4THIA

Thiaminase i from bacillus thiaminolyticus with covalently bound 4-amino-2,5-dimethylpyrimidine
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
362
structure length
362
Chain Sequence
ITLKVAIYPYVPDPARFQAAVLDQWQRQEPGVKLEFTDWDSYSADPPDDLDVFVLDSIFLSHFVDAGYLLPFGSQDIDQAEDVLPFALQGAKRNGEVYGLPQILCTNLLFYRKGDLKIGQVDNIYELYKKIGTSHSEQIPPPQNKGLLINMAGGTTKASMYLEALIDVTGQYTEYDLLPPLDPLNDKVIRGLRLLINMAGEKPSQYVPEDGDAYVRASWFAQGSGRAFIGYSESMMRMGDYAEQVRFKPISSSAGQDIPLFYSDVVSVNSKTAHPELAKKLANVMASADTVEQALRPQADGQYPQYLLPARHQVYEALMQDYPIYSELAQIVNKPSNRVFRLGPEVRTWLKDAKQVLPEALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (THIAMINASE I)
publication title Crystal structure of thiaminase-I from Bacillus thiaminolyticus at 2.0 A resolution.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transferase
total genus 115
structure length 362
sequence length 362
ec nomenclature ec 2.5.1.2: Thiamine pyridinylase.
pdb deposition date 1998-10-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4thiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4thiA02
4F3SA 1Y3PA 1MPDA 3TCGA 3Q28A 2NWJA 4PP0A 2ONSA 3VV5A 3EN3A 4R9GA 2H98A 3PV0E 4O3CA 3VE1B 5CRYA 3KGCA 1NFTA 2NVUB 2QRYA 3IOUA 1MDQA 3LSXA 2W7YA 1KWHA 3VVEA 5FHMA 4WKMA 1MPCA 5M2VA 5H8FA 4GLIA 1OQHA 2Z23A 1MQHA 3RN8A 4N07A 3P7IA 4DCXA 3K1MA 4I1DA 1A54A 3IORA 1MY0A 2UXAA 2P1SA 4XKNA 4GXSB 2DQVA 3FZVA 4OYVA 3C31A 2VP1A 3MUQA 4FE8A 4R73A 3CFZA 4LA9A 4O3AA 4Q8RA 1MRPA 1OLAA 1B1XA 4ZEDA 1CB6A 5KZTA 2XXVA 3PMVA 2GH9A 3FXQA 4P0IA 4Q0CA 1QKBA 1LBCA 4XIGQ 2XXPA 2VD2A 1B1HA 1B05A 4ELRA 4OTEA 1GR2A 2HAUA 4DE8A 1GTKA 1GV8A 3V83A 2O6AA 3LSWA 5DEXB 1YAEA 3KBRA 2HEUA 1SW2A 3DLNA 3HPIA 1EZPA 3PUVE 3TTLA 2BJJX 3S9EA 1IITA 3Q26A 3MQ9A 3O66A 3CFXA 3SERA 1UTHA 3UK4A 1B3GA 1JETA 3GLBA 2P2AA 1OIBA 2I3WA 1VE4A 1FQFA 4H0WA 1USYE 3HHGA 2XXYA 5DVFA 1P1NA 3CG3A 4JSOA 1IZ1A 4EXKA 1Y20A 4N6PA 4TQUQ 1LSTA 3K2DA 2PT2A 3EF7A 4GVOA 5L9MA 1B5HA 1QVSA 1ZMGA 3LSFB 2DWHA 2OWTA 1B4HA 3E9XA 3SKPA 3FUZA 4NF5A 2QMXA 4NF8B 2H9BA 4QFPA 4OETA 1XHYA 2NOOA 3U72A 3T66A 3V89B 5B7DA 3FJGA 4GWOA 3SDFA 3MBPA 2F7CA 4KFQA 5EYFA 4EUOA 3O2AA 1OVBA 1A55A 1D3KA 4DXBA 5JTYB 4YMBA 3RQTA 1POY1 5CMCA 3IB1A 4F19A 1ATGA 3IOWA 5I2NA 3S9MC 2FA7A 3TFLA 3TELA 4ZZEA 4OFLA 1EZOA 3C36A 1AL3A 3FV1A 3Q25A 5EHMA 4JDFA 3TAJA 3G3KA 4XXUA 1SD3A 3DM0A 4JWXA 1UTBA 1M5FA 4PFYA 4JXIA 2I3VA 1NH8A 1NNTA 2O7IA 1M5DA 3RLFE 4FATA 4AQ4A 4XKPA 1LAXA 3OO7A 1L5TA 4H1XA 1PB8A 1JEVA 2GRVA 3HV1A 5TP9B 2UVJA 3TUSA 1B52A 2A5TB 3H06B 3M3KA 3V8XB 3IB0A 1YCJA 3VLWA 2ZYNA 4YKIA 3V5AA 3IOVA 4U21A 5L8DA 3VFJA 1B32A 4QRZA 5I2KB 4QFNA 3I5OA 4C1TA 1P1QA 3MP1A 2DE4A 4THIA 2RCAA 1S9TA 2ABHA 3FIRA 5DTBA 4M1VA 3SESA 4M4GA 1F9BA 4MH5A 1II5A 3C35A 2G29A 4ZS9A 3OENA 1M5EA 2Q2AA 4RK2A 3B6QA 4KYDA 2AYSA 3A3CA 4ZDMA 3WAFA 4IO7A 5I56B 2GHBA 4MBPA 1NMUA 3K02A 3KN7A 3C34A 4EXLA 1QULA 1HSEA 4X9TA 2DS9A 3BFUA 5FTIA 1DTZA 2O69A 4EF1A 3PGFA 4F1VA 5FHOA 3A3UA 5F1QA 2F34A 3CIJA 4JSDA 3W9VA 4PFTA 1BLFA 1Y4TA 2FYIA 3SETA 3PUWE 1QUJA 4X1DA 4G68B 2Q9TA 4YU0A 3S9LC 3UIFA 2F5XA 5JK4A 1FQDA 1N3WA 4AB6A 2O84X 3H6VA 1WDNA 4ESWA 1TXFA 3N94A 5H8NA 1T0KA 1MY2A 4PFWA 2P0SA 2FNCA 2REGA 3S2VA 4QSDA 3TCFA 5DT6A 3E4RA 5CI5A 3MW0A 2PYYA 3H6TA 2XX8A 3K6VA 4G77A 4F3GA 4HW8A 4EDPA 2YLNA 1B7UA 2H5YA 2HCAA 4NMYA 3KJ7A 4UACA 5DEXA 3IX1A 2Y84A 4BDRA 1B7ZA 3IR1A 1Y3NA 1S50A 4LVQA 4IO5A 4N13A 2O68A 5I57A 1N04A 4F2OA 4TOZA 2XXUA 4NEDA 3C33A 5I58B 3D4GA 2PT1A 3CFLA 3F11A 3R7XA 3QUJA 3RNNA 1IXHA 3HN0A 2ZMBA 5ICTA 3T9UA 3IK6B 5H8HB 5AA2D 1AMFA 5I59B 1US5A 3U92A 1DOTA 3ILUB 1FTMA 2DE3A 2M8CA 1NNFA 4PE5B 3PPPA 4BDLA 1TT1A 3T22A 3WAEA 1H3DA 4FJPA 1LBBA 3D4CA 4GIZA 2IA4A 2THIA 3B6TA 1MPBA 4F22A 4POWA 1B5IA 4H8IA 4GD5A 3GBAA 4BDQA 1PEBA 3KSXA 1Z7NE 4NF8A 4ZE8A 3KN8A 1DSNA 3KZGA 4PFUA 1SW4A 4NF4B 4P11A 4FEDA 3M3FA 3MC2A 1ZKBA 2QS2A 2I6EA 3ILTB 1POTA 4I62A 4LP2B 2RC7A 3TQLA 1ZTYA 3RUMA 3TTKA 3O9PA 5L9SA 1D4NA 1QUIA 4ESXA 2ONKE 4GOTA 3L6HA 4ECFA 3QXMA 5F7VA 5JTYA 4K3FA 4IGRA 5CMMA 5H8QA 4QSCA 3PPQA 4MF3A 2RKMA 2F36A 2VGQA 1OLCA 4Q5TA 5KDTB 1IXIA 3N26A 3TEPA 3GBBA 2V3QA 1MXWA 3KOSA 3PUYE 4MLQA 1J1NA 2VHAA 4F1UA 2V93A 1MXVA 1CE2A 3MVXA 2Q88A 4JWYA 3RTWB 1XS5A 4IO4A 1MDP1 3ZS6A 4IO2A 2DOJA 2X7QA 5AE4A 2H99A 1A8FA 3DP4A 1Z7ME 2DWAA 1FQCA 4KD5A 4KCCA 1RYXA 1Y9UA 4NTLA 2X7PA 2D3IA 3FXRA 2VOZA 1FCKA 3GZGA 1MXXA 1SYIA 3KFMA 4U1ZA 1H43A 5IAIA 1NKXA 3PD9A 5I2KA 2F78A 2E0SA 4H6DA 4C1UA 2F6PA 1SDXA 4NF6B 3TQWA 5KCJB 4NWDA 3LUYA 4G8MA 1HSJA 4GRKA 1LFHA 1SW5A 1TFAA 2NXOA 4ZEKA 4QFOA 3G3GA 1XVXA 1Y4CA 4Q30B 4WEPA 2R9JA 5CBRA 3FVOA 2XX7A 3EPEA 4ZEBA 1HSLA 1SW1A 4RYAA 4F2QA 2XXTA 3VLUA 4ZECA 3JZJA 5I56A 5HM4B 2O51A 1OMPA 4ZEIA 2O7UA 4X48A 4LQ2A 3PPRA 3MPKA 5EHSA 5AA4A 4IO3A 3TMGA 2RCBA 3BFTA 1NNPA 5DVJA 1VR5A 4TLMB 3PUZE 1JVYA 3FGSA 2ZYKA 3MWBA 2X26A 2LAOA 3FATA 3IJOB 5TPAA 2NUVA 5L9OA 4G4PA 4G68A 3KG2A 4RPNA 1MXZA 5CMBA 2O1LA 3W9WA 5ITPA 2UVIA 2E1SA 3K01A 3TDJA 5K2YA 2DVCA 3O28A 1H76A 4QSEA 2XHDA 3CVGA 1PC3A 3TKDA 1BP5A 2I4BA 4FAJA 2RC9A 3KN3A 1H45A 3FVNA 3TYHA 2GHAA 5ELVA 3K6WA 1PB7A 1XT8A 3MZ1A 1JW4A 3K6UA 2R71A 4XKQA 2PVUA 3FJ7A 3QSLA 1D9VA 3T9HB 3MVWA 4OEUA 1LAHE 4YICA 2VD3A 4RA1A 1IXGA 1N0TA 3RT6B 1GGGA 3R26A 3LR1A 3LC8A 4OEVA 5I58A 3IL1B 2UYEA 1D9YA 2G93A 1A8EA 3R6UA 2Y7RA 4IGTA 4GXAA 3ZKKA 3Q29A 5A5XB 1P1OA 1A99A 3FD3A 4EQ9A 5HPQA 3PPNA 2AL5A 5H8HA 5ITOA 1B46A 1R9QA 5I59A 2A5SA 1USYH 4IB2A 1P1UA 3FVKA 1PDAA 3U8QA 1YTVA 2O1MA 2DP8A 1UTHB 4FECA 4Z7EA 1IEJA 4DLDA 1FW0A 4OFJA 4P0GA 4F3BA 5AA3A 3U94A 3O29A 1B40A 1NNKA 4H8JA 1B0HA 1XOCA 4NWCA 3VXBA 2DXRA 3IB2A 4FIMA 4ZE9A 1S7YA 1SI1A 2Y7IA 2QL3A 4BDOA 3N6UA 1BIYA 3PMXA 2OBGA 2V25A 2XX9A 3OO8A 4RJZA 1FTKA 2OK2A 1TFDA 4HCWA 4ONYA 4KPTA 1I6QA 1RKMA 3QK6A 2HZKA 3ONMA 1I69A 1LCTA 2Q89A 2QMWA 1NH7A 5KDTA 3VVDA 3K00A 4OQOA 4EQBA 3HSTA 1JNFA 2ZXTA 4TLLB 1MG1A 4I9DA 1R1NA 1VFEA 2D21A 4FEBA 3E13X 1N76A 4ELOA 4G68C 2DXYA 1LFGA 5I2NB 3SEYA 3UN6A 4GFRA 2IEEA 2D5WA 4G8NA 2AL4A 2Z22A 4U22A 1N84A 4WEDA 2CMOA 2UVGA 1VFDA 3H4ZA 2WKYA 4ZZAA 1QJMA 1UTBB 2F35A 1N7WA 4LATA 3T96B 3IAZA 2F6GA 1UIUA 3FASA 4C0RA 3TODA 5AA2B 2H4IA 4IO6A 3T9VA 3MP8A 3G3IA 3KEIA 2ZNUA 1MQJA 3AXFA 3U1OA 3ZSFA 3A09A 3DELB 1WVJA 1YPNA 4E0WA 4NF6A 4L17A 4POXA 1O7TA 3CRBA 2QJEA 4MLVA 2QS1A 3OO9A 1ZLQA 4YAHX 1QW0A 4YMAA 1Q1KA 4RPOA 3LSLA 4JWOA 1JEUA 2KLFA 2CZLA 2XXIA 2I49A 4F31B 3RGYA 4XTCQ 1FTOA 3M3LA 4R6HA 4R6KA 4DXUA 2B3BA 4R75A 1JW1A 5LOMA 4LQ5A 2ZNSA 3OOAA 3TTRA 5ISUA 5I84A 4H67A 2Y7KA 2V84A 2ONRA 1B3FA 1PBQA 3EHTA 1B51A 3MVZA 3OMBA 3H6WA 4R2BA 2HFBA 3U93A 4Z0IA 2ZYOA 3K4UA 3HO7A 3QIMA 1PBPA 1B3LA 1ANFA 5FTHA 4KQPA 4YKKA 1WODA 4DCYA 1P1WA 3N6TA 4YB6A 4AB5A 4G2ZA 1LGBC 2OZZA 1LAFE 3O97A 3G3JA 1MXUA 4LZ8A 4KYEA 3TPAA 2Z8DA 2Q2CA 3MVYA 4E0XA 5H8SA 3K0VA 2XD2A 3T9XB 3L6GA 5ICQA 4GL8A 3OD7A 2XXHA 4F3PA 5H8NB 3TZAA 1DTGA 2DWIA 3VDFA 2XXWA 2PX1A 3SEVA 1LB8A 4ISUA 1ZIUA 2XXRA 4I8CA 3JV9A 1EZ9A 2R6GE 2ZYMA 5TP9A 1UIVA 3OSRA 1B58A 4LUBA 4JB7A 1BKAA 2A5TA 1N7XA 4FORA 4DDDA 1UQWA 5IKBA 1ELJA 1O64A 4F39A 4YKJA 4U4SA 2DVZA 3CI8A 3TTMA 5CM6A 5A5XA 3MZ9A 2OJTA 5FHNA 1QKAA 3KOTA 4R2FA 5CC2A 1A40A 4KCDA 1ZU0A 1URDA 1SI0A 4F18A 2QS4A 4NE4A 4OWDA 3CG1A 2B3FA 3Q27A 4RXLA 4U4XA 5I57B 1DMBA 3GXAA 3K1PA 2OWSA 1MY3A 4MFIA 4XKRA 2YPNA 1B5JA 1GVCA 3MZBA 3EHSA 1MH4A 3USDA 4OHNA 2AIXA 2DE2A 3ECRA 1MQDA 1Y1ZA 3RT8A 1EH3A 3MJNA 3OEKA 4BDMA 5CMKA 2YJPA 1IQ7A 2XXQA 3CSGA 4BLAA 4R72A 4U23A 1VSOA 3IJXB 3G3FA 3PMWA 3MP6A 4R6YA 3SEUA 1B9JA 1URSA 5BWJA 2ZNTA 3I3VA 2ANJA 4ELQA 3H03A 2PBWA 1PB9A 4LZ5A 4DZ1A 2Q8JA 5J1DA 1FTLA 3IOTA 3PUXE 3OELA 3IO4A 4F1YA 2HXWA 1LAGE 5DVIA 4GF8A 1ZBMA 3UGWA 4DXCA 4KI0E 3EQ1A 4OXVA 5K2XA 5H8FB 2QPQA 1FQBA 3LBSA 5H8QB 1B7HA 2F7BA 4GL0A 3IO6A 4JBZA 1TWYA 4LONB 1MS7A 4OZ9A 5JEIA 1AOVA 3QYTA 3FJMA 2DSFA 1B6HA 4RY1A 4PETA 3OO6A 2Z8FA 1NL5A 3KSJA 3PU5A 3BKIB 5AA2A 1IXCA 3HHFA 1M5BA 3MAMA 3OEMA 1A7LA 2V3UA 1MH3A 3UORA 4KHZE 2RF1A 1MY1A 1Y1MA 3TCHA 1MM7A 1SYHA 2XXXA 2H25A 3H3GA 4DIGA 3K6XA 4H5GA 4IY6A 1R6ZA 4HCYA 3DP6A 1R9LA 3EHUA 4U2RA 2HZLA 1JW5A 2I58A 4QF9A 2Y7PA 2Z8EA 4KR5A 1LFIA 3G3HA 1MM6A 1M5CA 1IUDA 4ZEFA 4QFKA 1LCFA 4OENA 1FQAA 3CSBA 3FVGA 4YZZA 3UA8A 4OERA 1JQFA 4NF4A 3S4UA 3VXCA 2I0CA 2I48A 4OFOA 3OSQA 5BUUA 4R74A 1ZJLA 1OVTA 1B3HA 1Q35A 1N3XA 5DYHA 4U1OA 1SVXB 1LLSA 4EF2A 2HAVA 1I6AA 4WXJA 3E3KA 4NF5B 1O63A 3UP9A 4ELPA 2QS3A 3HCQA 1US4A 3PPOA 4ND9A 2GFEA 2RINA 5AA4B 1RYOA 1SBPA 3BBRA 3W15C 3OXNA 3B7DA 3C32A 4LZ7A 3TTNA 5TPAB 3JYRA 3QAXA 1OQGA 4G8HA 4O3BA 3FV2A 2QSXA 3M8UA 4PQJA 1FTJA 1B3EA 4GQOA 1I6BA 1XVYA 4YKPA 2DWJA 2OLBA 4QHQA 1MXYA 4OMBA 1SQYA 2ALUA 3SEXA 4KYSA 1B2HA 1DPPA 3THIA 4OVJA 2F7AA 2V3TA 2Y7WA 1FQEA 2OCUA 3G7WA 3KJTA 1BTJA 4HTGA 3DP8A 4R9FA 1P99A 1MY4A 4YB5A 4X1BA 2RC8A 4BDNA 3RPWA 5TU0A 3H7MA 3PD8A 4RK9A 4UA8A 5AA1A 4RNSA 1EU8A 3H6UA 1MQIA 5CBSA 4HS7A 2REJA 4EQ7A 3B6WA 1MQGA 1AH5A 4IY5A 2HQ0A 3RY3A 1DPEA 1JVXA 3N5LA 3O6IA 3ZKLA 2ESNA 3O6HA 3SEWA 3VLVA 5KCJA 3QUFA 3S9NC 2XD3A 2PMSA 3T93B 1B0LA 3FXUA 3MPLA 2DYXA 5HBCA 1XC1A 3RTFB 4F29A 4H5FA 2I0BA 2UVHA 4QFLA 4OESA 3C4MA 2F8DA 1QUKA 5B70A 2F97A 2UYFA 1LB9A 1H44A 1URGA 2I4CA 3C9HA 1Y3QA 1AIVA 2B65A 3O6GA 3ODBA 1IIWA 3VVFA 3K1NA 4H65A 4YB7A 3I6VA 3CR9A 1B4ZA
chains in the Genus database with same CATH superfamily
4F3SA 2Y5KA 1Y3PA 1MPDA 4MNPA 3TCGA 2OWZA 3Q28A 2NWJA 4PP0A 2ONSA 3VV5A 3EN3A 4R9GA 2H98A 4GWYA 3PV0E 4O3CA 3U65A 3VE1B 5CRYA 4PDHA 3KGCA 1NFTA 2NVUB 2QRYA 3IOUA 2MKZA 1MDQA 3LSXA 2KQZA 2W7YA 1KWHA 3VVEA 5FHMA 4WKMA 1MPCA 5M2VA 5H8FA 4GLIA 1OQHA 2Z23A 5IGAA 1MQHA 3RN8A 4N07A 2HXRA 3P7IA 4DCXA 3K1MA 4I1DA 1A54A 3IORA 1MY0A 2UXAA 2P1SA 4I3EA 4XKNA 4JVCA 4OVSA 4GXSB 2DQVA 2VPNA 3FZVA 4OYVA 3C31A 2VP1A 3MUQA 4FE8A 4R73A 3CFZA 4LA9A 4N8YA 4O3AA 4Q8RA 1MRPA 1Q9DA 1OLAA 1B1XA 4MJOA 4ZEDA 4QBAA 1CB6A 5KZTA 2XXVA 3PMVA 5EYHA 2GH9A 3FXQA 4P0IA 4Q0CA 1QKBA 1LBCA 3RYDA 4XIGQ 2XXPA 2VD2A 1B1HA 1B05A 4ELRA 4OTEA 1GR2A 2HAUA 4DE8A 3MYUA 1GTKA 1GV8A 3V83A 2O6AA 3LSWA 5DEXB 1YAEA 3KBRA 2HEUA 1EYKA 1SW2A 3DLNA 3HPIA 1EZPA 3PUVE 3TTLA 2BJJX 3S9EA 1IITA 3Q26A 3MQ9A 3O66A 3CFXA 3SERA 1UTHA 3UK4A 1B3GA 1FRPA 1JETA 3GLBA 2P2AA 1OIBA 2I3WA 1VE4A 1FQFA 4GX4A 4H0WA 1USYE 3HHGA 2XXYA 5DVFA 1P1NA 3CG3A 4JSOA 1IZ1A 4EXKA 1Y20A 4N6PA 5LTCA 4TQUQ 1LSTA 3K2DA 2HHMA 2PT2A 3EF7A 1QGXA 4GVOA 5L9MA 1B5HA 1QVSA 2ZZWA 1ZMGA 3LSFB 2DWHA 2OWTA 4HE1A 1B4HA 3E9XA 3SKPA 3FUZA 4O7MA 4NF5A 2QMXA 3KC0A 4NF8B 2H9BA 4QFPA 2F3DA 4OETA 1XHYA 1VDWA 2NOOA 3U72A 3T66A 3V89B 5B7DA 3FJGA 4GWOA 4GWXA 3SDFA 1FPKA 1NV7A 3MBPA 2F7CA 4KFQA 5EYFA 4EUOA 4IR8A 3O2AA 3IFCA 1OVBA 1A55A 1D3KA 1JP4A 4DXBA 5JTYB 4X04A 3RQTA 4YMBA 1POY1 5CMCA 3IB1A 3T1BA 4F19A 1ATGA 3IOWA 4PFBA 5I2NA 3S9MC 4NHBA 3ROJA 2FA7A 1DCUA 3TFLA 1LBVA 3TELA 4ZZEA 4NQ8A 4OFLA 1EZOA 3C36A 5A5LA 5EQ8A 1AL3A 3FV1A 3Q25A 5EHMA 4JDFA 2B4LA 3TAJA 3G3KA 5ET7A 4XXUA 2VT5A 1FPFA 1SD3A 3DM0A 4JWXA 1UTBA 4X8RA 1M5FA 4PFYA 4JXIA 2I3VA 1FPIA 1NH8A 1NNTA 2O7IA 1M5DA 3RLFE 4FATA 4AQ4A 4XKPA 1LAXA 3OO7A 1L5TA 4H1XA 1PB8A 1JEVA 2GRVA 3HV1A 5TP9B 2UVJA 1FBPA 2XWOA 3TUSA 1B52A 2A5TB 3H06B 3M3KA 1D9QA 3V8XB 3IB0A 1YCJA 3VLWA 2ZYNA 4YKIA 3V5AA 3IOVA 4U21A 5ET5A 5L8DA 3VFJA 1B32A 4QRZA 5I2KB 4QFNA 3I5OA 4C1TA 1P1QA 3MP1A 2DE4A 4THIA 2RCAA 1S9TA 2ABHA 3FIRA 3E78A 5DTBA 4M1VA 2DDKA 3SESA 4M4GA 1F9BA 1FBCA 4MH5A 1II5A 3C35A 2G29A 4ZS9A 2FIXA 3OENA 1FBHA 1M5EA 1IMCA 2Q2AA 4RK2A 3B6QA 4KYDA 2AYSA 3A3CA 4ZDMA 3WAFA 4IO7A 5I56B 2GHBA 4MBPA 1NMUA 3K02A 3KN7A 3PTYA 5LDZA 3C34A 4EXLA 1QULA 1HSEA 4X9TA 5IM2A 2DS9A 4N6DA 4PGNA 3BFUA 5FTIA 1DTZA 2O69A 4EF1A 1DBZA 3PGFA 4F1VA 1KA0A 5FHOA 3A3UA 5F1QA 2F34A 3CIJA 4JSDA 3W9VA 4PFTA 4JVIA 4GX3A 1BLFA 1Y4TA 2FYIA 3SETA 3PUWE 1QUJA 4X1DA 4PGPA 4G68B 2Q9TA 4YU0A 3S9LC 3UIFA 2F5XA 5JK4A 1FQDA 1N3WA 4AB6A 2O84X 3H6VA 1WDNA 4ESWA 1TXFA 3N94A 5H8NA 1T0KA 1MY2A 4PFWA 2P0SA 2FHYA 1XI6A 2FNCA 2REGA 3S2VA 4QSDA 3TCFA 5T3JA 5DT6A 4MMPA 3E4RA 4I3YA 4KXPA 5CI5A 3MW0A 4NX1A 2PYYA 3H6TA 1INPA 2XX8A 3K6VA 4G77A 4F3GA 4HW8A 4EDPA 2YLNA 1B7UA 2H5YA 5EQAA 2HCAA 4NMYA 3KJ7A 4UACA 2CZKA 5DEXA 3IX1A 2Y84A 4BDRA 1B7ZA 3IR1A 1Y3NA 1S50A 4N17A 1NV0A 4LVQA 4IO5A 4N13A 2WYPA 2O68A 1NV5A 5I57A 1N04A 4F2OA 4TOZA 2XXUA 4NEDA 3C33A 5I58B 3BIGA 3D4GA 2PT1A 3CFLA 3F11A 2QVVA 3R7XA 3QUJA 3RNNA 1IXHA 3HN0A 2ZMBA 5ICTA 3T9UA 2P3NA 3IK6B 5H8HB 5AA2D 1AMFA 5I59B 1US5A 1AWBA 4PF6A 3U92A 2R8TA 1DOTA 3ILUB 2PCRA 1FTMA 5IZ3A 2DE3A 2M8CA 1NNFA 4PE5B 3PPPA 2XWIA 4BDLA 1TT1A 3T22A 3WAEA 1H3DA 4FJPA 1LBBA 3D4CA 3QMFA 4GIZA 2IA4A 2THIA 4OVQA 3B6TA 1MPBA 4F22A 5FBPA 4POWA 1RDYA 1B5IA 4H8IA 4GD5A 3GBAA 4BDQA 1PEBA 3KSXA 1Z7NE 4NF8A 4ZE8A 3KN8A 1DSNA 3KZGA 4PFUA 1SW4A 4NF4B 4P11A 3CHGA 4FEDA 2CZIA 3M3FA 3MC2A 1ZKBA 2QS2A 2I6EA 3ILTB 1POTA 4I62A 4LP2B 2RC7A 3TQLA 1ZTYA 3RPLB 1LEVA 3RUMA 3TTKA 3O9PA 1CNQA 5L9SA 1D4NA 1QUIA 4ESXA 2ONKE 4GOTA 3L6HA 4ECFA 3QXMA 5F7VA 5JTYA 4K3FA 4IGRA 5CMMA 5H8QA 4QSCA 3PPQA 4MF3A 2RKMA 2F36A 2VGQA 1OLCA 4Q5TA 5KDTB 1IXIA 2XWKA 3N26A 3TEPA 3GBBA 4MCOA 2V3QA 4PAKA 1MXWA 3KOSA 3PUYE 4MLQA 4FBPA 1J1NA 2BJIA 2VHAA 4F1UA 4MHFA 2V93A 1MXVA 1CE2A 1FBFA 3MVXA 2Q88A 4JWYA 3RTWB 1XS5A 4IO4A 1MDP1 3ZS6A 4IO2A 2DOJA 2X7QA 5AE4A 2H99A 1A8FA 3DP4A 1Z7ME 2DWAA 1FQCA 4KD5A 4KCCA 1RYXA 1Y9UA 4NTLA 2X7PA 3T0JA 2D3IA 3FXRA 2VOZA 1FCKA 3GZGA 1MXXA 1SYIA 1FPLA 3KFMA 5F24A 4U1ZA 1H43A 5IAIA 1NKXA 3PD9A 5I2KA 2F78A 2E0SA 4H6DA 4C1UA 2F6PA 1SDXA 4NF6B 3TQWA 5KCJB 4NWDA 3LUYA 4G8MA 1HSJA 4GRKA 4NGUA 5ET8A 1LFHA 1NV1A 1SW5A 1TFAA 2NXOA 4ZEKA 1FPDA 4QFOA 3G3GA 1XVXA 1Y4CA 3ISPA 2QVRA 4Q30B 4WEPA 2R9JA 5CBRA 3FVOA 2XX7A 3EPEA 4ZEBA 1HSLA 1SW1A 4RYAA 1FPGA 5EQ9A 4F2QA 1NV2A 2XXTA 3VLUA 4ZECA 3JZJA 4UABA 5I56A 3LV0A 5HM4B 2O51A 2OX3A 1OMPA 4ZEIA 4GX6A 2O7UA 4N15A 4X48A 4LQ2A 2CZHA 5I3SA 4GWWA 3PPRA 3MPKA 5EHSA 5AA4A 4IO3A 3TMGA 2RCBA 3BFTA 1NNPA 5DVJA 1VR5A 4TLMB 1IMEA 3PUZE 1JVYA 3FGSA 2ZYKA 3MWBA 2X26A 2LAOA 3FATA 3IJOB 1NV3A 5TPAA 2NUVA 5L9OA 4G4PA 1RDZA 4G68A 3KG2A 4OA4A 4RPNA 2CEYA 1MXZA 5CMBA 2O1LA 3KBZA 3W9WA 5ITPA 2UVIA 2E1SA 3K01A 3TDJA 4GBWA 5K2YA 2DVCA 3O28A 1H76A 4QSEA 2XHDA 3CVGA 1PC3A 3TKDA 1BP5A 2I4BA 4FAJA 2RC9A 3KN3A 1FSAA 1H45A 3FVNA 4PAFA 3TYHA 4DI4B 1SPIA 2GHAA 5ELVA 3K6WA 1PB7A 1XT8A 3MZ1A 4P56A 1JW4A 3K6UA 2R71A 4GWUA 4XKQA 2PVUA 3FJ7A 4HE2A 3QSLA 1D9VA 3T9HB 3MVWA 4OEUA 1LAHE 4YICA 2VD3A 1LBWA 4RA1A 1IXGA 1N0TA 3RT6B 1GGGA 3R26A 4PTKA 4OVPA 3LR1A 3LC8A 3MSTA 4OEVA 5I58A 3IL1B 2UYEA 1D9YA 1KA1A 2G93A 1A8EA 3R6UA 2Y7RA 4IGTA 4GXAA 3ZKKA 3Q29A 5A5XB 1P1OA 4NAPA 1A99A 3FD3A 4EQ9A 4PE3A 5HPQA 3PPNA 2AL5A 5H8HA 5ITOA 1B46A 1R9QA 5I59A 2A5SA 1USYH 4XEQA 4IB2A 1P1UA 3FVKA 1PDAA 3U8QA 1YTVA 2O1MA 2DP8A 1UTHB 4N81A 4FECA 4Z7EA 1IEJA 4DLDA 5EYGA 1FW0A 4OFJA 4P0GA 2PFZA 5DW8A 4F3BA 5AA3A 3U94A 3O29A 1NI9A 1B40A 1NNKA 4H8JA 1B0HA 4PAIA 1XOCA 1FPEA 4NWCA 3VXBA 2DXRA 3IB2A 4FIMA 4QXDA 2FBPA 4ZE9A 3HFUA 1S7YA 1SI1A 2Y7IA 2QL3A 4BDOA 4NF0A 3N6UA 1BIYA 3PMXA 2OBGA 2V25A 2XX9A 3OO8A 2B4MA 4RJZA 1FTKA 2OK2A 1TFDA 4HCWA 4ONYA 4G61A 4KPTA 1FJ6A 1I6QA 4P1LA 4MIJA 1RKMA 1BK4A 3QK6A 2HZKA 3ONMA 1I69A 1LBXA 1LCTA 2Q89A 2QMWA 1NH7A 5KDTA 1FJ9A 3VVDA 3K00A 4OQOA 2WX9A 4EQBA 3HSTA 1JNFA 2ZXTA 4OANA 1YZ0A 4TLLB 1MG1A 4I9DA 1NUXA 1R1NA 1VFEA 2D21A 4FEBA 4I40A 3E13X 1N76A 4ELOA 4G68C 2DXYA 3B50A 4O8MA 1LFGA 2CEXA 5I2NB 3KC1A 1G0IA 3SEYA 3UN6A 2VPOA 2XA5A 4GFRA 2IEEA 2D5WA 4G8NA 2AL4A 2Z22A 5I5PA 4U22A 1N84A 4WEDA 2CMOA 2KR0A 2UVGA 1VFDA 3H4ZA 2WKYA 4AS4A 4ZZAA 1QJMA 1UTBB 2F35A 1N7WA 4LATA 3T96B 3IAZA 2F6GA 1UIUA 3FASA 4C0RA 2FIEA 3TODA 5AA2B 2H4IA 4HE0A 1DK4A 4IO6A 3T9VA 3MP8A 3G3IA 3KEIA 4LN5A 2ZNUA 1MQJA 4P3LA 3AXFA 3U1OA 3ZSFA 3A09A 3DELB 1WVJA 1YPNA 4E0WA 2JJKA 5EQ7A 4NG7A 4NF6A 4L17A 4POXA 1O7TA 3CRBA 2QJEA 4MLVA 2QS1A 3OO9A 1ZLQA 4H45A 1RDXA 4YAHX 1QW0A 4YMAA 1Q1KA 4RPOA 3LSLA 4JWOA 1JEUA 4O7IA 4AS5A 2L5VA 2KLFA 2CZLA 2XXIA 4N4UA 2I49A 4XF5A 4F31B 3RGYA 4XTCQ 1FTOA 3M3LA 4R6HA 4N91A 4PBHA 4R6KA 4DXUA 2B3BA 4R75A 4MNCA 1K9ZA 1JW1A 5LOMA 4H46A 4LQ5A 1FBDA 2ZNSA 3OOAA 4PF8A 3TTRA 5ISUA 5I84A 3SZPA 4H67A 2Y7KA 2V84A 2WBDA 2ONRA 1B3FA 1PBQA 3EHTA 1B51A 3MVZA 3OMBA 3E79A 3H6WA 4R2BA 2HFBA 4GWSA 3U93A 4Z0IA 2ZYOA 3K4UA 3HO7A 3QIMA 1PBPA 1B3LA 1ANFA 5FTHA 4KQPA 4YKKA 2Q8MA 1WODA 1G0HA 4DCYA 1P1WA 3N6TA 4P47A 5IZZA 4YB6A 4AB5A 4G2ZA 1LGBC 2F3BA 2OZZA 1LAFE 3O97A 3G3JA 1MXUA 4LZ8A 4KYEA 3TPAA 2Z8DA 2Q2CA 3MVYA 4E0XA 5H8SA 3K0VA 2XD2A 3T9XB 3L6GA 5ICQA 1NV6A 4GL8A 3GYYA 3OD7A 2XXHA 4F3PA 5H8NB 4MEVA 3TZAA 1DTGA 2DWIA 3VDFA 3FBPA 2XXWA 2PX1A 3NOHA 3SEVA 1LB8A 4N8GA 4ISUA 1ZIUA 2XXRA 1IMBA 4I8CA 3JV9A 1EYIA 1K9YA 4PFIA 1EZ9A 2R6GE 2ZYMA 5TP9A 1UIVA 3OSRA 1B58A 4LUBA 4JB7A 1BKAA 2A5TA 1N7XA 4FORA 1FTAA 4DDDA 1UQWA 5IKBA 1ELJA 1O64A 4F39A 4YKJA 4U4SA 2DVZA 3CI8A 4MX6A 3TTMA 5CM6A 5A5XA 3MZ9A 2OJTA 5FHNA 1QKAA 3KOTA 4O94A 4R2FA 5CC2A 1A40A 4KCDA 1ZU0A 1URDA 1SI0A 4F18A 2QS4A 4NE4A 4OWDA 3CG1A 2B3FA 3Q27A 4RXLA 4U4XA 1NUZA 5I57B 1DMBA 3GXAA 3K1PA 2OWSA 1MY3A 2ZZXA 4MFIA 4XKRA 2YPNA 1B5JA 1GVCA 3MZBA 3D1RA 5I7IA 3EHSA 1MH4A 3USDA 4OHNA 4OVRA 2P3VA 2AIXA 2DE2A 3ECRA 1MQDA 1Y1ZA 3RT8A 1EH3A 3MJNA 5IZ3B 3OEKA 4BDMA 5CMKA 2YJPA 1IQ7A 2XXQA 3CSGA 4BLAA 4R72A 1LBZA 4U23A 1VSOA 2PFYA 3IJXB 3G3FA 2QFLA 3PMWA 5IZ1A 3MP6A 4R6YA 3SEUA 1B9JA 1URSA 5BWJA 2ZNTA 3I3VA 2ANJA 4ELQA 3H03A 2PBWA 4OVTA 1PB9A 4LZ5A 4DZ1A 2Q8JA 4GBVA 5J1DA 4P8BA 1FTLA 3IOTA 3PUXE 3OELA 3IO4A 4F1YA 1YXIA 1LAGE 2HXWA 5DVIA 4GF8A 1ZBMA 3UGWA 4DXCA 4KI0E 3EQ1A 4OXVA 5K2XA 5H8FB 2QPQA 1FQBA 3LBSA 4N6KA 5H8QB 1B7HA 4JVDA 2F7BA 4GL0A 3IO6A 4JBZA 1TWYA 4LONB 1MS7A 4OZ9A 5JEIA 1AOVA 2GQ1A 3LUZA 3QYTA 3FJMA 2DSFA 1B6HA 4RY1A 3IFAA 4PETA 2HPGA 3OO6A 2Z8FA 1NL5A 3KSJA 2V4CA 3PU5A 3BKIB 5AA2A 1IXCA 3HHFA 1M5BA 3MAMA 1NUYA 3OEMA 1A7LA 2V3UA 1MH3A 3UORA 4KHZE 2RF1A 1MY1A 1Y1MA 3TCHA 1MM7A 1SYHA 2XXXA 2H25A 3H3GA 4DI3D 4DIGA 3K6XA 4H5GA 4IY6A 2WYKA 1R6ZA 4HCYA 4PDDA 3DP6A 1R9LA 3EHUA 4U2RA 2HZLA 1JW5A 4PBQA 2I58A 4QF9A 2Y7PA 2Z8EA 4P9KA 4KR5A 3A29A 1LFIA 3G3HA 1MM6A 1M5CA 1IUDA 4ZEFA 4QFKA 1LCFA 4OENA 1YYZA 1FQAA 3CSBA 3FVGA 4YZZA 3UA8A 4OERA 1JQFA 1IMFA 4NF4A 3S4UA 3VXCA 2I0CA 2I48A 5ET6A 4OFOA 3OSQA 5BUUA 4R74A 1ZJLA 3RPLA 1OVTA 1B3HA 1Q35A 1N3XA 5DYHA 4U1OA 4P1EA 1SVXB 1LLSA 4EF2A 2HAVA 1I6AA 2FVZA 4WXJA 3E3KA 4NF5B 1O63A 3UP9A 4ELPA 2QS3A 3HCQA 1US4A 3PPOA 4ND9A 2GFEA 3BIHA 2RINA 5AA4B 1RYOA 1SBPA 3BBRA 2Q74A 3W15C 3OXNA 3B7DA 3C32A 4MAGA 4LZ7A 5J16A 3TTNA 4NN3A 5TPAB 3JYRA 3QAXA 1OQGA 4G8HA 4O3BA 3FV2A 4HXVA 2XXKA 2QSXA 3M8UA 4PQJA 1FTJA 1B3EA 4GQOA 1I6BA 1XVYA 2XWVA 4YKPA 2DWJA 2OLBA 4QHQA 1MXYA 4OMBA 1SQYA 2ALUA 3SEXA 4KYSA 4GWZA 1B2HA 1DPPA 3THIA 4OVJA 2F7AA 2V3TA 1IMAA 2QVUA 2Y7WA 4PFRA 1FQEA 2OCUA 3G7WA 5ESYA 4MNIA 3KJTA 1BTJA 4HTGA 3DP8A 4R9FA 1P99A 1MY4A 4YB5A 2RC8A 3H7MA 4X1BA 3RPWA 5TU0A 4BDNA 3PD8A 4RK9A 2WEFA 4PCDA 4UA8A 5AA1A 1IMDA 4RNSA 1EYJA 1EU8A 3H6UA 1MQIA 5CBSA 4HS7A 2REJA 4EQ7A 3B6WA 1MQGA 1AH5A 4IY5A 2HQ0A 3RY3A 1DPEA 1JVXA 3N5LA 3O6IA 3ZKLA 2ESNA 3O6HA 3SEWA 3VLVA 5KCJA 3QUFA 3S9NC 2Y5LA 2XD3A 2PMSA 3T93B 1FPJA 1B0LA 3FXUA 3MPLA 2DYXA 5HBCA 1XC1A 3FXBA 3RTFB 4F29A 4H5FA 2I0BA 1FBEA 2UVHA 4PC9A 4XFEA 4QFLA 4OESA 3C4MA 2F8DA 1QUKA 1KZ8A 3B8BA 5B70A 2F97A 2UYFA 1LB9A 1H44A 1FBGA 1URGA 2I4CA 3C9HA 1Y3QA 1AIVA 2B65A 1NUWA 3O6GA 3ODBA 1IIWA 2WBBA 3VVFA 3K1NA 4H65A 3EKIA 1NV4A 2ZZVA 4YB7A 3I6VA 3CR9A 1LBYA 1B4ZA 1FPBA
chains in the Genus database with same CATH topology
4F3SA 1Y3PA 1MPDA 3TCGA 3Q28A 2NWJA 4PP0A 2ONSA 3VV5A 3EN3A 4R9GA 2H98A 3PV0E 4O3CA 3VE1B 5CRYA 3KGCA 1NFTA 2NVUB 2QRYA 3IOUA 1MDQA 3LSXA 2W7YA 1KWHA 3VVEA 5FHMA 4WKMA 1MPCA 5M2VA 5H8FA 4GLIA 1OQHA 2Z23A 1MQHA 3RN8A 4N07A 3P7IA 4DCXA 3K1MA 4I1DA 1A54A 3IORA 1MY0A 2UXAA 2P1SA 4XKNA 4GXSB 2DQVA 3FZVA 4OYVA 3C31A 2VP1A 3MUQA 4FE8A 4R73A 3CFZA 4LA9A 4O3AA 4Q8RA 1MRPA 1OLAA 1B1XA 4ZEDA 1CB6A 5KZTA 2XXVA 3PMVA 2GH9A 3FXQA 4P0IA 4Q0CA 1QKBA 1LBCA 4XIGQ 2XXPA 2VD2A 1B1HA 1B05A 4ELRA 4OTEA 1GR2A 2HAUA 4DE8A 1GTKA 1GV8A 3V83A 2O6AA 3LSWA 5DEXB 1YAEA 3KBRA 2HEUA 1SW2A 3DLNA 3HPIA 1EZPA 3PUVE 3TTLA 2BJJX 3S9EA 1IITA 3Q26A 3MQ9A 3O66A 3CFXA 3SERA 1UTHA 3UK4A 1B3GA 1JETA 3GLBA 2P2AA 1OIBA 2I3WA 1VE4A 1FQFA 4H0WA 1USYE 3HHGA 2XXYA 5DVFA 1P1NA 3CG3A 4JSOA 1IZ1A 4EXKA 1Y20A 4N6PA 4TQUQ 1LSTA 3K2DA 2PT2A 3EF7A 4GVOA 5L9MA 1B5HA 1QVSA 1ZMGA 3LSFB 2DWHA 2OWTA 1B4HA 3E9XA 3SKPA 3FUZA 4NF5A 2QMXA 4NF8B 2H9BA 4QFPA 4OETA 1XHYA 2NOOA 3U72A 3T66A 3V89B 5B7DA 3FJGA 4GWOA 3SDFA 3MBPA 2F7CA 4KFQA 5EYFA 4EUOA 3O2AA 1OVBA 1A55A 1D3KA 4DXBA 5JTYB 4YMBA 3RQTA 1POY1 5CMCA 3IB1A 4F19A 1ATGA 3IOWA 5I2NA 3S9MC 2FA7A 3TFLA 3TELA 4ZZEA 4OFLA 1EZOA 3C36A 1AL3A 3FV1A 3Q25A 5EHMA 4JDFA 3TAJA 3G3KA 4XXUA 1SD3A 3DM0A 4JWXA 1UTBA 1M5FA 4PFYA 4JXIA 2I3VA 1NH8A 1NNTA 2O7IA 1M5DA 3RLFE 4FATA 4AQ4A 4XKPA 1LAXA 3OO7A 1L5TA 4H1XA 1PB8A 1JEVA 2GRVA 3HV1A 5TP9B 2UVJA 3TUSA 1B52A 2A5TB 3H06B 3M3KA 3V8XB 3IB0A 1YCJA 3VLWA 2ZYNA 4YKIA 3V5AA 3IOVA 4U21A 5L8DA 3VFJA 1B32A 4QRZA 5I2KB 4QFNA 3I5OA 4C1TA 1P1QA 3MP1A 2DE4A 4THIA 2RCAA 1S9TA 2ABHA 3FIRA 5DTBA 4M1VA 3SESA 4M4GA 1F9BA 4MH5A 1II5A 3C35A 2G29A 4ZS9A 3OENA 1M5EA 2Q2AA 4RK2A 3B6QA 4KYDA 2AYSA 3A3CA 4ZDMA 3WAFA 4IO7A 5I56B 2GHBA 4MBPA 1NMUA 3K02A 3KN7A 3C34A 4EXLA 1QULA 1HSEA 4X9TA 2DS9A 3BFUA 5FTIA 1DTZA 2O69A 4EF1A 3PGFA 4F1VA 5FHOA 3A3UA 5F1QA 2F34A 3CIJA 4JSDA 3W9VA 4PFTA 1BLFA 1Y4TA 2FYIA 3SETA 3PUWE 1QUJA 4X1DA 4G68B 2Q9TA 4YU0A 3S9LC 3UIFA 2F5XA 5JK4A 1FQDA 1N3WA 4AB6A 2O84X 3H6VA 1WDNA 4ESWA 1TXFA 3N94A 5H8NA 1T0KA 1MY2A 4PFWA 2P0SA 2FNCA 2REGA 3S2VA 4QSDA 3TCFA 5DT6A 3E4RA 5CI5A 3MW0A 2PYYA 3H6TA 2XX8A 3K6VA 4G77A 4F3GA 4HW8A 4EDPA 2YLNA 1B7UA 2H5YA 2HCAA 4NMYA 3KJ7A 4UACA 5DEXA 3IX1A 2Y84A 4BDRA 1B7ZA 3IR1A 1Y3NA 1S50A 4LVQA 4IO5A 4N13A 2O68A 5I57A 1N04A 4F2OA 4TOZA 2XXUA 4NEDA 3C33A 5I58B 3D4GA 2PT1A 3CFLA 3F11A 3R7XA 3QUJA 3RNNA 1IXHA 3HN0A 2ZMBA 5ICTA 3T9UA 3IK6B 5H8HB 5AA2D 1AMFA 5I59B 1US5A 3U92A 1DOTA 3ILUB 1FTMA 2DE3A 2M8CA 1NNFA 4PE5B 3PPPA 4BDLA 1TT1A 3T22A 3WAEA 1H3DA 4FJPA 1LBBA 3D4CA 4GIZA 2IA4A 2THIA 3B6TA 1MPBA 4F22A 4POWA 1B5IA 4H8IA 4GD5A 3GBAA 4BDQA 1PEBA 3KSXA 1Z7NE 4NF8A 4ZE8A 3KN8A 1DSNA 3KZGA 4PFUA 1SW4A 4NF4B 4P11A 4FEDA 3M3FA 3MC2A 1ZKBA 2QS2A 2I6EA 3ILTB 1POTA 4I62A 4LP2B 2RC7A 3TQLA 1ZTYA 3RUMA 3TTKA 3O9PA 5L9SA 1D4NA 1QUIA 4ESXA 2ONKE 4GOTA 3L6HA 4ECFA 3QXMA 5F7VA 5JTYA 4K3FA 4IGRA 5CMMA 5H8QA 4QSCA 3PPQA 4MF3A 2RKMA 2F36A 2VGQA 1OLCA 4Q5TA 5KDTB 1IXIA 3N26A 3TEPA 3GBBA 2V3QA 1MXWA 3KOSA 3PUYE 4MLQA 1J1NA 2VHAA 4F1UA 2V93A 1MXVA 1CE2A 3MVXA 2Q88A 4JWYA 3RTWB 1XS5A 4IO4A 1MDP1 3ZS6A 4IO2A 2DOJA 2X7QA 5AE4A 2H99A 1A8FA 3DP4A 1Z7ME 2DWAA 1FQCA 4KD5A 4KCCA 1RYXA 1Y9UA 4NTLA 2X7PA 2D3IA 3FXRA 2VOZA 1FCKA 3GZGA 1MXXA 1SYIA 3KFMA 4U1ZA 1H43A 5IAIA 1NKXA 3PD9A 5I2KA 2F78A 2E0SA 4H6DA 4C1UA 2F6PA 1SDXA 4NF6B 3TQWA 5KCJB 4NWDA 3LUYA 4G8MA 1HSJA 4GRKA 1LFHA 1SW5A 1TFAA 2NXOA 4ZEKA 4QFOA 3G3GA 1XVXA 1Y4CA 4Q30B 4WEPA 2R9JA 5CBRA 3FVOA 2XX7A 3EPEA 4ZEBA 1HSLA 1SW1A 4RYAA 4F2QA 2XXTA 3VLUA 4ZECA 3JZJA 5I56A 5HM4B 2O51A 1OMPA 4ZEIA 2O7UA 4X48A 4LQ2A 3PPRA 3MPKA 5EHSA 5AA4A 4IO3A 3TMGA 2RCBA 3BFTA 1NNPA 5DVJA 1VR5A 4TLMB 3PUZE 1JVYA 3FGSA 2ZYKA 3MWBA 2X26A 2LAOA 3FATA 3IJOB 5TPAA 2NUVA 5L9OA 4G4PA 4G68A 3KG2A 4RPNA 1MXZA 5CMBA 2O1LA 3W9WA 5ITPA 2UVIA 2E1SA 3K01A 3TDJA 5K2YA 2DVCA 3O28A 1H76A 4QSEA 2XHDA 3CVGA 1PC3A 3TKDA 1BP5A 2I4BA 4FAJA 2RC9A 3KN3A 1H45A 3FVNA 3TYHA 2GHAA 5ELVA 3K6WA 1PB7A 1XT8A 3MZ1A 1JW4A 3K6UA 2R71A 4XKQA 2PVUA 3FJ7A 3QSLA 1D9VA 3T9HB 3MVWA 4OEUA 1LAHE 4YICA 2VD3A 4RA1A 1IXGA 1N0TA 3RT6B 1GGGA 3R26A 3LR1A 3LC8A 4OEVA 5I58A 3IL1B 2UYEA 1D9YA 2G93A 1A8EA 3R6UA 2Y7RA 4IGTA 4GXAA 3ZKKA 3Q29A 5A5XB 1P1OA 1A99A 3FD3A 4EQ9A 5HPQA 3PPNA 2AL5A 5H8HA 5ITOA 1B46A 1R9QA 5I59A 2A5SA 1USYH 4IB2A 1P1UA 3FVKA 1PDAA 3U8QA 1YTVA 2O1MA 2DP8A 1UTHB 4FECA 4Z7EA 1IEJA 4DLDA 1FW0A 4OFJA 4P0GA 4F3BA 5AA3A 3U94A 3O29A 1B40A 1NNKA 4H8JA 1B0HA 1XOCA 4NWCA 3VXBA 2DXRA 3IB2A 4FIMA 4ZE9A 1S7YA 1SI1A 2Y7IA 2QL3A 4BDOA 3N6UA 1BIYA 3PMXA 2OBGA 2V25A 2XX9A 3OO8A 4RJZA 1FTKA 2OK2A 1TFDA 4HCWA 4ONYA 4KPTA 1I6QA 1RKMA 3QK6A 2HZKA 3ONMA 1I69A 1LCTA 2Q89A 2QMWA 1NH7A 5KDTA 3VVDA 3K00A 4OQOA 4EQBA 3HSTA 1JNFA 2ZXTA 4TLLB 1MG1A 4I9DA 1R1NA 1VFEA 2D21A 4FEBA 3E13X 1N76A 4ELOA 4G68C 2DXYA 1LFGA 5I2NB 3SEYA 3UN6A 4GFRA 2IEEA 2D5WA 4G8NA 2AL4A 2Z22A 4U22A 1N84A 4WEDA 2CMOA 2UVGA 1VFDA 3H4ZA 2WKYA 4ZZAA 1QJMA 1UTBB 2F35A 1N7WA 4LATA 3T96B 3IAZA 2F6GA 1UIUA 3FASA 4C0RA 3TODA 5AA2B 2H4IA 4IO6A 3T9VA 3MP8A 3G3IA 3KEIA 2ZNUA 1MQJA 3AXFA 3U1OA 3ZSFA 3A09A 3DELB 1WVJA 1YPNA 4E0WA 4NF6A 4L17A 4POXA 1O7TA 3CRBA 2QJEA 4MLVA 2QS1A 3OO9A 1ZLQA 4YAHX 1QW0A 4YMAA 1Q1KA 4RPOA 3LSLA 4JWOA 1JEUA 2KLFA 2CZLA 2XXIA 2I49A 4F31B 3RGYA 4XTCQ 1FTOA 3M3LA 4R6HA 4R6KA 4DXUA 2B3BA 4R75A 1JW1A 5LOMA 4LQ5A 2ZNSA 3OOAA 3TTRA 5ISUA 5I84A 4H67A 2Y7KA 2V84A 2ONRA 1B3FA 1PBQA 3EHTA 1B51A 3MVZA 3OMBA 3H6WA 4R2BA 2HFBA 3U93A 4Z0IA 2ZYOA 3K4UA 3HO7A 3QIMA 1PBPA 1B3LA 1ANFA 5FTHA 4KQPA 4YKKA 1WODA 4DCYA 1P1WA 3N6TA 4YB6A 4AB5A 4G2ZA 1LGBC 2OZZA 1LAFE 3O97A 3G3JA 1MXUA 4LZ8A 4KYEA 3TPAA 2Z8DA 2Q2CA 3MVYA 4E0XA 5H8SA 3K0VA 2XD2A 3T9XB 3L6GA 5ICQA 4GL8A 3OD7A 2XXHA 4F3PA 5H8NB 3TZAA 1DTGA 2DWIA 3VDFA 2XXWA 2PX1A 3SEVA 1LB8A 4ISUA 1ZIUA 2XXRA 4I8CA 3JV9A 1EZ9A 2R6GE 2ZYMA 5TP9A 1UIVA 3OSRA 1B58A 4LUBA 4JB7A 1BKAA 2A5TA 1N7XA 4FORA 4DDDA 1UQWA 5IKBA 1ELJA 1O64A 4F39A 4YKJA 4U4SA 2DVZA 3CI8A 3TTMA 5CM6A 5A5XA 3MZ9A 2OJTA 5FHNA 1QKAA 3KOTA 4R2FA 5CC2A 1A40A 4KCDA 1ZU0A 1URDA 1SI0A 4F18A 2QS4A 4NE4A 4OWDA 3CG1A 2B3FA 3Q27A 4RXLA 4U4XA 5I57B 1DMBA 3GXAA 3K1PA 2OWSA 1MY3A 4MFIA 4XKRA 2YPNA 1B5JA 1GVCA 3MZBA 3EHSA 1MH4A 3USDA 4OHNA 2AIXA 2DE2A 3ECRA 1MQDA 1Y1ZA 3RT8A 1EH3A 3MJNA 3OEKA 4BDMA 5CMKA 2YJPA 1IQ7A 2XXQA 3CSGA 4BLAA 4R72A 4U23A 1VSOA 3IJXB 3G3FA 3PMWA 3MP6A 4R6YA 3SEUA 1B9JA 1URSA 5BWJA 2ZNTA 3I3VA 2ANJA 4ELQA 3H03A 2PBWA 1PB9A 4LZ5A 4DZ1A 2Q8JA 5J1DA 1FTLA 3IOTA 3PUXE 3OELA 3IO4A 4F1YA 2HXWA 1LAGE 5DVIA 4GF8A 1ZBMA 3UGWA 4DXCA 4KI0E 3EQ1A 4OXVA 5K2XA 5H8FB 2QPQA 1FQBA 3LBSA 5H8QB 1B7HA 2F7BA 4GL0A 3IO6A 4JBZA 1TWYA 4LONB 1MS7A 4OZ9A 5JEIA 1AOVA 3QYTA 3FJMA 2DSFA 1B6HA 4RY1A 4PETA 3OO6A 2Z8FA 1NL5A 3KSJA 3PU5A 3BKIB 5AA2A 1IXCA 3HHFA 1M5BA 3MAMA 3OEMA 1A7LA 2V3UA 1MH3A 3UORA 4KHZE 2RF1A 1MY1A 1Y1MA 3TCHA 1MM7A 1SYHA 2XXXA 2H25A 3H3GA 4DIGA 3K6XA 4H5GA 4IY6A 1R6ZA 4HCYA 3DP6A 1R9LA 3EHUA 4U2RA 2HZLA 1JW5A 2I58A 4QF9A 2Y7PA 2Z8EA 4KR5A 1LFIA 3G3HA 1MM6A 1M5CA 1IUDA 4ZEFA 4QFKA 1LCFA 4OENA 1FQAA 3CSBA 3FVGA 4YZZA 3UA8A 4OERA 1JQFA 4NF4A 3S4UA 3VXCA 2I0CA 2I48A 4OFOA 3OSQA 5BUUA 4R74A 1ZJLA 1OVTA 1B3HA 1Q35A 1N3XA 5DYHA 4U1OA 1SVXB 1LLSA 4EF2A 2HAVA 1I6AA 4WXJA 3E3KA 4NF5B 1O63A 3UP9A 4ELPA 2QS3A 3HCQA 1US4A 3PPOA 4ND9A 2GFEA 2RINA 5AA4B 1RYOA 1SBPA 3BBRA 3W15C 3OXNA 3B7DA 3C32A 4LZ7A 3TTNA 5TPAB 3JYRA 3QAXA 1OQGA 4G8HA 4O3BA 3FV2A 2QSXA 3M8UA 4PQJA 1FTJA 1B3EA 4GQOA 1I6BA 1XVYA 4YKPA 2DWJA 2OLBA 4QHQA 1MXYA 4OMBA 1SQYA 2ALUA 3SEXA 4KYSA 1B2HA 1DPPA 3THIA 4OVJA 2F7AA 2V3TA 2Y7WA 1FQEA 2OCUA 3G7WA 3KJTA 1BTJA 4HTGA 3DP8A 4R9FA 1P99A 1MY4A 4YB5A 4X1BA 2RC8A 4BDNA 3RPWA 5TU0A 3H7MA 3PD8A 4RK9A 4UA8A 5AA1A 4RNSA 1EU8A 3H6UA 1MQIA 5CBSA 4HS7A 2REJA 4EQ7A 3B6WA 1MQGA 1AH5A 4IY5A 2HQ0A 3RY3A 1DPEA 1JVXA 3N5LA 3O6IA 3ZKLA 2ESNA 3O6HA 3SEWA 3VLVA 5KCJA 3QUFA 3S9NC 2XD3A 2PMSA 3T93B 1B0LA 3FXUA 3MPLA 2DYXA 5HBCA 1XC1A 3RTFB 4F29A 4H5FA 2I0BA 2UVHA 4QFLA 4OESA 3C4MA 2F8DA 1QUKA 5B70A 2F97A 2UYFA 1LB9A 1H44A 1URGA 2I4CA 3C9HA 1Y3QA 1AIVA 2B65A 3O6GA 3ODBA 1IIWA 3VVFA 3K1NA 4H65A 4YB7A 3I6VA 3CR9A 1B4ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3S A;  1Y3P A;  1MPD A;  3TCG A;  3Q28 A;  2NWJ A;  4PP0 A;  2ONS A;  3VV5 A;  3EN3 A;  4R9G A;  2H98 A;  3PV0 E;  4O3C A;  3VE1 B;  5CRY A;  3KGC A;  1NFT A;  2NVU B;  2QRY A;  3IOU A;  1MDQ A;  3LSX A;  2W7Y A;  1KWH A;  3VVE A;  5FHM A;  4WKM A;  1MPC A;  5M2V A;  5H8F A;  4GLI A;  1OQH A;  2Z23 A;  1MQH A;  3RN8 A;  4N07 A;  3P7I A;  4DCX A;  3K1M A;  4I1D A;  1A54 A;  3IOR A;  1MY0 A;  2UXA A;  2P1S A;  4XKN A;  4GXS B;  2DQV A;  3FZV A;  4OYV A;  3C31 A;  2VP1 A;  3MUQ A;  4FE8 A;  4R73 A;  3CFZ A;  4LA9 A;  4O3A A;  4Q8R A;  1MRP A;  1OLA A;  1B1X A;  4ZED A;  1CB6 A;  5KZT A;  2XXV A;  3PMV A;  2GH9 A;  3FXQ A;  4P0I A;  4Q0C A;  1QKB A;  1LBC A;  4XIG Q;  2XXP A;  2VD2 A;  1B1H A;  1B05 A;  4ELR A;  4OTE A;  1GR2 A;  2HAU A;  4DE8 A;  1GTK A;  1GV8 A;  3V83 A;  2O6A A;  3LSW A;  5DEX B;  1YAE A;  3KBR A;  2HEU A;  1SW2 A;  3DLN A;  3HPI A;  1EZP A;  3PUV E;  3TTL A;  2BJJ X;  3S9E A;  1IIT A;  3Q26 A;  3MQ9 A;  3O66 A;  3CFX A;  3SER A;  1UTH A;  3UK4 A;  1B3G A;  1JET A;  3GLB A;  2P2A A;  1OIB A;  2I3W A;  1VE4 A;  1FQF A;  4H0W A;  1USY E;  3HHG A;  2XXY A;  5DVF A;  1P1N A;  3CG3 A;  4JSO A;  1IZ1 A;  4EXK A;  1Y20 A;  4N6P A;  4TQU Q;  1LST A;  3K2D A;  2PT2 A;  3EF7 A;  4GVO A;  5L9M A;  1B5H A;  1QVS A;  1ZMG A;  3LSF B;  2DWH A;  2OWT A;  1B4H A;  3E9X A;  3SKP A;  3FUZ A;  4NF5 A;  2QMX A;  4NF8 B;  2H9B A;  4QFP A;  4OET A;  1XHY A;  2NOO A;  3U72 A;  3T66 A;  3V89 B;  5B7D A;  3FJG A;  4GWO A;  3SDF A;  3MBP A;  2F7C A;  4KFQ A;  5EYF A;  4EUO A;  3O2A A;  1OVB A;  1A55 A;  1D3K A;  4DXB A;  5JTY B;  4YMB A;  3RQT A;  1POY 1;  5CMC A;  3IB1 A;  4F19 A;  1ATG A;  3IOW A;  5I2N A;  3S9M C;  2FA7 A;  3TFL A;  3TEL A;  4ZZE A;  4OFL A;  1EZO A;  3C36 A;  1AL3 A;  3FV1 A;  3Q25 A;  5EHM A;  4JDF A;  3TAJ A;  3G3K A;  4XXU A;  1SD3 A;  3DM0 A;  4JWX A;  1UTB A;  1M5F A;  4PFY A;  4JXI A;  2I3V A;  1NH8 A;  1NNT A;  2O7I A;  1M5D A;  3RLF E;  4FAT A;  4AQ4 A;  4XKP A;  1LAX A;  3OO7 A;  1L5T A;  4H1X A;  1PB8 A;  1JEV A;  2GRV A;  3HV1 A;  5TP9 B;  2UVJ A;  3TUS A;  1B52 A;  2A5T B;  3H06 B;  3M3K A;  3V8X B;  3IB0 A;  1YCJ A;  3VLW A;  2ZYN A;  4YKI A;  3V5A A;  3IOV A;  4U21 A;  5L8D A;  3VFJ A;  1B32 A;  4QRZ A;  5I2K B;  4QFN A;  3I5O A;  4C1T A;  1P1Q A;  3MP1 A;  2DE4 A;  4THI A;  2RCA A;  1S9T A;  2ABH A;  3FIR A;  5DTB A;  4M1V A;  3SES A;  4M4G A;  1F9B A;  4MH5 A;  1II5 A;  3C35 A;  2G29 A;  4ZS9 A;  3OEN A;  1M5E A;  2Q2A A;  4RK2 A;  3B6Q A;  4KYD A;  2AYS A;  3A3C A;  4ZDM A;  3WAF A;  4IO7 A;  5I56 B;  2GHB A;  4MBP A;  1NMU A;  3K02 A;  3KN7 A;  3C34 A;  4EXL A;  1QUL A;  1HSE A;  4X9T A;  2DS9 A;  3BFU A;  5FTI A;  1DTZ A;  2O69 A;  4EF1 A;  3PGF A;  4F1V A;  5FHO A;  3A3U A;  5F1Q A;  2F34 A;  3CIJ A;  4JSD A;  3W9V A;  4PFT A;  1BLF A;  1Y4T A;  2FYI A;  3SET A;  3PUW E;  1QUJ A;  4X1D A;  4G68 B;  2Q9T A;  4YU0 A;  3S9L C;  3UIF A;  2F5X A;  5JK4 A;  1FQD A;  1N3W A;  4AB6 A;  2O84 X;  3H6V A;  1WDN A;  4ESW A;  1TXF A;  3N94 A;  5H8N A;  1T0K A;  1MY2 A;  4PFW A;  2P0S A;  2FNC A;  2REG A;  3S2V A;  4QSD A;  3TCF A;  5DT6 A;  3E4R A;  5CI5 A;  3MW0 A;  2PYY A;  3H6T A;  2XX8 A;  3K6V A;  4G77 A;  4F3G A;  4HW8 A;  4EDP A;  2YLN A;  1B7U A;  2H5Y A;  2HCA A;  4NMY A;  3KJ7 A;  4UAC A;  5DEX A;  3IX1 A;  2Y84 A;  4BDR A;  1B7Z A;  3IR1 A;  1Y3N A;  1S50 A;  4LVQ A;  4IO5 A;  4N13 A;  2O68 A;  5I57 A;  1N04 A;  4F2O A;  4TOZ A;  2XXU A;  4NED A;  3C33 A;  5I58 B;  3D4G A;  2PT1 A;  3CFL A;  3F11 A;  3R7X A;  3QUJ A;  3RNN A;  1IXH A;  3HN0 A;  2ZMB A;  5ICT A;  3T9U A;  3IK6 B;  5H8H B;  5AA2 D;  1AMF A;  5I59 B;  1US5 A;  3U92 A;  1DOT A;  3ILU B;  1FTM A;  2DE3 A;  2M8C A;  1NNF A;  4PE5 B;  3PPP A;  4BDL A;  1TT1 A;  3T22 A;  3WAE A;  1H3D A;  4FJP A;  1LBB A;  3D4C A;  4GIZ A;  2IA4 A;  2THI A;  3B6T A;  1MPB A;  4F22 A;  4POW A;  1B5I A;  4H8I A;  4GD5 A;  3GBA A;  4BDQ A;  1PEB A;  3KSX A;  1Z7N E;  4NF8 A;  4ZE8 A;  3KN8 A;  1DSN A;  3KZG A;  4PFU A;  1SW4 A;  4NF4 B;  4P11 A;  4FED A;  3M3F A;  3MC2 A;  1ZKB A;  2QS2 A;  2I6E A;  3ILT B;  1POT A;  4I62 A;  4LP2 B;  2RC7 A;  3TQL A;  1ZTY A;  3RUM A;  3TTK A;  3O9P A;  5L9S A;  1D4N A;  1QUI A;  4ESX A;  2ONK E;  4GOT A;  3L6H A;  4ECF A;  3QXM A;  5F7V A;  5JTY A;  4K3F A;  4IGR A;  5CMM A;  5H8Q A;  4QSC A;  3PPQ A;  4MF3 A;  2RKM A;  2F36 A;  2VGQ A;  1OLC A;  4Q5T A;  5KDT B;  1IXI A;  3N26 A;  3TEP A;  3GBB A;  2V3Q A;  1MXW A;  3KOS A;  3PUY E;  4MLQ A;  1J1N A;  2VHA A;  4F1U A;  2V93 A;  1MXV A;  1CE2 A;  3MVX A;  2Q88 A;  4JWY A;  3RTW B;  1XS5 A;  4IO4 A;  1MDP 1;  3ZS6 A;  4IO2 A;  2DOJ A;  2X7Q A;  5AE4 A;  2H99 A;  1A8F A;  3DP4 A;  1Z7M E;  2DWA A;  1FQC A;  4KD5 A;  4KCC A;  1RYX A;  1Y9U A;  4NTL A;  2X7P A;  2D3I A;  3FXR A;  2VOZ A;  1FCK A;  3GZG A;  1MXX A;  1SYI A;  3KFM A;  4U1Z A;  1H43 A;  5IAI A;  1NKX A;  3PD9 A;  5I2K A;  2F78 A;  2E0S A;  4H6D A;  4C1U A;  2F6P A;  1SDX A;  4NF6 B;  3TQW A;  5KCJ B;  4NWD A;  3LUY A;  4G8M A;  1HSJ A;  4GRK A;  1LFH A;  1SW5 A;  1TFA A;  2NXO A;  4ZEK A;  4QFO A;  3G3G A;  1XVX A;  1Y4C A;  4Q30 B;  4WEP A;  2R9J A;  5CBR A;  3FVO A;  2XX7 A;  3EPE A;  4ZEB A;  1HSL A;  1SW1 A;  4RYA A;  4F2Q A;  2XXT A;  3VLU A;  4ZEC A;  3JZJ A;  5I56 A;  5HM4 B;  2O51 A;  1OMP A;  4ZEI A;  2O7U A;  4X48 A;  4LQ2 A;  3PPR A;  3MPK A;  5EHS A;  5AA4 A;  4IO3 A;  3TMG A;  2RCB A;  3BFT A;  1NNP A;  5DVJ A;  1VR5 A;  4TLM B;  3PUZ E;  1JVY A;  3FGS A;  2ZYK A;  3MWB A;  2X26 A;  2LAO A;  3FAT A;  3IJO B;  5TPA A;  2NUV A;  5L9O A;  4G4P A;  4G68 A;  3KG2 A;  4RPN A;  1MXZ A;  5CMB A;  2O1L A;  3W9W A;  5ITP A;  2UVI A;  2E1S A;  3K01 A;  3TDJ A;  5K2Y A;  2DVC A;  3O28 A;  1H76 A;  4QSE A;  2XHD A;  3CVG A;  1PC3 A;  3TKD A;  1BP5 A;  2I4B A;  4FAJ A;  2RC9 A;  3KN3 A;  1H45 A;  3FVN A;  3TYH A;  2GHA A;  5ELV A;  3K6W A;  1PB7 A;  1XT8 A;  3MZ1 A;  1JW4 A;  3K6U A;  2R71 A;  4XKQ A;  2PVU A;  3FJ7 A;  3QSL A;  1D9V A;  3T9H B;  3MVW A;  4OEU A;  1LAH E;  4YIC A;  2VD3 A;  4RA1 A;  1IXG A;  1N0T A;  3RT6 B;  1GGG A;  3R26 A;  3LR1 A;  3LC8 A;  4OEV A;  5I58 A;  3IL1 B;  2UYE A;  1D9Y A;  2G93 A;  1A8E A;  3R6U A;  2Y7R A;  4IGT A;  4GXA A;  3ZKK A;  3Q29 A;  5A5X B;  1P1O A;  1A99 A;  3FD3 A;  4EQ9 A;  5HPQ A;  3PPN A;  2AL5 A;  5H8H A;  5ITO A;  1B46 A;  1R9Q A;  5I59 A;  2A5S A;  1USY H;  4IB2 A;  1P1U A;  3FVK A;  1PDA A;  3U8Q A;  1YTV A;  2O1M A;  2DP8 A;  1UTH B;  4FEC A;  4Z7E A;  1IEJ A;  4DLD A;  1FW0 A;  4OFJ A;  4P0G A;  4F3B A;  5AA3 A;  3U94 A;  3O29 A;  1B40 A;  1NNK A;  4H8J A;  1B0H A;  1XOC A;  4NWC A;  3VXB A;  2DXR A;  3IB2 A;  4FIM A;  4ZE9 A;  1S7Y A;  1SI1 A;  2Y7I A;  2QL3 A;  4BDO A;  3N6U A;  1BIY A;  3PMX A;  2OBG A;  2V25 A;  2XX9 A;  3OO8 A;  4RJZ A;  1FTK A;  2OK2 A;  1TFD A;  4HCW A;  4ONY A;  4KPT A;  1I6Q A;  1RKM A;  3QK6 A;  2HZK A;  3ONM A;  1I69 A;  1LCT A;  2Q89 A;  2QMW A;  1NH7 A;  5KDT A;  3VVD A;  3K00 A;  4OQO A;  4EQB A;  3HST A;  1JNF A;  2ZXT A;  4TLL B;  1MG1 A;  4I9D A;  1R1N A;  1VFE A;  2D21 A;  4FEB A;  3E13 X;  1N76 A;  4ELO A;  4G68 C;  2DXY A;  1LFG A;  5I2N B;  3SEY A;  3UN6 A;  4GFR A;  2IEE A;  2D5W A;  4G8N A;  2AL4 A;  2Z22 A;  4U22 A;  1N84 A;  4WED A;  2CMO A;  2UVG A;  1VFD A;  3H4Z A;  2WKY A;  4ZZA A;  1QJM A;  1UTB B;  2F35 A;  1N7W A;  4LAT A;  3T96 B;  3IAZ A;  2F6G A;  1UIU A;  3FAS A;  4C0R A;  3TOD A;  5AA2 B;  2H4I A;  4IO6 A;  3T9V A;  3MP8 A;  3G3I A;  3KEI A;  2ZNU A;  1MQJ A;  3AXF A;  3U1O A;  3ZSF A;  3A09 A;  3DEL B;  1WVJ A;  1YPN A;  4E0W A;  4NF6 A;  4L17 A;  4POX A;  1O7T A;  3CRB A;  2QJE A;  4MLV A;  2QS1 A;  3OO9 A;  1ZLQ A;  4YAH X;  1QW0 A;  4YMA A;  1Q1K A;  4RPO A;  3LSL A;  4JWO A;  1JEU A;  2KLF A;  2CZL A;  2XXI A;  2I49 A;  4F31 B;  3RGY A;  4XTC Q;  1FTO A;  3M3L A;  4R6H A;  4R6K A;  4DXU A;  2B3B A;  4R75 A;  1JW1 A;  5LOM A;  4LQ5 A;  2ZNS A;  3OOA A;  3TTR A;  5ISU A;  5I84 A;  4H67 A;  2Y7K A;  2V84 A;  2ONR A;  1B3F A;  1PBQ A;  3EHT A;  1B51 A;  3MVZ A;  3OMB A;  3H6W A;  4R2B A;  2HFB A;  3U93 A;  4Z0I A;  2ZYO A;  3K4U A;  3HO7 A;  3QIM A;  1PBP A;  1B3L A;  1ANF A;  5FTH A;  4KQP A;  4YKK A;  1WOD A;  4DCY A;  1P1W A;  3N6T A;  4YB6 A;  4AB5 A;  4G2Z A;  1LGB C;  2OZZ A;  1LAF E;  3O97 A;  3G3J A;  1MXU A;  4LZ8 A;  4KYE A;  3TPA A;  2Z8D A;  2Q2C A;  3MVY A;  4E0X A;  5H8S A;  3K0V A;  2XD2 A;  3T9X B;  3L6G A;  5ICQ A;  4GL8 A;  3OD7 A;  2XXH A;  4F3P A;  5H8N B;  3TZA A;  1DTG A;  2DWI A;  3VDF A;  2XXW A;  2PX1 A;  3SEV A;  1LB8 A;  4ISU A;  1ZIU A;  2XXR A;  4I8C A;  3JV9 A;  1EZ9 A;  2R6G E;  2ZYM A;  5TP9 A;  1UIV A;  3OSR A;  1B58 A;  4LUB A;  4JB7 A;  1BKA A;  2A5T A;  1N7X A;  4FOR A;  4DDD A;  1UQW A;  5IKB A;  1ELJ A;  1O64 A;  4F39 A;  4YKJ A;  4U4S A;  2DVZ A;  3CI8 A;  3TTM A;  5CM6 A;  5A5X A;  3MZ9 A;  2OJT A;  5FHN A;  1QKA A;  3KOT A;  4R2F A;  5CC2 A;  1A40 A;  4KCD A;  1ZU0 A;  1URD A;  1SI0 A;  4F18 A;  2QS4 A;  4NE4 A;  4OWD A;  3CG1 A;  2B3F A;  3Q27 A;  4RXL A;  4U4X A;  5I57 B;  1DMB A;  3GXA A;  3K1P A;  2OWS A;  1MY3 A;  4MFI A;  4XKR A;  2YPN A;  1B5J A;  1GVC A;  3MZB A;  3EHS A;  1MH4 A;  3USD A;  4OHN A;  2AIX A;  2DE2 A;  3ECR A;  1MQD A;  1Y1Z A;  3RT8 A;  1EH3 A;  3MJN A;  3OEK A;  4BDM A;  5CMK A;  2YJP A;  1IQ7 A;  2XXQ A;  3CSG A;  4BLA A;  4R72 A;  4U23 A;  1VSO A;  3IJX B;  3G3F A;  3PMW A;  3MP6 A;  4R6Y A;  3SEU A;  1B9J A;  1URS A;  5BWJ A;  2ZNT A;  3I3V A;  2ANJ A;  4ELQ A;  3H03 A;  2PBW A;  1PB9 A;  4LZ5 A;  4DZ1 A;  2Q8J A;  5J1D A;  1FTL A;  3IOT A;  3PUX E;  3OEL A;  3IO4 A;  4F1Y A;  2HXW A;  1LAG E;  5DVI A;  4GF8 A;  1ZBM A;  3UGW A;  4DXC A;  4KI0 E;  3EQ1 A;  4OXV A;  5K2X A;  5H8F B;  2QPQ A;  1FQB A;  3LBS A;  5H8Q B;  1B7H A;  2F7B A;  4GL0 A;  3IO6 A;  4JBZ A;  1TWY A;  4LON B;  1MS7 A;  4OZ9 A;  5JEI A;  1AOV A;  3QYT A;  3FJM A;  2DSF A;  1B6H A;  4RY1 A;  4PET A;  3OO6 A;  2Z8F A;  1NL5 A;  3KSJ A;  3PU5 A;  3BKI B;  5AA2 A;  1IXC A;  3HHF A;  1M5B A;  3MAM A;  3OEM A;  1A7L A;  2V3U A;  1MH3 A;  3UOR A;  4KHZ E;  2RF1 A;  1MY1 A;  1Y1M A;  3TCH A;  1MM7 A;  1SYH A;  2XXX A;  2H25 A;  3H3G A;  4DIG A;  3K6X A;  4H5G A;  4IY6 A;  1R6Z A;  4HCY A;  3DP6 A;  1R9L A;  3EHU A;  4U2R A;  2HZL A;  1JW5 A;  2I58 A;  4QF9 A;  2Y7P A;  2Z8E A;  4KR5 A;  1LFI A;  3G3H A;  1MM6 A;  1M5C A;  1IUD A;  4ZEF A;  4QFK A;  1LCF A;  4OEN A;  1FQA A;  3CSB A;  3FVG A;  4YZZ A;  3UA8 A;  4OER A;  1JQF A;  4NF4 A;  3S4U A;  3VXC A;  2I0C A;  2I48 A;  4OFO A;  3OSQ A;  5BUU A;  4R74 A;  1ZJL A;  1OVT A;  1B3H A;  1Q35 A;  1N3X A;  5DYH A;  4U1O A;  1SVX B;  1LLS A;  4EF2 A;  2HAV A;  1I6A A;  4WXJ A;  3E3K A;  4NF5 B;  1O63 A;  3UP9 A;  4ELP A;  2QS3 A;  3HCQ A;  1US4 A;  3PPO A;  4ND9 A;  2GFE A;  2RIN A;  5AA4 B;  1RYO A;  1SBP A;  3BBR A;  3W15 C;  3OXN A;  3B7D A;  3C32 A;  4LZ7 A;  3TTN A;  5TPA B;  3JYR A;  3QAX A;  1OQG A;  4G8H A;  4O3B A;  3FV2 A;  2QSX A;  3M8U A;  4PQJ A;  1FTJ A;  1B3E A;  4GQO A;  1I6B A;  1XVY A;  4YKP A;  2DWJ A;  2OLB A;  4QHQ A;  1MXY A;  4OMB A;  1SQY A;  2ALU A;  3SEX A;  4KYS A;  1B2H A;  1DPP A;  3THI A;  4OVJ A;  2F7A A;  2V3T A;  2Y7W A;  1FQE A;  2OCU A;  3G7W A;  3KJT A;  1BTJ A;  4HTG A;  3DP8 A;  4R9F A;  1P99 A;  1MY4 A;  4YB5 A;  4X1B A;  2RC8 A;  4BDN A;  3RPW A;  5TU0 A;  3H7M A;  3PD8 A;  4RK9 A;  4UA8 A;  5AA1 A;  4RNS A;  1EU8 A;  3H6U A;  1MQI A;  5CBS A;  4HS7 A;  2REJ A;  4EQ7 A;  3B6W A;  1MQG A;  1AH5 A;  4IY5 A;  2HQ0 A;  3RY3 A;  1DPE A;  1JVX A;  3N5L A;  3O6I A;  3ZKL A;  2ESN A;  3O6H A;  3SEW A;  3VLV A;  5KCJ A;  3QUF A;  3S9N C;  2XD3 A;  2PMS A;  3T93 B;  1B0L A;  3FXU A;  3MPL A;  2DYX A;  5HBC A;  1XC1 A;  3RTF B;  4F29 A;  4H5F A;  2I0B A;  2UVH A;  4QFL A;  4OES A;  3C4M A;  2F8D A;  1QUK A;  5B70 A;  2F97 A;  2UYF A;  1LB9 A;  1H44 A;  1URG A;  2I4C A;  3C9H A;  1Y3Q A;  1AIV A;  2B65 A;  3O6G A;  3ODB A;  1IIW A;  3VVF A;  3K1N A;  4H65 A;  4YB7 A;  3I6V A;  3CR9 A;  1B4Z A; 
#chains in the Genus database with same CATH topology
 4F3S A;  2Y5K A;  1Y3P A;  1MPD A;  4MNP A;  3TCG A;  2OWZ A;  3Q28 A;  2NWJ A;  4PP0 A;  2ONS A;  3VV5 A;  3EN3 A;  4R9G A;  2H98 A;  4GWY A;  3PV0 E;  4O3C A;  3U65 A;  3VE1 B;  5CRY A;  4PDH A;  3KGC A;  1NFT A;  2NVU B;  2QRY A;  3IOU A;  2MKZ A;  1MDQ A;  3LSX A;  2KQZ A;  2W7Y A;  1KWH A;  3VVE A;  5FHM A;  4WKM A;  1MPC A;  5M2V A;  5H8F A;  4GLI A;  1OQH A;  2Z23 A;  5IGA A;  1MQH A;  3RN8 A;  4N07 A;  2HXR A;  3P7I A;  4DCX A;  3K1M A;  4I1D A;  1A54 A;  3IOR A;  1MY0 A;  2UXA A;  2P1S A;  4I3E A;  4XKN A;  4JVC A;  4OVS A;  4GXS B;  2DQV A;  2VPN A;  3FZV A;  4OYV A;  3C31 A;  2VP1 A;  3MUQ A;  4FE8 A;  4R73 A;  3CFZ A;  4LA9 A;  4N8Y A;  4O3A A;  4Q8R A;  1MRP A;  1Q9D A;  1OLA A;  1B1X A;  4MJO A;  4ZED A;  4QBA A;  1CB6 A;  5KZT A;  2XXV A;  3PMV A;  5EYH A;  2GH9 A;  3FXQ A;  4P0I A;  4Q0C A;  1QKB A;  1LBC A;  3RYD A;  4XIG Q;  2XXP A;  2VD2 A;  1B1H A;  1B05 A;  4ELR A;  4OTE A;  1GR2 A;  2HAU A;  4DE8 A;  3MYU A;  1GTK A;  1GV8 A;  3V83 A;  2O6A A;  3LSW A;  5DEX B;  1YAE A;  3KBR A;  2HEU A;  1EYK A;  1SW2 A;  3DLN A;  3HPI A;  1EZP A;  3PUV E;  3TTL A;  2BJJ X;  3S9E A;  1IIT A;  3Q26 A;  3MQ9 A;  3O66 A;  3CFX A;  3SER A;  1UTH A;  3UK4 A;  1B3G A;  1FRP A;  1JET A;  3GLB A;  2P2A A;  1OIB A;  2I3W A;  1VE4 A;  1FQF A;  4GX4 A;  4H0W A;  1USY E;  3HHG A;  2XXY A;  5DVF A;  1P1N A;  3CG3 A;  4JSO A;  1IZ1 A;  4EXK A;  1Y20 A;  4N6P A;  5LTC A;  4TQU Q;  1LST A;  3K2D A;  2HHM A;  2PT2 A;  3EF7 A;  1QGX A;  4GVO A;  5L9M A;  1B5H A;  1QVS A;  2ZZW A;  1ZMG A;  3LSF B;  2DWH A;  2OWT A;  4HE1 A;  1B4H A;  3E9X A;  3SKP A;  3FUZ A;  4O7M A;  4NF5 A;  2QMX A;  3KC0 A;  4NF8 B;  2H9B A;  4QFP A;  2F3D A;  4OET A;  1XHY A;  1VDW A;  2NOO A;  3U72 A;  3T66 A;  3V89 B;  5B7D A;  3FJG A;  4GWO A;  4GWX A;  3SDF A;  1FPK A;  1NV7 A;  3MBP A;  2F7C A;  4KFQ A;  5EYF A;  4EUO A;  4IR8 A;  3O2A A;  3IFC A;  1OVB A;  1A55 A;  1D3K A;  1JP4 A;  4DXB A;  5JTY B;  4X04 A;  3RQT A;  4YMB A;  1POY 1;  5CMC A;  3IB1 A;  3T1B A;  4F19 A;  1ATG A;  3IOW A;  4PFB A;  5I2N A;  3S9M C;  4NHB A;  3ROJ A;  2FA7 A;  1DCU A;  3TFL A;  1LBV A;  3TEL A;  4ZZE A;  4NQ8 A;  4OFL A;  1EZO A;  3C36 A;  5A5L A;  5EQ8 A;  1AL3 A;  3FV1 A;  3Q25 A;  5EHM A;  4JDF A;  2B4L A;  3TAJ A;  3G3K A;  5ET7 A;  4XXU A;  2VT5 A;  1FPF A;  1SD3 A;  3DM0 A;  4JWX A;  1UTB A;  4X8R A;  1M5F A;  4PFY A;  4JXI A;  2I3V A;  1FPI A;  1NH8 A;  1NNT A;  2O7I A;  1M5D A;  3RLF E;  4FAT A;  4AQ4 A;  4XKP A;  1LAX A;  3OO7 A;  1L5T A;  4H1X A;  1PB8 A;  1JEV A;  2GRV A;  3HV1 A;  5TP9 B;  2UVJ A;  1FBP A;  2XWO A;  3TUS A;  1B52 A;  2A5T B;  3H06 B;  3M3K A;  1D9Q A;  3V8X B;  3IB0 A;  1YCJ A;  3VLW A;  2ZYN A;  4YKI A;  3V5A A;  3IOV A;  4U21 A;  5ET5 A;  5L8D A;  3VFJ A;  1B32 A;  4QRZ A;  5I2K B;  4QFN A;  3I5O A;  4C1T A;  1P1Q A;  3MP1 A;  2DE4 A;  4THI A;  2RCA A;  1S9T A;  2ABH A;  3FIR A;  3E78 A;  5DTB A;  4M1V A;  2DDK A;  3SES A;  4M4G A;  1F9B A;  1FBC A;  4MH5 A;  1II5 A;  3C35 A;  2G29 A;  4ZS9 A;  2FIX A;  3OEN A;  1FBH A;  1M5E A;  1IMC A;  2Q2A A;  4RK2 A;  3B6Q A;  4KYD A;  2AYS A;  3A3C A;  4ZDM A;  3WAF A;  4IO7 A;  5I56 B;  2GHB A;  4MBP A;  1NMU A;  3K02 A;  3KN7 A;  3PTY A;  5LDZ A;  3C34 A;  4EXL A;  1QUL A;  1HSE A;  4X9T A;  5IM2 A;  2DS9 A;  4N6D A;  4PGN A;  3BFU A;  5FTI A;  1DTZ A;  2O69 A;  4EF1 A;  1DBZ A;  3PGF A;  4F1V A;  1KA0 A;  5FHO A;  3A3U A;  5F1Q A;  2F34 A;  3CIJ A;  4JSD A;  3W9V A;  4PFT A;  4JVI A;  4GX3 A;  1BLF A;  1Y4T A;  2FYI A;  3SET A;  3PUW E;  1QUJ A;  4X1D A;  4PGP A;  4G68 B;  2Q9T A;  4YU0 A;  3S9L C;  3UIF A;  2F5X A;  5JK4 A;  1FQD A;  1N3W A;  4AB6 A;  2O84 X;  3H6V A;  1WDN A;  4ESW A;  1TXF A;  3N94 A;  5H8N A;  1T0K A;  1MY2 A;  4PFW A;  2P0S A;  2FHY A;  1XI6 A;  2FNC A;  2REG A;  3S2V A;  4QSD A;  3TCF A;  5T3J A;  5DT6 A;  4MMP A;  3E4R A;  4I3Y A;  4KXP A;  5CI5 A;  3MW0 A;  4NX1 A;  2PYY A;  3H6T A;  1INP A;  2XX8 A;  3K6V A;  4G77 A;  4F3G A;  4HW8 A;  4EDP A;  2YLN A;  1B7U A;  2H5Y A;  5EQA A;  2HCA A;  4NMY A;  3KJ7 A;  4UAC A;  2CZK A;  5DEX A;  3IX1 A;  2Y84 A;  4BDR A;  1B7Z A;  3IR1 A;  1Y3N A;  1S50 A;  4N17 A;  1NV0 A;  4LVQ A;  4IO5 A;  4N13 A;  2WYP A;  2O68 A;  1NV5 A;  5I57 A;  1N04 A;  4F2O A;  4TOZ A;  2XXU A;  4NED A;  3C33 A;  5I58 B;  3BIG A;  3D4G A;  2PT1 A;  3CFL A;  3F11 A;  2QVV A;  3R7X A;  3QUJ A;  3RNN A;  1IXH A;  3HN0 A;  2ZMB A;  5ICT A;  3T9U A;  2P3N A;  3IK6 B;  5H8H B;  5AA2 D;  1AMF A;  5I59 B;  1US5 A;  1AWB A;  4PF6 A;  3U92 A;  2R8T A;  1DOT A;  3ILU B;  2PCR A;  1FTM A;  5IZ3 A;  2DE3 A;  2M8C A;  1NNF A;  4PE5 B;  3PPP A;  2XWI A;  4BDL A;  1TT1 A;  3T22 A;  3WAE A;  1H3D A;  4FJP A;  1LBB A;  3D4C A;  3QMF A;  4GIZ A;  2IA4 A;  2THI A;  4OVQ A;  3B6T A;  1MPB A;  4F22 A;  5FBP A;  4POW A;  1RDY A;  1B5I A;  4H8I A;  4GD5 A;  3GBA A;  4BDQ A;  1PEB A;  3KSX A;  1Z7N E;  4NF8 A;  4ZE8 A;  3KN8 A;  1DSN A;  3KZG A;  4PFU A;  1SW4 A;  4NF4 B;  4P11 A;  3CHG A;  4FED A;  2CZI A;  3M3F A;  3MC2 A;  1ZKB A;  2QS2 A;  2I6E A;  3ILT B;  1POT A;  4I62 A;  4LP2 B;  2RC7 A;  3TQL A;  1ZTY A;  3RPL B;  1LEV A;  3RUM A;  3TTK A;  3O9P A;  1CNQ A;  5L9S A;  1D4N A;  1QUI A;  4ESX A;  2ONK E;  4GOT A;  3L6H A;  4ECF A;  3QXM A;  5F7V A;  5JTY A;  4K3F A;  4IGR A;  5CMM A;  5H8Q A;  4QSC A;  3PPQ A;  4MF3 A;  2RKM A;  2F36 A;  2VGQ A;  1OLC A;  4Q5T A;  5KDT B;  1IXI A;  2XWK A;  3N26 A;  3TEP A;  3GBB A;  4MCO A;  2V3Q A;  4PAK A;  1MXW A;  3KOS A;  3PUY E;  4MLQ A;  4FBP A;  1J1N A;  2BJI A;  2VHA A;  4F1U A;  4MHF A;  2V93 A;  1MXV A;  1CE2 A;  1FBF A;  3MVX A;  2Q88 A;  4JWY A;  3RTW B;  1XS5 A;  4IO4 A;  1MDP 1;  3ZS6 A;  4IO2 A;  2DOJ A;  2X7Q A;  5AE4 A;  2H99 A;  1A8F A;  3DP4 A;  1Z7M E;  2DWA A;  1FQC A;  4KD5 A;  4KCC A;  1RYX A;  1Y9U A;  4NTL A;  2X7P A;  3T0J A;  2D3I A;  3FXR A;  2VOZ A;  1FCK A;  3GZG A;  1MXX A;  1SYI A;  1FPL A;  3KFM A;  5F24 A;  4U1Z A;  1H43 A;  5IAI A;  1NKX A;  3PD9 A;  5I2K A;  2F78 A;  2E0S A;  4H6D A;  4C1U A;  2F6P A;  1SDX A;  4NF6 B;  3TQW A;  5KCJ B;  4NWD A;  3LUY A;  4G8M A;  1HSJ A;  4GRK A;  4NGU A;  5ET8 A;  1LFH A;  1NV1 A;  1SW5 A;  1TFA A;  2NXO A;  4ZEK A;  1FPD A;  4QFO A;  3G3G A;  1XVX A;  1Y4C A;  3ISP A;  2QVR A;  4Q30 B;  4WEP A;  2R9J A;  5CBR A;  3FVO A;  2XX7 A;  3EPE A;  4ZEB A;  1HSL A;  1SW1 A;  4RYA A;  1FPG A;  5EQ9 A;  4F2Q A;  1NV2 A;  2XXT A;  3VLU A;  4ZEC A;  3JZJ A;  4UAB A;  5I56 A;  3LV0 A;  5HM4 B;  2O51 A;  2OX3 A;  1OMP A;  4ZEI A;  4GX6 A;  2O7U A;  4N15 A;  4X48 A;  4LQ2 A;  2CZH A;  5I3S A;  4GWW A;  3PPR A;  3MPK A;  5EHS A;  5AA4 A;  4IO3 A;  3TMG A;  2RCB A;  3BFT A;  1NNP A;  5DVJ A;  1VR5 A;  4TLM B;  1IME A;  3PUZ E;  1JVY A;  3FGS A;  2ZYK A;  3MWB A;  2X26 A;  2LAO A;  3FAT A;  3IJO B;  1NV3 A;  5TPA A;  2NUV A;  5L9O A;  4G4P A;  1RDZ A;  4G68 A;  3KG2 A;  4OA4 A;  4RPN A;  2CEY A;  1MXZ A;  5CMB A;  2O1L A;  3KBZ A;  3W9W A;  5ITP A;  2UVI A;  2E1S A;  3K01 A;  3TDJ A;  4GBW A;  5K2Y A;  2DVC A;  3O28 A;  1H76 A;  4QSE A;  2XHD A;  3CVG A;  1PC3 A;  3TKD A;  1BP5 A;  2I4B A;  4FAJ A;  2RC9 A;  3KN3 A;  1FSA A;  1H45 A;  3FVN A;  4PAF A;  3TYH A;  4DI4 B;  1SPI A;  2GHA A;  5ELV A;  3K6W A;  1PB7 A;  1XT8 A;  3MZ1 A;  4P56 A;  1JW4 A;  3K6U A;  2R71 A;  4GWU A;  4XKQ A;  2PVU A;  3FJ7 A;  4HE2 A;  3QSL A;  1D9V A;  3T9H B;  3MVW A;  4OEU A;  1LAH E;  4YIC A;  2VD3 A;  1LBW A;  4RA1 A;  1IXG A;  1N0T A;  3RT6 B;  1GGG A;  3R26 A;  4PTK A;  4OVP A;  3LR1 A;  3LC8 A;  3MST A;  4OEV A;  5I58 A;  3IL1 B;  2UYE A;  1D9Y A;  1KA1 A;  2G93 A;  1A8E A;  3R6U A;  2Y7R A;  4IGT A;  4GXA A;  3ZKK A;  3Q29 A;  5A5X B;  1P1O A;  4NAP A;  1A99 A;  3FD3 A;  4EQ9 A;  4PE3 A;  5HPQ A;  3PPN A;  2AL5 A;  5H8H A;  5ITO A;  1B46 A;  1R9Q A;  5I59 A;  2A5S A;  1USY H;  4XEQ A;  4IB2 A;  1P1U A;  3FVK A;  1PDA A;  3U8Q A;  1YTV A;  2O1M A;  2DP8 A;  1UTH B;  4N81 A;  4FEC A;  4Z7E A;  1IEJ A;  4DLD A;  5EYG A;  1FW0 A;  4OFJ A;  4P0G A;  2PFZ A;  5DW8 A;  4F3B A;  5AA3 A;  3U94 A;  3O29 A;  1NI9 A;  1B40 A;  1NNK A;  4H8J A;  1B0H A;  4PAI A;  1XOC A;  1FPE A;  4NWC A;  3VXB A;  2DXR A;  3IB2 A;  4FIM A;  4QXD A;  2FBP A;  4ZE9 A;  3HFU A;  1S7Y A;  1SI1 A;  2Y7I A;  2QL3 A;  4BDO A;  4NF0 A;  3N6U A;  1BIY A;  3PMX A;  2OBG A;  2V25 A;  2XX9 A;  3OO8 A;  2B4M A;  4RJZ A;  1FTK A;  2OK2 A;  1TFD A;  4HCW A;  4ONY A;  4G61 A;  4KPT A;  1FJ6 A;  1I6Q A;  4P1L A;  4MIJ A;  1RKM A;  1BK4 A;  3QK6 A;  2HZK A;  3ONM A;  1I69 A;  1LBX A;  1LCT A;  2Q89 A;  2QMW A;  1NH7 A;  5KDT A;  1FJ9 A;  3VVD A;  3K00 A;  4OQO A;  2WX9 A;  4EQB A;  3HST A;  1JNF A;  2ZXT A;  4OAN A;  1YZ0 A;  4TLL B;  1MG1 A;  4I9D A;  1NUX A;  1R1N A;  1VFE A;  2D21 A;  4FEB A;  4I40 A;  3E13 X;  1N76 A;  4ELO A;  4G68 C;  2DXY A;  3B50 A;  4O8M A;  1LFG A;  2CEX A;  5I2N B;  3KC1 A;  1G0I A;  3SEY A;  3UN6 A;  2VPO A;  2XA5 A;  4GFR A;  2IEE A;  2D5W A;  4G8N A;  2AL4 A;  2Z22 A;  5I5P A;  4U22 A;  1N84 A;  4WED A;  2CMO A;  2KR0 A;  2UVG A;  1VFD A;  3H4Z A;  2WKY A;  4AS4 A;  4ZZA A;  1QJM A;  1UTB B;  2F35 A;  1N7W A;  4LAT A;  3T96 B;  3IAZ A;  2F6G A;  1UIU A;  3FAS A;  4C0R A;  2FIE A;  3TOD A;  5AA2 B;  2H4I A;  4HE0 A;  1DK4 A;  4IO6 A;  3T9V A;  3MP8 A;  3G3I A;  3KEI A;  4LN5 A;  2ZNU A;  1MQJ A;  4P3L A;  3AXF A;  3U1O A;  3ZSF A;  3A09 A;  3DEL B;  1WVJ A;  1YPN A;  4E0W A;  2JJK A;  5EQ7 A;  4NG7 A;  4NF6 A;  4L17 A;  4POX A;  1O7T A;  3CRB A;  2QJE A;  4MLV A;  2QS1 A;  3OO9 A;  1ZLQ A;  4H45 A;  1RDX A;  4YAH X;  1QW0 A;  4YMA A;  1Q1K A;  4RPO A;  3LSL A;  4JWO A;  1JEU A;  4O7I A;  4AS5 A;  2L5V A;  2KLF A;  2CZL A;  2XXI A;  4N4U A;  2I49 A;  4XF5 A;  4F31 B;  3RGY A;  4XTC Q;  1FTO A;  3M3L A;  4R6H A;  4N91 A;  4PBH A;  4R6K A;  4DXU A;  2B3B A;  4R75 A;  4MNC A;  1K9Z A;  1JW1 A;  5LOM A;  4H46 A;  4LQ5 A;  1FBD A;  2ZNS A;  3OOA A;  4PF8 A;  3TTR A;  5ISU A;  5I84 A;  3SZP A;  4H67 A;  2Y7K A;  2V84 A;  2WBD A;  2ONR A;  1B3F A;  1PBQ A;  3EHT A;  1B51 A;  3MVZ A;  3OMB A;  3E79 A;  3H6W A;  4R2B A;  2HFB A;  4GWS A;  3U93 A;  4Z0I A;  2ZYO A;  3K4U A;  3HO7 A;  3QIM A;  1PBP A;  1B3L A;  1ANF A;  5FTH A;  4KQP A;  4YKK A;  2Q8M A;  1WOD A;  1G0H A;  4DCY A;  1P1W A;  3N6T A;  4P47 A;  5IZZ A;  4YB6 A;  4AB5 A;  4G2Z A;  1LGB C;  2F3B A;  2OZZ A;  1LAF E;  3O97 A;  3G3J A;  1MXU A;  4LZ8 A;  4KYE A;  3TPA A;  2Z8D A;  2Q2C A;  3MVY A;  4E0X A;  5H8S A;  3K0V A;  2XD2 A;  3T9X B;  3L6G A;  5ICQ A;  1NV6 A;  4GL8 A;  3GYY A;  3OD7 A;  2XXH A;  4F3P A;  5H8N B;  4MEV A;  3TZA A;  1DTG A;  2DWI A;  3VDF A;  3FBP A;  2XXW A;  2PX1 A;  3NOH A;  3SEV A;  1LB8 A;  4N8G A;  4ISU A;  1ZIU A;  2XXR A;  1IMB A;  4I8C A;  3JV9 A;  1EYI A;  1K9Y A;  4PFI A;  1EZ9 A;  2R6G E;  2ZYM A;  5TP9 A;  1UIV A;  3OSR A;  1B58 A;  4LUB A;  4JB7 A;  1BKA A;  2A5T A;  1N7X A;  4FOR A;  1FTA A;  4DDD A;  1UQW A;  5IKB A;  1ELJ A;  1O64 A;  4F39 A;  4YKJ A;  4U4S A;  2DVZ A;  3CI8 A;  4MX6 A;  3TTM A;  5CM6 A;  5A5X A;  3MZ9 A;  2OJT A;  5FHN A;  1QKA A;  3KOT A;  4O94 A;  4R2F A;  5CC2 A;  1A40 A;  4KCD A;  1ZU0 A;  1URD A;  1SI0 A;  4F18 A;  2QS4 A;  4NE4 A;  4OWD A;  3CG1 A;  2B3F A;  3Q27 A;  4RXL A;  4U4X A;  1NUZ A;  5I57 B;  1DMB A;  3GXA A;  3K1P A;  2OWS A;  1MY3 A;  2ZZX A;  4MFI A;  4XKR A;  2YPN A;  1B5J A;  1GVC A;  3MZB A;  3D1R A;  5I7I A;  3EHS A;  1MH4 A;  3USD A;  4OHN A;  4OVR A;  2P3V A;  2AIX A;  2DE2 A;  3ECR A;  1MQD A;  1Y1Z A;  3RT8 A;  1EH3 A;  3MJN A;  5IZ3 B;  3OEK A;  4BDM A;  5CMK A;  2YJP A;  1IQ7 A;  2XXQ A;  3CSG A;  4BLA A;  4R72 A;  1LBZ A;  4U23 A;  1VSO A;  2PFY A;  3IJX B;  3G3F A;  2QFL A;  3PMW A;  5IZ1 A;  3MP6 A;  4R6Y A;  3SEU A;  1B9J A;  1URS A;  5BWJ A;  2ZNT A;  3I3V A;  2ANJ A;  4ELQ A;  3H03 A;  2PBW A;  4OVT A;  1PB9 A;  4LZ5 A;  4DZ1 A;  2Q8J A;  4GBV A;  5J1D A;  4P8B A;  1FTL A;  3IOT A;  3PUX E;  3OEL A;  3IO4 A;  4F1Y A;  1YXI A;  1LAG E;  2HXW A;  5DVI A;  4GF8 A;  1ZBM A;  3UGW A;  4DXC A;  4KI0 E;  3EQ1 A;  4OXV A;  5K2X A;  5H8F B;  2QPQ A;  1FQB A;  3LBS A;  4N6K A;  5H8Q B;  1B7H A;  4JVD A;  2F7B A;  4GL0 A;  3IO6 A;  4JBZ A;  1TWY A;  4LON B;  1MS7 A;  4OZ9 A;  5JEI A;  1AOV A;  2GQ1 A;  3LUZ A;  3QYT A;  3FJM A;  2DSF A;  1B6H A;  4RY1 A;  3IFA A;  4PET A;  2HPG A;  3OO6 A;  2Z8F A;  1NL5 A;  3KSJ A;  2V4C A;  3PU5 A;  3BKI B;  5AA2 A;  1IXC A;  3HHF A;  1M5B A;  3MAM A;  1NUY A;  3OEM A;  1A7L A;  2V3U A;  1MH3 A;  3UOR A;  4KHZ E;  2RF1 A;  1MY1 A;  1Y1M A;  3TCH A;  1MM7 A;  1SYH A;  2XXX A;  2H25 A;  3H3G A;  4DI3 D;  4DIG A;  3K6X A;  4H5G A;  4IY6 A;  2WYK A;  1R6Z A;  4HCY A;  4PDD A;  3DP6 A;  1R9L A;  3EHU A;  4U2R A;  2HZL A;  1JW5 A;  4PBQ A;  2I58 A;  4QF9 A;  2Y7P A;  2Z8E A;  4P9K A;  4KR5 A;  3A29 A;  1LFI A;  3G3H A;  1MM6 A;  1M5C A;  1IUD A;  4ZEF A;  4QFK A;  1LCF A;  4OEN A;  1YYZ A;  1FQA A;  3CSB A;  3FVG A;  4YZZ A;  3UA8 A;  4OER A;  1JQF A;  1IMF A;  4NF4 A;  3S4U A;  3VXC A;  2I0C A;  2I48 A;  5ET6 A;  4OFO A;  3OSQ A;  5BUU A;  4R74 A;  1ZJL A;  3RPL A;  1OVT A;  1B3H A;  1Q35 A;  1N3X A;  5DYH A;  4U1O A;  4P1E A;  1SVX B;  1LLS A;  4EF2 A;  2HAV A;  1I6A A;  2FVZ A;  4WXJ A;  3E3K A;  4NF5 B;  1O63 A;  3UP9 A;  4ELP A;  2QS3 A;  3HCQ A;  1US4 A;  3PPO A;  4ND9 A;  2GFE A;  3BIH A;  2RIN A;  5AA4 B;  1RYO A;  1SBP A;  3BBR A;  2Q74 A;  3W15 C;  3OXN A;  3B7D A;  3C32 A;  4MAG A;  4LZ7 A;  5J16 A;  3TTN A;  4NN3 A;  5TPA B;  3JYR A;  3QAX A;  1OQG A;  4G8H A;  4O3B A;  3FV2 A;  4HXV A;  2XXK A;  2QSX A;  3M8U A;  4PQJ A;  1FTJ A;  1B3E A;  4GQO A;  1I6B A;  1XVY A;  2XWV A;  4YKP A;  2DWJ A;  2OLB A;  4QHQ A;  1MXY A;  4OMB A;  1SQY A;  2ALU A;  3SEX A;  4KYS A;  4GWZ A;  1B2H A;  1DPP A;  3THI A;  4OVJ A;  2F7A A;  2V3T A;  1IMA A;  2QVU A;  2Y7W A;  4PFR A;  1FQE A;  2OCU A;  3G7W A;  5ESY A;  4MNI A;  3KJT A;  1BTJ A;  4HTG A;  3DP8 A;  4R9F A;  1P99 A;  1MY4 A;  4YB5 A;  2RC8 A;  3H7M A;  4X1B A;  3RPW A;  5TU0 A;  4BDN A;  3PD8 A;  4RK9 A;  2WEF A;  4PCD A;  4UA8 A;  5AA1 A;  1IMD A;  4RNS A;  1EYJ A;  1EU8 A;  3H6U A;  1MQI A;  5CBS A;  4HS7 A;  2REJ A;  4EQ7 A;  3B6W A;  1MQG A;  1AH5 A;  4IY5 A;  2HQ0 A;  3RY3 A;  1DPE A;  1JVX A;  3N5L A;  3O6I A;  3ZKL A;  2ESN A;  3O6H A;  3SEW A;  3VLV A;  5KCJ A;  3QUF A;  3S9N C;  2Y5L A;  2XD3 A;  2PMS A;  3T93 B;  1FPJ A;  1B0L A;  3FXU A;  3MPL A;  2DYX A;  5HBC A;  1XC1 A;  3FXB A;  3RTF B;  4F29 A;  4H5F A;  2I0B A;  1FBE A;  2UVH A;  4PC9 A;  4XFE A;  4QFL A;  4OES A;  3C4M A;  2F8D A;  1QUK A;  1KZ8 A;  3B8B A;  5B70 A;  2F97 A;  2UYF A;  1LB9 A;  1H44 A;  1FBG A;  1URG A;  2I4C A;  3C9H A;  1Y3Q A;  1AIV A;  2B65 A;  1NUW A;  3O6G A;  3ODB A;  1IIW A;  2WBB A;  3VVF A;  3K1N A;  4H65 A;  3EKI A;  1NV4 A;  2ZZV A;  4YB7 A;  3I6V A;  3CR9 A;  1LBY A;  1B4Z A;  1FPB A; 
#chains in the Genus database with same CATH homology
 4F3S A;  1Y3P A;  1MPD A;  3TCG A;  3Q28 A;  2NWJ A;  4PP0 A;  2ONS A;  3VV5 A;  3EN3 A;  4R9G A;  2H98 A;  3PV0 E;  4O3C A;  3VE1 B;  5CRY A;  3KGC A;  1NFT A;  2NVU B;  2QRY A;  3IOU A;  1MDQ A;  3LSX A;  2W7Y A;  1KWH A;  3VVE A;  5FHM A;  4WKM A;  1MPC A;  5M2V A;  5H8F A;  4GLI A;  1OQH A;  2Z23 A;  1MQH A;  3RN8 A;  4N07 A;  3P7I A;  4DCX A;  3K1M A;  4I1D A;  1A54 A;  3IOR A;  1MY0 A;  2UXA A;  2P1S A;  4XKN A;  4GXS B;  2DQV A;  3FZV A;  4OYV A;  3C31 A;  2VP1 A;  3MUQ A;  4FE8 A;  4R73 A;  3CFZ A;  4LA9 A;  4O3A A;  4Q8R A;  1MRP A;  1OLA A;  1B1X A;  4ZED A;  1CB6 A;  5KZT A;  2XXV A;  3PMV A;  2GH9 A;  3FXQ A;  4P0I A;  4Q0C A;  1QKB A;  1LBC A;  4XIG Q;  2XXP A;  2VD2 A;  1B1H A;  1B05 A;  4ELR A;  4OTE A;  1GR2 A;  2HAU A;  4DE8 A;  1GTK A;  1GV8 A;  3V83 A;  2O6A A;  3LSW A;  5DEX B;  1YAE A;  3KBR A;  2HEU A;  1SW2 A;  3DLN A;  3HPI A;  1EZP A;  3PUV E;  3TTL A;  2BJJ X;  3S9E A;  1IIT A;  3Q26 A;  3MQ9 A;  3O66 A;  3CFX A;  3SER A;  1UTH A;  3UK4 A;  1B3G A;  1JET A;  3GLB A;  2P2A A;  1OIB A;  2I3W A;  1VE4 A;  1FQF A;  4H0W A;  1USY E;  3HHG A;  2XXY A;  5DVF A;  1P1N A;  3CG3 A;  4JSO A;  1IZ1 A;  4EXK A;  1Y20 A;  4N6P A;  4TQU Q;  1LST A;  3K2D A;  2PT2 A;  3EF7 A;  4GVO A;  5L9M A;  1B5H A;  1QVS A;  1ZMG A;  3LSF B;  2DWH A;  2OWT A;  1B4H A;  3E9X A;  3SKP A;  3FUZ A;  4NF5 A;  2QMX A;  4NF8 B;  2H9B A;  4QFP A;  4OET A;  1XHY A;  2NOO A;  3U72 A;  3T66 A;  3V89 B;  5B7D A;  3FJG A;  4GWO A;  3SDF A;  3MBP A;  2F7C A;  4KFQ A;  5EYF A;  4EUO A;  3O2A A;  1OVB A;  1A55 A;  1D3K A;  4DXB A;  5JTY B;  4YMB A;  3RQT A;  1POY 1;  5CMC A;  3IB1 A;  4F19 A;  1ATG A;  3IOW A;  5I2N A;  3S9M C;  2FA7 A;  3TFL A;  3TEL A;  4ZZE A;  4OFL A;  1EZO A;  3C36 A;  1AL3 A;  3FV1 A;  3Q25 A;  5EHM A;  4JDF A;  3TAJ A;  3G3K A;  4XXU A;  1SD3 A;  3DM0 A;  4JWX A;  1UTB A;  1M5F A;  4PFY A;  4JXI A;  2I3V A;  1NH8 A;  1NNT A;  2O7I A;  1M5D A;  3RLF E;  4FAT A;  4AQ4 A;  4XKP A;  1LAX A;  3OO7 A;  1L5T A;  4H1X A;  1PB8 A;  1JEV A;  2GRV A;  3HV1 A;  5TP9 B;  2UVJ A;  3TUS A;  1B52 A;  2A5T B;  3H06 B;  3M3K A;  3V8X B;  3IB0 A;  1YCJ A;  3VLW A;  2ZYN A;  4YKI A;  3V5A A;  3IOV A;  4U21 A;  5L8D A;  3VFJ A;  1B32 A;  4QRZ A;  5I2K B;  4QFN A;  3I5O A;  4C1T A;  1P1Q A;  3MP1 A;  2DE4 A;  4THI A;  2RCA A;  1S9T A;  2ABH A;  3FIR A;  5DTB A;  4M1V A;  3SES A;  4M4G A;  1F9B A;  4MH5 A;  1II5 A;  3C35 A;  2G29 A;  4ZS9 A;  3OEN A;  1M5E A;  2Q2A A;  4RK2 A;  3B6Q A;  4KYD A;  2AYS A;  3A3C A;  4ZDM A;  3WAF A;  4IO7 A;  5I56 B;  2GHB A;  4MBP A;  1NMU A;  3K02 A;  3KN7 A;  3C34 A;  4EXL A;  1QUL A;  1HSE A;  4X9T A;  2DS9 A;  3BFU A;  5FTI A;  1DTZ A;  2O69 A;  4EF1 A;  3PGF A;  4F1V A;  5FHO A;  3A3U A;  5F1Q A;  2F34 A;  3CIJ A;  4JSD A;  3W9V A;  4PFT A;  1BLF A;  1Y4T A;  2FYI A;  3SET A;  3PUW E;  1QUJ A;  4X1D A;  4G68 B;  2Q9T A;  4YU0 A;  3S9L C;  3UIF A;  2F5X A;  5JK4 A;  1FQD A;  1N3W A;  4AB6 A;  2O84 X;  3H6V A;  1WDN A;  4ESW A;  1TXF A;  3N94 A;  5H8N A;  1T0K A;  1MY2 A;  4PFW A;  2P0S A;  2FNC A;  2REG A;  3S2V A;  4QSD A;  3TCF A;  5DT6 A;  3E4R A;  5CI5 A;  3MW0 A;  2PYY A;  3H6T A;  2XX8 A;  3K6V A;  4G77 A;  4F3G A;  4HW8 A;  4EDP A;  2YLN A;  1B7U A;  2H5Y A;  2HCA A;  4NMY A;  3KJ7 A;  4UAC A;  5DEX A;  3IX1 A;  2Y84 A;  4BDR A;  1B7Z A;  3IR1 A;  1Y3N A;  1S50 A;  4LVQ A;  4IO5 A;  4N13 A;  2O68 A;  5I57 A;  1N04 A;  4F2O A;  4TOZ A;  2XXU A;  4NED A;  3C33 A;  5I58 B;  3D4G A;  2PT1 A;  3CFL A;  3F11 A;  3R7X A;  3QUJ A;  3RNN A;  1IXH A;  3HN0 A;  2ZMB A;  5ICT A;  3T9U A;  3IK6 B;  5H8H B;  5AA2 D;  1AMF A;  5I59 B;  1US5 A;  3U92 A;  1DOT A;  3ILU B;  1FTM A;  2DE3 A;  2M8C A;  1NNF A;  4PE5 B;  3PPP A;  4BDL A;  1TT1 A;  3T22 A;  3WAE A;  1H3D A;  4FJP A;  1LBB A;  3D4C A;  4GIZ A;  2IA4 A;  2THI A;  3B6T A;  1MPB A;  4F22 A;  4POW A;  1B5I A;  4H8I A;  4GD5 A;  3GBA A;  4BDQ A;  1PEB A;  3KSX A;  1Z7N E;  4NF8 A;  4ZE8 A;  3KN8 A;  1DSN A;  3KZG A;  4PFU A;  1SW4 A;  4NF4 B;  4P11 A;  4FED A;  3M3F A;  3MC2 A;  1ZKB A;  2QS2 A;  2I6E A;  3ILT B;  1POT A;  4I62 A;  4LP2 B;  2RC7 A;  3TQL A;  1ZTY A;  3RUM A;  3TTK A;  3O9P A;  5L9S A;  1D4N A;  1QUI A;  4ESX A;  2ONK E;  4GOT A;  3L6H A;  4ECF A;  3QXM A;  5F7V A;  5JTY A;  4K3F A;  4IGR A;  5CMM A;  5H8Q A;  4QSC A;  3PPQ A;  4MF3 A;  2RKM A;  2F36 A;  2VGQ A;  1OLC A;  4Q5T A;  5KDT B;  1IXI A;  3N26 A;  3TEP A;  3GBB A;  2V3Q A;  1MXW A;  3KOS A;  3PUY E;  4MLQ A;  1J1N A;  2VHA A;  4F1U A;  2V93 A;  1MXV A;  1CE2 A;  3MVX A;  2Q88 A;  4JWY A;  3RTW B;  1XS5 A;  4IO4 A;  1MDP 1;  3ZS6 A;  4IO2 A;  2DOJ A;  2X7Q A;  5AE4 A;  2H99 A;  1A8F A;  3DP4 A;  1Z7M E;  2DWA A;  1FQC A;  4KD5 A;  4KCC A;  1RYX A;  1Y9U A;  4NTL A;  2X7P A;  2D3I A;  3FXR A;  2VOZ A;  1FCK A;  3GZG A;  1MXX A;  1SYI A;  3KFM A;  4U1Z A;  1H43 A;  5IAI A;  1NKX A;  3PD9 A;  5I2K A;  2F78 A;  2E0S A;  4H6D A;  4C1U A;  2F6P A;  1SDX A;  4NF6 B;  3TQW A;  5KCJ B;  4NWD A;  3LUY A;  4G8M A;  1HSJ A;  4GRK A;  1LFH A;  1SW5 A;  1TFA A;  2NXO A;  4ZEK A;  4QFO A;  3G3G A;  1XVX A;  1Y4C A;  4Q30 B;  4WEP A;  2R9J A;  5CBR A;  3FVO A;  2XX7 A;  3EPE A;  4ZEB A;  1HSL A;  1SW1 A;  4RYA A;  4F2Q A;  2XXT A;  3VLU A;  4ZEC A;  3JZJ A;  5I56 A;  5HM4 B;  2O51 A;  1OMP A;  4ZEI A;  2O7U A;  4X48 A;  4LQ2 A;  3PPR A;  3MPK A;  5EHS A;  5AA4 A;  4IO3 A;  3TMG A;  2RCB A;  3BFT A;  1NNP A;  5DVJ A;  1VR5 A;  4TLM B;  3PUZ E;  1JVY A;  3FGS A;  2ZYK A;  3MWB A;  2X26 A;  2LAO A;  3FAT A;  3IJO B;  5TPA A;  2NUV A;  5L9O A;  4G4P A;  4G68 A;  3KG2 A;  4RPN A;  1MXZ A;  5CMB A;  2O1L A;  3W9W A;  5ITP A;  2UVI A;  2E1S A;  3K01 A;  3TDJ A;  5K2Y A;  2DVC A;  3O28 A;  1H76 A;  4QSE A;  2XHD A;  3CVG A;  1PC3 A;  3TKD A;  1BP5 A;  2I4B A;  4FAJ A;  2RC9 A;  3KN3 A;  1H45 A;  3FVN A;  3TYH A;  2GHA A;  5ELV A;  3K6W A;  1PB7 A;  1XT8 A;  3MZ1 A;  1JW4 A;  3K6U A;  2R71 A;  4XKQ A;  2PVU A;  3FJ7 A;  3QSL A;  1D9V A;  3T9H B;  3MVW A;  4OEU A;  1LAH E;  4YIC A;  2VD3 A;  4RA1 A;  1IXG A;  1N0T A;  3RT6 B;  1GGG A;  3R26 A;  3LR1 A;  3LC8 A;  4OEV A;  5I58 A;  3IL1 B;  2UYE A;  1D9Y A;  2G93 A;  1A8E A;  3R6U A;  2Y7R A;  4IGT A;  4GXA A;  3ZKK A;  3Q29 A;  5A5X B;  1P1O A;  1A99 A;  3FD3 A;  4EQ9 A;  5HPQ A;  3PPN A;  2AL5 A;  5H8H A;  5ITO A;  1B46 A;  1R9Q A;  5I59 A;  2A5S A;  1USY H;  4IB2 A;  1P1U A;  3FVK A;  1PDA A;  3U8Q A;  1YTV A;  2O1M A;  2DP8 A;  1UTH B;  4FEC A;  4Z7E A;  1IEJ A;  4DLD A;  1FW0 A;  4OFJ A;  4P0G A;  4F3B A;  5AA3 A;  3U94 A;  3O29 A;  1B40 A;  1NNK A;  4H8J A;  1B0H A;  1XOC A;  4NWC A;  3VXB A;  2DXR A;  3IB2 A;  4FIM A;  4ZE9 A;  1S7Y A;  1SI1 A;  2Y7I A;  2QL3 A;  4BDO A;  3N6U A;  1BIY A;  3PMX A;  2OBG A;  2V25 A;  2XX9 A;  3OO8 A;  4RJZ A;  1FTK A;  2OK2 A;  1TFD A;  4HCW A;  4ONY A;  4KPT A;  1I6Q A;  1RKM A;  3QK6 A;  2HZK A;  3ONM A;  1I69 A;  1LCT A;  2Q89 A;  2QMW A;  1NH7 A;  5KDT A;  3VVD A;  3K00 A;  4OQO A;  4EQB A;  3HST A;  1JNF A;  2ZXT A;  4TLL B;  1MG1 A;  4I9D A;  1R1N A;  1VFE A;  2D21 A;  4FEB A;  3E13 X;  1N76 A;  4ELO A;  4G68 C;  2DXY A;  1LFG A;  5I2N B;  3SEY A;  3UN6 A;  4GFR A;  2IEE A;  2D5W A;  4G8N A;  2AL4 A;  2Z22 A;  4U22 A;  1N84 A;  4WED A;  2CMO A;  2UVG A;  1VFD A;  3H4Z A;  2WKY A;  4ZZA A;  1QJM A;  1UTB B;  2F35 A;  1N7W A;  4LAT A;  3T96 B;  3IAZ A;  2F6G A;  1UIU A;  3FAS A;  4C0R A;  3TOD A;  5AA2 B;  2H4I A;  4IO6 A;  3T9V A;  3MP8 A;  3G3I A;  3KEI A;  2ZNU A;  1MQJ A;  3AXF A;  3U1O A;  3ZSF A;  3A09 A;  3DEL B;  1WVJ A;  1YPN A;  4E0W A;  4NF6 A;  4L17 A;  4POX A;  1O7T A;  3CRB A;  2QJE A;  4MLV A;  2QS1 A;  3OO9 A;  1ZLQ A;  4YAH X;  1QW0 A;  4YMA A;  1Q1K A;  4RPO A;  3LSL A;  4JWO A;  1JEU A;  2KLF A;  2CZL A;  2XXI A;  2I49 A;  4F31 B;  3RGY A;  4XTC Q;  1FTO A;  3M3L A;  4R6H A;  4R6K A;  4DXU A;  2B3B A;  4R75 A;  1JW1 A;  5LOM A;  4LQ5 A;  2ZNS A;  3OOA A;  3TTR A;  5ISU A;  5I84 A;  4H67 A;  2Y7K A;  2V84 A;  2ONR A;  1B3F A;  1PBQ A;  3EHT A;  1B51 A;  3MVZ A;  3OMB A;  3H6W A;  4R2B A;  2HFB A;  3U93 A;  4Z0I A;  2ZYO A;  3K4U A;  3HO7 A;  3QIM A;  1PBP A;  1B3L A;  1ANF A;  5FTH A;  4KQP A;  4YKK A;  1WOD A;  4DCY A;  1P1W A;  3N6T A;  4YB6 A;  4AB5 A;  4G2Z A;  1LGB C;  2OZZ A;  1LAF E;  3O97 A;  3G3J A;  1MXU A;  4LZ8 A;  4KYE A;  3TPA A;  2Z8D A;  2Q2C A;  3MVY A;  4E0X A;  5H8S A;  3K0V A;  2XD2 A;  3T9X B;  3L6G A;  5ICQ A;  4GL8 A;  3OD7 A;  2XXH A;  4F3P A;  5H8N B;  3TZA A;  1DTG A;  2DWI A;  3VDF A;  2XXW A;  2PX1 A;  3SEV A;  1LB8 A;  4ISU A;  1ZIU A;  2XXR A;  4I8C A;  3JV9 A;  1EZ9 A;  2R6G E;  2ZYM A;  5TP9 A;  1UIV A;  3OSR A;  1B58 A;  4LUB A;  4JB7 A;  1BKA A;  2A5T A;  1N7X A;  4FOR A;  4DDD A;  1UQW A;  5IKB A;  1ELJ A;  1O64 A;  4F39 A;  4YKJ A;  4U4S A;  2DVZ A;  3CI8 A;  3TTM A;  5CM6 A;  5A5X A;  3MZ9 A;  2OJT A;  5FHN A;  1QKA A;  3KOT A;  4R2F A;  5CC2 A;  1A40 A;  4KCD A;  1ZU0 A;  1URD A;  1SI0 A;  4F18 A;  2QS4 A;  4NE4 A;  4OWD A;  3CG1 A;  2B3F A;  3Q27 A;  4RXL A;  4U4X A;  5I57 B;  1DMB A;  3GXA A;  3K1P A;  2OWS A;  1MY3 A;  4MFI A;  4XKR A;  2YPN A;  1B5J A;  1GVC A;  3MZB A;  3EHS A;  1MH4 A;  3USD A;  4OHN A;  2AIX A;  2DE2 A;  3ECR A;  1MQD A;  1Y1Z A;  3RT8 A;  1EH3 A;  3MJN A;  3OEK A;  4BDM A;  5CMK A;  2YJP A;  1IQ7 A;  2XXQ A;  3CSG A;  4BLA A;  4R72 A;  4U23 A;  1VSO A;  3IJX B;  3G3F A;  3PMW A;  3MP6 A;  4R6Y A;  3SEU A;  1B9J A;  1URS A;  5BWJ A;  2ZNT A;  3I3V A;  2ANJ A;  4ELQ A;  3H03 A;  2PBW A;  1PB9 A;  4LZ5 A;  4DZ1 A;  2Q8J A;  5J1D A;  1FTL A;  3IOT A;  3PUX E;  3OEL A;  3IO4 A;  4F1Y A;  2HXW A;  1LAG E;  5DVI A;  4GF8 A;  1ZBM A;  3UGW A;  4DXC A;  4KI0 E;  3EQ1 A;  4OXV A;  5K2X A;  5H8F B;  2QPQ A;  1FQB A;  3LBS A;  5H8Q B;  1B7H A;  2F7B A;  4GL0 A;  3IO6 A;  4JBZ A;  1TWY A;  4LON B;  1MS7 A;  4OZ9 A;  5JEI A;  1AOV A;  3QYT A;  3FJM A;  2DSF A;  1B6H A;  4RY1 A;  4PET A;  3OO6 A;  2Z8F A;  1NL5 A;  3KSJ A;  3PU5 A;  3BKI B;  5AA2 A;  1IXC A;  3HHF A;  1M5B A;  3MAM A;  3OEM A;  1A7L A;  2V3U A;  1MH3 A;  3UOR A;  4KHZ E;  2RF1 A;  1MY1 A;  1Y1M A;  3TCH A;  1MM7 A;  1SYH A;  2XXX A;  2H25 A;  3H3G A;  4DIG A;  3K6X A;  4H5G A;  4IY6 A;  1R6Z A;  4HCY A;  3DP6 A;  1R9L A;  3EHU A;  4U2R A;  2HZL A;  1JW5 A;  2I58 A;  4QF9 A;  2Y7P A;  2Z8E A;  4KR5 A;  1LFI A;  3G3H A;  1MM6 A;  1M5C A;  1IUD A;  4ZEF A;  4QFK A;  1LCF A;  4OEN A;  1FQA A;  3CSB A;  3FVG A;  4YZZ A;  3UA8 A;  4OER A;  1JQF A;  4NF4 A;  3S4U A;  3VXC A;  2I0C A;  2I48 A;  4OFO A;  3OSQ A;  5BUU A;  4R74 A;  1ZJL A;  1OVT A;  1B3H A;  1Q35 A;  1N3X A;  5DYH A;  4U1O A;  1SVX B;  1LLS A;  4EF2 A;  2HAV A;  1I6A A;  4WXJ A;  3E3K A;  4NF5 B;  1O63 A;  3UP9 A;  4ELP A;  2QS3 A;  3HCQ A;  1US4 A;  3PPO A;  4ND9 A;  2GFE A;  2RIN A;  5AA4 B;  1RYO A;  1SBP A;  3BBR A;  3W15 C;  3OXN A;  3B7D A;  3C32 A;  4LZ7 A;  3TTN A;  5TPA B;  3JYR A;  3QAX A;  1OQG A;  4G8H A;  4O3B A;  3FV2 A;  2QSX A;  3M8U A;  4PQJ A;  1FTJ A;  1B3E A;  4GQO A;  1I6B A;  1XVY A;  4YKP A;  2DWJ A;  2OLB A;  4QHQ A;  1MXY A;  4OMB A;  1SQY A;  2ALU A;  3SEX A;  4KYS A;  1B2H A;  1DPP A;  3THI A;  4OVJ A;  2F7A A;  2V3T A;  2Y7W A;  1FQE A;  2OCU A;  3G7W A;  3KJT A;  1BTJ A;  4HTG A;  3DP8 A;  4R9F A;  1P99 A;  1MY4 A;  4YB5 A;  4X1B A;  2RC8 A;  4BDN A;  3RPW A;  5TU0 A;  3H7M A;  3PD8 A;  4RK9 A;  4UA8 A;  5AA1 A;  4RNS A;  1EU8 A;  3H6U A;  1MQI A;  5CBS A;  4HS7 A;  2REJ A;  4EQ7 A;  3B6W A;  1MQG A;  1AH5 A;  4IY5 A;  2HQ0 A;  3RY3 A;  1DPE A;  1JVX A;  3N5L A;  3O6I A;  3ZKL A;  2ESN A;  3O6H A;  3SEW A;  3VLV A;  5KCJ A;  3QUF A;  3S9N C;  2XD3 A;  2PMS A;  3T93 B;  1B0L A;  3FXU A;  3MPL A;  2DYX A;  5HBC A;  1XC1 A;  3RTF B;  4F29 A;  4H5F A;  2I0B A;  2UVH A;  4QFL A;  4OES A;  3C4M A;  2F8D A;  1QUK A;  5B70 A;  2F97 A;  2UYF A;  1LB9 A;  1H44 A;  1URG A;  2I4C A;  3C9H A;  1Y3Q A;  1AIV A;  2B65 A;  3O6G A;  3ODB A;  1IIW A;  3VVF A;  3K1N A;  4H65 A;  4YB7 A;  3I6V A;  3CR9 A;  1B4Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...