3PPOA

Structures of the substrate-binding protein provide insights into the multiple compatible solutes binding specificities of bacillus subtilis abc transporter opuc
Total Genus 99
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
99
sequence length
272
structure length
272
Chain Sequence
DTIKIGAQSMTESEIVANMIAQLIEHDTDLNTALVKNLGSNYVQHQAMLGGDIDISATRYSGTDLTSTLGKEAEKDPKKALNIVQNEFQKRFSYKWFDSYGFDNTYAFTVTKKFAEKEHINTVSDLKKNASQYKLGVDNAWLKRKGDGYKGFVSTYGFEFGTTYPMQIGLVYDAVKNGKMDAVLAYSTDGRIKAYDLKILKDDKRFFPPYDCSPVIPEKVLKEHPELEGVINKLIGQIDTETMQELNYEVDGKLKEPSVVAKEFLEKHHYFD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glycine betaine/carnitine/choline-binding protein
publication title Structures of the substrate-binding protein provide insights into the multiple compatible solute binding specificities of the Bacillus subtilis ABC transporter OpuC
pubmed doi rcsb
source organism Bacillus subtilis
total genus 99
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-11-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04069 OpuAC Substrate binding domain of ABC-type glycine betaine transport system
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3ppoA01
3.40.190.120 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Osmoprotection protein (prox); domain 2 3ppoA02
4HW8A 4RPOA 4R9FA 4NF8B 1FTMA 2F36A 4C0RA 4XXUA 2OLBA 2I48A 5AA4B 1A8FA 1M5DA 4OFOA 4NMYA 4BDNA 4R6YA 4M4GA 4N6PA 3SEYA 1ZU0A 2OZZA 5K2XA 1Y9UA 3Q29A 2RCBA 4XKNA 2QRYA 2A5TB 3MQ9A 1NMUA 4QSCA 4WEPA 3VDFA 3FGSA 1P1WA 1JEUA 2ZMBA 1R1NA 4WKMA 3QUFA 5H8SA 4LONB 3Q26A 3VXBA 4DCXA 1MQDA 2RC8A 5AA2A 4OEVA 2ZNTA 4OETA 4DLDA 1NH7A 2O7UA 5DEXB 1URSA 3LR1A 3HHFA 1OVBA 1M5FA 4OYVA 3K2DA 5B7DA 3TCFA 1ZTYA 4AQ4A 3ECRA 1WDNA 2XXQA 1US5A 1CB6A 3IX1A 1B58A 3FXRA 5F7VA 1O7TA 4HS7A 5L9OA 1QJMA 4H1XA 2QSXA 4OWDA 3SEVA 4IO6A 2PBWA 3D4GA 3HPIA 4H8JA 4PFYA 3KOTA 4BDQA 1DPEA 3I3VA 2ZYOA 4E0XA 1LBCA 2DWAA 3PUYE 4YKJA 3HSTA 4U4XA 3FXQA 3PPOA 1GR2A 2VOZA 4YU0A 4P0GA 3RNNA 2VGQA 4UACA 1LB8A 1OQHA 4GRKA 5JEIA 5AA2B 4ZEBA 3EHTA 5DVIA 2Q2AA 1NFTA 2B3FA 2ZYKA 2DQVA 2H98A 1HSEA 2I0BA 1JVXA 4RJZA 2GRVA 4NF4A 4H6DA 3S9MC 2F6PA 1JNFA 2O6AA 2PX1A 3C36A 3QXMA 2REJA 3F11A 3PMVA 2Z8FA 4NEDA 1N7XA 1MXXA 2HZLA 3EPEA 3PUXE 4F18A 3ZSFA 3CSBA 4LA9A 4IY5A 1NKXA 3DLNA 4EXKA 1Y3PA 3CRBA 4JBZA 4YKPA 1B7UA 4G8NA 3KSXA 5JK4A 2AL5A 3RQTA 3W9VA 2XXPA 2DXRA 1B3LA 3SEWA 3PUVE 4HTGA 4O3AA 2ABHA 4XTCQ 4KCDA 3R6UA 1R9LA 2Y84A 1MQIA 1DSNA 3G3KA 4G68A 4DXBA 3FJGA 1B2HA 1ZMGA 2HQ0A 1XVXA 3C34A 3UN6A 3R26A 4MLVA 5LOMA 5FHOA 2O84X 3N94A 2ZNSA 3U94A 2NUVA 2Y7RA 3IB1A 5I59B 4GFRA 1DOTA 2REGA 1I6QA 4LZ5A 5DTBA 4RPNA 2XXUA 1Y1ZA 3C4MA 3DP6A 3TCHA 5H8QA 2H9BA 1IXIA 1B3EA 2E0SA 2QS2A 2ZXTA 3GBAA 3ZKKA 4I9DA 5H8FB 2RKMA 3B7DA 4H8IA 3S9NC 3C9HA 4XKPA 3S2VA 4JWOA 1UTHA 3FIRA 4X1BA 5DYHA 4H67A 1H3DA 4JDFA 3H6TA 1JVYA 2F97A 1PB8A 3T9VA 1M5CA 3PPRA 1N3XA 5JTYA 4GQOA 3TODA 2Q89A 1QKAA 4ISUA 1EZ9A 1MXZA 4IO3A 1NNTA 3E9XA 2RINA 3OMBA 4YB6A 1IEJA 1H43A 3WAEA 3K00A 1MPDA 1ATGA 1AIVA 2DXYA 4ZS9A 4OHNA 5A5XA 1FQBA 4C1TA 1SDXA 2HXWA 4DXCA 4Q30B 3KBRA 3MZ1A 4FECA 3MUQA 1IIWA 3LSLA 1QULA 3PD9A 3OEMA 4RA1A 3OO8A 4QF9A 3R7XA 4GL0A 4YB5A 4X9TA 3MP1A 2DE2A 4U21A 3CIJA 4WEDA 2LAOA 3M3KA 1UTBA 5ICTA 3ZKLA 4DZ1A 3HHGA 2FA7A 2R71A 4GOTA 5AA2D 2P2AA 2CMOA 3KJ7A 3EHSA 2ZNUA 2Z8DA 3SKPA 2XXYA 2QS3A 2DWJA 1MY2A 5CBRA 3RTFB 1IXGA 2G93A 3UIFA 2PYYA 3EF7A 5HBCA 3TTMA 4XKQA 1RKMA 3IOUA 2QS1A 1SI0A 3IJXB 1LFGA 4O3BA 4TLMB 1N7WA 1ZBMA 2V25A 3LSWA 2Q88A 2H5YA 1BP5A 1S7YA 1NNKA 3N6UA 1ZLQA 2ONSA 3HCQA 1VSOA 4NF8A 1GTKA 1GV8A 4TOZA 4ELQA 1H76A 3MVWA 1Q35A 3QSLA 1UTBB 2XD2A 4OFLA 3K6VA 5CM6A 5IKBA 1SW1A 1BTJA 4QRZA 2UVIA 1MH4A 2FYIA 3CI8A 3TDJA 4ND9A 4JWYA 4YMAA 4IO4A 2A5TA 2I3VA 3THIA 4F39A 1Y3QA 2KLFA 2ANJA 5CI5A 2I58A 3O28A 5AE4A 1AH5A 4HCWA 1LGBC 1XC1A 4NWDA 4EF2A 1IITA 1MRPA 4K3FA 1DPPA 5K2YA 3T9XB 3WAFA 3IOVA 1PB9A 4PE5B 4OFJA 3MW0A 2O1MA 1RYOA 4IO2A 1B52A 1B4ZA 1PDAA 4PFWA 5TU0A 2WKYA 3EQ1A 1XVYA 3LBSA 4OQOA 5AA1A 4YICA 3UP9A 4G68C 3K0VA 2XX7A 1B9JA 3TTLA 3OXNA 2V93A 1YPNA 1NH8A 1KWHA 4PP0A 2O1LA 5TPAB 1MM7A 4F3SA 4EQ7A 2Z22A 4F1YA 3RPWA 4NF6A 1D4NA 3V83A 3A3UA 3U72A 1US4A 4E0WA 4LUBA 2XXTA 3QIMA 4NTLA 4R75A 2VD2A 5CMMA 3PPNA 4GVOA 2P1SA 4XKRA 4YKKA 3L6HA 4ECFA 1B3FA 2O51A 1B32A 2OWSA 3RGYA 1AL3A 2Y7PA 5DT6A 3T9UA 1OLAA 3OSRA 1QUKA 4I8CA 3TPAA 4EQ9A 2QMWA 4KYEA 3OEKA 3B6QA 5H8HA 1B5JA 1FQAA 3TELA 3KG2A 2NWJA 2PVUA 4U1ZA 3W9WA 5I56A 4QSDA 1M5BA 2UVGA 1MY3A 3O29A 3IAZA 2RC9A 4ELPA 4I1DA 3CVGA 4HCYA 3GZGA 1P1QA 4Q5TA 4NF6B 3FD3A 1HSLA 1BIYA 3BFTA 3MZ9A 1EU8A 1B5HA 2XXVA 2I3WA 2Q2CA 2XD3A 3ONMA 4U22A 5BWJA 2XHDA 3S4UA 1B0LA 1B40A 1LFIA 3O66A 3QK6A 4F3PA 2UXAA 2XXRA 3FVKA 1JQFA 1Y4CA 4OXVA 3TUSA 3H3GA 5DVJA 4KPTA 3K1PA 2HAUA 1DMBA 1USYE 3IB0A 4RK9A 5H8HB 3C35A 4LATA 4FATA 1YAEA 1YCJA 4GIZA 5I59A 1IXCA 2HFBA 3H03A 1Y3NA 5I56B 1H45A 2DP8A 3FATA 4AB5A 1XT8A 1RYXA 2YJPA 3RN8A 2F78A 3MPKA 5J1DA 5FTHA 5CMKA 3O6GA 5H8FA 4F2OA 3IO4A 1FCKA 5CMBA 3VVDA 4R74A 4FE8A 1B3GA 2XX8A 4R2BA 4WXJA 3VXCA 1L5TA 2ZYMA 2GHBA 4QFPA 1B7ZA 1FTLA 1URGA 2X7QA 4ZZEA 5BUUA 3KFMA 3FUZA 1FQCA 3UGWA 3B6WA 3U92A 3RLFE 3C33A 3K6UA 2IA4A 1FW0A 3E3KA 4H65A 2UYFA 3V89B 2RC7A 3H6UA 1MQGA 5F1QA 1N04A 2DS9A 3PMWA 1XOCA 4I62A 1FTJA 3IOWA 3RT6B 5H8NA 1Z7NE 2G29A 4ONYA 4F1UA 1BLFA 4F3BA 2VP1A 3HO7A 3MVYA 2D3IA 4FIMA 1I6AA 4GWOA 3FZVA 4YB7A 4YZZA 3KN3A 2F7BA 1SQYA 4ZEIA 1B51A 4KR5A 2HZKA 5I2NA 1TWYA 1IZ1A 4BDRA 2QMXA 2I4BA 4OESA 2OJTA 2ONKE 4G2ZA 4Z7EA 3MVZA 3OD7A 2I0CA 1T0KA 4GXAA 3RUMA 2W7YA 1FQEA 3SESA 3OENA 3I5OA 3O2AA 1SI1A 4IO7A 2UVHA 3PGFA 3DELB 2PMSA 2I4CA 3VV5A 3N26A 3KN7A 3K1MA 3CR9A 3CSGA 3FV1A 1TFAA 5H8NB 3V8XB 4F2QA 4QFNA 5L9MA 2F7AA 2PT1A 4JWXA 2M8CA 5ISUA 2I49A 4KYSA 4X48A 1MQJA 3KEIA 1POTA 2Z23A 3MC2A 4MFIA 1AOVA 3C31A 3S9LC 1NL5A 1MY0A 2DVCA 1PBPA 1PB7A 2ZYNA 3QAXA 4MH5A 5I2NB 1ANFA 3T9HB 2D21A 3Q27A 3OO7A 2OWTA 4POXA 3E13X 3RTWB 1S50A 4ELOA 1EZOA 5FTIA 3PV0E 2I6EA 1R6ZA 3HV1A 3I6VA 4LVQA 2QPQA 3ZS6A 3ILTB 3P7IA 3MPLA 5FHNA 1DTZA 1I69A 1MY4A 1B3HA 1PC3A 4KYDA 4JSOA 2H25A 4DCYA 5HM4B 4G4PA 1DTGA 4NF5B 1P1OA 2DSFA 4XIGQ 2HAVA 1OIBA 1OQGA 3T96B 3L6GA 5AA3A 2DWHA 2F35A 1PBQA 3N6TA 4MBPA 5I57B 1B7HA 4RXLA 1A54A 1LSTA 3TTRA 2ONRA 4BLAA 4ZEFA 4ZEKA 1Z7ME 4U1OA 1N3WA 3USDA 4PETA 3SEXA 3FASA 5CRYA 2A5SA 4THIA 3DM0A 3UK4A 1JETA 2H99A 2HEUA 3MZBA 1N0TA 1A99A 3KOSA 1JW5A 1LCTA 4KI0E 4Z0IA 3FV2A 1JW4A 5TPAA 1WODA 3TYHA 5DVFA 5EHMA 2R9JA 1LAFE 5L8DA 2NVUB 1FTKA 1A8EA 2Y7KA 1FQFA 4JB7A 1MXWA 4ESWA 4M1VA 3VVEA 4BDLA 3MBPA 3VLUA 1A7LA 3TKDA 1Y4TA 1URDA 2B3BA 4PFUA 5EYFA 4O3CA 1LCFA 1B05A 3OSQA 2X7PA 3HN0A 3IJOB 2XXWA 1WVJA 1YTVA 4ELRA 3A3CA 2UYEA 4Q8RA 2QJEA 3VVFA 1QW0A 3CFLA 3M8UA 1N76A 2XXIA 4EQBA 1SBPA 4QFOA 3Q25A 4ZE9A 1ELJA 1MH3A 4EF1A 1PEBA 1B1XA 3IL1B 4POWA 1B5IA 4DDDA 5ELVA 1SD3A 4UA8A 3EN3A 5B70A 3H6WA 1OLCA 3PUWE 3PPPA 2RCAA 3EHUA 1SW2A 3JZJA 4G77A 1ZIUA 2XXHA 1F9BA 4FAJA 4YKIA 1QKBA 3O6HA 2H4IA 2F8DA 3FVGA 1QUJA 4F31B 1SYIA 3TZAA 4NE4A 2ALUA 3OOAA 1EZPA 2GHAA 1FQDA 2V3TA 3QYTA 5IAIA 1MXUA 4QHQA 4YMBA 1Q1KA 5ICQA 3FJ7A 1FTOA 4LQ2A 3RY3A 2UVJA 4GL8A 4JSDA 2QS4A 3MJNA 1LBBA 3G3JA 2DWIA 4GD5A 3CFXA 3G3GA 5I2KA 3H6VA 1B0HA 2R6GE 2CZLA 3ILUB 1Y20A 4FEDA 3U1OA 1XHYA 1JEVA 1OMPA 3BFUA 3GXAA 4TLLB 3K1NA 1NNPA 2YLNA 5KDTA 4U23A 3CFZA 4H5FA 1GVCA 2F6GA 3O97A 3JYRA 1B1HA 4DIGA 3KGCA 2DYXA 1LAXA 5EHSA 5KZTA 5TP9A 3LSFB 3MP6A 4PFTA 4RNSA 1A40A 2OBGA 1ZKBA 4OMBA 4X1DA 3U8QA 2HCAA 1CE2A 1IQ7A 3VFJA 4QSEA 3FVNA 4IGTA 4F29A 3GLBA 3G3FA 4Q0CA 1SYHA 3K4UA 5HPQA 3TFLA 5I84A 1POY1 3IB2A 2FNCA 4IGRA 3FJMA 4KHZE 5I2KB 1XS5A 2YPNA 3AXFA 5CMCA 2RF1A 3CG3A 1N84A 4DE8A 2Y7IA 1J1NA 3MWBA 1S9TA 4ESXA 4ZECA 3PD8A 5FHMA 1D9YA 5KDTB 4R6HA 5L9SA 2NXOA 4N07A 1P1NA 1UQWA 3VE1B 2XXXA 3IORA 5TP9B 3G3IA 1IUDA 4OERA 2F7CA 1AMFA 1MXYA 4LP2B 3TCGA 4R2FA 4P0IA 3OO6A 4PQJA 5KCJA 1NNFA 2DOJA 2GH9A 2F34A 3KN8A 4ZE8A 2DE4A 3GBBA 1GGGA 1SW5A 1D3KA 3S9EA 4NF4B 1VFEA 4GLIA 3V5AA 3Q28A 4KFQA 3N5LA 1MXVA 4GXSB 3SDFA 1JW1A 4FEBA 1MDQA 1B46A 4YAHX 4EDPA 3U93A 4ZDMA 3OELA 3TQLA 4F1VA 3C32A 1MS7A 4RYAA 2E1SA 3IK6B 3PU5A 3PUZE 2GFEA 3PMXA 1MY1A 4OEUA 5ITPA 1LAHE 5M2VA 4JXIA 5I58A 3O9PA 3TAJA 1MPCA 3UA8A 1MDP1 3VLVA 3K02A 3LUYA 1P1UA 1TT1A 1SVXB 2O68A 1Y1MA 1MPBA 4G68B 3TTNA 4R73A 4NF5A 5KCJB 4G8HA 3BBRA 2XX9A 4KQPA 2BJJX 1MG1A 3T66A 3FXUA 1TFDA 4LZ7A 2IEEA 1VE4A 5I57A 2P0SA 2PT2A 2Y7WA 3T93B 1I6BA 3IR1A 3MVXA 2AIXA 1QVSA 4ZZAA 2O7IA 1P99A 3K01A 4OVJA 2F5XA 2OK2A 5H8QB 5ITOA 4QFKA 3KZGA 2VD3A 1VR5A 3E4RA 3BKIB 1EH3A 4RY1A 5CBSA 2ESNA 4H5GA 3KSJA 5I58B 3CG1A 2O69A 3UORA 3RT8A 4ZEDA 4N13A 2NOOA 2Q8JA 4H0WA 3IOTA 4IB2A 1LAGE 1UTHB 2AL4A 1TXFA 1LB9A 3JV9A 4F3GA 1M5EA 4LZ8A 1R9QA 2OCUA 4C1UA 2AYSA 5JTYB 1LLSA 2VHAA 4EXLA 4MLQA 4IY6A 1QUIA 3FVOA 3TTKA 4TQUQ 3H7MA 3ODBA 4OZ9A 3DP4A 3SEUA 3LC8A 1LFHA 4L17A 3TMGA 4EUOA 1MM6A 4KCCA 2THIA 4P11A 1H44A 1USYH 5A5XB 3MP8A 4MF3A 1II5A 3OO9A 4DXUA 4R6KA 3IO6A 2X26A 4KD5A 4R9GA 4GF8A 3O6IA 4IO5A 3DP8A 3K6XA 3M3FA 3G7WA 1IXHA 1MQHA 4RK2A 3TEPA 3M3LA 1OVTA 4OENA 1A55A 4QFLA 4OTEA 5AA4A 2Q9TA 1BKAA 3MAMA 2DE3A 2V3UA 4FJPA 2V84A 1B6HA 4G8MA 1HSJA 2Z8EA 3SERA 2B65A 3KJTA 4NWCA 3VLWA 3G3HA 1SW4A 1UIVA 4BDMA 1UIUA 4FORA 5CC2A 1VFDA 4R72A 4AB6A 3H06B 3A09A 3QUJA 1ZJLA 3LSXA 4LQ5A 4BDOA 3T22A 2V3QA 3PPQA 4F19A 1O64A 3H4ZA 1D9VA 5DEXA 3D4CA 3SETA 3W15C 2QL3A 2D5WA 3B6TA 1O63A 4U2RA 4F22A 1B4HA 3K6WA 2DVZA 3TQWA 4U4SA
chains in the Genus database with same CATH superfamily
4HW8A 4RPOA 4R9FA 4NF8B 1FTMA 3T1BA 2F36A 2F3BA 4C0RA 4XXUA 2OLBA 2I48A 3FXBA 5AA4B 1A8FA 1M5DA 4OFOA 4NMYA 4BDNA 4R6YA 4M4GA 4N6PA 3SEYA 1ZU0A 2OZZA 5K2XA 1Y9UA 3Q29A 2RCBA 2WBBA 4XKNA 2QRYA 2A5TB 2XWIA 3E79A 3MQ9A 1NMUA 4QSCA 1YYZA 2FIXA 4WEPA 3VDFA 3FGSA 1P1WA 1JEUA 2ZMBA 1LEVA 1R1NA 4WKMA 3QUFA 5H8SA 4LONB 3Q26A 3VXBA 4DCXA 4PE3A 1MQDA 1NV6A 2RC8A 4OVRA 5AA2A 4PDHA 4OEVA 5A5LA 2ZNTA 4OETA 4DLDA 1NH7A 2O7UA 5DEXB 1URSA 4MAGA 3LR1A 3HHFA 1OVBA 1M5FA 4OYVA 3K2DA 5B7DA 3TCFA 1ZTYA 4AQ4A 3ECRA 1WDNA 2XXQA 1US5A 2Y5KA 1CB6A 5IZ3B 3IX1A 1B58A 3FXRA 2B4MA 5F7VA 1O7TA 4HS7A 5L9OA 2FHYA 1QJMA 4H1XA 2QSXA 4OWDA 1RDZA 3SEVA 4IO6A 2PBWA 3D4GA 3HPIA 4H8JA 3IFCA 2PFZA 4PFYA 1KZ8A 3KOTA 4BDQA 4XF5A 1DPEA 3I3VA 2ZYOA 4E0XA 1LBCA 1IMFA 2DWAA 3PUYE 4YKJA 2KQZA 3HSTA 4U4XA 3FXQA 3PPOA 1GR2A 2VOZA 4YU0A 4P0GA 3RNNA 1Q9DA 2VGQA 4UACA 1LB8A 1OQHA 4GRKA 5JEIA 5AA2B 4ZEBA 3EHTA 5DVIA 1IMCA 2Q2AA 1NFTA 2B3FA 1NI9A 2ZYKA 2DQVA 2H98A 1HSEA 2I0BA 1JVXA 4RJZA 2GRVA 4NF4A 4G61A 4H6DA 3S9MC 2F6PA 1JNFA 2O6AA 2PX1A 3C36A 3QXMA 2REJA 3F11A 2XWKA 3PMVA 2Z8FA 4NEDA 1FBHA 1N7XA 1MXXA 2HZLA 3GYYA 4MNCA 3EPEA 3PUXE 4F18A 3ZSFA 4O7MA 3CSBA 5ET6A 4LA9A 4IY5A 1NKXA 3DLNA 4EXKA 1Y3PA 3CRBA 4JBZA 4YKPA 1B7UA 4G8NA 3KSXA 5JK4A 4NX1A 2AL5A 3RQTA 3W9VA 2XXPA 2DXRA 4HE0A 1B3LA 3SEWA 3PUVE 2VPNA 1FPLA 4HTGA 4O3AA 5LTCA 2ABHA 1IMAA 4XTCQ 2ZZWA 4KCDA 3R6UA 4GWYA 1R9LA 2Y84A 1MQIA 1DSNA 4PGPA 3G3KA 4G68A 4DXBA 3FJGA 1B2HA 1ZMGA 2HQ0A 1XVXA 3C34A 4GWSA 4NQ8A 3UN6A 3R26A 1K9ZA 4MLVA 5LOMA 5FHOA 2O84X 3N94A 2ZNSA 3U94A 2VT5A 4GBVA 2NUVA 2Y7RA 3IB1A 4GX3A 5I59B 4GFRA 1DOTA 2REGA 5DW8A 1I6QA 4PAKA 4LZ5A 4PFIA 5DTBA 4RPNA 2XXUA 1Y1ZA 3C4MA 3DP6A 3TCHA 4QXDA 5H8QA 2H9BA 1IXIA 1B3EA 2L5VA 4I3YA 4P8BA 4X8RA 2E0SA 2QS2A 2ZXTA 3GBAA 3ZKKA 2ZZXA 4I9DA 5H8FB 2RKMA 4OA4A 3B7DA 4H8IA 1LBZA 3S9NC 3C9HA 4OVPA 4XKPA 3S2VA 4JWOA 1UTHA 3FIRA 1NV4A 3BIHA 4X1BA 5DYHA 4H67A 1H3DA 4JDFA 3H6TA 3E78A 1JVYA 2F97A 4PC9A 1PB8A 2Q8MA 3T9VA 1M5CA 4N91A 4I40A 3PPRA 1EYIA 1N3XA 5JTYA 1FPBA 4GQOA 3TODA 2Q89A 1QKAA 4ISUA 1EZ9A 1MXZA 4IO3A 1NNTA 3E9XA 2RINA 5I7IA 3OMBA 4MCOA 4YB6A 1IEJA 1H43A 3WAEA 3K00A 1FBPA 1MPDA 1G0HA 1ATGA 1AIVA 2DXYA 1FPDA 4ZS9A 4OHNA 4MNPA 5A5XA 1FQBA 4N8YA 4C1TA 1SDXA 2HXWA 4DXCA 4Q30B 3KBRA 4OVTA 3MZ1A 5T3JA 4FECA 3MUQA 1IIWA 3LSLA 1QULA 3PD9A 2DDKA 3OEMA 4RA1A 3OO8A 4QF9A 3R7XA 4GL0A 4YB5A 4X9TA 3MP1A 2DE2A 4U21A 3CIJA 4WEDA 2LAOA 3M3KA 1UTBA 5ICTA 3ZKLA 4DZ1A 3HHGA 2FA7A 2R71A 4GOTA 5IGAA 5AA2D 2P2AA 2CMOA 4PCDA 3KJ7A 3EHSA 2ZNUA 2Z8DA 3SKPA 2OWZA 2XXYA 2BJIA 3LV0A 4KXPA 1FBDA 2QS3A 2DWJA 1MY2A 5CBRA 3RTFB 1IXGA 2G93A 3MSTA 2QVRA 3UIFA 2PYYA 3EF7A 2XWVA 5HBCA 3TTMA 4XKQA 4NGUA 1RKMA 3IOUA 2QS1A 1SI0A 3IJXB 1LFGA 4O3BA 4TLMB 1N7WA 1ZBMA 2V25A 3LSWA 2PFYA 3T0JA 3HFUA 2Q88A 2H5YA 1BP5A 1S7YA 1NNKA 3N6UA 1ZLQA 2ONSA 3HCQA 1VSOA 4NF8A 1GTKA 1GV8A 4TOZA 4ELQA 1H76A 1K9YA 3MVWA 1Q35A 3QSLA 1UTBB 4PF6A 2XD2A 4OFLA 3K6VA 5CM6A 5IKBA 1SW1A 1BTJA 4QRZA 2UVIA 1MH4A 2FYIA 3CI8A 3TDJA 4GWUA 4N81A 4ND9A 4JWYA 1FPEA 3MYUA 4YMAA 4IO4A 2A5TA 2I3VA 1FPFA 1G0IA 3THIA 4F39A 1Y3QA 2KLFA 2ANJA 5CI5A 4HE2A 5LDZA 2I58A 3O28A 5AE4A 1AH5A 4HCWA 2R8TA 1LGBC 1XC1A 4NWDA 4EF2A 4N4UA 1IITA 1MRPA 3D1RA 4K3FA 1DPPA 5K2YA 3T9XB 3WAFA 3IOVA 1PB9A 4PE5B 4OFJA 3MW0A 2O1MA 1RYOA 1FPKA 4IO2A 1B52A 1B4ZA 1PDAA 4PFWA 4O8MA 1DCUA 5IM2A 2FBPA 2WKYA 5TU0A 3EQ1A 1XVYA 3LBSA 4OQOA 1JP4A 5AA1A 4YICA 3UP9A 4G68C 3K0VA 2XX7A 1B9JA 4O94A 3TTLA 3OXNA 2WBDA 2V93A 1YPNA 1NH8A 1KWHA 4PP0A 2O1LA 5TPAB 1MM7A 4F3SA 4EQ7A 2Z22A 5EQ7A 4F1YA 3RPWA 4NF6A 1D4NA 3V83A 3A3UA 3U72A 1US4A 4E0WA 4LUBA 2FIEA 2XXTA 3QIMA 4NTLA 4R75A 2VD2A 5CMMA 3NOHA 3PPNA 4GVOA 2P1SA 4XKRA 4YKKA 3L6HA 4ECFA 1B3FA 2O51A 1B32A 2OWSA 1LBXA 3RGYA 1KA1A 1AL3A 2Y7PA 5DT6A 3T9UA 1IMBA 2P3VA 1OLAA 3OSRA 1QUKA 4I8CA 3TPAA 1KA0A 2QFLA 4EQ9A 2QMWA 4KYEA 3OEKA 3RPLA 3B6QA 5H8HA 1B5JA 1FQAA 3TELA 3KG2A 2NWJA 2PVUA 4U1ZA 3W9WA 5I56A 4QSDA 1M5BA 2UVGA 1MY3A 3O29A 3IAZA 5EQ8A 2QVUA 2RC9A 4ELPA 4I1DA 3CVGA 4HCYA 3GZGA 1P1QA 4Q5TA 1NUYA 4NF6B 3FD3A 1HSLA 1BIYA 3BFTA 2XWOA 3MZ9A 1EU8A 3A29A 1B5HA 2XXVA 2I3WA 2Q2CA 2XD3A 3ONMA 4MMPA 4U22A 5BWJA 2XHDA 3S4UA 1B0LA 1B40A 1LFIA 3O66A 3QK6A 4F3PA 2UXAA 2XXRA 3FVKA 1JQFA 1Y4CA 4OXVA 3TUSA 3H3GA 5DVJA 4KPTA 3K1PA 2HAUA 1DMBA 1USYE 3IB0A 3QMFA 4RK9A 2CEYA 3RPLB 5H8HB 3C35A 4LATA 4FATA 1YAEA 1YCJA 4GIZA 5I59A 1IXCA 2HFBA 3H03A 1Y3NA 4HXVA 5I56B 1H45A 2DP8A 3FATA 4AB5A 1XT8A 1RYXA 2YJPA 3RN8A 4DI3D 4NN3A 2F78A 5FBPA 4AS5A 3MPKA 5J1DA 5FTHA 5CMKA 3O6GA 5H8FA 4F2OA 3IO4A 1FCKA 5CMBA 3VVDA 4R74A 4FE8A 4P3LA 1B3GA 2XX8A 4R2BA 1NV7A 4WXJA 2XXKA 3VXCA 1L5TA 2ZYMA 2GHBA 4QFPA 1B7ZA 1FJ9A 1FTLA 1URGA 2X7QA 4ZZEA 5BUUA 3KFMA 3FUZA 1D9QA 1FQCA 3UGWA 3B6WA 3U92A 3RLFE 2CZHA 3C33A 3K6UA 2IA4A 1FPGA 1FW0A 2VPOA 3E3KA 3KBZA 4H65A 2UYFA 4P1EA 3V89B 2OX3A 2RC7A 3H6UA 1MQGA 5F1QA 1DBZA 1N04A 2DS9A 3PMWA 4GWXA 1XOCA 4I62A 1FTJA 3IOWA 3RT6B 5H8NA 1Z7NE 2G29A 2QVVA 4ONYA 1BK4A 4MJOA 4F1UA 1BLFA 4F3BA 2VP1A 3HO7A 3MVYA 2D3IA 2CEXA 4FIMA 1I6AA 4GWOA 3FZVA 4YB7A 4YZZA 3KN3A 2F7BA 4X04A 1SQYA 1NUWA 4ZEIA 1B51A 4KR5A 2HZKA 5I2NA 1TWYA 1IZ1A 4BDRA 2QMXA 2I4BA 4OESA 4PGNA 2OJTA 4NG7A 5ET8A 2ONKE 4G2ZA 1NUZA 4Z7EA 3U65A 2Y5LA 3MVZA 3OD7A 2I0CA 1T0KA 4GXAA 3RUMA 2W7YA 1FQEA 3SESA 3OENA 3I5OA 3O2AA 1SI1A 4PFRA 4IO7A 2UVHA 3PGFA 3DELB 2PMSA 2I4CA 3VV5A 3N26A 3KN7A 3K1MA 3CR9A 3CSGA 3FV1A 1TFAA 5H8NB 1FBCA 3V8XB 4F2QA 4QFNA 4H45A 5L9MA 2F7AA 3B50A 2PT1A 4JWXA 1CNQA 2M8CA 5ISUA 2I49A 1INPA 4KYSA 4X48A 1MQJA 2GQ1A 3KEIA 1POTA 2Z23A 3MC2A 4MFIA 5F24A 1AOVA 3C31A 3S9LC 1NL5A 4PBQA 1MY0A 2DVCA 1PBPA 1PB7A 2ZYNA 3QAXA 4MH5A 5I2NB 1ANFA 3T9HB 2D21A 4P47A 3Q27A 3OO7A 2OWTA 1QGXA 4POXA 3E13X 3RTWB 1S50A 4PF8A 4ELOA 1EZOA 5FTIA 3PV0E 2I6EA 1R6ZA 3HV1A 3I6VA 4LVQA 2QPQA 5I3SA 3ZS6A 3ILTB 3P7IA 3MPLA 5FHNA 1DTZA 1I69A 1MY4A 1B3HA 1PC3A 4KYDA 4JSOA 2B4LA 2H25A 4DCYA 2WEFA 5HM4B 4G4PA 1DTGA 4NF5B 1P1OA 2DSFA 4XIGQ 2HAVA 1OIBA 4NF0A 1OQGA 3T96B 3L6GA 5AA3A 2DWHA 2F35A 1PBQA 4JVDA 3N6TA 4MBPA 5I57B 1VDWA 1B7HA 4RXLA 1A54A 1LSTA 3TTRA 2XA5A 4DI4B 2ONRA 4BLAA 4ZEFA 4ZEKA 1YXIA 1Z7ME 4U1OA 5J16A 1N3WA 4IR8A 3USDA 4PETA 3SEXA 3FASA 5CRYA 2A5SA 4THIA 3DM0A 3UK4A 1JETA 2H99A 2HEUA 3MZBA 1N0TA 1A99A 3KOSA 1JW5A 1LCTA 4KI0E 4Z0IA 3FV2A 1JW4A 5TPAA 1WODA 3TYHA 1FPJA 5DVFA 5EHMA 3IFAA 2R9JA 1LAFE 5L8DA 2NVUB 1FTKA 1A8EA 2Y7KA 1FQFA 1FSAA 4JB7A 1MXWA 4ESWA 4M1VA 3VVEA 4BDLA 3MBPA 4NHBA 3VLUA 4N15A 1A7LA 3TKDA 4MX6A 1Y4TA 1URDA 2B3BA 4PFUA 5EYFA 4O3CA 1LCFA 4GWWA 1B05A 3OSQA 2X7PA 3HN0A 3IJOB 1NV5A 2XXWA 1WVJA 1YTVA 4ELRA 3A3CA 2UYEA 4Q8RA 2QJEA 3VVFA 1QW0A 3CFLA 3M8UA 1N76A 2XXIA 4EQBA 1SBPA 3LUZA 3SZPA 4H46A 4QFOA 4PFBA 3Q25A 4ZE9A 1ELJA 1MH3A 4EF1A 1PEBA 1B1XA 4MEVA 3IL1B 4POWA 1B5IA 4DDDA 5ELVA 1SD3A 4UA8A 3EN3A 5I5PA 5B70A 3H6WA 1OLCA 3PUWE 3PPPA 2RCAA 3EHUA 1SW2A 3JZJA 4G77A 1ZIUA 2XXHA 1F9BA 1RDYA 4FAJA 4YKIA 1QKBA 3O6HA 3BIGA 2H4IA 2F8DA 3FVGA 1SPIA 1QUJA 4F31B 1SYIA 3TZAA 4NE4A 4I3EA 2ALUA 3OOAA 1EZPA 1RDXA 2GHAA 1FQDA 2V3TA 3QYTA 3ISPA 5IAIA 1MXUA 4QHQA 4YMBA 1Q1KA 5ICQA 3FJ7A 1FTOA 4LQ2A 3RY3A 2UVJA 4GL8A 4JSDA 2QS4A 3MJNA 1LBBA 3G3JA 2DWIA 4GD5A 3CFXA 3G3GA 5I2KA 3H6VA 1B0HA 3ROJA 2HPGA 5ET5A 2R6GE 5EYGA 2CZLA 2FVZA 3ILUB 1Y20A 4FEDA 3U1OA 2JJKA 1XHYA 4PBHA 1JEVA 4GBWA 1OMPA 2HHMA 3BFUA 3GXAA 4TLLB 1XI6A 3K1NA 1NNPA 2YLNA 5KDTA 4U23A 3CFZA 4H5FA 1FTAA 1GVCA 2F6GA 3O97A 3JYRA 1B1HA 4DIGA 3KGCA 2DYXA 1LAXA 5EHSA 5KZTA 5TP9A 3LSFB 4GX4A 3MP6A 4PFTA 4RNSA 1A40A 1LBWA 2OBGA 1ZKBA 4OMBA 4X1DA 3U8QA 2HCAA 1CE2A 1IQ7A 3VFJA 4QSEA 3FVNA 4IGTA 4F29A 4N6DA 3GLBA 2CZIA 3G3FA 5IZZA 2MKZA 4Q0CA 1SYHA 3KC0A 4OVSA 3K4UA 5HPQA 3TFLA 5I84A 1POY1 1FRPA 3IB2A 2FNCA 4IGRA 3FJMA 4KHZE 5I2KB 1XS5A 2YPNA 3AXFA 5CMCA 3KC1A 2RF1A 3CG3A 3FBPA 4OANA 1N84A 4DE8A 3RYDA 2Y7IA 1J1NA 3MWBA 1S9TA 1FPIA 4ESXA 4ZECA 2WX9A 3PD8A 5FHMA 1D9YA 2WYPA 3PTYA 5KDTB 4R6HA 5L9SA 2NXOA 4N07A 5ESYA 1P1NA 1UQWA 3VE1B 1DK4A 2XXXA 3IORA 5TP9B 4FBPA 3G3IA 1IUDA 4OERA 4P1LA 2F7CA 1AMFA 1MXYA 4LP2B 3TCGA 1FBEA 4R2FA 4P0IA 3OO6A 4N8GA 1NUXA 4PTKA 4PQJA 5KCJA 1NNFA 2DOJA 2GH9A 1YZ0A 4HE1A 2F34A 3KN8A 4PAFA 2DE4A 4ZE8A 3GBBA 1GGGA 1SW5A 5IZ1A 1D3KA 3B8BA 1FBFA 3S9EA 4NF4B 1FJ6A 1EYJA 2V4CA 1FBGA 4MIJA 1VFEA 4OVQA 4GLIA 3V5AA 3Q28A 4KFQA 3N5LA 1MXVA 4GXSB 3SDFA 1JW1A 4FEBA 1MDQA 1B46A 4YAHX 4EDPA 3U93A 4ZDMA 3OELA 3TQLA 4F1VA 3C32A 1MS7A 4RYAA 2E1SA 3IK6B 3PU5A 3PUZE 2GFEA 3PMXA 1MY1A 2KR0A 4OEUA 5ITPA 1LAHE 5M2VA 4JXIA 5I58A 4UABA 3O9PA 3TAJA 1MPCA 3UA8A 1MDP1 4N6KA 3VLVA 3K02A 3LUYA 1P1UA 1TT1A 1SVXB 2O68A 1Y1MA 1MPBA 4G68B 3TTNA 4R73A 4NF5A 5KCJB 4G8HA 4JVIA 4JVCA 2P3NA 3BBRA 2ZZVA 3CHGA 1NV0A 2XX9A 4KQPA 2BJJX 1MG1A 3T66A 4O7IA 1NV2A 3FXUA 1TFDA 4LZ7A 2IEEA 1LBVA 1VE4A 5EQ9A 5I57A 2P0SA 2PT2A 2Y7WA 3T93B 1I6BA 3IR1A 3MVXA 2AIXA 4PDDA 2PCRA 1IMDA 1QVSA 4ZZAA 2O7IA 1P99A 3K01A 4OVJA 2F5XA 2OK2A 1IMEA 5H8QB 5ITOA 4QFKA 3KZGA 1LBYA 2VD3A 1VR5A 3E4RA 3BKIB 1EH3A 4RY1A 5CBSA 2ESNA 4H5GA 3KSJA 5I58B 3CG1A 4MNIA 2O69A 3UORA 3RT8A 4ZEDA 4N13A 2NOOA 4NAPA 4LN5A 2Q8JA 1AWBA 4H0WA 3IOTA 4IB2A 1LAGE 1UTHB 4AS4A 2AL4A 1TXFA 2Q74A 1LB9A 3JV9A 4F3GA 1M5EA 4LZ8A 1R9QA 2OCUA 5EYHA 4C1UA 2AYSA 5JTYB 1LLSA 2VHAA 4EXLA 4MLQA 4IY6A 1QUIA 3FVOA 3TTKA 4TQUQ 3H7MA 3ODBA 2CZKA 4OZ9A 3DP4A 2F3DA 3SEUA 3LC8A 1LFHA 4L17A 3TMGA 4EUOA 1MM6A 4MHFA 4KCCA 2THIA 4P11A 1H44A 1USYH 5A5XB 4N17A 3EKIA 3MP8A 4MF3A 1II5A 3OO9A 4DXUA 4R6KA 3IO6A 4XEQA 5EQAA 2X26A 4KD5A 4R9GA 4PAIA 4GF8A 3O6IA 4IO5A 3DP8A 3K6XA 3M3FA 3G7WA 1IXHA 1MQHA 4RK2A 3TEPA 3M3LA 1OVTA 4OENA 4GWZA 5ET7A 1A55A 4QFLA 4OTEA 5AA4A 2Q9TA 1BKAA 4P56A 1NV3A 4QBAA 3MAMA 2DE3A 2V3UA 4FJPA 2V84A 1B6HA 4G8MA 1HSJA 2Z8EA 3SERA 2B65A 3KJTA 4GX6A 4NWCA 2HXRA 1NV1A 2WYKA 3VLWA 3G3HA 1SW4A 1UIVA 4BDMA 1UIUA 4FORA 5CC2A 1VFDA 4R72A 4AB6A 3H06B 3A09A 3QUJA 1ZJLA 3LSXA 4LQ5A 4XFEA 4BDOA 3T22A 2V3QA 3PPQA 4F19A 1O64A 3H4ZA 1EYKA 1D9VA 5DEXA 3D4CA 3SETA 3W15C 2QL3A 4P9KA 2D5WA 3B6TA 1O63A 4U2RA 4F22A 1B4HA 3K6WA 5IZ3A 2DVZA 3TQWA 4U4SA
chains in the Genus database with same CATH topology
4HW8A 4RPOA 4R9FA 4NF8B 1FTMA 2F36A 4C0RA 4XXUA 2OLBA 2I48A 5AA4B 1A8FA 1M5DA 4OFOA 4NMYA 4BDNA 4R6YA 4M4GA 4N6PA 3SEYA 1ZU0A 2OZZA 5K2XA 1Y9UA 3Q29A 2RCBA 4XKNA 2QRYA 2A5TB 3MQ9A 1NMUA 4QSCA 4WEPA 3VDFA 3FGSA 1P1WA 1JEUA 2ZMBA 1R1NA 4WKMA 3QUFA 5H8SA 4LONB 3Q26A 3VXBA 4DCXA 1MQDA 2RC8A 5AA2A 4OEVA 2ZNTA 4OETA 4DLDA 1NH7A 2O7UA 5DEXB 1URSA 3LR1A 3HHFA 1OVBA 1M5FA 4OYVA 3K2DA 5B7DA 3TCFA 1ZTYA 4AQ4A 3ECRA 1WDNA 2XXQA 1US5A 1CB6A 3IX1A 1B58A 3FXRA 5F7VA 1O7TA 4HS7A 5L9OA 1QJMA 4H1XA 2QSXA 4OWDA 3SEVA 4IO6A 2PBWA 3D4GA 3HPIA 4H8JA 4PFYA 3KOTA 4BDQA 1DPEA 3I3VA 2ZYOA 4E0XA 1LBCA 2DWAA 3PUYE 4YKJA 3HSTA 4U4XA 3FXQA 3PPOA 1GR2A 2VOZA 4YU0A 4P0GA 3RNNA 2VGQA 4UACA 1LB8A 1OQHA 4GRKA 5JEIA 5AA2B 4ZEBA 3EHTA 5DVIA 2Q2AA 1NFTA 2B3FA 2ZYKA 2DQVA 2H98A 1HSEA 2I0BA 1JVXA 4RJZA 2GRVA 4NF4A 4H6DA 3S9MC 2F6PA 1JNFA 2O6AA 2PX1A 3C36A 3QXMA 2REJA 3F11A 3PMVA 2Z8FA 4NEDA 1N7XA 1MXXA 2HZLA 3EPEA 3PUXE 4F18A 3ZSFA 3CSBA 4LA9A 4IY5A 1NKXA 3DLNA 4EXKA 1Y3PA 3CRBA 4JBZA 4YKPA 1B7UA 4G8NA 3KSXA 5JK4A 2AL5A 3RQTA 3W9VA 2XXPA 2DXRA 1B3LA 3SEWA 3PUVE 4HTGA 4O3AA 2ABHA 4XTCQ 4KCDA 3R6UA 1R9LA 2Y84A 1MQIA 1DSNA 3G3KA 4G68A 4DXBA 3FJGA 1B2HA 1ZMGA 2HQ0A 1XVXA 3C34A 3UN6A 3R26A 4MLVA 5LOMA 5FHOA 2O84X 3N94A 2ZNSA 3U94A 2NUVA 2Y7RA 3IB1A 5I59B 4GFRA 1DOTA 2REGA 1I6QA 4LZ5A 5DTBA 4RPNA 2XXUA 1Y1ZA 3C4MA 3DP6A 3TCHA 5H8QA 2H9BA 1IXIA 1B3EA 2E0SA 2QS2A 2ZXTA 3GBAA 3ZKKA 4I9DA 5H8FB 2RKMA 3B7DA 4H8IA 3S9NC 3C9HA 4XKPA 3S2VA 4JWOA 1UTHA 3FIRA 4X1BA 5DYHA 4H67A 1H3DA 4JDFA 3H6TA 1JVYA 2F97A 1PB8A 3T9VA 1M5CA 3PPRA 1N3XA 5JTYA 4GQOA 3TODA 2Q89A 1QKAA 4ISUA 1EZ9A 1MXZA 4IO3A 1NNTA 3E9XA 2RINA 3OMBA 4YB6A 1IEJA 1H43A 3WAEA 3K00A 1MPDA 1ATGA 1AIVA 2DXYA 4ZS9A 4OHNA 5A5XA 1FQBA 4C1TA 1SDXA 2HXWA 4DXCA 4Q30B 3KBRA 3MZ1A 4FECA 3MUQA 1IIWA 3LSLA 1QULA 3PD9A 3OEMA 4RA1A 3OO8A 4QF9A 3R7XA 4GL0A 4YB5A 4X9TA 3MP1A 2DE2A 4U21A 3CIJA 4WEDA 2LAOA 3M3KA 1UTBA 5ICTA 3ZKLA 4DZ1A 3HHGA 2FA7A 2R71A 4GOTA 5AA2D 2P2AA 2CMOA 3KJ7A 3EHSA 2ZNUA 2Z8DA 3SKPA 2XXYA 2QS3A 2DWJA 1MY2A 5CBRA 3RTFB 1IXGA 2G93A 3UIFA 2PYYA 3EF7A 5HBCA 3TTMA 4XKQA 1RKMA 3IOUA 2QS1A 1SI0A 3IJXB 1LFGA 4O3BA 4TLMB 1N7WA 1ZBMA 2V25A 3LSWA 2Q88A 2H5YA 1BP5A 1S7YA 1NNKA 3N6UA 1ZLQA 2ONSA 3HCQA 1VSOA 4NF8A 1GTKA 1GV8A 4TOZA 4ELQA 1H76A 3MVWA 1Q35A 3QSLA 1UTBB 2XD2A 4OFLA 3K6VA 5CM6A 5IKBA 1SW1A 1BTJA 4QRZA 2UVIA 1MH4A 2FYIA 3CI8A 3TDJA 4ND9A 4JWYA 4YMAA 4IO4A 2A5TA 2I3VA 3THIA 4F39A 1Y3QA 2KLFA 2ANJA 5CI5A 2I58A 3O28A 5AE4A 1AH5A 4HCWA 1LGBC 1XC1A 4NWDA 4EF2A 1IITA 1MRPA 4K3FA 1DPPA 5K2YA 3T9XB 3WAFA 3IOVA 1PB9A 4PE5B 4OFJA 3MW0A 2O1MA 1RYOA 4IO2A 1B52A 1B4ZA 1PDAA 4PFWA 5TU0A 2WKYA 3EQ1A 1XVYA 3LBSA 4OQOA 5AA1A 4YICA 3UP9A 4G68C 3K0VA 2XX7A 1B9JA 3TTLA 3OXNA 2V93A 1YPNA 1NH8A 1KWHA 4PP0A 2O1LA 5TPAB 1MM7A 4F3SA 4EQ7A 2Z22A 4F1YA 3RPWA 4NF6A 1D4NA 3V83A 3A3UA 3U72A 1US4A 4E0WA 4LUBA 2XXTA 3QIMA 4NTLA 4R75A 2VD2A 5CMMA 3PPNA 4GVOA 2P1SA 4XKRA 4YKKA 3L6HA 4ECFA 1B3FA 2O51A 1B32A 2OWSA 3RGYA 1AL3A 2Y7PA 5DT6A 3T9UA 1OLAA 3OSRA 1QUKA 4I8CA 3TPAA 4EQ9A 2QMWA 4KYEA 3OEKA 3B6QA 5H8HA 1B5JA 1FQAA 3TELA 3KG2A 2NWJA 2PVUA 4U1ZA 3W9WA 5I56A 4QSDA 1M5BA 2UVGA 1MY3A 3O29A 3IAZA 2RC9A 4ELPA 4I1DA 3CVGA 4HCYA 3GZGA 1P1QA 4Q5TA 4NF6B 3FD3A 1HSLA 1BIYA 3BFTA 3MZ9A 1EU8A 1B5HA 2XXVA 2I3WA 2Q2CA 2XD3A 3ONMA 4U22A 5BWJA 2XHDA 3S4UA 1B0LA 1B40A 1LFIA 3O66A 3QK6A 4F3PA 2UXAA 2XXRA 3FVKA 1JQFA 1Y4CA 4OXVA 3TUSA 3H3GA 5DVJA 4KPTA 3K1PA 2HAUA 1DMBA 1USYE 3IB0A 4RK9A 5H8HB 3C35A 4LATA 4FATA 1YAEA 1YCJA 4GIZA 5I59A 1IXCA 2HFBA 3H03A 1Y3NA 5I56B 1H45A 2DP8A 3FATA 4AB5A 1XT8A 1RYXA 2YJPA 3RN8A 2F78A 3MPKA 5J1DA 5FTHA 5CMKA 3O6GA 5H8FA 4F2OA 3IO4A 1FCKA 5CMBA 3VVDA 4R74A 4FE8A 1B3GA 2XX8A 4R2BA 4WXJA 3VXCA 1L5TA 2ZYMA 2GHBA 4QFPA 1B7ZA 1FTLA 1URGA 2X7QA 4ZZEA 5BUUA 3KFMA 3FUZA 1FQCA 3UGWA 3B6WA 3U92A 3RLFE 3C33A 3K6UA 2IA4A 1FW0A 3E3KA 4H65A 2UYFA 3V89B 2RC7A 3H6UA 1MQGA 5F1QA 1N04A 2DS9A 3PMWA 1XOCA 4I62A 1FTJA 3IOWA 3RT6B 5H8NA 1Z7NE 2G29A 4ONYA 4F1UA 1BLFA 4F3BA 2VP1A 3HO7A 3MVYA 2D3IA 4FIMA 1I6AA 4GWOA 3FZVA 4YB7A 4YZZA 3KN3A 2F7BA 1SQYA 4ZEIA 1B51A 4KR5A 2HZKA 5I2NA 1TWYA 1IZ1A 4BDRA 2QMXA 2I4BA 4OESA 2OJTA 2ONKE 4G2ZA 4Z7EA 3MVZA 3OD7A 2I0CA 1T0KA 4GXAA 3RUMA 2W7YA 1FQEA 3SESA 3OENA 3I5OA 3O2AA 1SI1A 4IO7A 2UVHA 3PGFA 3DELB 2PMSA 2I4CA 3VV5A 3N26A 3KN7A 3K1MA 3CR9A 3CSGA 3FV1A 1TFAA 5H8NB 3V8XB 4F2QA 4QFNA 5L9MA 2F7AA 2PT1A 4JWXA 2M8CA 5ISUA 2I49A 4KYSA 4X48A 1MQJA 3KEIA 1POTA 2Z23A 3MC2A 4MFIA 1AOVA 3C31A 3S9LC 1NL5A 1MY0A 2DVCA 1PBPA 1PB7A 2ZYNA 3QAXA 4MH5A 5I2NB 1ANFA 3T9HB 2D21A 3Q27A 3OO7A 2OWTA 4POXA 3E13X 3RTWB 1S50A 4ELOA 1EZOA 5FTIA 3PV0E 2I6EA 1R6ZA 3HV1A 3I6VA 4LVQA 2QPQA 3ZS6A 3ILTB 3P7IA 3MPLA 5FHNA 1DTZA 1I69A 1MY4A 1B3HA 1PC3A 4KYDA 4JSOA 2H25A 4DCYA 5HM4B 4G4PA 1DTGA 4NF5B 1P1OA 2DSFA 4XIGQ 2HAVA 1OIBA 1OQGA 3T96B 3L6GA 5AA3A 2DWHA 2F35A 1PBQA 3N6TA 4MBPA 5I57B 1B7HA 4RXLA 1A54A 1LSTA 3TTRA 2ONRA 4BLAA 4ZEFA 4ZEKA 1Z7ME 4U1OA 1N3WA 3USDA 4PETA 3SEXA 3FASA 5CRYA 2A5SA 4THIA 3DM0A 3UK4A 1JETA 2H99A 2HEUA 3MZBA 1N0TA 1A99A 3KOSA 1JW5A 1LCTA 4KI0E 4Z0IA 3FV2A 1JW4A 5TPAA 1WODA 3TYHA 5DVFA 5EHMA 2R9JA 1LAFE 5L8DA 2NVUB 1FTKA 1A8EA 2Y7KA 1FQFA 4JB7A 1MXWA 4ESWA 4M1VA 3VVEA 4BDLA 3MBPA 3VLUA 1A7LA 3TKDA 1Y4TA 1URDA 2B3BA 4PFUA 5EYFA 4O3CA 1LCFA 1B05A 3OSQA 2X7PA 3HN0A 3IJOB 2XXWA 1WVJA 1YTVA 4ELRA 3A3CA 2UYEA 4Q8RA 2QJEA 3VVFA 1QW0A 3CFLA 3M8UA 1N76A 2XXIA 4EQBA 1SBPA 4QFOA 3Q25A 4ZE9A 1ELJA 1MH3A 4EF1A 1PEBA 1B1XA 3IL1B 4POWA 1B5IA 4DDDA 5ELVA 1SD3A 4UA8A 3EN3A 5B70A 3H6WA 1OLCA 3PUWE 3PPPA 2RCAA 3EHUA 1SW2A 3JZJA 4G77A 1ZIUA 2XXHA 1F9BA 4FAJA 4YKIA 1QKBA 3O6HA 2H4IA 2F8DA 3FVGA 1QUJA 4F31B 1SYIA 3TZAA 4NE4A 2ALUA 3OOAA 1EZPA 2GHAA 1FQDA 2V3TA 3QYTA 5IAIA 1MXUA 4QHQA 4YMBA 1Q1KA 5ICQA 3FJ7A 1FTOA 4LQ2A 3RY3A 2UVJA 4GL8A 4JSDA 2QS4A 3MJNA 1LBBA 3G3JA 2DWIA 4GD5A 3CFXA 3G3GA 5I2KA 3H6VA 1B0HA 2R6GE 2CZLA 3ILUB 1Y20A 4FEDA 3U1OA 1XHYA 1JEVA 1OMPA 3BFUA 3GXAA 4TLLB 3K1NA 1NNPA 2YLNA 5KDTA 4U23A 3CFZA 4H5FA 1GVCA 2F6GA 3O97A 3JYRA 1B1HA 4DIGA 3KGCA 2DYXA 1LAXA 5EHSA 5KZTA 5TP9A 3LSFB 3MP6A 4PFTA 4RNSA 1A40A 2OBGA 1ZKBA 4OMBA 4X1DA 3U8QA 2HCAA 1CE2A 1IQ7A 3VFJA 4QSEA 3FVNA 4IGTA 4F29A 3GLBA 3G3FA 4Q0CA 1SYHA 3K4UA 5HPQA 3TFLA 5I84A 1POY1 3IB2A 2FNCA 4IGRA 3FJMA 4KHZE 5I2KB 1XS5A 2YPNA 3AXFA 5CMCA 2RF1A 3CG3A 1N84A 4DE8A 2Y7IA 1J1NA 3MWBA 1S9TA 4ESXA 4ZECA 3PD8A 5FHMA 1D9YA 5KDTB 4R6HA 5L9SA 2NXOA 4N07A 1P1NA 1UQWA 3VE1B 2XXXA 3IORA 5TP9B 3G3IA 1IUDA 4OERA 2F7CA 1AMFA 1MXYA 4LP2B 3TCGA 4R2FA 4P0IA 3OO6A 4PQJA 5KCJA 1NNFA 2DOJA 2GH9A 2F34A 3KN8A 4ZE8A 2DE4A 3GBBA 1GGGA 1SW5A 1D3KA 3S9EA 4NF4B 1VFEA 4GLIA 3V5AA 3Q28A 4KFQA 3N5LA 1MXVA 4GXSB 3SDFA 1JW1A 4FEBA 1MDQA 1B46A 4YAHX 4EDPA 3U93A 4ZDMA 3OELA 3TQLA 4F1VA 3C32A 1MS7A 4RYAA 2E1SA 3IK6B 3PU5A 3PUZE 2GFEA 3PMXA 1MY1A 4OEUA 5ITPA 1LAHE 5M2VA 4JXIA 5I58A 3O9PA 3TAJA 1MPCA 3UA8A 1MDP1 3VLVA 3K02A 3LUYA 1P1UA 1TT1A 1SVXB 2O68A 1Y1MA 1MPBA 4G68B 3TTNA 4R73A 4NF5A 5KCJB 4G8HA 3BBRA 2XX9A 4KQPA 2BJJX 1MG1A 3T66A 3FXUA 1TFDA 4LZ7A 2IEEA 1VE4A 5I57A 2P0SA 2PT2A 2Y7WA 3T93B 1I6BA 3IR1A 3MVXA 2AIXA 1QVSA 4ZZAA 2O7IA 1P99A 3K01A 4OVJA 2F5XA 2OK2A 5H8QB 5ITOA 4QFKA 3KZGA 2VD3A 1VR5A 3E4RA 3BKIB 1EH3A 4RY1A 5CBSA 2ESNA 4H5GA 3KSJA 5I58B 3CG1A 2O69A 3UORA 3RT8A 4ZEDA 4N13A 2NOOA 2Q8JA 4H0WA 3IOTA 4IB2A 1LAGE 1UTHB 2AL4A 1TXFA 1LB9A 3JV9A 4F3GA 1M5EA 4LZ8A 1R9QA 2OCUA 4C1UA 2AYSA 5JTYB 1LLSA 2VHAA 4EXLA 4MLQA 4IY6A 1QUIA 3FVOA 3TTKA 4TQUQ 3H7MA 3ODBA 4OZ9A 3DP4A 3SEUA 3LC8A 1LFHA 4L17A 3TMGA 4EUOA 1MM6A 4KCCA 2THIA 4P11A 1H44A 1USYH 5A5XB 3MP8A 4MF3A 1II5A 3OO9A 4DXUA 4R6KA 3IO6A 2X26A 4KD5A 4R9GA 4GF8A 3O6IA 4IO5A 3DP8A 3K6XA 3M3FA 3G7WA 1IXHA 1MQHA 4RK2A 3TEPA 3M3LA 1OVTA 4OENA 1A55A 4QFLA 4OTEA 5AA4A 2Q9TA 1BKAA 3MAMA 2DE3A 2V3UA 4FJPA 2V84A 1B6HA 4G8MA 1HSJA 2Z8EA 3SERA 2B65A 3KJTA 4NWCA 3VLWA 3G3HA 1SW4A 1UIVA 4BDMA 1UIUA 4FORA 5CC2A 1VFDA 4R72A 4AB6A 3H06B 3A09A 3QUJA 1ZJLA 3LSXA 4LQ5A 4BDOA 3T22A 2V3QA 3PPQA 4F19A 1O64A 3H4ZA 1D9VA 5DEXA 3D4CA 3SETA 3W15C 2QL3A 2D5WA 3B6TA 1O63A 4U2RA 4F22A 1B4HA 3K6WA 2DVZA 3TQWA 4U4SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HW8 A;  4RPO A;  4R9F A;  4NF8 B;  1FTM A;  2F36 A;  4C0R A;  4XXU A;  2OLB A;  2I48 A;  5AA4 B;  1A8F A;  1M5D A;  4OFO A;  4NMY A;  4BDN A;  4R6Y A;  4M4G A;  4N6P A;  3SEY A;  1ZU0 A;  2OZZ A;  5K2X A;  1Y9U A;  3Q29 A;  2RCB A;  4XKN A;  2QRY A;  2A5T B;  3MQ9 A;  1NMU A;  4QSC A;  4WEP A;  3VDF A;  3FGS A;  1P1W A;  1JEU A;  2ZMB A;  1R1N A;  4WKM A;  3QUF A;  5H8S A;  4LON B;  3Q26 A;  3VXB A;  4DCX A;  1MQD A;  2RC8 A;  5AA2 A;  4OEV A;  2ZNT A;  4OET A;  4DLD A;  1NH7 A;  2O7U A;  5DEX B;  1URS A;  3LR1 A;  3HHF A;  1OVB A;  1M5F A;  4OYV A;  3K2D A;  5B7D A;  3TCF A;  1ZTY A;  4AQ4 A;  3ECR A;  1WDN A;  2XXQ A;  1US5 A;  1CB6 A;  3IX1 A;  1B58 A;  3FXR A;  5F7V A;  1O7T A;  4HS7 A;  5L9O A;  1QJM A;  4H1X A;  2QSX A;  4OWD A;  3SEV A;  4IO6 A;  2PBW A;  3D4G A;  3HPI A;  4H8J A;  4PFY A;  3KOT A;  4BDQ A;  1DPE A;  3I3V A;  2ZYO A;  4E0X A;  1LBC A;  2DWA A;  3PUY E;  4YKJ A;  3HST A;  4U4X A;  3FXQ A;  3PPO A;  1GR2 A;  2VOZ A;  4YU0 A;  4P0G A;  3RNN A;  2VGQ A;  4UAC A;  1LB8 A;  1OQH A;  4GRK A;  5JEI A;  5AA2 B;  4ZEB A;  3EHT A;  5DVI A;  2Q2A A;  1NFT A;  2B3F A;  2ZYK A;  2DQV A;  2H98 A;  1HSE A;  2I0B A;  1JVX A;  4RJZ A;  2GRV A;  4NF4 A;  4H6D A;  3S9M C;  2F6P A;  1JNF A;  2O6A A;  2PX1 A;  3C36 A;  3QXM A;  2REJ A;  3F11 A;  3PMV A;  2Z8F A;  4NED A;  1N7X A;  1MXX A;  2HZL A;  3EPE A;  3PUX E;  4F18 A;  3ZSF A;  3CSB A;  4LA9 A;  4IY5 A;  1NKX A;  3DLN A;  4EXK A;  1Y3P A;  3CRB A;  4JBZ A;  4YKP A;  1B7U A;  4G8N A;  3KSX A;  5JK4 A;  2AL5 A;  3RQT A;  3W9V A;  2XXP A;  2DXR A;  1B3L A;  3SEW A;  3PUV E;  4HTG A;  4O3A A;  2ABH A;  4XTC Q;  4KCD A;  3R6U A;  1R9L A;  2Y84 A;  1MQI A;  1DSN A;  3G3K A;  4G68 A;  4DXB A;  3FJG A;  1B2H A;  1ZMG A;  2HQ0 A;  1XVX A;  3C34 A;  3UN6 A;  3R26 A;  4MLV A;  5LOM A;  5FHO A;  2O84 X;  3N94 A;  2ZNS A;  3U94 A;  2NUV A;  2Y7R A;  3IB1 A;  5I59 B;  4GFR A;  1DOT A;  2REG A;  1I6Q A;  4LZ5 A;  5DTB A;  4RPN A;  2XXU A;  1Y1Z A;  3C4M A;  3DP6 A;  3TCH A;  5H8Q A;  2H9B A;  1IXI A;  1B3E A;  2E0S A;  2QS2 A;  2ZXT A;  3GBA A;  3ZKK A;  4I9D A;  5H8F B;  2RKM A;  3B7D A;  4H8I A;  3S9N C;  3C9H A;  4XKP A;  3S2V A;  4JWO A;  1UTH A;  3FIR A;  4X1B A;  5DYH A;  4H67 A;  1H3D A;  4JDF A;  3H6T A;  1JVY A;  2F97 A;  1PB8 A;  3T9V A;  1M5C A;  3PPR A;  1N3X A;  5JTY A;  4GQO A;  3TOD A;  2Q89 A;  1QKA A;  4ISU A;  1EZ9 A;  1MXZ A;  4IO3 A;  1NNT A;  3E9X A;  2RIN A;  3OMB A;  4YB6 A;  1IEJ A;  1H43 A;  3WAE A;  3K00 A;  1MPD A;  1ATG A;  1AIV A;  2DXY A;  4ZS9 A;  4OHN A;  5A5X A;  1FQB A;  4C1T A;  1SDX A;  2HXW A;  4DXC A;  4Q30 B;  3KBR A;  3MZ1 A;  4FEC A;  3MUQ A;  1IIW A;  3LSL A;  1QUL A;  3PD9 A;  3OEM A;  4RA1 A;  3OO8 A;  4QF9 A;  3R7X A;  4GL0 A;  4YB5 A;  4X9T A;  3MP1 A;  2DE2 A;  4U21 A;  3CIJ A;  4WED A;  2LAO A;  3M3K A;  1UTB A;  5ICT A;  3ZKL A;  4DZ1 A;  3HHG A;  2FA7 A;  2R71 A;  4GOT A;  5AA2 D;  2P2A A;  2CMO A;  3KJ7 A;  3EHS A;  2ZNU A;  2Z8D A;  3SKP A;  2XXY A;  2QS3 A;  2DWJ A;  1MY2 A;  5CBR A;  3RTF B;  1IXG A;  2G93 A;  3UIF A;  2PYY A;  3EF7 A;  5HBC A;  3TTM A;  4XKQ A;  1RKM A;  3IOU A;  2QS1 A;  1SI0 A;  3IJX B;  1LFG A;  4O3B A;  4TLM B;  1N7W A;  1ZBM A;  2V25 A;  3LSW A;  2Q88 A;  2H5Y A;  1BP5 A;  1S7Y A;  1NNK A;  3N6U A;  1ZLQ A;  2ONS A;  3HCQ A;  1VSO A;  4NF8 A;  1GTK A;  1GV8 A;  4TOZ A;  4ELQ A;  1H76 A;  3MVW A;  1Q35 A;  3QSL A;  1UTB B;  2XD2 A;  4OFL A;  3K6V A;  5CM6 A;  5IKB A;  1SW1 A;  1BTJ A;  4QRZ A;  2UVI A;  1MH4 A;  2FYI A;  3CI8 A;  3TDJ A;  4ND9 A;  4JWY A;  4YMA A;  4IO4 A;  2A5T A;  2I3V A;  3THI A;  4F39 A;  1Y3Q A;  2KLF A;  2ANJ A;  5CI5 A;  2I58 A;  3O28 A;  5AE4 A;  1AH5 A;  4HCW A;  1LGB C;  1XC1 A;  4NWD A;  4EF2 A;  1IIT A;  1MRP A;  4K3F A;  1DPP A;  5K2Y A;  3T9X B;  3WAF A;  3IOV A;  1PB9 A;  4PE5 B;  4OFJ A;  3MW0 A;  2O1M A;  1RYO A;  4IO2 A;  1B52 A;  1B4Z A;  1PDA A;  4PFW A;  5TU0 A;  2WKY A;  3EQ1 A;  1XVY A;  3LBS A;  4OQO A;  5AA1 A;  4YIC A;  3UP9 A;  4G68 C;  3K0V A;  2XX7 A;  1B9J A;  3TTL A;  3OXN A;  2V93 A;  1YPN A;  1NH8 A;  1KWH A;  4PP0 A;  2O1L A;  5TPA B;  1MM7 A;  4F3S A;  4EQ7 A;  2Z22 A;  4F1Y A;  3RPW A;  4NF6 A;  1D4N A;  3V83 A;  3A3U A;  3U72 A;  1US4 A;  4E0W A;  4LUB A;  2XXT A;  3QIM A;  4NTL A;  4R75 A;  2VD2 A;  5CMM A;  3PPN A;  4GVO A;  2P1S A;  4XKR A;  4YKK A;  3L6H A;  4ECF A;  1B3F A;  2O51 A;  1B32 A;  2OWS A;  3RGY A;  1AL3 A;  2Y7P A;  5DT6 A;  3T9U A;  1OLA A;  3OSR A;  1QUK A;  4I8C A;  3TPA A;  4EQ9 A;  2QMW A;  4KYE A;  3OEK A;  3B6Q A;  5H8H A;  1B5J A;  1FQA A;  3TEL A;  3KG2 A;  2NWJ A;  2PVU A;  4U1Z A;  3W9W A;  5I56 A;  4QSD A;  1M5B A;  2UVG A;  1MY3 A;  3O29 A;  3IAZ A;  2RC9 A;  4ELP A;  4I1D A;  3CVG A;  4HCY A;  3GZG A;  1P1Q A;  4Q5T A;  4NF6 B;  3FD3 A;  1HSL A;  1BIY A;  3BFT A;  3MZ9 A;  1EU8 A;  1B5H A;  2XXV A;  2I3W A;  2Q2C A;  2XD3 A;  3ONM A;  4U22 A;  5BWJ A;  2XHD A;  3S4U A;  1B0L A;  1B40 A;  1LFI A;  3O66 A;  3QK6 A;  4F3P A;  2UXA A;  2XXR A;  3FVK A;  1JQF A;  1Y4C A;  4OXV A;  3TUS A;  3H3G A;  5DVJ A;  4KPT A;  3K1P A;  2HAU A;  1DMB A;  1USY E;  3IB0 A;  4RK9 A;  5H8H B;  3C35 A;  4LAT A;  4FAT A;  1YAE A;  1YCJ A;  4GIZ A;  5I59 A;  1IXC A;  2HFB A;  3H03 A;  1Y3N A;  5I56 B;  1H45 A;  2DP8 A;  3FAT A;  4AB5 A;  1XT8 A;  1RYX A;  2YJP A;  3RN8 A;  2F78 A;  3MPK A;  5J1D A;  5FTH A;  5CMK A;  3O6G A;  5H8F A;  4F2O A;  3IO4 A;  1FCK A;  5CMB A;  3VVD A;  4R74 A;  4FE8 A;  1B3G A;  2XX8 A;  4R2B A;  4WXJ A;  3VXC A;  1L5T A;  2ZYM A;  2GHB A;  4QFP A;  1B7Z A;  1FTL A;  1URG A;  2X7Q A;  4ZZE A;  5BUU A;  3KFM A;  3FUZ A;  1FQC A;  3UGW A;  3B6W A;  3U92 A;  3RLF E;  3C33 A;  3K6U A;  2IA4 A;  1FW0 A;  3E3K A;  4H65 A;  2UYF A;  3V89 B;  2RC7 A;  3H6U A;  1MQG A;  5F1Q A;  1N04 A;  2DS9 A;  3PMW A;  1XOC A;  4I62 A;  1FTJ A;  3IOW A;  3RT6 B;  5H8N A;  1Z7N E;  2G29 A;  4ONY A;  4F1U A;  1BLF A;  4F3B A;  2VP1 A;  3HO7 A;  3MVY A;  2D3I A;  4FIM A;  1I6A A;  4GWO A;  3FZV A;  4YB7 A;  4YZZ A;  3KN3 A;  2F7B A;  1SQY A;  4ZEI A;  1B51 A;  4KR5 A;  2HZK A;  5I2N A;  1TWY A;  1IZ1 A;  4BDR A;  2QMX A;  2I4B A;  4OES A;  2OJT A;  2ONK E;  4G2Z A;  4Z7E A;  3MVZ A;  3OD7 A;  2I0C A;  1T0K A;  4GXA A;  3RUM A;  2W7Y A;  1FQE A;  3SES A;  3OEN A;  3I5O A;  3O2A A;  1SI1 A;  4IO7 A;  2UVH A;  3PGF A;  3DEL B;  2PMS A;  2I4C A;  3VV5 A;  3N26 A;  3KN7 A;  3K1M A;  3CR9 A;  3CSG A;  3FV1 A;  1TFA A;  5H8N B;  3V8X B;  4F2Q A;  4QFN A;  5L9M A;  2F7A A;  2PT1 A;  4JWX A;  2M8C A;  5ISU A;  2I49 A;  4KYS A;  4X48 A;  1MQJ A;  3KEI A;  1POT A;  2Z23 A;  3MC2 A;  4MFI A;  1AOV A;  3C31 A;  3S9L C;  1NL5 A;  1MY0 A;  2DVC A;  1PBP A;  1PB7 A;  2ZYN A;  3QAX A;  4MH5 A;  5I2N B;  1ANF A;  3T9H B;  2D21 A;  3Q27 A;  3OO7 A;  2OWT A;  4POX A;  3E13 X;  3RTW B;  1S50 A;  4ELO A;  1EZO A;  5FTI A;  3PV0 E;  2I6E A;  1R6Z A;  3HV1 A;  3I6V A;  4LVQ A;  2QPQ A;  3ZS6 A;  3ILT B;  3P7I A;  3MPL A;  5FHN A;  1DTZ A;  1I69 A;  1MY4 A;  1B3H A;  1PC3 A;  4KYD A;  4JSO A;  2H25 A;  4DCY A;  5HM4 B;  4G4P A;  1DTG A;  4NF5 B;  1P1O A;  2DSF A;  4XIG Q;  2HAV A;  1OIB A;  1OQG A;  3T96 B;  3L6G A;  5AA3 A;  2DWH A;  2F35 A;  1PBQ A;  3N6T A;  4MBP A;  5I57 B;  1B7H A;  4RXL A;  1A54 A;  1LST A;  3TTR A;  2ONR A;  4BLA A;  4ZEF A;  4ZEK A;  1Z7M E;  4U1O A;  1N3W A;  3USD A;  4PET A;  3SEX A;  3FAS A;  5CRY A;  2A5S A;  4THI A;  3DM0 A;  3UK4 A;  1JET A;  2H99 A;  2HEU A;  3MZB A;  1N0T A;  1A99 A;  3KOS A;  1JW5 A;  1LCT A;  4KI0 E;  4Z0I A;  3FV2 A;  1JW4 A;  5TPA A;  1WOD A;  3TYH A;  5DVF A;  5EHM A;  2R9J A;  1LAF E;  5L8D A;  2NVU B;  1FTK A;  1A8E A;  2Y7K A;  1FQF A;  4JB7 A;  1MXW A;  4ESW A;  4M1V A;  3VVE A;  4BDL A;  3MBP A;  3VLU A;  1A7L A;  3TKD A;  1Y4T A;  1URD A;  2B3B A;  4PFU A;  5EYF A;  4O3C A;  1LCF A;  1B05 A;  3OSQ A;  2X7P A;  3HN0 A;  3IJO B;  2XXW A;  1WVJ A;  1YTV A;  4ELR A;  3A3C A;  2UYE A;  4Q8R A;  2QJE A;  3VVF A;  1QW0 A;  3CFL A;  3M8U A;  1N76 A;  2XXI A;  4EQB A;  1SBP A;  4QFO A;  3Q25 A;  4ZE9 A;  1ELJ A;  1MH3 A;  4EF1 A;  1PEB A;  1B1X A;  3IL1 B;  4POW A;  1B5I A;  4DDD A;  5ELV A;  1SD3 A;  4UA8 A;  3EN3 A;  5B70 A;  3H6W A;  1OLC A;  3PUW E;  3PPP A;  2RCA A;  3EHU A;  1SW2 A;  3JZJ A;  4G77 A;  1ZIU A;  2XXH A;  1F9B A;  4FAJ A;  4YKI A;  1QKB A;  3O6H A;  2H4I A;  2F8D A;  3FVG A;  1QUJ A;  4F31 B;  1SYI A;  3TZA A;  4NE4 A;  2ALU A;  3OOA A;  1EZP A;  2GHA A;  1FQD A;  2V3T A;  3QYT A;  5IAI A;  1MXU A;  4QHQ A;  4YMB A;  1Q1K A;  5ICQ A;  3FJ7 A;  1FTO A;  4LQ2 A;  3RY3 A;  2UVJ A;  4GL8 A;  4JSD A;  2QS4 A;  3MJN A;  1LBB A;  3G3J A;  2DWI A;  4GD5 A;  3CFX A;  3G3G A;  5I2K A;  3H6V A;  1B0H A;  2R6G E;  2CZL A;  3ILU B;  1Y20 A;  4FED A;  3U1O A;  1XHY A;  1JEV A;  1OMP A;  3BFU A;  3GXA A;  4TLL B;  3K1N A;  1NNP A;  2YLN A;  5KDT A;  4U23 A;  3CFZ A;  4H5F A;  1GVC A;  2F6G A;  3O97 A;  3JYR A;  1B1H A;  4DIG A;  3KGC A;  2DYX A;  1LAX A;  5EHS A;  5KZT A;  5TP9 A;  3LSF B;  3MP6 A;  4PFT A;  4RNS A;  1A40 A;  2OBG A;  1ZKB A;  4OMB A;  4X1D A;  3U8Q A;  2HCA A;  1CE2 A;  1IQ7 A;  3VFJ A;  4QSE A;  3FVN A;  4IGT A;  4F29 A;  3GLB A;  3G3F A;  4Q0C A;  1SYH A;  3K4U A;  5HPQ A;  3TFL A;  5I84 A;  1POY 1;  3IB2 A;  2FNC A;  4IGR A;  3FJM A;  4KHZ E;  5I2K B;  1XS5 A;  2YPN A;  3AXF A;  5CMC A;  2RF1 A;  3CG3 A;  1N84 A;  4DE8 A;  2Y7I A;  1J1N A;  3MWB A;  1S9T A;  4ESX A;  4ZEC A;  3PD8 A;  5FHM A;  1D9Y A;  5KDT B;  4R6H A;  5L9S A;  2NXO A;  4N07 A;  1P1N A;  1UQW A;  3VE1 B;  2XXX A;  3IOR A;  5TP9 B;  3G3I A;  1IUD A;  4OER A;  2F7C A;  1AMF A;  1MXY A;  4LP2 B;  3TCG A;  4R2F A;  4P0I A;  3OO6 A;  4PQJ A;  5KCJ A;  1NNF A;  2DOJ A;  2GH9 A;  2F34 A;  3KN8 A;  4ZE8 A;  2DE4 A;  3GBB A;  1GGG A;  1SW5 A;  1D3K A;  3S9E A;  4NF4 B;  1VFE A;  4GLI A;  3V5A A;  3Q28 A;  4KFQ A;  3N5L A;  1MXV A;  4GXS B;  3SDF A;  1JW1 A;  4FEB A;  1MDQ A;  1B46 A;  4YAH X;  4EDP A;  3U93 A;  4ZDM A;  3OEL A;  3TQL A;  4F1V A;  3C32 A;  1MS7 A;  4RYA A;  2E1S A;  3IK6 B;  3PU5 A;  3PUZ E;  2GFE A;  3PMX A;  1MY1 A;  4OEU A;  5ITP A;  1LAH E;  5M2V A;  4JXI A;  5I58 A;  3O9P A;  3TAJ A;  1MPC A;  3UA8 A;  1MDP 1;  3VLV A;  3K02 A;  3LUY A;  1P1U A;  1TT1 A;  1SVX B;  2O68 A;  1Y1M A;  1MPB A;  4G68 B;  3TTN A;  4R73 A;  4NF5 A;  5KCJ B;  4G8H A;  3BBR A;  2XX9 A;  4KQP A;  2BJJ X;  1MG1 A;  3T66 A;  3FXU A;  1TFD A;  4LZ7 A;  2IEE A;  1VE4 A;  5I57 A;  2P0S A;  2PT2 A;  2Y7W A;  3T93 B;  1I6B A;  3IR1 A;  3MVX A;  2AIX A;  1QVS A;  4ZZA A;  2O7I A;  1P99 A;  3K01 A;  4OVJ A;  2F5X A;  2OK2 A;  5H8Q B;  5ITO A;  4QFK A;  3KZG A;  2VD3 A;  1VR5 A;  3E4R A;  3BKI B;  1EH3 A;  4RY1 A;  5CBS A;  2ESN A;  4H5G A;  3KSJ A;  5I58 B;  3CG1 A;  2O69 A;  3UOR A;  3RT8 A;  4ZED A;  4N13 A;  2NOO A;  2Q8J A;  4H0W A;  3IOT A;  4IB2 A;  1LAG E;  1UTH B;  2AL4 A;  1TXF A;  1LB9 A;  3JV9 A;  4F3G A;  1M5E A;  4LZ8 A;  1R9Q A;  2OCU A;  4C1U A;  2AYS A;  5JTY B;  1LLS A;  2VHA A;  4EXL A;  4MLQ A;  4IY6 A;  1QUI A;  3FVO A;  3TTK A;  4TQU Q;  3H7M A;  3ODB A;  4OZ9 A;  3DP4 A;  3SEU A;  3LC8 A;  1LFH A;  4L17 A;  3TMG A;  4EUO A;  1MM6 A;  4KCC A;  2THI A;  4P11 A;  1H44 A;  1USY H;  5A5X B;  3MP8 A;  4MF3 A;  1II5 A;  3OO9 A;  4DXU A;  4R6K A;  3IO6 A;  2X26 A;  4KD5 A;  4R9G A;  4GF8 A;  3O6I A;  4IO5 A;  3DP8 A;  3K6X A;  3M3F A;  3G7W A;  1IXH A;  1MQH A;  4RK2 A;  3TEP A;  3M3L A;  1OVT A;  4OEN A;  1A55 A;  4QFL A;  4OTE A;  5AA4 A;  2Q9T A;  1BKA A;  3MAM A;  2DE3 A;  2V3U A;  4FJP A;  2V84 A;  1B6H A;  4G8M A;  1HSJ A;  2Z8E A;  3SER A;  2B65 A;  3KJT A;  4NWC A;  3VLW A;  3G3H A;  1SW4 A;  1UIV A;  4BDM A;  1UIU A;  4FOR A;  5CC2 A;  1VFD A;  4R72 A;  4AB6 A;  3H06 B;  3A09 A;  3QUJ A;  1ZJL A;  3LSX A;  4LQ5 A;  4BDO A;  3T22 A;  2V3Q A;  3PPQ A;  4F19 A;  1O64 A;  3H4Z A;  1D9V A;  5DEX A;  3D4C A;  3SET A;  3W15 C;  2QL3 A;  2D5W A;  3B6T A;  1O63 A;  4U2R A;  4F22 A;  1B4H A;  3K6W A;  2DVZ A;  3TQW A;  4U4S A; 
#chains in the Genus database with same CATH topology
 4HW8 A;  4RPO A;  4R9F A;  4NF8 B;  1FTM A;  3T1B A;  2F36 A;  2F3B A;  4C0R A;  4XXU A;  2OLB A;  2I48 A;  3FXB A;  5AA4 B;  1A8F A;  1M5D A;  4OFO A;  4NMY A;  4BDN A;  4R6Y A;  4M4G A;  4N6P A;  3SEY A;  1ZU0 A;  2OZZ A;  5K2X A;  1Y9U A;  3Q29 A;  2RCB A;  2WBB A;  4XKN A;  2QRY A;  2A5T B;  2XWI A;  3E79 A;  3MQ9 A;  1NMU A;  4QSC A;  1YYZ A;  2FIX A;  4WEP A;  3VDF A;  3FGS A;  1P1W A;  1JEU A;  2ZMB A;  1LEV A;  1R1N A;  4WKM A;  3QUF A;  5H8S A;  4LON B;  3Q26 A;  3VXB A;  4DCX A;  4PE3 A;  1MQD A;  1NV6 A;  2RC8 A;  4OVR A;  5AA2 A;  4PDH A;  4OEV A;  5A5L A;  2ZNT A;  4OET A;  4DLD A;  1NH7 A;  2O7U A;  5DEX B;  1URS A;  4MAG A;  3LR1 A;  3HHF A;  1OVB A;  1M5F A;  4OYV A;  3K2D A;  5B7D A;  3TCF A;  1ZTY A;  4AQ4 A;  3ECR A;  1WDN A;  2XXQ A;  1US5 A;  2Y5K A;  1CB6 A;  5IZ3 B;  3IX1 A;  1B58 A;  3FXR A;  2B4M A;  5F7V A;  1O7T A;  4HS7 A;  5L9O A;  2FHY A;  1QJM A;  4H1X A;  2QSX A;  4OWD A;  1RDZ A;  3SEV A;  4IO6 A;  2PBW A;  3D4G A;  3HPI A;  4H8J A;  3IFC A;  2PFZ A;  4PFY A;  1KZ8 A;  3KOT A;  4BDQ A;  4XF5 A;  1DPE A;  3I3V A;  2ZYO A;  4E0X A;  1LBC A;  1IMF A;  2DWA A;  3PUY E;  4YKJ A;  2KQZ A;  3HST A;  4U4X A;  3FXQ A;  3PPO A;  1GR2 A;  2VOZ A;  4YU0 A;  4P0G A;  3RNN A;  1Q9D A;  2VGQ A;  4UAC A;  1LB8 A;  1OQH A;  4GRK A;  5JEI A;  5AA2 B;  4ZEB A;  3EHT A;  5DVI A;  1IMC A;  2Q2A A;  1NFT A;  2B3F A;  1NI9 A;  2ZYK A;  2DQV A;  2H98 A;  1HSE A;  2I0B A;  1JVX A;  4RJZ A;  2GRV A;  4NF4 A;  4G61 A;  4H6D A;  3S9M C;  2F6P A;  1JNF A;  2O6A A;  2PX1 A;  3C36 A;  3QXM A;  2REJ A;  3F11 A;  2XWK A;  3PMV A;  2Z8F A;  4NED A;  1FBH A;  1N7X A;  1MXX A;  2HZL A;  3GYY A;  4MNC A;  3EPE A;  3PUX E;  4F18 A;  3ZSF A;  4O7M A;  3CSB A;  5ET6 A;  4LA9 A;  4IY5 A;  1NKX A;  3DLN A;  4EXK A;  1Y3P A;  3CRB A;  4JBZ A;  4YKP A;  1B7U A;  4G8N A;  3KSX A;  5JK4 A;  4NX1 A;  2AL5 A;  3RQT A;  3W9V A;  2XXP A;  2DXR A;  4HE0 A;  1B3L A;  3SEW A;  3PUV E;  2VPN A;  1FPL A;  4HTG A;  4O3A A;  5LTC A;  2ABH A;  1IMA A;  4XTC Q;  2ZZW A;  4KCD A;  3R6U A;  4GWY A;  1R9L A;  2Y84 A;  1MQI A;  1DSN A;  4PGP A;  3G3K A;  4G68 A;  4DXB A;  3FJG A;  1B2H A;  1ZMG A;  2HQ0 A;  1XVX A;  3C34 A;  4GWS A;  4NQ8 A;  3UN6 A;  3R26 A;  1K9Z A;  4MLV A;  5LOM A;  5FHO A;  2O84 X;  3N94 A;  2ZNS A;  3U94 A;  2VT5 A;  4GBV A;  2NUV A;  2Y7R A;  3IB1 A;  4GX3 A;  5I59 B;  4GFR A;  1DOT A;  2REG A;  5DW8 A;  1I6Q A;  4PAK A;  4LZ5 A;  4PFI A;  5DTB A;  4RPN A;  2XXU A;  1Y1Z A;  3C4M A;  3DP6 A;  3TCH A;  4QXD A;  5H8Q A;  2H9B A;  1IXI A;  1B3E A;  2L5V A;  4I3Y A;  4P8B A;  4X8R A;  2E0S A;  2QS2 A;  2ZXT A;  3GBA A;  3ZKK A;  2ZZX A;  4I9D A;  5H8F B;  2RKM A;  4OA4 A;  3B7D A;  4H8I A;  1LBZ A;  3S9N C;  3C9H A;  4OVP A;  4XKP A;  3S2V A;  4JWO A;  1UTH A;  3FIR A;  1NV4 A;  3BIH A;  4X1B A;  5DYH A;  4H67 A;  1H3D A;  4JDF A;  3H6T A;  3E78 A;  1JVY A;  2F97 A;  4PC9 A;  1PB8 A;  2Q8M A;  3T9V A;  1M5C A;  4N91 A;  4I40 A;  3PPR A;  1EYI A;  1N3X A;  5JTY A;  1FPB A;  4GQO A;  3TOD A;  2Q89 A;  1QKA A;  4ISU A;  1EZ9 A;  1MXZ A;  4IO3 A;  1NNT A;  3E9X A;  2RIN A;  5I7I A;  3OMB A;  4MCO A;  4YB6 A;  1IEJ A;  1H43 A;  3WAE A;  3K00 A;  1FBP A;  1MPD A;  1G0H A;  1ATG A;  1AIV A;  2DXY A;  1FPD A;  4ZS9 A;  4OHN A;  4MNP A;  5A5X A;  1FQB A;  4N8Y A;  4C1T A;  1SDX A;  2HXW A;  4DXC A;  4Q30 B;  3KBR A;  4OVT A;  3MZ1 A;  5T3J A;  4FEC A;  3MUQ A;  1IIW A;  3LSL A;  1QUL A;  3PD9 A;  2DDK A;  3OEM A;  4RA1 A;  3OO8 A;  4QF9 A;  3R7X A;  4GL0 A;  4YB5 A;  4X9T A;  3MP1 A;  2DE2 A;  4U21 A;  3CIJ A;  4WED A;  2LAO A;  3M3K A;  1UTB A;  5ICT A;  3ZKL A;  4DZ1 A;  3HHG A;  2FA7 A;  2R71 A;  4GOT A;  5IGA A;  5AA2 D;  2P2A A;  2CMO A;  4PCD A;  3KJ7 A;  3EHS A;  2ZNU A;  2Z8D A;  3SKP A;  2OWZ A;  2XXY A;  2BJI A;  3LV0 A;  4KXP A;  1FBD A;  2QS3 A;  2DWJ A;  1MY2 A;  5CBR A;  3RTF B;  1IXG A;  2G93 A;  3MST A;  2QVR A;  3UIF A;  2PYY A;  3EF7 A;  2XWV A;  5HBC A;  3TTM A;  4XKQ A;  4NGU A;  1RKM A;  3IOU A;  2QS1 A;  1SI0 A;  3IJX B;  1LFG A;  4O3B A;  4TLM B;  1N7W A;  1ZBM A;  2V25 A;  3LSW A;  2PFY A;  3T0J A;  3HFU A;  2Q88 A;  2H5Y A;  1BP5 A;  1S7Y A;  1NNK A;  3N6U A;  1ZLQ A;  2ONS A;  3HCQ A;  1VSO A;  4NF8 A;  1GTK A;  1GV8 A;  4TOZ A;  4ELQ A;  1H76 A;  1K9Y A;  3MVW A;  1Q35 A;  3QSL A;  1UTB B;  4PF6 A;  2XD2 A;  4OFL A;  3K6V A;  5CM6 A;  5IKB A;  1SW1 A;  1BTJ A;  4QRZ A;  2UVI A;  1MH4 A;  2FYI A;  3CI8 A;  3TDJ A;  4GWU A;  4N81 A;  4ND9 A;  4JWY A;  1FPE A;  3MYU A;  4YMA A;  4IO4 A;  2A5T A;  2I3V A;  1FPF A;  1G0I A;  3THI A;  4F39 A;  1Y3Q A;  2KLF A;  2ANJ A;  5CI5 A;  4HE2 A;  5LDZ A;  2I58 A;  3O28 A;  5AE4 A;  1AH5 A;  4HCW A;  2R8T A;  1LGB C;  1XC1 A;  4NWD A;  4EF2 A;  4N4U A;  1IIT A;  1MRP A;  3D1R A;  4K3F A;  1DPP A;  5K2Y A;  3T9X B;  3WAF A;  3IOV A;  1PB9 A;  4PE5 B;  4OFJ A;  3MW0 A;  2O1M A;  1RYO A;  1FPK A;  4IO2 A;  1B52 A;  1B4Z A;  1PDA A;  4PFW A;  4O8M A;  1DCU A;  5IM2 A;  2FBP A;  2WKY A;  5TU0 A;  3EQ1 A;  1XVY A;  3LBS A;  4OQO A;  1JP4 A;  5AA1 A;  4YIC A;  3UP9 A;  4G68 C;  3K0V A;  2XX7 A;  1B9J A;  4O94 A;  3TTL A;  3OXN A;  2WBD A;  2V93 A;  1YPN A;  1NH8 A;  1KWH A;  4PP0 A;  2O1L A;  5TPA B;  1MM7 A;  4F3S A;  4EQ7 A;  2Z22 A;  5EQ7 A;  4F1Y A;  3RPW A;  4NF6 A;  1D4N A;  3V83 A;  3A3U A;  3U72 A;  1US4 A;  4E0W A;  4LUB A;  2FIE A;  2XXT A;  3QIM A;  4NTL A;  4R75 A;  2VD2 A;  5CMM A;  3NOH A;  3PPN A;  4GVO A;  2P1S A;  4XKR A;  4YKK A;  3L6H A;  4ECF A;  1B3F A;  2O51 A;  1B32 A;  2OWS A;  1LBX A;  3RGY A;  1KA1 A;  1AL3 A;  2Y7P A;  5DT6 A;  3T9U A;  1IMB A;  2P3V A;  1OLA A;  3OSR A;  1QUK A;  4I8C A;  3TPA A;  1KA0 A;  2QFL A;  4EQ9 A;  2QMW A;  4KYE A;  3OEK A;  3RPL A;  3B6Q A;  5H8H A;  1B5J A;  1FQA A;  3TEL A;  3KG2 A;  2NWJ A;  2PVU A;  4U1Z A;  3W9W A;  5I56 A;  4QSD A;  1M5B A;  2UVG A;  1MY3 A;  3O29 A;  3IAZ A;  5EQ8 A;  2QVU A;  2RC9 A;  4ELP A;  4I1D A;  3CVG A;  4HCY A;  3GZG A;  1P1Q A;  4Q5T A;  1NUY A;  4NF6 B;  3FD3 A;  1HSL A;  1BIY A;  3BFT A;  2XWO A;  3MZ9 A;  1EU8 A;  3A29 A;  1B5H A;  2XXV A;  2I3W A;  2Q2C A;  2XD3 A;  3ONM A;  4MMP A;  4U22 A;  5BWJ A;  2XHD A;  3S4U A;  1B0L A;  1B40 A;  1LFI A;  3O66 A;  3QK6 A;  4F3P A;  2UXA A;  2XXR A;  3FVK A;  1JQF A;  1Y4C A;  4OXV A;  3TUS A;  3H3G A;  5DVJ A;  4KPT A;  3K1P A;  2HAU A;  1DMB A;  1USY E;  3IB0 A;  3QMF A;  4RK9 A;  2CEY A;  3RPL B;  5H8H B;  3C35 A;  4LAT A;  4FAT A;  1YAE A;  1YCJ A;  4GIZ A;  5I59 A;  1IXC A;  2HFB A;  3H03 A;  1Y3N A;  4HXV A;  5I56 B;  1H45 A;  2DP8 A;  3FAT A;  4AB5 A;  1XT8 A;  1RYX A;  2YJP A;  3RN8 A;  4DI3 D;  4NN3 A;  2F78 A;  5FBP A;  4AS5 A;  3MPK A;  5J1D A;  5FTH A;  5CMK A;  3O6G A;  5H8F A;  4F2O A;  3IO4 A;  1FCK A;  5CMB A;  3VVD A;  4R74 A;  4FE8 A;  4P3L A;  1B3G A;  2XX8 A;  4R2B A;  1NV7 A;  4WXJ A;  2XXK A;  3VXC A;  1L5T A;  2ZYM A;  2GHB A;  4QFP A;  1B7Z A;  1FJ9 A;  1FTL A;  1URG A;  2X7Q A;  4ZZE A;  5BUU A;  3KFM A;  3FUZ A;  1D9Q A;  1FQC A;  3UGW A;  3B6W A;  3U92 A;  3RLF E;  2CZH A;  3C33 A;  3K6U A;  2IA4 A;  1FPG A;  1FW0 A;  2VPO A;  3E3K A;  3KBZ A;  4H65 A;  2UYF A;  4P1E A;  3V89 B;  2OX3 A;  2RC7 A;  3H6U A;  1MQG A;  5F1Q A;  1DBZ A;  1N04 A;  2DS9 A;  3PMW A;  4GWX A;  1XOC A;  4I62 A;  1FTJ A;  3IOW A;  3RT6 B;  5H8N A;  1Z7N E;  2G29 A;  2QVV A;  4ONY A;  1BK4 A;  4MJO A;  4F1U A;  1BLF A;  4F3B A;  2VP1 A;  3HO7 A;  3MVY A;  2D3I A;  2CEX A;  4FIM A;  1I6A A;  4GWO A;  3FZV A;  4YB7 A;  4YZZ A;  3KN3 A;  2F7B A;  4X04 A;  1SQY A;  1NUW A;  4ZEI A;  1B51 A;  4KR5 A;  2HZK A;  5I2N A;  1TWY A;  1IZ1 A;  4BDR A;  2QMX A;  2I4B A;  4OES A;  4PGN A;  2OJT A;  4NG7 A;  5ET8 A;  2ONK E;  4G2Z A;  1NUZ A;  4Z7E A;  3U65 A;  2Y5L A;  3MVZ A;  3OD7 A;  2I0C A;  1T0K A;  4GXA A;  3RUM A;  2W7Y A;  1FQE A;  3SES A;  3OEN A;  3I5O A;  3O2A A;  1SI1 A;  4PFR A;  4IO7 A;  2UVH A;  3PGF A;  3DEL B;  2PMS A;  2I4C A;  3VV5 A;  3N26 A;  3KN7 A;  3K1M A;  3CR9 A;  3CSG A;  3FV1 A;  1TFA A;  5H8N B;  1FBC A;  3V8X B;  4F2Q A;  4QFN A;  4H45 A;  5L9M A;  2F7A A;  3B50 A;  2PT1 A;  4JWX A;  1CNQ A;  2M8C A;  5ISU A;  2I49 A;  1INP A;  4KYS A;  4X48 A;  1MQJ A;  2GQ1 A;  3KEI A;  1POT A;  2Z23 A;  3MC2 A;  4MFI A;  5F24 A;  1AOV A;  3C31 A;  3S9L C;  1NL5 A;  4PBQ A;  1MY0 A;  2DVC A;  1PBP A;  1PB7 A;  2ZYN A;  3QAX A;  4MH5 A;  5I2N B;  1ANF A;  3T9H B;  2D21 A;  4P47 A;  3Q27 A;  3OO7 A;  2OWT A;  1QGX A;  4POX A;  3E13 X;  3RTW B;  1S50 A;  4PF8 A;  4ELO A;  1EZO A;  5FTI A;  3PV0 E;  2I6E A;  1R6Z A;  3HV1 A;  3I6V A;  4LVQ A;  2QPQ A;  5I3S A;  3ZS6 A;  3ILT B;  3P7I A;  3MPL A;  5FHN A;  1DTZ A;  1I69 A;  1MY4 A;  1B3H A;  1PC3 A;  4KYD A;  4JSO A;  2B4L A;  2H25 A;  4DCY A;  2WEF A;  5HM4 B;  4G4P A;  1DTG A;  4NF5 B;  1P1O A;  2DSF A;  4XIG Q;  2HAV A;  1OIB A;  4NF0 A;  1OQG A;  3T96 B;  3L6G A;  5AA3 A;  2DWH A;  2F35 A;  1PBQ A;  4JVD A;  3N6T A;  4MBP A;  5I57 B;  1VDW A;  1B7H A;  4RXL A;  1A54 A;  1LST A;  3TTR A;  2XA5 A;  4DI4 B;  2ONR A;  4BLA A;  4ZEF A;  4ZEK A;  1YXI A;  1Z7M E;  4U1O A;  5J16 A;  1N3W A;  4IR8 A;  3USD A;  4PET A;  3SEX A;  3FAS A;  5CRY A;  2A5S A;  4THI A;  3DM0 A;  3UK4 A;  1JET A;  2H99 A;  2HEU A;  3MZB A;  1N0T A;  1A99 A;  3KOS A;  1JW5 A;  1LCT A;  4KI0 E;  4Z0I A;  3FV2 A;  1JW4 A;  5TPA A;  1WOD A;  3TYH A;  1FPJ A;  5DVF A;  5EHM A;  3IFA A;  2R9J A;  1LAF E;  5L8D A;  2NVU B;  1FTK A;  1A8E A;  2Y7K A;  1FQF A;  1FSA A;  4JB7 A;  1MXW A;  4ESW A;  4M1V A;  3VVE A;  4BDL A;  3MBP A;  4NHB A;  3VLU A;  4N15 A;  1A7L A;  3TKD A;  4MX6 A;  1Y4T A;  1URD A;  2B3B A;  4PFU A;  5EYF A;  4O3C A;  1LCF A;  4GWW A;  1B05 A;  3OSQ A;  2X7P A;  3HN0 A;  3IJO B;  1NV5 A;  2XXW A;  1WVJ A;  1YTV A;  4ELR A;  3A3C A;  2UYE A;  4Q8R A;  2QJE A;  3VVF A;  1QW0 A;  3CFL A;  3M8U A;  1N76 A;  2XXI A;  4EQB A;  1SBP A;  3LUZ A;  3SZP A;  4H46 A;  4QFO A;  4PFB A;  3Q25 A;  4ZE9 A;  1ELJ A;  1MH3 A;  4EF1 A;  1PEB A;  1B1X A;  4MEV A;  3IL1 B;  4POW A;  1B5I A;  4DDD A;  5ELV A;  1SD3 A;  4UA8 A;  3EN3 A;  5I5P A;  5B70 A;  3H6W A;  1OLC A;  3PUW E;  3PPP A;  2RCA A;  3EHU A;  1SW2 A;  3JZJ A;  4G77 A;  1ZIU A;  2XXH A;  1F9B A;  1RDY A;  4FAJ A;  4YKI A;  1QKB A;  3O6H A;  3BIG A;  2H4I A;  2F8D A;  3FVG A;  1SPI A;  1QUJ A;  4F31 B;  1SYI A;  3TZA A;  4NE4 A;  4I3E A;  2ALU A;  3OOA A;  1EZP A;  1RDX A;  2GHA A;  1FQD A;  2V3T A;  3QYT A;  3ISP A;  5IAI A;  1MXU A;  4QHQ A;  4YMB A;  1Q1K A;  5ICQ A;  3FJ7 A;  1FTO A;  4LQ2 A;  3RY3 A;  2UVJ A;  4GL8 A;  4JSD A;  2QS4 A;  3MJN A;  1LBB A;  3G3J A;  2DWI A;  4GD5 A;  3CFX A;  3G3G A;  5I2K A;  3H6V A;  1B0H A;  3ROJ A;  2HPG A;  5ET5 A;  2R6G E;  5EYG A;  2CZL A;  2FVZ A;  3ILU B;  1Y20 A;  4FED A;  3U1O A;  2JJK A;  1XHY A;  4PBH A;  1JEV A;  4GBW A;  1OMP A;  2HHM A;  3BFU A;  3GXA A;  4TLL B;  1XI6 A;  3K1N A;  1NNP A;  2YLN A;  5KDT A;  4U23 A;  3CFZ A;  4H5F A;  1FTA A;  1GVC A;  2F6G A;  3O97 A;  3JYR A;  1B1H A;  4DIG A;  3KGC A;  2DYX A;  1LAX A;  5EHS A;  5KZT A;  5TP9 A;  3LSF B;  4GX4 A;  3MP6 A;  4PFT A;  4RNS A;  1A40 A;  1LBW A;  2OBG A;  1ZKB A;  4OMB A;  4X1D A;  3U8Q A;  2HCA A;  1CE2 A;  1IQ7 A;  3VFJ A;  4QSE A;  3FVN A;  4IGT A;  4F29 A;  4N6D A;  3GLB A;  2CZI A;  3G3F A;  5IZZ A;  2MKZ A;  4Q0C A;  1SYH A;  3KC0 A;  4OVS A;  3K4U A;  5HPQ A;  3TFL A;  5I84 A;  1POY 1;  1FRP A;  3IB2 A;  2FNC A;  4IGR A;  3FJM A;  4KHZ E;  5I2K B;  1XS5 A;  2YPN A;  3AXF A;  5CMC A;  3KC1 A;  2RF1 A;  3CG3 A;  3FBP A;  4OAN A;  1N84 A;  4DE8 A;  3RYD A;  2Y7I A;  1J1N A;  3MWB A;  1S9T A;  1FPI A;  4ESX A;  4ZEC A;  2WX9 A;  3PD8 A;  5FHM A;  1D9Y A;  2WYP A;  3PTY A;  5KDT B;  4R6H A;  5L9S A;  2NXO A;  4N07 A;  5ESY A;  1P1N A;  1UQW A;  3VE1 B;  1DK4 A;  2XXX A;  3IOR A;  5TP9 B;  4FBP A;  3G3I A;  1IUD A;  4OER A;  4P1L A;  2F7C A;  1AMF A;  1MXY A;  4LP2 B;  3TCG A;  1FBE A;  4R2F A;  4P0I A;  3OO6 A;  4N8G A;  1NUX A;  4PTK A;  4PQJ A;  5KCJ A;  1NNF A;  2DOJ A;  2GH9 A;  1YZ0 A;  4HE1 A;  2F34 A;  3KN8 A;  4PAF A;  2DE4 A;  4ZE8 A;  3GBB A;  1GGG A;  1SW5 A;  5IZ1 A;  1D3K A;  3B8B A;  1FBF A;  3S9E A;  4NF4 B;  1FJ6 A;  1EYJ A;  2V4C A;  1FBG A;  4MIJ A;  1VFE A;  4OVQ A;  4GLI A;  3V5A A;  3Q28 A;  4KFQ A;  3N5L A;  1MXV A;  4GXS B;  3SDF A;  1JW1 A;  4FEB A;  1MDQ A;  1B46 A;  4YAH X;  4EDP A;  3U93 A;  4ZDM A;  3OEL A;  3TQL A;  4F1V A;  3C32 A;  1MS7 A;  4RYA A;  2E1S A;  3IK6 B;  3PU5 A;  3PUZ E;  2GFE A;  3PMX A;  1MY1 A;  2KR0 A;  4OEU A;  5ITP A;  1LAH E;  5M2V A;  4JXI A;  5I58 A;  4UAB A;  3O9P A;  3TAJ A;  1MPC A;  3UA8 A;  1MDP 1;  4N6K A;  3VLV A;  3K02 A;  3LUY A;  1P1U A;  1TT1 A;  1SVX B;  2O68 A;  1Y1M A;  1MPB A;  4G68 B;  3TTN A;  4R73 A;  4NF5 A;  5KCJ B;  4G8H A;  4JVI A;  4JVC A;  2P3N A;  3BBR A;  2ZZV A;  3CHG A;  1NV0 A;  2XX9 A;  4KQP A;  2BJJ X;  1MG1 A;  3T66 A;  4O7I A;  1NV2 A;  3FXU A;  1TFD A;  4LZ7 A;  2IEE A;  1LBV A;  1VE4 A;  5EQ9 A;  5I57 A;  2P0S A;  2PT2 A;  2Y7W A;  3T93 B;  1I6B A;  3IR1 A;  3MVX A;  2AIX A;  4PDD A;  2PCR A;  1IMD A;  1QVS A;  4ZZA A;  2O7I A;  1P99 A;  3K01 A;  4OVJ A;  2F5X A;  2OK2 A;  1IME A;  5H8Q B;  5ITO A;  4QFK A;  3KZG A;  1LBY A;  2VD3 A;  1VR5 A;  3E4R A;  3BKI B;  1EH3 A;  4RY1 A;  5CBS A;  2ESN A;  4H5G A;  3KSJ A;  5I58 B;  3CG1 A;  4MNI A;  2O69 A;  3UOR A;  3RT8 A;  4ZED A;  4N13 A;  2NOO A;  4NAP A;  4LN5 A;  2Q8J A;  1AWB A;  4H0W A;  3IOT A;  4IB2 A;  1LAG E;  1UTH B;  4AS4 A;  2AL4 A;  1TXF A;  2Q74 A;  1LB9 A;  3JV9 A;  4F3G A;  1M5E A;  4LZ8 A;  1R9Q A;  2OCU A;  5EYH A;  4C1U A;  2AYS A;  5JTY B;  1LLS A;  2VHA A;  4EXL A;  4MLQ A;  4IY6 A;  1QUI A;  3FVO A;  3TTK A;  4TQU Q;  3H7M A;  3ODB A;  2CZK A;  4OZ9 A;  3DP4 A;  2F3D A;  3SEU A;  3LC8 A;  1LFH A;  4L17 A;  3TMG A;  4EUO A;  1MM6 A;  4MHF A;  4KCC A;  2THI A;  4P11 A;  1H44 A;  1USY H;  5A5X B;  4N17 A;  3EKI A;  3MP8 A;  4MF3 A;  1II5 A;  3OO9 A;  4DXU A;  4R6K A;  3IO6 A;  4XEQ A;  5EQA A;  2X26 A;  4KD5 A;  4R9G A;  4PAI A;  4GF8 A;  3O6I A;  4IO5 A;  3DP8 A;  3K6X A;  3M3F A;  3G7W A;  1IXH A;  1MQH A;  4RK2 A;  3TEP A;  3M3L A;  1OVT A;  4OEN A;  4GWZ A;  5ET7 A;  1A55 A;  4QFL A;  4OTE A;  5AA4 A;  2Q9T A;  1BKA A;  4P56 A;  1NV3 A;  4QBA A;  3MAM A;  2DE3 A;  2V3U A;  4FJP A;  2V84 A;  1B6H A;  4G8M A;  1HSJ A;  2Z8E A;  3SER A;  2B65 A;  3KJT A;  4GX6 A;  4NWC A;  2HXR A;  1NV1 A;  2WYK A;  3VLW A;  3G3H A;  1SW4 A;  1UIV A;  4BDM A;  1UIU A;  4FOR A;  5CC2 A;  1VFD A;  4R72 A;  4AB6 A;  3H06 B;  3A09 A;  3QUJ A;  1ZJL A;  3LSX A;  4LQ5 A;  4XFE A;  4BDO A;  3T22 A;  2V3Q A;  3PPQ A;  4F19 A;  1O64 A;  3H4Z A;  1EYK A;  1D9V A;  5DEX A;  3D4C A;  3SET A;  3W15 C;  2QL3 A;  4P9K A;  2D5W A;  3B6T A;  1O63 A;  4U2R A;  4F22 A;  1B4H A;  3K6W A;  5IZ3 A;  2DVZ A;  3TQW A;  4U4S A; 
#chains in the Genus database with same CATH homology
 4HW8 A;  4RPO A;  4R9F A;  4NF8 B;  1FTM A;  2F36 A;  4C0R A;  4XXU A;  2OLB A;  2I48 A;  5AA4 B;  1A8F A;  1M5D A;  4OFO A;  4NMY A;  4BDN A;  4R6Y A;  4M4G A;  4N6P A;  3SEY A;  1ZU0 A;  2OZZ A;  5K2X A;  1Y9U A;  3Q29 A;  2RCB A;  4XKN A;  2QRY A;  2A5T B;  3MQ9 A;  1NMU A;  4QSC A;  4WEP A;  3VDF A;  3FGS A;  1P1W A;  1JEU A;  2ZMB A;  1R1N A;  4WKM A;  3QUF A;  5H8S A;  4LON B;  3Q26 A;  3VXB A;  4DCX A;  1MQD A;  2RC8 A;  5AA2 A;  4OEV A;  2ZNT A;  4OET A;  4DLD A;  1NH7 A;  2O7U A;  5DEX B;  1URS A;  3LR1 A;  3HHF A;  1OVB A;  1M5F A;  4OYV A;  3K2D A;  5B7D A;  3TCF A;  1ZTY A;  4AQ4 A;  3ECR A;  1WDN A;  2XXQ A;  1US5 A;  1CB6 A;  3IX1 A;  1B58 A;  3FXR A;  5F7V A;  1O7T A;  4HS7 A;  5L9O A;  1QJM A;  4H1X A;  2QSX A;  4OWD A;  3SEV A;  4IO6 A;  2PBW A;  3D4G A;  3HPI A;  4H8J A;  4PFY A;  3KOT A;  4BDQ A;  1DPE A;  3I3V A;  2ZYO A;  4E0X A;  1LBC A;  2DWA A;  3PUY E;  4YKJ A;  3HST A;  4U4X A;  3FXQ A;  3PPO A;  1GR2 A;  2VOZ A;  4YU0 A;  4P0G A;  3RNN A;  2VGQ A;  4UAC A;  1LB8 A;  1OQH A;  4GRK A;  5JEI A;  5AA2 B;  4ZEB A;  3EHT A;  5DVI A;  2Q2A A;  1NFT A;  2B3F A;  2ZYK A;  2DQV A;  2H98 A;  1HSE A;  2I0B A;  1JVX A;  4RJZ A;  2GRV A;  4NF4 A;  4H6D A;  3S9M C;  2F6P A;  1JNF A;  2O6A A;  2PX1 A;  3C36 A;  3QXM A;  2REJ A;  3F11 A;  3PMV A;  2Z8F A;  4NED A;  1N7X A;  1MXX A;  2HZL A;  3EPE A;  3PUX E;  4F18 A;  3ZSF A;  3CSB A;  4LA9 A;  4IY5 A;  1NKX A;  3DLN A;  4EXK A;  1Y3P A;  3CRB A;  4JBZ A;  4YKP A;  1B7U A;  4G8N A;  3KSX A;  5JK4 A;  2AL5 A;  3RQT A;  3W9V A;  2XXP A;  2DXR A;  1B3L A;  3SEW A;  3PUV E;  4HTG A;  4O3A A;  2ABH A;  4XTC Q;  4KCD A;  3R6U A;  1R9L A;  2Y84 A;  1MQI A;  1DSN A;  3G3K A;  4G68 A;  4DXB A;  3FJG A;  1B2H A;  1ZMG A;  2HQ0 A;  1XVX A;  3C34 A;  3UN6 A;  3R26 A;  4MLV A;  5LOM A;  5FHO A;  2O84 X;  3N94 A;  2ZNS A;  3U94 A;  2NUV A;  2Y7R A;  3IB1 A;  5I59 B;  4GFR A;  1DOT A;  2REG A;  1I6Q A;  4LZ5 A;  5DTB A;  4RPN A;  2XXU A;  1Y1Z A;  3C4M A;  3DP6 A;  3TCH A;  5H8Q A;  2H9B A;  1IXI A;  1B3E A;  2E0S A;  2QS2 A;  2ZXT A;  3GBA A;  3ZKK A;  4I9D A;  5H8F B;  2RKM A;  3B7D A;  4H8I A;  3S9N C;  3C9H A;  4XKP A;  3S2V A;  4JWO A;  1UTH A;  3FIR A;  4X1B A;  5DYH A;  4H67 A;  1H3D A;  4JDF A;  3H6T A;  1JVY A;  2F97 A;  1PB8 A;  3T9V A;  1M5C A;  3PPR A;  1N3X A;  5JTY A;  4GQO A;  3TOD A;  2Q89 A;  1QKA A;  4ISU A;  1EZ9 A;  1MXZ A;  4IO3 A;  1NNT A;  3E9X A;  2RIN A;  3OMB A;  4YB6 A;  1IEJ A;  1H43 A;  3WAE A;  3K00 A;  1MPD A;  1ATG A;  1AIV A;  2DXY A;  4ZS9 A;  4OHN A;  5A5X A;  1FQB A;  4C1T A;  1SDX A;  2HXW A;  4DXC A;  4Q30 B;  3KBR A;  3MZ1 A;  4FEC A;  3MUQ A;  1IIW A;  3LSL A;  1QUL A;  3PD9 A;  3OEM A;  4RA1 A;  3OO8 A;  4QF9 A;  3R7X A;  4GL0 A;  4YB5 A;  4X9T A;  3MP1 A;  2DE2 A;  4U21 A;  3CIJ A;  4WED A;  2LAO A;  3M3K A;  1UTB A;  5ICT A;  3ZKL A;  4DZ1 A;  3HHG A;  2FA7 A;  2R71 A;  4GOT A;  5AA2 D;  2P2A A;  2CMO A;  3KJ7 A;  3EHS A;  2ZNU A;  2Z8D A;  3SKP A;  2XXY A;  2QS3 A;  2DWJ A;  1MY2 A;  5CBR A;  3RTF B;  1IXG A;  2G93 A;  3UIF A;  2PYY A;  3EF7 A;  5HBC A;  3TTM A;  4XKQ A;  1RKM A;  3IOU A;  2QS1 A;  1SI0 A;  3IJX B;  1LFG A;  4O3B A;  4TLM B;  1N7W A;  1ZBM A;  2V25 A;  3LSW A;  2Q88 A;  2H5Y A;  1BP5 A;  1S7Y A;  1NNK A;  3N6U A;  1ZLQ A;  2ONS A;  3HCQ A;  1VSO A;  4NF8 A;  1GTK A;  1GV8 A;  4TOZ A;  4ELQ A;  1H76 A;  3MVW A;  1Q35 A;  3QSL A;  1UTB B;  2XD2 A;  4OFL A;  3K6V A;  5CM6 A;  5IKB A;  1SW1 A;  1BTJ A;  4QRZ A;  2UVI A;  1MH4 A;  2FYI A;  3CI8 A;  3TDJ A;  4ND9 A;  4JWY A;  4YMA A;  4IO4 A;  2A5T A;  2I3V A;  3THI A;  4F39 A;  1Y3Q A;  2KLF A;  2ANJ A;  5CI5 A;  2I58 A;  3O28 A;  5AE4 A;  1AH5 A;  4HCW A;  1LGB C;  1XC1 A;  4NWD A;  4EF2 A;  1IIT A;  1MRP A;  4K3F A;  1DPP A;  5K2Y A;  3T9X B;  3WAF A;  3IOV A;  1PB9 A;  4PE5 B;  4OFJ A;  3MW0 A;  2O1M A;  1RYO A;  4IO2 A;  1B52 A;  1B4Z A;  1PDA A;  4PFW A;  5TU0 A;  2WKY A;  3EQ1 A;  1XVY A;  3LBS A;  4OQO A;  5AA1 A;  4YIC A;  3UP9 A;  4G68 C;  3K0V A;  2XX7 A;  1B9J A;  3TTL A;  3OXN A;  2V93 A;  1YPN A;  1NH8 A;  1KWH A;  4PP0 A;  2O1L A;  5TPA B;  1MM7 A;  4F3S A;  4EQ7 A;  2Z22 A;  4F1Y A;  3RPW A;  4NF6 A;  1D4N A;  3V83 A;  3A3U A;  3U72 A;  1US4 A;  4E0W A;  4LUB A;  2XXT A;  3QIM A;  4NTL A;  4R75 A;  2VD2 A;  5CMM A;  3PPN A;  4GVO A;  2P1S A;  4XKR A;  4YKK A;  3L6H A;  4ECF A;  1B3F A;  2O51 A;  1B32 A;  2OWS A;  3RGY A;  1AL3 A;  2Y7P A;  5DT6 A;  3T9U A;  1OLA A;  3OSR A;  1QUK A;  4I8C A;  3TPA A;  4EQ9 A;  2QMW A;  4KYE A;  3OEK A;  3B6Q A;  5H8H A;  1B5J A;  1FQA A;  3TEL A;  3KG2 A;  2NWJ A;  2PVU A;  4U1Z A;  3W9W A;  5I56 A;  4QSD A;  1M5B A;  2UVG A;  1MY3 A;  3O29 A;  3IAZ A;  2RC9 A;  4ELP A;  4I1D A;  3CVG A;  4HCY A;  3GZG A;  1P1Q A;  4Q5T A;  4NF6 B;  3FD3 A;  1HSL A;  1BIY A;  3BFT A;  3MZ9 A;  1EU8 A;  1B5H A;  2XXV A;  2I3W A;  2Q2C A;  2XD3 A;  3ONM A;  4U22 A;  5BWJ A;  2XHD A;  3S4U A;  1B0L A;  1B40 A;  1LFI A;  3O66 A;  3QK6 A;  4F3P A;  2UXA A;  2XXR A;  3FVK A;  1JQF A;  1Y4C A;  4OXV A;  3TUS A;  3H3G A;  5DVJ A;  4KPT A;  3K1P A;  2HAU A;  1DMB A;  1USY E;  3IB0 A;  4RK9 A;  5H8H B;  3C35 A;  4LAT A;  4FAT A;  1YAE A;  1YCJ A;  4GIZ A;  5I59 A;  1IXC A;  2HFB A;  3H03 A;  1Y3N A;  5I56 B;  1H45 A;  2DP8 A;  3FAT A;  4AB5 A;  1XT8 A;  1RYX A;  2YJP A;  3RN8 A;  2F78 A;  3MPK A;  5J1D A;  5FTH A;  5CMK A;  3O6G A;  5H8F A;  4F2O A;  3IO4 A;  1FCK A;  5CMB A;  3VVD A;  4R74 A;  4FE8 A;  1B3G A;  2XX8 A;  4R2B A;  4WXJ A;  3VXC A;  1L5T A;  2ZYM A;  2GHB A;  4QFP A;  1B7Z A;  1FTL A;  1URG A;  2X7Q A;  4ZZE A;  5BUU A;  3KFM A;  3FUZ A;  1FQC A;  3UGW A;  3B6W A;  3U92 A;  3RLF E;  3C33 A;  3K6U A;  2IA4 A;  1FW0 A;  3E3K A;  4H65 A;  2UYF A;  3V89 B;  2RC7 A;  3H6U A;  1MQG A;  5F1Q A;  1N04 A;  2DS9 A;  3PMW A;  1XOC A;  4I62 A;  1FTJ A;  3IOW A;  3RT6 B;  5H8N A;  1Z7N E;  2G29 A;  4ONY A;  4F1U A;  1BLF A;  4F3B A;  2VP1 A;  3HO7 A;  3MVY A;  2D3I A;  4FIM A;  1I6A A;  4GWO A;  3FZV A;  4YB7 A;  4YZZ A;  3KN3 A;  2F7B A;  1SQY A;  4ZEI A;  1B51 A;  4KR5 A;  2HZK A;  5I2N A;  1TWY A;  1IZ1 A;  4BDR A;  2QMX A;  2I4B A;  4OES A;  2OJT A;  2ONK E;  4G2Z A;  4Z7E A;  3MVZ A;  3OD7 A;  2I0C A;  1T0K A;  4GXA A;  3RUM A;  2W7Y A;  1FQE A;  3SES A;  3OEN A;  3I5O A;  3O2A A;  1SI1 A;  4IO7 A;  2UVH A;  3PGF A;  3DEL B;  2PMS A;  2I4C A;  3VV5 A;  3N26 A;  3KN7 A;  3K1M A;  3CR9 A;  3CSG A;  3FV1 A;  1TFA A;  5H8N B;  3V8X B;  4F2Q A;  4QFN A;  5L9M A;  2F7A A;  2PT1 A;  4JWX A;  2M8C A;  5ISU A;  2I49 A;  4KYS A;  4X48 A;  1MQJ A;  3KEI A;  1POT A;  2Z23 A;  3MC2 A;  4MFI A;  1AOV A;  3C31 A;  3S9L C;  1NL5 A;  1MY0 A;  2DVC A;  1PBP A;  1PB7 A;  2ZYN A;  3QAX A;  4MH5 A;  5I2N B;  1ANF A;  3T9H B;  2D21 A;  3Q27 A;  3OO7 A;  2OWT A;  4POX A;  3E13 X;  3RTW B;  1S50 A;  4ELO A;  1EZO A;  5FTI A;  3PV0 E;  2I6E A;  1R6Z A;  3HV1 A;  3I6V A;  4LVQ A;  2QPQ A;  3ZS6 A;  3ILT B;  3P7I A;  3MPL A;  5FHN A;  1DTZ A;  1I69 A;  1MY4 A;  1B3H A;  1PC3 A;  4KYD A;  4JSO A;  2H25 A;  4DCY A;  5HM4 B;  4G4P A;  1DTG A;  4NF5 B;  1P1O A;  2DSF A;  4XIG Q;  2HAV A;  1OIB A;  1OQG A;  3T96 B;  3L6G A;  5AA3 A;  2DWH A;  2F35 A;  1PBQ A;  3N6T A;  4MBP A;  5I57 B;  1B7H A;  4RXL A;  1A54 A;  1LST A;  3TTR A;  2ONR A;  4BLA A;  4ZEF A;  4ZEK A;  1Z7M E;  4U1O A;  1N3W A;  3USD A;  4PET A;  3SEX A;  3FAS A;  5CRY A;  2A5S A;  4THI A;  3DM0 A;  3UK4 A;  1JET A;  2H99 A;  2HEU A;  3MZB A;  1N0T A;  1A99 A;  3KOS A;  1JW5 A;  1LCT A;  4KI0 E;  4Z0I A;  3FV2 A;  1JW4 A;  5TPA A;  1WOD A;  3TYH A;  5DVF A;  5EHM A;  2R9J A;  1LAF E;  5L8D A;  2NVU B;  1FTK A;  1A8E A;  2Y7K A;  1FQF A;  4JB7 A;  1MXW A;  4ESW A;  4M1V A;  3VVE A;  4BDL A;  3MBP A;  3VLU A;  1A7L A;  3TKD A;  1Y4T A;  1URD A;  2B3B A;  4PFU A;  5EYF A;  4O3C A;  1LCF A;  1B05 A;  3OSQ A;  2X7P A;  3HN0 A;  3IJO B;  2XXW A;  1WVJ A;  1YTV A;  4ELR A;  3A3C A;  2UYE A;  4Q8R A;  2QJE A;  3VVF A;  1QW0 A;  3CFL A;  3M8U A;  1N76 A;  2XXI A;  4EQB A;  1SBP A;  4QFO A;  3Q25 A;  4ZE9 A;  1ELJ A;  1MH3 A;  4EF1 A;  1PEB A;  1B1X A;  3IL1 B;  4POW A;  1B5I A;  4DDD A;  5ELV A;  1SD3 A;  4UA8 A;  3EN3 A;  5B70 A;  3H6W A;  1OLC A;  3PUW E;  3PPP A;  2RCA A;  3EHU A;  1SW2 A;  3JZJ A;  4G77 A;  1ZIU A;  2XXH A;  1F9B A;  4FAJ A;  4YKI A;  1QKB A;  3O6H A;  2H4I A;  2F8D A;  3FVG A;  1QUJ A;  4F31 B;  1SYI A;  3TZA A;  4NE4 A;  2ALU A;  3OOA A;  1EZP A;  2GHA A;  1FQD A;  2V3T A;  3QYT A;  5IAI A;  1MXU A;  4QHQ A;  4YMB A;  1Q1K A;  5ICQ A;  3FJ7 A;  1FTO A;  4LQ2 A;  3RY3 A;  2UVJ A;  4GL8 A;  4JSD A;  2QS4 A;  3MJN A;  1LBB A;  3G3J A;  2DWI A;  4GD5 A;  3CFX A;  3G3G A;  5I2K A;  3H6V A;  1B0H A;  2R6G E;  2CZL A;  3ILU B;  1Y20 A;  4FED A;  3U1O A;  1XHY A;  1JEV A;  1OMP A;  3BFU A;  3GXA A;  4TLL B;  3K1N A;  1NNP A;  2YLN A;  5KDT A;  4U23 A;  3CFZ A;  4H5F A;  1GVC A;  2F6G A;  3O97 A;  3JYR A;  1B1H A;  4DIG A;  3KGC A;  2DYX A;  1LAX A;  5EHS A;  5KZT A;  5TP9 A;  3LSF B;  3MP6 A;  4PFT A;  4RNS A;  1A40 A;  2OBG A;  1ZKB A;  4OMB A;  4X1D A;  3U8Q A;  2HCA A;  1CE2 A;  1IQ7 A;  3VFJ A;  4QSE A;  3FVN A;  4IGT A;  4F29 A;  3GLB A;  3G3F A;  4Q0C A;  1SYH A;  3K4U A;  5HPQ A;  3TFL A;  5I84 A;  1POY 1;  3IB2 A;  2FNC A;  4IGR A;  3FJM A;  4KHZ E;  5I2K B;  1XS5 A;  2YPN A;  3AXF A;  5CMC A;  2RF1 A;  3CG3 A;  1N84 A;  4DE8 A;  2Y7I A;  1J1N A;  3MWB A;  1S9T A;  4ESX A;  4ZEC A;  3PD8 A;  5FHM A;  1D9Y A;  5KDT B;  4R6H A;  5L9S A;  2NXO A;  4N07 A;  1P1N A;  1UQW A;  3VE1 B;  2XXX A;  3IOR A;  5TP9 B;  3G3I A;  1IUD A;  4OER A;  2F7C A;  1AMF A;  1MXY A;  4LP2 B;  3TCG A;  4R2F A;  4P0I A;  3OO6 A;  4PQJ A;  5KCJ A;  1NNF A;  2DOJ A;  2GH9 A;  2F34 A;  3KN8 A;  4ZE8 A;  2DE4 A;  3GBB A;  1GGG A;  1SW5 A;  1D3K A;  3S9E A;  4NF4 B;  1VFE A;  4GLI A;  3V5A A;  3Q28 A;  4KFQ A;  3N5L A;  1MXV A;  4GXS B;  3SDF A;  1JW1 A;  4FEB A;  1MDQ A;  1B46 A;  4YAH X;  4EDP A;  3U93 A;  4ZDM A;  3OEL A;  3TQL A;  4F1V A;  3C32 A;  1MS7 A;  4RYA A;  2E1S A;  3IK6 B;  3PU5 A;  3PUZ E;  2GFE A;  3PMX A;  1MY1 A;  4OEU A;  5ITP A;  1LAH E;  5M2V A;  4JXI A;  5I58 A;  3O9P A;  3TAJ A;  1MPC A;  3UA8 A;  1MDP 1;  3VLV A;  3K02 A;  3LUY A;  1P1U A;  1TT1 A;  1SVX B;  2O68 A;  1Y1M A;  1MPB A;  4G68 B;  3TTN A;  4R73 A;  4NF5 A;  5KCJ B;  4G8H A;  3BBR A;  2XX9 A;  4KQP A;  2BJJ X;  1MG1 A;  3T66 A;  3FXU A;  1TFD A;  4LZ7 A;  2IEE A;  1VE4 A;  5I57 A;  2P0S A;  2PT2 A;  2Y7W A;  3T93 B;  1I6B A;  3IR1 A;  3MVX A;  2AIX A;  1QVS A;  4ZZA A;  2O7I A;  1P99 A;  3K01 A;  4OVJ A;  2F5X A;  2OK2 A;  5H8Q B;  5ITO A;  4QFK A;  3KZG A;  2VD3 A;  1VR5 A;  3E4R A;  3BKI B;  1EH3 A;  4RY1 A;  5CBS A;  2ESN A;  4H5G A;  3KSJ A;  5I58 B;  3CG1 A;  2O69 A;  3UOR A;  3RT8 A;  4ZED A;  4N13 A;  2NOO A;  2Q8J A;  4H0W A;  3IOT A;  4IB2 A;  1LAG E;  1UTH B;  2AL4 A;  1TXF A;  1LB9 A;  3JV9 A;  4F3G A;  1M5E A;  4LZ8 A;  1R9Q A;  2OCU A;  4C1U A;  2AYS A;  5JTY B;  1LLS A;  2VHA A;  4EXL A;  4MLQ A;  4IY6 A;  1QUI A;  3FVO A;  3TTK A;  4TQU Q;  3H7M A;  3ODB A;  4OZ9 A;  3DP4 A;  3SEU A;  3LC8 A;  1LFH A;  4L17 A;  3TMG A;  4EUO A;  1MM6 A;  4KCC A;  2THI A;  4P11 A;  1H44 A;  1USY H;  5A5X B;  3MP8 A;  4MF3 A;  1II5 A;  3OO9 A;  4DXU A;  4R6K A;  3IO6 A;  2X26 A;  4KD5 A;  4R9G A;  4GF8 A;  3O6I A;  4IO5 A;  3DP8 A;  3K6X A;  3M3F A;  3G7W A;  1IXH A;  1MQH A;  4RK2 A;  3TEP A;  3M3L A;  1OVT A;  4OEN A;  1A55 A;  4QFL A;  4OTE A;  5AA4 A;  2Q9T A;  1BKA A;  3MAM A;  2DE3 A;  2V3U A;  4FJP A;  2V84 A;  1B6H A;  4G8M A;  1HSJ A;  2Z8E A;  3SER A;  2B65 A;  3KJT A;  4NWC A;  3VLW A;  3G3H A;  1SW4 A;  1UIV A;  4BDM A;  1UIU A;  4FOR A;  5CC2 A;  1VFD A;  4R72 A;  4AB6 A;  3H06 B;  3A09 A;  3QUJ A;  1ZJL A;  3LSX A;  4LQ5 A;  4BDO A;  3T22 A;  2V3Q A;  3PPQ A;  4F19 A;  1O64 A;  3H4Z A;  1D9V A;  5DEX A;  3D4C A;  3SET A;  3W15 C;  2QL3 A;  2D5W A;  3B6T A;  1O63 A;  4U2R A;  4F22 A;  1B4H A;  3K6W A;  2DVZ A;  3TQW A;  4U4S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...