4F3BA 4GX3A 3E4RA 1FPDA 1B9JA 3NOHA 3B50A 2QS3A 1K9ZA 3UIFA 4N81A 4P11A 2DE2A 2XXVA 4OHNA 1MH4A 4NX1A 4PE5B 5K2XA 1JVYA 4EXLA 3ZS6A 4Q5TA 3U72A 3U92A 4P47A 3H06B 1SW2A 4OERA 4WEDA 3RUMA 4F29A 1FW0A 1MY3A 5JEIA 3B6TA 4PTKA 4LN5A 1D9QA 4H0WA 4HE1A 1OVBA 1PDAA 2HPGA 4O7MA 4X8RA 1ZIUA 2UXAA 3T9VA 1FTOA 3H4ZA 3R26A 5A5XB 4RK2A 3MC2A 3KBZA 5F24A 1IUDA 4U4XA 4EQ7A 1TT1A 2YJPA 4LQ5A 3T9HB 3LUYA 3SEYA 2GFEA 1FPLA 1DCUA 1YXIA 1NV3A 4ZDMA 2X7QA 1CB6A 4O3AA 1LAXA 5F7VA 3FJMA 1B52A 4GXSB 4U1OA 1MH3A 4PDDA 3GLBA 5I59A 1B7ZA 1FCKA 4Q0CA 1YCJA 1WDNA 4JVIA 2P3VA 1N04A 2V3QA 1OMPA 3G3HA 1RYOA 4G68B 2O68A 2F7AA 3ILUB 2X26A 5AA2A 3M3FA 1MQDA 5J16A 1T0KA 3N6TA 4EQ9A 3MVYA 1VE4A 3C33A 2UVGA 2Z8EA 1VDWA 1MY0A 4F2OA 3OXNA 5ITPA 1NUWA 4ZE8A 3KN7A 2Q8JA 5I57A 3IO6A 2JJKA 1IXGA 2HZKA 4PFBA 2HCAA 4KR5A 4YKKA 2HAUA 2KQZA 5IZ3B 4PBQA 2QVUA 3PMVA 1RDXA 4NAPA 1MM6A 3PV0E 3KEIA 3CHGA 4ELRA 4RK9A 4TQUQ 4YKIA 3N94A 3UA8A 1A8EA 1MRPA 2X7PA 4F3SA 3K01A 1S7YA 2Z22A 3TTLA 3ZKLA 1II5A 4RY1A 2VP1A 1H44A 4HCYA 1FTJA 1FBHA 4ZECA 4OVPA 2Z8DA 4X04A 4DXCA 3FATA 4QSCA 3MVZA 4NEDA 3IJXB 5H8FB 4GVOA 3B6WA 1IIWA 4R9FA 3PPQA 1DTZA 5L9OA 1JEVA 1MXZA 3IB2A 4QFKA 4G68C 4OVJA 4PFUA 1MS7A 2V4CA 3VLWA 3HO7A 2QFLA 5HPQA 4H1XA 1FBPA 5EHSA 4QSDA 5EQ9A 4R9GA 1MXWA 3KBRA 4KXPA 1UQWA 3TTNA 3CVGA 4NF5B 1NH7A 4NWCA 2QMXA 3ECRA 1GV8A 2VPNA 1CE2A 1B32A 4UABA 3TAJA 4MX6A 4HW8A 4XKNA 1NNTA 4C1TA 2XX8A 3IR1A 2A5SA 1LBWA 1USYE 2Y7WA 4HS7A 5FTIA 2V84A 2Q9TA 3MZ9A 2XXTA 2O7IA 2XXHA 3OEMA 1FTKA 2F3BA 2FBPA 1EYKA 3GYYA 4N6KA 5FBPA 1R6ZA 2I0CA 3KFMA 3OMBA 1KA1A 2QPQA 1FPGA 2O84X 4OFOA 3QMFA 4PFIA 2I3VA 2DQVA 1I6QA 3CG3A 4EQBA 1ANFA 1Q1KA 5H8HA 3C4MA 1B3HA 4PFWA
chains in the Genus database with same CATH topology
3MP8A 5I2NB 3TCFA 2H9BA 4OEUA 4XTCQ 1AOVA 3WAEA 5AA1A 3LC8A 2R9JA 3TODA 3SEUA 3PPPA 4YZZA 3HN0A 1Z7NE 3TCGA 4GQOA 2Q89A 1XS5A 3EQ1A 3LR1A 4DCXA 3O6HA 2RCAA 5H8FA 4RA1A 4G8HA 2RC9A 3ONMA 4WEPA 1XHYA 1Y3QA 5AA2D 2XXIA 1MXUA 1EZ9A 5FHNA 1A8FA 4NF6A 4F18A 3MBPA 2CMOA 1DSNA 3H6UA 2FA7A 5CMBA 2HFBA 3MP1A 5CMCA 1B3FA 3QIMA 2DVCA 5I58B 4HTGA 1DPEA 2A5TB 4LP2B 5I56A 4JWOA 2UVJA 3UK4A 4OENA 2QS2A 4R72A 2QS4A 3VLUA 1N3WA 5CI5A 2CZLA 1B3LA 2ZYMA 1LAHE 3JYRA 1PBPA 5AE4A 2VD2A 3PMXA 4U1ZA 2I0BA 3HHGA 3FJ7A 4R75A 4N07A 3FXQA 5AA4B 3K02A 1MQHA 3FV1A 3QUJA 3DM0A 4IGRA 1XVYA 1MQJA 4KCDA 4P0GA 3UORA 2UVIA 1NL5A 1ZBMA 4F1VA 3EN3A 4JDFA 3N26A 2AL5A 3KJ7A 4POXA 2QMWA 4PFYA 4KCCA 1OLCA 3O29A 3U8QA 3VV5A 3IB0A 2LAOA 2Q2CA 1FQFA 5JTYB 4OZ9A 4ZEBA 4IGTA 5H8NB 2ZYNA 5KDTB 3UN6A 3FJGA 2Y7RA 5ICTA 4AQ4A 1LCFA 1UTBA 3FV2A 4GD5A 4H8IA 5IAIA 1ZU0A 5KZTA 1DMBA 4GLIA 2VOZA 4RPNA 3EHUA 2E1SA 1O64A 4H67A 3S9MC 1LFGA 4FECA 4F2QA 1SI0A 2XHDA 1SYHA 1N7XA 4P0IA 5DEXB 4NE4A 4ECFA 3IJOB 2ANJA 3VDFA 5ITOA 2VGQA 3A09A 4U23A 2HEUA 3N6UA 4OWDA 4DCYA 1P99A 3QSLA 3SERA 1B5HA 1PEBA 4F1YA 1H76A 1A54A 4LZ7A 3TELA 3TYHA 2H4IA 3LSFB 4MBPA 1MXYA 2AIXA 4LZ5A 4GL0A 1AIVA 2RF1A 2D21A 3S2VA 4EDPA 3M3KA 2V3UA 2DE3A 4I1DA 4R2BA 4EF1A 3SEXA 3H6WA 4QF9A 2I49A 5M2VA 4KPTA 2OZZA 4H65A 2RCBA 3IOTA 1MM7A 3RT6B 3TQWA 1DTGA 3KGCA 3P7IA 1PC3A 4F31B 5B7DA 5HM4B 3RTFB 1XOCA 2UVHA 4OTEA 3DELB 2REJA 2XD3A 2AL4A 5H8NA 5KDTA 3H03A 4GRKA 3BFTA 1PB7A 3IL1B 4LATA 3T9UA 4IO5A 3B6QA 1P1QA 3Q29A 1QVSA 4U2RA 4OMBA 3U1OA 3GBAA 1URSA 1OVTA 2OWTA 2DVZA 3O28A 1LAFE 3PUVE 4IO6A 1Y3PA 3BBRA 4OETA 4GXAA 1USYH 1M5CA 2O1LA 3PD8A 4JWYA 3W9VA 2P2AA 2ZYOA 4IY6A 4N6PA 3CG1A 2REGA 4LZ8A 1JEUA 4QRZA 4F3PA 4YKJA 2OCUA 1N3XA 4YAHX 3LSXA 5ELVA 3RNNA 3HHFA 4PFTA 4BLAA 1XVXA 3PUYE 1QUIA 1N7WA 3USDA 3TDJA 3ZSFA 2ONRA 4WKMA 4XKQA 4Q8RA 4BDMA 1MY1A 4YU0A 1FTMA 1A7LA 2G93A 2RINA 3HPIA 5H8QB 4FORA 5ICQA 4QFPA 5EHMA 1B46A 3T9XB 1B0LA 5CBRA 2B3FA 1MY2A 3FZVA 4GF8A 3JZJA 1URDA 3SDFA 4G8NA 3PPOA 2B3BA 2DWAA 5JK4A 2E0SA 5TP9B 3MP6A 1LFIA 1M5DA 3AXFA 1UIUA 1TFAA 3S4UA 4OYVA 5A5XA 3E9XA 4RPOA 4L17A 4RJZA 2GRVA 2PVUA 1ZTYA 5DTBA 3CFZA 5FHOA 2HXWA 3BFUA 4XIGQ 3MUQA 2F35A 2RC7A 1FQEA 4YICA 4DE8A 2XXRA 3QYTA 2R71A 5HBCA 5DVFA 3UP9A 4OFJA 1QW0A 2QRYA 1B40A 2Y7KA 4U4SA 4G68A 3EPEA 3MWBA 3G7WA 1JVXA 2UYFA 4Z0IA 1F9BA 4KD5A 3DP6A 5TPAB 4O3CA 4G2ZA 2OK2A 1US4A 1JNFA 1Y1MA 3PUXE 5FTHA 4OQOA 1BIYA 1FQAA 1YTVA 4ZS9A 5KCJB 4GL8A 5CMKA 3TFLA 3C36A 1MXVA 1PBQA 4MFIA 5F1QA 2GH9A 3OO7A 3OO8A 1MY4A 4X1DA 5AA3A 1ZKBA 1R9LA 3V89B 3GXAA 4RXLA 5H8SA 1MDP1 1B7HA 1SYIA 2YPNA 3OSRA 2I4CA 4FE8A 4XKPA 2V93A 1ZLQA 4IO7A 3JV9A 3U94A 4TLLB 2AYSA 2OWSA 4EUOA 3EHTA 3S9EA 1LB8A 3G3JA 2H25A 3TTRA 5CMMA 5J1DA 5LOMA 1MQGA 4MLVA 3TTKA 1VR5A 3I3VA 2XXYA 5I84A 3G3KA 1AH5A 3KSXA 2M8CA 3IO4A 3R7XA 2HAVA 1BKAA 2F6PA 1B1XA 1SW4A 4MH5A 3KN8A 2RC8A 1D3KA 4GOTA 3N5LA 4AB6A 4JWXA 4LQ2A 4WXJA 4N13A 1D4NA 1UTHB 4JSOA 4DXUA 5L8DA 3FVOA 4GIZA 3G3IA 2Y7IA 1QKAA 4NF5A 1YAEA 2P0SA 1O63A 2DWJA 2PT2A 3K6XA 4PP0A 3G3FA 3FGSA 1XT8A 5L9SA 4PETA 2D3IA 2P1SA 2PMSA 1DOTA 1IZ1A 3DP4A 1NFTA 4JSDA 4NWDA 2QS1A 3B7DA 1N0TA 1IQ7A 2OLBA 2ZMBA 3QK6A 3TUSA 3QAXA 4I8CA 2Q88A 4RNSA 2F5XA 3O6IA 2KLFA 4ELOA 4QSEA 3VE1B 4NF4B 3PUZE 4YB7A 1EH3A 1M5FA 3E13X 5I2KB 2NWJA 3CFLA 3V5AA 4XXUA 4ZZEA 1N84A 1A99A 4F19A 2IEEA 1SI1A 3LSLA 5B70A 1LB9A 5I2NA 3V83A 1AL3A 2DP8A 4ZEIA 3O66A 2Z23A 4DXBA 1QKBA 1NNKA 5BUUA 2NOOA 4YKPA 1ZJLA 2VHAA 2Q2AA 1TWYA 3VVDA 1PB9A 1I69A 1JW5A 4G8MA 3TKDA 2THIA 1LBCA 4GWOA 5DT6A 3OSQA 3MAMA 4OESA 1B5JA 4XKRA 1BTJA 1YPNA 3BKIB 1P1UA 1RKMA 3OD7A 1IXCA 1P1WA 3MVWA 3Q27A 5CBSA 4KYEA 1VFDA 2IA4A 1H43A 1N76A 2O7UA 4KHZE 3MZ1A 4H8JA 3K0VA 1HSLA 5I58A 1LCTA 1TXFA 4ZE9A 2A5TA 5I59B 4POWA 1Y4CA 4JB7A 1L5TA 1Y3NA 2V25A 4ELQA 1EZOA 4KI0E 2NUVA 4O3BA 4YMAA 2QSXA 4R74A 2I4BA 3MPLA 1KWHA 3H7MA 3RTWB 3E3KA 5K2YA 1IXHA 1PB8A 4G4PA 3W15C 2ZNUA 4BDLA 3CSGA 5AA2B 4E0XA 2F7BA 4ISUA 3ILTB 3VVFA 1B5IA 3D4GA 4YMBA 1WODA 4DIGA 1MPCA 3I5OA 4NF4A 4U22A 3RGYA 4FJPA 5AA4A 3RQTA 1H45A 1GVCA 2PBWA 4Q30B 3C34A 1LLSA 3K2DA 3TPAA 1B3EA 2DE4A 5I57B 2PYYA 3MVXA 4R6KA 4LVQA 1UIVA 1R9QA 4KFQA 1JW4A 1QUKA 3K00A 1B05A 2I3WA 3K6VA 4BDOA 4AB5A 3Q28A 4UACA 2FNCA 4R6HA 4F22A 3O6GA 3T22A 4EF2A 4ZEKA 3IX1A 1EU8A 3OENA 4R73A 2F97A 3W9WA 1I6AA 2XX7A 2Y84A 5JTYA 2ABHA 2O6AA 4C1UA 4FEBA 2Z8FA 4JBZA 3KSJA 2ZXTA 1QULA 1XC1A 3RY3A 3IB1A 1OIBA 3FVGA 3K6UA 3H6TA 3SETA 4K3FA 2ONKE 4R2FA 2I58A 1ATGA 3OOAA 1B1HA 1R1NA 1J1NA 4GFRA 4FATA 1JETA 3K1MA 3O97A 1NH8A 3FVNA 4HCWA 1P1NA 4G77A 3OELA 3KG2A 4H5GA 3VXBA 5DEXA 2O1MA 3O9PA 3C32A 2XXWA 2F8DA 3V8XB 3MW0A 4FIMA 4R6YA 1MXXA 4JXIA 4F1UA 4QFLA 4H5FA 1IEJA 3FASA 2ONSA 4RYAA 1MPBA 2Y7PA 3TZAA 5CRYA 2PX1A 2D5WA 3LSWA 3CFXA 5DYHA 1ZMGA 2R6GE 4TOZA 1JQFA 4DZ1A 1MDQA 2B65A 1VSOA 3CSBA 1RYXA 3Q26A 3CRBA 3WAFA 1FQBA 3VVEA 4THIA 3RN8A 1IXIA 1VFEA 2ZNTA 1LBBA 3DP8A 3MQ9A 3QXMA 2QL3A 1S50A 3PGFA 1SW1A 4M4GA 2DXRA 3OO6A 4LUBA 4MLQA 1LGBC 1OLAA 2XX9A 4U21A 2H99A 3KOSA 4C0RA 5H8HB 3TCHA 1GGGA 4DLDA 2G29A 1GTKA 1B0HA 3KOTA 1B2HA 3CI8A 3LBSA 5ISUA 3M3LA 4LA9A 1D9YA 2W7YA 3O2AA 3C9HA 5BWJA 1SDXA 3TTMA 1LAGE 1QUJA 1DPPA 4X1BA 4F39A 4F3GA 2ALUA 3M8UA 5FHMA 1M5BA 1US5A 5EYFA 2NVUB 3K1PA 1S9TA 5CC2A 2XXPA 1NMUA 4NF6B 3MJNA 1SD3A 4QFOA 3R6UA 2ESNA 1HSJA 3IK6B 3K1NA 1POTA 2XXXA 3F11A 1MG1A 1NNPA 4NF8B 4BDRA 4IB2A 4TLMB 2F34A 1SW5A 1Y4TA 3RLFE 5I56B 1LSTA 3UGWA 2HQ0A 3PUWE 4OFLA 5CM6A 3RT8A 3EHSA 5H8QA 3FXUA 1MPDA 1B3GA 1TFDA 2F36A 4OXVA 3L6HA 2F6GA 3H3GA 2FYIA 2H98A 1H3DA 3OEKA 4FAJA 1JW1A 2OJTA 3D4CA 4H6DA 3IORA 1SQYA 4IO4A 5TP9A 4ZZAA 3T96B 2I6EA 3TQLA 2XXQA 1NKXA 3Q25A 1Z7ME 2F78A 5DVJA 3MZBA 4Z7EA 4KYDA 3FUZA 4E0WA 3H6VA 4I9DA 2YLNA 4ZEDA 5IKBA 3C35A 3SEWA 3I6VA 3PU5A 2DSFA 1FTLA 1EZPA 3GZGA 3SEVA 1B51A 2GHBA 3K4UA 3VLVA 1B4HA 1B6HA 2ZYKA 5L9MA 2O51A 1URGA 3THIA 1SVXB 1UTBB 1A40A 3IOWA 2PT1A 4UA8A 5TPAA 1A55A 2F7CA 2XD2A 1D9VA 3ODBA 4IO2A 2BJJX 3SKPA 4KQPA 5KCJA 2H5YA 1FQCA 2GHAA 1FQDA 2QJEA 5TU0A 4BDQA 4NF8A 3G3GA 3IOVA 2DWHA 3L6GA 3S9LC 1Y20A 3DLNA 1LFHA 3PPNA 3CR9A 4QFNA 2V3TA 1QJMA 4EXKA 3TEPA 3PD9A 1Q35A 2WKYA 3OO9A 1IITA 2DOJA 1B58A 2DYXA 3FIRA 4ZEFA 3MPKA 3K6WA 1POY1 4DDDA 4M1VA 2I48A 1BLFA 1OQGA 1Y9UA 4I62A 1P1OA 2DWIA 3FXRA 2UYEA 1Y1ZA 3HCQA 3PPRA 4BDNA 4X48A 3A3UA 4KYSA 3HV1A 2ZNSA 4ESXA 1SBPA 3FVKA 1B4ZA 3GBBA 4ESWA 3ZKKA 2NXOA 1AMFA 4X9TA 1BP5A 1OQHA 3PMWA 3QUFA 4ONYA 1GR2A 2XXUA 3TMGA 3SESA 1MQIA 1UTHA 1NNFA 4IY5A 3HSTA 3KJTA 5DVIA 1ELJA 4NTLA 1HSEA 3S9NC 2HZLA 2O69A 3KZGA 1M5EA 4NMYA 3T93B 3U93A 3IAZA 3VXCA 1O7TA 3RPWA 1B7UA 3FD3A 1I6BA 3KN3A 2OBGA 4FEDA 3CIJA 4IO3A 3T66A 4QHQA 2RKMA 3A3CA 4YB6A 4OEVA 4MF3A 4ND9A 4ELPA 1WVJA 4PQJA 5I2KA 3VFJA 3EF7A 2VD3A 3IOUA 4LONB 4YB5A 2DXYA 2DS9A 3C31A 4F3BA 3E4RA 1B9JA 2QS3A 3UIFA 4P11A 2DE2A 2XXVA 4OHNA 1MH4A 4PE5B 5K2XA 1JVYA 4EXLA 3ZS6A 4Q5TA 3U72A 3U92A 3H06B 1SW2A 4OERA 4WEDA 3RUMA 4F29A 1FW0A 1MY3A 5JEIA 3B6TA 4H0WA 1OVBA 1PDAA 1ZIUA 2UXAA 3T9VA 1FTOA 3H4ZA 3R26A 5A5XB 4RK2A 3MC2A 1IUDA 4U4XA 4EQ7A 1TT1A 2YJPA 4LQ5A 3T9HB 3LUYA 3SEYA 2GFEA 4ZDMA 2X7QA 1CB6A 4O3AA 1LAXA 5F7VA 3FJMA 1B52A 4GXSB 4U1OA 1MH3A 3GLBA 5I59A 1B7ZA 1FCKA 4Q0CA 1YCJA 1WDNA 1N04A 2V3QA 1OMPA 3G3HA 1RYOA 4G68B 2O68A 2F7AA 3ILUB 2X26A 5AA2A 3M3FA 1MQDA 1T0KA 3N6TA 4EQ9A 3MVYA 1VE4A 3C33A 2UVGA 2Z8EA 1MY0A 4F2OA 3OXNA 5ITPA 4ZE8A 3KN7A 2Q8JA 5I57A 3IO6A 1IXGA 2HZKA 2HCAA 4KR5A 4YKKA 2HAUA 3PMVA 1MM6A 3PV0E 3KEIA 4ELRA 4RK9A 4TQUQ 4YKIA 3N94A 3UA8A 1A8EA 1MRPA 2X7PA 4F3SA 3K01A 1S7YA 2Z22A 3ZKLA 3TTLA 1II5A 4RY1A 2VP1A 1H44A 4HCYA 1FTJA 4ZECA 2Z8DA 4DXCA 3FATA 4QSCA 3MVZA 4NEDA 3IJXB 5H8FB 4GVOA 3B6WA 1IIWA 4R9FA 3PPQA 1DTZA 5L9OA 1JEVA 1MXZA 3IB2A 4QFKA 4G68C 4OVJA 4PFUA 1MS7A 3VLWA 5HPQA 3HO7A 4H1XA 5EHSA 4QSDA 4R9GA 1MXWA 3KBRA 1UQWA 3TTNA 3CVGA 4NF5B 1NH7A 4NWCA 2QMXA 3ECRA 1GV8A 1CE2A 1B32A 3TAJA 4HW8A 4XKNA 1NNTA 4C1TA 2XX8A 3IR1A 2A5SA 1USYE 2Y7WA 4HS7A 5FTIA 2V84A 2Q9TA 3MZ9A 2XXTA 2O7IA 2XXHA 3OEMA 1FTKA 1R6ZA 2I0CA 3KFMA 3OMBA 2QPQA 2O84X 4OFOA 2I3VA 2DQVA 1I6QA 3CG3A 4EQBA 1ANFA 1Q1KA 5H8HA 3C4MA 1B3HA 4PFWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MP8 A;  5I2N B;  3TCF A;  2H9B A;  4OEU A;  4XTC Q;  1AOV A;  3WAE A;  5AA1 A;  3LC8 A;  2R9J A;  3TOD A;  3SEU A;  3PPP A;  4YZZ A;  3HN0 A;  1Z7N E;  3TCG A;  4GQO A;  2Q89 A;  1XS5 A;  3EQ1 A;  3LR1 A;  4DCX A;  3O6H A;  2RCA A;  5H8F A;  4RA1 A;  4G8H A;  2RC9 A;  3ONM A;  4WEP A;  1XHY A;  1Y3Q A;  5AA2 D;  2XXI A;  1MXU A;  1EZ9 A;  5FHN A;  1A8F A;  4NF6 A;  4F18 A;  3MBP A;  2CMO A;  1DSN A;  3H6U A;  2FA7 A;  5CMB A;  2HFB A;  3MP1 A;  5CMC A;  1B3F A;  3QIM A;  2DVC A;  5I58 B;  4HTG A;  1DPE A;  2A5T B;  4LP2 B;  5I56 A;  4JWO A;  2UVJ A;  3UK4 A;  4OEN A;  2QS2 A;  4R72 A;  2QS4 A;  3VLU A;  1N3W A;  5CI5 A;  2CZL A;  1B3L A;  2ZYM A;  1LAH E;  3JYR A;  1PBP A;  5AE4 A;  2VD2 A;  3PMX A;  4U1Z A;  2I0B A;  3HHG A;  3FJ7 A;  4R75 A;  4N07 A;  3FXQ A;  5AA4 B;  3K02 A;  1MQH A;  3FV1 A;  3QUJ A;  3DM0 A;  4IGR A;  1XVY A;  1MQJ A;  4KCD A;  4P0G A;  3UOR A;  2UVI A;  1NL5 A;  1ZBM A;  4F1V A;  3EN3 A;  4JDF A;  3N26 A;  2AL5 A;  3KJ7 A;  4POX A;  2QMW A;  4PFY A;  4KCC A;  1OLC A;  3O29 A;  3U8Q A;  3VV5 A;  3IB0 A;  2LAO A;  2Q2C A;  1FQF A;  5JTY B;  4OZ9 A;  4ZEB A;  4IGT A;  5H8N B;  2ZYN A;  5KDT B;  3UN6 A;  3FJG A;  2Y7R A;  5ICT A;  4AQ4 A;  1LCF A;  1UTB A;  3FV2 A;  4GD5 A;  4H8I A;  5IAI A;  1ZU0 A;  5KZT A;  1DMB A;  4GLI A;  2VOZ A;  4RPN A;  3EHU A;  2E1S A;  1O64 A;  4H67 A;  3S9M C;  1LFG A;  4FEC A;  4F2Q A;  1SI0 A;  2XHD A;  1SYH A;  1N7X A;  4P0I A;  5DEX B;  4NE4 A;  4ECF A;  3IJO B;  2ANJ A;  3VDF A;  5ITO A;  2VGQ A;  3A09 A;  4U23 A;  2HEU A;  3N6U A;  4OWD A;  4DCY A;  1P99 A;  3QSL A;  3SER A;  1B5H A;  1PEB A;  4F1Y A;  1H76 A;  1A54 A;  4LZ7 A;  3TEL A;  3TYH A;  2H4I A;  3LSF B;  4MBP A;  1MXY A;  2AIX A;  4LZ5 A;  4GL0 A;  1AIV A;  2RF1 A;  2D21 A;  3S2V A;  4EDP A;  3M3K A;  2V3U A;  2DE3 A;  4I1D A;  4R2B A;  4EF1 A;  3SEX A;  3H6W A;  4QF9 A;  2I49 A;  5M2V A;  4KPT A;  2OZZ A;  4H65 A;  2RCB A;  3IOT A;  1MM7 A;  3RT6 B;  3TQW A;  1DTG A;  3KGC A;  3P7I A;  1PC3 A;  4F31 B;  5B7D A;  5HM4 B;  3RTF B;  1XOC A;  2UVH A;  4OTE A;  3DEL B;  2REJ A;  2XD3 A;  2AL4 A;  5H8N A;  5KDT A;  3H03 A;  4GRK A;  3BFT A;  1PB7 A;  3IL1 B;  4LAT A;  3T9U A;  4IO5 A;  3B6Q A;  1P1Q A;  3Q29 A;  1QVS A;  4U2R A;  4OMB A;  3U1O A;  3GBA A;  1URS A;  1OVT A;  2OWT A;  2DVZ A;  3O28 A;  1LAF E;  3PUV E;  4IO6 A;  1Y3P A;  3BBR A;  4OET A;  4GXA A;  1USY H;  1M5C A;  2O1L A;  3PD8 A;  4JWY A;  3W9V A;  2P2A A;  2ZYO A;  4IY6 A;  4N6P A;  3CG1 A;  2REG A;  4LZ8 A;  1JEU A;  4QRZ A;  4F3P A;  4YKJ A;  2OCU A;  1N3X A;  4YAH X;  3LSX A;  5ELV A;  3RNN A;  3HHF A;  4PFT A;  4BLA A;  1XVX A;  3PUY E;  1QUI A;  1N7W A;  3USD A;  3TDJ A;  3ZSF A;  2ONR A;  4WKM A;  4XKQ A;  4Q8R A;  4BDM A;  1MY1 A;  4YU0 A;  1FTM A;  1A7L A;  2G93 A;  2RIN A;  3HPI A;  5H8Q B;  4FOR A;  5ICQ A;  4QFP A;  5EHM A;  1B46 A;  3T9X B;  1B0L A;  5CBR A;  2B3F A;  1MY2 A;  3FZV A;  4GF8 A;  3JZJ A;  1URD A;  3SDF A;  4G8N A;  3PPO A;  2B3B A;  2DWA A;  5JK4 A;  2E0S A;  5TP9 B;  3MP6 A;  1LFI A;  1M5D A;  3AXF A;  1UIU A;  1TFA A;  3S4U A;  4OYV A;  5A5X A;  3E9X A;  4RPO A;  4L17 A;  4RJZ A;  2GRV A;  2PVU A;  1ZTY A;  5DTB A;  3CFZ A;  5FHO A;  2HXW A;  3BFU A;  4XIG Q;  3MUQ A;  2F35 A;  2RC7 A;  1FQE A;  4YIC A;  4DE8 A;  2XXR A;  3QYT A;  2R71 A;  5HBC A;  5DVF A;  3UP9 A;  4OFJ A;  1QW0 A;  2QRY A;  1B40 A;  2Y7K A;  4U4S A;  4G68 A;  3EPE A;  3MWB A;  3G7W A;  1JVX A;  2UYF A;  4Z0I A;  1F9B A;  4KD5 A;  3DP6 A;  5TPA B;  4O3C A;  4G2Z A;  2OK2 A;  1US4 A;  1JNF A;  1Y1M A;  3PUX E;  5FTH A;  4OQO A;  1BIY A;  1FQA A;  1YTV A;  4ZS9 A;  5KCJ B;  4GL8 A;  5CMK A;  3TFL A;  3C36 A;  1MXV A;  1PBQ A;  4MFI A;  5F1Q A;  2GH9 A;  3OO7 A;  3OO8 A;  1MY4 A;  4X1D A;  5AA3 A;  1ZKB A;  1R9L A;  3V89 B;  3GXA A;  4RXL A;  5H8S A;  1MDP 1;  1B7H A;  1SYI A;  2YPN A;  3OSR A;  2I4C A;  4FE8 A;  4XKP A;  2V93 A;  1ZLQ A;  4IO7 A;  3JV9 A;  3U94 A;  4TLL B;  2AYS A;  2OWS A;  4EUO A;  3EHT A;  3S9E A;  1LB8 A;  3G3J A;  2H25 A;  3TTR A;  5CMM A;  5J1D A;  5LOM A;  1MQG A;  4MLV A;  3TTK A;  1VR5 A;  3I3V A;  2XXY A;  5I84 A;  3G3K A;  1AH5 A;  3KSX A;  2M8C A;  3IO4 A;  3R7X A;  2HAV A;  1BKA A;  2F6P A;  1B1X A;  1SW4 A;  4MH5 A;  3KN8 A;  2RC8 A;  1D3K A;  4GOT A;  3N5L A;  4AB6 A;  4JWX A;  4LQ2 A;  4WXJ A;  4N13 A;  1D4N A;  1UTH B;  4JSO A;  4DXU A;  5L8D A;  3FVO A;  4GIZ A;  3G3I A;  2Y7I A;  1QKA A;  4NF5 A;  1YAE A;  2P0S A;  1O63 A;  2DWJ A;  2PT2 A;  3K6X A;  4PP0 A;  3G3F A;  3FGS A;  1XT8 A;  5L9S A;  4PET A;  2D3I A;  2P1S A;  2PMS A;  1DOT A;  1IZ1 A;  3DP4 A;  1NFT A;  4JSD A;  4NWD A;  2QS1 A;  3B7D A;  1N0T A;  1IQ7 A;  2OLB A;  2ZMB A;  3QK6 A;  3TUS A;  3QAX A;  4I8C A;  2Q88 A;  4RNS A;  2F5X A;  3O6I A;  2KLF A;  4ELO A;  4QSE A;  3VE1 B;  4NF4 B;  3PUZ E;  4YB7 A;  1EH3 A;  1M5F A;  3E13 X;  5I2K B;  2NWJ A;  3CFL A;  3V5A A;  4XXU A;  4ZZE A;  1N84 A;  1A99 A;  4F19 A;  2IEE A;  1SI1 A;  3LSL A;  5B70 A;  1LB9 A;  5I2N A;  3V83 A;  1AL3 A;  2DP8 A;  4ZEI A;  3O66 A;  2Z23 A;  4DXB A;  1QKB A;  1NNK A;  5BUU A;  2NOO A;  4YKP A;  1ZJL A;  2VHA A;  2Q2A A;  1TWY A;  3VVD A;  1PB9 A;  1I69 A;  1JW5 A;  4G8M A;  3TKD A;  2THI A;  1LBC A;  4GWO A;  5DT6 A;  3OSQ A;  3MAM A;  4OES A;  1B5J A;  4XKR A;  1BTJ A;  1YPN A;  3BKI B;  1P1U A;  1RKM A;  3OD7 A;  1IXC A;  1P1W A;  3MVW A;  3Q27 A;  5CBS A;  4KYE A;  1VFD A;  2IA4 A;  1H43 A;  1N76 A;  2O7U A;  4KHZ E;  3MZ1 A;  4H8J A;  3K0V A;  1HSL A;  5I58 A;  1LCT A;  1TXF A;  4ZE9 A;  2A5T A;  5I59 B;  4POW A;  1Y4C A;  4JB7 A;  1L5T A;  1Y3N A;  2V25 A;  4ELQ A;  1EZO A;  4KI0 E;  2NUV A;  4O3B A;  4YMA A;  2QSX A;  4R74 A;  2I4B A;  3MPL A;  1KWH A;  3H7M A;  3RTW B;  3E3K A;  5K2Y A;  1IXH A;  1PB8 A;  4G4P A;  3W15 C;  2ZNU A;  4BDL A;  3CSG A;  5AA2 B;  4E0X A;  2F7B A;  4ISU A;  3ILT B;  3VVF A;  1B5I A;  3D4G A;  4YMB A;  1WOD A;  4DIG A;  1MPC A;  3I5O A;  4NF4 A;  4U22 A;  3RGY A;  4FJP A;  5AA4 A;  3RQT A;  1H45 A;  1GVC A;  2PBW A;  4Q30 B;  3C34 A;  1LLS A;  3K2D A;  3TPA A;  1B3E A;  2DE4 A;  5I57 B;  2PYY A;  3MVX A;  4R6K A;  4LVQ A;  1UIV A;  1R9Q A;  4KFQ A;  1JW4 A;  1QUK A;  3K00 A;  1B05 A;  2I3W A;  3K6V A;  4BDO A;  4AB5 A;  3Q28 A;  4UAC A;  2FNC A;  4R6H A;  4F22 A;  3O6G A;  3T22 A;  4EF2 A;  4ZEK A;  3IX1 A;  1EU8 A;  3OEN A;  4R73 A;  2F97 A;  3W9W A;  1I6A A;  2XX7 A;  2Y84 A;  5JTY A;  2ABH A;  2O6A A;  4C1U A;  4FEB A;  2Z8F A;  4JBZ A;  3KSJ A;  2ZXT A;  1QUL A;  1XC1 A;  3RY3 A;  3IB1 A;  1OIB A;  3FVG A;  3K6U A;  3H6T A;  3SET A;  4K3F A;  2ONK E;  4R2F A;  2I58 A;  1ATG A;  3OOA A;  1B1H A;  1R1N A;  1J1N A;  4GFR A;  4FAT A;  1JET A;  3K1M A;  3O97 A;  1NH8 A;  3FVN A;  4HCW A;  1P1N A;  4G77 A;  3OEL A;  3KG2 A;  4H5G A;  3VXB A;  5DEX A;  2O1M A;  3O9P A;  3C32 A;  2XXW A;  2F8D A;  3V8X B;  3MW0 A;  4FIM A;  4R6Y A;  1MXX A;  4JXI A;  4F1U A;  4QFL A;  4H5F A;  1IEJ A;  3FAS A;  2ONS A;  4RYA A;  1MPB A;  2Y7P A;  3TZA A;  5CRY A;  2PX1 A;  2D5W A;  3LSW A;  3CFX A;  5DYH A;  1ZMG A;  2R6G E;  4TOZ A;  1JQF A;  4DZ1 A;  1MDQ A;  2B65 A;  1VSO A;  3CSB A;  1RYX A;  3Q26 A;  3CRB A;  3WAF A;  1FQB A;  3VVE A;  4THI A;  3RN8 A;  1IXI A;  1VFE A;  2ZNT A;  1LBB A;  3DP8 A;  3MQ9 A;  3QXM A;  2QL3 A;  1S50 A;  3PGF A;  1SW1 A;  4M4G A;  2DXR A;  3OO6 A;  4LUB A;  4MLQ A;  1LGB C;  1OLA A;  2XX9 A;  4U21 A;  2H99 A;  3KOS A;  4C0R A;  5H8H B;  3TCH A;  1GGG A;  4DLD A;  2G29 A;  1GTK A;  1B0H A;  3KOT A;  1B2H A;  3CI8 A;  3LBS A;  5ISU A;  3M3L A;  4LA9 A;  1D9Y A;  2W7Y A;  3O2A A;  3C9H A;  5BWJ A;  1SDX A;  3TTM A;  1LAG E;  1QUJ A;  1DPP A;  4X1B A;  4F39 A;  4F3G A;  2ALU A;  3M8U A;  5FHM A;  1M5B A;  1US5 A;  5EYF A;  2NVU B;  3K1P A;  1S9T A;  5CC2 A;  2XXP A;  1NMU A;  4NF6 B;  3MJN A;  1SD3 A;  4QFO A;  3R6U A;  2ESN A;  1HSJ A;  3IK6 B;  3K1N A;  1POT A;  2XXX A;  3F11 A;  1MG1 A;  1NNP A;  4NF8 B;  4BDR A;  4IB2 A;  4TLM B;  2F34 A;  1SW5 A;  1Y4T A;  3RLF E;  5I56 B;  1LST A;  3UGW A;  2HQ0 A;  3PUW E;  4OFL A;  5CM6 A;  3RT8 A;  3EHS A;  5H8Q A;  3FXU A;  1MPD A;  1B3G A;  1TFD A;  2F36 A;  4OXV A;  3L6H A;  2F6G A;  3H3G A;  2FYI A;  2H98 A;  1H3D A;  3OEK A;  4FAJ A;  1JW1 A;  2OJT A;  3D4C A;  4H6D A;  3IOR A;  1SQY A;  4IO4 A;  5TP9 A;  4ZZA A;  3T96 B;  2I6E A;  3TQL A;  2XXQ A;  1NKX A;  3Q25 A;  1Z7M E;  2F78 A;  5DVJ A;  3MZB A;  4Z7E A;  4KYD A;  3FUZ A;  4E0W A;  3H6V A;  4I9D A;  2YLN A;  4ZED A;  5IKB A;  3C35 A;  3SEW A;  3I6V A;  3PU5 A;  2DSF A;  1FTL A;  1EZP A;  3GZG A;  3SEV A;  1B51 A;  2GHB A;  3K4U A;  3VLV A;  1B4H A;  1B6H A;  2ZYK A;  5L9M A;  2O51 A;  1URG A;  3THI A;  1SVX B;  1UTB B;  1A40 A;  3IOW A;  2PT1 A;  4UA8 A;  5TPA A;  1A55 A;  2F7C A;  2XD2 A;  1D9V A;  3ODB A;  4IO2 A;  2BJJ X;  3SKP A;  4KQP A;  5KCJ A;  2H5Y A;  1FQC A;  2GHA A;  1FQD A;  2QJE A;  5TU0 A;  4BDQ A;  4NF8 A;  3G3G A;  3IOV A;  2DWH A;  3L6G A;  3S9L C;  1Y20 A;  3DLN A;  1LFH A;  3PPN A;  3CR9 A;  4QFN A;  2V3T A;  1QJM A;  4EXK A;  3TEP A;  3PD9 A;  1Q35 A;  2WKY A;  3OO9 A;  1IIT A;  2DOJ A;  1B58 A;  2DYX A;  3FIR A;  4ZEF A;  3MPK A;  3K6W A;  1POY 1;  4DDD A;  4M1V A;  2I48 A;  1BLF A;  1OQG A;  1Y9U A;  4I62 A;  1P1O A;  2DWI A;  3FXR A;  2UYE A;  1Y1Z A;  3HCQ A;  3PPR A;  4BDN A;  4X48 A;  3A3U A;  4KYS A;  3HV1 A;  2ZNS A;  4ESX A;  1SBP A;  3FVK A;  1B4Z A;  3GBB A;  4ESW A;  3ZKK A;  2NXO A;  1AMF A;  4X9T A;  1BP5 A;  1OQH A;  3PMW A;  3QUF A;  4ONY A;  1GR2 A;  2XXU A;  3TMG A;  3SES A;  1MQI A;  1UTH A;  1NNF A;  4IY5 A;  3HST A;  3KJT A;  5DVI A;  1ELJ A;  4NTL A;  1HSE A;  3S9N C;  2HZL A;  2O69 A;  3KZG A;  1M5E A;  4NMY A;  3T93 B;  3U93 A;  3IAZ A;  3VXC A;  1O7T A;  3RPW A;  1B7U A;  3FD3 A;  1I6B A;  3KN3 A;  2OBG A;  4FED A;  3CIJ A;  4IO3 A;  3T66 A;  4QHQ A;  2RKM A;  3A3C A;  4YB6 A;  4OEV A;  4MF3 A;  4ND9 A;  4ELP A;  1WVJ A;  4PQJ A;  5I2K A;  3VFJ A;  3EF7 A;  2VD3 A;  3IOU A;  4LON B;  4YB5 A;  2DXY A;  2DS9 A;  3C31 A;  4F3B A;  3E4R A;  1B9J A;  2QS3 A;  3UIF A;  4P11 A;  2DE2 A;  2XXV A;  4OHN A;  1MH4 A;  4PE5 B;  5K2X A;  1JVY A;  4EXL A;  3ZS6 A;  4Q5T A;  3U72 A;  3U92 A;  3H06 B;  1SW2 A;  4OER A;  4WED A;  3RUM A;  4F29 A;  1FW0 A;  1MY3 A;  5JEI A;  3B6T A;  4H0W A;  1OVB A;  1PDA A;  1ZIU A;  2UXA A;  3T9V A;  1FTO A;  3H4Z A;  3R26 A;  5A5X B;  4RK2 A;  3MC2 A;  1IUD A;  4U4X A;  4EQ7 A;  1TT1 A;  2YJP A;  4LQ5 A;  3T9H B;  3LUY A;  3SEY A;  2GFE A;  4ZDM A;  2X7Q A;  1CB6 A;  4O3A A;  1LAX A;  5F7V A;  3FJM A;  1B52 A;  4GXS B;  4U1O A;  1MH3 A;  3GLB A;  5I59 A;  1B7Z A;  1FCK A;  4Q0C A;  1YCJ A;  1WDN A;  1N04 A;  2V3Q A;  1OMP A;  3G3H A;  1RYO A;  4G68 B;  2O68 A;  2F7A A;  3ILU B;  2X26 A;  5AA2 A;  3M3F A;  1MQD A;  1T0K A;  3N6T A;  4EQ9 A;  3MVY A;  1VE4 A;  3C33 A;  2UVG A;  2Z8E A;  1MY0 A;  4F2O A;  3OXN A;  5ITP A;  4ZE8 A;  3KN7 A;  2Q8J A;  5I57 A;  3IO6 A;  1IXG A;  2HZK A;  2HCA A;  4KR5 A;  4YKK A;  2HAU A;  3PMV A;  1MM6 A;  3PV0 E;  3KEI A;  4ELR A;  4RK9 A;  4TQU Q;  4YKI A;  3N94 A;  3UA8 A;  1A8E A;  1MRP A;  2X7P A;  4F3S A;  3K01 A;  1S7Y A;  2Z22 A;  3ZKL A;  3TTL A;  1II5 A;  4RY1 A;  2VP1 A;  1H44 A;  4HCY A;  1FTJ A;  4ZEC A;  2Z8D A;  4DXC A;  3FAT A;  4QSC A;  3MVZ A;  4NED A;  3IJX B;  5H8F B;  4GVO A;  3B6W A;  1IIW A;  4R9F A;  3PPQ A;  1DTZ A;  5L9O A;  1JEV A;  1MXZ A;  3IB2 A;  4QFK A;  4G68 C;  4OVJ A;  4PFU A;  1MS7 A;  3VLW A;  5HPQ A;  3HO7 A;  4H1X A;  5EHS A;  4QSD A;  4R9G A;  1MXW A;  3KBR A;  1UQW A;  3TTN A;  3CVG A;  4NF5 B;  1NH7 A;  4NWC A;  2QMX A;  3ECR A;  1GV8 A;  1CE2 A;  1B32 A;  3TAJ A;  4HW8 A;  4XKN A;  1NNT A;  4C1T A;  2XX8 A;  3IR1 A;  2A5S A;  1USY E;  2Y7W A;  4HS7 A;  5FTI A;  2V84 A;  2Q9T A;  3MZ9 A;  2XXT A;  2O7I A;  2XXH A;  3OEM A;  1FTK A;  1R6Z A;  2I0C A;  3KFM A;  3OMB A;  2QPQ A;  2O84 X;  4OFO A;  2I3V A;  2DQV A;  1I6Q A;  3CG3 A;  4EQB A;  1ANF A;  1Q1K A;  5H8H A;  3C4M A;  1B3H A;  4PFW A; 
#chains in the Genus database with same CATH topology
 3MP8 A;  5I2N B;  3TCF A;  4N17 A;  5IGA A;  2H9B A;  4OEU A;  1FBD A;  4XTC Q;  1AOV A;  3WAE A;  2WYK A;  1IME A;  5AA1 A;  4OVR A;  3LC8 A;  2R9J A;  3TOD A;  3SEU A;  3PPP A;  4YZZ A;  3HN0 A;  1Z7N E;  3TCG A;  1JP4 A;  1INP A;  4GQO A;  2Q89 A;  1XS5 A;  3EQ1 A;  3LR1 A;  4I40 A;  4DCX A;  2WBD A;  3O6H A;  2OX3 A;  2RCA A;  5H8F A;  4RA1 A;  4G8H A;  2RC9 A;  3ONM A;  4WEP A;  4GWS A;  1XHY A;  1Y3Q A;  5AA2 D;  2XXI A;  1MXU A;  1FPF A;  1EZ9 A;  5FHN A;  1A8F A;  4NF6 A;  4F18 A;  3MBP A;  4NQ8 A;  2CMO A;  1DSN A;  3H6U A;  2FA7 A;  4P56 A;  5CMB A;  4OVS A;  2HFB A;  3MP1 A;  5CMC A;  3IFC A;  1B3F A;  3QIM A;  2DVC A;  2ZZW A;  5I58 B;  4HTG A;  1DPE A;  2A5T B;  4LP2 B;  3LV0 A;  2PFY A;  5I56 A;  4JWO A;  2UVJ A;  2GQ1 A;  3UK4 A;  4OEN A;  2QS2 A;  4R72 A;  2Y5K A;  2QS4 A;  3VLU A;  1N3W A;  3E78 A;  5CI5 A;  1NV7 A;  1B3L A;  2CZL A;  2ZYM A;  1LAH E;  2XWO A;  3JYR A;  1PBP A;  5AE4 A;  2VD2 A;  3PMX A;  4U1Z A;  2I0B A;  3HHG A;  3FJ7 A;  4R75 A;  4N07 A;  3FXQ A;  5AA4 B;  4IR8 A;  3K02 A;  1MQH A;  3FV1 A;  4NF0 A;  3QUJ A;  3DM0 A;  4IGR A;  1XVY A;  1FPI A;  1MQJ A;  4KCD A;  4P0G A;  3UOR A;  2UVI A;  1NL5 A;  3ROJ A;  1EYJ A;  1ZBM A;  4F1V A;  3EN3 A;  4JDF A;  3N26 A;  2AL5 A;  3KJ7 A;  4POX A;  2QMW A;  4PFY A;  4KCC A;  1OLC A;  5IZZ A;  2DDK A;  3O29 A;  4N4U A;  3U8Q A;  1FJ6 A;  3VV5 A;  2L5V A;  3IB0 A;  2LAO A;  2Q2C A;  1FQF A;  5JTY B;  4OZ9 A;  4DI3 D;  4ZEB A;  4IGT A;  2B4M A;  5H8N B;  2ZYN A;  5KDT B;  3UN6 A;  3FJG A;  2Y7R A;  5ICT A;  4AQ4 A;  1NUX A;  1LCF A;  1NUZ A;  1UTB A;  3FV2 A;  4GD5 A;  4H8I A;  5IAI A;  1ZU0 A;  5KZT A;  1DMB A;  4GLI A;  4O8M A;  2VOZ A;  4RPN A;  3B8B A;  3EHU A;  2E1S A;  1O64 A;  4H67 A;  3S9M C;  2QVR A;  1LFG A;  4FEC A;  1SI0 A;  2XHD A;  4F2Q A;  1SYH A;  2Q74 A;  4P0I A;  1N7X A;  5DEX B;  4GX4 A;  4G61 A;  2ZZV A;  4NE4 A;  4ECF A;  3IJO B;  2ANJ A;  4GBV A;  3VDF A;  5ITO A;  2VGQ A;  3A09 A;  4U23 A;  2HEU A;  3N6U A;  4OWD A;  4DCY A;  1P99 A;  3QSL A;  3SER A;  1B5H A;  1PEB A;  4F1Y A;  1Q9D A;  1H76 A;  1A54 A;  4LZ7 A;  3TEL A;  3TYH A;  2H4I A;  3LSF B;  4MBP A;  1MXY A;  2AIX A;  1LBZ A;  4LZ5 A;  4GL0 A;  1AIV A;  2RF1 A;  2D21 A;  3S2V A;  4EDP A;  3M3K A;  2V3U A;  2DE3 A;  4I1D A;  4R2B A;  5ESY A;  4EF1 A;  3SEX A;  3H6W A;  3T0J A;  4QF9 A;  2I49 A;  5M2V A;  4KPT A;  2OZZ A;  4H65 A;  2RCB A;  3IOT A;  1MM7 A;  3RT6 B;  3TQW A;  4P9K A;  1DTG A;  3KGC A;  3P7I A;  1PC3 A;  4F31 B;  5B7D A;  4PAI A;  5HM4 B;  3RTF B;  1XOC A;  2UVH A;  2VPO A;  4OTE A;  3DEL B;  5I5P A;  2REJ A;  2XD3 A;  2AL4 A;  5H8N A;  5KDT A;  3H03 A;  4GRK A;  3BFT A;  1FJ9 A;  1PB7 A;  3IL1 B;  4LAT A;  3T9U A;  4IO5 A;  3B6Q A;  1P1Q A;  3Q29 A;  1QVS A;  1FSA A;  4U2R A;  4OMB A;  3U1O A;  3GBA A;  1URS A;  1OVT A;  2OWT A;  2DVZ A;  4PE3 A;  3O28 A;  1LAF E;  4P1L A;  3PUV E;  4IO6 A;  3RPL B;  1Y3P A;  3BBR A;  5IM2 A;  4OET A;  4GXA A;  1USY H;  1M5C A;  2O1L A;  4JWY A;  3PD8 A;  3W9V A;  2P2A A;  1NUY A;  2ZYO A;  4IY6 A;  3CG1 A;  4N6P A;  2REG A;  4LZ8 A;  1JEU A;  4QRZ A;  4F3P A;  4YKJ A;  2OCU A;  2XXK A;  1N3X A;  4YAH X;  3LSX A;  5ELV A;  2FHY A;  3RNN A;  3HHF A;  4PFT A;  4BLA A;  4MHF A;  1XVX A;  3PUY E;  1QUI A;  1N7W A;  3USD A;  4MMP A;  3TDJ A;  3ZSF A;  2ONR A;  1LEV A;  4WKM A;  4XKQ A;  4Q8R A;  4BDM A;  1MY1 A;  1NV6 A;  4YU0 A;  1FTM A;  1A7L A;  2G93 A;  2RIN A;  4PF8 A;  3HPI A;  5H8Q B;  4FOR A;  5ICQ A;  4QFP A;  5EHM A;  1B46 A;  4GWZ A;  3T9X B;  1B0L A;  5CBR A;  2B3F A;  1MY2 A;  3FZV A;  4GF8 A;  3JZJ A;  1LBY A;  1URD A;  3EKI A;  3SDF A;  4G8N A;  3PPO A;  2B3B A;  2DWA A;  5JK4 A;  4PCD A;  2E0S A;  4N15 A;  5TP9 B;  3MP6 A;  1LFI A;  1M5D A;  3AXF A;  1UIU A;  4QXD A;  1TFA A;  3S4U A;  2PFZ A;  4OYV A;  5A5X A;  3IFA A;  3E9X A;  4RPO A;  2VT5 A;  4L17 A;  4RJZ A;  2GRV A;  2PVU A;  4P3L A;  1ZTY A;  5DTB A;  3CFZ A;  5FHO A;  1FRP A;  2HXW A;  3BFU A;  4XIG Q;  1FPE A;  3MUQ A;  4GBW A;  1YYZ A;  5I7I A;  2F35 A;  2RC7 A;  1FQE A;  4YIC A;  4DE8 A;  2XXR A;  3QYT A;  2R71 A;  5HBC A;  4PC9 A;  5DVF A;  3UP9 A;  4OFJ A;  1QW0 A;  2QRY A;  1B40 A;  2Y7K A;  4U4S A;  4G68 A;  3EPE A;  3MWB A;  3G7W A;  1JVX A;  2UYF A;  4Z0I A;  1F9B A;  4KD5 A;  3DP6 A;  5TPA B;  4O3C A;  4G2Z A;  2OK2 A;  1US4 A;  1JNF A;  1Y1M A;  3PUX E;  5FTH A;  4OQO A;  1BIY A;  1FQA A;  1YTV A;  4XEQ A;  4ZS9 A;  4GL8 A;  4JVC A;  5KCJ B;  4MEV A;  5CMK A;  5EYG A;  3TFL A;  3C36 A;  1MXV A;  1PBQ A;  4MFI A;  5F1Q A;  2GH9 A;  3OO7 A;  3OO8 A;  1KZ8 A;  2R8T A;  1MY4 A;  4X1D A;  5AA3 A;  1ZKB A;  4O94 A;  2CZK A;  1R9L A;  3V89 B;  3GXA A;  4RXL A;  5H8S A;  1MDP 1;  1B7H A;  1SYI A;  5IZ3 A;  2YPN A;  3OSR A;  2I4C A;  4FE8 A;  4XKP A;  2V93 A;  1ZLQ A;  3T1B A;  4IO7 A;  3JV9 A;  3U94 A;  4TLL B;  2AYS A;  2OWS A;  4EUO A;  2HHM A;  3EHT A;  3S9E A;  1LB8 A;  3G3J A;  4H45 A;  2H25 A;  3TTR A;  5CMM A;  5J1D A;  5LOM A;  4GWX A;  1MQG A;  4MLV A;  3TTK A;  1VR5 A;  3I3V A;  2XXY A;  5I84 A;  3G3K A;  4MNC A;  1AH5 A;  3KSX A;  2M8C A;  4GWU A;  3IO4 A;  3R7X A;  2HAV A;  1BKA A;  2F6P A;  1B1X A;  1SW4 A;  4MH5 A;  3KN8 A;  2RC8 A;  1D3K A;  2CEX A;  4GOT A;  3N5L A;  4MCO A;  4AB6 A;  4JWX A;  4LQ2 A;  4WXJ A;  4N13 A;  1D4N A;  1UTH B;  4JSO A;  4DXU A;  5L8D A;  3FVO A;  4GIZ A;  4H46 A;  3G3I A;  2Y7I A;  1QKA A;  4PDH A;  4NF5 A;  1YAE A;  2P0S A;  1O63 A;  2DWJ A;  2Q8M A;  2PT2 A;  3K6X A;  4PP0 A;  3G3F A;  3FGS A;  1XT8 A;  5L9S A;  4PET A;  5ET8 A;  4PAK A;  2D3I A;  2P1S A;  2PMS A;  1DOT A;  1IZ1 A;  3DP4 A;  1NFT A;  4JSD A;  4NWD A;  2QS1 A;  3B7D A;  2BJI A;  1N0T A;  1IQ7 A;  2OLB A;  4OVQ A;  2ZMB A;  2WBB A;  3QK6 A;  4N6D A;  3TUS A;  3QAX A;  1SPI A;  4I8C A;  4QBA A;  2Q88 A;  1FPK A;  2CZI A;  4RNS A;  4DI4 B;  2F5X A;  3O6I A;  2KLF A;  4ELO A;  4QSE A;  3VE1 B;  4NF4 B;  3PUZ E;  4YB7 A;  1EH3 A;  1M5F A;  3E13 X;  5I2K B;  2NWJ A;  3CFL A;  3V5A A;  2KR0 A;  4XXU A;  4ZZE A;  5LDZ A;  1N84 A;  1A99 A;  2XWV A;  4F19 A;  4JVD A;  2IEE A;  1SI1 A;  3LSL A;  5B70 A;  4OVT A;  1LB9 A;  5I2N A;  3V83 A;  1AL3 A;  2DP8 A;  4ZEI A;  3O66 A;  1IMA A;  2Z23 A;  4DXB A;  1QKB A;  1NNK A;  5BUU A;  2NOO A;  4YKP A;  1ZJL A;  4PBH A;  2VHA A;  4AS4 A;  2Q2A A;  4FBP A;  1TWY A;  3VVD A;  5ET5 A;  1PB9 A;  1I69 A;  1JW5 A;  5DW8 A;  5EQ7 A;  4G8M A;  3TKD A;  2THI A;  1LBC A;  4I3Y A;  4N91 A;  4GWO A;  5DT6 A;  3OSQ A;  3MAM A;  1DK4 A;  4OES A;  3BIG A;  1B5J A;  4XKR A;  1BTJ A;  5T3J A;  1YPN A;  3BKI B;  1P1U A;  1K9Y A;  1RKM A;  3OD7 A;  1IXC A;  1P1W A;  3MVW A;  4NGU A;  3Q27 A;  5EYH A;  2XWI A;  5CBS A;  4KYE A;  1VFD A;  2IA4 A;  1H43 A;  1N76 A;  4KHZ E;  2O7U A;  1IMF A;  3MZ1 A;  4H8J A;  3K0V A;  1HSL A;  5I58 A;  1LCT A;  1TXF A;  4ZE9 A;  2A5T A;  1RDY A;  4POW A;  1Y4C A;  5I59 B;  4JB7 A;  1L5T A;  1Y3N A;  2V25 A;  5A5L A;  4ELQ A;  1EZO A;  4KI0 E;  2NUV A;  4O3B A;  4YMA A;  2QSX A;  4R74 A;  2I4B A;  4I3E A;  1YZ0 A;  3MPL A;  1KWH A;  3H7M A;  3RTW B;  3E3K A;  5K2Y A;  1IXH A;  1PB8 A;  4G4P A;  2FIE A;  2ZNU A;  3W15 C;  4BDL A;  3CSG A;  5AA2 B;  4E0X A;  2F7B A;  4ISU A;  3ILT B;  3VVF A;  1B5I A;  3D4G A;  4YMB A;  1WOD A;  4DIG A;  1MPC A;  3I5O A;  3U65 A;  4NF4 A;  4U22 A;  3RGY A;  4FJP A;  5AA4 A;  3RQT A;  1H45 A;  1GVC A;  2PBW A;  4PF6 A;  4Q30 B;  3C34 A;  1LLS A;  3K2D A;  3TPA A;  1FPJ A;  2CZH A;  1B3E A;  2CEY A;  2DE4 A;  5I57 B;  2PYY A;  3MVX A;  4R6K A;  4LVQ A;  1UIV A;  1R9Q A;  4KFQ A;  1JW4 A;  2PCR A;  1QUK A;  3K00 A;  1B05 A;  2I3W A;  3K6V A;  4BDO A;  4AB5 A;  3Q28 A;  4UAC A;  2FNC A;  4PFR A;  1FBG A;  4MIJ A;  4R6H A;  4F22 A;  3O6G A;  3T22 A;  4EF2 A;  4ZEK A;  4NN3 A;  3IX1 A;  1EU8 A;  3OEN A;  4R73 A;  2F97 A;  3W9W A;  1I6A A;  5ET7 A;  2XX7 A;  2Y84 A;  5JTY A;  2ABH A;  2O6A A;  4C1U A;  1FBF A;  2Z8F A;  4FEB A;  3PTY A;  4JBZ A;  3KSJ A;  2ZXT A;  1QUL A;  1RDZ A;  4XFE A;  1XC1 A;  3RY3 A;  3IB1 A;  1OIB A;  3FVG A;  3K6U A;  3H6T A;  3SET A;  4K3F A;  2ONK E;  4P1E A;  4R2F A;  3ISP A;  5EQA A;  2I58 A;  1ATG A;  4N8G A;  3OOA A;  1B1H A;  2B4L A;  1R1N A;  1J1N A;  4GFR A;  4FAT A;  4NG7 A;  1JET A;  3K1M A;  3O97 A;  1NH8 A;  3FVN A;  4HCW A;  1P1N A;  4G77 A;  3OEL A;  4AS5 A;  3HFU A;  3KG2 A;  4H5G A;  3VXB A;  5DEX A;  2O1M A;  3O9P A;  3C32 A;  2WYP A;  2XXW A;  2F8D A;  3V8X B;  3MW0 A;  4FIM A;  4R6Y A;  1MXX A;  4JXI A;  4F1U A;  4QFL A;  4GX6 A;  1IEJ A;  3FAS A;  4H5F A;  4MNI A;  2ONS A;  4RYA A;  1MPB A;  2Y7P A;  3TZA A;  5CRY A;  2PX1 A;  2D5W A;  2HXR A;  3LSW A;  3CFX A;  5DYH A;  2MKZ A;  1ZMG A;  2R6G E;  4TOZ A;  1JQF A;  1LBX A;  4DZ1 A;  1MDQ A;  2B65 A;  1VSO A;  3CSB A;  1RYX A;  3Q26 A;  3CRB A;  3WAF A;  1FQB A;  3FBP A;  4THI A;  3VVE A;  3RN8 A;  1IXI A;  1VFE A;  2ZNT A;  1LBB A;  4PGN A;  3DP8 A;  3MQ9 A;  3QXM A;  2QL3 A;  1S50 A;  3PGF A;  2F3D A;  1SW1 A;  4M4G A;  2DXR A;  3OO6 A;  4LUB A;  4O7I A;  5LTC A;  4MLQ A;  1LGB C;  1OLA A;  2XX9 A;  4HE2 A;  4U21 A;  1IMD A;  2H99 A;  3KOS A;  4C0R A;  5H8H B;  3TCH A;  1GGG A;  4DLD A;  1LBV A;  3E79 A;  2G29 A;  1GTK A;  1B0H A;  3KOT A;  1B2H A;  1NV1 A;  3CI8 A;  3LBS A;  5ISU A;  3M3L A;  4LA9 A;  4MJO A;  4PGP A;  1D9Y A;  3LUZ A;  2W7Y A;  3O2A A;  3D1R A;  3C9H A;  3RYD A;  3RPL A;  5BWJ A;  1SDX A;  3TTM A;  1LAG E;  1QUJ A;  1DPP A;  4X1B A;  4F39 A;  2ZZX A;  4F3G A;  2ALU A;  3M8U A;  5FHM A;  4PAF A;  1M5B A;  1US5 A;  1EYI A;  5EYF A;  2NVU B;  3SZP A;  3K1P A;  1S9T A;  5CC2 A;  2XXP A;  1NMU A;  4GWY A;  4NF6 B;  3MJN A;  1SD3 A;  4QFO A;  3R6U A;  2ESN A;  1HSJ A;  3IK6 B;  3K1N A;  1POT A;  2XXX A;  3F11 A;  1MG1 A;  1IMC A;  1NNP A;  4NF8 B;  4BDR A;  4IB2 A;  4TLM B;  2F34 A;  1SW5 A;  1Y4T A;  3RLF E;  3KC0 A;  5I56 B;  1LST A;  3UGW A;  2HQ0 A;  3PUW E;  4OFL A;  5CM6 A;  5ET6 A;  3RT8 A;  4OA4 A;  3EHS A;  5H8Q A;  3FXU A;  1MPD A;  1B3G A;  1TFD A;  2F36 A;  4OXV A;  3L6H A;  2FIX A;  2F6G A;  3H3G A;  2FYI A;  2H98 A;  1H3D A;  3OEK A;  4FAJ A;  3KC1 A;  1JW1 A;  2OJT A;  2XA5 A;  3D4C A;  4H6D A;  3IOR A;  1G0I A;  1NV4 A;  1SQY A;  4IO4 A;  5TP9 A;  4P8B A;  4ZZA A;  3T96 B;  3FXB A;  2I6E A;  4OAN A;  3TQL A;  2XXQ A;  1NKX A;  3Q25 A;  1Z7M E;  2F78 A;  5DVJ A;  3MZB A;  4Z7E A;  4KYD A;  4HXV A;  3FUZ A;  4E0W A;  3H6V A;  4I9D A;  2YLN A;  1DBZ A;  4ZED A;  5IKB A;  3C35 A;  3SEW A;  3I6V A;  3PU5 A;  2DSF A;  1FTL A;  2P3N A;  1EZP A;  4MAG A;  3GZG A;  2QVV A;  3SEV A;  1B51 A;  2GHB A;  3K4U A;  3VLV A;  1B4H A;  1B6H A;  2ZYK A;  5L9M A;  2O51 A;  4XF5 A;  1URG A;  3THI A;  1SVX B;  1UTB B;  4MNP A;  1A40 A;  3IOW A;  2PT1 A;  2OWZ A;  4UA8 A;  5TPA A;  2WEF A;  1A55 A;  2F7C A;  2XD2 A;  1D9V A;  3ODB A;  4IO2 A;  2BJJ X;  4N8Y A;  3SKP A;  4KQP A;  5KCJ A;  2H5Y A;  1FQC A;  1IMB A;  2GHA A;  1FQD A;  2QJE A;  2WX9 A;  1NV0 A;  5TU0 A;  4BDQ A;  4NF8 A;  3G3G A;  3IOV A;  2DWH A;  3L6G A;  3S9L C;  1Y20 A;  3DLN A;  1FPB A;  1LFH A;  3PPN A;  3CR9 A;  5IZ1 A;  4QFN A;  2V3T A;  1QJM A;  4EXK A;  3TEP A;  4NHB A;  1XI6 A;  3PD9 A;  3BIH A;  1Q35 A;  2WKY A;  3OO9 A;  1IIT A;  3MYU A;  2DOJ A;  1B58 A;  2DYX A;  3FIR A;  4ZEF A;  3MPK A;  3MST A;  2XWK A;  3K6W A;  1POY 1;  4DDD A;  4M1V A;  2I48 A;  1BLF A;  1FTA A;  1OQG A;  1Y9U A;  4I62 A;  1P1O A;  2DWI A;  3FXR A;  2UYE A;  1Y1Z A;  3HCQ A;  3PPR A;  4BDN A;  4X48 A;  3A3U A;  1FBC A;  4KYS A;  3HV1 A;  2ZNS A;  4ESX A;  1SBP A;  3FVK A;  1B4Z A;  3GBB A;  5EQ8 A;  4ESW A;  2Y5L A;  3ZKK A;  2NXO A;  1AMF A;  4X9T A;  1BP5 A;  1OQH A;  3PMW A;  3QUF A;  4ONY A;  1GR2 A;  2XXU A;  3TMG A;  1QGX A;  3SES A;  1MQI A;  1UTH A;  1NNF A;  4IY5 A;  3HST A;  1CNQ A;  3KJT A;  5DVI A;  1KA0 A;  1ELJ A;  4NTL A;  1HSE A;  3S9N C;  1G0H A;  2HZL A;  2O69 A;  3KZG A;  1M5E A;  4NMY A;  3T93 B;  3U93 A;  3IAZ A;  1NV5 A;  3VXC A;  1NI9 A;  1O7T A;  3RPW A;  1B7U A;  3FD3 A;  1I6B A;  3KN3 A;  2OBG A;  4FED A;  3CIJ A;  4IO3 A;  3T66 A;  1AWB A;  3A29 A;  4QHQ A;  2FVZ A;  2RKM A;  3A3C A;  4YB6 A;  4GWW A;  1NV2 A;  4OEV A;  4MF3 A;  4ND9 A;  4ELP A;  1WVJ A;  4PQJ A;  5I2K A;  1FBE A;  3VFJ A;  4HE0 A;  3EF7 A;  2VD3 A;  3IOU A;  4LON B;  5I3S A;  4YB5 A;  1BK4 A;  2DXY A;  2DS9 A;  3C31 A;  4F3B A;  4GX3 A;  3E4R A;  1FPD A;  1B9J A;  3NOH A;  3B50 A;  2QS3 A;  1K9Z A;  3UIF A;  4N81 A;  4P11 A;  2DE2 A;  2XXV A;  4OHN A;  1MH4 A;  4NX1 A;  4PE5 B;  5K2X A;  1JVY A;  4EXL A;  3ZS6 A;  4Q5T A;  3U72 A;  3U92 A;  4P47 A;  3H06 B;  1SW2 A;  4OER A;  4WED A;  3RUM A;  4F29 A;  1FW0 A;  1MY3 A;  5JEI A;  3B6T A;  4PTK A;  4LN5 A;  1D9Q A;  4H0W A;  4HE1 A;  1OVB A;  1PDA A;  2HPG A;  4O7M A;  4X8R A;  1ZIU A;  2UXA A;  3T9V A;  1FTO A;  3H4Z A;  3R26 A;  5A5X B;  4RK2 A;  3MC2 A;  3KBZ A;  5F24 A;  1IUD A;  4U4X A;  4EQ7 A;  1TT1 A;  2YJP A;  4LQ5 A;  3T9H B;  3LUY A;  3SEY A;  2GFE A;  1FPL A;  1DCU A;  1YXI A;  1NV3 A;  4ZDM A;  2X7Q A;  1CB6 A;  4O3A A;  1LAX A;  5F7V A;  3FJM A;  1B52 A;  4GXS B;  4U1O A;  1MH3 A;  4PDD A;  3GLB A;  5I59 A;  1B7Z A;  1FCK A;  4Q0C A;  1YCJ A;  1WDN A;  4JVI A;  2P3V A;  1N04 A;  2V3Q A;  1OMP A;  3G3H A;  1RYO A;  4G68 B;  2O68 A;  2F7A A;  3ILU B;  2X26 A;  5AA2 A;  3M3F A;  1MQD A;  5J16 A;  1T0K A;  3N6T A;  4EQ9 A;  3MVY A;  1VE4 A;  3C33 A;  2UVG A;  2Z8E A;  1VDW A;  1MY0 A;  4F2O A;  3OXN A;  5ITP A;  1NUW A;  4ZE8 A;  3KN7 A;  2Q8J A;  5I57 A;  3IO6 A;  2JJK A;  1IXG A;  2HZK A;  4PFB A;  2HCA A;  4KR5 A;  4YKK A;  2HAU A;  2KQZ A;  5IZ3 B;  4PBQ A;  2QVU A;  3PMV A;  1RDX A;  4NAP A;  1MM6 A;  3PV0 E;  3KEI A;  3CHG A;  4ELR A;  4RK9 A;  4TQU Q;  4YKI A;  3N94 A;  3UA8 A;  1A8E A;  1MRP A;  2X7P A;  4F3S A;  3K01 A;  1S7Y A;  2Z22 A;  3TTL A;  3ZKL A;  1II5 A;  4RY1 A;  2VP1 A;  1H44 A;  4HCY A;  1FTJ A;  1FBH A;  4ZEC A;  4OVP A;  2Z8D A;  4X04 A;  4DXC A;  3FAT A;  4QSC A;  3MVZ A;  4NED A;  3IJX B;  5H8F B;  4GVO A;  3B6W A;  1IIW A;  4R9F A;  3PPQ A;  1DTZ A;  5L9O A;  1JEV A;  1MXZ A;  3IB2 A;  4QFK A;  4G68 C;  4OVJ A;  4PFU A;  1MS7 A;  2V4C A;  3VLW A;  3HO7 A;  2QFL A;  5HPQ A;  4H1X A;  1FBP A;  5EHS A;  4QSD A;  5EQ9 A;  4R9G A;  1MXW A;  3KBR A;  4KXP A;  1UQW A;  3TTN A;  3CVG A;  4NF5 B;  1NH7 A;  4NWC A;  2QMX A;  3ECR A;  1GV8 A;  2VPN A;  1CE2 A;  1B32 A;  4UAB A;  3TAJ A;  4MX6 A;  4HW8 A;  4XKN A;  1NNT A;  4C1T A;  2XX8 A;  3IR1 A;  2A5S A;  1LBW A;  1USY E;  2Y7W A;  4HS7 A;  5FTI A;  2V84 A;  2Q9T A;  3MZ9 A;  2XXT A;  2O7I A;  2XXH A;  3OEM A;  1FTK A;  2F3B A;  2FBP A;  1EYK A;  3GYY A;  4N6K A;  5FBP A;  1R6Z A;  2I0C A;  3KFM A;  3OMB A;  1KA1 A;  2QPQ A;  1FPG A;  2O84 X;  4OFO A;  3QMF A;  4PFI A;  2I3V A;  2DQV A;  1I6Q A;  3CG3 A;  4EQB A;  1ANF A;  1Q1K A;  5H8H A;  3C4M A;  1B3H A;  4PFW A; 
#chains in the Genus database with same CATH homology
 3MP8 A;  5I2N B;  3TCF A;  2H9B A;  4OEU A;  4XTC Q;  1AOV A;  3WAE A;  5AA1 A;  3LC8 A;  2R9J A;  3TOD A;  3SEU A;  3PPP A;  4YZZ A;  3HN0 A;  1Z7N E;  3TCG A;  4GQO A;  2Q89 A;  1XS5 A;  3EQ1 A;  3LR1 A;  4DCX A;  3O6H A;  2RCA A;  5H8F A;  4RA1 A;  4G8H A;  2RC9 A;  3ONM A;  4WEP A;  1XHY A;  1Y3Q A;  5AA2 D;  2XXI A;  1MXU A;  1EZ9 A;  5FHN A;  1A8F A;  4NF6 A;  4F18 A;  3MBP A;  2CMO A;  1DSN A;  3H6U A;  2FA7 A;  5CMB A;  2HFB A;  3MP1 A;  5CMC A;  1B3F A;  3QIM A;  2DVC A;  5I58 B;  4HTG A;  1DPE A;  2A5T B;  4LP2 B;  5I56 A;  4JWO A;  2UVJ A;  3UK4 A;  4OEN A;  2QS2 A;  4R72 A;  2QS4 A;  3VLU A;  1N3W A;  5CI5 A;  2CZL A;  1B3L A;  2ZYM A;  1LAH E;  3JYR A;  1PBP A;  5AE4 A;  2VD2 A;  3PMX A;  4U1Z A;  2I0B A;  3HHG A;  3FJ7 A;  4R75 A;  4N07 A;  3FXQ A;  5AA4 B;  3K02 A;  1MQH A;  3FV1 A;  3QUJ A;  3DM0 A;  4IGR A;  1XVY A;  1MQJ A;  4KCD A;  4P0G A;  3UOR A;  2UVI A;  1NL5 A;  1ZBM A;  4F1V A;  3EN3 A;  4JDF A;  3N26 A;  2AL5 A;  3KJ7 A;  4POX A;  2QMW A;  4PFY A;  4KCC A;  1OLC A;  3O29 A;  3U8Q A;  3VV5 A;  3IB0 A;  2LAO A;  2Q2C A;  1FQF A;  5JTY B;  4OZ9 A;  4ZEB A;  4IGT A;  5H8N B;  2ZYN A;  5KDT B;  3UN6 A;  3FJG A;  2Y7R A;  5ICT A;  4AQ4 A;  1LCF A;  1UTB A;  3FV2 A;  4GD5 A;  4H8I A;  5IAI A;  1ZU0 A;  5KZT A;  1DMB A;  4GLI A;  2VOZ A;  4RPN A;  3EHU A;  2E1S A;  1O64 A;  4H67 A;  3S9M C;  1LFG A;  4FEC A;  4F2Q A;  1SI0 A;  2XHD A;  1SYH A;  1N7X A;  4P0I A;  5DEX B;  4NE4 A;  4ECF A;  3IJO B;  2ANJ A;  3VDF A;  5ITO A;  2VGQ A;  3A09 A;  4U23 A;  2HEU A;  3N6U A;  4OWD A;  4DCY A;  1P99 A;  3QSL A;  3SER A;  1B5H A;  1PEB A;  4F1Y A;  1H76 A;  1A54 A;  4LZ7 A;  3TEL A;  3TYH A;  2H4I A;  3LSF B;  4MBP A;  1MXY A;  2AIX A;  4LZ5 A;  4GL0 A;  1AIV A;  2RF1 A;  2D21 A;  3S2V A;  4EDP A;  3M3K A;  2V3U A;  2DE3 A;  4I1D A;  4R2B A;  4EF1 A;  3SEX A;  3H6W A;  4QF9 A;  2I49 A;  5M2V A;  4KPT A;  2OZZ A;  4H65 A;  2RCB A;  3IOT A;  1MM7 A;  3RT6 B;  3TQW A;  1DTG A;  3KGC A;  3P7I A;  1PC3 A;  4F31 B;  5B7D A;  5HM4 B;  3RTF B;  1XOC A;  2UVH A;  4OTE A;  3DEL B;  2REJ A;  2XD3 A;  2AL4 A;  5H8N A;  5KDT A;  3H03 A;  4GRK A;  3BFT A;  1PB7 A;  3IL1 B;  4LAT A;  3T9U A;  4IO5 A;  3B6Q A;  1P1Q A;  3Q29 A;  1QVS A;  4U2R A;  4OMB A;  3U1O A;  3GBA A;  1URS A;  1OVT A;  2OWT A;  2DVZ A;  3O28 A;  1LAF E;  3PUV E;  4IO6 A;  1Y3P A;  3BBR A;  4OET A;  4GXA A;  1USY H;  1M5C A;  2O1L A;  3PD8 A;  4JWY A;  3W9V A;  2P2A A;  2ZYO A;  4IY6 A;  4N6P A;  3CG1 A;  2REG A;  4LZ8 A;  1JEU A;  4QRZ A;  4F3P A;  4YKJ A;  2OCU A;  1N3X A;  4YAH X;  3LSX A;  5ELV A;  3RNN A;  3HHF A;  4PFT A;  4BLA A;  1XVX A;  3PUY E;  1QUI A;  1N7W A;  3USD A;  3TDJ A;  3ZSF A;  2ONR A;  4WKM A;  4XKQ A;  4Q8R A;  4BDM A;  1MY1 A;  4YU0 A;  1FTM A;  1A7L A;  2G93 A;  2RIN A;  3HPI A;  5H8Q B;  4FOR A;  5ICQ A;  4QFP A;  5EHM A;  1B46 A;  3T9X B;  1B0L A;  5CBR A;  2B3F A;  1MY2 A;  3FZV A;  4GF8 A;  3JZJ A;  1URD A;  3SDF A;  4G8N A;  3PPO A;  2B3B A;  2DWA A;  5JK4 A;  2E0S A;  5TP9 B;  3MP6 A;  1LFI A;  1M5D A;  3AXF A;  1UIU A;  1TFA A;  3S4U A;  4OYV A;  5A5X A;  3E9X A;  4RPO A;  4L17 A;  4RJZ A;  2GRV A;  2PVU A;  1ZTY A;  5DTB A;  3CFZ A;  5FHO A;  2HXW A;  3BFU A;  4XIG Q;  3MUQ A;  2F35 A;  2RC7 A;  1FQE A;  4YIC A;  4DE8 A;  2XXR A;  3QYT A;  2R71 A;  5HBC A;  5DVF A;  3UP9 A;  4OFJ A;  1QW0 A;  2QRY A;  1B40 A;  2Y7K A;  4U4S A;  4G68 A;  3EPE A;  3MWB A;  3G7W A;  1JVX A;  2UYF A;  4Z0I A;  1F9B A;  4KD5 A;  3DP6 A;  5TPA B;  4O3C A;  4G2Z A;  2OK2 A;  1US4 A;  1JNF A;  1Y1M A;  3PUX E;  5FTH A;  4OQO A;  1BIY A;  1FQA A;  1YTV A;  4ZS9 A;  5KCJ B;  4GL8 A;  5CMK A;  3TFL A;  3C36 A;  1MXV A;  1PBQ A;  4MFI A;  5F1Q A;  2GH9 A;  3OO7 A;  3OO8 A;  1MY4 A;  4X1D A;  5AA3 A;  1ZKB A;  1R9L A;  3V89 B;  3GXA A;  4RXL A;  5H8S A;  1MDP 1;  1B7H A;  1SYI A;  2YPN A;  3OSR A;  2I4C A;  4FE8 A;  4XKP A;  2V93 A;  1ZLQ A;  4IO7 A;  3JV9 A;  3U94 A;  4TLL B;  2AYS A;  2OWS A;  4EUO A;  3EHT A;  3S9E A;  1LB8 A;  3G3J A;  2H25 A;  3TTR A;  5CMM A;  5J1D A;  5LOM A;  1MQG A;  4MLV A;  3TTK A;  1VR5 A;  3I3V A;  2XXY A;  5I84 A;  3G3K A;  1AH5 A;  3KSX A;  2M8C A;  3IO4 A;  3R7X A;  2HAV A;  1BKA A;  2F6P A;  1B1X A;  1SW4 A;  4MH5 A;  3KN8 A;  2RC8 A;  1D3K A;  4GOT A;  3N5L A;  4AB6 A;  4JWX A;  4LQ2 A;  4WXJ A;  4N13 A;  1D4N A;  1UTH B;  4JSO A;  4DXU A;  5L8D A;  3FVO A;  4GIZ A;  3G3I A;  2Y7I A;  1QKA A;  4NF5 A;  1YAE A;  2P0S A;  1O63 A;  2DWJ A;  2PT2 A;  3K6X A;  4PP0 A;  3G3F A;  3FGS A;  1XT8 A;  5L9S A;  4PET A;  2D3I A;  2P1S A;  2PMS A;  1DOT A;  1IZ1 A;  3DP4 A;  1NFT A;  4JSD A;  4NWD A;  2QS1 A;  3B7D A;  1N0T A;  1IQ7 A;  2OLB A;  2ZMB A;  3QK6 A;  3TUS A;  3QAX A;  4I8C A;  2Q88 A;  4RNS A;  2F5X A;  3O6I A;  2KLF A;  4ELO A;  4QSE A;  3VE1 B;  4NF4 B;  3PUZ E;  4YB7 A;  1EH3 A;  1M5F A;  3E13 X;  5I2K B;  2NWJ A;  3CFL A;  3V5A A;  4XXU A;  4ZZE A;  1N84 A;  1A99 A;  4F19 A;  2IEE A;  1SI1 A;  3LSL A;  5B70 A;  1LB9 A;  5I2N A;  3V83 A;  1AL3 A;  2DP8 A;  4ZEI A;  3O66 A;  2Z23 A;  4DXB A;  1QKB A;  1NNK A;  5BUU A;  2NOO A;  4YKP A;  1ZJL A;  2VHA A;  2Q2A A;  1TWY A;  3VVD A;  1PB9 A;  1I69 A;  1JW5 A;  4G8M A;  3TKD A;  2THI A;  1LBC A;  4GWO A;  5DT6 A;  3OSQ A;  3MAM A;  4OES A;  1B5J A;  4XKR A;  1BTJ A;  1YPN A;  3BKI B;  1P1U A;  1RKM A;  3OD7 A;  1IXC A;  1P1W A;  3MVW A;  3Q27 A;  5CBS A;  4KYE A;  1VFD A;  2IA4 A;  1H43 A;  1N76 A;  2O7U A;  4KHZ E;  3MZ1 A;  4H8J A;  3K0V A;  1HSL A;  5I58 A;  1LCT A;  1TXF A;  4ZE9 A;  2A5T A;  5I59 B;  4POW A;  1Y4C A;  4JB7 A;  1L5T A;  1Y3N A;  2V25 A;  4ELQ A;  1EZO A;  4KI0 E;  2NUV A;  4O3B A;  4YMA A;  2QSX A;  4R74 A;  2I4B A;  3MPL A;  1KWH A;  3H7M A;  3RTW B;  3E3K A;  5K2Y A;  1IXH A;  1PB8 A;  4G4P A;  3W15 C;  2ZNU A;  4BDL A;  3CSG A;  5AA2 B;  4E0X A;  2F7B A;  4ISU A;  3ILT B;  3VVF A;  1B5I A;  3D4G A;  4YMB A;  1WOD A;  4DIG A;  1MPC A;  3I5O A;  4NF4 A;  4U22 A;  3RGY A;  4FJP A;  5AA4 A;  3RQT A;  1H45 A;  1GVC A;  2PBW A;  4Q30 B;  3C34 A;  1LLS A;  3K2D A;  3TPA A;  1B3E A;  2DE4 A;  5I57 B;  2PYY A;  3MVX A;  4R6K A;  4LVQ A;  1UIV A;  1R9Q A;  4KFQ A;  1JW4 A;  1QUK A;  3K00 A;  1B05 A;  2I3W A;  3K6V A;  4BDO A;  4AB5 A;  3Q28 A;  4UAC A;  2FNC A;  4R6H A;  4F22 A;  3O6G A;  3T22 A;  4EF2 A;  4ZEK A;  3IX1 A;  1EU8 A;  3OEN A;  4R73 A;  2F97 A;  3W9W A;  1I6A A;  2XX7 A;  2Y84 A;  5JTY A;  2ABH A;  2O6A A;  4C1U A;  4FEB A;  2Z8F A;  4JBZ A;  3KSJ A;  2ZXT A;  1QUL A;  1XC1 A;  3RY3 A;  3IB1 A;  1OIB A;  3FVG A;  3K6U A;  3H6T A;  3SET A;  4K3F A;  2ONK E;  4R2F A;  2I58 A;  1ATG A;  3OOA A;  1B1H A;  1R1N A;  1J1N A;  4GFR A;  4FAT A;  1JET A;  3K1M A;  3O97 A;  1NH8 A;  3FVN A;  4HCW A;  1P1N A;  4G77 A;  3OEL A;  3KG2 A;  4H5G A;  3VXB A;  5DEX A;  2O1M A;  3O9P A;  3C32 A;  2XXW A;  2F8D A;  3V8X B;  3MW0 A;  4FIM A;  4R6Y A;  1MXX A;  4JXI A;  4F1U A;  4QFL A;  4H5F A;  1IEJ A;  3FAS A;  2ONS A;  4RYA A;  1MPB A;  2Y7P A;  3TZA A;  5CRY A;  2PX1 A;  2D5W A;  3LSW A;  3CFX A;  5DYH A;  1ZMG A;  2R6G E;  4TOZ A;  1JQF A;  4DZ1 A;  1MDQ A;  2B65 A;  1VSO A;  3CSB A;  1RYX A;  3Q26 A;  3CRB A;  3WAF A;  1FQB A;  3VVE A;  4THI A;  3RN8 A;  1IXI A;  1VFE A;  2ZNT A;  1LBB A;  3DP8 A;  3MQ9 A;  3QXM A;  2QL3 A;  1S50 A;  3PGF A;  1SW1 A;  4M4G A;  2DXR A;  3OO6 A;  4LUB A;  4MLQ A;  1LGB C;  1OLA A;  2XX9 A;  4U21 A;  2H99 A;  3KOS A;  4C0R A;  5H8H B;  3TCH A;  1GGG A;  4DLD A;  2G29 A;  1GTK A;  1B0H A;  3KOT A;  1B2H A;  3CI8 A;  3LBS A;  5ISU A;  3M3L A;  4LA9 A;  1D9Y A;  2W7Y A;  3O2A A;  3C9H A;  5BWJ A;  1SDX A;  3TTM A;  1LAG E;  1QUJ A;  1DPP A;  4X1B A;  4F39 A;  4F3G A;  2ALU A;  3M8U A;  5FHM A;  1M5B A;  1US5 A;  5EYF A;  2NVU B;  3K1P A;  1S9T A;  5CC2 A;  2XXP A;  1NMU A;  4NF6 B;  3MJN A;  1SD3 A;  4QFO A;  3R6U A;  2ESN A;  1HSJ A;  3IK6 B;  3K1N A;  1POT A;  2XXX A;  3F11 A;  1MG1 A;  1NNP A;  4NF8 B;  4BDR A;  4IB2 A;  4TLM B;  2F34 A;  1SW5 A;  1Y4T A;  3RLF E;  5I56 B;  1LST A;  3UGW A;  2HQ0 A;  3PUW E;  4OFL A;  5CM6 A;  3RT8 A;  3EHS A;  5H8Q A;  3FXU A;  1MPD A;  1B3G A;  1TFD A;  2F36 A;  4OXV A;  3L6H A;  2F6G A;  3H3G A;  2FYI A;  2H98 A;  1H3D A;  3OEK A;  4FAJ A;  1JW1 A;  2OJT A;  3D4C A;  4H6D A;  3IOR A;  1SQY A;  4IO4 A;  5TP9 A;  4ZZA A;  3T96 B;  2I6E A;  3TQL A;  2XXQ A;  1NKX A;  3Q25 A;  1Z7M E;  2F78 A;  5DVJ A;  3MZB A;  4Z7E A;  4KYD A;  3FUZ A;  4E0W A;  3H6V A;  4I9D A;  2YLN A;  4ZED A;  5IKB A;  3C35 A;  3SEW A;  3I6V A;  3PU5 A;  2DSF A;  1FTL A;  1EZP A;  3GZG A;  3SEV A;  1B51 A;  2GHB A;  3K4U A;  3VLV A;  1B4H A;  1B6H A;  2ZYK A;  5L9M A;  2O51 A;  1URG A;  3THI A;  1SVX B;  1UTB B;  1A40 A;  3IOW A;  2PT1 A;  4UA8 A;  5TPA A;  1A55 A;  2F7C A;  2XD2 A;  1D9V A;  3ODB A;  4IO2 A;  2BJJ X;  3SKP A;  4KQP A;  5KCJ A;  2H5Y A;  1FQC A;  2GHA A;  1FQD A;  2QJE A;  5TU0 A;  4BDQ A;  4NF8 A;  3G3G A;  3IOV A;  2DWH A;  3L6G A;  3S9L C;  1Y20 A;  3DLN A;  1LFH A;  3PPN A;  3CR9 A;  4QFN A;  2V3T A;  1QJM A;  4EXK A;  3TEP A;  3PD9 A;  1Q35 A;  2WKY A;  3OO9 A;  1IIT A;  2DOJ A;  1B58 A;  2DYX A;  3FIR A;  4ZEF A;  3MPK A;  3K6W A;  1POY 1;  4DDD A;  4M1V A;  2I48 A;  1BLF A;  1OQG A;  1Y9U A;  4I62 A;  1P1O A;  2DWI A;  3FXR A;  2UYE A;  1Y1Z A;  3HCQ A;  3PPR A;  4BDN A;  4X48 A;  3A3U A;  4KYS A;  3HV1 A;  2ZNS A;  4ESX A;  1SBP A;  3FVK A;  1B4Z A;  3GBB A;  4ESW A;  3ZKK A;  2NXO A;  1AMF A;  4X9T A;  1BP5 A;  1OQH A;  3PMW A;  3QUF A;  4ONY A;  1GR2 A;  2XXU A;  3TMG A;  3SES A;  1MQI A;  1UTH A;  1NNF A;  4IY5 A;  3HST A;  3KJT A;  5DVI A;  1ELJ A;  4NTL A;  1HSE A;  3S9N C;  2HZL A;  2O69 A;  3KZG A;  1M5E A;  4NMY A;  3T93 B;  3U93 A;  3IAZ A;  3VXC A;  1O7T A;  3RPW A;  1B7U A;  3FD3 A;  1I6B A;  3KN3 A;  2OBG A;  4FED A;  3CIJ A;  4IO3 A;  3T66 A;  4QHQ A;  2RKM A;  3A3C A;  4YB6 A;  4OEV A;  4MF3 A;  4ND9 A;  4ELP A;  1WVJ A;  4PQJ A;  5I2K A;  3VFJ A;  3EF7 A;  2VD3 A;  3IOU A;  4LON B;  4YB5 A;  2DXY A;  2DS9 A;  3C31 A;  4F3B A;  3E4R A;  1B9J A;  2QS3 A;  3UIF A;  4P11 A;  2DE2 A;  2XXV A;  4OHN A;  1MH4 A;  4PE5 B;  5K2X A;  1JVY A;  4EXL A;  3ZS6 A;  4Q5T A;  3U72 A;  3U92 A;  3H06 B;  1SW2 A;  4OER A;  4WED A;  3RUM A;  4F29 A;  1FW0 A;  1MY3 A;  5JEI A;  3B6T A;  4H0W A;  1OVB A;  1PDA A;  1ZIU A;  2UXA A;  3T9V A;  1FTO A;  3H4Z A;  3R26 A;  5A5X B;  4RK2 A;  3MC2 A;  1IUD A;  4U4X A;  4EQ7 A;  1TT1 A;  2YJP A;  4LQ5 A;  3T9H B;  3LUY A;  3SEY A;  2GFE A;  4ZDM A;  2X7Q A;  1CB6 A;  4O3A A;  1LAX A;  5F7V A;  3FJM A;  1B52 A;  4GXS B;  4U1O A;  1MH3 A;  3GLB A;  5I59 A;  1B7Z A;  1FCK A;  4Q0C A;  1YCJ A;  1WDN A;  1N04 A;  2V3Q A;  1OMP A;  3G3H A;  1RYO A;  4G68 B;  2O68 A;  2F7A A;  3ILU B;  2X26 A;  5AA2 A;  3M3F A;  1MQD A;  1T0K A;  3N6T A;  4EQ9 A;  3MVY A;  1VE4 A;  3C33 A;  2UVG A;  2Z8E A;  1MY0 A;  4F2O A;  3OXN A;  5ITP A;  4ZE8 A;  3KN7 A;  2Q8J A;  5I57 A;  3IO6 A;  1IXG A;  2HZK A;  2HCA A;  4KR5 A;  4YKK A;  2HAU A;  3PMV A;  1MM6 A;  3PV0 E;  3KEI A;  4ELR A;  4RK9 A;  4TQU Q;  4YKI A;  3N94 A;  3UA8 A;  1A8E A;  1MRP A;  2X7P A;  4F3S A;  3K01 A;  1S7Y A;  2Z22 A;  3ZKL A;  3TTL A;  1II5 A;  4RY1 A;  2VP1 A;  1H44 A;  4HCY A;  1FTJ A;  4ZEC A;  2Z8D A;  4DXC A;  3FAT A;  4QSC A;  3MVZ A;  4NED A;  3IJX B;  5H8F B;  4GVO A;  3B6W A;  1IIW A;  4R9F A;  3PPQ A;  1DTZ A;  5L9O A;  1JEV A;  1MXZ A;  3IB2 A;  4QFK A;  4G68 C;  4OVJ A;  4PFU A;  1MS7 A;  3VLW A;  5HPQ A;  3HO7 A;  4H1X A;  5EHS A;  4QSD A;  4R9G A;  1MXW A;  3KBR A;  1UQW A;  3TTN A;  3CVG A;  4NF5 B;  1NH7 A;  4NWC A;  2QMX A;  3ECR A;  1GV8 A;  1CE2 A;  1B32 A;  3TAJ A;  4HW8 A;  4XKN A;  1NNT A;  4C1T A;  2XX8 A;  3IR1 A;  2A5S A;  1USY E;  2Y7W A;  4HS7 A;  5FTI A;  2V84 A;  2Q9T A;  3MZ9 A;  2XXT A;  2O7I A;  2XXH A;  3OEM A;  1FTK A;  1R6Z A;  2I0C A;  3KFM A;  3OMB A;  2QPQ A;  2O84 X;  4OFO A;  2I3V A;  2DQV A;  1I6Q A;  3CG3 A;  4EQB A;  1ANF A;  1Q1K A;  5H8H A;  3C4M A;  1B3H A;  4PFW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...