4N15A

Crystal structure of a trap periplasmic solute binding protein from burkholderia ambifaria (bam_6123), target efi-510059, with bound beta-d-glucuronate
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
301
structure length
301
Chain Sequence
RVFRSADVHGDSFPTNMAVKFMGDELSKLTGGKDSIKVFGNSALGSEKDTVDQVRIGAIDMARVNGASFNEIVPESLIPSFPFLFRDVDHFRKAMYGPAGQKILDAFAAKGMIALTFYESGARSIYAKRPVRTPADMKGLKVRVQPSDLMVDEIRAMGGTPTPMPFAEVYTGLKTGLVDAAENNLPSYEETKHFEVAPDYSETQHAMTPEVLVFSKKIWDTLSPQEQAAIRKAAADSVPYYQKLWTAREASAQQAVTKGGANILPAAQVDRAAFVKAMQPLWTKYEKTPQMKQIVDEIEAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Burkholderia ambifaria
total genus 109
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 2013-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4n15A00
4P8BA 3FXBA 4NF0A 4NX1A 4YZZA 2VPNA 5I5PA 4PCDA 4P56A 4X04A 4O7MA 5IZZA 2WYKA 4PGNA 4X8RA 2HZKA 4OVQA 4MAGA 4OA4A 4MNPA 4N17A 4N6KA 4OVPA 2XWVA 4NHBA 4P9KA 4PETA 4MEVA 4P47A 2V4CA 2VPOA 4N15A 4PFRA 4XFEA 5I7IA 4PBHA 4P3LA 4O8MA 4MX6A 5CM6A 4N6DA 5IGAA 4MIJA 4PAKA 4P1EA 4PAFA 4PFIA 4N8GA 4NGUA 5LTCA 4N8YA 4XEQA 4PDDA 4N91A 4LN5A 4UABA 4N4UA 4NQ8A 4MMPA 4PF8A 2ZZWA 4PC9A 2WYPA 4NG7A 5IM2A 2HPGA 4PF6A 2WX9A 2XWOA 2CEXA 2XWIA 4PAIA 4PFBA 2PFYA 2ZZXA 4PBQA 4PGPA 4NAPA 4MNIA 4YICA 3U65A 2ZZVA 3GYYA 4OVTA 4P1LA 4O94A 4PE3A 4OVRA 2XXKA 2PFZA 4OVSA 4DI3D 2CEYA 2XWKA 3B50A 4MHFA 2XA5A 4MNCA 4NN3A 4PDHA 4OANA 4DI4B 4XF5A 4MCOA 2HZLA
chains in the Genus database with same CATH superfamily
5L9SA 1SVXB 4KI0E 1R9QA 5DVFA 5AA2D 3IORA 4YZZA 3PMWA 2Q9TA 3VVDA 4X04A 1H3DA 3IFAA 1SD3A 1MS7A 3C9HA 1B5JA 2AL5A 1FPBA 1B1XA 1CB6A 5IZ3B 3LSWA 3K4UA 1LSTA 5I7IA 4QFPA 1A8FA 5DW8A 4PBHA 1OQHA 3VE1B 5KDTB 4F2QA 3KJTA 3W15C 3PPPA 4NTLA 3VXBA 1MQHA 5IKBA 1LFGA 3PTYA 4QFNA 4U4SA 1LAFE 5KZTA 1B3GA 1TWYA 2F7AA 2VD2A 3FVNA 1D9YA 1LGBC 3V8XB 5CRYA 2GHBA 3I5OA 1FBCA 2F7CA 2Y84A 4RY1A 4F19A 2GHAA 1ZTYA 1A99A 2ZZVA 5A5XB 4JWXA 4AS5A 4JSDA 1LBYA 3VLWA 3HO7A 4DI3D 2XXTA 1LCTA 3TUSA 3PU5A 1OVTA 1MXYA 4AQ4A 3A3UA 4KPTA 4KXPA 5B7DA 4G8NA 3LC8A 4ZZEA 3CI8A 2VP1A 4NX1A 3RTFB 1NV5A 2ZYNA 2R71A 1IIWA 4LUBA 4BDNA 3RY3A 2DWJA 2I4BA 4R74A 4EUOA 3N5LA 4N13A 1B32A 4Q5TA 1ZU0A 3LUYA 2FA7A 4DXBA 4PFRA 2NOOA 5I59A 5FHMA 1TFDA 2OK2A 1Z7NE 1DOTA 4MLQA 1VE4A 3ZSFA 5EHSA 3KZGA 4ZEBA 1JW1A 3T66A 4R6HA 4QSDA 5I56B 1AIVA 4G68A 2QRYA 5F1QA 1LBXA 3B8BA 4PFYA 3BIHA 4OZ9A 2DE2A 4RJZA 1AL3A 4GX3A 3TQWA 4OFLA 4EQ9A 3QIMA 1MPCA 3B6TA 3RN8A 1ZLQA 1LAHE 2ZMBA 5AE4A 1IEJA 2CEYA 1B3EA 4R73A 1PDAA 3LBSA 1SQYA 2Q2AA 4RPOA 2QMXA 2HXWA 2ONKE 1OQGA 2XX8A 4XF5A 4JBZA 3A09A 4LZ5A 2E0SA 1FRPA 2F8DA 1MY4A 1US5A 5I5PA 5TPAA 3A3CA 2OZZA 4X8RA 1D9VA 2F6PA 4IGTA 1IUDA 4NF8A 3FVGA 4KFQA 2UYFA 4FIMA 2FYIA 1QKAA 3EF7A 3DLNA 3L6GA 1Y1ZA 3N6UA 1FPKA 2VHAA 1FJ9A 4P3LA 3MZ1A 3C36A 4R6KA 5I57A 1T0KA 2B4MA 1ELJA 4P0IA 5ET8A 5CM6A 1YAEA 2ANJA 4O3AA 1MY0A 4NGUA 2DSFA 3PPOA 4N91A 2DXRA 3IB1A 1B05A 1GGGA 4OERA 1JNFA 1LAGE 2RF1A 5EYGA 2HQ0A 2PVUA 1B9JA 1N84A 4MFIA 2ZYMA 1UTBB 2XX9A 1XVYA 3TFLA 5ISUA 4H6DA 3K02A 1FBEA 3U1OA 3FD3A 1FTKA 4GWYA 4LQ2A 1A8EA 1SI0A 1B0HA 2XXKA 1LEVA 4ELRA 4L17A 1QVSA 3PPQA 1QUIA 1N0TA 1FPFA 1IMAA 3H06B 3NOHA 4GLIA 3OO6A 1H43A 4ND9A 1FQCA 4F1YA 1FPDA 2Q8JA 2D5WA 1LB9A 1EZ9A 4BLAA 3PPRA 2Q89A 3MSTA 3SKPA 1P1QA 1WVJA 4P56A 1DK4A 1ZBMA 2WYKA 3FJMA 4OFOA 3G7WA 3MUQA 2CMOA 3IB2A 5AA1A 5CMCA 4G4PA 4QFKA 4OVPA 3LR1A 2GQ1A 3SEYA 3TTKA 4P47A 2V4CA 2VPOA 2F7BA 4N15A 4ZEFA 1R1NA 5FTHA 4U21A 2WEFA 3IR1A 1B7ZA 2DDKA 2X26A 1A7LA 1B51A 1Q1KA 3M3KA 4ZEDA 3CG3A 4R72A 1USYH 3T9XB 3RT6B 4N8YA 3SEXA 1IXGA 5H8HA 3W9WA 3S9LC 1DPPA 1H44A 4F2OA 4OQOA 3TDJA 1PEBA 1INPA 3KG2A 3O6HA 4FE8A 3TODA 1IMBA 1H76A 2A5TA 4GF8A 3RT8A 4EF1A 2ZZXA 2L5VA 4HS7A 5EYHA 3ZS6A 4PFUA 4GWSA 2H4IA 4O94A 2WKYA 3IX1A 3B50A 3KC1A 1L5TA 4TLMB 1R6ZA 3SEWA 4LZ7A 4MCOA 1OMPA 4IO6A 4P8BA 3V83A 1NH7A 2AYSA 5DEXB 1BTJA 3ZKLA 3UGWA 3DP8A 3DP6A 4DCXA 4YU0A 2F3DA 3ILUB 3K6WA 1IMDA 3TKDA 5F7VA 3KN3A 1GR2A 2XD2A 1JVXA 1EU8A 1MDP1 3C31A 1FBDA 2I48A 4POXA 4ECFA 2Q88A 1YZ0A 2AIXA 1FTLA 4IY6A 3G3KA 4XFEA 5CMBA 3SEUA 4F3PA 2P0SA 1B3HA 3VLVA 3O97A 2I3VA 2DWIA 3T0JA 4C1UA 4R2BA 3E4RA 1VDWA 4C0RA 4XIGQ 1NMUA 2A5SA 3FXQA 1SPIA 2GRVA 3H4ZA 5IZ1A 4YB7A 3K6XA 1QULA 2UYEA 1LFIA 4ZEKA 2NUVA 1G0HA 2F34A 3GZGA 3TTLA 1NUZA 4H5FA 2JJKA 1NV3A 2NVUB 1RKMA 1IMEA 4DIGA 2PX1A 2CEXA 3T93B 5EQ9A 2M8CA 4GL0A 1J1NA 3EHUA 1MDQA 5AA2B 3U65A 4MF3A 5JTYA 3RYDA 3GYYA 1RYOA 2I3WA 2ZNUA 5TP9A 2F3BA 4GX6A 2QS2A 3GXAA 1DMBA 3OEKA 1M5BA 1LAXA 3IOUA 4U23A 4NN3A 2OLBA 3QXMA 4PDHA 1JW5A 4OANA 3IO6A 4IR8A 1Y1MA 4ZS9A 4PE5B 2H98A 2DXYA 2V3QA 4JDFA 4FORA 4ZDMA 3PMVA 3QMFA 4MAGA 2V3TA 5AA3A 3C33A 3RPLB 4Z0IA 4P9KA 4PETA 3KC0A 1LBWA 3RNNA 3O9PA 1NNKA 3IB0A 4OTEA 4DXCA 2QVVA 5A5LA 3WAFA 2XXRA 3ONMA 1UTHA 1P1OA 1HSLA 3OEMA 5H8FA 2B4LA 4OMBA 4X48A 2I4CA 4F31B 1LBCA 3SEVA 2DWAA 1ANFA 2QS4A 4ZECA 3IJOB 4TLLB 2WYPA 2AL4A 4I3YA 3EPEA 4BDRA 1TT1A 1B5HA 1FPIA 2XWIA 4POWA 4LA9A 5AA4A 1VSOA 3GLBA 4MBPA 3CFXA 5H8NB 4JVCA 1QW0A 3ECRA 1DBZA 1YPNA 3O6GA 4QBAA 3TYHA 5I58A 1OLCA 3T1BA 1FCKA 4NWCA 2B3BA 3UIFA 1SBPA 4MNCA 5ELVA 2WBDA 3IOVA 3K1NA 3H6UA 4ELPA 2ZNTA 3HCQA 1R9LA 1DTZA 2V84A 1WODA 2VD3A 2QS3A 4H67A 5I2KA 3D1RA 3FBPA 5K2XA 5IZZA 4LONB 4GXAA 4OWDA 1FQDA 5BUUA 1VFDA 4FEDA 3MVWA 4QRZA 4G2ZA 1FBFA 3OELA 1AH5A 3MC2A 2DVCA 1F9BA 2YLNA 3DM0A 3O29A 4I40A 3TPAA 4DCYA 5HM4B 4TOZA 5LDZA 4XKNA 1FW0A 3U92A 1FPJA 1URSA 4OYVA 4NF6B 2QSXA 5EYFA 4IO3A 4KYSA 3M3LA 4LATA 4F29A 4NQ8A 5T3JA 4I3EA 4QFOA 4ZE9A 5FTIA 1NV2A 1MH4A 3VV5A 1LBVA 1QGXA 4PC9A 1NUWA 1JVYA 4NF4B 4TQUQ 2F5XA 4YKJA 2ONSA 2OCUA 3SETA 3N94A 4IB2A 1EYKA 1SYHA 4PAIA 3LSFB 4THIA 4FAJA 4MNIA 5I2NB 2V25A 5DT6A 2RINA 4ZE8A 3PUVE 4OVTA 4EF2A 2XXPA 1Q9DA 4JSOA 4PE3A 4R9FA 4OFJA 1PC3A 1SI1A 3PMXA 1M5DA 3B6WA 4ELOA 4IO5A 4N07A 2Z22A 2XXWA 1D9QA 3OO9A 4QHQA 1FBGA 3FUZA 3K6VA 3TTMA 1MQDA 4NF5A 1NUYA 2HAUA 1ZJLA 3PUWE 4GX4A 5DTBA 4F18A 3RTWB 3K6UA 3TAJA 5CBSA 2ABHA 4KYEA 3KSXA 3HPIA 1DTGA 2RC9A 1NL5A 4ESWA 3FIRA 3ISPA 5H8QB 2DWHA 2QL3A 4NWDA 1XHYA 1N04A 3PUXE 5L8DA 4OESA 4E0WA 2G93A 3H6TA 1B4ZA 5IGAA 4NMYA 3K1PA 4UABA 2UVHA 2I58A 5CC2A 3G3GA 2F36A 3B7DA 3S2VA 1B2HA 4H65A 1NNFA 3FASA 5IM2A 1EYIA 4PQJA 3PGFA 2QVUA 4F22A 1EZPA 1BIYA 3IOTA 3UA8A 5KCJB 1D3KA 4WEDA 3K0VA 5FHOA 4QSCA 2QS1A 1KZ8A 5F24A 2QJEA 4OXVA 2F97A 4OVRA 1Y3QA 4DE8A 5EQ7A 4Z7EA 3VFJA 1VR5A 4HCWA 4IY5A 2XA5A 1PB8A 3PUZE 4JB7A 1FTOA 4NEDA 3O66A 1O64A 1P1WA 4EQ7A 1GV8A 4OEVA 3D4GA 1MY3A 4H1XA 1B4HA 3CHGA 3DP4A 4LZ8A 1B52A 4UACA 4HTGA 1NV1A 1MM6A 5IZ3A 1QUKA 2CZIA 2DS9A 3JZJA 1OLAA 2D21A 4KR5A 2Z23A 1MY2A 2XWVA 3U72A 5KDTA 3CSGA 4YB5A 2H25A 1M5CA 2IA4A 3FXUA 3LSLA 3FZVA 2RCBA 2H99A 4XKQA 2O1MA 3D4CA 1HSEA 2ESNA 1RDYA 2HHMA 5BWJA 4GD5A 3S9EA 3KSJA 4C1TA 3HHFA 1GTKA 2HPGA 3BBRA 5ET7A 3T9VA 1M5FA 5A5XA 5CMMA 3FJGA 3FJ7A 1B7UA 1MH3A 2PFYA 3HSTA 4ELQA 2Y7WA 4XTCQ 2XXQA 4F1VA 1FTMA 2PFZA 3IK6B 3T96B 1FTJA 5ET5A 3HFUA 2XXIA 1AWBA 2OWSA 5IAIA 3RPWA 1BLFA 4MLVA 2HZLA 2XXVA 4KD5A 3FVOA 3TELA 1Y20A 4JVDA 3U8QA 1NUXA 2O7IA 2CZLA 4PCDA 3H7MA 2FIEA 2GFEA 3RGYA 1NV0A 3FGSA 3VLUA 1LB8A 1SYIA 1A40A 1FJ6A 4N17A 4H5GA 4G8MA 4ISUA 2Q74A 4BDMA 2HEUA 1MQGA 2RC7A 4U2RA 4JWOA 1NV7A 4H8IA 1PBQA 4H46A 3G3FA 4P11A 4U1ZA 4IGRA 2XD3A 5I59B 5I56A 1MQIA 2D3IA 2Z8DA 4DZ1A 2XXHA 2PBWA 1POY1 4Q30B 2PT1A 1UQWA 1JW4A 3TCGA 4QXDA 4PF8A 3EQ1A 1NI9A 2I0BA 1EH3A 3HN0A 2O7UA 4G68B 3C4MA 2XWOA 3LSXA 5CI5A 3EN3A 1K9YA 3CR9A 3MWBA 3S4UA 3E3KA 4FEBA 4PFTA 1N3XA 1SW2A 2QVRA 2RKMA 1RDZA 2H5YA 1BK4A 3KBRA 3QUJA 4H8JA 1H45A 4E0XA 1UIVA 1S7YA 2Q8MA 3LUZA 3QAXA 1K9ZA 2ZXTA 1DCUA 1N76A 4FJPA 4M1VA 3O28A 4DDDA 1SW5A 2VPNA 4I62A 3H03A 5ICQA 4O7MA 3MW0A 2F35A 2Z8EA 1HSJA 1JQFA 1LBBA 3E79A 4U4XA 1ZIUA 3EHSA 4R6YA 3F11A 1DSNA 1LFHA 1MXVA 5TPAB 2RCAA 3ILTB 4FBPA 4MEVA 1IMFA 4NF8B 1I6BA 3CSBA 4GVOA 3OOAA 1FPLA 1MPBA 1NH8A 2PMSA 3MPLA 3PV0E 2CZHA 4NE4A 4PFWA 1YYZA 4PAKA 3IFCA 5I57B 4MH5A 3WAEA 3H6VA 3MJNA 2WBBA 4KCCA 5J16A 4GWUA 1I6QA 4IO2A 3IJXB 2HFBA 3B6QA 1UTBA 1FQEA 4XKRA 1B40A 1FQFA 4GXSB 2G29A 3MZBA 1RYXA 3KN8A 3CIJA 3SESA 3EKIA 1NKXA 5EHMA 3QSLA 1QKBA 5I3SA 4YMBA 1IZ1A 2Y7IA 4RNSA 2DOJA 5DVJA 5DVIA 1MG1A 3TZAA 2BJJX 3BFTA 1MQJA 4Q8RA 3O6IA 1BP5A 3ODBA 4H0WA 5K2YA 1B1HA 4JVIA 4LQ5A 4R9GA 4NF0A 2O6AA 1A54A 4F3SA 1JP4A 3IO4A 2V93A 4YB6A 2VT5A 4YKKA 4OVQA 3G3JA 3A29A 5L9OA 2DYXA 5HBCA 2B65A 4N6KA 2CZKA 2KQZA 2Y7KA 2PT2A 1Z7ME 5LOMA 5B70A 3PUYE 1PBPA 1MPDA 4O3BA 3VVEA 3UK4A 3M8UA 1JEUA 4HE2A 2GH9A 1P1NA 4YKPA 2UXAA 3E9XA 3RLFE 3FV1A 1URGA 5TU0A 2DE4A 3FVKA 3OENA 4PAFA 3FATA 4N8GA 2O69A 1XOCA 2RC8A 1CNQA 2UVIA 4PDDA 2P3NA 4N4UA 1M5EA 1US4A 2YJPA 4GBVA 3SDFA 3O2AA 4Q0CA 5H8HB 3HV1A 3IL1B 1GVCA 3PPNA 1SW4A 4RK9A 4OETA 2IEEA 3KOSA 4X1BA 3MVYA 4PBQA 2KLFA 2OJTA 1I6AA 2KR0A 4AB5A 3MAMA 4R2FA 3CG1A 2A5TB 1P99A 1AOVA 1YTVA 5EQAA 4OVSA 3EHTA 3KEIA 3TQLA 3TTNA 3C35A 2P1SA 1ZKBA 3CFZA 2Y7RA 4JXIA 1Y4TA 5DEXA 4OVJA 1O7TA 1IMCA 4WXJA 2PCRA 1DPEA 4X1DA 3V89B 5FHNA 1LBZA 3H6WA 4GWWA 3Q29A 4X9TA 3JV9A 3OO8A 4OEUA 4MNPA 2MKZA 4BDOA 2NXOA 3S9MC 1ATGA 4P0GA 5J1DA 3R6UA 2HAVA 1NV6A 1SDXA 3KBZA 2XXUA 3MVZA 3K2DA 2F6GA 4JWYA 1Q35A 5CBRA 1KWHA 4MIJA 2HXRA 1NNTA 3K00A 3CFLA 4DXUA 2FIXA 4XEQA 2XX7A 5FBPA 3QYTA 3VXCA 4ZEIA 2DVZA 4EQBA 2REGA 2THIA 3KGCA 1Y3NA 1B7HA 1TXFA 5AA2A 1NV4A 4PFBA 3Q25A 3KJ7A 2DE3A 2I0CA 4O3CA 4F1UA 4O7IA 4G61A 2XWKA 5JTYB 2XHDA 4IO4A 2X7PA 5TP9B 3Q26A 1P1UA 5JK4A 3V5AA 4WKMA 3E13X 3GBBA 2FBPA 3P7IA 4PP0A 3OSQA 3MYUA 2ALUA 4DLDA 4GFRA 2OX3A 4GQOA 2LAOA 4GWXA 2O1LA 4EDPA 3RPLA 1OIBA 3MP6A 4XXUA 4HE0A 3H3GA 3MQ9A 2Y7PA 4ESXA 3TEPA 3MVXA 1YCJA 4NHBA 1BKAA 1OVBA 5M2VA 5EQ8A 2F78A 1WDNA 2HCAA 1ZMGA 1AMFA 1FQBA 1B0LA 1B6HA 3RUMA 3R26A 1UIUA 4RXLA 3MP8A 1FPEA 1A55A 4N6DA 4K3FA 2B3FA 1MXUA 3T9HB 1FSAA 4G77A 1URDA 1Y4CA 4IO7A 3T22A 1B3LA 1MXXA 2FHYA 3AXFA 1UTHB 3PD9A 3TMGA 1IXCA 1Y9UA 3TCHA 1JEVA 2UVGA 4MMPA 4H45A 2BJIA 4I8CA 2QFLA 2X7QA 2ZNSA 5H8FB 1PB9A 2FVZA 4NG7A 4HW8A 4PF6A 1RDXA 4N6PA 5L9MA 2WX9A 5H8NA 4OHNA 1FBHA 4KYDA 1FTAA 5ITPA 3BKIB 4PGPA 4R75A 1VFEA 2VGQA 4GRKA 1I69A 4RA1A 1O63A 2OWZA 1FQAA 5AA4B 1XC1A 4KHZE 2REJA 4QSEA 3Q28A 2Z8FA 5ET6A 5ESYA 1QJMA 3RQTA 2UVJA 4BDLA 4WEPA 3C34A 3THIA 1D4NA 4DI4B 4G8HA 5I58B 2ONRA 2FNCA 4U1OA 1IITA 3FXBA 1XI6A 3CRBA 4FATA 1IXIA 2Y5KA 2VOZA 4EXLA 2E1SA 3W9VA 4PGNA 3MP1A 2R6GE 2I6EA 1PB7A 2HZKA 3N26A 1NNPA 3UN6A 4OA4A 1B46A 2PYYA 3OMBA 2ZYKA 5ITOA 2Y5LA 4HE1A 4F3BA 1XVXA 5I2KB 3QUFA 2R8TA 4RPNA 3UP9A 4N81A 3KFMA 2OWTA 4HCYA 3OSRA 3JYRA 3T9UA 3I6VA 4AB6A 1EZOA 1NFTA 3HHGA 3S9NC 3PD8A 4NF6A 1N3WA 4YMAA 4O8MA 4MX6A 3KOTA 3SERA 3G3HA 4LVQA 2O68A 1MRPA 4G68C 1FPGA 1XS5A 5LTCA 1N7XA 1LCFA 4OENA 5ICTA 4LN5A 4QF9A 4NF4A 3VDFA 3M3FA 1KA1A 3TCFA 3DELB 2ZZWA 4U22A 5I2NA 3R7XA 3UORA 1TFAA 1EYJA 1JETA 4EXKA 1KA0A 1MM7A 4F39A 3ROJA 5JEIA 2XXYA 2V3UA 3SZPA 4FECA 1POTA 3IOWA 5HPQA 2P3VA 2ZYOA 4RK2A 4M4GA 1Y3PA 3G3IA 3MZ9A 4BDQA 1N7WA 4KQPA 1B5IA 1S9TA 3BFUA 2QMWA 3IAZA 2P2AA 3MBPA 5CMKA 3I3VA 4PTKA 4YKIA 4RYAA 4QFLA 2Q2CA 3GBAA 1S50A 3ZKKA 3FV2A 3OD7A 3N6TA 3VVFA 4YAHX 2OBGA 4NF5B 5H8QA 3KN7A 1IXHA 3OO7A 2O84X 1MXWA 3L6HA 4ONYA 4XKPA 4KCDA 3BIGA 4MJOA 2W7YA 4I9DA 4F3GA 3Q27A 1G0IA 5I84A 1B3FA 5DYHA 3QK6A 4GOTA 1LLSA 3LV0A 4GWZA 2O51A 1B58A 4GWOA 1USYE 4P1EA 3FXRA 4PFIA 3K01A 3U93A 4AS4A 1YXIA 1FBPA 3E78A 4GIZA 3C32A 2DP8A 2YPNA 4HXVA 3K1MA 5KCJA 2R9JA 2H9BA 5H8SA 1MXZA 1IQ7A 4ZZAA 4LP2B 4GL8A 2QPQA 1MY1A 4NAPA 2XXXA 4YICA 4GBWA 4P1LA 1CE2A 3USDA 1II5A 2DQVA 1QUJA 1XT8A 4UA8A 3CVGA 4MHFA 4I1DA 3U94A 3TTRA 1SW1A 2I49A 3OXNA 2NWJA 3MPKA
chains in the Genus database with same CATH topology
4P8BA 3CHGA 1LBZA 4YZZA 4GWWA 2Q9TA 4X9TA 1NV1A 4X04A 3IFAA 5IZ3A 2F3DA 1IMDA 4MNPA 2MKZA 2CZIA 1FPBA 1FBDA 2XWVA 5IZ3B 1YZ0A 4XFEA 5I7IA 5DW8A 4PBHA 5J1DA 3T0JA 1NV6A 3KBZA 1VDWA 4MIJA 2HXRA 1SPIA 5IZ1A 2FIXA 3PTYA 4XEQA 1RDYA 5FBPA 2HHMA 1G0HA 2DVZA 1NUZA 2JJKA 1NV3A 2HPGA 1IMEA 5ET7A 1NV4A 1FBCA 2CEXA 4F19A 5EQ9A 4PFBA 2PFYA 2DE3A 3U65A 4F1VA 3RYDA 2ZZVA 3GYYA 4F1UA 4AS5A 4O7IA 2PFZA 4G61A 1LBYA 2F3BA 4DI3D 2XWKA 4GX6A 5ET5A 3HFUA 1AWBA 4NN3A 5JK4A 4PDHA 4OANA 4KXPA 4IR8A 2HZLA 2FBPA 2V3QA 4JVDA 1NUXA 4NX1A 1NV5A 3MYUA 4PCDA 3QMFA 2OX3A 2FIEA 4GWXA 1NV0A 3RPLA 4MAGA 4HE0A 1FJ6A 4N17A 2Q74A 4NHBA 3RPLB 5EQ8A 4P9KA 4PETA 3KC0A 1LBWA 4PFRA 2QVVA 1NV7A 4H46A 5A5LA 1FPEA 4N6DA 1FSAA 2FHYA 2B4LA 4MMPA 4H45A 4QXDA 4PF8A 2BJIA 2QFLA 1NI9A 2WYPA 2FVZA 4NG7A 1LBXA 3B8BA 4PF6A 1RDXA 4I3YA 2WX9A 3BIHA 1FPIA 2XWOA 1FBHA 2XWIA 2DE2A 1FTAA 4GX3A 4PGPA 1K9YA 4JVCA 2OWZA 2QVRA 1DBZA 1RDZA 4QBAA 1BK4A 2CEYA 5ET6A 5ESYA 3T1BA 4MNCA 2WBDA 4DI4B 2Q8MA 4XF5A 3LUZA 1DCUA 3FXBA 4M1VA 1FRPA 2VPNA 1XI6A 5I5PA 3D1RA 2Y5KA 4O7MA 3FBPA 5IZZA 3W9VA 4PGNA 3E79A 4X8RA 2HZKA 4OA4A 2Y5LA 4HE1A 2R8TA 4N81A 4FBPA 1FBFA 4MEVA 4HCYA 1IMFA 1FPLA 1FPKA 1FJ9A 4P3LA 4I40A 4O8MA 2CZHA 5LDZA 2B4MA 4MX6A 5ET8A 5CM6A 1FPJA 1YYZA 4PAKA 3IFCA 1FPGA 4NGUA 5LTCA 2WBBA 4N91A 4LN5A 5J16A 4NQ8A 4GWUA 5T3JA 4I3EA 1NV2A 1KA1A 2ZZWA 1LBVA 5EYGA 1QGXA 4PC9A 1NUWA 2F5XA 1EYJA 1EYKA 4PAIA 3EKIA 1KA0A 4MNIA 1FBEA 4OVTA 4GWYA 3ROJA 1Q9DA 5I3SA 4PE3A 2XXKA 1LEVA 3SZPA 2P3VA 1FPFA 1IMAA 3NOHA 1FPDA 4JVIA 1D9QA 4NF0A 1FBGA 4PTKA 3MSTA 1JP4A 4P56A 1DK4A 1NUYA 2VT5A 2WYKA 4OVQA 4GX4A 4F18A 3A29A 4N6KA 2CZKA 2KQZA 4OVPA 2GQ1A 4P47A 2V4CA 2VPOA 3BIGA 4MJOA 4N15A 3ISPA 4HE2A 1G0IA 2WEFA 2DDKA 3LV0A 4GWZA 5IGAA 2DE4A 4P1EA 4PAFA 4PFIA 4N8GA 4N8YA 1CNQA 4AS4A 4PDDA 1YXIA 3W9WA 4UABA 2P3NA 4N4UA 1FBPA 3E78A 4GBVA 4HXVA 1INPA 5IM2A 1EYIA 2QVUA 1IMBA 2QPQA 2ZZXA 4PBQA 4NAPA 2L5VA 5EYHA 4YICA 2KR0A 4GBWA 1KZ8A 5F24A 4P1LA 4GWSA 4O94A 4OVRA 5EQ7A 5EQAA 4OVSA 3B50A 3KC1A 4HCWA 4MHFA 2XA5A 1IMCA 4MCOA 2PCRA 1K9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P8B A;  3FXB A;  4NF0 A;  4NX1 A;  4YZZ A;  2VPN A;  5I5P A;  4PCD A;  4P56 A;  4X04 A;  4O7M A;  5IZZ A;  2WYK A;  4PGN A;  4X8R A;  2HZK A;  4OVQ A;  4MAG A;  4OA4 A;  4MNP A;  4N17 A;  4N6K A;  4OVP A;  2XWV A;  4NHB A;  4P9K A;  4PET A;  4MEV A;  4P47 A;  2V4C A;  2VPO A;  4N15 A;  4PFR A;  4XFE A;  5I7I A;  4PBH A;  4P3L A;  4O8M A;  4MX6 A;  5CM6 A;  4N6D A;  5IGA A;  4MIJ A;  4PAK A;  4P1E A;  4PAF A;  4PFI A;  4N8G A;  4NGU A;  5LTC A;  4N8Y A;  4XEQ A;  4PDD A;  4N91 A;  4LN5 A;  4UAB A;  4N4U A;  4NQ8 A;  4MMP A;  4PF8 A;  2ZZW A;  4PC9 A;  2WYP A;  4NG7 A;  5IM2 A;  2HPG A;  4PF6 A;  2WX9 A;  2XWO A;  2CEX A;  2XWI A;  4PAI A;  4PFB A;  2PFY A;  2ZZX A;  4PBQ A;  4PGP A;  4NAP A;  4MNI A;  4YIC A;  3U65 A;  2ZZV A;  3GYY A;  4OVT A;  4P1L A;  4O94 A;  4PE3 A;  4OVR A;  2XXK A;  2PFZ A;  4OVS A;  4DI3 D;  2CEY A;  2XWK A;  3B50 A;  4MHF A;  2XA5 A;  4MNC A;  4NN3 A;  4PDH A;  4OAN A;  4DI4 B;  4XF5 A;  4MCO A;  2HZL A; 
#chains in the Genus database with same CATH topology
 5L9S A;  1SVX B;  4KI0 E;  1R9Q A;  5DVF A;  5AA2 D;  3IOR A;  4YZZ A;  3PMW A;  2Q9T A;  3VVD A;  4X04 A;  1H3D A;  3IFA A;  1SD3 A;  1MS7 A;  3C9H A;  1B5J A;  2AL5 A;  1FPB A;  1B1X A;  1CB6 A;  5IZ3 B;  3LSW A;  3K4U A;  1LST A;  5I7I A;  4QFP A;  1A8F A;  5DW8 A;  4PBH A;  1OQH A;  3VE1 B;  5KDT B;  4F2Q A;  3KJT A;  3W15 C;  3PPP A;  4NTL A;  3VXB A;  1MQH A;  5IKB A;  1LFG A;  3PTY A;  4QFN A;  4U4S A;  1LAF E;  5KZT A;  1B3G A;  1TWY A;  2F7A A;  2VD2 A;  3FVN A;  1D9Y A;  1LGB C;  3V8X B;  5CRY A;  2GHB A;  3I5O A;  1FBC A;  2F7C A;  2Y84 A;  4RY1 A;  4F19 A;  2GHA A;  1ZTY A;  1A99 A;  2ZZV A;  5A5X B;  4JWX A;  4AS5 A;  4JSD A;  1LBY A;  3VLW A;  3HO7 A;  4DI3 D;  2XXT A;  1LCT A;  3TUS A;  3PU5 A;  1OVT A;  1MXY A;  4AQ4 A;  3A3U A;  4KPT A;  4KXP A;  5B7D A;  4G8N A;  3LC8 A;  4ZZE A;  3CI8 A;  2VP1 A;  4NX1 A;  3RTF B;  1NV5 A;  2ZYN A;  2R71 A;  1IIW A;  4LUB A;  4BDN A;  3RY3 A;  2DWJ A;  2I4B A;  4R74 A;  4EUO A;  3N5L A;  4N13 A;  1B32 A;  4Q5T A;  1ZU0 A;  3LUY A;  2FA7 A;  4DXB A;  4PFR A;  2NOO A;  5I59 A;  5FHM A;  1TFD A;  2OK2 A;  1Z7N E;  1DOT A;  4MLQ A;  1VE4 A;  3ZSF A;  5EHS A;  3KZG A;  4ZEB A;  1JW1 A;  3T66 A;  4R6H A;  4QSD A;  5I56 B;  1AIV A;  4G68 A;  2QRY A;  5F1Q A;  1LBX A;  3B8B A;  4PFY A;  3BIH A;  4OZ9 A;  2DE2 A;  4RJZ A;  1AL3 A;  4GX3 A;  3TQW A;  4OFL A;  4EQ9 A;  3QIM A;  1MPC A;  3B6T A;  3RN8 A;  1ZLQ A;  1LAH E;  2ZMB A;  5AE4 A;  1IEJ A;  2CEY A;  1B3E A;  4R73 A;  1PDA A;  3LBS A;  1SQY A;  2Q2A A;  4RPO A;  2QMX A;  2HXW A;  2ONK E;  1OQG A;  2XX8 A;  4XF5 A;  4JBZ A;  3A09 A;  4LZ5 A;  2E0S A;  1FRP A;  2F8D A;  1MY4 A;  1US5 A;  5I5P A;  5TPA A;  3A3C A;  2OZZ A;  4X8R A;  1D9V A;  2F6P A;  4IGT A;  1IUD A;  4NF8 A;  3FVG A;  4KFQ A;  2UYF A;  4FIM A;  2FYI A;  1QKA A;  3EF7 A;  3DLN A;  3L6G A;  1Y1Z A;  3N6U A;  1FPK A;  2VHA A;  1FJ9 A;  4P3L A;  3MZ1 A;  3C36 A;  4R6K A;  5I57 A;  1T0K A;  2B4M A;  1ELJ A;  4P0I A;  5ET8 A;  5CM6 A;  1YAE A;  2ANJ A;  4O3A A;  1MY0 A;  4NGU A;  2DSF A;  3PPO A;  4N91 A;  2DXR A;  3IB1 A;  1B05 A;  1GGG A;  4OER A;  1JNF A;  1LAG E;  2RF1 A;  5EYG A;  2HQ0 A;  2PVU A;  1B9J A;  1N84 A;  4MFI A;  2ZYM A;  1UTB B;  2XX9 A;  1XVY A;  3TFL A;  5ISU A;  4H6D A;  3K02 A;  1FBE A;  3U1O A;  3FD3 A;  1FTK A;  4GWY A;  4LQ2 A;  1A8E A;  1SI0 A;  1B0H A;  2XXK A;  1LEV A;  4ELR A;  4L17 A;  1QVS A;  3PPQ A;  1QUI A;  1N0T A;  1FPF A;  1IMA A;  3H06 B;  3NOH A;  4GLI A;  3OO6 A;  1H43 A;  4ND9 A;  1FQC A;  4F1Y A;  1FPD A;  2Q8J A;  2D5W A;  1LB9 A;  1EZ9 A;  4BLA A;  3PPR A;  2Q89 A;  3MST A;  3SKP A;  1P1Q A;  1WVJ A;  4P56 A;  1DK4 A;  1ZBM A;  2WYK A;  3FJM A;  4OFO A;  3G7W A;  3MUQ A;  2CMO A;  3IB2 A;  5AA1 A;  5CMC A;  4G4P A;  4QFK A;  4OVP A;  3LR1 A;  2GQ1 A;  3SEY A;  3TTK A;  4P47 A;  2V4C A;  2VPO A;  2F7B A;  4N15 A;  4ZEF A;  1R1N A;  5FTH A;  4U21 A;  2WEF A;  3IR1 A;  1B7Z A;  2DDK A;  2X26 A;  1A7L A;  1B51 A;  1Q1K A;  3M3K A;  4ZED A;  3CG3 A;  4R72 A;  1USY H;  3T9X B;  3RT6 B;  4N8Y A;  3SEX A;  1IXG A;  5H8H A;  3W9W A;  3S9L C;  1DPP A;  1H44 A;  4F2O A;  4OQO A;  3TDJ A;  1PEB A;  1INP A;  3KG2 A;  3O6H A;  4FE8 A;  3TOD A;  1IMB A;  1H76 A;  2A5T A;  4GF8 A;  3RT8 A;  4EF1 A;  2ZZX A;  2L5V A;  4HS7 A;  5EYH A;  3ZS6 A;  4PFU A;  4GWS A;  2H4I A;  4O94 A;  2WKY A;  3IX1 A;  3B50 A;  3KC1 A;  1L5T A;  4TLM B;  1R6Z A;  3SEW A;  4LZ7 A;  4MCO A;  1OMP A;  4IO6 A;  4P8B A;  3V83 A;  1NH7 A;  2AYS A;  5DEX B;  1BTJ A;  3ZKL A;  3UGW A;  3DP8 A;  3DP6 A;  4DCX A;  4YU0 A;  2F3D A;  3ILU B;  3K6W A;  1IMD A;  3TKD A;  5F7V A;  3KN3 A;  1GR2 A;  2XD2 A;  1JVX A;  1EU8 A;  1MDP 1;  3C31 A;  1FBD A;  2I48 A;  4POX A;  4ECF A;  2Q88 A;  1YZ0 A;  2AIX A;  1FTL A;  4IY6 A;  3G3K A;  4XFE A;  5CMB A;  3SEU A;  4F3P A;  2P0S A;  1B3H A;  3VLV A;  3O97 A;  2I3V A;  2DWI A;  3T0J A;  4C1U A;  4R2B A;  3E4R A;  1VDW A;  4C0R A;  4XIG Q;  1NMU A;  2A5S A;  3FXQ A;  1SPI A;  2GRV A;  3H4Z A;  5IZ1 A;  4YB7 A;  3K6X A;  1QUL A;  2UYE A;  1LFI A;  4ZEK A;  2NUV A;  1G0H A;  2F34 A;  3GZG A;  3TTL A;  1NUZ A;  4H5F A;  2JJK A;  1NV3 A;  2NVU B;  1RKM A;  1IME A;  4DIG A;  2PX1 A;  2CEX A;  3T93 B;  5EQ9 A;  2M8C A;  4GL0 A;  1J1N A;  3EHU A;  1MDQ A;  5AA2 B;  3U65 A;  4MF3 A;  5JTY A;  3RYD A;  3GYY A;  1RYO A;  2I3W A;  2ZNU A;  5TP9 A;  2F3B A;  4GX6 A;  2QS2 A;  3GXA A;  1DMB A;  3OEK A;  1M5B A;  1LAX A;  3IOU A;  4U23 A;  4NN3 A;  2OLB A;  3QXM A;  4PDH A;  1JW5 A;  4OAN A;  3IO6 A;  4IR8 A;  1Y1M A;  4ZS9 A;  4PE5 B;  2H98 A;  2DXY A;  2V3Q A;  4JDF A;  4FOR A;  4ZDM A;  3PMV A;  3QMF A;  4MAG A;  2V3T A;  5AA3 A;  3C33 A;  3RPL B;  4Z0I A;  4P9K A;  4PET A;  3KC0 A;  1LBW A;  3RNN A;  3O9P A;  1NNK A;  3IB0 A;  4OTE A;  4DXC A;  2QVV A;  5A5L A;  3WAF A;  2XXR A;  3ONM A;  1UTH A;  1P1O A;  1HSL A;  3OEM A;  5H8F A;  2B4L A;  4OMB A;  4X48 A;  2I4C A;  4F31 B;  1LBC A;  3SEV A;  2DWA A;  1ANF A;  2QS4 A;  4ZEC A;  3IJO B;  4TLL B;  2WYP A;  2AL4 A;  4I3Y A;  3EPE A;  4BDR A;  1TT1 A;  1B5H A;  1FPI A;  2XWI A;  4POW A;  4LA9 A;  5AA4 A;  1VSO A;  3GLB A;  4MBP A;  3CFX A;  5H8N B;  4JVC A;  1QW0 A;  3ECR A;  1DBZ A;  1YPN A;  3O6G A;  4QBA A;  3TYH A;  5I58 A;  1OLC A;  3T1B A;  1FCK A;  4NWC A;  2B3B A;  3UIF A;  1SBP A;  4MNC A;  5ELV A;  2WBD A;  3IOV A;  3K1N A;  3H6U A;  4ELP A;  2ZNT A;  3HCQ A;  1R9L A;  1DTZ A;  2V84 A;  1WOD A;  2VD3 A;  2QS3 A;  4H67 A;  5I2K A;  3D1R A;  3FBP A;  5K2X A;  5IZZ A;  4LON B;  4GXA A;  4OWD A;  1FQD A;  5BUU A;  1VFD A;  4FED A;  3MVW A;  4QRZ A;  4G2Z A;  1FBF A;  3OEL A;  1AH5 A;  3MC2 A;  2DVC A;  1F9B A;  2YLN A;  3DM0 A;  3O29 A;  4I40 A;  3TPA A;  4DCY A;  5HM4 B;  4TOZ A;  5LDZ A;  4XKN A;  1FW0 A;  3U92 A;  1FPJ A;  1URS A;  4OYV A;  4NF6 B;  2QSX A;  5EYF A;  4IO3 A;  4KYS A;  3M3L A;  4LAT A;  4F29 A;  4NQ8 A;  5T3J A;  4I3E A;  4QFO A;  4ZE9 A;  5FTI A;  1NV2 A;  1MH4 A;  3VV5 A;  1LBV A;  1QGX A;  4PC9 A;  1NUW A;  1JVY A;  4NF4 B;  4TQU Q;  2F5X A;  4YKJ A;  2ONS A;  2OCU A;  3SET A;  3N94 A;  4IB2 A;  1EYK A;  1SYH A;  4PAI A;  3LSF B;  4THI A;  4FAJ A;  4MNI A;  5I2N B;  2V25 A;  5DT6 A;  2RIN A;  4ZE8 A;  3PUV E;  4OVT A;  4EF2 A;  2XXP A;  1Q9D A;  4JSO A;  4PE3 A;  4R9F A;  4OFJ A;  1PC3 A;  1SI1 A;  3PMX A;  1M5D A;  3B6W A;  4ELO A;  4IO5 A;  4N07 A;  2Z22 A;  2XXW A;  1D9Q A;  3OO9 A;  4QHQ A;  1FBG A;  3FUZ A;  3K6V A;  3TTM A;  1MQD A;  4NF5 A;  1NUY A;  2HAU A;  1ZJL A;  3PUW E;  4GX4 A;  5DTB A;  4F18 A;  3RTW B;  3K6U A;  3TAJ A;  5CBS A;  2ABH A;  4KYE A;  3KSX A;  3HPI A;  1DTG A;  2RC9 A;  1NL5 A;  4ESW A;  3FIR A;  3ISP A;  5H8Q B;  2DWH A;  2QL3 A;  4NWD A;  1XHY A;  1N04 A;  3PUX E;  5L8D A;  4OES A;  4E0W A;  2G93 A;  3H6T A;  1B4Z A;  5IGA A;  4NMY A;  3K1P A;  4UAB A;  2UVH A;  2I58 A;  5CC2 A;  3G3G A;  2F36 A;  3B7D A;  3S2V A;  1B2H A;  4H65 A;  1NNF A;  3FAS A;  5IM2 A;  1EYI A;  4PQJ A;  3PGF A;  2QVU A;  4F22 A;  1EZP A;  1BIY A;  3IOT A;  3UA8 A;  5KCJ B;  1D3K A;  4WED A;  3K0V A;  5FHO A;  4QSC A;  2QS1 A;  1KZ8 A;  5F24 A;  2QJE A;  4OXV A;  2F97 A;  4OVR A;  1Y3Q A;  4DE8 A;  5EQ7 A;  4Z7E A;  3VFJ A;  1VR5 A;  4HCW A;  4IY5 A;  2XA5 A;  1PB8 A;  3PUZ E;  4JB7 A;  1FTO A;  4NED A;  3O66 A;  1O64 A;  1P1W A;  4EQ7 A;  1GV8 A;  4OEV A;  3D4G A;  1MY3 A;  4H1X A;  1B4H A;  3CHG A;  3DP4 A;  4LZ8 A;  1B52 A;  4UAC A;  4HTG A;  1NV1 A;  1MM6 A;  5IZ3 A;  1QUK A;  2CZI A;  2DS9 A;  3JZJ A;  1OLA A;  2D21 A;  4KR5 A;  2Z23 A;  1MY2 A;  2XWV A;  3U72 A;  5KDT A;  3CSG A;  4YB5 A;  2H25 A;  1M5C A;  2IA4 A;  3FXU A;  3LSL A;  3FZV A;  2RCB A;  2H99 A;  4XKQ A;  2O1M A;  3D4C A;  1HSE A;  2ESN A;  1RDY A;  2HHM A;  5BWJ A;  4GD5 A;  3S9E A;  3KSJ A;  4C1T A;  3HHF A;  1GTK A;  2HPG A;  3BBR A;  5ET7 A;  3T9V A;  1M5F A;  5A5X A;  5CMM A;  3FJG A;  3FJ7 A;  1B7U A;  1MH3 A;  2PFY A;  3HST A;  4ELQ A;  2Y7W A;  4XTC Q;  2XXQ A;  4F1V A;  1FTM A;  2PFZ A;  3IK6 B;  3T96 B;  1FTJ A;  5ET5 A;  3HFU A;  2XXI A;  1AWB A;  2OWS A;  5IAI A;  3RPW A;  1BLF A;  4MLV A;  2HZL A;  2XXV A;  4KD5 A;  3FVO A;  3TEL A;  1Y20 A;  4JVD A;  3U8Q A;  1NUX A;  2O7I A;  2CZL A;  4PCD A;  3H7M A;  2FIE A;  2GFE A;  3RGY A;  1NV0 A;  3FGS A;  3VLU A;  1LB8 A;  1SYI A;  1A40 A;  1FJ6 A;  4N17 A;  4H5G A;  4G8M A;  4ISU A;  2Q74 A;  4BDM A;  2HEU A;  1MQG A;  2RC7 A;  4U2R A;  4JWO A;  1NV7 A;  4H8I A;  1PBQ A;  4H46 A;  3G3F A;  4P11 A;  4U1Z A;  4IGR A;  2XD3 A;  5I59 B;  5I56 A;  1MQI A;  2D3I A;  2Z8D A;  4DZ1 A;  2XXH A;  2PBW A;  1POY 1;  4Q30 B;  2PT1 A;  1UQW A;  1JW4 A;  3TCG A;  4QXD A;  4PF8 A;  3EQ1 A;  1NI9 A;  2I0B A;  1EH3 A;  3HN0 A;  2O7U A;  4G68 B;  3C4M A;  2XWO A;  3LSX A;  5CI5 A;  3EN3 A;  1K9Y A;  3CR9 A;  3MWB A;  3S4U A;  3E3K A;  4FEB A;  4PFT A;  1N3X A;  1SW2 A;  2QVR A;  2RKM A;  1RDZ A;  2H5Y A;  1BK4 A;  3KBR A;  3QUJ A;  4H8J A;  1H45 A;  4E0X A;  1UIV A;  1S7Y A;  2Q8M A;  3LUZ A;  3QAX A;  1K9Z A;  2ZXT A;  1DCU A;  1N76 A;  4FJP A;  4M1V A;  3O28 A;  4DDD A;  1SW5 A;  2VPN A;  4I62 A;  3H03 A;  5ICQ A;  4O7M A;  3MW0 A;  2F35 A;  2Z8E A;  1HSJ A;  1JQF A;  1LBB A;  3E79 A;  4U4X A;  1ZIU A;  3EHS A;  4R6Y A;  3F11 A;  1DSN A;  1LFH A;  1MXV A;  5TPA B;  2RCA A;  3ILT B;  4FBP A;  4MEV A;  1IMF A;  4NF8 B;  1I6B A;  3CSB A;  4GVO A;  3OOA A;  1FPL A;  1MPB A;  1NH8 A;  2PMS A;  3MPL A;  3PV0 E;  2CZH A;  4NE4 A;  4PFW A;  1YYZ A;  4PAK A;  3IFC A;  5I57 B;  4MH5 A;  3WAE A;  3H6V A;  3MJN A;  2WBB A;  4KCC A;  5J16 A;  4GWU A;  1I6Q A;  4IO2 A;  3IJX B;  2HFB A;  3B6Q A;  1UTB A;  1FQE A;  4XKR A;  1B40 A;  1FQF A;  4GXS B;  2G29 A;  3MZB A;  1RYX A;  3KN8 A;  3CIJ A;  3SES A;  3EKI A;  1NKX A;  5EHM A;  3QSL A;  1QKB A;  5I3S A;  4YMB A;  1IZ1 A;  2Y7I A;  4RNS A;  2DOJ A;  5DVJ A;  5DVI A;  1MG1 A;  3TZA A;  2BJJ X;  3BFT A;  1MQJ A;  4Q8R A;  3O6I A;  1BP5 A;  3ODB A;  4H0W A;  5K2Y A;  1B1H A;  4JVI A;  4LQ5 A;  4R9G A;  4NF0 A;  2O6A A;  1A54 A;  4F3S A;  1JP4 A;  3IO4 A;  2V93 A;  4YB6 A;  2VT5 A;  4YKK A;  4OVQ A;  3G3J A;  3A29 A;  5L9O A;  2DYX A;  5HBC A;  2B65 A;  4N6K A;  2CZK A;  2KQZ A;  2Y7K A;  2PT2 A;  1Z7M E;  5LOM A;  5B70 A;  3PUY E;  1PBP A;  1MPD A;  4O3B A;  3VVE A;  3UK4 A;  3M8U A;  1JEU A;  4HE2 A;  2GH9 A;  1P1N A;  4YKP A;  2UXA A;  3E9X A;  3RLF E;  3FV1 A;  1URG A;  5TU0 A;  2DE4 A;  3FVK A;  3OEN A;  4PAF A;  3FAT A;  4N8G A;  2O69 A;  1XOC A;  2RC8 A;  1CNQ A;  2UVI A;  4PDD A;  2P3N A;  4N4U A;  1M5E A;  1US4 A;  2YJP A;  4GBV A;  3SDF A;  3O2A A;  4Q0C A;  5H8H B;  3HV1 A;  3IL1 B;  1GVC A;  3PPN A;  1SW4 A;  4RK9 A;  4OET A;  2IEE A;  3KOS A;  4X1B A;  3MVY A;  4PBQ A;  2KLF A;  2OJT A;  1I6A A;  2KR0 A;  4AB5 A;  3MAM A;  4R2F A;  3CG1 A;  2A5T B;  1P99 A;  1AOV A;  1YTV A;  5EQA A;  4OVS A;  3EHT A;  3KEI A;  3TQL A;  3TTN A;  3C35 A;  2P1S A;  1ZKB A;  3CFZ A;  2Y7R A;  4JXI A;  1Y4T A;  5DEX A;  4OVJ A;  1O7T A;  1IMC A;  4WXJ A;  2PCR A;  1DPE A;  4X1D A;  3V89 B;  5FHN A;  1LBZ A;  3H6W A;  4GWW A;  3Q29 A;  4X9T A;  3JV9 A;  3OO8 A;  4OEU A;  4MNP A;  2MKZ A;  4BDO A;  2NXO A;  3S9M C;  1ATG A;  4P0G A;  5J1D A;  3R6U A;  2HAV A;  1NV6 A;  1SDX A;  3KBZ A;  2XXU A;  3MVZ A;  3K2D A;  2F6G A;  4JWY A;  1Q35 A;  5CBR A;  1KWH A;  4MIJ A;  2HXR A;  1NNT A;  3K00 A;  3CFL A;  4DXU A;  2FIX A;  4XEQ A;  2XX7 A;  5FBP A;  3QYT A;  3VXC A;  4ZEI A;  2DVZ A;  4EQB A;  2REG A;  2THI A;  3KGC A;  1Y3N A;  1B7H A;  1TXF A;  5AA2 A;  1NV4 A;  4PFB A;  3Q25 A;  3KJ7 A;  2DE3 A;  2I0C A;  4O3C A;  4F1U A;  4O7I A;  4G61 A;  2XWK A;  5JTY B;  2XHD A;  4IO4 A;  2X7P A;  5TP9 B;  3Q26 A;  1P1U A;  5JK4 A;  3V5A A;  4WKM A;  3E13 X;  3GBB A;  2FBP A;  3P7I A;  4PP0 A;  3OSQ A;  3MYU A;  2ALU A;  4DLD A;  4GFR A;  2OX3 A;  4GQO A;  2LAO A;  4GWX A;  2O1L A;  4EDP A;  3RPL A;  1OIB A;  3MP6 A;  4XXU A;  4HE0 A;  3H3G A;  3MQ9 A;  2Y7P A;  4ESX A;  3TEP A;  3MVX A;  1YCJ A;  4NHB A;  1BKA A;  1OVB A;  5M2V A;  5EQ8 A;  2F78 A;  1WDN A;  2HCA A;  1ZMG A;  1AMF A;  1FQB A;  1B0L A;  1B6H A;  3RUM A;  3R26 A;  1UIU A;  4RXL A;  3MP8 A;  1FPE A;  1A55 A;  4N6D A;  4K3F A;  2B3F A;  1MXU A;  3T9H B;  1FSA A;  4G77 A;  1URD A;  1Y4C A;  4IO7 A;  3T22 A;  1B3L A;  1MXX A;  2FHY A;  3AXF A;  1UTH B;  3PD9 A;  3TMG A;  1IXC A;  1Y9U A;  3TCH A;  1JEV A;  2UVG A;  4MMP A;  4H45 A;  2BJI A;  4I8C A;  2QFL A;  2X7Q A;  2ZNS A;  5H8F B;  1PB9 A;  2FVZ A;  4NG7 A;  4HW8 A;  4PF6 A;  1RDX A;  4N6P A;  5L9M A;  2WX9 A;  5H8N A;  4OHN A;  1FBH A;  4KYD A;  1FTA A;  5ITP A;  3BKI B;  4PGP A;  4R75 A;  1VFE A;  2VGQ A;  4GRK A;  1I69 A;  4RA1 A;  1O63 A;  2OWZ A;  1FQA A;  5AA4 B;  1XC1 A;  4KHZ E;  2REJ A;  4QSE A;  3Q28 A;  2Z8F A;  5ET6 A;  5ESY A;  1QJM A;  3RQT A;  2UVJ A;  4BDL A;  4WEP A;  3C34 A;  3THI A;  1D4N A;  4DI4 B;  4G8H A;  5I58 B;  2ONR A;  2FNC A;  4U1O A;  1IIT A;  3FXB A;  1XI6 A;  3CRB A;  4FAT A;  1IXI A;  2Y5K A;  2VOZ A;  4EXL A;  2E1S A;  3W9V A;  4PGN A;  3MP1 A;  2R6G E;  2I6E A;  1PB7 A;  2HZK A;  3N26 A;  1NNP A;  3UN6 A;  4OA4 A;  1B46 A;  2PYY A;  3OMB A;  2ZYK A;  5ITO A;  2Y5L A;  4HE1 A;  4F3B A;  1XVX A;  5I2K B;  3QUF A;  2R8T A;  4RPN A;  3UP9 A;  4N81 A;  3KFM A;  2OWT A;  4HCY A;  3OSR A;  3JYR A;  3T9U A;  3I6V A;  4AB6 A;  1EZO A;  1NFT A;  3HHG A;  3S9N C;  3PD8 A;  4NF6 A;  1N3W A;  4YMA A;  4O8M A;  4MX6 A;  3KOT A;  3SER A;  3G3H A;  4LVQ A;  2O68 A;  1MRP A;  4G68 C;  1FPG A;  1XS5 A;  5LTC A;  1N7X A;  1LCF A;  4OEN A;  5ICT A;  4LN5 A;  4QF9 A;  4NF4 A;  3VDF A;  3M3F A;  1KA1 A;  3TCF A;  3DEL B;  2ZZW A;  4U22 A;  5I2N A;  3R7X A;  3UOR A;  1TFA A;  1EYJ A;  1JET A;  4EXK A;  1KA0 A;  1MM7 A;  4F39 A;  3ROJ A;  5JEI A;  2XXY A;  2V3U A;  3SZP A;  4FEC A;  1POT A;  3IOW A;  5HPQ A;  2P3V A;  2ZYO A;  4RK2 A;  4M4G A;  1Y3P A;  3G3I A;  3MZ9 A;  4BDQ A;  1N7W A;  4KQP A;  1B5I A;  1S9T A;  3BFU A;  2QMW A;  3IAZ A;  2P2A A;  3MBP A;  5CMK A;  3I3V A;  4PTK A;  4YKI A;  4RYA A;  4QFL A;  2Q2C A;  3GBA A;  1S50 A;  3ZKK A;  3FV2 A;  3OD7 A;  3N6T A;  3VVF A;  4YAH X;  2OBG A;  4NF5 B;  5H8Q A;  3KN7 A;  1IXH A;  3OO7 A;  2O84 X;  1MXW A;  3L6H A;  4ONY A;  4XKP A;  4KCD A;  3BIG A;  4MJO A;  2W7Y A;  4I9D A;  4F3G A;  3Q27 A;  1G0I A;  5I84 A;  1B3F A;  5DYH A;  3QK6 A;  4GOT A;  1LLS A;  3LV0 A;  4GWZ A;  2O51 A;  1B58 A;  4GWO A;  1USY E;  4P1E A;  3FXR A;  4PFI A;  3K01 A;  3U93 A;  4AS4 A;  1YXI A;  1FBP A;  3E78 A;  4GIZ A;  3C32 A;  2DP8 A;  2YPN A;  4HXV A;  3K1M A;  5KCJ A;  2R9J A;  2H9B A;  5H8S A;  1MXZ A;  1IQ7 A;  4ZZA A;  4LP2 B;  4GL8 A;  2QPQ A;  1MY1 A;  4NAP A;  2XXX A;  4YIC A;  4GBW A;  4P1L A;  1CE2 A;  3USD A;  1II5 A;  2DQV A;  1QUJ A;  1XT8 A;  4UA8 A;  3CVG A;  4MHF A;  4I1D A;  3U94 A;  3TTR A;  1SW1 A;  2I49 A;  3OXN A;  2NWJ A;  3MPK A; 
#chains in the Genus database with same CATH homology
 4P8B A;  3CHG A;  1LBZ A;  4YZZ A;  4GWW A;  2Q9T A;  4X9T A;  1NV1 A;  4X04 A;  3IFA A;  5IZ3 A;  2F3D A;  1IMD A;  4MNP A;  2MKZ A;  2CZI A;  1FPB A;  1FBD A;  2XWV A;  5IZ3 B;  1YZ0 A;  4XFE A;  5I7I A;  5DW8 A;  4PBH A;  5J1D A;  3T0J A;  1NV6 A;  3KBZ A;  1VDW A;  4MIJ A;  2HXR A;  1SPI A;  5IZ1 A;  2FIX A;  3PTY A;  4XEQ A;  1RDY A;  5FBP A;  2HHM A;  1G0H A;  2DVZ A;  1NUZ A;  2JJK A;  1NV3 A;  2HPG A;  1IME A;  5ET7 A;  1NV4 A;  1FBC A;  2CEX A;  4F19 A;  5EQ9 A;  4PFB A;  2PFY A;  2DE3 A;  3U65 A;  4F1V A;  3RYD A;  2ZZV A;  3GYY A;  4F1U A;  4AS5 A;  4O7I A;  2PFZ A;  4G61 A;  1LBY A;  2F3B A;  4DI3 D;  2XWK A;  4GX6 A;  5ET5 A;  3HFU A;  1AWB A;  4NN3 A;  5JK4 A;  4PDH A;  4OAN A;  4KXP A;  4IR8 A;  2HZL A;  2FBP A;  2V3Q A;  4JVD A;  1NUX A;  4NX1 A;  1NV5 A;  3MYU A;  4PCD A;  3QMF A;  2OX3 A;  2FIE A;  4GWX A;  1NV0 A;  3RPL A;  4MAG A;  4HE0 A;  1FJ6 A;  4N17 A;  2Q74 A;  4NHB A;  3RPL B;  5EQ8 A;  4P9K A;  4PET A;  3KC0 A;  1LBW A;  4PFR A;  2QVV A;  1NV7 A;  4H46 A;  5A5L A;  1FPE A;  4N6D A;  1FSA A;  2FHY A;  2B4L A;  4MMP A;  4H45 A;  4QXD A;  4PF8 A;  2BJI A;  2QFL A;  1NI9 A;  2WYP A;  2FVZ A;  4NG7 A;  1LBX A;  3B8B A;  4PF6 A;  1RDX A;  4I3Y A;  2WX9 A;  3BIH A;  1FPI A;  2XWO A;  1FBH A;  2XWI A;  2DE2 A;  1FTA A;  4GX3 A;  4PGP A;  1K9Y A;  4JVC A;  2OWZ A;  2QVR A;  1DBZ A;  1RDZ A;  4QBA A;  1BK4 A;  2CEY A;  5ET6 A;  5ESY A;  3T1B A;  4MNC A;  2WBD A;  4DI4 B;  2Q8M A;  4XF5 A;  3LUZ A;  1DCU A;  3FXB A;  4M1V A;  1FRP A;  2VPN A;  1XI6 A;  5I5P A;  3D1R A;  2Y5K A;  4O7M A;  3FBP A;  5IZZ A;  3W9V A;  4PGN A;  3E79 A;  4X8R A;  2HZK A;  4OA4 A;  2Y5L A;  4HE1 A;  2R8T A;  4N81 A;  4FBP A;  1FBF A;  4MEV A;  4HCY A;  1IMF A;  1FPL A;  1FPK A;  1FJ9 A;  4P3L A;  4I40 A;  4O8M A;  2CZH A;  5LDZ A;  2B4M A;  4MX6 A;  5ET8 A;  5CM6 A;  1FPJ A;  1YYZ A;  4PAK A;  3IFC A;  1FPG A;  4NGU A;  5LTC A;  2WBB A;  4N91 A;  4LN5 A;  5J16 A;  4NQ8 A;  4GWU A;  5T3J A;  4I3E A;  1NV2 A;  1KA1 A;  2ZZW A;  1LBV A;  5EYG A;  1QGX A;  4PC9 A;  1NUW A;  2F5X A;  1EYJ A;  1EYK A;  4PAI A;  3EKI A;  1KA0 A;  4MNI A;  1FBE A;  4OVT A;  4GWY A;  3ROJ A;  1Q9D A;  5I3S A;  4PE3 A;  2XXK A;  1LEV A;  3SZP A;  2P3V A;  1FPF A;  1IMA A;  3NOH A;  1FPD A;  4JVI A;  1D9Q A;  4NF0 A;  1FBG A;  4PTK A;  3MST A;  1JP4 A;  4P56 A;  1DK4 A;  1NUY A;  2VT5 A;  2WYK A;  4OVQ A;  4GX4 A;  4F18 A;  3A29 A;  4N6K A;  2CZK A;  2KQZ A;  4OVP A;  2GQ1 A;  4P47 A;  2V4C A;  2VPO A;  3BIG A;  4MJO A;  4N15 A;  3ISP A;  4HE2 A;  1G0I A;  2WEF A;  2DDK A;  3LV0 A;  4GWZ A;  5IGA A;  2DE4 A;  4P1E A;  4PAF A;  4PFI A;  4N8G A;  4N8Y A;  1CNQ A;  4AS4 A;  4PDD A;  1YXI A;  3W9W A;  4UAB A;  2P3N A;  4N4U A;  1FBP A;  3E78 A;  4GBV A;  4HXV A;  1INP A;  5IM2 A;  1EYI A;  2QVU A;  1IMB A;  2QPQ A;  2ZZX A;  4PBQ A;  4NAP A;  2L5V A;  5EYH A;  4YIC A;  2KR0 A;  4GBW A;  1KZ8 A;  5F24 A;  4P1L A;  4GWS A;  4O94 A;  4OVR A;  5EQ7 A;  5EQA A;  4OVS A;  3B50 A;  3KC1 A;  4HCW A;  4MHF A;  2XA5 A;  1IMC A;  4MCO A;  2PCR A;  1K9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...