2WX9A

Crystal structure of the sialic acid binding periplasmic protein siap
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
308
structure length
308
Chain Sequence
ADYDLKFGMNNGTSSNEYKAAEMFAKEVKEKSQGKIEISLYPSSQLGDDRAMLKQLKDGSLDFTFAESARFQLFYPEAAVFALPYVISNYNVAQKALFDTEFGKDLIKKMDKDLGVTLLSQAYNGTRQTTSNRAINSIADMKGLKLRVPNAATNLAYAKYVGASPTPMAFSEVYLALQTNAVDGQENPLAAVQAQKFYEVQKFLAMTNHILNDQLYLVSNETYKELPEDLQKVVKDAAENAAKYHTKLFVDGEKDLVTFFEKQGVKITHPDLVPFKESMKPYYAEFVKQTGQKGESALKQIEAINPHH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of the Sialic Acid Binding Periplasmic Protein Siap.
rcsb
source organism Haemophilus influenzae
molecule tags Transport protein
molecule keywords SIALIC ACID-BINDING PERIPLASMIC PROTEIN SIAP
total genus 123
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2009-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 2wx9A00
2WX9A 2WYKA 4NHBA 2VPNA 4N15A 5I5PA 2V4CA 4P9KA 4NQ8A 4OVTA 5IZZA 4N6DA 4MCOA 2HZLA 2CEYA 4PFRA 2ZZXA 4PCDA 4PDDA 4O94A 5IM2A 3U65A 2CEXA 4DI3D 4OVPA 4PAKA 4OVRA 4PF8A 2PFYA 2HPGA 4P56A 4PE3A 4P8BA 2PFZA 4P3LA 2XWOA 4PETA 3FXBA 4UABA 4N17A 5LTCA 2ZZWA 3B50A 4PFIA 5I7IA 4MEVA 4PFBA 2XWIA 4N8GA 4YZZA 4N4UA 4OVQA 4MHFA 2WYPA 2XWKA 4MX6A 4NG7A 4O8MA 4NN3A 2XXKA 4PF6A 4X04A 4MMPA 4OA4A 4X8RA 4N6KA 2HZKA 4NGUA 4PDHA 4LN5A 2ZZVA 4MAGA 4N91A 4N8YA 4MNCA 4MNPA 4PBHA 5IGAA 4O7MA 4DI4B 4P1LA 4PBQA 2XA5A 4PGNA 4NX1A 4PC9A 4NAPA 4OVSA 4XEQA 4PGPA 4P1EA 5CM6A 4YICA 4PAIA 4XFEA 2VPOA 4OANA 4P47A 4MNIA 4MIJA 4PAFA 4XF5A 3GYYA 4NF0A 2XWVA
chains in the Genus database with same CATH superfamily
2FIXA 5DTBA 4OFOA 1LAFE 4ESWA 1USYH 4KYDA 1DPEA 4JSOA 2FIEA 2L5VA 3K6XA 4U1OA 3HSTA 4PFRA 3CI8A 3PUVE 1URSA 4I3YA 5IM2A 3RGYA 4F1YA 4G68B 1HSEA 4PF8A 1MQHA 2F34A 1PB7A 4NWCA 4N17A 4JWOA 5H8QB 3Q26A 2BJJX 1N04A 5T3JA 4R6KA 3IFCA 5J16A 4DXCA 4ISUA 1AH5A 1XVYA 3LUYA 1Q35A 1VFEA 4Q30B 1EZOA 4R74A 5JK4A 2XXWA 3LR1A 5FHOA 4YB7A 4OTEA 1FSAA 2UVGA 1Y20A 3C31A 3B6TA 3E9XA 1GTKA 1LGBC 4AS5A 3OO8A 3TYHA 1O63A 1UTBA 1LFGA 5H8HA 1FPKA 3KN7A 4RYAA 3FZVA 3L6HA 2ZYKA 2XA5A 5KCJB 2UVJA 3TTMA 2B4LA 3B7DA 3QK6A 3TEPA 1YCJA 1EH3A 3HV1A 1G0HA 4HW8A 4POWA 1RKMA 3N5LA 1YZ0A 4NHBA 1MRPA 1O64A 1NV2A 4G68C 1A8FA 1IMBA 4JWYA 3QIMA 1XHYA 1LAGE 3PD8A 4GBWA 3VVDA 4PP0A 4GWXA 1PC3A 3H6WA 4Q8RA 1MH3A 4XKNA 3M3LA 1ZKBA 3FXRA 3N6UA 4F39A 2V93A 3A09A 3FV1A 4MLQA 4QSCA 4OQOA 1BK4A 5DVFA 4BDQA 5FBPA 1LAHE 1H45A 3PMXA 3QAXA 1B46A 3K0VA 4U2RA 4JWXA 2XWIA 2XXTA 1BLFA 5AA2B 1MQGA 1YPNA 2XWKA 3E79A 1XI6A 3I5OA 1N3WA 5F1QA 1B3LA 4PFYA 2P1SA 2CZKA 4FAJA 4N6KA 2AL4A 4E0XA 1WVJA 1XS5A 4LONB 4GWYA 2QMWA 1SW2A 2I0BA 3RTFB 1SI0A 1AWBA 1EU8A 1AMFA 4JDFA 4ZE8A 2F5XA 1P1UA 4GWWA 1I69A 3LBSA 3IFAA 4JXIA 2NXOA 3QYTA 3OO6A 4MIJA 3H03A 3TFLA 3KSJA 1NUXA 5FHNA 3H7MA 5L8DA 2GHBA 1FBPA 4FECA 4KI0E 2I4CA 2XX8A 3PPPA 4MCOA 1N7WA 3A29A 5H8SA 3Q25A 3C36A 3IR1A 4ELRA 1INPA 2DXYA 1FCKA 2Y5KA 5TPAB 4C0RA 2PFYA 2PVUA 4R6YA 4O3BA 4IO2A 4C1TA 3RT6B 4UABA 1XOCA 5I57A 4H45A 3RN8A 4DCYA 3LSXA 2D3IA 2NOOA 4NWDA 3RQTA 4N8GA 5AA4B 4N4UA 3ROJA 1DTZA 2YLNA 2MKZA 1M5FA 3UIFA 3DP6A 1LFHA 4OHNA 4FEBA 4X8RA 2Z8DA 4QXDA 3E4RA 3FJMA 2WEFA 5H8QA 4N8YA 3E3KA 3O28A 4MNPA 2OCUA 2UYFA 4GF8A 3UN6A 4N81A 3U92A 1EYKA 1NV5A 2DQVA 3RYDA 3ODBA 5ESYA 3OD7A 1OVBA 2XXRA 3OSQA 2O7UA 4OANA 4PAFA 1UIVA 1Q1KA 1VE4A 1B1XA 2D21A 3W9VA 1ZU0A 2ZNUA 4PFUA 4AB6A 2XX7A 3VLWA 1FTJA 4NF8B 2WBBA 4GFRA 4OVTA 5DVJA 4FIMA 1IIWA 2HEUA 1K9YA 3P7IA 1AIVA 4F31B 2CEYA 1LLSA 4LUBA 4PCDA 3MP1A 1PB8A 2ALUA 4YKIA 1MXYA 3E78A 2IA4A 4U21A 4YMBA 1B5HA 5CMKA 1HSLA 3TMGA 4IB2A 3BFUA 1B05A 4U4SA 3S9LC 3RT8A 4IO7A 2Y7IA 2H98A 3GXAA 4ZE9A 2FYIA 5I56B 1YXIA 2REGA 2UVHA 4RK2A 1EZPA 4YKJA 3V5AA 1B7UA 1B7ZA 1Q9DA 1VSOA 1B4HA 3FASA 5F7VA 2H25A 2Y7PA 1SW4A 4R9FA 1URDA 1H44A 1NV3A 1CB6A 2A5TA 3UK4A 4MF3A 3PUXE 3BIHA 5H8FB 1FW0A 4TQUQ 2V3QA 3KSXA 4N91A 3CSGA 1GR2A 3O97A 4H5GA 3KN3A 4QSEA 2XXQA 2UVIA 3IOTA 2LAOA 1ZMGA 4O7IA 2R71A 1FBHA 5CM6A 1F9BA 1B0HA 2I3WA 3RNNA 1NMUA 1MQDA 3T93B 1UTHB 1R9QA 4YMAA 3IL1B 2VD3A 3K1MA 1USYE 5CBSA 1ZBMA 4G8NA 2Q9TA 3S9EA 5ET8A 2V3UA 3BKIB 1SW1A 1N84A 1IMAA 2P3NA 1IMEA 3A3CA 4DI3D 3VVEA 4QHQA 4I9DA 5F24A 2DDKA 5L9MA 5CC2A 3WAFA 5ICTA 2I58A 4OMBA 1EYIA 5DYHA 5EQ9A 1A99A 2QJEA 2Y7RA 2ZYMA 3MYUA 4R6HA 5I7IA 1VDWA 3DM0A 3HHGA 2F36A 4MFIA 1FRPA 1FBGA 4H6DA 2DWIA 2Q8MA 4MX6A 1IUDA 3OMBA 2HAVA 2Q2AA 2THIA 3TCHA 2HCAA 3OO9A 4NN3A 4HCWA 4P0IA 5AA4A 4F19A 2H99A 3SEWA 4HE0A 5CMBA 2FBPA 1Y3PA 5IGAA 5IKBA 2VOZA 2ZMBA 1M5DA 1US5A 1UTBB 4LZ5A 5IZ3B 3C32A 4PC9A 5FTHA 1IZ1A 3T66A 3H6VA 4GXSB 3CFLA 2H4IA 4NF6A 1FTMA 5FHMA 1LBYA 1FTAA 2HFBA 1O7TA 1NNTA 4NF0A 2XWVA 2WX9A 2WYKA 1RDZA 4I40A 5AE4A 3H06B 1POTA 3EHTA 1JEUA 3PPNA 5EQ8A 4RJZA 1B52A 2RKMA 1DK4A 3C9HA 4EF1A 3PPQA 5ET5A 3BFTA 3VDFA 4PTKA 3FUZA 2QS1A 2Q89A 3KC0A 4POXA 1CE2A 3N6TA 4OVRA 4HCYA 2PMSA 3B6WA 1B32A 1BKAA 4OETA 3E13X 3MWBA 2AIXA 1A7LA 3SETA 2O6AA 5IZ1A 5K2YA 2O51A 3H4ZA 1DOTA 3C4MA 3MP6A 2JJKA 3CVGA 1D3KA 3KZGA 2F7CA 4MH5A 1LB9A 1QGXA 3VXBA 3K4UA 4MHFA 2Q2CA 3CIJA 3RPLB 3U93A 4FE8A 1LBXA 1JW5A 4PF6A 1MXVA 4G8MA 4OA4A 5H8NB 1NNPA 2W7YA 1N0TA 4KYSA 1K9ZA 2DWJA 3SEVA 2ONRA 2P3VA 4WKMA 2HXWA 4PFWA 3TPAA 1ATGA 5KZTA 4NX1A 4NAPA 1Y1ZA 4OZ9A 3SDFA 2QVUA 5A5LA 4P1EA 2PT1A 3K6UA 4IR8A 3K1PA 3JYRA 1J1NA 4MNIA 1Y3QA 4HXVA 3OEKA 2VPNA 3VLUA 5ISUA 3KN8A 4HS7A 1QVSA 2XXUA 5B7DA 3IK6B 3QUFA 4R72A 3SESA 3S9MC 3RY3A 5CMCA 2OX3A 5ICQA 4PDDA 1MH4A 2RCAA 1B3EA 2F6PA 2FHYA 2XWOA 5LDZA 4UACA 1EZ9A 4F1UA 2ZZWA 3FXQA 4KXPA 3TQWA 4DDDA 1FQEA 3TUSA 2QMXA 4GWZA 1YYZA 3WAEA 4OESA 1POY1 3C35A 4GVOA 2WYPA 3T1BA 1P99A 5EYHA 5HM4B 4YAHX 3KBRA 3IO6A 3V89B 5DEXB 5LOMA 2Y84A 4LVQA 5ET6A 1FPFA 3RPWA 3Q27A 4NF5B 5TP9A 3MVWA 1RDXA 1A55A 3ZSFA 3D4GA 4I62A 4IY5A 4PBHA 3O9PA 4QFLA 1MXUA 4BDRA 1NUZA 5A5XB 1NNKA 4GX3A 4XEQA 4RNSA 5H8FA 1D9QA 3TELA 4EQ7A 4I8CA 2G29A 3MZ1A 2ONKE 2VPOA 1A54A 4QFPA 1GV8A 4F1VA 2OZZA 3ILTB 5I2NA 4G77A 2PX1A 2B3FA 2I6EA 3VV5A 1RYXA 1FTLA 3MSTA 2HXRA 3KJ7A 4OEVA 3SEUA 3MZBA 5CRYA 2QVVA 2V25A 2RC9A 4MJOA 4EF2A 3TQLA 2X26A 3MBPA 3GBAA 1NI9A 4TLLB 2ZYOA 5JTYB 4PE3A 1HSJA 4P3LA 3GBBA 1P1NA 1MS7A 4XXUA 2XXPA 4NF4A 5LTCA 2XHDA 1N76A 4TLMB 4OEUA 3G3FA 5KCJA 5J1DA 4X48A 1DPPA 1PDAA 1IMCA 2XX9A 2XXYA 3N26A 3OELA 1B9JA 2Q8JA 3PPOA 5I56A 4GRKA 3N94A 1NV6A 1LFIA 3LSWA 2R6GE 4PE5B 1XC1A 3CHGA 1R6ZA 4IO6A 3GZGA 1B3GA 1LEVA 4KYEA 4GWOA 2D5WA 4IO5A 1FPJA 3KG2A 1TT1A 1N3XA 3M3FA 1JW4A 1H3DA 1B6HA 1DBZA 2KLFA 1MY1A 3TTNA 1II5A 3IOVA 4OFLA 4OENA 3MZ9A 4LQ2A 2R9JA 2WBDA 2Z8FA 1NUYA 2PT2A 3OEMA 1M5CA 4R9GA 3TDJA 4X9TA 2QS4A 4ZEIA 2O84X 4YU0A 2I49A 4LZ7A 4DXBA 2VD2A 4H5FA 3O66A 2RC7A 3B8BA 1S7YA 1MQIA 4LA9A 1P1OA 2Z23A 2VHAA 4RPOA 3OXNA 3THIA 4JVCA 2HZLA 4I1DA 1OLAA 3PV0E 4N13A 4ZZEA 2KQZA 4KPTA 2OWTA 1NL5A 1LCTA 2OWZA 3SZPA 4P56A 5CI5A 4P8BA 2PFZA 3VFJA 5AA3A 1QUKA 1QW0A 2F8DA 4H1XA 5FTIA 4YKPA 2XXVA 3FVNA 1T0KA 4MEVA 3IB1A 1LBBA 4IGTA 3CFZA 2V84A 4K3FA 1SBPA 4BDOA 4XKPA 2O69A 1TXFA 2ESNA 4H65A 4P11A 4X04A 1DTGA 1M5EA 4C1UA 3K02A 3QMFA 1MXXA 1JVXA 2ZZVA 1LB8A 1Y1MA 1G0IA 4ZEKA 4NEDA 4F3SA 3JV9A 3MQ9A 4O7MA 2ZXTA 2I0CA 3PUWE 2ABHA 4R2FA 5TPAA 2UYEA 5TP9B 5EYFA 4GLIA 3F11A 1SDXA 2R8TA 2B3BA 3QXMA 2XD3A 4YKKA 2AL5A 2Q88A 4H0WA 4QFNA 4WEPA 4GWUA 3BIGA 2QPQA 3D1RA 4KCCA 4R75A 3T96B 1I6QA 4GD5A 5I5PA 3IJXB 2V4CA 4KD5A 3MPKA 1OIBA 1MY2A 3K2DA 4F18A 5I58A 3IOWA 4O94A 4EDPA 1JVYA 2GRVA 2O68A 3CG3A 2I48A 1PEBA 1PBPA 3CRBA 3SEXA 1D9VA 1MXWA 1B5JA 4PETA 3FXBA 1DMBA 4QFOA 1MPBA 2ZNTA 3MC2A 4U23A 3B50A 4PFIA 4GXAA 5A5XA 2I3VA 2E0SA 4EQ9A 2UXAA 4ZEDA 4HE2A 3U8QA 3IB0A 4FORA 5ITPA 1MM7A 4EXKA 4DXUA 1A40A 4NF6B 4O8MA 3USDA 1XVXA 1NV1A 3T0JA 4DLDA 3SKPA 1WDNA 2F7BA 4LZ8A 4MMPA 2PCRA 1B7HA 4G61A 1XT8A 3AXFA 1IITA 4OERA 3PTYA 5TU0A 3H3GA 3ISPA 4ZS9A 2DSFA 3H6UA 4DI4B 3EHSA 3VLVA 4PBQA 3K6WA 5I59A 2F7AA 3KOTA 1OVTA 1MPCA 2X7PA 2DE2A 4KCDA 4RXLA 2DVCA 3C34A 4LQ5A 2E1SA 4IY6A 1BIYA 3O6HA 2G93A 4RK9A 4N15A 2HHMA 1MDQA 1JQFA 4G68A 5KDTB 4JVIA 1NH8A 2VGQA 3SERA 1TWYA 3GLBA 2HQ0A 1I6AA 1RYOA 4BDMA 3RTWB 4NE4A 5DW8A 4M4GA 2PBWA 4OVPA 2KR0A 4THIA 4JSDA 1FPEA 1R1NA 4H8IA 4FBPA 3O2AA 3ECRA 1FBDA 4R2BA 1IEJA 4Q5TA 1FQCA 1MG1A 2O1MA 4PFBA 1Z7ME 4OVQA 1FQBA 1FTOA 1LSTA 1Y9UA 5I2KB 4NG7A 3L6GA 5DT6A 3LV0A 3K6VA 1A8EA 5H8NA 4AB5A 1UQWA 1ELJA 3UP9A 4HE1A 4HTGA 5I59B 5JEIA 5DEXA 4GWSA 2B65A 1GVCA 3OSRA 4U1ZA 4GIZA 1IXCA 4KFQA 3IORA 3ZKLA 4R73A 1NV0A 4G4PA 4H46A 4G8HA 3MW0A 3W15C 3EF7A 1KA1A 2WKYA 4P47A 3T9XB 1NH7A 3EKIA 1QKBA 4N07A 1L5TA 2NUVA 4XF5A 4OFJA 3GYYA 3T9VA 4BDNA 3S9NC 1QKAA 4EUOA 2RF1A 2RINA 2F3BA 3IJOB 4I3EA 2DOJA 3I6VA 1TFAA 1CNQA 4P9KA 1UTHA 2Z22A 4DZ1A 4M1VA 5IZZA 1Y3NA 4N6DA 3PMVA 5EHMA 1ZLQA 1URGA 3KOSA 2ZZXA 4NMYA 3MVYA 5I2KA 4GBVA 1OQHA 2F6GA 3TTRA 2DE3A 3K1NA 3FGSA 4P0GA 1VR5A 2ONSA 2Y7KA 1DCUA 3SEYA 1QULA 4MBPA 4QBAA 4FJPA 3HFUA 3OENA 3PUZE 2FA7A 2OWSA 2DE4A 4ELPA 1FQDA 3OO7A 1YAEA 2GQ1A 1B1HA 1QUIA 3G3JA 4YZZA 2P0SA 1S9TA 4OVJA 5M2VA 3MJNA 5CMMA 3CFXA 3G7WA 3EQ1A 3T9UA 1LBZA 1NV4A 2GH9A 4RY1A 1FJ6A 1OMPA 1JNFA 2YJPA 1OLCA 2OLBA 4NGUA 3T9HB 2RC8A 4JBZA 4DE8A 3FVKA 4MAGA 1JP4A 4WEDA 1GGGA 1ZJLA 4FATA 3UORA 1B3HA 3LSLA 3QUJA 1N7XA 1FPIA 1RDYA 4UA8A 4YB5A 1B5IA 3Q29A 2F3DA 3TKDA 5L9OA 4PGPA 1B58A 2CZIA 1FTKA 2YPNA 4ZDMA 2X7QA 2DWAA 5I57B 3R26A 1B0LA 3HHFA 1ZTYA 1IXGA 4KR5A 4F3PA 1WODA 4IO3A 2QS3A 1Y4TA 3EPEA 1NKXA 5H8HB 3KC1A 3ZKKA 5HBCA 1KZ8A 1NUWA 3FV2A 1VFDA 2DVZA 4FEDA 3FVGA 1KWHA 4O3AA 5JTYA 2QRYA 2CEXA 4NF5A 4PAKA 3C33A 3U94A 1MXZA 2XD2A 1FJ9A 3CR9A 1I6BA 5I84A 1PB9A 2FNCA 1B51A 2QS2A 1AOVA 4H8JA 3FVOA 1LBVA 1DSNA 4F2OA 3BBRA 2BJIA 3V8XB 4JB7A 3LSFB 3G3HA 3CSBA 4KQPA 3IAZA 1FQAA 3R6UA 2XXKA 5CBRA 4U22A 4ZEFA 1FBCA 3CG1A 2HZKA 2H5YA 4LATA 4H67A 1JW1A 4O3CA 4G2ZA 4X1BA 1ZIUA 5EYGA 4GL0A 4DIGA 3V83A 4TOZA 1B40A 5EQAA 2Y5LA 5IZ3A 1S50A 3VE1B 1LCFA 4YICA 3FJ7A 2O1LA 2QFLA 4XTCQ 1MY3A 1SPIA 1P1WA 2XXIA 3KBZA 1AL3A 3DELB 3T22A 3K01A 3IX1A 4F29A 2CZHA 3FIRA 4ONYA 3LC8A 4RA1A 5AA2D 4AS4A 3EN3A 4F22A 2Y7WA 2ANJA 1IMDA 1FBEA 3U65A 3U72A 5KDTA 3HO7A 2DP8A 3R7XA 3I3VA 1SYIA 3O6GA 2HPGA 3W9WA 1M5BA 4ND9A 4OWDA 4Z0IA 3ZS6A 3TZAA 2V3TA 2DWHA 1MPDA 1MY4A 4XKQA 5AA2A 1TFDA 3TAJA 4ZEBA 4NTLA 2AYSA 1LAXA 3FJGA 1BP5A 2H9BA 4YB6A 4ESXA 3K00A 2DS9A 4PFTA 4GOTA 1IXIA 2F97A 1SD3A 3OOAA 2HAUA 4GL8A 3PPRA 3Q28A 4QFKA 4EXLA 3RUMA 2VP1A 3RPLA 2O7IA 4LN5A 3KEIA 3PGFA 2IEEA 2A5SA 5BWJA 3PUYE 4MNCA 4GX4A 5ET7A 3TCFA 2FVZA 2NVUB 2GHAA 4E0WA 1JEVA 1SW5A 3DP4A 3MVXA 4EQBA 3U1OA 1NFTA 3RLFE 4PAIA 4NF4B 5ELVA 3TCGA 1SI1A 5BUUA 4F3BA 1Z7NE 3S2VA 1IQ7A 2OK2A 4DCXA 3ILUB 3IO4A 3M3KA 1FBFA 2XXHA 1YTVA 1FPLA 3FXUA 5I2NB 4F2QA 4NQ8A 5L9SA 5I58B 3B6QA 5I3SA 4BLAA 1D9YA 5DVIA 4ZECA 2QSXA 1H43A 1EYJA 1JETA 2P2AA 4AQ4A 1B3FA 3MP8A 4QF9A 2OJTA 4U4XA 1FPGA 4NF8A 3KJTA 3LUZA 3KGCA 2Q74A 4GX6A 1BTJA 3KFMA 3MVZA 3MPLA 3TODA 3QSLA 4KHZE 5B70A 2I4BA 4OXVA 4Q0CA 1B2HA 1KA0A 3UA8A 3A3UA 3UGWA 1MQJA 4GQOA 3ONMA 2B4MA 4Z7EA 5AA1A 3MUQA 4ELOA 5HPQA 2VT5A 1P1QA 3DLNA 3VXCA 1MY0A 3PD9A 1ANFA 3M8UA 3FATA 3EHUA 4MLVA 2RCBA 1QJMA 2GFEA 4OVSA 2NWJA 4XFEA 1MDP1 3DP8A 2F35A 2Z8EA 1FQFA 3IB2A 3PMWA 1PBQA 4JVDA 1MM6A 3G3KA 4N6PA 1IMFA 4RPNA 1NV7A 4LP2B 4ZZAA 2M8CA 3PU5A 1LBWA 3HPIA 3D4CA 4ELQA 3H6TA 2QL3A 2OBGA 1QUJA 1SQYA 2PYYA 2ZYNA 2XXXA 2REJA 3HCQA 2CMOA 3G3GA 4ECFA 4L17A 5IAIA 5K2XA 3O29A 2CZLA 4PQJA 1NNFA 1R9LA 4BDLA 5EQ7A 4IGRA 3VVFA 4QRZA 3TTKA 1SVXB 3FD3A 3JZJA 3NOHA 1FPBA 1H76A 2A5TB 2F78A 1OQGA 3G3IA 3TTLA 4IO4A 4F3GA 4WXJA 2DYXA 4X1DA 1IXHA 4PDHA 5ITOA 2QVRA 4XIGQ 1D4NA 1Y4CA 1UIUA 3IOUA 3O6IA 4P1LA 4XKRA 1FPDA 3HN0A 4PGNA 4QSDA 5EHSA 3S4UA 1SYHA 1B4ZA 2ZNSA 2DXRA 3MAMA 3FBPA 1LBCA 4OYVA 1US4A
chains in the Genus database with same CATH topology
2FIXA 2QPQA 2WX9A 2WYKA 2VPNA 3D1RA 3KBZA 4N15A 4NHBA 3W9VA 2HHMA 2F3BA 1NUXA 1RDZA 1FBFA 4I40A 4I3EA 5I5PA 1FPLA 1NV2A 2V4CA 1IMFA 2WBBA 1CNQA 1FBPA 4JVIA 4P9KA 4NQ8A 2CZHA 1NV7A 3MSTA 3KC1A 1IMBA 4OVTA 2Q9TA 1KZ8A 2HXRA 1NUWA 4M1VA 5IZZA 2FIEA 1K9YA 2L5VA 1LBWA 4MCOA 4N6DA 4JVCA 5EQ8A 5ET8A 3A29A 1DK4A 2HZLA 2CEYA 2DVZA 4AS4A 4GBWA 4PFRA 2OX3A 5I3SA 4F18A 2ZZXA 4GWXA 1IMAA 2KQZA 1INPA 4PCDA 4O94A 4PDDA 2QVVA 4I3YA 4GBVA 5ET5A 1IMDA 4PTKA 5DW8A 5IM2A 1FBEA 1IMEA 2DE3A 2P3NA 4MJOA 3U65A 3KC0A 2CEXA 3E78A 2Y5KA 4OVPA 4DI3D 3B8BA 4OVRA 4PAKA 1NI9A 4PF8A 2PFYA 1EYJA 4HCYA 2OWZA 3SZPA 2HPGA 2FHYA 4P56A 4PE3A 5F24A 2KR0A 2PFZA 4P8BA 3W9WA 4P3LA 2DDKA 1DCUA 1FPEA 1FJ9A 2XWOA 4PETA 3FXBA 4UABA 1BK4A 1EYIA 4FBPA 5EQ9A 4QBAA 5LDZA 4N17A 1FBDA 5FBPA 3HFUA 4H45A 5IZ1A 5LTCA 4F1UA 3MYUA 2ZZWA 1FPGA 3LUZA 4KXPA 3B50A 2DE4A 4PFIA 5T3JA 5I7IA 1VDWA 2JJKA 2Q74A 3IFCA 4GX6A 1YXIA 5J16A 1LBVA 5J1DA 2GQ1A 4MEVA 4PFBA 2XWIA 4N8GA 1IMCA 4YZZA 5EQ7A 2BJIA 4N4UA 4OVQA 3ROJA 4GWZA 4HE2A 1QGXA 1YYZA 1FRPA 4MHFA 1FBGA 1NV6A 3T1BA 5JK4A 2WYPA 2XWKA 4MX6A 4NG7A 2Q8MA 5EYHA 3NOHA 3E79A 1XI6A 3LV0A 1Q9DA 1KA0A 1LBZA 3CHGA 2MKZA 1FPBA 1FSAA 3RPLB 4O8MA 1LEVA 1LBXA 2B4MA 1NV4A 1NV1A 2XXKA 4NN3A 1FJ6A 4PF6A 4HCWA 4HE1A 4X04A 3T0JA 1FPJA 5ET6A 1FPFA 2CZKA 4F19A 4AS5A 1NV3A 2VT5A 4MMPA 1FBCA 4OA4A 4X8RA 3RPLA 4N6KA 2HZKA 4QXDA 4NGUA 4GWSA 1DBZA 3QMFA 2PCRA 2QVRA 2WEFA 4LN5A 3BIHA 4PDHA 2ZZVA 4HE0A 4GWYA 1RDXA 4G61A 4MAGA 1JP4A 2V3QA 4N8YA 2FBPA 1K9ZA 4N91A 4GWUA 4MNCA 4MNPA 4GX4A 4PBHA 5EYGA 5IGAA 5ET7A 1FPKA 1G0IA 3PTYA 3ISPA 4XF5A 1AWBA 2WBDA 2FVZA 1FPIA 1NUYA 4O7MA 2P3VA 4P1LA 5IZ3B 4DI4B 1FPDA 4PBQA 4N81A 1RDYA 1EYKA 1NV5A 3RYDA 2F5XA 2XA5A 1NUZA 4GWWA 4PGNA 5EQAA 2F3DA 2Y5LA 1NV0A 4NX1A 4O7IA 4GX3A 4NAPA 4OVSA 4PC9A 4PGPA 4XEQA 5ESYA 3IFAA 2CZIA 2B4LA 1D9QA 5IZ3A 2DE2A 1FBHA 4X9TA 4H46A 2QVUA 5A5LA 4P1EA 5CM6A 4JVDA 4YICA 4PAIA 4IR8A 1LBYA 2R8TA 2VPOA 1KA1A 2QFLA 1FTAA 4XFEA 3FBPA 4OANA 1G0HA 4P47A 4MNIA 4MIJA 4PAFA 4F1VA 1SPIA 3EKIA 1YZ0A 4HXVA 3GYYA 3BIGA 4NF0A 2XWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WX9 A;  2WYK A;  4NHB A;  2VPN A;  4N15 A;  5I5P A;  2V4C A;  4P9K A;  4NQ8 A;  4OVT A;  5IZZ A;  4N6D A;  4MCO A;  2HZL A;  2CEY A;  4PFR A;  2ZZX A;  4PCD A;  4PDD A;  4O94 A;  5IM2 A;  3U65 A;  2CEX A;  4DI3 D;  4OVP A;  4PAK A;  4OVR A;  4PF8 A;  2PFY A;  2HPG A;  4P56 A;  4PE3 A;  4P8B A;  2PFZ A;  4P3L A;  2XWO A;  4PET A;  3FXB A;  4UAB A;  4N17 A;  5LTC A;  2ZZW A;  3B50 A;  4PFI A;  5I7I A;  4MEV A;  4PFB A;  2XWI A;  4N8G A;  4YZZ A;  4N4U A;  4OVQ A;  4MHF A;  2WYP A;  2XWK A;  4MX6 A;  4NG7 A;  4O8M A;  4NN3 A;  2XXK A;  4PF6 A;  4X04 A;  4MMP A;  4OA4 A;  4X8R A;  4N6K A;  2HZK A;  4NGU A;  4PDH A;  4LN5 A;  2ZZV A;  4MAG A;  4N91 A;  4N8Y A;  4MNC A;  4MNP A;  4PBH A;  5IGA A;  4O7M A;  4DI4 B;  4P1L A;  4PBQ A;  2XA5 A;  4PGN A;  4NX1 A;  4PC9 A;  4NAP A;  4OVS A;  4XEQ A;  4PGP A;  4P1E A;  5CM6 A;  4YIC A;  4PAI A;  4XFE A;  2VPO A;  4OAN A;  4P47 A;  4MNI A;  4MIJ A;  4PAF A;  4XF5 A;  3GYY A;  4NF0 A;  2XWV A; 
#chains in the Genus database with same CATH topology
 2FIX A;  5DTB A;  4OFO A;  1LAF E;  4ESW A;  1USY H;  4KYD A;  1DPE A;  4JSO A;  2FIE A;  2L5V A;  3K6X A;  4U1O A;  3HST A;  4PFR A;  3CI8 A;  3PUV E;  1URS A;  4I3Y A;  5IM2 A;  3RGY A;  4F1Y A;  4G68 B;  1HSE A;  4PF8 A;  1MQH A;  2F34 A;  1PB7 A;  4NWC A;  4N17 A;  4JWO A;  5H8Q B;  3Q26 A;  2BJJ X;  1N04 A;  5T3J A;  4R6K A;  3IFC A;  5J16 A;  4DXC A;  4ISU A;  1AH5 A;  1XVY A;  3LUY A;  1Q35 A;  1VFE A;  4Q30 B;  1EZO A;  4R74 A;  5JK4 A;  2XXW A;  3LR1 A;  5FHO A;  4YB7 A;  4OTE A;  1FSA A;  2UVG A;  1Y20 A;  3C31 A;  3B6T A;  3E9X A;  1GTK A;  1LGB C;  4AS5 A;  3OO8 A;  3TYH A;  1O63 A;  1UTB A;  1LFG A;  5H8H A;  1FPK A;  3KN7 A;  4RYA A;  3FZV A;  3L6H A;  2ZYK A;  2XA5 A;  5KCJ B;  2UVJ A;  3TTM A;  2B4L A;  3B7D A;  3QK6 A;  3TEP A;  1YCJ A;  1EH3 A;  3HV1 A;  1G0H A;  4HW8 A;  4POW A;  1RKM A;  3N5L A;  1YZ0 A;  4NHB A;  1MRP A;  1O64 A;  1NV2 A;  4G68 C;  1A8F A;  1IMB A;  4JWY A;  3QIM A;  1XHY A;  1LAG E;  3PD8 A;  4GBW A;  3VVD A;  4PP0 A;  4GWX A;  1PC3 A;  3H6W A;  4Q8R A;  1MH3 A;  4XKN A;  3M3L A;  1ZKB A;  3FXR A;  3N6U A;  4F39 A;  2V93 A;  3A09 A;  3FV1 A;  4MLQ A;  4QSC A;  4OQO A;  1BK4 A;  5DVF A;  4BDQ A;  5FBP A;  1LAH E;  1H45 A;  3PMX A;  3QAX A;  1B46 A;  3K0V A;  4U2R A;  4JWX A;  2XWI A;  2XXT A;  1BLF A;  5AA2 B;  1MQG A;  1YPN A;  2XWK A;  3E79 A;  1XI6 A;  3I5O A;  1N3W A;  5F1Q A;  1B3L A;  4PFY A;  2P1S A;  2CZK A;  4FAJ A;  4N6K A;  2AL4 A;  4E0X A;  1WVJ A;  1XS5 A;  4LON B;  4GWY A;  2QMW A;  1SW2 A;  2I0B A;  3RTF B;  1SI0 A;  1AWB A;  1EU8 A;  1AMF A;  4JDF A;  4ZE8 A;  2F5X A;  1P1U A;  4GWW A;  1I69 A;  3LBS A;  3IFA A;  4JXI A;  2NXO A;  3QYT A;  3OO6 A;  4MIJ A;  3H03 A;  3TFL A;  3KSJ A;  1NUX A;  5FHN A;  3H7M A;  5L8D A;  2GHB A;  1FBP A;  4FEC A;  4KI0 E;  2I4C A;  2XX8 A;  3PPP A;  4MCO A;  1N7W A;  3A29 A;  5H8S A;  3Q25 A;  3C36 A;  3IR1 A;  4ELR A;  1INP A;  2DXY A;  1FCK A;  2Y5K A;  5TPA B;  4C0R A;  2PFY A;  2PVU A;  4R6Y A;  4O3B A;  4IO2 A;  4C1T A;  3RT6 B;  4UAB A;  1XOC A;  5I57 A;  4H45 A;  3RN8 A;  4DCY A;  3LSX A;  2D3I A;  2NOO A;  4NWD A;  3RQT A;  4N8G A;  5AA4 B;  4N4U A;  3ROJ A;  1DTZ A;  2YLN A;  2MKZ A;  1M5F A;  3UIF A;  3DP6 A;  1LFH A;  4OHN A;  4FEB A;  4X8R A;  2Z8D A;  4QXD A;  3E4R A;  3FJM A;  2WEF A;  5H8Q A;  4N8Y A;  3E3K A;  3O28 A;  4MNP A;  2OCU A;  2UYF A;  4GF8 A;  3UN6 A;  4N81 A;  3U92 A;  1EYK A;  1NV5 A;  2DQV A;  3RYD A;  3ODB A;  5ESY A;  3OD7 A;  1OVB A;  2XXR A;  3OSQ A;  2O7U A;  4OAN A;  4PAF A;  1UIV A;  1Q1K A;  1VE4 A;  1B1X A;  2D21 A;  3W9V A;  1ZU0 A;  2ZNU A;  4PFU A;  4AB6 A;  2XX7 A;  3VLW A;  1FTJ A;  4NF8 B;  2WBB A;  4GFR A;  4OVT A;  5DVJ A;  4FIM A;  1IIW A;  2HEU A;  1K9Y A;  3P7I A;  1AIV A;  4F31 B;  2CEY A;  1LLS A;  4LUB A;  4PCD A;  3MP1 A;  1PB8 A;  2ALU A;  4YKI A;  1MXY A;  3E78 A;  2IA4 A;  4U21 A;  4YMB A;  1B5H A;  5CMK A;  1HSL A;  3TMG A;  4IB2 A;  3BFU A;  1B05 A;  4U4S A;  3S9L C;  3RT8 A;  4IO7 A;  2Y7I A;  2H98 A;  3GXA A;  4ZE9 A;  2FYI A;  5I56 B;  1YXI A;  2REG A;  2UVH A;  4RK2 A;  1EZP A;  4YKJ A;  3V5A A;  1B7U A;  1B7Z A;  1Q9D A;  1VSO A;  1B4H A;  3FAS A;  5F7V A;  2H25 A;  2Y7P A;  1SW4 A;  4R9F A;  1URD A;  1H44 A;  1NV3 A;  1CB6 A;  2A5T A;  3UK4 A;  4MF3 A;  3PUX E;  3BIH A;  5H8F B;  1FW0 A;  4TQU Q;  2V3Q A;  3KSX A;  4N91 A;  3CSG A;  1GR2 A;  3O97 A;  4H5G A;  3KN3 A;  4QSE A;  2XXQ A;  2UVI A;  3IOT A;  2LAO A;  1ZMG A;  4O7I A;  2R71 A;  1FBH A;  5CM6 A;  1F9B A;  1B0H A;  2I3W A;  3RNN A;  1NMU A;  1MQD A;  3T93 B;  1UTH B;  1R9Q A;  4YMA A;  3IL1 B;  2VD3 A;  3K1M A;  1USY E;  5CBS A;  1ZBM A;  4G8N A;  2Q9T A;  3S9E A;  5ET8 A;  2V3U A;  3BKI B;  1SW1 A;  1N84 A;  1IMA A;  2P3N A;  1IME A;  3A3C A;  4DI3 D;  3VVE A;  4QHQ A;  4I9D A;  5F24 A;  2DDK A;  5L9M A;  5CC2 A;  3WAF A;  5ICT A;  2I58 A;  4OMB A;  1EYI A;  5DYH A;  5EQ9 A;  1A99 A;  2QJE A;  2Y7R A;  2ZYM A;  3MYU A;  4R6H A;  5I7I A;  1VDW A;  3DM0 A;  3HHG A;  2F36 A;  4MFI A;  1FRP A;  1FBG A;  4H6D A;  2DWI A;  2Q8M A;  4MX6 A;  1IUD A;  3OMB A;  2HAV A;  2Q2A A;  2THI A;  3TCH A;  2HCA A;  3OO9 A;  4NN3 A;  4HCW A;  4P0I A;  5AA4 A;  4F19 A;  2H99 A;  3SEW A;  4HE0 A;  5CMB A;  2FBP A;  1Y3P A;  5IGA A;  5IKB A;  2VOZ A;  2ZMB A;  1M5D A;  1US5 A;  1UTB B;  4LZ5 A;  5IZ3 B;  3C32 A;  4PC9 A;  5FTH A;  1IZ1 A;  3T66 A;  3H6V A;  4GXS B;  3CFL A;  2H4I A;  4NF6 A;  1FTM A;  5FHM A;  1LBY A;  1FTA A;  2HFB A;  1O7T A;  1NNT A;  4NF0 A;  2XWV A;  2WX9 A;  2WYK A;  1RDZ A;  4I40 A;  5AE4 A;  3H06 B;  1POT A;  3EHT A;  1JEU A;  3PPN A;  5EQ8 A;  4RJZ A;  1B52 A;  2RKM A;  1DK4 A;  3C9H A;  4EF1 A;  3PPQ A;  5ET5 A;  3BFT A;  3VDF A;  4PTK A;  3FUZ A;  2QS1 A;  2Q89 A;  3KC0 A;  4POX A;  1CE2 A;  3N6T A;  4OVR A;  4HCY A;  2PMS A;  3B6W A;  1B32 A;  1BKA A;  4OET A;  3E13 X;  3MWB A;  2AIX A;  1A7L A;  3SET A;  2O6A A;  5IZ1 A;  5K2Y A;  2O51 A;  3H4Z A;  1DOT A;  3C4M A;  3MP6 A;  2JJK A;  3CVG A;  1D3K A;  3KZG A;  2F7C A;  4MH5 A;  1LB9 A;  1QGX A;  3VXB A;  3K4U A;  4MHF A;  2Q2C A;  3CIJ A;  3RPL B;  3U93 A;  4FE8 A;  1LBX A;  1JW5 A;  4PF6 A;  1MXV A;  4G8M A;  4OA4 A;  5H8N B;  1NNP A;  2W7Y A;  1N0T A;  4KYS A;  1K9Z A;  2DWJ A;  3SEV A;  2ONR A;  2P3V A;  4WKM A;  2HXW A;  4PFW A;  3TPA A;  1ATG A;  5KZT A;  4NX1 A;  4NAP A;  1Y1Z A;  4OZ9 A;  3SDF A;  2QVU A;  5A5L A;  4P1E A;  2PT1 A;  3K6U A;  4IR8 A;  3K1P A;  3JYR A;  1J1N A;  4MNI A;  1Y3Q A;  4HXV A;  3OEK A;  2VPN A;  3VLU A;  5ISU A;  3KN8 A;  4HS7 A;  1QVS A;  2XXU A;  5B7D A;  3IK6 B;  3QUF A;  4R72 A;  3SES A;  3S9M C;  3RY3 A;  5CMC A;  2OX3 A;  5ICQ A;  4PDD A;  1MH4 A;  2RCA A;  1B3E A;  2F6P A;  2FHY A;  2XWO A;  5LDZ A;  4UAC A;  1EZ9 A;  4F1U A;  2ZZW A;  3FXQ A;  4KXP A;  3TQW A;  4DDD A;  1FQE A;  3TUS A;  2QMX A;  4GWZ A;  1YYZ A;  3WAE A;  4OES A;  1POY 1;  3C35 A;  4GVO A;  2WYP A;  3T1B A;  1P99 A;  5EYH A;  5HM4 B;  4YAH X;  3KBR A;  3IO6 A;  3V89 B;  5DEX B;  5LOM A;  2Y84 A;  4LVQ A;  5ET6 A;  1FPF A;  3RPW A;  3Q27 A;  4NF5 B;  5TP9 A;  3MVW A;  1RDX A;  1A55 A;  3ZSF A;  3D4G A;  4I62 A;  4IY5 A;  4PBH A;  3O9P A;  4QFL A;  1MXU A;  4BDR A;  1NUZ A;  5A5X B;  1NNK A;  4GX3 A;  4XEQ A;  4RNS A;  5H8F A;  1D9Q A;  3TEL A;  4EQ7 A;  4I8C A;  2G29 A;  3MZ1 A;  2ONK E;  2VPO A;  1A54 A;  4QFP A;  1GV8 A;  4F1V A;  2OZZ A;  3ILT B;  5I2N A;  4G77 A;  2PX1 A;  2B3F A;  2I6E A;  3VV5 A;  1RYX A;  1FTL A;  3MST A;  2HXR A;  3KJ7 A;  4OEV A;  3SEU A;  3MZB A;  5CRY A;  2QVV A;  2V25 A;  2RC9 A;  4MJO A;  4EF2 A;  3TQL A;  2X26 A;  3MBP A;  3GBA A;  1NI9 A;  4TLL B;  2ZYO A;  5JTY B;  4PE3 A;  1HSJ A;  4P3L A;  3GBB A;  1P1N A;  1MS7 A;  4XXU A;  2XXP A;  4NF4 A;  5LTC A;  2XHD A;  1N76 A;  4TLM B;  4OEU A;  3G3F A;  5KCJ A;  5J1D A;  4X48 A;  1DPP A;  1PDA A;  1IMC A;  2XX9 A;  2XXY A;  3N26 A;  3OEL A;  1B9J A;  2Q8J A;  3PPO A;  5I56 A;  4GRK A;  3N94 A;  1NV6 A;  1LFI A;  3LSW A;  2R6G E;  4PE5 B;  1XC1 A;  3CHG A;  1R6Z A;  4IO6 A;  3GZG A;  1B3G A;  1LEV A;  4KYE A;  4GWO A;  2D5W A;  4IO5 A;  1FPJ A;  3KG2 A;  1TT1 A;  1N3X A;  3M3F A;  1JW4 A;  1H3D A;  1B6H A;  1DBZ A;  2KLF A;  1MY1 A;  3TTN A;  1II5 A;  3IOV A;  4OFL A;  4OEN A;  3MZ9 A;  4LQ2 A;  2R9J A;  2WBD A;  2Z8F A;  1NUY A;  2PT2 A;  3OEM A;  1M5C A;  4R9G A;  3TDJ A;  4X9T A;  2QS4 A;  4ZEI A;  2O84 X;  4YU0 A;  2I49 A;  4LZ7 A;  4DXB A;  2VD2 A;  4H5F A;  3O66 A;  2RC7 A;  3B8B A;  1S7Y A;  1MQI A;  4LA9 A;  1P1O A;  2Z23 A;  2VHA A;  4RPO A;  3OXN A;  3THI A;  4JVC A;  2HZL A;  4I1D A;  1OLA A;  3PV0 E;  4N13 A;  4ZZE A;  2KQZ A;  4KPT A;  2OWT A;  1NL5 A;  1LCT A;  2OWZ A;  3SZP A;  4P56 A;  5CI5 A;  4P8B A;  2PFZ A;  3VFJ A;  5AA3 A;  1QUK A;  1QW0 A;  2F8D A;  4H1X A;  5FTI A;  4YKP A;  2XXV A;  3FVN A;  1T0K A;  4MEV A;  3IB1 A;  1LBB A;  4IGT A;  3CFZ A;  2V84 A;  4K3F A;  1SBP A;  4BDO A;  4XKP A;  2O69 A;  1TXF A;  2ESN A;  4H65 A;  4P11 A;  4X04 A;  1DTG A;  1M5E A;  4C1U A;  3K02 A;  3QMF A;  1MXX A;  1JVX A;  2ZZV A;  1LB8 A;  1Y1M A;  1G0I A;  4ZEK A;  4NED A;  4F3S A;  3JV9 A;  3MQ9 A;  4O7M A;  2ZXT A;  2I0C A;  3PUW E;  2ABH A;  4R2F A;  5TPA A;  2UYE A;  5TP9 B;  5EYF A;  4GLI A;  3F11 A;  1SDX A;  2R8T A;  2B3B A;  3QXM A;  2XD3 A;  4YKK A;  2AL5 A;  2Q88 A;  4H0W A;  4QFN A;  4WEP A;  4GWU A;  3BIG A;  2QPQ A;  3D1R A;  4KCC A;  4R75 A;  3T96 B;  1I6Q A;  4GD5 A;  5I5P A;  3IJX B;  2V4C A;  4KD5 A;  3MPK A;  1OIB A;  1MY2 A;  3K2D A;  4F18 A;  5I58 A;  3IOW A;  4O94 A;  4EDP A;  1JVY A;  2GRV A;  2O68 A;  3CG3 A;  2I48 A;  1PEB A;  1PBP A;  3CRB A;  3SEX A;  1D9V A;  1MXW A;  1B5J A;  4PET A;  3FXB A;  1DMB A;  4QFO A;  1MPB A;  2ZNT A;  3MC2 A;  4U23 A;  3B50 A;  4PFI A;  4GXA A;  5A5X A;  2I3V A;  2E0S A;  4EQ9 A;  2UXA A;  4ZED A;  4HE2 A;  3U8Q A;  3IB0 A;  4FOR A;  5ITP A;  1MM7 A;  4EXK A;  4DXU A;  1A40 A;  4NF6 B;  4O8M A;  3USD A;  1XVX A;  1NV1 A;  3T0J A;  4DLD A;  3SKP A;  1WDN A;  2F7B A;  4LZ8 A;  4MMP A;  2PCR A;  1B7H A;  4G61 A;  1XT8 A;  3AXF A;  1IIT A;  4OER A;  3PTY A;  5TU0 A;  3H3G A;  3ISP A;  4ZS9 A;  2DSF A;  3H6U A;  4DI4 B;  3EHS A;  3VLV A;  4PBQ A;  3K6W A;  5I59 A;  2F7A A;  3KOT A;  1OVT A;  1MPC A;  2X7P A;  2DE2 A;  4KCD A;  4RXL A;  2DVC A;  3C34 A;  4LQ5 A;  2E1S A;  4IY6 A;  1BIY A;  3O6H A;  2G93 A;  4RK9 A;  4N15 A;  2HHM A;  1MDQ A;  1JQF A;  4G68 A;  5KDT B;  4JVI A;  1NH8 A;  2VGQ A;  3SER A;  1TWY A;  3GLB A;  2HQ0 A;  1I6A A;  1RYO A;  4BDM A;  3RTW B;  4NE4 A;  5DW8 A;  4M4G A;  2PBW A;  4OVP A;  2KR0 A;  4THI A;  4JSD A;  1FPE A;  1R1N A;  4H8I A;  4FBP A;  3O2A A;  3ECR A;  1FBD A;  4R2B A;  1IEJ A;  4Q5T A;  1FQC A;  1MG1 A;  2O1M A;  4PFB A;  1Z7M E;  4OVQ A;  1FQB A;  1FTO A;  1LST A;  1Y9U A;  5I2K B;  4NG7 A;  3L6G A;  5DT6 A;  3LV0 A;  3K6V A;  1A8E A;  5H8N A;  4AB5 A;  1UQW A;  1ELJ A;  3UP9 A;  4HE1 A;  4HTG A;  5I59 B;  5JEI A;  5DEX A;  4GWS A;  2B65 A;  1GVC A;  3OSR A;  4U1Z A;  4GIZ A;  1IXC A;  4KFQ A;  3IOR A;  3ZKL A;  4R73 A;  1NV0 A;  4G4P A;  4H46 A;  4G8H A;  3MW0 A;  3W15 C;  3EF7 A;  1KA1 A;  2WKY A;  4P47 A;  3T9X B;  1NH7 A;  3EKI A;  1QKB A;  4N07 A;  1L5T A;  2NUV A;  4XF5 A;  4OFJ A;  3GYY A;  3T9V A;  4BDN A;  3S9N C;  1QKA A;  4EUO A;  2RF1 A;  2RIN A;  2F3B A;  3IJO B;  4I3E A;  2DOJ A;  3I6V A;  1TFA A;  1CNQ A;  4P9K A;  1UTH A;  2Z22 A;  4DZ1 A;  4M1V A;  5IZZ A;  1Y3N A;  4N6D A;  3PMV A;  5EHM A;  1ZLQ A;  1URG A;  3KOS A;  2ZZX A;  4NMY A;  3MVY A;  5I2K A;  4GBV A;  1OQH A;  2F6G A;  3TTR A;  2DE3 A;  3K1N A;  3FGS A;  4P0G A;  1VR5 A;  2ONS A;  2Y7K A;  1DCU A;  3SEY A;  1QUL A;  4MBP A;  4QBA A;  4FJP A;  3HFU A;  3OEN A;  3PUZ E;  2FA7 A;  2OWS A;  2DE4 A;  4ELP A;  1FQD A;  3OO7 A;  1YAE A;  2GQ1 A;  1B1H A;  1QUI A;  3G3J A;  4YZZ A;  2P0S A;  1S9T A;  4OVJ A;  5M2V A;  3MJN A;  5CMM A;  3CFX A;  3G7W A;  3EQ1 A;  3T9U A;  1LBZ A;  1NV4 A;  2GH9 A;  4RY1 A;  1FJ6 A;  1OMP A;  1JNF A;  2YJP A;  1OLC A;  2OLB A;  4NGU A;  3T9H B;  2RC8 A;  4JBZ A;  4DE8 A;  3FVK A;  4MAG A;  1JP4 A;  4WED A;  1GGG A;  1ZJL A;  4FAT A;  3UOR A;  1B3H A;  3LSL A;  3QUJ A;  1N7X A;  1FPI A;  1RDY A;  4UA8 A;  4YB5 A;  1B5I A;  3Q29 A;  2F3D A;  3TKD A;  5L9O A;  4PGP A;  1B58 A;  2CZI A;  1FTK A;  2YPN A;  4ZDM A;  2X7Q A;  2DWA A;  5I57 B;  3R26 A;  1B0L A;  3HHF A;  1ZTY A;  1IXG A;  4KR5 A;  4F3P A;  1WOD A;  4IO3 A;  2QS3 A;  1Y4T A;  3EPE A;  1NKX A;  5H8H B;  3KC1 A;  3ZKK A;  5HBC A;  1KZ8 A;  1NUW A;  3FV2 A;  1VFD A;  2DVZ A;  4FED A;  3FVG A;  1KWH A;  4O3A A;  5JTY A;  2QRY A;  2CEX A;  4NF5 A;  4PAK A;  3C33 A;  3U94 A;  1MXZ A;  2XD2 A;  1FJ9 A;  3CR9 A;  1I6B A;  5I84 A;  1PB9 A;  2FNC A;  1B51 A;  2QS2 A;  1AOV A;  4H8J A;  3FVO A;  1LBV A;  1DSN A;  4F2O A;  3BBR A;  2BJI A;  3V8X B;  4JB7 A;  3LSF B;  3G3H A;  3CSB A;  4KQP A;  3IAZ A;  1FQA A;  3R6U A;  2XXK A;  5CBR A;  4U22 A;  4ZEF A;  1FBC A;  3CG1 A;  2HZK A;  2H5Y A;  4LAT A;  4H67 A;  1JW1 A;  4O3C A;  4G2Z A;  4X1B A;  1ZIU A;  5EYG A;  4GL0 A;  4DIG A;  3V83 A;  4TOZ A;  1B40 A;  5EQA A;  2Y5L A;  5IZ3 A;  1S50 A;  3VE1 B;  1LCF A;  4YIC A;  3FJ7 A;  2O1L A;  2QFL A;  4XTC Q;  1MY3 A;  1SPI A;  1P1W A;  2XXI A;  3KBZ A;  1AL3 A;  3DEL B;  3T22 A;  3K01 A;  3IX1 A;  4F29 A;  2CZH A;  3FIR A;  4ONY A;  3LC8 A;  4RA1 A;  5AA2 D;  4AS4 A;  3EN3 A;  4F22 A;  2Y7W A;  2ANJ A;  1IMD A;  1FBE A;  3U65 A;  3U72 A;  5KDT A;  3HO7 A;  2DP8 A;  3R7X A;  3I3V A;  1SYI A;  3O6G A;  2HPG A;  3W9W A;  1M5B A;  4ND9 A;  4OWD A;  4Z0I A;  3ZS6 A;  3TZA A;  2V3T A;  2DWH A;  1MPD A;  1MY4 A;  4XKQ A;  5AA2 A;  1TFD A;  3TAJ A;  4ZEB A;  4NTL A;  2AYS A;  1LAX A;  3FJG A;  1BP5 A;  2H9B A;  4YB6 A;  4ESX A;  3K00 A;  2DS9 A;  4PFT A;  4GOT A;  1IXI A;  2F97 A;  1SD3 A;  3OOA A;  2HAU A;  4GL8 A;  3PPR A;  3Q28 A;  4QFK A;  4EXL A;  3RUM A;  2VP1 A;  3RPL A;  2O7I A;  4LN5 A;  3KEI A;  3PGF A;  2IEE A;  2A5S A;  5BWJ A;  3PUY E;  4MNC A;  4GX4 A;  5ET7 A;  3TCF A;  2FVZ A;  2NVU B;  2GHA A;  4E0W A;  1JEV A;  1SW5 A;  3DP4 A;  3MVX A;  4EQB A;  3U1O A;  1NFT A;  3RLF E;  4PAI A;  4NF4 B;  5ELV A;  3TCG A;  1SI1 A;  5BUU A;  4F3B A;  1Z7N E;  3S2V A;  1IQ7 A;  2OK2 A;  4DCX A;  3ILU B;  3IO4 A;  3M3K A;  1FBF A;  2XXH A;  1YTV A;  1FPL A;  3FXU A;  5I2N B;  4F2Q A;  4NQ8 A;  5L9S A;  5I58 B;  3B6Q A;  5I3S A;  4BLA A;  1D9Y A;  5DVI A;  4ZEC A;  2QSX A;  1H43 A;  1EYJ A;  1JET A;  2P2A A;  4AQ4 A;  1B3F A;  3MP8 A;  4QF9 A;  2OJT A;  4U4X A;  1FPG A;  4NF8 A;  3KJT A;  3LUZ A;  3KGC A;  2Q74 A;  4GX6 A;  1BTJ A;  3KFM A;  3MVZ A;  3MPL A;  3TOD A;  3QSL A;  4KHZ E;  5B70 A;  2I4B A;  4OXV A;  4Q0C A;  1B2H A;  1KA0 A;  3UA8 A;  3A3U A;  3UGW A;  1MQJ A;  4GQO A;  3ONM A;  2B4M A;  4Z7E A;  5AA1 A;  3MUQ A;  4ELO A;  5HPQ A;  2VT5 A;  1P1Q A;  3DLN A;  3VXC A;  1MY0 A;  3PD9 A;  1ANF A;  3M8U A;  3FAT A;  3EHU A;  4MLV A;  2RCB A;  1QJM A;  2GFE A;  4OVS A;  2NWJ A;  4XFE A;  1MDP 1;  3DP8 A;  2F35 A;  2Z8E A;  1FQF A;  3IB2 A;  3PMW A;  1PBQ A;  4JVD A;  1MM6 A;  3G3K A;  4N6P A;  1IMF A;  4RPN A;  1NV7 A;  4LP2 B;  4ZZA A;  2M8C A;  3PU5 A;  1LBW A;  3HPI A;  3D4C A;  4ELQ A;  3H6T A;  2QL3 A;  2OBG A;  1QUJ A;  1SQY A;  2PYY A;  2ZYN A;  2XXX A;  2REJ A;  3HCQ A;  2CMO A;  3G3G A;  4ECF A;  4L17 A;  5IAI A;  5K2X A;  3O29 A;  2CZL A;  4PQJ A;  1NNF A;  1R9L A;  4BDL A;  5EQ7 A;  4IGR A;  3VVF A;  4QRZ A;  3TTK A;  1SVX B;  3FD3 A;  3JZJ A;  3NOH A;  1FPB A;  1H76 A;  2A5T B;  2F78 A;  1OQG A;  3G3I A;  3TTL A;  4IO4 A;  4F3G A;  4WXJ A;  2DYX A;  4X1D A;  1IXH A;  4PDH A;  5ITO A;  2QVR A;  4XIG Q;  1D4N A;  1Y4C A;  1UIU A;  3IOU A;  3O6I A;  4P1L A;  4XKR A;  1FPD A;  3HN0 A;  4PGN A;  4QSD A;  5EHS A;  3S4U A;  1SYH A;  1B4Z A;  2ZNS A;  2DXR A;  3MAM A;  3FBP A;  1LBC A;  4OYV A;  1US4 A; 
#chains in the Genus database with same CATH homology
 2FIX A;  2QPQ A;  2WX9 A;  2WYK A;  2VPN A;  3D1R A;  3KBZ A;  4N15 A;  4NHB A;  3W9V A;  2HHM A;  2F3B A;  1NUX A;  1RDZ A;  1FBF A;  4I40 A;  4I3E A;  5I5P A;  1FPL A;  1NV2 A;  2V4C A;  1IMF A;  2WBB A;  1CNQ A;  1FBP A;  4JVI A;  4P9K A;  4NQ8 A;  2CZH A;  1NV7 A;  3MST A;  3KC1 A;  1IMB A;  4OVT A;  2Q9T A;  1KZ8 A;  2HXR A;  1NUW A;  4M1V A;  5IZZ A;  2FIE A;  1K9Y A;  2L5V A;  1LBW A;  4MCO A;  4N6D A;  4JVC A;  5EQ8 A;  5ET8 A;  3A29 A;  1DK4 A;  2HZL A;  2CEY A;  2DVZ A;  4AS4 A;  4GBW A;  4PFR A;  2OX3 A;  5I3S A;  4F18 A;  2ZZX A;  4GWX A;  1IMA A;  2KQZ A;  1INP A;  4PCD A;  4O94 A;  4PDD A;  2QVV A;  4I3Y A;  4GBV A;  5ET5 A;  1IMD A;  4PTK A;  5DW8 A;  5IM2 A;  1FBE A;  1IME A;  2DE3 A;  2P3N A;  4MJO A;  3U65 A;  3KC0 A;  2CEX A;  3E78 A;  2Y5K A;  4OVP A;  4DI3 D;  3B8B A;  4OVR A;  4PAK A;  1NI9 A;  4PF8 A;  2PFY A;  1EYJ A;  4HCY A;  2OWZ A;  3SZP A;  2HPG A;  2FHY A;  4P56 A;  4PE3 A;  5F24 A;  2KR0 A;  2PFZ A;  4P8B A;  3W9W A;  4P3L A;  2DDK A;  1DCU A;  1FPE A;  1FJ9 A;  2XWO A;  4PET A;  3FXB A;  4UAB A;  1BK4 A;  1EYI A;  4FBP A;  5EQ9 A;  4QBA A;  5LDZ A;  4N17 A;  1FBD A;  5FBP A;  3HFU A;  4H45 A;  5IZ1 A;  5LTC A;  4F1U A;  3MYU A;  2ZZW A;  1FPG A;  3LUZ A;  4KXP A;  3B50 A;  2DE4 A;  4PFI A;  5T3J A;  5I7I A;  1VDW A;  2JJK A;  2Q74 A;  3IFC A;  4GX6 A;  1YXI A;  5J16 A;  1LBV A;  5J1D A;  2GQ1 A;  4MEV A;  4PFB A;  2XWI A;  4N8G A;  1IMC A;  4YZZ A;  5EQ7 A;  2BJI A;  4N4U A;  4OVQ A;  3ROJ A;  4GWZ A;  4HE2 A;  1QGX A;  1YYZ A;  1FRP A;  4MHF A;  1FBG A;  1NV6 A;  3T1B A;  5JK4 A;  2WYP A;  2XWK A;  4MX6 A;  4NG7 A;  2Q8M A;  5EYH A;  3NOH A;  3E79 A;  1XI6 A;  3LV0 A;  1Q9D A;  1KA0 A;  1LBZ A;  3CHG A;  2MKZ A;  1FPB A;  1FSA A;  3RPL B;  4O8M A;  1LEV A;  1LBX A;  2B4M A;  1NV4 A;  1NV1 A;  2XXK A;  4NN3 A;  1FJ6 A;  4PF6 A;  4HCW A;  4HE1 A;  4X04 A;  3T0J A;  1FPJ A;  5ET6 A;  1FPF A;  2CZK A;  4F19 A;  4AS5 A;  1NV3 A;  2VT5 A;  4MMP A;  1FBC A;  4OA4 A;  4X8R A;  3RPL A;  4N6K A;  2HZK A;  4QXD A;  4NGU A;  4GWS A;  1DBZ A;  3QMF A;  2PCR A;  2QVR A;  2WEF A;  4LN5 A;  3BIH A;  4PDH A;  2ZZV A;  4HE0 A;  4GWY A;  1RDX A;  4G61 A;  4MAG A;  1JP4 A;  2V3Q A;  4N8Y A;  2FBP A;  1K9Z A;  4N91 A;  4GWU A;  4MNC A;  4MNP A;  4GX4 A;  4PBH A;  5EYG A;  5IGA A;  5ET7 A;  1FPK A;  1G0I A;  3PTY A;  3ISP A;  4XF5 A;  1AWB A;  2WBD A;  2FVZ A;  1FPI A;  1NUY A;  4O7M A;  2P3V A;  4P1L A;  5IZ3 B;  4DI4 B;  1FPD A;  4PBQ A;  4N81 A;  1RDY A;  1EYK A;  1NV5 A;  3RYD A;  2F5X A;  2XA5 A;  1NUZ A;  4GWW A;  4PGN A;  5EQA A;  2F3D A;  2Y5L A;  1NV0 A;  4NX1 A;  4O7I A;  4GX3 A;  4NAP A;  4OVS A;  4PC9 A;  4PGP A;  4XEQ A;  5ESY A;  3IFA A;  2CZI A;  2B4L A;  1D9Q A;  5IZ3 A;  2DE2 A;  1FBH A;  4X9T A;  4H46 A;  2QVU A;  5A5L A;  4P1E A;  5CM6 A;  4JVD A;  4YIC A;  4PAI A;  4IR8 A;  1LBY A;  2R8T A;  2VPO A;  1KA1 A;  2QFL A;  1FTA A;  4XFE A;  3FBP A;  4OAN A;  1G0H A;  4P47 A;  4MNI A;  4MIJ A;  4PAF A;  4F1V A;  1SPI A;  3EKI A;  1YZ0 A;  4HXV A;  3GYY A;  3BIG A;  4NF0 A;  2XWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...