3UIFA

Crystal structure of putative sulfonate abc transporter, periplasmic sulfonate-binding protein ssua from methylobacillus flagellatus kt
Total Genus 111
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
330
structure length
330
Chain Sequence
VEDLKVVRIASVATNVGGKTVYAGSASLVVNGAFPEELRKQGIKVEWVPAAMASVGPVINEGFASGKIDFGIYGDLPPIILNASKPTVQLVAPWGTTSNSYLVVPKNSTAKSIKDLKGKKIALHRGRPWELAFSNLLQSEGLTFKDFKIVNVNPQVGAAALASGTVDGFFSLFDSYILEDRGVGKIIWSTKTAPVDWKLMGGVWARNDFVKQNPEITQAIVTAYLKSVHWVAQDENKETYIREYSNKIYPESVNRREYDQDNVSWRQRWSPLYDVALQEHYRKAVAYAQASGLTRTQADVQQMLNPHFVATALKELKLEGFWTPNAENLY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Sulfonate ABC transporter, periplasmic sulfonate-binding pro
publication title CRYSTAL STRUCTURE OF putative sulfonate ABC transporter, periplasmic sulfonate-binding protein SsuA from Methylobacillus flagellatus KT
rcsb
source organism Methylobacillus flagellatus
total genus 111
structure length 330
sequence length 330
ec nomenclature
pdb deposition date 2011-11-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3uifA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3uifA01
1MQHA 4KD5A 4IGRA 4ND9A 4H8JA 4JBZA 4XTCQ 1Y4CA 4KPTA 3IAZA 5BWJA 1J1NA 5I59B 4NWCA 2RC9A 1SW5A 4I9DA 4XIGQ 3TEPA 3K4UA 5F1QA 1B1XA 2Q2AA 1N7XA 3A3UA 1O63A 3G3IA 2PYYA 4R6HA 2GFEA 3ECRA 3MC2A 1SW2A 5I56A 4PFTA 3RTWB 2F78A 2HXWA 3ZS6A 3DP8A 4OQOA 3S9NC 4R6YA 1LFIA 4WEDA 1L5TA 2HZKA 1P1WA 4KYEA 3HHGA 5ITOA 5CBSA 1JEUA 3S9MC 3M8UA 4YKKA 4NTLA 5EYFA 3OXNA 4NF6A 1Y9UA 3T93B 3G3KA 4IO7A 4GIZA 2NVUB 2Q88A 3DELB 3Q29A 2XXRA 3VFJA 2GHAA 1JQFA 4NF5B 5I2KB 2XXUA 3ZSFA 1A99A 2XXVA 4IO6A 3FIRA 2ZNTA 5L8DA 3GZGA 1SQYA 3PUZE 5M2VA 3MZBA 2X7PA 4H5GA 4H67A 1FQBA 4ZDMA 3OO8A 1NKXA 4PQJA 2HCAA 1B2HA 1B7UA 1WDNA 1Y4TA 3E13X 4EXLA 2H99A 1YPNA 3UA8A 5ICQA 4U1ZA 3PPOA 1UTBB 4IO5A 2R71A 2GH9A 3RPWA 4NMYA 3DP4A 3JYRA 4NF8A 3K1NA 3EHUA 1B6HA 2XX7A 3OD7A 4BDRA 4KCCA 1MPBA 2OBGA 1TFDA 4YMAA 1I6BA 1FTLA 1HSLA 4GXSB 4ZE9A 4RK2A 4ZEDA 5ITPA 3KSXA 3LSWA 3O2AA 1GVCA 5FHNA 4R72A 3UORA 4ECFA 1PC3A 1GGGA 3VVFA 1OLCA 2PT1A 4GRKA 5I84A 3S9LC 1B7ZA 4U4SA 3USDA 3K1MA 3OENA 1LAHE 4M1VA 5H8QA 3E4RA 4ZS9A 1LAGE 4OXVA 3F11A 3PMWA 2HFBA 3OSRA 1OMPA 1QVSA 3T66A 1MH3A 1MY2A 4YKIA 4F3BA 3QUFA 4EF1A 3N5LA 3QK6A 1XS5A 4ZEFA 3PPNA 1IZ1A 4E0WA 4DCXA 1FTOA 4HTGA 4YAHX 1Q35A 1B40A 2F5XA 1LB8A 3G3JA 1LBCA 3EHTA 2RC8A 1MQGA 1O7TA 2RF1A 3BKIB 1PBPA 4XKNA 4Q0CA 4EQ7A 2V3TA 1JNFA 4ZEBA 1T0KA 3CFXA 3SKPA 4G68A 2XXTA 5ICTA 1HSEA 1US5A 2F35A 1SW1A 1IEJA 3CI8A 2Q2CA 5EHSA 1LLSA 2PMSA 1B5IA 4MH5A 3PUWE 2I4BA 4IO2A 4RJZA 4FATA 3OSQA 2Y84A 5DT6A 3C33A 5L9MA 1B3EA 2P1SA 4BDMA 4XKRA 1VR5A 2FA7A 3H7MA 2Y7WA 5HBCA 3T9HB 4FAJA 2O7UA 3FXUA 4LATA 3OO9A 4YB7A 2AL5A 1LAXA 3RTFB 2HAVA 2I4CA 2Y7IA 1LB9A 3O9PA 2O7IA 3KG2A 3PV0E 3TAJA 4JWYA 3ONMA 3JZJA 4KR5A 2ABHA 2LAOA 3TELA 3TFLA 1D9VA 3MUQA 4GWOA 3B6QA 1I6QA 3OO6A 3K6WA 2AL4A 4UACA 3IB0A 1PB8A 2Z8DA 1M5FA 4PFUA 5CMMA 3FVGA 4R2BA 3KJTA 1H44A 3PD8A 2ZNSA 2VP1A 3M3FA 4WEPA 3GBBA 4Z7EA 4R9FA 4WXJA 3IORA 4IY5A 4MBPA 1YCJA 3QSLA 3I5OA 4MF3A 4U4XA 2PT2A 1MDQA 4FECA 4RYAA 2FNCA 3PPPA 4F3GA 3TZAA 3U92A 1MXYA 3SESA 3SERA 1TXFA 1RKMA 4POWA 3SETA 3BFUA 4DZ1A 1M5CA 1DPPA 2OWSA 3V8XB 2A5TA 4TQUQ 2V3UA 3IB1A 1A55A 3MZ9A 4G77A 1B58A 3SEWA 4JB7A 1FQEA 2NUVA 4ZEKA 5CMBA 5CM6A 1IUDA 4ESWA 1P1QA 3O29A 2AIXA 3T9VA 4POXA 1H43A 3IK6B 3K1PA 4FJPA 3V5AA 5AA3A 5CBRA 2B3FA 3CRBA 5HM4B 4R75A 1ZKBA 2UVIA 5KDTA 3E9XA 1Z7NE 5L9OA 2HZLA 1PDAA 1URGA 4OWDA 2O51A 3U8QA 3S9EA 4ESXA 1MY4A 3I3VA 3FVNA 3R7XA 3B7DA 5K2XA 2XD3A 1XC1A 2Z8FA 2V84A 5B7DA 1F9BA 1UIUA 3IO4A 3CFLA 3U1OA 1LGBC 2I58A 3PUXE 3CSBA 3C31A 5EHMA 4OFOA 4MLQA 4OMBA 2REGA 2X26A 1DSNA 1B51A 3K6UA 2Y7KA 4G68B 1MPDA 1IQ7A 2HEUA 3OEKA 1P1OA 5CMKA 3T96B 2F7AA 3K00A 3VDFA 3RY3A 5H8NA 1N04A 4I1DA 3GXAA 1SW4A 1OQHA 4P0GA 4HW8A 5DEXB 2XXPA 3H6VA 1II5A 3N6TA 2DWHA 3FVOA 5DVIA 5AA4A 1MG1A 1N0TA 4QFLA 4N07A 4KCDA 1MM7A 5TP9A 5CC2A 4R74A 2IEEA 1I6AA 2RC7A 5JTYA 3K02A 2DE4A 4JSDA 3EF7A 3H6UA 3A09A 1A8FA 4OEVA 4FEBA 2QS2A 1B32A 1H45A 1MM6A 4JSOA 3VLWA 5AA1A 1LCFA 1JW1A 3RNNA 2OJTA 4F3SA 1B7HA 1MQJA 1QJMA 1LFGA 3KOTA 3O6GA 1NNTA 3D4GA 2GHBA 1UTHB 2I0CA 4OESA 1P99A 1POTA 4RA1A 4LUBA 3WAEA 4AB5A 1QKBA 3PU5A 3FV1A 4OYVA 3CSGA 2A5SA 3K6VA 2F8DA 1JVYA 2WKYA 4R9GA 3IX1A 1EZPA 3CG3A 4K3FA 1LCTA 3T9UA 5JEIA 1ZIUA 5B70A 2P2AA 1QUKA 2QSXA 4LQ2A 2G93A 1QULA 1MDP1 4JDFA 5KCJA 4G68C 3LSXA 3G3FA 3RT6B 1URDA 3MP1A 3MVYA 2A5TB 3HPIA 5H8FB 1A54A 3TUSA 1KWHA 3C9HA 1M5BA 4O3BA 2Z22A 2DE2A 4F29A 3KFMA 3JV9A 1R6ZA 2M8CA 2I48A 4FORA 2XX8A 3CG1A 4DCYA 3Q28A 4THIA 1H3DA 4DIGA 1Z7ME 2FYIA 3FV2A 3QIMA 3PPQA 2OZZA 3C4MA 4Q8RA 1SYHA 2HAUA 1JW4A 3Q25A 3G3HA 3MJNA 4MLVA 3MBPA 4R73A 1EZ9A 3TQWA 5I2NB 3T22A 2F7CA 5A5XA 4RPNA 3V83A 2B3BA 5CMCA 2H5YA 5I57B 3ODBA 4LZ5A 4EDPA 2Z8EA 2F36A 4F19A 4WKMA 2UVGA 1R1NA 3FATA 5AA2A 1VE4A 4G8MA 1NFTA 4OERA 4Q5TA 2V25A 1FQFA 4IGTA 4NWDA 4U2RA 3O6IA 3PPRA 3TTMA 1CB6A 4BDQA 1PB7A 5DVJA 2VHAA 3K2DA 3SDFA 4H6DA 3IOTA 2UVHA 2ONRA 2E1SA 1GV8A 5L9SA 3TTNA 3W9WA 3LSFB 3HO7A 4IB2A 4YU0A 1Y3QA 1ZMGA 1MXWA 3IR1A 3PD9A 1P1NA 4H8IA 4YICA 2RKMA 3BBRA 2QS4A 1B3FA 3FJ7A 1ZTYA 4NF4A 3U72A 5I56B 4XKPA 2O6AA 4EQBA 1RYOA 2P0SA 1B4HA 1JEVA 3I6VA 3S2VA 1LBBA 4XXUA 3LC8A 3TCFA 2DVCA 2QJEA 3N6UA 3Q26A 3FUZA 2D5WA 1LSTA 3TPAA 4YZZA 3ZKLA 4G4PA 2PX1A 1IXGA 4NF6B 4RNSA 5I58A 4ISUA 3RQTA 5TPAA 5F7VA 3ZKKA 1YTVA 4C1TA 1JVXA 4U23A 1ZLQA 4O3CA 3O97A 2Q9TA 3RLFE 3TYHA 1R9QA 2XXXA 2QMWA 1Y3NA 4X48A 4C1UA 5I59A 1FCKA 4U1OA 4F3PA 4QFOA 2X7QA 1MXXA 2REJA 1GR2A 1BP5A 1Y1MA 3KOSA 1GTKA 2THIA 3FGSA 5CI5A 3VXCA 2RINA 4X1BA 1USYH 3OO7A 1MH4A 4KI0E 4PFYA 2NXOA 1DMBA 3QAXA 4NF8B 4ZE8A 3R6UA 4F18A 4Q30B 4RXLA 4OTEA 2DVZA 1B3HA 1NNKA 4KQPA 1BIYA 1Q1KA 3VXBA 5TU0A 1O64A 5BUUA 3DM0A 3FXQA 3TTRA 2RCBA 2D21A 1FQCA 2ZYNA 4GFRA 3M3LA 5H8HA 4HCYA 4F2QA 2CZLA 2D3IA 1NNFA 3FASA 4FIMA 3E3KA 3KBRA 5I2KA 3TODA 2ESNA 2QL3A 4OFJA 3VVEA 1MQDA 5H8QB 1B3LA 5K2YA 1XOCA 2F34A 1XHYA 2AYSA 2B65A 4PFWA 1IXHA 1B0HA 3D4CA 3H6TA 3TCHA 2HQ0A 4PE5B 2O69A 3VE1B 1PB9A 4G8NA 2Q8JA 2RCAA 3PGFA 4DLDA 4GF8A 3IO6A 1P1UA 3FZVA 3UN6A 1IXIA 5CRYA 1A8EA 3FJGA 3OOAA 3MP6A 3MPKA 4YKJA 5AA2D 1OVTA 3LUYA 4OVJA 4GLIA 2QPQA 4PETA 2DOJA 3KEIA 3L6GA 4GD5A 3PMXA 1SYIA 2UYEA 1AL3A 2XHDA 1PBQA 4M4GA 3K01A 3H4ZA 2DP8A 4TOZA 3TTKA 1BLFA 3C36A 4H0WA 1PEBA 4AQ4A 1NL5A 1SBPA 4YKPA 4GQOA 1IIWA 5DVFA 2ZNUA 3PMVA 3SEVA 3UIFA 4QHQA 3H6WA 3PUVE 4QRZA 1FTMA 2IA4A 1OVBA 4KFQA 3LR1A 2DWJA 1OIBA 4EXKA 3DLNA 4X9TA 1WVJA 1IITA 5TPAB 4BDLA 3TDJA 2Q89A 4OHNA 4DXCA 1EU8A 1B5HA 3CVGA 1CE2A 4QFPA 1S9TA 2UYFA 2F7BA 1FTKA 1MXZA 2H9BA 4GL8A 2BJJX 1M5DA 4OZ9A 4U21A 4ZZEA 2VGQA 2VOZA 1A7LA 2YPNA 2ANJA 2H98A 2PBWA 2NOOA 4QSDA 2UXAA 3ILUB 1EZOA 1N3WA 1MQIA 1ATGA 4MFIA 1SD3A 2QMXA 2QRYA 2XXYA 1JETA 3IJXB 2ZYMA 2OLBA 1MY3A 3SEUA 3KN3A 5KZTA 4P0IA 4H1XA 4DXUA 4AB6A 4NE4A 3VV5A 4XKQA 4N6PA 2V93A 4RY1A 2R6GE 3FVKA 3C34A 3MZ1A 4DXBA 4EQ9A 1VFDA 4LA9A 3ILTB 3VLUA 4IY6A 3HSTA 5H8HB 3SEYA 4LZ8A 1ANFA 4DE8A 4FE8A 3OELA 3B6TA 5FHMA 4PP0A 2DE3A 2CMOA 3OMBA 3LBSA 1ZJLA 2XXWA 3G7WA 3QUJA 3MW0A 3O66A 4O3AA 1B05A 4C0RA 4ELQA 2VD3A 1POY1 3TMGA 5KDTB 4GOTA 4TLMB 4YMBA 4P11A 1FQDA 4U22A 3UGWA 1ZU0A 1BTJA 3CIJA 3IOUA 4F31B 2DSFA 2XXQA 1MS7A 4X1DA 1URSA 1EH3A 1B9JA 3HCQA 1MY1A 3UP9A 3AXFA 1QUIA 4BDNA 3MP8A 2YLNA 4YB5A 2ZMBA 1B52A 4QF9A 3KN8A 4LQ5A 4OENA 4R6KA 2ONSA 3UK4A 2PVUA 5FHOA 1Y1ZA 2Z23A 2DWAA 5FTIA 4JWOA 1MPCA 4GVOA 4F39A 5H8NB 4F1YA 3LSLA 3DP6A 2Y7PA 4KHZE 3SEXA 4OEUA 4ONYA 5HPQA 2W7YA 1LFHA 3CR9A 4GXAA 2O1MA 2I3WA 4ELRA 2Y7RA 4QSCA 3MQ9A 5AA4B 1UQWA 1Y3PA 3THIA 5TP9B 1MXVA 3H3GA 1TFAA 3S4UA 1N76A 3W15C 3HHFA 1ELJA 2DS9A 1B1HA 2I3VA 5JTYB 4QFKA 5ELVA 3FD3A 2O68A 1SI0A 2QS1A 1OLAA 4H65A 1NH7A 2ZXTA 1USYE 3M3KA 2XXIA 2ALUA 5ISUA 4QSEA 1NMUA 3MWBA 4G2ZA 3FJMA 3P7IA 1B0LA 1AIVA 4YB6A 3KSJA 1WODA 1VFEA 2E0SA 4RPOA 4RK9A 5JK4A 3U94A 4BLAA 1US4A 2OK2A 1NNPA 2XXHA 3C32A 1FTJA 4ELOA 1A40A 2I6EA 3QYTA 5DEXA 1QUJA 3KZGA 3RN8A 4UA8A 1RYXA 2DXRA 1AMFA 5LOMA 1B3GA 4NEDA 5H8SA 2ZYOA 4F1UA 4Z0IA 4ZZAA 3EN3A 3C35A 1JW5A 4I62A 3RT8A 1SDXA 4F2OA 3TTLA 2O84X 1MXUA 4JXIA 5IKBA 1XVYA 5KCJB 3W9VA 4LVQA 5DYHA 3RUMA 3FXRA 5FTHA 1DOTA 1D3KA 3HN0A 1AH5A 3H06B 3MVWA 3KJ7A 3EQ1A 2GRVA 2H25A 3IB2A 1TT1A 4QFNA 1S50A 3A3CA 4GL0A 3O6HA 3TKDA 2XD2A 1N84A 2KLFA 1UTHA 4KYSA 3Q27A 3L6HA 1R9LA 1B4ZA 3IOWA 4ELPA 4G8HA 3N94A 4BDOA 1S7YA 1MY0A 3GBAA 4KYDA 3IJOB 2YJPA 3G3GA 2DXYA 2DYXA 2I49A 4ZECA 3V89B 3RGYA 1H76A 3B6WA 4IO3A 3K0VA 4NF5A 1FQAA 5A5XB 1D9YA 4HCWA 2ONKE 1SI1A 1MRPA 3N26A 3MVZA 3BFTA 3T9XB 1N3XA 3EPEA 3WAFA 3OEMA 4HS7A 1I69A 2UVJA 3MAMA 5H8FA 3MPLA 4E0XA 5AA2B 1M5EA 1UIVA 1B46A 3TCGA 1YAEA 1UTBA 3U93A 2O1LA 3H03A 2V3QA 4H5FA 3MVXA 4DDDA 2F6GA 2H4IA 4LZ7A 3QXMA 3KGCA 3VLVA 5AE4A 2I0BA 2F97A 1SVXB 2OCUA 5J1DA 1XT8A 4FEDA 4LONB 1VSOA 1QKAA 2R9JA 3IL1B 1Y20A 4F1VA 1IXCA 3O28A 1DPEA 1FW0A 4R2FA 1AOVA 1NH8A 1OQGA 4N13A 1LAFE 4L17A 5DTBA 2G29A 3IOVA 2DWIA 1N7WA 1HSJA 5IAIA 1DTZA 5I2NA 2QS3A 4TLLB 4NF4B 2OWTA 1ZBMA 2NWJA 3CFZA 3R26A 5I57A 4LP2B 3TQLA 4ZEIA 3VVDA 4EF2A 1QW0A 2ZYKA 3GLBA 3EHSA 4F22A 4I8CA 3PUYE 4OFLA 1DTGA 2XX9A 1B5JA 1XVXA 1TWYA 2DQVA 3KN7A 3K6XA 4EUOA 5I58B 3HV1A 2VD2A 1D4NA 4OETA 4JWXA 2F6PA 1BKAA 4IO4A
chains in the Genus database with same CATH superfamily
1MQHA 4KD5A 4IGRA 4ND9A 4H8JA 4JBZA 4XTCQ 1Y4CA 4KPTA 3IAZA 5BWJA 1J1NA 5I59B 2WX9A 4NWCA 2RC9A 1SW5A 4I9DA 4XIGQ 4P8BA 5J16A 3TEPA 3K4UA 5LTCA 5F1QA 1B1XA 5I7IA 2Q2AA 1N7XA 3A3UA 1O63A 3G3IA 2PYYA 4N8YA 4NQ8A 5DW8A 4R6HA 2GFEA 3ECRA 2F3DA 3MC2A 1SW2A 5I56A 4PFTA 3RTWB 2F78A 2HXWA 3IFAA 3ZS6A 3DP8A 4OQOA 1FBPA 3S9NC 4R6YA 1LFIA 4WEDA 1L5TA 2HZKA 1P1WA 4KYEA 3HHGA 5ITOA 1SPIA 5CBSA 1JEUA 3S9MC 2CZHA 3M8UA 4YKKA 4NTLA 5EYFA 3OXNA 4NF6A 1Y9UA 2XWKA 3T93B 4MX6A 3G3KA 4IO7A 4GIZA 2NVUB 2Q88A 3DELB 3Q29A 2XXRA 3VFJA 4N8GA 1DBZA 2GHAA 1JQFA 4NF5B 5I2KB 2XXUA 3ZSFA 1A99A 2XXVA 4IO6A 3FIRA 2ZNTA 5L8DA 3GZGA 1SQYA 3PUZE 5M2VA 3MZBA 2X7PA 1EYJA 4H5GA 4IR8A 4H67A 3QMFA 1FQBA 4ZDMA 2PFZA 3OO8A 1NKXA 4PQJA 2HCAA 1B2HA 1B7UA 1WDNA 1Y4TA 3E13X 2DDKA 4EXLA 2H99A 1YPNA 3UA8A 5ICQA 3PTYA 4U1ZA 3PPOA 1UTBB 4IO5A 2R71A 2GH9A 3RPWA 4NMYA 3DP4A 3JYRA 4NF8A 3K1NA 3EHUA 1LBXA 1B6HA 2XX7A 3OD7A 4BDRA 4KCCA 1MPBA 2OBGA 1TFDA 4YMAA 1I6BA 1FTLA 1HSLA 4GXSB 4N6KA 4DI3D 4ZE9A 4QXDA 4RK2A 4ZEDA 5ITPA 3KSXA 3LSWA 3O2AA 4P9KA 1GVCA 5FHNA 4R72A 3NOHA 3UORA 4ECFA 1PC3A 1GGGA 3VVFA 1NV2A 1OLCA 2PT1A 4GRKA 5I84A 3S9LC 1B7ZA 4U4SA 3USDA 1NV7A 3K1MA 3OENA 1LAHE 4M1VA 5H8QA 3E4RA 4ZS9A 1LAGE 4OXVA 4O94A 4N6DA 3F11A 3PMWA 4XFEA 1XI6A 2WBDA 2HFBA 3OSRA 4OVRA 2B4LA 1OMPA 1QVSA 3T66A 1MH3A 1MY2A 2HHMA 4YKIA 4F3BA 3QUFA 4EF1A 4NN3A 3N5LA 3QK6A 1FPEA 1XS5A 4ZEFA 3PPNA 1IZ1A 4E0WA 4LN5A 4DCXA 4N91A 2HPGA 1NV4A 1FTOA 1CNQA 4HTGA 4YAHX 1Q35A 1B40A 2F5XA 1LB8A 4PGNA 3G3JA 1LBCA 4HE2A 3EHTA 4G61A 4GWUA 2RC8A 1MQGA 1O7TA 2RF1A 3BKIB 1PBPA 4XKNA 4Q0CA 4EQ7A 2V3TA 1JNFA 4ZEBA 1T0KA 3CFXA 3SKPA 4G68A 2XXTA 5ICTA 3E78A 1HSEA 5ET8A 1US5A 2F35A 1SW1A 1IEJA 3CI8A 2Q2CA 4NX1A 5EHSA 1LLSA 2PMSA 1FJ9A 1B5IA 4MH5A 3PUWE 2I4BA 2V4CA 4IO2A 4RJZA 3HFUA 4FATA 3OSQA 2Y84A 3CHGA 5DT6A 5IGAA 3C33A 4OVQA 5L9MA 1B3EA 2P1SA 4BDMA 4XKRA 1VR5A 2FA7A 3H7MA 5IZZA 2Y7WA 5HBCA 3T9HB 2O7UA 3FXUA 4FAJA 4LATA 3OO9A 4YB7A 2AL5A 1LAXA 3RTFB 2HAVA 4O8MA 2I4CA 2Y7IA 1LB9A 3O9PA 2O7IA 3KG2A 3PV0E 3TAJA 4JWYA 3ONMA 3JZJA 4KR5A 2ABHA 2LAOA 3TELA 4P3LA 3TFLA 1D9VA 3MUQA 4GWOA 3B6QA 1I6QA 4H46A 3OO6A 3K6WA 2AL4A 2FIXA 4H45A 4UACA 1FBDA 3IB0A 1PB8A 2Z8DA 1M5FA 4MNPA 4PFUA 1EYKA 2PCRA 4PDDA 5CMMA 3FVGA 4R2BA 1FBFA 3KJTA 1H44A 4NAPA 3PD8A 1FBEA 4MIJA 2ZNSA 2VP1A 4NF0A 3M3FA 4WEPA 3GBBA 4Z7EA 4R9FA 4WXJA 5EQAA 3IORA 4IY5A 4MBPA 1YCJA 3QSLA 4OVPA 2GQ1A 3I5OA 4MF3A 1NUWA 4U4XA 2PT2A 1MDQA 4FECA 4RYAA 2FNCA 2R8TA 3PPPA 4PC9A 2L5VA 4F3GA 3TZAA 3U92A 1MXYA 3SESA 3SERA 1TXFA 1RKMA 4POWA 5ET7A 3SETA 3BFUA 1FRPA 4DZ1A 1M5CA 1DPPA 2OWSA 3V8XB 2A5TA 4TQUQ 2V3UA 3IB1A 1A55A 3MZ9A 4G77A 1B58A 3SEWA 4JB7A 1FQEA 2NUVA 4ZEKA 5CMBA 5CM6A 1IUDA 4ESWA 1P1QA 1NUXA 3O29A 2AIXA 2HXRA 3T9VA 4PF8A 4POXA 1H43A 2FBPA 3IK6B 3K1PA 4FJPA 3V5AA 5AA3A 5CBRA 2B3FA 3CRBA 5HM4B 4R75A 1ZKBA 2UVIA 5KDTA 3E9XA 1Z7NE 5L9OA 2HZLA 1PDAA 1URGA 4OWDA 2O51A 3U8QA 3S9EA 4ESXA 1MY4A 3I3VA 3FVNA 3R7XA 3B7DA 5K2XA 2Q8MA 2XD3A 3B50A 1XC1A 2Z8FA 2V84A 5B7DA 1F9BA 5F24A 1UIUA 3IO4A 3CFLA 3U1OA 1LGBC 2I58A 3PUXE 4X04A 3CSBA 3C31A 5EHMA 4OFOA 4MLQA 4OMBA 2REGA 3T0JA 2X26A 1DSNA 1B51A 3K6UA 2Y7KA 4G68B 1MPDA 1IQ7A 2HEUA 3OEKA 2OWZA 1P1OA 5CMKA 1VDWA 4FBPA 4OANA 3T96B 1LBZA 2F7AA 3K00A 3VDFA 1NV0A 3RY3A 5H8NA 1N04A 4I1DA 3GXAA 4AS4A 4UABA 1SW4A 1OQHA 4P0GA 4HW8A 5DEXB 2XXPA 3H6VA 1II5A 3N6TA 2DWHA 3FVOA 5DVIA 5AA4A 1MG1A 1N0TA 1IMFA 4QFLA 4P47A 4N07A 4KCDA 5IZ1A 1MM7A 5TP9A 3T1BA 5CC2A 4JVIA 4R74A 2IEEA 1I6AA 2RC7A 5JTYA 3K02A 2DE4A 4JSDA 3EF7A 3H6UA 3A09A 1A8FA 4OEVA 4FEBA 2QS2A 1B32A 1H45A 1MM6A 4JSOA 3VLWA 5AA1A 1LCFA 1JW1A 3RNNA 2OJTA 4F3SA 4PAIA 1B7HA 1MQJA 1QJMA 1LFGA 3KOTA 3O6GA 1NNTA 3D4GA 4GWZA 2GHBA 1FPJA 1UTHB 4O7MA 2I0CA 3U65A 4OESA 1P99A 1POTA 4RA1A 1NV1A 4LUBA 2CZKA 3WAEA 2FVZA 2XXKA 4AB5A 1QKBA 1YZ0A 3PU5A 3FV1A 4OYVA 3CSGA 2A5SA 3K6VA 2F8DA 1JVYA 2WKYA 4R9GA 3IX1A 1EZPA 3CG3A 4K3FA 1LCTA 3T9UA 1FSAA 5JEIA 1ZIUA 5B70A 2P2AA 2WYKA 1QUKA 2QSXA 4LQ2A 2G93A 1FBCA 4HXVA 1QULA 1QGXA 1MDP1 4JDFA 5KCJA 4G68C 3LSXA 3G3FA 3RT6B 1URDA 3MP1A 3MVYA 2A5TB 3HPIA 2F3BA 4MMPA 5H8FB 1A54A 5EQ7A 4GX3A 3TUSA 1KWHA 1LBWA 3C9HA 1M5BA 4O3BA 2Z22A 1Q9DA 2DE2A 4F29A 3KFMA 3JV9A 1R6ZA 2M8CA 2I48A 4FORA 2XX8A 3CG1A 4DCYA 2FIEA 3Q28A 4THIA 1H3DA 4DIGA 1Z7ME 2FYIA 3FV2A 3QIMA 3PPQA 2OZZA 3C4MA 4Q8RA 1SYHA 2HAUA 1JW4A 3Q25A 3G3HA 3MJNA 4QBAA 4OA4A 4MLVA 3MBPA 4R73A 1EZ9A 4GBVA 4GWSA 3TQWA 5I2NB 2Y5LA 3T22A 2F7CA 5A5XA 4RPNA 2XA5A 3V83A 2B3BA 3BIHA 5CMCA 2H5YA 1EYIA 5I57B 3ODBA 4LZ5A 2Z8EA 4EDPA 2F36A 4PFRA 3IFCA 4F19A 4WKMA 2UVGA 1R1NA 4NGUA 2WEFA 3FATA 3EKIA 5AA2A 1VE4A 4G8MA 1NFTA 4OERA 4Q5TA 2V25A 1BK4A 1FQFA 4IGTA 4NWDA 1NV5A 4U2RA 3O6IA 3PPRA 3TTMA 1CB6A 3MSTA 4BDQA 2PFYA 1PB7A 5DVJA 2VHAA 3K2DA 3SDFA 4H6DA 3IOTA 2UVHA 2ONRA 2E1SA 1GV8A 5L9SA 4I3YA 3TTNA 3W9WA 3LSFB 3HO7A 4IB2A 4YU0A 1Y3QA 4PTKA 1ZMGA 1MXWA 3IR1A 3PD9A 1P1NA 4H8IA 4YICA 3D1RA 2RKMA 3BBRA 4PBHA 2QS4A 1B3FA 3FJ7A 1ZTYA 4NF4A 3U72A 5I56B 4XKPA 4GWXA 1FPDA 2O6AA 4EQBA 1RYOA 2P0SA 1B4HA 4PE3A 4MNIA 1JEVA 3I6VA 1LEVA 4GBWA 3S2VA 1LBBA 4XXUA 3LC8A 3TCFA 2DVCA 2QJEA 3N6UA 3Q26A 3FUZA 2D5WA 1LSTA 2MKZA 2WBBA 4JVCA 3TPAA 4YZZA 3ZKLA 3RPLA 4G4PA 2PX1A 1IXGA 4NF6B 4RNSA 5I58A 4ISUA 3RQTA 5TPAA 5F7VA 3ZKKA 1YTVA 4C1TA 1JVXA 4U23A 1FPIA 1NI9A 1ZLQA 4O3CA 3O97A 2Q9TA 3RLFE 1FTAA 3TYHA 1R9QA 2XXXA 2QMWA 1Y3NA 4X48A 4C1UA 5IM2A 5I59A 1FCKA 4U1OA 4F3PA 4QFOA 2X7QA 1MXXA 2REJA 1GR2A 1BP5A 1Y1MA 1NUYA 3KOSA 1GTKA 2THIA 3FGSA 5CI5A 3VXCA 4XF5A 4PFIA 2RINA 4X1BA 1USYH 3OO7A 1MH4A 4KI0E 4PFYA 2NXOA 2VPOA 1DMBA 3QAXA 4NF8B 4PCDA 4ZE8A 3R6UA 4F18A 4Q30B 4RXLA 1NUZA 4X8RA 4OTEA 2DVZA 1B3HA 1NNKA 1AWBA 3GYYA 2XWVA 4KQPA 1BIYA 1Q1KA 3VXBA 5TU0A 1KA1A 1O64A 5BUUA 3DM0A 3FXQA 3TTRA 2KQZA 4MNCA 2RCBA 2D21A 1FQCA 2ZYNA 4GFRA 3M3LA 5H8HA 4HCYA 1RDZA 4F2QA 2CZLA 2D3IA 1NNFA 3FASA 4FIMA 3E3KA 3KBRA 5I2KA 3TODA 2ESNA 2QL3A 4OFJA 3VVEA 1MQDA 4HE0A 2FHYA 5H8QB 1B3LA 5K2YA 1XOCA 2F34A 1XHYA 2AYSA 2B65A 4PFWA 4MCOA 1IXHA 1B0HA 3D4CA 3H6TA 3TCHA 2HQ0A 4PE5B 4MEVA 2O69A 3BIGA 3VE1B 1PB9A 4G8NA 2Q8JA 2RCAA 4GWYA 3PGFA 4DLDA 4GF8A 3IO6A 1P1UA 3FZVA 3UN6A 1IXIA 5FBPA 5CRYA 1A8EA 1DK4A 2Q74A 2ZZWA 2QFLA 3FJGA 3OOAA 3E79A 4P1LA 3MP6A 3MPKA 5I3SA 4YKJA 5AA2D 1OVTA 3LUYA 4OVJA 4GLIA 5IZ3A 2QPQA 4PETA 2DOJA 3KEIA 3L6GA 2VPNA 1G0HA 4GD5A 3PMXA 1SYIA 2UYEA 1AL3A 2XHDA 3B8BA 1PBQA 4M4GA 3K01A 3H4ZA 2DP8A 4TOZA 3TTKA 1BLFA 3C36A 4H0WA 1PEBA 4AQ4A 1YYZA 1NL5A 1IMDA 1SBPA 4YKPA 4GQOA 1K9ZA 1IIWA 5DVFA 2ZNUA 3PMVA 3SEVA 3UIFA 1K9YA 4QHQA 5ESYA 3H6WA 3PUVE 4QRZA 1FTMA 4P1EA 2IA4A 1OVBA 4KFQA 3LR1A 2DWJA 1OIBA 4NG7A 4EXKA 3RPLB 3DLNA 4AS5A 4X9TA 1KA0A 1WVJA 1IITA 5TPAB 4BDLA 3TDJA 2Q89A 2ZZVA 4OHNA 4DXCA 1EU8A 1B5HA 1INPA 3CVGA 4PBQA 1NV3A 1CE2A 4QFPA 1S9TA 2UYFA 4N15A 2F7BA 1FTKA 1MXZA 2H9BA 4GL8A 2BJJX 5I5PA 1M5DA 4OZ9A 4U21A 4ZZEA 2VGQA 2VOZA 1A7LA 2YPNA 2ANJA 2H98A 2PBWA 2NOOA 4QSDA 2UXAA 3ILUB 2Y5KA 1EZOA 1FPGA 1N3WA 1MQIA 1ATGA 4MFIA 4GWWA 1SD3A 2QMXA 2QRYA 2XWIA 2XXYA 1JETA 3IJXB 2ZYMA 2OLBA 1MY3A 3SEUA 3KN3A 5KZTA 4P0IA 4H1XA 4DXUA 4AB6A 4NE4A 1YXIA 3VV5A 4XKQA 1FPKA 4N6PA 2V93A 4RY1A 2R6GE 3FVKA 3C34A 3MZ1A 4DXBA 4EQ9A 1VFDA 2WYPA 1FPBA 4LA9A 3ILTB 4PAFA 3VLUA 4IY6A 3HSTA 4GX4A 5H8HB 3SEYA 4LZ8A 1ANFA 4DE8A 4FE8A 4MHFA 3OELA 4XEQA 1IMBA 3B6TA 4MJOA 1JP4A 5FHMA 4GX6A 4PGPA 4PP0A 2DE3A 2CMOA 3OMBA 3LBSA 1ZJLA 2XXWA 3G7WA 2KR0A 3QUJA 3MW0A 4PFBA 3O66A 4O3AA 1B05A 4C0RA 4ELQA 2VD3A 1POY1 5ET6A 3TMGA 5KDTB 4GOTA 2BJIA 4TLMB 4YMBA 4P11A 5ET5A 1FQDA 4U22A 3UGWA 1ZU0A 1BTJA 3CIJA 3IOUA 4F31B 1RDYA 2DSFA 2XXQA 1MS7A 4X1DA 1URSA 1EH3A 5EQ9A 3RYDA 1B9JA 3HCQA 1MY1A 3UP9A 3AXFA 1QUIA 4BDNA 3MP8A 1FJ6A 5IZ3B 2YLNA 4DI4B 4YB5A 2ZMBA 4OVSA 2B4MA 1B52A 4QF9A 3ISPA 3KN8A 5A5LA 4LQ5A 1G0IA 4OENA 4R6KA 2ONSA 3UK4A 1DCUA 2PVUA 3KBZA 5FHOA 1Y1ZA 2Z23A 2DWAA 5FTIA 4JWOA 1MPCA 4GVOA 4F39A 5EQ8A 4F1YA 5H8NB 3LSLA 3DP6A 2Y7PA 4KHZE 3KC0A 3SEXA 4OEUA 4ONYA 4KXPA 5HPQA 4P56A 2W7YA 1LFHA 3CR9A 4GXAA 2O1MA 2I3WA 4ELRA 2Y7RA 4HE1A 4QSCA 5T3JA 3MQ9A 5AA4B 1UQWA 1Y3PA 3THIA 5TP9B 1MXVA 3H3GA 1TFAA 3S4UA 1N76A 3W15C 3HHFA 1ELJA 2DS9A 2CZIA 1B1HA 2I3VA 5JTYB 4QFKA 5ELVA 3FD3A 2O68A 1SI0A 2QS1A 1FPLA 1OLAA 4H65A 3ROJA 1NH7A 2ZXTA 1USYE 3M3KA 2XXIA 2ALUA 5ISUA 4QSEA 1NMUA 3MWBA 4G2ZA 3FJMA 3P7IA 4I3EA 1B0LA 1AIVA 4NHBA 3MYUA 4YB6A 3KSJA 1WODA 1VFEA 2E0SA 4RPOA 4RK9A 5JK4A 3U94A 4BLAA 4MAGA 5LDZA 2QVRA 1US4A 2OK2A 3LUZA 1NNPA 2XXHA 2CEXA 1FTJA 3C32A 2P3VA 4PF6A 4ELOA 1A40A 2I6EA 3QYTA 5DEXA 1QUJA 3KZGA 3RN8A 4UA8A 1RYXA 2DXRA 1AMFA 3LV0A 4PAKA 1B3GA 5LOMA 2P3NA 4NEDA 5H8SA 2ZYOA 4F1UA 4Z0IA 4ZZAA 3EN3A 3C35A 3KC1A 1JW5A 4I62A 3RT8A 1SDXA 3A29A 4F2OA 3TTLA 1KZ8A 2O84X 3SZPA 1MXUA 4JXIA 5IKBA 1XVYA 5KCJB 3W9VA 3FBPA 2OX3A 4LVQA 5DYHA 3RUMA 3FXRA 5FTHA 1DOTA 1D3KA 3HN0A 1AH5A 1IMEA 3H06B 3MVWA 3KJ7A 4PDHA 1IMCA 3EQ1A 2GRVA 2H25A 3IB2A 1TT1A 2JJKA 4QFNA 1S50A 3A3CA 4GL0A 3O6HA 3TKDA 2XD2A 1N84A 2KLFA 1UTHA 3FXBA 4KYSA 3Q27A 3L6HA 1FBGA 1R9LA 1B4ZA 3IOWA 4ELPA 4G8HA 4N4UA 3N94A 4BDOA 1S7YA 1MY0A 3GBAA 2XWOA 4KYDA 3IJOB 1RDXA 2YJPA 3G3GA 2DXYA 2DYXA 2I49A 4ZECA 3V89B 3RGYA 1H76A 3B6WA 5EYHA 4IO3A 3K0VA 4NF5A 1FQAA 5A5XB 1D9YA 4HCWA 2QVVA 2ONKE 1SI1A 1MRPA 3N26A 3MVZA 3BFTA 3T9XB 1N3XA 3EPEA 3WAFA 3OEMA 4HS7A 1I69A 2UVJA 1LBYA 3MAMA 5H8FA 2QVUA 1IMAA 4I40A 3MPLA 4E0XA 5AA2B 1M5EA 1UIVA 1B46A 3TCGA 1YAEA 1UTBA 3U93A 2O1LA 3H03A 2V3QA 4H5FA 3MVXA 4N81A 4DDDA 2F6GA 2H4IA 4LZ7A 3QXMA 3KGCA 3VLVA 5AE4A 2I0BA 2F97A 4N17A 1SVXB 1FPFA 2OCUA 5J1DA 1XT8A 4FEDA 4JVDA 1VSOA 4LONB 1QKAA 2R9JA 3IL1B 1Y20A 4F1VA 1IXCA 3O28A 2VT5A 1DPEA 1FW0A 4R2FA 1AOVA 1NH8A 1OQGA 2CEYA 4N13A 1LAFE 4L17A 5DTBA 2G29A 3IOVA 1FBHA 5EYGA 2DWIA 1N7WA 1HSJA 5IAIA 1DTZA 5I2NA 2QS3A 4TLLB 4NF4B 4O7IA 2OWTA 1ZBMA 2NWJA 3CFZA 1NV6A 3R26A 5I57A 4LP2B 3TQLA 4ZEIA 3VVDA 1LBVA 4EF2A 1QW0A 4OVTA 2ZYKA 3GLBA 3EHSA 4F22A 4I8CA 3PUYE 4OFLA 1DTGA 2XX9A 1B5JA 1XVXA 1TWYA 2ZZXA 2DQVA 3KN7A 3K6XA 1D9QA 4EUOA 5I58B 3HV1A 2VD2A 1D4NA 4OETA 4JWXA 2F6PA 1BKAA 4IO4A
chains in the Genus database with same CATH topology
1MQHA 4KD5A 4IGRA 4ND9A 4H8JA 4JBZA 4XTCQ 1Y4CA 4KPTA 3IAZA 5BWJA 1J1NA 5I59B 4NWCA 2RC9A 1SW5A 4I9DA 4XIGQ 3TEPA 3K4UA 5F1QA 1B1XA 2Q2AA 1N7XA 3A3UA 1O63A 3G3IA 2PYYA 4R6HA 2GFEA 3ECRA 3MC2A 1SW2A 5I56A 4PFTA 3RTWB 2F78A 2HXWA 3ZS6A 3DP8A 4OQOA 3S9NC 4R6YA 1LFIA 4WEDA 1L5TA 2HZKA 1P1WA 4KYEA 3HHGA 5ITOA 5CBSA 1JEUA 3S9MC 3M8UA 4YKKA 4NTLA 5EYFA 3OXNA 4NF6A 1Y9UA 3T93B 3G3KA 4IO7A 4GIZA 2NVUB 2Q88A 3DELB 3Q29A 2XXRA 3VFJA 2GHAA 1JQFA 4NF5B 5I2KB 2XXUA 3ZSFA 1A99A 2XXVA 4IO6A 3FIRA 2ZNTA 5L8DA 3GZGA 1SQYA 3PUZE 5M2VA 3MZBA 2X7PA 4H5GA 4H67A 1FQBA 4ZDMA 3OO8A 1NKXA 4PQJA 2HCAA 1B2HA 1B7UA 1WDNA 1Y4TA 3E13X 4EXLA 2H99A 1YPNA 3UA8A 5ICQA 4U1ZA 3PPOA 1UTBB 4IO5A 2R71A 2GH9A 3RPWA 4NMYA 3DP4A 3JYRA 4NF8A 3K1NA 3EHUA 1B6HA 2XX7A 3OD7A 4BDRA 4KCCA 1MPBA 2OBGA 1TFDA 4YMAA 1I6BA 1FTLA 1HSLA 4GXSB 4ZE9A 4RK2A 4ZEDA 5ITPA 3KSXA 3LSWA 3O2AA 1GVCA 5FHNA 4R72A 3UORA 4ECFA 1PC3A 1GGGA 3VVFA 1OLCA 2PT1A 4GRKA 5I84A 3S9LC 1B7ZA 4U4SA 3USDA 3K1MA 3OENA 1LAHE 4M1VA 5H8QA 3E4RA 4ZS9A 1LAGE 4OXVA 3F11A 3PMWA 2HFBA 3OSRA 1OMPA 1QVSA 3T66A 1MH3A 1MY2A 4YKIA 4F3BA 3QUFA 4EF1A 3N5LA 3QK6A 1XS5A 4ZEFA 3PPNA 1IZ1A 4E0WA 4DCXA 1FTOA 4HTGA 4YAHX 1Q35A 1B40A 2F5XA 1LB8A 3G3JA 1LBCA 3EHTA 2RC8A 1MQGA 1O7TA 2RF1A 3BKIB 1PBPA 4XKNA 4Q0CA 4EQ7A 2V3TA 1JNFA 4ZEBA 1T0KA 3CFXA 3SKPA 4G68A 2XXTA 5ICTA 1HSEA 1US5A 2F35A 1SW1A 1IEJA 3CI8A 2Q2CA 5EHSA 1LLSA 2PMSA 1B5IA 4MH5A 3PUWE 2I4BA 4IO2A 4RJZA 4FATA 3OSQA 2Y84A 5DT6A 3C33A 5L9MA 1B3EA 2P1SA 4BDMA 4XKRA 1VR5A 2FA7A 3H7MA 2Y7WA 5HBCA 3T9HB 4FAJA 2O7UA 3FXUA 4LATA 3OO9A 4YB7A 2AL5A 1LAXA 3RTFB 2HAVA 2I4CA 2Y7IA 1LB9A 3O9PA 2O7IA 3KG2A 3PV0E 3TAJA 4JWYA 3ONMA 3JZJA 4KR5A 2ABHA 2LAOA 3TELA 3TFLA 1D9VA 3MUQA 4GWOA 3B6QA 1I6QA 3OO6A 3K6WA 2AL4A 4UACA 3IB0A 1PB8A 2Z8DA 1M5FA 4PFUA 5CMMA 3FVGA 4R2BA 3KJTA 1H44A 3PD8A 2ZNSA 2VP1A 3M3FA 4WEPA 3GBBA 4Z7EA 4R9FA 4WXJA 3IORA 4IY5A 4MBPA 1YCJA 3QSLA 3I5OA 4MF3A 4U4XA 2PT2A 1MDQA 4FECA 4RYAA 2FNCA 3PPPA 4F3GA 3TZAA 3U92A 1MXYA 3SESA 3SERA 1TXFA 1RKMA 4POWA 3SETA 3BFUA 4DZ1A 1M5CA 1DPPA 2OWSA 3V8XB 2A5TA 4TQUQ 2V3UA 3IB1A 1A55A 3MZ9A 4G77A 1B58A 3SEWA 4JB7A 1FQEA 2NUVA 4ZEKA 5CMBA 5CM6A 1IUDA 4ESWA 1P1QA 3O29A 2AIXA 3T9VA 4POXA 1H43A 3IK6B 3K1PA 4FJPA 3V5AA 5AA3A 5CBRA 2B3FA 3CRBA 5HM4B 4R75A 1ZKBA 2UVIA 5KDTA 3E9XA 1Z7NE 5L9OA 2HZLA 1PDAA 1URGA 4OWDA 2O51A 3U8QA 3S9EA 4ESXA 1MY4A 3I3VA 3FVNA 3R7XA 3B7DA 5K2XA 2XD3A 1XC1A 2Z8FA 2V84A 5B7DA 1F9BA 1UIUA 3IO4A 3CFLA 3U1OA 1LGBC 2I58A 3PUXE 3CSBA 3C31A 5EHMA 4OFOA 4MLQA 4OMBA 2REGA 2X26A 1DSNA 1B51A 3K6UA 2Y7KA 4G68B 1MPDA 1IQ7A 2HEUA 3OEKA 1P1OA 5CMKA 3T96B 2F7AA 3K00A 3VDFA 3RY3A 5H8NA 1N04A 4I1DA 3GXAA 1SW4A 1OQHA 4P0GA 4HW8A 5DEXB 2XXPA 3H6VA 1II5A 3N6TA 2DWHA 3FVOA 5DVIA 5AA4A 1MG1A 1N0TA 4QFLA 4N07A 4KCDA 1MM7A 5TP9A 5CC2A 4R74A 2IEEA 1I6AA 2RC7A 5JTYA 3K02A 2DE4A 4JSDA 3EF7A 3H6UA 3A09A 1A8FA 4OEVA 4FEBA 2QS2A 1B32A 1H45A 1MM6A 4JSOA 3VLWA 5AA1A 1LCFA 1JW1A 3RNNA 2OJTA 4F3SA 1B7HA 1MQJA 1QJMA 1LFGA 3KOTA 3O6GA 1NNTA 3D4GA 2GHBA 1UTHB 2I0CA 4OESA 1P99A 1POTA 4RA1A 4LUBA 3WAEA 4AB5A 1QKBA 3PU5A 3FV1A 4OYVA 3CSGA 2A5SA 3K6VA 2F8DA 1JVYA 2WKYA 4R9GA 3IX1A 1EZPA 3CG3A 4K3FA 1LCTA 3T9UA 5JEIA 1ZIUA 5B70A 2P2AA 1QUKA 2QSXA 4LQ2A 2G93A 1QULA 1MDP1 4JDFA 5KCJA 4G68C 3LSXA 3G3FA 3RT6B 1URDA 3MP1A 3MVYA 2A5TB 3HPIA 5H8FB 1A54A 3TUSA 1KWHA 3C9HA 1M5BA 4O3BA 2Z22A 2DE2A 4F29A 3KFMA 3JV9A 1R6ZA 2M8CA 2I48A 4FORA 2XX8A 3CG1A 4DCYA 3Q28A 4THIA 1H3DA 4DIGA 1Z7ME 2FYIA 3FV2A 3QIMA 3PPQA 2OZZA 3C4MA 4Q8RA 1SYHA 2HAUA 1JW4A 3Q25A 3G3HA 3MJNA 4MLVA 3MBPA 4R73A 1EZ9A 3TQWA 5I2NB 3T22A 2F7CA 5A5XA 4RPNA 3V83A 2B3BA 5CMCA 2H5YA 5I57B 3ODBA 4LZ5A 4EDPA 2Z8EA 2F36A 4F19A 4WKMA 2UVGA 1R1NA 3FATA 5AA2A 1VE4A 4G8MA 1NFTA 4OERA 4Q5TA 2V25A 1FQFA 4IGTA 4NWDA 4U2RA 3O6IA 3PPRA 3TTMA 1CB6A 4BDQA 1PB7A 5DVJA 2VHAA 3K2DA 3SDFA 4H6DA 3IOTA 2UVHA 2ONRA 2E1SA 1GV8A 5L9SA 3TTNA 3W9WA 3LSFB 3HO7A 4IB2A 4YU0A 1Y3QA 1ZMGA 1MXWA 3IR1A 3PD9A 1P1NA 4H8IA 4YICA 2RKMA 3BBRA 2QS4A 1B3FA 3FJ7A 1ZTYA 4NF4A 3U72A 5I56B 4XKPA 2O6AA 4EQBA 1RYOA 2P0SA 1B4HA 1JEVA 3I6VA 3S2VA 1LBBA 4XXUA 3LC8A 3TCFA 2DVCA 2QJEA 3N6UA 3Q26A 3FUZA 2D5WA 1LSTA 3TPAA 4YZZA 3ZKLA 4G4PA 2PX1A 1IXGA 4NF6B 4RNSA 5I58A 4ISUA 3RQTA 5TPAA 5F7VA 3ZKKA 1YTVA 4C1TA 1JVXA 4U23A 1ZLQA 4O3CA 3O97A 2Q9TA 3RLFE 3TYHA 1R9QA 2XXXA 2QMWA 1Y3NA 4X48A 4C1UA 5I59A 1FCKA 4U1OA 4F3PA 4QFOA 2X7QA 1MXXA 2REJA 1GR2A 1BP5A 1Y1MA 3KOSA 1GTKA 2THIA 3FGSA 5CI5A 3VXCA 2RINA 4X1BA 1USYH 3OO7A 1MH4A 4KI0E 4PFYA 2NXOA 1DMBA 3QAXA 4NF8B 4ZE8A 3R6UA 4F18A 4Q30B 4RXLA 4OTEA 2DVZA 1B3HA 1NNKA 4KQPA 1BIYA 1Q1KA 3VXBA 5TU0A 1O64A 5BUUA 3DM0A 3FXQA 3TTRA 2RCBA 2D21A 1FQCA 2ZYNA 4GFRA 3M3LA 5H8HA 4HCYA 4F2QA 2CZLA 2D3IA 1NNFA 3FASA 4FIMA 3E3KA 3KBRA 5I2KA 3TODA 2ESNA 2QL3A 4OFJA 3VVEA 1MQDA 5H8QB 1B3LA 5K2YA 1XOCA 2F34A 1XHYA 2AYSA 2B65A 4PFWA 1IXHA 1B0HA 3D4CA 3H6TA 3TCHA 2HQ0A 4PE5B 2O69A 3VE1B 1PB9A 4G8NA 2Q8JA 2RCAA 3PGFA 4DLDA 4GF8A 3IO6A 1P1UA 3FZVA 3UN6A 1IXIA 5CRYA 1A8EA 3FJGA 3OOAA 3MP6A 3MPKA 4YKJA 5AA2D 1OVTA 3LUYA 4OVJA 4GLIA 2QPQA 4PETA 2DOJA 3KEIA 3L6GA 4GD5A 3PMXA 1SYIA 2UYEA 1AL3A 2XHDA 1PBQA 4M4GA 3K01A 3H4ZA 2DP8A 4TOZA 3TTKA 1BLFA 3C36A 4H0WA 1PEBA 4AQ4A 1NL5A 1SBPA 4YKPA 4GQOA 1IIWA 5DVFA 2ZNUA 3PMVA 3SEVA 3UIFA 4QHQA 3H6WA 3PUVE 4QRZA 1FTMA 2IA4A 1OVBA 4KFQA 3LR1A 2DWJA 1OIBA 4EXKA 3DLNA 4X9TA 1WVJA 1IITA 5TPAB 4BDLA 3TDJA 2Q89A 4OHNA 4DXCA 1EU8A 1B5HA 3CVGA 1CE2A 4QFPA 1S9TA 2UYFA 2F7BA 1FTKA 1MXZA 2H9BA 4GL8A 2BJJX 1M5DA 4OZ9A 4U21A 4ZZEA 2VGQA 2VOZA 1A7LA 2YPNA 2ANJA 2H98A 2PBWA 2NOOA 4QSDA 2UXAA 3ILUB 1EZOA 1N3WA 1MQIA 1ATGA 4MFIA 1SD3A 2QMXA 2QRYA 2XXYA 1JETA 3IJXB 2ZYMA 2OLBA 1MY3A 3SEUA 3KN3A 5KZTA 4P0IA 4H1XA 4DXUA 4AB6A 4NE4A 3VV5A 4XKQA 4N6PA 2V93A 4RY1A 2R6GE 3FVKA 3C34A 3MZ1A 4DXBA 4EQ9A 1VFDA 4LA9A 3ILTB 3VLUA 4IY6A 3HSTA 5H8HB 3SEYA 4LZ8A 1ANFA 4DE8A 4FE8A 3OELA 3B6TA 5FHMA 4PP0A 2DE3A 2CMOA 3OMBA 3LBSA 1ZJLA 2XXWA 3G7WA 3QUJA 3MW0A 3O66A 4O3AA 1B05A 4C0RA 4ELQA 2VD3A 1POY1 3TMGA 5KDTB 4GOTA 4TLMB 4YMBA 4P11A 1FQDA 4U22A 3UGWA 1ZU0A 1BTJA 3CIJA 3IOUA 4F31B 2DSFA 2XXQA 1MS7A 4X1DA 1URSA 1EH3A 1B9JA 3HCQA 1MY1A 3UP9A 3AXFA 1QUIA 4BDNA 3MP8A 2YLNA 4YB5A 2ZMBA 1B52A 4QF9A 3KN8A 4LQ5A 4OENA 4R6KA 2ONSA 3UK4A 2PVUA 5FHOA 1Y1ZA 2Z23A 2DWAA 5FTIA 4JWOA 1MPCA 4GVOA 4F39A 5H8NB 4F1YA 3LSLA 3DP6A 2Y7PA 4KHZE 3SEXA 4OEUA 4ONYA 5HPQA 2W7YA 1LFHA 3CR9A 4GXAA 2O1MA 2I3WA 4ELRA 2Y7RA 4QSCA 3MQ9A 5AA4B 1UQWA 1Y3PA 3THIA 5TP9B 1MXVA 3H3GA 1TFAA 3S4UA 1N76A 3W15C 3HHFA 1ELJA 2DS9A 1B1HA 2I3VA 5JTYB 4QFKA 5ELVA 3FD3A 2O68A 1SI0A 2QS1A 1OLAA 4H65A 1NH7A 2ZXTA 1USYE 3M3KA 2XXIA 2ALUA 5ISUA 4QSEA 1NMUA 3MWBA 4G2ZA 3FJMA 3P7IA 1B0LA 1AIVA 4YB6A 3KSJA 1WODA 1VFEA 2E0SA 4RPOA 4RK9A 5JK4A 3U94A 4BLAA 1US4A 2OK2A 1NNPA 2XXHA 3C32A 1FTJA 4ELOA 1A40A 2I6EA 3QYTA 5DEXA 1QUJA 3KZGA 3RN8A 4UA8A 1RYXA 2DXRA 1AMFA 5LOMA 1B3GA 4NEDA 5H8SA 2ZYOA 4F1UA 4Z0IA 4ZZAA 3EN3A 3C35A 1JW5A 4I62A 3RT8A 1SDXA 4F2OA 3TTLA 2O84X 1MXUA 4JXIA 5IKBA 1XVYA 5KCJB 3W9VA 4LVQA 5DYHA 3RUMA 3FXRA 5FTHA 1DOTA 1D3KA 3HN0A 1AH5A 3H06B 3MVWA 3KJ7A 3EQ1A 2GRVA 2H25A 3IB2A 1TT1A 4QFNA 1S50A 3A3CA 4GL0A 3O6HA 3TKDA 2XD2A 1N84A 2KLFA 1UTHA 4KYSA 3Q27A 3L6HA 1R9LA 1B4ZA 3IOWA 4ELPA 4G8HA 3N94A 4BDOA 1S7YA 1MY0A 3GBAA 4KYDA 3IJOB 2YJPA 3G3GA 2DXYA 2DYXA 2I49A 4ZECA 3V89B 3RGYA 1H76A 3B6WA 4IO3A 3K0VA 4NF5A 1FQAA 5A5XB 1D9YA 4HCWA 2ONKE 1SI1A 1MRPA 3N26A 3MVZA 3BFTA 3T9XB 1N3XA 3EPEA 3WAFA 3OEMA 4HS7A 1I69A 2UVJA 3MAMA 5H8FA 3MPLA 4E0XA 5AA2B 1M5EA 1UIVA 1B46A 3TCGA 1YAEA 1UTBA 3U93A 2O1LA 3H03A 2V3QA 4H5FA 3MVXA 4DDDA 2F6GA 2H4IA 4LZ7A 3QXMA 3KGCA 3VLVA 5AE4A 2I0BA 2F97A 1SVXB 2OCUA 5J1DA 1XT8A 4FEDA 4LONB 1VSOA 1QKAA 2R9JA 3IL1B 1Y20A 4F1VA 1IXCA 3O28A 1DPEA 1FW0A 4R2FA 1AOVA 1NH8A 1OQGA 4N13A 1LAFE 4L17A 5DTBA 2G29A 3IOVA 2DWIA 1N7WA 1HSJA 5IAIA 1DTZA 5I2NA 2QS3A 4TLLB 4NF4B 2OWTA 1ZBMA 2NWJA 3CFZA 3R26A 5I57A 4LP2B 3TQLA 4ZEIA 3VVDA 4EF2A 1QW0A 2ZYKA 3GLBA 3EHSA 4F22A 4I8CA 3PUYE 4OFLA 1DTGA 2XX9A 1B5JA 1XVXA 1TWYA 2DQVA 3KN7A 3K6XA 4EUOA 5I58B 3HV1A 2VD2A 1D4NA 4OETA 4JWXA 2F6PA 1BKAA 4IO4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MQH A;  4KD5 A;  4IGR A;  4ND9 A;  4H8J A;  4JBZ A;  4XTC Q;  1Y4C A;  4KPT A;  3IAZ A;  5BWJ A;  1J1N A;  5I59 B;  4NWC A;  2RC9 A;  1SW5 A;  4I9D A;  4XIG Q;  3TEP A;  3K4U A;  5F1Q A;  1B1X A;  2Q2A A;  1N7X A;  3A3U A;  1O63 A;  3G3I A;  2PYY A;  4R6H A;  2GFE A;  3ECR A;  3MC2 A;  1SW2 A;  5I56 A;  4PFT A;  3RTW B;  2F78 A;  2HXW A;  3ZS6 A;  3DP8 A;  4OQO A;  3S9N C;  4R6Y A;  1LFI A;  4WED A;  1L5T A;  2HZK A;  1P1W A;  4KYE A;  3HHG A;  5ITO A;  5CBS A;  1JEU A;  3S9M C;  3M8U A;  4YKK A;  4NTL A;  5EYF A;  3OXN A;  4NF6 A;  1Y9U A;  3T93 B;  3G3K A;  4IO7 A;  4GIZ A;  2NVU B;  2Q88 A;  3DEL B;  3Q29 A;  2XXR A;  3VFJ A;  2GHA A;  1JQF A;  4NF5 B;  5I2K B;  2XXU A;  3ZSF A;  1A99 A;  2XXV A;  4IO6 A;  3FIR A;  2ZNT A;  5L8D A;  3GZG A;  1SQY A;  3PUZ E;  5M2V A;  3MZB A;  2X7P A;  4H5G A;  4H67 A;  1FQB A;  4ZDM A;  3OO8 A;  1NKX A;  4PQJ A;  2HCA A;  1B2H A;  1B7U A;  1WDN A;  1Y4T A;  3E13 X;  4EXL A;  2H99 A;  1YPN A;  3UA8 A;  5ICQ A;  4U1Z A;  3PPO A;  1UTB B;  4IO5 A;  2R71 A;  2GH9 A;  3RPW A;  4NMY A;  3DP4 A;  3JYR A;  4NF8 A;  3K1N A;  3EHU A;  1B6H A;  2XX7 A;  3OD7 A;  4BDR A;  4KCC A;  1MPB A;  2OBG A;  1TFD A;  4YMA A;  1I6B A;  1FTL A;  1HSL A;  4GXS B;  4ZE9 A;  4RK2 A;  4ZED A;  5ITP A;  3KSX A;  3LSW A;  3O2A A;  1GVC A;  5FHN A;  4R72 A;  3UOR A;  4ECF A;  1PC3 A;  1GGG A;  3VVF A;  1OLC A;  2PT1 A;  4GRK A;  5I84 A;  3S9L C;  1B7Z A;  4U4S A;  3USD A;  3K1M A;  3OEN A;  1LAH E;  4M1V A;  5H8Q A;  3E4R A;  4ZS9 A;  1LAG E;  4OXV A;  3F11 A;  3PMW A;  2HFB A;  3OSR A;  1OMP A;  1QVS A;  3T66 A;  1MH3 A;  1MY2 A;  4YKI A;  4F3B A;  3QUF A;  4EF1 A;  3N5L A;  3QK6 A;  1XS5 A;  4ZEF A;  3PPN A;  1IZ1 A;  4E0W A;  4DCX A;  1FTO A;  4HTG A;  4YAH X;  1Q35 A;  1B40 A;  2F5X A;  1LB8 A;  3G3J A;  1LBC A;  3EHT A;  2RC8 A;  1MQG A;  1O7T A;  2RF1 A;  3BKI B;  1PBP A;  4XKN A;  4Q0C A;  4EQ7 A;  2V3T A;  1JNF A;  4ZEB A;  1T0K A;  3CFX A;  3SKP A;  4G68 A;  2XXT A;  5ICT A;  1HSE A;  1US5 A;  2F35 A;  1SW1 A;  1IEJ A;  3CI8 A;  2Q2C A;  5EHS A;  1LLS A;  2PMS A;  1B5I A;  4MH5 A;  3PUW E;  2I4B A;  4IO2 A;  4RJZ A;  4FAT A;  3OSQ A;  2Y84 A;  5DT6 A;  3C33 A;  5L9M A;  1B3E A;  2P1S A;  4BDM A;  4XKR A;  1VR5 A;  2FA7 A;  3H7M A;  2Y7W A;  5HBC A;  3T9H B;  4FAJ A;  2O7U A;  3FXU A;  4LAT A;  3OO9 A;  4YB7 A;  2AL5 A;  1LAX A;  3RTF B;  2HAV A;  2I4C A;  2Y7I A;  1LB9 A;  3O9P A;  2O7I A;  3KG2 A;  3PV0 E;  3TAJ A;  4JWY A;  3ONM A;  3JZJ A;  4KR5 A;  2ABH A;  2LAO A;  3TEL A;  3TFL A;  1D9V A;  3MUQ A;  4GWO A;  3B6Q A;  1I6Q A;  3OO6 A;  3K6W A;  2AL4 A;  4UAC A;  3IB0 A;  1PB8 A;  2Z8D A;  1M5F A;  4PFU A;  5CMM A;  3FVG A;  4R2B A;  3KJT A;  1H44 A;  3PD8 A;  2ZNS A;  2VP1 A;  3M3F A;  4WEP A;  3GBB A;  4Z7E A;  4R9F A;  4WXJ A;  3IOR A;  4IY5 A;  4MBP A;  1YCJ A;  3QSL A;  3I5O A;  4MF3 A;  4U4X A;  2PT2 A;  1MDQ A;  4FEC A;  4RYA A;  2FNC A;  3PPP A;  4F3G A;  3TZA A;  3U92 A;  1MXY A;  3SES A;  3SER A;  1TXF A;  1RKM A;  4POW A;  3SET A;  3BFU A;  4DZ1 A;  1M5C A;  1DPP A;  2OWS A;  3V8X B;  2A5T A;  4TQU Q;  2V3U A;  3IB1 A;  1A55 A;  3MZ9 A;  4G77 A;  1B58 A;  3SEW A;  4JB7 A;  1FQE A;  2NUV A;  4ZEK A;  5CMB A;  5CM6 A;  1IUD A;  4ESW A;  1P1Q A;  3O29 A;  2AIX A;  3T9V A;  4POX A;  1H43 A;  3IK6 B;  3K1P A;  4FJP A;  3V5A A;  5AA3 A;  5CBR A;  2B3F A;  3CRB A;  5HM4 B;  4R75 A;  1ZKB A;  2UVI A;  5KDT A;  3E9X A;  1Z7N E;  5L9O A;  2HZL A;  1PDA A;  1URG A;  4OWD A;  2O51 A;  3U8Q A;  3S9E A;  4ESX A;  1MY4 A;  3I3V A;  3FVN A;  3R7X A;  3B7D A;  5K2X A;  2XD3 A;  1XC1 A;  2Z8F A;  2V84 A;  5B7D A;  1F9B A;  1UIU A;  3IO4 A;  3CFL A;  3U1O A;  1LGB C;  2I58 A;  3PUX E;  3CSB A;  3C31 A;  5EHM A;  4OFO A;  4MLQ A;  4OMB A;  2REG A;  2X26 A;  1DSN A;  1B51 A;  3K6U A;  2Y7K A;  4G68 B;  1MPD A;  1IQ7 A;  2HEU A;  3OEK A;  1P1O A;  5CMK A;  3T96 B;  2F7A A;  3K00 A;  3VDF A;  3RY3 A;  5H8N A;  1N04 A;  4I1D A;  3GXA A;  1SW4 A;  1OQH A;  4P0G A;  4HW8 A;  5DEX B;  2XXP A;  3H6V A;  1II5 A;  3N6T A;  2DWH A;  3FVO A;  5DVI A;  5AA4 A;  1MG1 A;  1N0T A;  4QFL A;  4N07 A;  4KCD A;  1MM7 A;  5TP9 A;  5CC2 A;  4R74 A;  2IEE A;  1I6A A;  2RC7 A;  5JTY A;  3K02 A;  2DE4 A;  4JSD A;  3EF7 A;  3H6U A;  3A09 A;  1A8F A;  4OEV A;  4FEB A;  2QS2 A;  1B32 A;  1H45 A;  1MM6 A;  4JSO A;  3VLW A;  5AA1 A;  1LCF A;  1JW1 A;  3RNN A;  2OJT A;  4F3S A;  1B7H A;  1MQJ A;  1QJM A;  1LFG A;  3KOT A;  3O6G A;  1NNT A;  3D4G A;  2GHB A;  1UTH B;  2I0C A;  4OES A;  1P99 A;  1POT A;  4RA1 A;  4LUB A;  3WAE A;  4AB5 A;  1QKB A;  3PU5 A;  3FV1 A;  4OYV A;  3CSG A;  2A5S A;  3K6V A;  2F8D A;  1JVY A;  2WKY A;  4R9G A;  3IX1 A;  1EZP A;  3CG3 A;  4K3F A;  1LCT A;  3T9U A;  5JEI A;  1ZIU A;  5B70 A;  2P2A A;  1QUK A;  2QSX A;  4LQ2 A;  2G93 A;  1QUL A;  1MDP 1;  4JDF A;  5KCJ A;  4G68 C;  3LSX A;  3G3F A;  3RT6 B;  1URD A;  3MP1 A;  3MVY A;  2A5T B;  3HPI A;  5H8F B;  1A54 A;  3TUS A;  1KWH A;  3C9H A;  1M5B A;  4O3B A;  2Z22 A;  2DE2 A;  4F29 A;  3KFM A;  3JV9 A;  1R6Z A;  2M8C A;  2I48 A;  4FOR A;  2XX8 A;  3CG1 A;  4DCY A;  3Q28 A;  4THI A;  1H3D A;  4DIG A;  1Z7M E;  2FYI A;  3FV2 A;  3QIM A;  3PPQ A;  2OZZ A;  3C4M A;  4Q8R A;  1SYH A;  2HAU A;  1JW4 A;  3Q25 A;  3G3H A;  3MJN A;  4MLV A;  3MBP A;  4R73 A;  1EZ9 A;  3TQW A;  5I2N B;  3T22 A;  2F7C A;  5A5X A;  4RPN A;  3V83 A;  2B3B A;  5CMC A;  2H5Y A;  5I57 B;  3ODB A;  4LZ5 A;  4EDP A;  2Z8E A;  2F36 A;  4F19 A;  4WKM A;  2UVG A;  1R1N A;  3FAT A;  5AA2 A;  1VE4 A;  4G8M A;  1NFT A;  4OER A;  4Q5T A;  2V25 A;  1FQF A;  4IGT A;  4NWD A;  4U2R A;  3O6I A;  3PPR A;  3TTM A;  1CB6 A;  4BDQ A;  1PB7 A;  5DVJ A;  2VHA A;  3K2D A;  3SDF A;  4H6D A;  3IOT A;  2UVH A;  2ONR A;  2E1S A;  1GV8 A;  5L9S A;  3TTN A;  3W9W A;  3LSF B;  3HO7 A;  4IB2 A;  4YU0 A;  1Y3Q A;  1ZMG A;  1MXW A;  3IR1 A;  3PD9 A;  1P1N A;  4H8I A;  4YIC A;  2RKM A;  3BBR A;  2QS4 A;  1B3F A;  3FJ7 A;  1ZTY A;  4NF4 A;  3U72 A;  5I56 B;  4XKP A;  2O6A A;  4EQB A;  1RYO A;  2P0S A;  1B4H A;  1JEV A;  3I6V A;  3S2V A;  1LBB A;  4XXU A;  3LC8 A;  3TCF A;  2DVC A;  2QJE A;  3N6U A;  3Q26 A;  3FUZ A;  2D5W A;  1LST A;  3TPA A;  4YZZ A;  3ZKL A;  4G4P A;  2PX1 A;  1IXG A;  4NF6 B;  4RNS A;  5I58 A;  4ISU A;  3RQT A;  5TPA A;  5F7V A;  3ZKK A;  1YTV A;  4C1T A;  1JVX A;  4U23 A;  1ZLQ A;  4O3C A;  3O97 A;  2Q9T A;  3RLF E;  3TYH A;  1R9Q A;  2XXX A;  2QMW A;  1Y3N A;  4X48 A;  4C1U A;  5I59 A;  1FCK A;  4U1O A;  4F3P A;  4QFO A;  2X7Q A;  1MXX A;  2REJ A;  1GR2 A;  1BP5 A;  1Y1M A;  3KOS A;  1GTK A;  2THI A;  3FGS A;  5CI5 A;  3VXC A;  2RIN A;  4X1B A;  1USY H;  3OO7 A;  1MH4 A;  4KI0 E;  4PFY A;  2NXO A;  1DMB A;  3QAX A;  4NF8 B;  4ZE8 A;  3R6U A;  4F18 A;  4Q30 B;  4RXL A;  4OTE A;  2DVZ A;  1B3H A;  1NNK A;  4KQP A;  1BIY A;  1Q1K A;  3VXB A;  5TU0 A;  1O64 A;  5BUU A;  3DM0 A;  3FXQ A;  3TTR A;  2RCB A;  2D21 A;  1FQC A;  2ZYN A;  4GFR A;  3M3L A;  5H8H A;  4HCY A;  4F2Q A;  2CZL A;  2D3I A;  1NNF A;  3FAS A;  4FIM A;  3E3K A;  3KBR A;  5I2K A;  3TOD A;  2ESN A;  2QL3 A;  4OFJ A;  3VVE A;  1MQD A;  5H8Q B;  1B3L A;  5K2Y A;  1XOC A;  2F34 A;  1XHY A;  2AYS A;  2B65 A;  4PFW A;  1IXH A;  1B0H A;  3D4C A;  3H6T A;  3TCH A;  2HQ0 A;  4PE5 B;  2O69 A;  3VE1 B;  1PB9 A;  4G8N A;  2Q8J A;  2RCA A;  3PGF A;  4DLD A;  4GF8 A;  3IO6 A;  1P1U A;  3FZV A;  3UN6 A;  1IXI A;  5CRY A;  1A8E A;  3FJG A;  3OOA A;  3MP6 A;  3MPK A;  4YKJ A;  5AA2 D;  1OVT A;  3LUY A;  4OVJ A;  4GLI A;  2QPQ A;  4PET A;  2DOJ A;  3KEI A;  3L6G A;  4GD5 A;  3PMX A;  1SYI A;  2UYE A;  1AL3 A;  2XHD A;  1PBQ A;  4M4G A;  3K01 A;  3H4Z A;  2DP8 A;  4TOZ A;  3TTK A;  1BLF A;  3C36 A;  4H0W A;  1PEB A;  4AQ4 A;  1NL5 A;  1SBP A;  4YKP A;  4GQO A;  1IIW A;  5DVF A;  2ZNU A;  3PMV A;  3SEV A;  3UIF A;  4QHQ A;  3H6W A;  3PUV E;  4QRZ A;  1FTM A;  2IA4 A;  1OVB A;  4KFQ A;  3LR1 A;  2DWJ A;  1OIB A;  4EXK A;  3DLN A;  4X9T A;  1WVJ A;  1IIT A;  5TPA B;  4BDL A;  3TDJ A;  2Q89 A;  4OHN A;  4DXC A;  1EU8 A;  1B5H A;  3CVG A;  1CE2 A;  4QFP A;  1S9T A;  2UYF A;  2F7B A;  1FTK A;  1MXZ A;  2H9B A;  4GL8 A;  2BJJ X;  1M5D A;  4OZ9 A;  4U21 A;  4ZZE A;  2VGQ A;  2VOZ A;  1A7L A;  2YPN A;  2ANJ A;  2H98 A;  2PBW A;  2NOO A;  4QSD A;  2UXA A;  3ILU B;  1EZO A;  1N3W A;  1MQI A;  1ATG A;  4MFI A;  1SD3 A;  2QMX A;  2QRY A;  2XXY A;  1JET A;  3IJX B;  2ZYM A;  2OLB A;  1MY3 A;  3SEU A;  3KN3 A;  5KZT A;  4P0I A;  4H1X A;  4DXU A;  4AB6 A;  4NE4 A;  3VV5 A;  4XKQ A;  4N6P A;  2V93 A;  4RY1 A;  2R6G E;  3FVK A;  3C34 A;  3MZ1 A;  4DXB A;  4EQ9 A;  1VFD A;  4LA9 A;  3ILT B;  3VLU A;  4IY6 A;  3HST A;  5H8H B;  3SEY A;  4LZ8 A;  1ANF A;  4DE8 A;  4FE8 A;  3OEL A;  3B6T A;  5FHM A;  4PP0 A;  2DE3 A;  2CMO A;  3OMB A;  3LBS A;  1ZJL A;  2XXW A;  3G7W A;  3QUJ A;  3MW0 A;  3O66 A;  4O3A A;  1B05 A;  4C0R A;  4ELQ A;  2VD3 A;  1POY 1;  3TMG A;  5KDT B;  4GOT A;  4TLM B;  4YMB A;  4P11 A;  1FQD A;  4U22 A;  3UGW A;  1ZU0 A;  1BTJ A;  3CIJ A;  3IOU A;  4F31 B;  2DSF A;  2XXQ A;  1MS7 A;  4X1D A;  1URS A;  1EH3 A;  1B9J A;  3HCQ A;  1MY1 A;  3UP9 A;  3AXF A;  1QUI A;  4BDN A;  3MP8 A;  2YLN A;  4YB5 A;  2ZMB A;  1B52 A;  4QF9 A;  3KN8 A;  4LQ5 A;  4OEN A;  4R6K A;  2ONS A;  3UK4 A;  2PVU A;  5FHO A;  1Y1Z A;  2Z23 A;  2DWA A;  5FTI A;  4JWO A;  1MPC A;  4GVO A;  4F39 A;  5H8N B;  4F1Y A;  3LSL A;  3DP6 A;  2Y7P A;  4KHZ E;  3SEX A;  4OEU A;  4ONY A;  5HPQ A;  2W7Y A;  1LFH A;  3CR9 A;  4GXA A;  2O1M A;  2I3W A;  4ELR A;  2Y7R A;  4QSC A;  3MQ9 A;  5AA4 B;  1UQW A;  1Y3P A;  3THI A;  5TP9 B;  1MXV A;  3H3G A;  1TFA A;  3S4U A;  1N76 A;  3W15 C;  3HHF A;  1ELJ A;  2DS9 A;  1B1H A;  2I3V A;  5JTY B;  4QFK A;  5ELV A;  3FD3 A;  2O68 A;  1SI0 A;  2QS1 A;  1OLA A;  4H65 A;  1NH7 A;  2ZXT A;  1USY E;  3M3K A;  2XXI A;  2ALU A;  5ISU A;  4QSE A;  1NMU A;  3MWB A;  4G2Z A;  3FJM A;  3P7I A;  1B0L A;  1AIV A;  4YB6 A;  3KSJ A;  1WOD A;  1VFE A;  2E0S A;  4RPO A;  4RK9 A;  5JK4 A;  3U94 A;  4BLA A;  1US4 A;  2OK2 A;  1NNP A;  2XXH A;  3C32 A;  1FTJ A;  4ELO A;  1A40 A;  2I6E A;  3QYT A;  5DEX A;  1QUJ A;  3KZG A;  3RN8 A;  4UA8 A;  1RYX A;  2DXR A;  1AMF A;  5LOM A;  1B3G A;  4NED A;  5H8S A;  2ZYO A;  4F1U A;  4Z0I A;  4ZZA A;  3EN3 A;  3C35 A;  1JW5 A;  4I62 A;  3RT8 A;  1SDX A;  4F2O A;  3TTL A;  2O84 X;  1MXU A;  4JXI A;  5IKB A;  1XVY A;  5KCJ B;  3W9V A;  4LVQ A;  5DYH A;  3RUM A;  3FXR A;  5FTH A;  1DOT A;  1D3K A;  3HN0 A;  1AH5 A;  3H06 B;  3MVW A;  3KJ7 A;  3EQ1 A;  2GRV A;  2H25 A;  3IB2 A;  1TT1 A;  4QFN A;  1S50 A;  3A3C A;  4GL0 A;  3O6H A;  3TKD A;  2XD2 A;  1N84 A;  2KLF A;  1UTH A;  4KYS A;  3Q27 A;  3L6H A;  1R9L A;  1B4Z A;  3IOW A;  4ELP A;  4G8H A;  3N94 A;  4BDO A;  1S7Y A;  1MY0 A;  3GBA A;  4KYD A;  3IJO B;  2YJP A;  3G3G A;  2DXY A;  2DYX A;  2I49 A;  4ZEC A;  3V89 B;  3RGY A;  1H76 A;  3B6W A;  4IO3 A;  3K0V A;  4NF5 A;  1FQA A;  5A5X B;  1D9Y A;  4HCW A;  2ONK E;  1SI1 A;  1MRP A;  3N26 A;  3MVZ A;  3BFT A;  3T9X B;  1N3X A;  3EPE A;  3WAF A;  3OEM A;  4HS7 A;  1I69 A;  2UVJ A;  3MAM A;  5H8F A;  3MPL A;  4E0X A;  5AA2 B;  1M5E A;  1UIV A;  1B46 A;  3TCG A;  1YAE A;  1UTB A;  3U93 A;  2O1L A;  3H03 A;  2V3Q A;  4H5F A;  3MVX A;  4DDD A;  2F6G A;  2H4I A;  4LZ7 A;  3QXM A;  3KGC A;  3VLV A;  5AE4 A;  2I0B A;  2F97 A;  1SVX B;  2OCU A;  5J1D A;  1XT8 A;  4FED A;  4LON B;  1VSO A;  1QKA A;  2R9J A;  3IL1 B;  1Y20 A;  4F1V A;  1IXC A;  3O28 A;  1DPE A;  1FW0 A;  4R2F A;  1AOV A;  1NH8 A;  1OQG A;  4N13 A;  1LAF E;  4L17 A;  5DTB A;  2G29 A;  3IOV A;  2DWI A;  1N7W A;  1HSJ A;  5IAI A;  1DTZ A;  5I2N A;  2QS3 A;  4TLL B;  4NF4 B;  2OWT A;  1ZBM A;  2NWJ A;  3CFZ A;  3R26 A;  5I57 A;  4LP2 B;  3TQL A;  4ZEI A;  3VVD A;  4EF2 A;  1QW0 A;  2ZYK A;  3GLB A;  3EHS A;  4F22 A;  4I8C A;  3PUY E;  4OFL A;  1DTG A;  2XX9 A;  1B5J A;  1XVX A;  1TWY A;  2DQV A;  3KN7 A;  3K6X A;  4EUO A;  5I58 B;  3HV1 A;  2VD2 A;  1D4N A;  4OET A;  4JWX A;  2F6P A;  1BKA A;  4IO4 A; 
#chains in the Genus database with same CATH topology
 1MQH A;  4KD5 A;  4IGR A;  4ND9 A;  4H8J A;  4JBZ A;  4XTC Q;  1Y4C A;  4KPT A;  3IAZ A;  5BWJ A;  1J1N A;  5I59 B;  2WX9 A;  4NWC A;  2RC9 A;  1SW5 A;  4I9D A;  4XIG Q;  4P8B A;  5J16 A;  3TEP A;  3K4U A;  5LTC A;  5F1Q A;  1B1X A;  5I7I A;  2Q2A A;  1N7X A;  3A3U A;  1O63 A;  3G3I A;  2PYY A;  4N8Y A;  4NQ8 A;  5DW8 A;  4R6H A;  2GFE A;  3ECR A;  2F3D A;  3MC2 A;  1SW2 A;  5I56 A;  4PFT A;  3RTW B;  2F78 A;  2HXW A;  3IFA A;  3ZS6 A;  3DP8 A;  4OQO A;  1FBP A;  3S9N C;  4R6Y A;  1LFI A;  4WED A;  1L5T A;  2HZK A;  1P1W A;  4KYE A;  3HHG A;  5ITO A;  1SPI A;  5CBS A;  1JEU A;  3S9M C;  2CZH A;  3M8U A;  4YKK A;  4NTL A;  5EYF A;  3OXN A;  4NF6 A;  1Y9U A;  2XWK A;  3T93 B;  4MX6 A;  3G3K A;  4IO7 A;  4GIZ A;  2NVU B;  2Q88 A;  3DEL B;  3Q29 A;  2XXR A;  3VFJ A;  4N8G A;  1DBZ A;  2GHA A;  1JQF A;  4NF5 B;  5I2K B;  2XXU A;  3ZSF A;  1A99 A;  2XXV A;  4IO6 A;  3FIR A;  2ZNT A;  5L8D A;  3GZG A;  1SQY A;  3PUZ E;  5M2V A;  3MZB A;  2X7P A;  1EYJ A;  4H5G A;  4IR8 A;  4H67 A;  3QMF A;  1FQB A;  4ZDM A;  2PFZ A;  3OO8 A;  1NKX A;  4PQJ A;  2HCA A;  1B2H A;  1B7U A;  1WDN A;  1Y4T A;  3E13 X;  2DDK A;  4EXL A;  2H99 A;  1YPN A;  3UA8 A;  5ICQ A;  3PTY A;  4U1Z A;  3PPO A;  1UTB B;  4IO5 A;  2R71 A;  2GH9 A;  3RPW A;  4NMY A;  3DP4 A;  3JYR A;  4NF8 A;  3K1N A;  3EHU A;  1LBX A;  1B6H A;  2XX7 A;  3OD7 A;  4BDR A;  4KCC A;  1MPB A;  2OBG A;  1TFD A;  4YMA A;  1I6B A;  1FTL A;  1HSL A;  4GXS B;  4N6K A;  4DI3 D;  4ZE9 A;  4QXD A;  4RK2 A;  4ZED A;  5ITP A;  3KSX A;  3LSW A;  3O2A A;  4P9K A;  1GVC A;  5FHN A;  4R72 A;  3NOH A;  3UOR A;  4ECF A;  1PC3 A;  1GGG A;  3VVF A;  1NV2 A;  1OLC A;  2PT1 A;  4GRK A;  5I84 A;  3S9L C;  1B7Z A;  4U4S A;  3USD A;  1NV7 A;  3K1M A;  3OEN A;  1LAH E;  4M1V A;  5H8Q A;  3E4R A;  4ZS9 A;  1LAG E;  4OXV A;  4O94 A;  4N6D A;  3F11 A;  3PMW A;  4XFE A;  1XI6 A;  2WBD A;  2HFB A;  3OSR A;  4OVR A;  2B4L A;  1OMP A;  1QVS A;  3T66 A;  1MH3 A;  1MY2 A;  2HHM A;  4YKI A;  4F3B A;  3QUF A;  4EF1 A;  4NN3 A;  3N5L A;  3QK6 A;  1FPE A;  1XS5 A;  4ZEF A;  3PPN A;  1IZ1 A;  4E0W A;  4LN5 A;  4DCX A;  4N91 A;  2HPG A;  1NV4 A;  1FTO A;  1CNQ A;  4HTG A;  4YAH X;  1Q35 A;  1B40 A;  2F5X A;  1LB8 A;  4PGN A;  3G3J A;  1LBC A;  4HE2 A;  3EHT A;  4G61 A;  4GWU A;  2RC8 A;  1MQG A;  1O7T A;  2RF1 A;  3BKI B;  1PBP A;  4XKN A;  4Q0C A;  4EQ7 A;  2V3T A;  1JNF A;  4ZEB A;  1T0K A;  3CFX A;  3SKP A;  4G68 A;  2XXT A;  5ICT A;  3E78 A;  1HSE A;  5ET8 A;  1US5 A;  2F35 A;  1SW1 A;  1IEJ A;  3CI8 A;  2Q2C A;  4NX1 A;  5EHS A;  1LLS A;  2PMS A;  1FJ9 A;  1B5I A;  4MH5 A;  3PUW E;  2I4B A;  2V4C A;  4IO2 A;  4RJZ A;  3HFU A;  4FAT A;  3OSQ A;  2Y84 A;  3CHG A;  5DT6 A;  5IGA A;  3C33 A;  4OVQ A;  5L9M A;  1B3E A;  2P1S A;  4BDM A;  4XKR A;  1VR5 A;  2FA7 A;  3H7M A;  5IZZ A;  2Y7W A;  5HBC A;  3T9H B;  2O7U A;  3FXU A;  4FAJ A;  4LAT A;  3OO9 A;  4YB7 A;  2AL5 A;  1LAX A;  3RTF B;  2HAV A;  4O8M A;  2I4C A;  2Y7I A;  1LB9 A;  3O9P A;  2O7I A;  3KG2 A;  3PV0 E;  3TAJ A;  4JWY A;  3ONM A;  3JZJ A;  4KR5 A;  2ABH A;  2LAO A;  3TEL A;  4P3L A;  3TFL A;  1D9V A;  3MUQ A;  4GWO A;  3B6Q A;  1I6Q A;  4H46 A;  3OO6 A;  3K6W A;  2AL4 A;  2FIX A;  4H45 A;  4UAC A;  1FBD A;  3IB0 A;  1PB8 A;  2Z8D A;  1M5F A;  4MNP A;  4PFU A;  1EYK A;  2PCR A;  4PDD A;  5CMM A;  3FVG A;  4R2B A;  1FBF A;  3KJT A;  1H44 A;  4NAP A;  3PD8 A;  1FBE A;  4MIJ A;  2ZNS A;  2VP1 A;  4NF0 A;  3M3F A;  4WEP A;  3GBB A;  4Z7E A;  4R9F A;  4WXJ A;  5EQA A;  3IOR A;  4IY5 A;  4MBP A;  1YCJ A;  3QSL A;  4OVP A;  2GQ1 A;  3I5O A;  4MF3 A;  1NUW A;  4U4X A;  2PT2 A;  1MDQ A;  4FEC A;  4RYA A;  2FNC A;  2R8T A;  3PPP A;  4PC9 A;  2L5V A;  4F3G A;  3TZA A;  3U92 A;  1MXY A;  3SES A;  3SER A;  1TXF A;  1RKM A;  4POW A;  5ET7 A;  3SET A;  3BFU A;  1FRP A;  4DZ1 A;  1M5C A;  1DPP A;  2OWS A;  3V8X B;  2A5T A;  4TQU Q;  2V3U A;  3IB1 A;  1A55 A;  3MZ9 A;  4G77 A;  1B58 A;  3SEW A;  4JB7 A;  1FQE A;  2NUV A;  4ZEK A;  5CMB A;  5CM6 A;  1IUD A;  4ESW A;  1P1Q A;  1NUX A;  3O29 A;  2AIX A;  2HXR A;  3T9V A;  4PF8 A;  4POX A;  1H43 A;  2FBP A;  3IK6 B;  3K1P A;  4FJP A;  3V5A A;  5AA3 A;  5CBR A;  2B3F A;  3CRB A;  5HM4 B;  4R75 A;  1ZKB A;  2UVI A;  5KDT A;  3E9X A;  1Z7N E;  5L9O A;  2HZL A;  1PDA A;  1URG A;  4OWD A;  2O51 A;  3U8Q A;  3S9E A;  4ESX A;  1MY4 A;  3I3V A;  3FVN A;  3R7X A;  3B7D A;  5K2X A;  2Q8M A;  2XD3 A;  3B50 A;  1XC1 A;  2Z8F A;  2V84 A;  5B7D A;  1F9B A;  5F24 A;  1UIU A;  3IO4 A;  3CFL A;  3U1O A;  1LGB C;  2I58 A;  3PUX E;  4X04 A;  3CSB A;  3C31 A;  5EHM A;  4OFO A;  4MLQ A;  4OMB A;  2REG A;  3T0J A;  2X26 A;  1DSN A;  1B51 A;  3K6U A;  2Y7K A;  4G68 B;  1MPD A;  1IQ7 A;  2HEU A;  3OEK A;  2OWZ A;  1P1O A;  5CMK A;  1VDW A;  4FBP A;  4OAN A;  3T96 B;  1LBZ A;  2F7A A;  3K00 A;  3VDF A;  1NV0 A;  3RY3 A;  5H8N A;  1N04 A;  4I1D A;  3GXA A;  4AS4 A;  4UAB A;  1SW4 A;  1OQH A;  4P0G A;  4HW8 A;  5DEX B;  2XXP A;  3H6V A;  1II5 A;  3N6T A;  2DWH A;  3FVO A;  5DVI A;  5AA4 A;  1MG1 A;  1N0T A;  1IMF A;  4QFL A;  4P47 A;  4N07 A;  4KCD A;  5IZ1 A;  1MM7 A;  5TP9 A;  3T1B A;  5CC2 A;  4JVI A;  4R74 A;  2IEE A;  1I6A A;  2RC7 A;  5JTY A;  3K02 A;  2DE4 A;  4JSD A;  3EF7 A;  3H6U A;  3A09 A;  1A8F A;  4OEV A;  4FEB A;  2QS2 A;  1B32 A;  1H45 A;  1MM6 A;  4JSO A;  3VLW A;  5AA1 A;  1LCF A;  1JW1 A;  3RNN A;  2OJT A;  4F3S A;  4PAI A;  1B7H A;  1MQJ A;  1QJM A;  1LFG A;  3KOT A;  3O6G A;  1NNT A;  3D4G A;  4GWZ A;  2GHB A;  1FPJ A;  1UTH B;  4O7M A;  2I0C A;  3U65 A;  4OES A;  1P99 A;  1POT A;  4RA1 A;  1NV1 A;  4LUB A;  2CZK A;  3WAE A;  2FVZ A;  2XXK A;  4AB5 A;  1QKB A;  1YZ0 A;  3PU5 A;  3FV1 A;  4OYV A;  3CSG A;  2A5S A;  3K6V A;  2F8D A;  1JVY A;  2WKY A;  4R9G A;  3IX1 A;  1EZP A;  3CG3 A;  4K3F A;  1LCT A;  3T9U A;  1FSA A;  5JEI A;  1ZIU A;  5B70 A;  2P2A A;  2WYK A;  1QUK A;  2QSX A;  4LQ2 A;  2G93 A;  1FBC A;  4HXV A;  1QUL A;  1QGX A;  1MDP 1;  4JDF A;  5KCJ A;  4G68 C;  3LSX A;  3G3F A;  3RT6 B;  1URD A;  3MP1 A;  3MVY A;  2A5T B;  3HPI A;  2F3B A;  4MMP A;  5H8F B;  1A54 A;  5EQ7 A;  4GX3 A;  3TUS A;  1KWH A;  1LBW A;  3C9H A;  1M5B A;  4O3B A;  2Z22 A;  1Q9D A;  2DE2 A;  4F29 A;  3KFM A;  3JV9 A;  1R6Z A;  2M8C A;  2I48 A;  4FOR A;  2XX8 A;  3CG1 A;  4DCY A;  2FIE A;  3Q28 A;  4THI A;  1H3D A;  4DIG A;  1Z7M E;  2FYI A;  3FV2 A;  3QIM A;  3PPQ A;  2OZZ A;  3C4M A;  4Q8R A;  1SYH A;  2HAU A;  1JW4 A;  3Q25 A;  3G3H A;  3MJN A;  4QBA A;  4OA4 A;  4MLV A;  3MBP A;  4R73 A;  1EZ9 A;  4GBV A;  4GWS A;  3TQW A;  5I2N B;  2Y5L A;  3T22 A;  2F7C A;  5A5X A;  4RPN A;  2XA5 A;  3V83 A;  2B3B A;  3BIH A;  5CMC A;  2H5Y A;  1EYI A;  5I57 B;  3ODB A;  4LZ5 A;  2Z8E A;  4EDP A;  2F36 A;  4PFR A;  3IFC A;  4F19 A;  4WKM A;  2UVG A;  1R1N A;  4NGU A;  2WEF A;  3FAT A;  3EKI A;  5AA2 A;  1VE4 A;  4G8M A;  1NFT A;  4OER A;  4Q5T A;  2V25 A;  1BK4 A;  1FQF A;  4IGT A;  4NWD A;  1NV5 A;  4U2R A;  3O6I A;  3PPR A;  3TTM A;  1CB6 A;  3MST A;  4BDQ A;  2PFY A;  1PB7 A;  5DVJ A;  2VHA A;  3K2D A;  3SDF A;  4H6D A;  3IOT A;  2UVH A;  2ONR A;  2E1S A;  1GV8 A;  5L9S A;  4I3Y A;  3TTN A;  3W9W A;  3LSF B;  3HO7 A;  4IB2 A;  4YU0 A;  1Y3Q A;  4PTK A;  1ZMG A;  1MXW A;  3IR1 A;  3PD9 A;  1P1N A;  4H8I A;  4YIC A;  3D1R A;  2RKM A;  3BBR A;  4PBH A;  2QS4 A;  1B3F A;  3FJ7 A;  1ZTY A;  4NF4 A;  3U72 A;  5I56 B;  4XKP A;  4GWX A;  1FPD A;  2O6A A;  4EQB A;  1RYO A;  2P0S A;  1B4H A;  4PE3 A;  4MNI A;  1JEV A;  3I6V A;  1LEV A;  4GBW A;  3S2V A;  1LBB A;  4XXU A;  3LC8 A;  3TCF A;  2DVC A;  2QJE A;  3N6U A;  3Q26 A;  3FUZ A;  2D5W A;  1LST A;  2MKZ A;  2WBB A;  4JVC A;  3TPA A;  4YZZ A;  3ZKL A;  3RPL A;  4G4P A;  2PX1 A;  1IXG A;  4NF6 B;  4RNS A;  5I58 A;  4ISU A;  3RQT A;  5TPA A;  5F7V A;  3ZKK A;  1YTV A;  4C1T A;  1JVX A;  4U23 A;  1FPI A;  1NI9 A;  1ZLQ A;  4O3C A;  3O97 A;  2Q9T A;  3RLF E;  1FTA A;  3TYH A;  1R9Q A;  2XXX A;  2QMW A;  1Y3N A;  4X48 A;  4C1U A;  5IM2 A;  5I59 A;  1FCK A;  4U1O A;  4F3P A;  4QFO A;  2X7Q A;  1MXX A;  2REJ A;  1GR2 A;  1BP5 A;  1Y1M A;  1NUY A;  3KOS A;  1GTK A;  2THI A;  3FGS A;  5CI5 A;  3VXC A;  4XF5 A;  4PFI A;  2RIN A;  4X1B A;  1USY H;  3OO7 A;  1MH4 A;  4KI0 E;  4PFY A;  2NXO A;  2VPO A;  1DMB A;  3QAX A;  4NF8 B;  4PCD A;  4ZE8 A;  3R6U A;  4F18 A;  4Q30 B;  4RXL A;  1NUZ A;  4X8R A;  4OTE A;  2DVZ A;  1B3H A;  1NNK A;  1AWB A;  3GYY A;  2XWV A;  4KQP A;  1BIY A;  1Q1K A;  3VXB A;  5TU0 A;  1KA1 A;  1O64 A;  5BUU A;  3DM0 A;  3FXQ A;  3TTR A;  2KQZ A;  4MNC A;  2RCB A;  2D21 A;  1FQC A;  2ZYN A;  4GFR A;  3M3L A;  5H8H A;  4HCY A;  1RDZ A;  4F2Q A;  2CZL A;  2D3I A;  1NNF A;  3FAS A;  4FIM A;  3E3K A;  3KBR A;  5I2K A;  3TOD A;  2ESN A;  2QL3 A;  4OFJ A;  3VVE A;  1MQD A;  4HE0 A;  2FHY A;  5H8Q B;  1B3L A;  5K2Y A;  1XOC A;  2F34 A;  1XHY A;  2AYS A;  2B65 A;  4PFW A;  4MCO A;  1IXH A;  1B0H A;  3D4C A;  3H6T A;  3TCH A;  2HQ0 A;  4PE5 B;  4MEV A;  2O69 A;  3BIG A;  3VE1 B;  1PB9 A;  4G8N A;  2Q8J A;  2RCA A;  4GWY A;  3PGF A;  4DLD A;  4GF8 A;  3IO6 A;  1P1U A;  3FZV A;  3UN6 A;  1IXI A;  5FBP A;  5CRY A;  1A8E A;  1DK4 A;  2Q74 A;  2ZZW A;  2QFL A;  3FJG A;  3OOA A;  3E79 A;  4P1L A;  3MP6 A;  3MPK A;  5I3S A;  4YKJ A;  5AA2 D;  1OVT A;  3LUY A;  4OVJ A;  4GLI A;  5IZ3 A;  2QPQ A;  4PET A;  2DOJ A;  3KEI A;  3L6G A;  2VPN A;  1G0H A;  4GD5 A;  3PMX A;  1SYI A;  2UYE A;  1AL3 A;  2XHD A;  3B8B A;  1PBQ A;  4M4G A;  3K01 A;  3H4Z A;  2DP8 A;  4TOZ A;  3TTK A;  1BLF A;  3C36 A;  4H0W A;  1PEB A;  4AQ4 A;  1YYZ A;  1NL5 A;  1IMD A;  1SBP A;  4YKP A;  4GQO A;  1K9Z A;  1IIW A;  5DVF A;  2ZNU A;  3PMV A;  3SEV A;  3UIF A;  1K9Y A;  4QHQ A;  5ESY A;  3H6W A;  3PUV E;  4QRZ A;  1FTM A;  4P1E A;  2IA4 A;  1OVB A;  4KFQ A;  3LR1 A;  2DWJ A;  1OIB A;  4NG7 A;  4EXK A;  3RPL B;  3DLN A;  4AS5 A;  4X9T A;  1KA0 A;  1WVJ A;  1IIT A;  5TPA B;  4BDL A;  3TDJ A;  2Q89 A;  2ZZV A;  4OHN A;  4DXC A;  1EU8 A;  1B5H A;  1INP A;  3CVG A;  4PBQ A;  1NV3 A;  1CE2 A;  4QFP A;  1S9T A;  2UYF A;  4N15 A;  2F7B A;  1FTK A;  1MXZ A;  2H9B A;  4GL8 A;  2BJJ X;  5I5P A;  1M5D A;  4OZ9 A;  4U21 A;  4ZZE A;  2VGQ A;  2VOZ A;  1A7L A;  2YPN A;  2ANJ A;  2H98 A;  2PBW A;  2NOO A;  4QSD A;  2UXA A;  3ILU B;  2Y5K A;  1EZO A;  1FPG A;  1N3W A;  1MQI A;  1ATG A;  4MFI A;  4GWW A;  1SD3 A;  2QMX A;  2QRY A;  2XWI A;  2XXY A;  1JET A;  3IJX B;  2ZYM A;  2OLB A;  1MY3 A;  3SEU A;  3KN3 A;  5KZT A;  4P0I A;  4H1X A;  4DXU A;  4AB6 A;  4NE4 A;  1YXI A;  3VV5 A;  4XKQ A;  1FPK A;  4N6P A;  2V93 A;  4RY1 A;  2R6G E;  3FVK A;  3C34 A;  3MZ1 A;  4DXB A;  4EQ9 A;  1VFD A;  2WYP A;  1FPB A;  4LA9 A;  3ILT B;  4PAF A;  3VLU A;  4IY6 A;  3HST A;  4GX4 A;  5H8H B;  3SEY A;  4LZ8 A;  1ANF A;  4DE8 A;  4FE8 A;  4MHF A;  3OEL A;  4XEQ A;  1IMB A;  3B6T A;  4MJO A;  1JP4 A;  5FHM A;  4GX6 A;  4PGP A;  4PP0 A;  2DE3 A;  2CMO A;  3OMB A;  3LBS A;  1ZJL A;  2XXW A;  3G7W A;  2KR0 A;  3QUJ A;  3MW0 A;  4PFB A;  3O66 A;  4O3A A;  1B05 A;  4C0R A;  4ELQ A;  2VD3 A;  1POY 1;  5ET6 A;  3TMG A;  5KDT B;  4GOT A;  2BJI A;  4TLM B;  4YMB A;  4P11 A;  5ET5 A;  1FQD A;  4U22 A;  3UGW A;  1ZU0 A;  1BTJ A;  3CIJ A;  3IOU A;  4F31 B;  1RDY A;  2DSF A;  2XXQ A;  1MS7 A;  4X1D A;  1URS A;  1EH3 A;  5EQ9 A;  3RYD A;  1B9J A;  3HCQ A;  1MY1 A;  3UP9 A;  3AXF A;  1QUI A;  4BDN A;  3MP8 A;  1FJ6 A;  5IZ3 B;  2YLN A;  4DI4 B;  4YB5 A;  2ZMB A;  4OVS A;  2B4M A;  1B52 A;  4QF9 A;  3ISP A;  3KN8 A;  5A5L A;  4LQ5 A;  1G0I A;  4OEN A;  4R6K A;  2ONS A;  3UK4 A;  1DCU A;  2PVU A;  3KBZ A;  5FHO A;  1Y1Z A;  2Z23 A;  2DWA A;  5FTI A;  4JWO A;  1MPC A;  4GVO A;  4F39 A;  5EQ8 A;  4F1Y A;  5H8N B;  3LSL A;  3DP6 A;  2Y7P A;  4KHZ E;  3KC0 A;  3SEX A;  4OEU A;  4ONY A;  4KXP A;  5HPQ A;  4P56 A;  2W7Y A;  1LFH A;  3CR9 A;  4GXA A;  2O1M A;  2I3W A;  4ELR A;  2Y7R A;  4HE1 A;  4QSC A;  5T3J A;  3MQ9 A;  5AA4 B;  1UQW A;  1Y3P A;  3THI A;  5TP9 B;  1MXV A;  3H3G A;  1TFA A;  3S4U A;  1N76 A;  3W15 C;  3HHF A;  1ELJ A;  2DS9 A;  2CZI A;  1B1H A;  2I3V A;  5JTY B;  4QFK A;  5ELV A;  3FD3 A;  2O68 A;  1SI0 A;  2QS1 A;  1FPL A;  1OLA A;  4H65 A;  3ROJ A;  1NH7 A;  2ZXT A;  1USY E;  3M3K A;  2XXI A;  2ALU A;  5ISU A;  4QSE A;  1NMU A;  3MWB A;  4G2Z A;  3FJM A;  3P7I A;  4I3E A;  1B0L A;  1AIV A;  4NHB A;  3MYU A;  4YB6 A;  3KSJ A;  1WOD A;  1VFE A;  2E0S A;  4RPO A;  4RK9 A;  5JK4 A;  3U94 A;  4BLA A;  4MAG A;  5LDZ A;  2QVR A;  1US4 A;  2OK2 A;  3LUZ A;  1NNP A;  2XXH A;  2CEX A;  1FTJ A;  3C32 A;  2P3V A;  4PF6 A;  4ELO A;  1A40 A;  2I6E A;  3QYT A;  5DEX A;  1QUJ A;  3KZG A;  3RN8 A;  4UA8 A;  1RYX A;  2DXR A;  1AMF A;  3LV0 A;  4PAK A;  1B3G A;  5LOM A;  2P3N A;  4NED A;  5H8S A;  2ZYO A;  4F1U A;  4Z0I A;  4ZZA A;  3EN3 A;  3C35 A;  3KC1 A;  1JW5 A;  4I62 A;  3RT8 A;  1SDX A;  3A29 A;  4F2O A;  3TTL A;  1KZ8 A;  2O84 X;  3SZP A;  1MXU A;  4JXI A;  5IKB A;  1XVY A;  5KCJ B;  3W9V A;  3FBP A;  2OX3 A;  4LVQ A;  5DYH A;  3RUM A;  3FXR A;  5FTH A;  1DOT A;  1D3K A;  3HN0 A;  1AH5 A;  1IME A;  3H06 B;  3MVW A;  3KJ7 A;  4PDH A;  1IMC A;  3EQ1 A;  2GRV A;  2H25 A;  3IB2 A;  1TT1 A;  2JJK A;  4QFN A;  1S50 A;  3A3C A;  4GL0 A;  3O6H A;  3TKD A;  2XD2 A;  1N84 A;  2KLF A;  1UTH A;  3FXB A;  4KYS A;  3Q27 A;  3L6H A;  1FBG A;  1R9L A;  1B4Z A;  3IOW A;  4ELP A;  4G8H A;  4N4U A;  3N94 A;  4BDO A;  1S7Y A;  1MY0 A;  3GBA A;  2XWO A;  4KYD A;  3IJO B;  1RDX A;  2YJP A;  3G3G A;  2DXY A;  2DYX A;  2I49 A;  4ZEC A;  3V89 B;  3RGY A;  1H76 A;  3B6W A;  5EYH A;  4IO3 A;  3K0V A;  4NF5 A;  1FQA A;  5A5X B;  1D9Y A;  4HCW A;  2QVV A;  2ONK E;  1SI1 A;  1MRP A;  3N26 A;  3MVZ A;  3BFT A;  3T9X B;  1N3X A;  3EPE A;  3WAF A;  3OEM A;  4HS7 A;  1I69 A;  2UVJ A;  1LBY A;  3MAM A;  5H8F A;  2QVU A;  1IMA A;  4I40 A;  3MPL A;  4E0X A;  5AA2 B;  1M5E A;  1UIV A;  1B46 A;  3TCG A;  1YAE A;  1UTB A;  3U93 A;  2O1L A;  3H03 A;  2V3Q A;  4H5F A;  3MVX A;  4N81 A;  4DDD A;  2F6G A;  2H4I A;  4LZ7 A;  3QXM A;  3KGC A;  3VLV A;  5AE4 A;  2I0B A;  2F97 A;  4N17 A;  1SVX B;  1FPF A;  2OCU A;  5J1D A;  1XT8 A;  4FED A;  4JVD A;  1VSO A;  4LON B;  1QKA A;  2R9J A;  3IL1 B;  1Y20 A;  4F1V A;  1IXC A;  3O28 A;  2VT5 A;  1DPE A;  1FW0 A;  4R2F A;  1AOV A;  1NH8 A;  1OQG A;  2CEY A;  4N13 A;  1LAF E;  4L17 A;  5DTB A;  2G29 A;  3IOV A;  1FBH A;  5EYG A;  2DWI A;  1N7W A;  1HSJ A;  5IAI A;  1DTZ A;  5I2N A;  2QS3 A;  4TLL B;  4NF4 B;  4O7I A;  2OWT A;  1ZBM A;  2NWJ A;  3CFZ A;  1NV6 A;  3R26 A;  5I57 A;  4LP2 B;  3TQL A;  4ZEI A;  3VVD A;  1LBV A;  4EF2 A;  1QW0 A;  4OVT A;  2ZYK A;  3GLB A;  3EHS A;  4F22 A;  4I8C A;  3PUY E;  4OFL A;  1DTG A;  2XX9 A;  1B5J A;  1XVX A;  1TWY A;  2ZZX A;  2DQV A;  3KN7 A;  3K6X A;  1D9Q A;  4EUO A;  5I58 B;  3HV1 A;  2VD2 A;  1D4N A;  4OET A;  4JWX A;  2F6P A;  1BKA A;  4IO4 A; 
#chains in the Genus database with same CATH homology
 1MQH A;  4KD5 A;  4IGR A;  4ND9 A;  4H8J A;  4JBZ A;  4XTC Q;  1Y4C A;  4KPT A;  3IAZ A;  5BWJ A;  1J1N A;  5I59 B;  4NWC A;  2RC9 A;  1SW5 A;  4I9D A;  4XIG Q;  3TEP A;  3K4U A;  5F1Q A;  1B1X A;  2Q2A A;  1N7X A;  3A3U A;  1O63 A;  3G3I A;  2PYY A;  4R6H A;  2GFE A;  3ECR A;  3MC2 A;  1SW2 A;  5I56 A;  4PFT A;  3RTW B;  2F78 A;  2HXW A;  3ZS6 A;  3DP8 A;  4OQO A;  3S9N C;  4R6Y A;  1LFI A;  4WED A;  1L5T A;  2HZK A;  1P1W A;  4KYE A;  3HHG A;  5ITO A;  5CBS A;  1JEU A;  3S9M C;  3M8U A;  4YKK A;  4NTL A;  5EYF A;  3OXN A;  4NF6 A;  1Y9U A;  3T93 B;  3G3K A;  4IO7 A;  4GIZ A;  2NVU B;  2Q88 A;  3DEL B;  3Q29 A;  2XXR A;  3VFJ A;  2GHA A;  1JQF A;  4NF5 B;  5I2K B;  2XXU A;  3ZSF A;  1A99 A;  2XXV A;  4IO6 A;  3FIR A;  2ZNT A;  5L8D A;  3GZG A;  1SQY A;  3PUZ E;  5M2V A;  3MZB A;  2X7P A;  4H5G A;  4H67 A;  1FQB A;  4ZDM A;  3OO8 A;  1NKX A;  4PQJ A;  2HCA A;  1B2H A;  1B7U A;  1WDN A;  1Y4T A;  3E13 X;  4EXL A;  2H99 A;  1YPN A;  3UA8 A;  5ICQ A;  4U1Z A;  3PPO A;  1UTB B;  4IO5 A;  2R71 A;  2GH9 A;  3RPW A;  4NMY A;  3DP4 A;  3JYR A;  4NF8 A;  3K1N A;  3EHU A;  1B6H A;  2XX7 A;  3OD7 A;  4BDR A;  4KCC A;  1MPB A;  2OBG A;  1TFD A;  4YMA A;  1I6B A;  1FTL A;  1HSL A;  4GXS B;  4ZE9 A;  4RK2 A;  4ZED A;  5ITP A;  3KSX A;  3LSW A;  3O2A A;  1GVC A;  5FHN A;  4R72 A;  3UOR A;  4ECF A;  1PC3 A;  1GGG A;  3VVF A;  1OLC A;  2PT1 A;  4GRK A;  5I84 A;  3S9L C;  1B7Z A;  4U4S A;  3USD A;  3K1M A;  3OEN A;  1LAH E;  4M1V A;  5H8Q A;  3E4R A;  4ZS9 A;  1LAG E;  4OXV A;  3F11 A;  3PMW A;  2HFB A;  3OSR A;  1OMP A;  1QVS A;  3T66 A;  1MH3 A;  1MY2 A;  4YKI A;  4F3B A;  3QUF A;  4EF1 A;  3N5L A;  3QK6 A;  1XS5 A;  4ZEF A;  3PPN A;  1IZ1 A;  4E0W A;  4DCX A;  1FTO A;  4HTG A;  4YAH X;  1Q35 A;  1B40 A;  2F5X A;  1LB8 A;  3G3J A;  1LBC A;  3EHT A;  2RC8 A;  1MQG A;  1O7T A;  2RF1 A;  3BKI B;  1PBP A;  4XKN A;  4Q0C A;  4EQ7 A;  2V3T A;  1JNF A;  4ZEB A;  1T0K A;  3CFX A;  3SKP A;  4G68 A;  2XXT A;  5ICT A;  1HSE A;  1US5 A;  2F35 A;  1SW1 A;  1IEJ A;  3CI8 A;  2Q2C A;  5EHS A;  1LLS A;  2PMS A;  1B5I A;  4MH5 A;  3PUW E;  2I4B A;  4IO2 A;  4RJZ A;  4FAT A;  3OSQ A;  2Y84 A;  5DT6 A;  3C33 A;  5L9M A;  1B3E A;  2P1S A;  4BDM A;  4XKR A;  1VR5 A;  2FA7 A;  3H7M A;  2Y7W A;  5HBC A;  3T9H B;  4FAJ A;  2O7U A;  3FXU A;  4LAT A;  3OO9 A;  4YB7 A;  2AL5 A;  1LAX A;  3RTF B;  2HAV A;  2I4C A;  2Y7I A;  1LB9 A;  3O9P A;  2O7I A;  3KG2 A;  3PV0 E;  3TAJ A;  4JWY A;  3ONM A;  3JZJ A;  4KR5 A;  2ABH A;  2LAO A;  3TEL A;  3TFL A;  1D9V A;  3MUQ A;  4GWO A;  3B6Q A;  1I6Q A;  3OO6 A;  3K6W A;  2AL4 A;  4UAC A;  3IB0 A;  1PB8 A;  2Z8D A;  1M5F A;  4PFU A;  5CMM A;  3FVG A;  4R2B A;  3KJT A;  1H44 A;  3PD8 A;  2ZNS A;  2VP1 A;  3M3F A;  4WEP A;  3GBB A;  4Z7E A;  4R9F A;  4WXJ A;  3IOR A;  4IY5 A;  4MBP A;  1YCJ A;  3QSL A;  3I5O A;  4MF3 A;  4U4X A;  2PT2 A;  1MDQ A;  4FEC A;  4RYA A;  2FNC A;  3PPP A;  4F3G A;  3TZA A;  3U92 A;  1MXY A;  3SES A;  3SER A;  1TXF A;  1RKM A;  4POW A;  3SET A;  3BFU A;  4DZ1 A;  1M5C A;  1DPP A;  2OWS A;  3V8X B;  2A5T A;  4TQU Q;  2V3U A;  3IB1 A;  1A55 A;  3MZ9 A;  4G77 A;  1B58 A;  3SEW A;  4JB7 A;  1FQE A;  2NUV A;  4ZEK A;  5CMB A;  5CM6 A;  1IUD A;  4ESW A;  1P1Q A;  3O29 A;  2AIX A;  3T9V A;  4POX A;  1H43 A;  3IK6 B;  3K1P A;  4FJP A;  3V5A A;  5AA3 A;  5CBR A;  2B3F A;  3CRB A;  5HM4 B;  4R75 A;  1ZKB A;  2UVI A;  5KDT A;  3E9X A;  1Z7N E;  5L9O A;  2HZL A;  1PDA A;  1URG A;  4OWD A;  2O51 A;  3U8Q A;  3S9E A;  4ESX A;  1MY4 A;  3I3V A;  3FVN A;  3R7X A;  3B7D A;  5K2X A;  2XD3 A;  1XC1 A;  2Z8F A;  2V84 A;  5B7D A;  1F9B A;  1UIU A;  3IO4 A;  3CFL A;  3U1O A;  1LGB C;  2I58 A;  3PUX E;  3CSB A;  3C31 A;  5EHM A;  4OFO A;  4MLQ A;  4OMB A;  2REG A;  2X26 A;  1DSN A;  1B51 A;  3K6U A;  2Y7K A;  4G68 B;  1MPD A;  1IQ7 A;  2HEU A;  3OEK A;  1P1O A;  5CMK A;  3T96 B;  2F7A A;  3K00 A;  3VDF A;  3RY3 A;  5H8N A;  1N04 A;  4I1D A;  3GXA A;  1SW4 A;  1OQH A;  4P0G A;  4HW8 A;  5DEX B;  2XXP A;  3H6V A;  1II5 A;  3N6T A;  2DWH A;  3FVO A;  5DVI A;  5AA4 A;  1MG1 A;  1N0T A;  4QFL A;  4N07 A;  4KCD A;  1MM7 A;  5TP9 A;  5CC2 A;  4R74 A;  2IEE A;  1I6A A;  2RC7 A;  5JTY A;  3K02 A;  2DE4 A;  4JSD A;  3EF7 A;  3H6U A;  3A09 A;  1A8F A;  4OEV A;  4FEB A;  2QS2 A;  1B32 A;  1H45 A;  1MM6 A;  4JSO A;  3VLW A;  5AA1 A;  1LCF A;  1JW1 A;  3RNN A;  2OJT A;  4F3S A;  1B7H A;  1MQJ A;  1QJM A;  1LFG A;  3KOT A;  3O6G A;  1NNT A;  3D4G A;  2GHB A;  1UTH B;  2I0C A;  4OES A;  1P99 A;  1POT A;  4RA1 A;  4LUB A;  3WAE A;  4AB5 A;  1QKB A;  3PU5 A;  3FV1 A;  4OYV A;  3CSG A;  2A5S A;  3K6V A;  2F8D A;  1JVY A;  2WKY A;  4R9G A;  3IX1 A;  1EZP A;  3CG3 A;  4K3F A;  1LCT A;  3T9U A;  5JEI A;  1ZIU A;  5B70 A;  2P2A A;  1QUK A;  2QSX A;  4LQ2 A;  2G93 A;  1QUL A;  1MDP 1;  4JDF A;  5KCJ A;  4G68 C;  3LSX A;  3G3F A;  3RT6 B;  1URD A;  3MP1 A;  3MVY A;  2A5T B;  3HPI A;  5H8F B;  1A54 A;  3TUS A;  1KWH A;  3C9H A;  1M5B A;  4O3B A;  2Z22 A;  2DE2 A;  4F29 A;  3KFM A;  3JV9 A;  1R6Z A;  2M8C A;  2I48 A;  4FOR A;  2XX8 A;  3CG1 A;  4DCY A;  3Q28 A;  4THI A;  1H3D A;  4DIG A;  1Z7M E;  2FYI A;  3FV2 A;  3QIM A;  3PPQ A;  2OZZ A;  3C4M A;  4Q8R A;  1SYH A;  2HAU A;  1JW4 A;  3Q25 A;  3G3H A;  3MJN A;  4MLV A;  3MBP A;  4R73 A;  1EZ9 A;  3TQW A;  5I2N B;  3T22 A;  2F7C A;  5A5X A;  4RPN A;  3V83 A;  2B3B A;  5CMC A;  2H5Y A;  5I57 B;  3ODB A;  4LZ5 A;  4EDP A;  2Z8E A;  2F36 A;  4F19 A;  4WKM A;  2UVG A;  1R1N A;  3FAT A;  5AA2 A;  1VE4 A;  4G8M A;  1NFT A;  4OER A;  4Q5T A;  2V25 A;  1FQF A;  4IGT A;  4NWD A;  4U2R A;  3O6I A;  3PPR A;  3TTM A;  1CB6 A;  4BDQ A;  1PB7 A;  5DVJ A;  2VHA A;  3K2D A;  3SDF A;  4H6D A;  3IOT A;  2UVH A;  2ONR A;  2E1S A;  1GV8 A;  5L9S A;  3TTN A;  3W9W A;  3LSF B;  3HO7 A;  4IB2 A;  4YU0 A;  1Y3Q A;  1ZMG A;  1MXW A;  3IR1 A;  3PD9 A;  1P1N A;  4H8I A;  4YIC A;  2RKM A;  3BBR A;  2QS4 A;  1B3F A;  3FJ7 A;  1ZTY A;  4NF4 A;  3U72 A;  5I56 B;  4XKP A;  2O6A A;  4EQB A;  1RYO A;  2P0S A;  1B4H A;  1JEV A;  3I6V A;  3S2V A;  1LBB A;  4XXU A;  3LC8 A;  3TCF A;  2DVC A;  2QJE A;  3N6U A;  3Q26 A;  3FUZ A;  2D5W A;  1LST A;  3TPA A;  4YZZ A;  3ZKL A;  4G4P A;  2PX1 A;  1IXG A;  4NF6 B;  4RNS A;  5I58 A;  4ISU A;  3RQT A;  5TPA A;  5F7V A;  3ZKK A;  1YTV A;  4C1T A;  1JVX A;  4U23 A;  1ZLQ A;  4O3C A;  3O97 A;  2Q9T A;  3RLF E;  3TYH A;  1R9Q A;  2XXX A;  2QMW A;  1Y3N A;  4X48 A;  4C1U A;  5I59 A;  1FCK A;  4U1O A;  4F3P A;  4QFO A;  2X7Q A;  1MXX A;  2REJ A;  1GR2 A;  1BP5 A;  1Y1M A;  3KOS A;  1GTK A;  2THI A;  3FGS A;  5CI5 A;  3VXC A;  2RIN A;  4X1B A;  1USY H;  3OO7 A;  1MH4 A;  4KI0 E;  4PFY A;  2NXO A;  1DMB A;  3QAX A;  4NF8 B;  4ZE8 A;  3R6U A;  4F18 A;  4Q30 B;  4RXL A;  4OTE A;  2DVZ A;  1B3H A;  1NNK A;  4KQP A;  1BIY A;  1Q1K A;  3VXB A;  5TU0 A;  1O64 A;  5BUU A;  3DM0 A;  3FXQ A;  3TTR A;  2RCB A;  2D21 A;  1FQC A;  2ZYN A;  4GFR A;  3M3L A;  5H8H A;  4HCY A;  4F2Q A;  2CZL A;  2D3I A;  1NNF A;  3FAS A;  4FIM A;  3E3K A;  3KBR A;  5I2K A;  3TOD A;  2ESN A;  2QL3 A;  4OFJ A;  3VVE A;  1MQD A;  5H8Q B;  1B3L A;  5K2Y A;  1XOC A;  2F34 A;  1XHY A;  2AYS A;  2B65 A;  4PFW A;  1IXH A;  1B0H A;  3D4C A;  3H6T A;  3TCH A;  2HQ0 A;  4PE5 B;  2O69 A;  3VE1 B;  1PB9 A;  4G8N A;  2Q8J A;  2RCA A;  3PGF A;  4DLD A;  4GF8 A;  3IO6 A;  1P1U A;  3FZV A;  3UN6 A;  1IXI A;  5CRY A;  1A8E A;  3FJG A;  3OOA A;  3MP6 A;  3MPK A;  4YKJ A;  5AA2 D;  1OVT A;  3LUY A;  4OVJ A;  4GLI A;  2QPQ A;  4PET A;  2DOJ A;  3KEI A;  3L6G A;  4GD5 A;  3PMX A;  1SYI A;  2UYE A;  1AL3 A;  2XHD A;  1PBQ A;  4M4G A;  3K01 A;  3H4Z A;  2DP8 A;  4TOZ A;  3TTK A;  1BLF A;  3C36 A;  4H0W A;  1PEB A;  4AQ4 A;  1NL5 A;  1SBP A;  4YKP A;  4GQO A;  1IIW A;  5DVF A;  2ZNU A;  3PMV A;  3SEV A;  3UIF A;  4QHQ A;  3H6W A;  3PUV E;  4QRZ A;  1FTM A;  2IA4 A;  1OVB A;  4KFQ A;  3LR1 A;  2DWJ A;  1OIB A;  4EXK A;  3DLN A;  4X9T A;  1WVJ A;  1IIT A;  5TPA B;  4BDL A;  3TDJ A;  2Q89 A;  4OHN A;  4DXC A;  1EU8 A;  1B5H A;  3CVG A;  1CE2 A;  4QFP A;  1S9T A;  2UYF A;  2F7B A;  1FTK A;  1MXZ A;  2H9B A;  4GL8 A;  2BJJ X;  1M5D A;  4OZ9 A;  4U21 A;  4ZZE A;  2VGQ A;  2VOZ A;  1A7L A;  2YPN A;  2ANJ A;  2H98 A;  2PBW A;  2NOO A;  4QSD A;  2UXA A;  3ILU B;  1EZO A;  1N3W A;  1MQI A;  1ATG A;  4MFI A;  1SD3 A;  2QMX A;  2QRY A;  2XXY A;  1JET A;  3IJX B;  2ZYM A;  2OLB A;  1MY3 A;  3SEU A;  3KN3 A;  5KZT A;  4P0I A;  4H1X A;  4DXU A;  4AB6 A;  4NE4 A;  3VV5 A;  4XKQ A;  4N6P A;  2V93 A;  4RY1 A;  2R6G E;  3FVK A;  3C34 A;  3MZ1 A;  4DXB A;  4EQ9 A;  1VFD A;  4LA9 A;  3ILT B;  3VLU A;  4IY6 A;  3HST A;  5H8H B;  3SEY A;  4LZ8 A;  1ANF A;  4DE8 A;  4FE8 A;  3OEL A;  3B6T A;  5FHM A;  4PP0 A;  2DE3 A;  2CMO A;  3OMB A;  3LBS A;  1ZJL A;  2XXW A;  3G7W A;  3QUJ A;  3MW0 A;  3O66 A;  4O3A A;  1B05 A;  4C0R A;  4ELQ A;  2VD3 A;  1POY 1;  3TMG A;  5KDT B;  4GOT A;  4TLM B;  4YMB A;  4P11 A;  1FQD A;  4U22 A;  3UGW A;  1ZU0 A;  1BTJ A;  3CIJ A;  3IOU A;  4F31 B;  2DSF A;  2XXQ A;  1MS7 A;  4X1D A;  1URS A;  1EH3 A;  1B9J A;  3HCQ A;  1MY1 A;  3UP9 A;  3AXF A;  1QUI A;  4BDN A;  3MP8 A;  2YLN A;  4YB5 A;  2ZMB A;  1B52 A;  4QF9 A;  3KN8 A;  4LQ5 A;  4OEN A;  4R6K A;  2ONS A;  3UK4 A;  2PVU A;  5FHO A;  1Y1Z A;  2Z23 A;  2DWA A;  5FTI A;  4JWO A;  1MPC A;  4GVO A;  4F39 A;  5H8N B;  4F1Y A;  3LSL A;  3DP6 A;  2Y7P A;  4KHZ E;  3SEX A;  4OEU A;  4ONY A;  5HPQ A;  2W7Y A;  1LFH A;  3CR9 A;  4GXA A;  2O1M A;  2I3W A;  4ELR A;  2Y7R A;  4QSC A;  3MQ9 A;  5AA4 B;  1UQW A;  1Y3P A;  3THI A;  5TP9 B;  1MXV A;  3H3G A;  1TFA A;  3S4U A;  1N76 A;  3W15 C;  3HHF A;  1ELJ A;  2DS9 A;  1B1H A;  2I3V A;  5JTY B;  4QFK A;  5ELV A;  3FD3 A;  2O68 A;  1SI0 A;  2QS1 A;  1OLA A;  4H65 A;  1NH7 A;  2ZXT A;  1USY E;  3M3K A;  2XXI A;  2ALU A;  5ISU A;  4QSE A;  1NMU A;  3MWB A;  4G2Z A;  3FJM A;  3P7I A;  1B0L A;  1AIV A;  4YB6 A;  3KSJ A;  1WOD A;  1VFE A;  2E0S A;  4RPO A;  4RK9 A;  5JK4 A;  3U94 A;  4BLA A;  1US4 A;  2OK2 A;  1NNP A;  2XXH A;  3C32 A;  1FTJ A;  4ELO A;  1A40 A;  2I6E A;  3QYT A;  5DEX A;  1QUJ A;  3KZG A;  3RN8 A;  4UA8 A;  1RYX A;  2DXR A;  1AMF A;  5LOM A;  1B3G A;  4NED A;  5H8S A;  2ZYO A;  4F1U A;  4Z0I A;  4ZZA A;  3EN3 A;  3C35 A;  1JW5 A;  4I62 A;  3RT8 A;  1SDX A;  4F2O A;  3TTL A;  2O84 X;  1MXU A;  4JXI A;  5IKB A;  1XVY A;  5KCJ B;  3W9V A;  4LVQ A;  5DYH A;  3RUM A;  3FXR A;  5FTH A;  1DOT A;  1D3K A;  3HN0 A;  1AH5 A;  3H06 B;  3MVW A;  3KJ7 A;  3EQ1 A;  2GRV A;  2H25 A;  3IB2 A;  1TT1 A;  4QFN A;  1S50 A;  3A3C A;  4GL0 A;  3O6H A;  3TKD A;  2XD2 A;  1N84 A;  2KLF A;  1UTH A;  4KYS A;  3Q27 A;  3L6H A;  1R9L A;  1B4Z A;  3IOW A;  4ELP A;  4G8H A;  3N94 A;  4BDO A;  1S7Y A;  1MY0 A;  3GBA A;  4KYD A;  3IJO B;  2YJP A;  3G3G A;  2DXY A;  2DYX A;  2I49 A;  4ZEC A;  3V89 B;  3RGY A;  1H76 A;  3B6W A;  4IO3 A;  3K0V A;  4NF5 A;  1FQA A;  5A5X B;  1D9Y A;  4HCW A;  2ONK E;  1SI1 A;  1MRP A;  3N26 A;  3MVZ A;  3BFT A;  3T9X B;  1N3X A;  3EPE A;  3WAF A;  3OEM A;  4HS7 A;  1I69 A;  2UVJ A;  3MAM A;  5H8F A;  3MPL A;  4E0X A;  5AA2 B;  1M5E A;  1UIV A;  1B46 A;  3TCG A;  1YAE A;  1UTB A;  3U93 A;  2O1L A;  3H03 A;  2V3Q A;  4H5F A;  3MVX A;  4DDD A;  2F6G A;  2H4I A;  4LZ7 A;  3QXM A;  3KGC A;  3VLV A;  5AE4 A;  2I0B A;  2F97 A;  1SVX B;  2OCU A;  5J1D A;  1XT8 A;  4FED A;  4LON B;  1VSO A;  1QKA A;  2R9J A;  3IL1 B;  1Y20 A;  4F1V A;  1IXC A;  3O28 A;  1DPE A;  1FW0 A;  4R2F A;  1AOV A;  1NH8 A;  1OQG A;  4N13 A;  1LAF E;  4L17 A;  5DTB A;  2G29 A;  3IOV A;  2DWI A;  1N7W A;  1HSJ A;  5IAI A;  1DTZ A;  5I2N A;  2QS3 A;  4TLL B;  4NF4 B;  2OWT A;  1ZBM A;  2NWJ A;  3CFZ A;  3R26 A;  5I57 A;  4LP2 B;  3TQL A;  4ZEI A;  3VVD A;  4EF2 A;  1QW0 A;  2ZYK A;  3GLB A;  3EHS A;  4F22 A;  4I8C A;  3PUY E;  4OFL A;  1DTG A;  2XX9 A;  1B5J A;  1XVX A;  1TWY A;  2DQV A;  3KN7 A;  3K6X A;  4EUO A;  5I58 B;  3HV1 A;  2VD2 A;  1D4N A;  4OET A;  4JWX A;  2F6P A;  1BKA A;  4IO4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...