2WX9A

Crystal structure of the sialic acid binding periplasmic protein siap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNNGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
publication title Crystal Structure of the Sialic Acid Binding Periplasmic Protein Siap.
rcsb
source organism Haemophilus influenzae
total genus 123
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wx9A00
4P9KA 4MMPA 2CEXA 3GYYA 5I5PA 4NN3A 2VPNA 2WYPA 4X04A 4PGNA 4P1LA 4PFBA 4NGUA 4P56A 4N8GA 4PF6A 4OANA 4OVRA 4MIJA 3U65A 4NAPA 5CM6A 4PETA 4PBHA 2WX9A 4MNIA 4PDHA 5LTCA 4OA4A 4N8YA 4XFEA 2HZKA 5IM2A 2ZZWA 4PC9A 3B50A 4DI4B 5IZZA 4X8RA 4N6DA 4MEVA 4N6KA 3FXBA 4OVQA 4N4UA 4DI3D 4PBQA 4P3LA 2HZLA 4N91A 4MAGA 4NG7A 4NF0A 4P47A 4NX1A 2ZZXA 4PFIA 4P8BA 4OVPA 4YZZA 4N15A 2HPGA 4PCDA 2PFYA 4O7MA 2PFZA 4NHBA 4LN5A 2XWOA 4NQ8A 5I7IA 2XA5A 4MNCA 2CEYA 4MX6A 2XWVA 4PFRA 4MCOA 4P1EA 4MNPA 4PDDA 4PE3A 4YICA 4O8MA 4PAFA 2WYKA 4XEQA 4N17A 2VPOA 4PGPA 4XF5A 2XWKA 2XWIA 4OVSA 4UABA 5IGAA 4OVTA 4PAIA 4O94A 2V4CA 2ZZVA 2XXKA 4MHFA 4PF8A 4PAKA
chains in the Genus database with same CATH superfamily
5A5XB 1HSLA 2DWJA 1ZLQA 4KYSA 1KZ8A 1FPKA 1EZOA 5I5PA 3OELA 4X1DA 1J1NA 1DPEA 1SW2A 4GXAA 1JW4A 3PPPA 1NI9A 3LSFB 1SVXB 4IO3A 1MXYA 2QVVA 5ICTA 1FTAA 3CHGA 1FBHA 2XXVA 4ELOA 3OSQA 5I57A 4PDHA 4HS7A 5HM4B 3TCGA 4N8YA 3KSJA 4NF8B 3DP6A 5IZZA 2DE2A 1MQHA 4YMAA 5IAIA 4DZ1A 2CZLA 3G3GA 1FBFA 4H8JA 4R2BA 3CSGA 1XS5A 3KBRA 1KA0A 4P8BA 5JK4A 2NOOA 2AL5A 2O1MA 1XVYA 1KWHA 2PFYA 4O7MA 2X7QA 4QFLA 1FBGA 1IEJA 5ICQA 3PPOA 3IJOB 4ECFA 3O2AA 1QUJA 1MQIA 2UXAA 4GWUA 3RTWB 2VGQA 5FHNA 1A8FA 4P1EA 3W9VA 1Q9DA 4R73A 3MC2A 4M1VA 1Y1ZA 4G8NA 4N17A 2ONKE 2ZNSA 2XWIA 3TCHA 4YB6A 1B7ZA 3FVNA 3FASA 3TUSA 3SZPA 4JWXA 4GF8A 1US4A 4NN3A 1L5TA 1ZMGA 2P2AA 5AA3A 3SETA 4N8GA 3IL1B 1A55A 4KD5A 3LUZA 3ZSFA 4OVJA 4GXSB 4IO5A 2DQVA 3MVZA 3OO8A 3O97A 4MH5A 4NF4A 3MBPA 2UYEA 3UIFA 4O7IA 3C31A 1A7LA 1QKBA 1BP5A 5FBPA 4MAGA 4IR8A 5F1QA 3KOSA 4NX1A 4ZECA 3ECRA 1MQJA 1B40A 1VR5A 3CRBA 5L9OA 1NMUA 3IR1A 3PMVA 4RPOA 4M4GA 1ANFA 3VVEA 3T9HB 1D9YA 1IMBA 1B46A 4PFRA 4F19A 4G68C 1QUKA 4RJZA 4HE0A 2VD2A 4AQ4A 3IFCA 3K6VA 4KHZE 4NWDA 4XF5A 4UACA 1VSOA 4O94A 2A5TA 1FW0A 2OWTA 4AS5A 4NF5A 1FTOA 2Q9TA 3RPWA 2Q2CA 4ZEKA 1D4NA 2QJEA 1PB9A 3GYYA 4THIA 1FPLA 4F3BA 1O63A 2B4MA 1B4ZA 3MPLA 4R9GA 1IXHA 3IOWA 5IZ3A 3PUYE 4DLDA 2H5YA 3MZBA 1AOVA 2CZIA 3MSTA 2PVUA 3TPAA 4YKPA 4HXVA 5FHMA 5ITPA 4P11A 2DYXA 3EQ1A 3B50A 4JXIA 5KDTB 5EQ7A 1B3GA 3FVOA 4IY5A 3CFZA 3FXBA 1LFHA 4RA1A 4GL8A 3FZVA 1DTZA 5I58A 3MWBA 4U1ZA 1LBWA 2ZZXA 5IKBA 3A29A 5I2NA 5FTHA 5CC2A 1I6AA 1P1QA 5DTBA 4QHQA 3E9XA 4NHBA 4R72A 1MDP1 3C32A 2VHAA 4YB7A 2DWHA 4WEPA 1NNPA 3OO9A 3Q28A 3CI8A 2CZHA 5AA2A 2E0SA 1Z7ME 2VOZA 1B05A 3IK6B 1UTHB 3TQLA 4Z7EA 1SPIA 1N0TA 3SEXA 3T9XB 1PC3A 4OQOA 4JSOA 2B4LA 1LAGE 2RKMA 4PFYA 3OO6A 2V3TA 3B7DA 3QYTA 5H8NA 1FBEA 4U21A 2F6GA 1UQWA 4G77A 3KN8A 2D5WA 4U1OA 1HSJA 3KN3A 5EYFA 2GRVA 4MNIA 5LTCA 2F7BA 1QKAA 2RINA 3QMFA 3IOUA 4NTLA 1XVXA 3G3HA 2HCAA 2X7PA 2YLNA 2P0SA 5TU0A 1MQGA 3CG3A 1QGXA 3RNNA 4JDFA 2H98A 1DTGA 1EH3A 4NWCA 5L8DA 1WODA 2XXWA 3UGWA 3N6UA 3U72A 2D21A 1JETA 4DXCA 5I57B 5JTYA 2ZYOA 3V89B 1Y3PA 2Q8JA 4IGTA 4XIGQ 5LDZA 4IO6A 4IO7A 4ZEDA 5DVFA 2OX3A 2M8CA 3P7IA 4LZ5A 4YKKA 4ND9A 1MPDA 2OBGA 5ET8A 4EF1A 2G93A 3KZGA 2GFEA 4MNPA 2XXPA 2F3DA 1H3DA 4FEBA 4PAFA 3OSRA 3MUQA 2R6GE 3DM0A 4XEQA 4XKQA 3UN6A 4MFIA 4XKRA 4OEVA 2Y5LA 5CRYA 5AA4A 4G2ZA 1OMPA 2QPQA 3C34A 1B3LA 4R75A 2FVZA 4QSDA 4BDMA 5TPAA 3JV9A 2WYPA 1LEVA 3TAJA 3HFUA 4OXVA 1B1HA 3LSLA 4OVRA 4F31B 3MVWA 4KI0E 4DCXA 3OMBA 5LOMA 1N3WA 4Z0IA 2HQ0A 1B7UA 3TDJA 3MAMA 5CI5A 4WXJA 4QFPA 1FQAA 2W7YA 3G3FA 4U4SA 3K02A 3H6UA 2GHAA 1S9TA 4EDPA 3DLNA 1RDYA 3UA8A 5DW8A 2DWAA 4H6DA 2ZYNA 2I0BA 3AXFA 3S4UA 4NG7A 3T66A 1ZIUA 2OLBA 1EYIA 1B0HA 3KBZA 4OYVA 5B7DA 2O68A 4OVPA 4ZEIA 4N15A 1KA1A 1SW4A 5H8HA 2PFZA 5CMMA 4NF4B 1MH3A 1FQEA 4GWZA 4E0WA 4O3CA 1YCJA 2UVJA 3RPLA 3TELA 1M5FA 1YXIA 2IA4A 4BDOA 2XXUA 3LR1A 4X48A 1MY1A 1RYOA 3M3FA 4GX3A 3KOTA 2CMOA 1LFGA 5J1DA 3TTNA 1MS7A 1B58A 4XTCQ 4OETA 5DVJA 4HTGA 3IB0A 1FQDA 1MRPA 5F7VA 1P1NA 2PYYA 1FSAA 3O9PA 3MYUA 3MQ9A 3FIRA 4N13A 1POTA 2P3NA 1SBPA 4DXUA 4C1TA 3WAEA 2G29A 1Y20A 3QUFA 1DBZA 2FHYA 1SW5A 4ONYA 1NV1A 2B3BA 3O6HA 3SEVA 3VV5A 1GR2A 1FQBA 2JJKA 2A5TB 4ZZAA 3SERA 1B3HA 4GD5A 2REGA 4G4PA 3FBPA 4RYAA 4XFEA 3LBSA 2V93A 2HAVA 1MY0A 4NE4A 1YAEA 3T22A 1RYXA 2HAUA 1FBPA 1JW5A 1US5A 2QVRA 4I3YA 4H65A 2DE3A 1AWBA 5AE4A 3W15C 2Y7RA 3D4GA 4LN5A 2D3IA 4H1XA 4QSEA 5EQ8A 1IMFA 1MM6A 2O84X 1M5EA 4Q8RA 3FVKA 1LAXA 1B7HA 1WVJA 5I58B 3N5LA 2Z22A 3V83A 1K9YA 1TWYA 3PUXE 1WDNA 1XC1A 3A09A 5EYHA 2P1SA 4NMYA 2V4CA 2E1SA 1MH4A 4ZS9A 3M3KA 1UTBA 4MMPA 2XD3A 5I2KA 5I56A 2XXRA 4FATA 1AH5A 2O69A 4NGUA 4MF3A 3BIGA 2R8TA 2Y7PA 3L6HA 2DVZA 5DT6A 4AS4A 1PBQA 1NUWA 3QXMA 4PETA 1SD3A 2O51A 3WAFA 1LB9A 2F34A 4PC9A 3U94A 3IO4A 3UORA 3SEWA 1B4HA 1OQHA 3O66A 4GWOA 4OESA 3C4MA 5H8NB 1LFIA 4GRKA 4POWA 2FNCA 3FJMA 4KQPA 4N4UA 3M3LA 4PBQA 4YMBA 4OEUA 4EXLA 3I3VA 4KCDA 3TKDA 1FPGA 3LSWA 2Q2AA 1SYIA 3H6VA 3IB2A 1NNTA 3TZAA 1OVTA 3SEYA 5ET6A 4NF6A 5I7IA 4LZ8A 4P0GA 4RK9A 2XHDA 1MXVA 2UVIA 1ZU0A 1ZTYA 3EHTA 4N07A 5H8QB 4N6PA 3QUJA 4JBZA 4DCYA 1I69A 3VXBA 4IO2A 1LBVA 4F3PA 2F7CA 2Y7KA 4KCCA 4UABA 1Y4CA 3MPKA 4QXDA 1FQCA 3VVDA 5CMBA 4QFNA 1IIWA 4O3AA 2Y84A 4JB7A 3QK6A 2VPNA 1B9JA 1B0LA 5FTIA 1II5A 3HN0A 2V3QA 5AA4B 3NOHA 3VDFA 4DE8A 2YPNA 3MVYA 2I4CA 2OWSA 1Q1KA 3R26A 3FJ7A 1FTJA 3KJ7A 3SEUA 5BUUA 1DK4A 2I48A 2ONRA 2THIA 4HCWA 4BDRA 3E3KA 3OXNA 1FPJA 1H44A 3H6WA 4PCDA 3K01A 3ODBA 1B3FA 2UVGA 5CMKA 3TQWA 3S2VA 4NQ8A 1H76A 2WEFA 4BLAA 4ESWA 3PUWE 1DOTA 2CEYA 1NV7A 3MJNA 2RC7A 1OQGA 4NF8A 3HPIA 3QSLA 4JVCA 2QFLA 1LCTA 3B6TA 1IMEA 1QW0A 2ANJA 1CE2A 1DSNA 1N7XA 3HHGA 4KXPA 5DEXA 3GXAA 5H8FA 3U1OA 4ELQA 2F97A 3H03A 1MM7A 2A5SA 1MPCA 3PMWA 4OERA 1MXWA 4H5FA 4F3GA 1A54A 4I1DA 1BKAA 4ZDMA 1S7YA 2RCBA 3H4ZA 5FHOA 2ZXTA 1MG1A 4I9DA 1FBCA 1FPDA 4P1LA 3TYHA 4PFBA 3Q25A 4POXA 3BKIB 4JSDA 2PMSA 4FAJA 3FUZA 3EN3A 4IGRA 1FBDA 3RTFB 4FBPA 3T0JA 5ELVA 3VXCA 3DP8A 2WX9A 1IXIA 2QVUA 3USDA 3IJXB 2AL4A 1LGBC 4YAHX 3KC1A 4X8RA 3OENA 4G68A 1JVXA 4N6KA 4HE2A 2XX8A 1UIUA 5A5LA 4Q5TA 4P3LA 2HZLA 4GX4A 4LQ2A 1BK4A 4AB5A 3RT8A 1MY4A 2I6EA 2XXYA 3KSXA 4ZE8A 3V8XB 3VVFA 1PB7A 1A8EA 3PPNA 1FQFA 1DCUA 5BWJA 3U92A 4FIMA 4ZEFA 3MW0A 1R9LA 3SKPA 3LUYA 4X9TA 4JWYA 4GIZA 4LZ7A 4MCOA 2I3WA 1URDA 3K00A 4QFKA 1Y3QA 2XX7A 3SESA 3H06B 5L9MA 3ZKLA 3OOAA 3PUZE 4L17A 2VPOA 4PGPA 4ISUA 3OEKA 1D9VA 4MLVA 5KCJA 3DELB 1I6QA 3ZKKA 4F2QA 3TTKA 2CEXA 2MKZA 1FTKA 3KEIA 3PGFA 1VFEA 1LB8A 4F18A 1QULA 2KQZA 4OFLA 1T0KA 2UYFA 1LBBA 4PF6A 4U4XA 1N7WA 1CNQA 4JVIA 1PEBA 1ZJLA 4F1UA 2UVHA 2ZYKA 5ISUA 2Q89A 1UTBB 4H45A 4NEDA 3D4CA 5I2KB 3CVGA 4I8CA 2QMWA 4OFJA 2H99A 1IITA 1H45A 3VLVA 3RYDA 1OVBA 1A40A 4BDLA 1D3KA 1IMDA 1VE4A 4XXUA 3U93A 3CG1A 1SI0A 4YKIA 1JNFA 4PFIA 5AA1A 4EQ7A 1QVSA 2ABHA 1AMFA 4TLLB 1NH7A 2Y5KA 1ATGA 1LAFE 3RUMA 4FE8A 2KLFA 3CR9A 1Y9UA 1FJ6A 1GGGA 2F78A 4U2RA 2OZZA 1B5HA 3VE1B 2V3UA 1NL5A 3HO7A 1O7TA 1LBCA 5EYGA 3PU5A 5K2YA 3EF7A 4X1BA 3KFMA 3Q29A 4GLIA 2XX9A 4GFRA 3E13X 2ZZVA 2XXIA 3TFLA 3L6GA 5KZTA 4JWOA 4LQ5A 4P9KA 1ELJA 5I59A 1NV3A 3ILUB 4IY6A 1Y4TA 4PFUA 3PUVE 4G61A 3FV1A 4U22A 5JEIA 3VFJA 4FORA 4MIJA 3PTYA 4WEDA 4NAPA 4QFOA 1IQ7A 3LV0A 3N6TA 1K9ZA 4DIGA 1Z7NE 1NV4A 1P1UA 1Y3NA 3FXUA 1EYKA 4ZEBA 1LSTA 1BLFA 4PFWA 4EXKA 3RLFE 3TEPA 2PT1A 4P0IA 1QUIA 2ZNTA 3BFTA 2F5XA 4I40A 4MEVA 1G0HA 1A99A 3GZGA 3VLUA 5ITOA 1B3EA 4H8IA 2HFBA 3N94A 4EQ9A 4N91A 3TTRA 1F9BA 2RCAA 3K1PA 4LA9A 3TCFA 4KFQA 4BDNA 4NF5B 2DE4A 3UK4A 4G8HA 1FTMA 3C35A 1FPBA 4R6HA 3EKIA 4XKNA 1FTLA 2P3VA 3FATA 1XI6A 4GBWA 4MNCA 3K4UA 5M2VA 3T9UA 5IZ3B 1B5JA 5K2XA 4F29A 5HBCA 3O28A 3S9MC 1BIYA 3T93B 4N81A 5TP9A 2GHBA 2YJPA 1N04A 3ZS6A 3K1MA 3C33A 4JVDA 1B51A 4MBPA 3H7MA 1LCFA 4GL0A 4MJOA 1ZKBA 3FV2A 1XHYA 1MY2A 2I4BA 4OWDA 4GWXA 1FPIA 3G7WA 3KN7A 4FECA 1FRPA 1USYE 4PP0A 3K6WA 3HSTA 5I2NB 3M8UA 4RNSA 4YU0A 3TMGA 4F1YA 1B32A 1SDXA 5H8SA 3KG2A 2Q8MA 4GX6A 5DEXB 3IO6A 5H8FB 4PBHA 1VFDA 4QSCA 3K6UA 4UA8A 2Z8EA 2Q74A 4PTKA 2RC8A 1IXGA 1O64A 4TLMB 1NH8A 3ILTB 2KR0A 5AA2B 3HHFA 4G8MA 3ONMA 2QS2A 4KYEA 2DOJA 3MP1A 1IXCA 1P1OA 1P1WA 1RKMA 2REJA 1AL3A 1IMAA 3IOTA 2PX1A 2FBPA 2NWJA 2OJTA 1NFTA 3T9VA 2IEEA 1MXZA 2L5VA 1SQYA 2O7IA 1USYH 1SYHA 4G68B 1OIBA 1AIVA 2OCUA 4E0XA 2I3VA 1EZ9A 4OHNA 1XT8A 3RGYA 2B65A 3A3UA 5T3JA 3HV1A 1CB6A 4YKJA 4H67A 2HXRA 3DP4A 4HE1A 3H6TA 4PAIA 3S9LC 1QJMA 4PF8A 2CZKA 1URGA 2AIXA 2QSXA 1MY3A 2F3BA 1LBXA 1S50A 5AA2D 3OD7A 4TOZA 2B3FA 5JTYB 2VP1A 2Y7IA 1JQFA 1Q35A 2DDKA 4PFTA 3TTLA 3K0VA 1B52A 3ISPA 3V5AA 5L9SA 2QL3A 5KCJB 1R9QA 3G3KA 3BFUA 2DP8A 2R9JA 3IAZA 2ZZWA 4DDDA 1IZ1A 4WKMA 3KGCA 4EQBA 5DVIA 4N6DA 3CFLA 3IOVA 1GVCA 2NXOA 2O7UA 1NUYA 4OFOA 4RPNA 2H4IA 4GBVA 4QBAA 1SW1A 2R71A 3EHUA 1TFAA 1N3XA 2AYSA 4R74A 4RXLA 1MQDA 4YB5A 2HPGA 3PD9A 2H25A 2F8DA 5CMCA 1H43A 3D1RA 4OMBA 5TPAB 1EU8A 3R7XA 5A5XA 4GVOA 4ZE9A 1G0IA 2WBBA 2XA5A 3HCQA 3Q27A 3EPEA 4PDDA 3PPRA 1VDWA 2WKYA 3U8QA 3G3JA 1INPA 4I3EA 1M5BA 1DMBA 2Y7WA 3PD8A 2PT2A 2DS9A 4MHFA 1JP4A 2XXHA 4RK2A 1NKXA 2DXRA 4PQJA 5I3SA 3THIA 1YTVA 3W9WA 3FGSA 3K6XA 1UIVA 4C0RA 1N76A 3T1BA 1POY1 5HPQA 1B2HA 5I84A 4PGNA 1TT1A 2DVCA 3FXQA 4P56A 3C9HA 5H8HB 5CBSA 3FD3A 4GWYA 1NNFA 1B1XA 1R6ZA 2OK2A 5CM6A 1R1NA 3RPLB 1JEVA 2FA7A 4F2OA 1MDQA 5I59B 3JYRA 2Z23A 3E79A 3PV0E 2GQ1A 3RN8A 4Q30B 2DSFA 3IX1A 3O6GA 1B6HA 4KYDA 2FIXA 2ZNUA 3R6UA 2Z8FA 3N26A 4ELPA 4GWWA 5EHSA 1IMCA 3TODA 3B6WA 3KJTA 4XKPA 4OENA 4IO4A 4R9FA 4QF9A 2F36A 3IB1A 4GQOA 1HSEA 2O1LA 5CBRA 2ZYMA 4U23A 5B70A 1XOCA 2XWVA 1DPPA 1RDXA 1OLCA 4PE3A 4EF2A 2XXQA 1NV6A 4RY1A 2ALUA 4H0WA 4Q0CA 1TXFA 4I62A 2F7AA 3C36A 1MXXA 4K3FA 5ET7A 1N84A 2XWKA 3S9NC 4KPTA 5IGAA 4OVTA 4H46A 1LAHE 3O29A 1FCKA 2GH9A 3BBRA 5EHMA 1PB8A 2RC9A 3LSXA 1P99A 1LBZA 4X04A 5TP9B 1TFDA 2QS4A 2VD3A 1NV5A 3SDFA 4R6YA 5H8QA 3U65A 5IZ1A 3S9EA 3RT6B 3PMXA 4F3SA 1OLAA 2XXTA 2HHMA 2DXYA 1NUZA 3CSBA 3MP6A 5F24A 2VT5A 1M5CA 1GV8A 4HCYA 3EHSA 4DI4B 3B6QA 3T96B 1ZBMA 3GBBA 4OTEA 3KC0A 2H9BA 4OVQA 4LONB 3MP8A 3FJGA 2ONSA 4NF0A 1PBPA 4ZZEA 3CIJA 2NVUB 4P47A 3QIMA 1NV2A 1EYJA 2I58A 3I5OA 4ELRA 4ESXA 3QAXA 4YZZA 4MLQA 1PDAA 3LC8A 4KR5A 2I49A 5I56B 2V84A 2XWOA 3OEMA 2Z8DA 3E4RA 4EUOA 5EQAA 1NNKA 4C1UA 3PPQA 5ET5A 3UP9A 4HW8A 2FYIA 3GLBA 2HEUA 3MZ1A 4IB2A 4FEDA 4YICA 1YYZA 2QS1A 1URSA 1LBYA 4GOTA 1FJ9A 3RY3A 4QRZA 2XXXA 3IFAA 1NV0A 3H3GA 1YZ0A 3K2DA 4LP2B 3FVGA 5ESYA 2DWIA 4R2FA 1I6BA 1JW1A 2PCRA 3F11A 1YPNA 2F6PA 5KDTA 1RDZA 1SI1A 2I0CA 3TTMA 2HXWA 2O6AA 1MXUA 2XD2A 5J16A 2WBDA 2V25A 4OANA 4TQUQ 4LUBA 4NF6B 4FJPA 3B8BA 4O3BA 3RQTA 4OA4A 2OWZA 4R6KA 3IORA 1IUDA 2HZKA 5IM2A 2LAOA 4OZ9A 3VLWA 4AB6A 4F39A 3FXRA 4GWSA 2NUVA 2ZMBA 3I6VA 5DYHA 2F35A 3Q26A 4DI3D 1FPEA 1FPFA 2RF1A 1GTKA 2BJIA 2QMXA 2X26A 2QRYA 4F22A 3G3IA 3MVXA 1D9QA 1JEUA 2Q88A 4LATA 4BDQA 1UTHA 3A3CA 3JZJA 5EQ9A 3BIHA 2BJJX 4F1VA 4DXBA 2PBWA 4MX6A 4LVQA 1BTJA 1B5IA 1NUXA 4H5GA 3GBAA 3K1NA 3MZ9A 1EZPA 2FIEA 4O8MA 4PE5B 2QS3A 2WYKA 2ESNA 1MPBA 3E78A 1LLSA 3O6IA 4OVSA 3ROJA 1M5DA 1JVYA 3OO7A 2XXKA 1Y1MA 4PAKA 3CFXA
chains in the Genus database with same CATH topology
2CZKA 2QPQA 2F3BA 1LBXA 1KZ8A 2FVZA 1FPKA 5I5PA 2WYPA 1LEVA 3HFUA 1FBCA 1FPDA 2DDKA 4P1LA 4PFBA 3ISPA 1NI9A 4OVRA 2QVVA 1FBDA 1FTAA 3CHGA 4FBPA 3T0JA 1FBHA 2WX9A 2QVUA 4PDHA 4N8YA 2ZZWA 3KC1A 5IZZA 4X8RA 2DE2A 4N6DA 4N6KA 1RDYA 4HE2A 1NUYA 5A5LA 4P3LA 1FBFA 4GBVA 4QBAA 2HZLA 5DW8A 4NG7A 4GX4A 1EYIA 3KBZA 1BK4A 1KA0A 4P8BA 4OVPA 5JK4A 4N15A 2HPGA 2PFYA 1KA1A 4O7MA 1FBGA 2PFZA 3D1RA 4GWZA 1DCUA 1G0IA 2WBBA 2XA5A 3RPLA 4GWUA 1YXIA 4X9TA 4MCOA 4P1EA 4PDDA 3W9VA 1Q9DA 1VDWA 4GX3A 4M1VA 5J1DA 4N17A 1INPA 2VPOA 4I3EA 4PGPA 2XWIA 1FSAA 3MYUA 4MHFA 1JP4A 5I3SA 3W9WA 2CEXA 2MKZA 2P3NA 3SZPA 3T1BA 4NN3A 1DBZA 2FHYA 4F18A 4PGNA 2KQZA 1NV1A 4P56A 4N8GA 4PF6A 1CNQA 3LUZA 4JVIA 2JJKA 4GWYA 5CM6A 3RPLB 4F1UA 3FBPA 4H45A 4XFEA 3E79A 2GQ1A 4O7IA 3RYDA 2FIXA 5FBPA 1IMDA 1FBPA 4MAGA 4IR8A 4GWWA 2QVRA 4NX1A 1IMCA 4PFIA 4I3YA 2DE3A 1AWBA 2Y5KA 4LN5A 5EQ8A 1IMFA 1IMBA 1FJ6A 2XWVA 4PFRA 1RDXA 4F19A 4PE3A 4HE0A 1K9YA 1NV6A 3IFCA 5EYGA 5ET7A 4XF5A 2XWKA 5IGAA 4OVTA 5EYHA 4O94A 4H46A 2V4CA 2ZZVA 4AS5A 2Q9TA 4P9KA 4MMPA 3GYYA 1NV3A 1FPLA 2B4MA 4G61A 1LBZA 4X04A 1NV5A 4NGUA 5IZ3A 3BIGA 2R8TA 4MIJA 3PTYA 2DVZA 3U65A 5IZ1A 4NAPA 3LV0A 4AS4A 1NUWA 1K9ZA 4PETA 2CZIA 3MSTA 1NV4A 2HHMA 1NUZA 4HXVA 5F24A 2VT5A 1EYKA 4HCYA 4PC9A 3B50A 4DI4B 5EQ7A 2F5XA 4I40A 4MEVA 1G0HA 3KC0A 3FXBA 4OVQA 4N4UA 4PBQA 4N91A 4NF0A 1FPGA 4P47A 1LBWA 1EYJA 1NV2A 2ZZXA 3A29A 2DE4A 4YZZA 1FPBA 4NHBA 2XWOA 3EKIA 5ET6A 5I7IA 2P3VA 1XI6A 4GBWA 4MNCA 5EQAA 5IZ3B 5ET5A 4YICA 2CZHA 4N81A 1LBVA 1YYZA 1LBYA 1FJ9A 4UABA 4JVDA 1SPIA 3IFAA 1NV0A 1YZ0A 4QXDA 5ESYA 4MJOA 2B4LA 2PCRA 4GWXA 1FPIA 1RDZA 1FRPA 2VPNA 1FBEA 5J16A 2WBDA 4OANA 2Q8MA 4GX6A 2V3QA 4PBHA 3NOHA 3B8BA 4MNIA 5LTCA 4OA4A 2OWZA 2HZKA 5IM2A 2Q74A 3QMFA 4PTKA 4GWSA 2KR0A 1DK4A 4DI3D 1FPFA 1FPEA 1QGXA 4HCWA 2BJIA 1FPJA 1IMAA 4PCDA 5LDZA 1D9QA 2FBPA 5EQ9A 3BIHA 2L5VA 2OX3A 4NQ8A 2WEFA 4F1VA 2CEYA 4MX6A 1NV7A 5ET8A 1NUXA 4MNPA 2F3DA 4JVCA 2QFLA 1IMEA 2FIEA 4O8MA 4PAFA 2WYKA 5T3JA 4XEQA 3E78A 4OVSA 3ROJA 2HXRA 4HE1A 4KXPA 4PAIA 2XXKA 2Y5LA 4PF8A 4PAKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P9K A;  4MMP A;  2CEX A;  3GYY A;  5I5P A;  4NN3 A;  2VPN A;  2WYP A;  4X04 A;  4PGN A;  4P1L A;  4PFB A;  4NGU A;  4P56 A;  4N8G A;  4PF6 A;  4OAN A;  4OVR A;  4MIJ A;  3U65 A;  4NAP A;  5CM6 A;  4PET A;  4PBH A;  2WX9 A;  4MNI A;  4PDH A;  5LTC A;  4OA4 A;  4N8Y A;  4XFE A;  2HZK A;  5IM2 A;  2ZZW A;  4PC9 A;  3B50 A;  4DI4 B;  5IZZ A;  4X8R A;  4N6D A;  4MEV A;  4N6K A;  3FXB A;  4OVQ A;  4N4U A;  4DI3 D;  4PBQ A;  4P3L A;  2HZL A;  4N91 A;  4MAG A;  4NG7 A;  4NF0 A;  4P47 A;  4NX1 A;  2ZZX A;  4PFI A;  4P8B A;  4OVP A;  4YZZ A;  4N15 A;  2HPG A;  4PCD A;  2PFY A;  4O7M A;  2PFZ A;  4NHB A;  4LN5 A;  2XWO A;  4NQ8 A;  5I7I A;  2XA5 A;  4MNC A;  2CEY A;  4MX6 A;  2XWV A;  4PFR A;  4MCO A;  4P1E A;  4MNP A;  4PDD A;  4PE3 A;  4YIC A;  4O8M A;  4PAF A;  2WYK A;  4XEQ A;  4N17 A;  2VPO A;  4PGP A;  4XF5 A;  2XWK A;  2XWI A;  4OVS A;  4UAB A;  5IGA A;  4OVT A;  4PAI A;  4O94 A;  2V4C A;  2ZZV A;  2XXK A;  4MHF A;  4PF8 A;  4PAK A; 
#chains in the Genus database with same CATH topology
 5A5X B;  1HSL A;  2DWJ A;  1ZLQ A;  4KYS A;  1KZ8 A;  1FPK A;  1EZO A;  5I5P A;  3OEL A;  4X1D A;  1J1N A;  1DPE A;  1SW2 A;  4GXA A;  1JW4 A;  3PPP A;  1NI9 A;  3LSF B;  1SVX B;  4IO3 A;  1MXY A;  2QVV A;  5ICT A;  1FTA A;  3CHG A;  1FBH A;  2XXV A;  4ELO A;  3OSQ A;  5I57 A;  4PDH A;  4HS7 A;  5HM4 B;  3TCG A;  4N8Y A;  3KSJ A;  4NF8 B;  3DP6 A;  5IZZ A;  2DE2 A;  1MQH A;  4YMA A;  5IAI A;  4DZ1 A;  2CZL A;  3G3G A;  1FBF A;  4H8J A;  4R2B A;  3CSG A;  1XS5 A;  3KBR A;  1KA0 A;  4P8B A;  5JK4 A;  2NOO A;  2AL5 A;  2O1M A;  1XVY A;  1KWH A;  2PFY A;  4O7M A;  2X7Q A;  4QFL A;  1FBG A;  1IEJ A;  5ICQ A;  3PPO A;  3IJO B;  4ECF A;  3O2A A;  1QUJ A;  1MQI A;  2UXA A;  4GWU A;  3RTW B;  2VGQ A;  5FHN A;  1A8F A;  4P1E A;  3W9V A;  1Q9D A;  4R73 A;  3MC2 A;  4M1V A;  1Y1Z A;  4G8N A;  4N17 A;  2ONK E;  2ZNS A;  2XWI A;  3TCH A;  4YB6 A;  1B7Z A;  3FVN A;  3FAS A;  3TUS A;  3SZP A;  4JWX A;  4GF8 A;  1US4 A;  4NN3 A;  1L5T A;  1ZMG A;  2P2A A;  5AA3 A;  3SET A;  4N8G A;  3IL1 B;  1A55 A;  4KD5 A;  3LUZ A;  3ZSF A;  4OVJ A;  4GXS B;  4IO5 A;  2DQV A;  3MVZ A;  3OO8 A;  3O97 A;  4MH5 A;  4NF4 A;  3MBP A;  2UYE A;  3UIF A;  4O7I A;  3C31 A;  1A7L A;  1QKB A;  1BP5 A;  5FBP A;  4MAG A;  4IR8 A;  5F1Q A;  3KOS A;  4NX1 A;  4ZEC A;  3ECR A;  1MQJ A;  1B40 A;  1VR5 A;  3CRB A;  5L9O A;  1NMU A;  3IR1 A;  3PMV A;  4RPO A;  4M4G A;  1ANF A;  3VVE A;  3T9H B;  1D9Y A;  1IMB A;  1B46 A;  4PFR A;  4F19 A;  4G68 C;  1QUK A;  4RJZ A;  4HE0 A;  2VD2 A;  4AQ4 A;  3IFC A;  3K6V A;  4KHZ E;  4NWD A;  4XF5 A;  4UAC A;  1VSO A;  4O94 A;  2A5T A;  1FW0 A;  2OWT A;  4AS5 A;  4NF5 A;  1FTO A;  2Q9T A;  3RPW A;  2Q2C A;  4ZEK A;  1D4N A;  2QJE A;  1PB9 A;  3GYY A;  4THI A;  1FPL A;  4F3B A;  1O63 A;  2B4M A;  1B4Z A;  3MPL A;  4R9G A;  1IXH A;  3IOW A;  5IZ3 A;  3PUY E;  4DLD A;  2H5Y A;  3MZB A;  1AOV A;  2CZI A;  3MST A;  2PVU A;  3TPA A;  4YKP A;  4HXV A;  5FHM A;  5ITP A;  4P11 A;  2DYX A;  3EQ1 A;  3B50 A;  4JXI A;  5KDT B;  5EQ7 A;  1B3G A;  3FVO A;  4IY5 A;  3CFZ A;  3FXB A;  1LFH A;  4RA1 A;  4GL8 A;  3FZV A;  1DTZ A;  5I58 A;  3MWB A;  4U1Z A;  1LBW A;  2ZZX A;  5IKB A;  3A29 A;  5I2N A;  5FTH A;  5CC2 A;  1I6A A;  1P1Q A;  5DTB A;  4QHQ A;  3E9X A;  4NHB A;  4R72 A;  1MDP 1;  3C32 A;  2VHA A;  4YB7 A;  2DWH A;  4WEP A;  1NNP A;  3OO9 A;  3Q28 A;  3CI8 A;  2CZH A;  5AA2 A;  2E0S A;  1Z7M E;  2VOZ A;  1B05 A;  3IK6 B;  1UTH B;  3TQL A;  4Z7E A;  1SPI A;  1N0T A;  3SEX A;  3T9X B;  1PC3 A;  4OQO A;  4JSO A;  2B4L A;  1LAG E;  2RKM A;  4PFY A;  3OO6 A;  2V3T A;  3B7D A;  3QYT A;  5H8N A;  1FBE A;  4U21 A;  2F6G A;  1UQW A;  4G77 A;  3KN8 A;  2D5W A;  4U1O A;  1HSJ A;  3KN3 A;  5EYF A;  2GRV A;  4MNI A;  5LTC A;  2F7B A;  1QKA A;  2RIN A;  3QMF A;  3IOU A;  4NTL A;  1XVX A;  3G3H A;  2HCA A;  2X7P A;  2YLN A;  2P0S A;  5TU0 A;  1MQG A;  3CG3 A;  1QGX A;  3RNN A;  4JDF A;  2H98 A;  1DTG A;  1EH3 A;  4NWC A;  5L8D A;  1WOD A;  2XXW A;  3UGW A;  3N6U A;  3U72 A;  2D21 A;  1JET A;  4DXC A;  5I57 B;  5JTY A;  2ZYO A;  3V89 B;  1Y3P A;  2Q8J A;  4IGT A;  4XIG Q;  5LDZ A;  4IO6 A;  4IO7 A;  4ZED A;  5DVF A;  2OX3 A;  2M8C A;  3P7I A;  4LZ5 A;  4YKK A;  4ND9 A;  1MPD A;  2OBG A;  5ET8 A;  4EF1 A;  2G93 A;  3KZG A;  2GFE A;  4MNP A;  2XXP A;  2F3D A;  1H3D A;  4FEB A;  4PAF A;  3OSR A;  3MUQ A;  2R6G E;  3DM0 A;  4XEQ A;  4XKQ A;  3UN6 A;  4MFI A;  4XKR A;  4OEV A;  2Y5L A;  5CRY A;  5AA4 A;  4G2Z A;  1OMP A;  2QPQ A;  3C34 A;  1B3L A;  4R75 A;  2FVZ A;  4QSD A;  4BDM A;  5TPA A;  3JV9 A;  2WYP A;  1LEV A;  3TAJ A;  3HFU A;  4OXV A;  1B1H A;  3LSL A;  4OVR A;  4F31 B;  3MVW A;  4KI0 E;  4DCX A;  3OMB A;  5LOM A;  1N3W A;  4Z0I A;  2HQ0 A;  1B7U A;  3TDJ A;  3MAM A;  5CI5 A;  4WXJ A;  4QFP A;  1FQA A;  2W7Y A;  3G3F A;  4U4S A;  3K02 A;  3H6U A;  2GHA A;  1S9T A;  4EDP A;  3DLN A;  1RDY A;  3UA8 A;  5DW8 A;  2DWA A;  4H6D A;  2ZYN A;  2I0B A;  3AXF A;  3S4U A;  4NG7 A;  3T66 A;  1ZIU A;  2OLB A;  1EYI A;  1B0H A;  3KBZ A;  4OYV A;  5B7D A;  2O68 A;  4OVP A;  4ZEI A;  4N15 A;  1KA1 A;  1SW4 A;  5H8H A;  2PFZ A;  5CMM A;  4NF4 B;  1MH3 A;  1FQE A;  4GWZ A;  4E0W A;  4O3C A;  1YCJ A;  2UVJ A;  3RPL A;  3TEL A;  1M5F A;  1YXI A;  2IA4 A;  4BDO A;  2XXU A;  3LR1 A;  4X48 A;  1MY1 A;  1RYO A;  3M3F A;  4GX3 A;  3KOT A;  2CMO A;  1LFG A;  5J1D A;  3TTN A;  1MS7 A;  1B58 A;  4XTC Q;  4OET A;  5DVJ A;  4HTG A;  3IB0 A;  1FQD A;  1MRP A;  5F7V A;  1P1N A;  2PYY A;  1FSA A;  3O9P A;  3MYU A;  3MQ9 A;  3FIR A;  4N13 A;  1POT A;  2P3N A;  1SBP A;  4DXU A;  4C1T A;  3WAE A;  2G29 A;  1Y20 A;  3QUF A;  1DBZ A;  2FHY A;  1SW5 A;  4ONY A;  1NV1 A;  2B3B A;  3O6H A;  3SEV A;  3VV5 A;  1GR2 A;  1FQB A;  2JJK A;  2A5T B;  4ZZA A;  3SER A;  1B3H A;  4GD5 A;  2REG A;  4G4P A;  3FBP A;  4RYA A;  4XFE A;  3LBS A;  2V93 A;  2HAV A;  1MY0 A;  4NE4 A;  1YAE A;  3T22 A;  1RYX A;  2HAU A;  1FBP A;  1JW5 A;  1US5 A;  2QVR A;  4I3Y A;  4H65 A;  2DE3 A;  1AWB A;  5AE4 A;  3W15 C;  2Y7R A;  3D4G A;  4LN5 A;  2D3I A;  4H1X A;  4QSE A;  5EQ8 A;  1IMF A;  1MM6 A;  2O84 X;  1M5E A;  4Q8R A;  3FVK A;  1LAX A;  1B7H A;  1WVJ A;  5I58 B;  3N5L A;  2Z22 A;  3V83 A;  1K9Y A;  1TWY A;  3PUX E;  1WDN A;  1XC1 A;  3A09 A;  5EYH A;  2P1S A;  4NMY A;  2V4C A;  2E1S A;  1MH4 A;  4ZS9 A;  3M3K A;  1UTB A;  4MMP A;  2XD3 A;  5I2K A;  5I56 A;  2XXR A;  4FAT A;  1AH5 A;  2O69 A;  4NGU A;  4MF3 A;  3BIG A;  2R8T A;  2Y7P A;  3L6H A;  2DVZ A;  5DT6 A;  4AS4 A;  1PBQ A;  1NUW A;  3QXM A;  4PET A;  1SD3 A;  2O51 A;  3WAF A;  1LB9 A;  2F34 A;  4PC9 A;  3U94 A;  3IO4 A;  3UOR A;  3SEW A;  1B4H A;  1OQH A;  3O66 A;  4GWO A;  4OES A;  3C4M A;  5H8N B;  1LFI A;  4GRK A;  4POW A;  2FNC A;  3FJM A;  4KQP A;  4N4U A;  3M3L A;  4PBQ A;  4YMB A;  4OEU A;  4EXL A;  3I3V A;  4KCD A;  3TKD A;  1FPG A;  3LSW A;  2Q2A A;  1SYI A;  3H6V A;  3IB2 A;  1NNT A;  3TZA A;  1OVT A;  3SEY A;  5ET6 A;  4NF6 A;  5I7I A;  4LZ8 A;  4P0G A;  4RK9 A;  2XHD A;  1MXV A;  2UVI A;  1ZU0 A;  1ZTY A;  3EHT A;  4N07 A;  5H8Q B;  4N6P A;  3QUJ A;  4JBZ A;  4DCY A;  1I69 A;  3VXB A;  4IO2 A;  1LBV A;  4F3P A;  2F7C A;  2Y7K A;  4KCC A;  4UAB A;  1Y4C A;  3MPK A;  4QXD A;  1FQC A;  3VVD A;  5CMB A;  4QFN A;  1IIW A;  4O3A A;  2Y84 A;  4JB7 A;  3QK6 A;  2VPN A;  1B9J A;  1B0L A;  5FTI A;  1II5 A;  3HN0 A;  2V3Q A;  5AA4 B;  3NOH A;  3VDF A;  4DE8 A;  2YPN A;  3MVY A;  2I4C A;  2OWS A;  1Q1K A;  3R26 A;  3FJ7 A;  1FTJ A;  3KJ7 A;  3SEU A;  5BUU A;  1DK4 A;  2I48 A;  2ONR A;  2THI A;  4HCW A;  4BDR A;  3E3K A;  3OXN A;  1FPJ A;  1H44 A;  3H6W A;  4PCD A;  3K01 A;  3ODB A;  1B3F A;  2UVG A;  5CMK A;  3TQW A;  3S2V A;  4NQ8 A;  1H76 A;  2WEF A;  4BLA A;  4ESW A;  3PUW E;  1DOT A;  2CEY A;  1NV7 A;  3MJN A;  2RC7 A;  1OQG A;  4NF8 A;  3HPI A;  3QSL A;  4JVC A;  2QFL A;  1LCT A;  3B6T A;  1IME A;  1QW0 A;  2ANJ A;  1CE2 A;  1DSN A;  1N7X A;  3HHG A;  4KXP A;  5DEX A;  3GXA A;  5H8F A;  3U1O A;  4ELQ A;  2F97 A;  3H03 A;  1MM7 A;  2A5S A;  1MPC A;  3PMW A;  4OER A;  1MXW A;  4H5F A;  4F3G A;  1A54 A;  4I1D A;  1BKA A;  4ZDM A;  1S7Y A;  2RCB A;  3H4Z A;  5FHO A;  2ZXT A;  1MG1 A;  4I9D A;  1FBC A;  1FPD A;  4P1L A;  3TYH A;  4PFB A;  3Q25 A;  4POX A;  3BKI B;  4JSD A;  2PMS A;  4FAJ A;  3FUZ A;  3EN3 A;  4IGR A;  1FBD A;  3RTF B;  4FBP A;  3T0J A;  5ELV A;  3VXC A;  3DP8 A;  2WX9 A;  1IXI A;  2QVU A;  3USD A;  3IJX B;  2AL4 A;  1LGB C;  4YAH X;  3KC1 A;  4X8R A;  3OEN A;  4G68 A;  1JVX A;  4N6K A;  4HE2 A;  2XX8 A;  1UIU A;  5A5L A;  4Q5T A;  4P3L A;  2HZL A;  4GX4 A;  4LQ2 A;  1BK4 A;  4AB5 A;  3RT8 A;  1MY4 A;  2I6E A;  2XXY A;  3KSX A;  4ZE8 A;  3V8X B;  3VVF A;  1PB7 A;  1A8E A;  3PPN A;  1FQF A;  1DCU A;  5BWJ A;  3U92 A;  4FIM A;  4ZEF A;  3MW0 A;  1R9L A;  3SKP A;  3LUY A;  4X9T A;  4JWY A;  4GIZ A;  4LZ7 A;  4MCO A;  2I3W A;  1URD A;  3K00 A;  4QFK A;  1Y3Q A;  2XX7 A;  3SES A;  3H06 B;  5L9M A;  3ZKL A;  3OOA A;  3PUZ E;  4L17 A;  2VPO A;  4PGP A;  4ISU A;  3OEK A;  1D9V A;  4MLV A;  5KCJ A;  3DEL B;  1I6Q A;  3ZKK A;  4F2Q A;  3TTK A;  2CEX A;  2MKZ A;  1FTK A;  3KEI A;  3PGF A;  1VFE A;  1LB8 A;  4F18 A;  1QUL A;  2KQZ A;  4OFL A;  1T0K A;  2UYF A;  1LBB A;  4PF6 A;  4U4X A;  1N7W A;  1CNQ A;  4JVI A;  1PEB A;  1ZJL A;  4F1U A;  2UVH A;  2ZYK A;  5ISU A;  2Q89 A;  1UTB B;  4H45 A;  4NED A;  3D4C A;  5I2K B;  3CVG A;  4I8C A;  2QMW A;  4OFJ A;  2H99 A;  1IIT A;  1H45 A;  3VLV A;  3RYD A;  1OVB A;  1A40 A;  4BDL A;  1D3K A;  1IMD A;  1VE4 A;  4XXU A;  3U93 A;  3CG1 A;  1SI0 A;  4YKI A;  1JNF A;  4PFI A;  5AA1 A;  4EQ7 A;  1QVS A;  2ABH A;  1AMF A;  4TLL B;  1NH7 A;  2Y5K A;  1ATG A;  1LAF E;  3RUM A;  4FE8 A;  2KLF A;  3CR9 A;  1Y9U A;  1FJ6 A;  1GGG A;  2F78 A;  4U2R A;  2OZZ A;  1B5H A;  3VE1 B;  2V3U A;  1NL5 A;  3HO7 A;  1O7T A;  1LBC A;  5EYG A;  3PU5 A;  5K2Y A;  3EF7 A;  4X1B A;  3KFM A;  3Q29 A;  4GLI A;  2XX9 A;  4GFR A;  3E13 X;  2ZZV A;  2XXI A;  3TFL A;  3L6G A;  5KZT A;  4JWO A;  4LQ5 A;  4P9K A;  1ELJ A;  5I59 A;  1NV3 A;  3ILU B;  4IY6 A;  1Y4T A;  4PFU A;  3PUV E;  4G61 A;  3FV1 A;  4U22 A;  5JEI A;  3VFJ A;  4FOR A;  4MIJ A;  3PTY A;  4WED A;  4NAP A;  4QFO A;  1IQ7 A;  3LV0 A;  3N6T A;  1K9Z A;  4DIG A;  1Z7N E;  1NV4 A;  1P1U A;  1Y3N A;  3FXU A;  1EYK A;  4ZEB A;  1LST A;  1BLF A;  4PFW A;  4EXK A;  3RLF E;  3TEP A;  2PT1 A;  4P0I A;  1QUI A;  2ZNT A;  3BFT A;  2F5X A;  4I40 A;  4MEV A;  1G0H A;  1A99 A;  3GZG A;  3VLU A;  5ITO A;  1B3E A;  4H8I A;  2HFB A;  3N94 A;  4EQ9 A;  4N91 A;  3TTR A;  1F9B A;  2RCA A;  3K1P A;  4LA9 A;  3TCF A;  4KFQ A;  4BDN A;  4NF5 B;  2DE4 A;  3UK4 A;  4G8H A;  1FTM A;  3C35 A;  1FPB A;  4R6H A;  3EKI A;  4XKN A;  1FTL A;  2P3V A;  3FAT A;  1XI6 A;  4GBW A;  4MNC A;  3K4U A;  5M2V A;  3T9U A;  5IZ3 B;  1B5J A;  5K2X A;  4F29 A;  5HBC A;  3O28 A;  3S9M C;  1BIY A;  3T93 B;  4N81 A;  5TP9 A;  2GHB A;  2YJP A;  1N04 A;  3ZS6 A;  3K1M A;  3C33 A;  4JVD A;  1B51 A;  4MBP A;  3H7M A;  1LCF A;  4GL0 A;  4MJO A;  1ZKB A;  3FV2 A;  1XHY A;  1MY2 A;  2I4B A;  4OWD A;  4GWX A;  1FPI A;  3G7W A;  3KN7 A;  4FEC A;  1FRP A;  1USY E;  4PP0 A;  3K6W A;  3HST A;  5I2N B;  3M8U A;  4RNS A;  4YU0 A;  3TMG A;  4F1Y A;  1B32 A;  1SDX A;  5H8S A;  3KG2 A;  2Q8M A;  4GX6 A;  5DEX B;  3IO6 A;  5H8F B;  4PBH A;  1VFD A;  4QSC A;  3K6U A;  4UA8 A;  2Z8E A;  2Q74 A;  4PTK A;  2RC8 A;  1IXG A;  1O64 A;  4TLM B;  1NH8 A;  3ILT B;  2KR0 A;  5AA2 B;  3HHF A;  4G8M A;  3ONM A;  2QS2 A;  4KYE A;  2DOJ A;  3MP1 A;  1IXC A;  1P1O A;  1P1W A;  1RKM A;  2REJ A;  1AL3 A;  1IMA A;  3IOT A;  2PX1 A;  2FBP A;  2NWJ A;  2OJT A;  1NFT A;  3T9V A;  2IEE A;  1MXZ A;  2L5V A;  1SQY A;  2O7I A;  1USY H;  1SYH A;  4G68 B;  1OIB A;  1AIV A;  2OCU A;  4E0X A;  2I3V A;  1EZ9 A;  4OHN A;  1XT8 A;  3RGY A;  2B65 A;  3A3U A;  5T3J A;  3HV1 A;  1CB6 A;  4YKJ A;  4H67 A;  2HXR A;  3DP4 A;  4HE1 A;  3H6T A;  4PAI A;  3S9L C;  1QJM A;  4PF8 A;  2CZK A;  1URG A;  2AIX A;  2QSX A;  1MY3 A;  2F3B A;  1LBX A;  1S50 A;  5AA2 D;  3OD7 A;  4TOZ A;  2B3F A;  5JTY B;  2VP1 A;  2Y7I A;  1JQF A;  1Q35 A;  2DDK A;  4PFT A;  3TTL A;  3K0V A;  1B52 A;  3ISP A;  3V5A A;  5L9S A;  2QL3 A;  5KCJ B;  1R9Q A;  3G3K A;  3BFU A;  2DP8 A;  2R9J A;  3IAZ A;  2ZZW A;  4DDD A;  1IZ1 A;  4WKM A;  3KGC A;  4EQB A;  5DVI A;  4N6D A;  3CFL A;  3IOV A;  1GVC A;  2NXO A;  2O7U A;  1NUY A;  4OFO A;  4RPN A;  2H4I A;  4GBV A;  4QBA A;  1SW1 A;  2R71 A;  3EHU A;  1TFA A;  1N3X A;  2AYS A;  4R74 A;  4RXL A;  1MQD A;  4YB5 A;  2HPG A;  3PD9 A;  2H25 A;  2F8D A;  5CMC A;  1H43 A;  3D1R A;  4OMB A;  5TPA B;  1EU8 A;  3R7X A;  5A5X A;  4GVO A;  4ZE9 A;  1G0I A;  2WBB A;  2XA5 A;  3HCQ A;  3Q27 A;  3EPE A;  4PDD A;  3PPR A;  1VDW A;  2WKY A;  3U8Q A;  3G3J A;  1INP A;  4I3E A;  1M5B A;  1DMB A;  2Y7W A;  3PD8 A;  2PT2 A;  2DS9 A;  4MHF A;  1JP4 A;  2XXH A;  4RK2 A;  1NKX A;  2DXR A;  4PQJ A;  5I3S A;  3THI A;  1YTV A;  3W9W A;  3FGS A;  3K6X A;  1UIV A;  4C0R A;  1N76 A;  3T1B A;  1POY 1;  5HPQ A;  1B2H A;  5I84 A;  4PGN A;  1TT1 A;  2DVC A;  3FXQ A;  4P56 A;  3C9H A;  5H8H B;  5CBS A;  3FD3 A;  4GWY A;  1NNF A;  1B1X A;  1R6Z A;  2OK2 A;  5CM6 A;  1R1N A;  3RPL B;  1JEV A;  2FA7 A;  4F2O A;  1MDQ A;  5I59 B;  3JYR A;  2Z23 A;  3E79 A;  3PV0 E;  2GQ1 A;  3RN8 A;  4Q30 B;  2DSF A;  3IX1 A;  3O6G A;  1B6H A;  4KYD A;  2FIX A;  2ZNU A;  3R6U A;  2Z8F A;  3N26 A;  4ELP A;  4GWW A;  5EHS A;  1IMC A;  3TOD A;  3B6W A;  3KJT A;  4XKP A;  4OEN A;  4IO4 A;  4R9F A;  4QF9 A;  2F36 A;  3IB1 A;  4GQO A;  1HSE A;  2O1L A;  5CBR A;  2ZYM A;  4U23 A;  5B70 A;  1XOC A;  2XWV A;  1DPP A;  1RDX A;  1OLC A;  4PE3 A;  4EF2 A;  2XXQ A;  1NV6 A;  4RY1 A;  2ALU A;  4H0W A;  4Q0C A;  1TXF A;  4I62 A;  2F7A A;  3C36 A;  1MXX A;  4K3F A;  5ET7 A;  1N84 A;  2XWK A;  3S9N C;  4KPT A;  5IGA A;  4OVT A;  4H46 A;  1LAH E;  3O29 A;  1FCK A;  2GH9 A;  3BBR A;  5EHM A;  1PB8 A;  2RC9 A;  3LSX A;  1P99 A;  1LBZ A;  4X04 A;  5TP9 B;  1TFD A;  2QS4 A;  2VD3 A;  1NV5 A;  3SDF A;  4R6Y A;  5H8Q A;  3U65 A;  5IZ1 A;  3S9E A;  3RT6 B;  3PMX A;  4F3S A;  1OLA A;  2XXT A;  2HHM A;  2DXY A;  1NUZ A;  3CSB A;  3MP6 A;  5F24 A;  2VT5 A;  1M5C A;  1GV8 A;  4HCY A;  3EHS A;  4DI4 B;  3B6Q A;  3T96 B;  1ZBM A;  3GBB A;  4OTE A;  3KC0 A;  2H9B A;  4OVQ A;  4LON B;  3MP8 A;  3FJG A;  2ONS A;  4NF0 A;  1PBP A;  4ZZE A;  3CIJ A;  2NVU B;  4P47 A;  3QIM A;  1NV2 A;  1EYJ A;  2I58 A;  3I5O A;  4ELR A;  4ESX A;  3QAX A;  4YZZ A;  4MLQ A;  1PDA A;  3LC8 A;  4KR5 A;  2I49 A;  5I56 B;  2V84 A;  2XWO A;  3OEM A;  2Z8D A;  3E4R A;  4EUO A;  5EQA A;  1NNK A;  4C1U A;  3PPQ A;  5ET5 A;  3UP9 A;  4HW8 A;  2FYI A;  3GLB A;  2HEU A;  3MZ1 A;  4IB2 A;  4FED A;  4YIC A;  1YYZ A;  2QS1 A;  1URS A;  1LBY A;  4GOT A;  1FJ9 A;  3RY3 A;  4QRZ A;  2XXX A;  3IFA A;  1NV0 A;  3H3G A;  1YZ0 A;  3K2D A;  4LP2 B;  3FVG A;  5ESY A;  2DWI A;  4R2F A;  1I6B A;  1JW1 A;  2PCR A;  3F11 A;  1YPN A;  2F6P A;  5KDT A;  1RDZ A;  1SI1 A;  2I0C A;  3TTM A;  2HXW A;  2O6A A;  1MXU A;  2XD2 A;  5J16 A;  2WBD A;  2V25 A;  4OAN A;  4TQU Q;  4LUB A;  4NF6 B;  4FJP A;  3B8B A;  4O3B A;  3RQT A;  4OA4 A;  2OWZ A;  4R6K A;  3IOR A;  1IUD A;  2HZK A;  5IM2 A;  2LAO A;  4OZ9 A;  3VLW A;  4AB6 A;  4F39 A;  3FXR A;  4GWS A;  2NUV A;  2ZMB A;  3I6V A;  5DYH A;  2F35 A;  3Q26 A;  4DI3 D;  1FPE A;  1FPF A;  2RF1 A;  1GTK A;  2BJI A;  2QMX A;  2X26 A;  2QRY A;  4F22 A;  3G3I A;  3MVX A;  1D9Q A;  1JEU A;  2Q88 A;  4LAT A;  4BDQ A;  1UTH A;  3A3C A;  3JZJ A;  5EQ9 A;  3BIH A;  2BJJ X;  4F1V A;  4DXB A;  2PBW A;  4MX6 A;  4LVQ A;  1BTJ A;  1B5I A;  1NUX A;  4H5G A;  3GBA A;  3K1N A;  3MZ9 A;  1EZP A;  2FIE A;  4O8M A;  4PE5 B;  2QS3 A;  2WYK A;  2ESN A;  1MPB A;  3E78 A;  1LLS A;  3O6I A;  4OVS A;  3ROJ A;  1M5D A;  1JVY A;  3OO7 A;  2XXK A;  1Y1M A;  4PAK A;  3CFX A; 
#chains in the Genus database with same CATH homology
 2CZK A;  2QPQ A;  2F3B A;  1LBX A;  1KZ8 A;  2FVZ A;  1FPK A;  5I5P A;  2WYP A;  1LEV A;  3HFU A;  1FBC A;  1FPD A;  2DDK A;  4P1L A;  4PFB A;  3ISP A;  1NI9 A;  4OVR A;  2QVV A;  1FBD A;  1FTA A;  3CHG A;  4FBP A;  3T0J A;  1FBH A;  2WX9 A;  2QVU A;  4PDH A;  4N8Y A;  2ZZW A;  3KC1 A;  5IZZ A;  4X8R A;  2DE2 A;  4N6D A;  4N6K A;  1RDY A;  4HE2 A;  1NUY A;  5A5L A;  4P3L A;  1FBF A;  4GBV A;  4QBA A;  2HZL A;  5DW8 A;  4NG7 A;  4GX4 A;  1EYI A;  3KBZ A;  1BK4 A;  1KA0 A;  4P8B A;  4OVP A;  5JK4 A;  4N15 A;  2HPG A;  2PFY A;  1KA1 A;  4O7M A;  1FBG A;  2PFZ A;  3D1R A;  4GWZ A;  1DCU A;  1G0I A;  2WBB A;  2XA5 A;  3RPL A;  4GWU A;  1YXI A;  4X9T A;  4MCO A;  4P1E A;  4PDD A;  3W9V A;  1Q9D A;  1VDW A;  4GX3 A;  4M1V A;  5J1D A;  4N17 A;  1INP A;  2VPO A;  4I3E A;  4PGP A;  2XWI A;  1FSA A;  3MYU A;  4MHF A;  1JP4 A;  5I3S A;  3W9W A;  2CEX A;  2MKZ A;  2P3N A;  3SZP A;  3T1B A;  4NN3 A;  1DBZ A;  2FHY A;  4F18 A;  4PGN A;  2KQZ A;  1NV1 A;  4P56 A;  4N8G A;  4PF6 A;  1CNQ A;  3LUZ A;  4JVI A;  2JJK A;  4GWY A;  5CM6 A;  3RPL B;  4F1U A;  3FBP A;  4H45 A;  4XFE A;  3E79 A;  2GQ1 A;  4O7I A;  3RYD A;  2FIX A;  5FBP A;  1IMD A;  1FBP A;  4MAG A;  4IR8 A;  4GWW A;  2QVR A;  4NX1 A;  1IMC A;  4PFI A;  4I3Y A;  2DE3 A;  1AWB A;  2Y5K A;  4LN5 A;  5EQ8 A;  1IMF A;  1IMB A;  1FJ6 A;  2XWV A;  4PFR A;  1RDX A;  4F19 A;  4PE3 A;  4HE0 A;  1K9Y A;  1NV6 A;  3IFC A;  5EYG A;  5ET7 A;  4XF5 A;  2XWK A;  5IGA A;  4OVT A;  5EYH A;  4O94 A;  4H46 A;  2V4C A;  2ZZV A;  4AS5 A;  2Q9T A;  4P9K A;  4MMP A;  3GYY A;  1NV3 A;  1FPL A;  2B4M A;  4G61 A;  1LBZ A;  4X04 A;  1NV5 A;  4NGU A;  5IZ3 A;  3BIG A;  2R8T A;  4MIJ A;  3PTY A;  2DVZ A;  3U65 A;  5IZ1 A;  4NAP A;  3LV0 A;  4AS4 A;  1NUW A;  1K9Z A;  4PET A;  2CZI A;  3MST A;  1NV4 A;  2HHM A;  1NUZ A;  4HXV A;  5F24 A;  2VT5 A;  1EYK A;  4HCY A;  4PC9 A;  3B50 A;  4DI4 B;  5EQ7 A;  2F5X A;  4I40 A;  4MEV A;  1G0H A;  3KC0 A;  3FXB A;  4OVQ A;  4N4U A;  4PBQ A;  4N91 A;  4NF0 A;  1FPG A;  4P47 A;  1LBW A;  1EYJ A;  1NV2 A;  2ZZX A;  3A29 A;  2DE4 A;  4YZZ A;  1FPB A;  4NHB A;  2XWO A;  3EKI A;  5ET6 A;  5I7I A;  2P3V A;  1XI6 A;  4GBW A;  4MNC A;  5EQA A;  5IZ3 B;  5ET5 A;  4YIC A;  2CZH A;  4N81 A;  1LBV A;  1YYZ A;  1LBY A;  1FJ9 A;  4UAB A;  4JVD A;  1SPI A;  3IFA A;  1NV0 A;  1YZ0 A;  4QXD A;  5ESY A;  4MJO A;  2B4L A;  2PCR A;  4GWX A;  1FPI A;  1RDZ A;  1FRP A;  2VPN A;  1FBE A;  5J16 A;  2WBD A;  4OAN A;  2Q8M A;  4GX6 A;  2V3Q A;  4PBH A;  3NOH A;  3B8B A;  4MNI A;  5LTC A;  4OA4 A;  2OWZ A;  2HZK A;  5IM2 A;  2Q74 A;  3QMF A;  4PTK A;  4GWS A;  2KR0 A;  1DK4 A;  4DI3 D;  1FPF A;  1FPE A;  1QGX A;  4HCW A;  2BJI A;  1FPJ A;  1IMA A;  4PCD A;  5LDZ A;  1D9Q A;  2FBP A;  5EQ9 A;  3BIH A;  2L5V A;  2OX3 A;  4NQ8 A;  2WEF A;  4F1V A;  2CEY A;  4MX6 A;  1NV7 A;  5ET8 A;  1NUX A;  4MNP A;  2F3D A;  4JVC A;  2QFL A;  1IME A;  2FIE A;  4O8M A;  4PAF A;  2WYK A;  5T3J A;  4XEQ A;  3E78 A;  4OVS A;  3ROJ A;  2HXR A;  4HE1 A;  4KXP A;  4PAI A;  2XXK A;  2Y5L A;  4PF8 A;  4PAK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...