2O7UA

Crystal structure of k206e/k296e mutant of the n-terminal half molecule of human transferrin
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
Knots found
sequence length
329
structure length
329
Chain Sequence
DKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVEHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFEDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords Serotransferrin
publication title Structures of two mutants that probe the role in iron release of the dilysine pair in the N-lobe of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
total genus 92
structure length 329
sequence length 329
chains with identical sequence B, C, D, E, F, G, H, I
other databases KnotProt 2.0: S
ec nomenclature
pdb deposition date 2006-12-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o7uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2o7uA02
4DLDA 3UN6A 4U21A 3SETA 1Y3NA 2X7PA 4M4GA 2IEEA 2CMOA 3OSQA 4YMBA 4MLVA 1P1QA 3TODA 4RYAA 4FEDA 2ZMBA 3M8UA 4XXUA 4OWDA 3R6UA 4R72A 2DE2A 3HSTA 2Y7RA 4H6DA 1N04A 1B1HA 4MBPA 3UA8A 5AA3A 2H99A 3DP4A 1ZU0A 3KN8A 4DXCA 3PPRA 1JVXA 5I58B 2VOZA 3MZ1A 4ELPA 1TWYA 2XX8A 1B58A 3EN3A 4ISUA 3S9MC 2F34A 2XXWA 3LR1A 4E0XA 4YMAA 3A3CA 3OO8A 2W7YA 3ILUB 5I56A 1D4NA 1MXUA 4THIA 2XXTA 3A09A 2HCAA 4IO7A 3W15C 4ZEBA 3IORA 1ZIUA 1QJMA 1GV8A 1R6ZA 3GBAA 5DEXA 5K2XA 4P11A 4NWDA 2Q88A 1SW5A 4U1ZA 4WEDA 4OTEA 5CBSA 1I69A 4JSOA 2HFBA 4ND9A 1O64A 3U93A 1XVYA 4WKMA 1MXVA 4UACA 4K3FA 3H4ZA 2O51A 2OCUA 2O84X 4NF6B 1LBBA 2XXUA 3FVKA 4JWXA 3C33A 1XC1A 3CR9A 3QUFA 2GFEA 2ZYKA 1D3KA 3I6VA 3KN3A 2UYEA 5HPQA 4R9FA 4ZE9A 4U4XA 1B05A 1PB7A 5EHMA 3TTKA 3IK6B 1M5FA 5B7DA 3DP8A 1KWHA 5I2KB 1N0TA 3USDA 1UIVA 2F6GA 5I59A 1QKAA 2PT2A 4EDPA 4BDLA 4ESWA 4H67A 4PETA 2V84A 5F1QA 1MQHA 3TFLA 4GQOA 3VV5A 1B3FA 4F3GA 3CG3A 4AB6A 3KJTA 3B6WA 3OENA 3IO6A 5L9SA 1OMPA 1F9BA 1PBQA 5IKBA 1A8FA 4KHZE 2QMWA 1B9JA 4N6PA 1H44A 3ECRA 5H8FA 4OFJA 3RPWA 1A99A 5KZTA 4BDNA 2I0CA 3PUXE 4MFIA 4OXVA 5I57A 3G3GA 4Q30B 3UK4A 2OJTA 3AXFA 3MPKA 4NF4A 2UYFA 4RPOA 4IY6A 5I2NB 2RCAA 3FV2A 1B46A 5AA2B 4ZEDA 1QUKA 3O66A 4R73A 2I49A 1R9QA 1HSLA 2ONKE 4ZECA 3T9UA 3BBRA 3VLUA 4H1XA 4O3AA 1DPEA 3TYHA 4F31B 3TCFA 4EXLA 4KD5A 3IOUA 5BWJA 3EQ1A 1DMBA 2I3VA 4JXIA 1JEVA 3HCQA 4X1DA 3R7XA 1IIWA 4H8IA 4PFYA 3TUSA 1FTKA 1H3DA 5L8DA 4NMYA 2V25A 1B2HA 4YU0A 4LA9A 4ONYA 4G8MA 2D5WA 1LCFA 3M3FA 4U4SA 3IOTA 3EHUA 4PFUA 1B5HA 3U8QA 3S9EA 2XD3A 1B7HA 3VVEA 2H4IA 2FYIA 4LUBA 2O68A 4KI0E 2NWJA 2OWTA 1IEJA 2HXWA 2PX1A 3IOVA 1IXHA 2M8CA 2H25A 3CVGA 4POWA 1LAXA 1N7WA 3TQWA 2Q89A 4R75A 1AIVA 1B51A 1I6AA 2Z23A 3FVOA 1US5A 4XIGQ 4GXSB 4FORA 4C1UA 3K00A 4G68B 2E1SA 1XS5A 4FE8A 2ESNA 4GVOA 3MP6A 2ONSA 1TXFA 2ZNUA 2RC8A 3C36A 4LZ8A 2THIA 3K1NA 4R6YA 4POXA 3Q28A 1FQCA 3C35A 1N76A 1DPPA 4ZEFA 3TTMA 4GXAA 5AA1A 4Z7EA 1LBCA 1B0HA 2RC7A 4PQJA 3KOTA 4F2QA 3PUWE 1DOTA 3KJ7A 2F7CA 4I9DA 3LSWA 3VE1B 2QS2A 4ELRA 1LAFE 3TPAA 4F18A 3PPQA 1N84A 4ZEIA 5H8NB 1MRPA 1LSTA 3PD9A 1FQAA 3BKIB 1IXGA 5CRYA 2QL3A 2QS4A 3PD8A 2Z8FA 1EZOA 4F22A 2F6PA 3IOWA 1IUDA 3G3FA 3O28A 4DCYA 4F3BA 5J1DA 1UTBB 4N07A 3RLFE 3BFUA 3MBPA 3IB2A 2HAUA 1SYHA 3T9HB 3K1PA 4QSDA 3SESA 1PBPA 1JNFA 3CFZA 3E9XA 1B7UA 3RY3A 3C34A 4H5GA 2Q2CA 2F7AA 3FIRA 3H6WA 5K2YA 3G7WA 4QSEA 3KFMA 3WAEA 1ZTYA 5L9OA 1MDP1 4KCCA 3PPPA 3D4GA 2ZNSA 3MWBA 3MC2A 1PC3A 2F36A 5B70A 1EU8A 1AOVA 3MZ9A 1UQWA 3GBBA 1MY0A 1JQFA 1MQGA 4IGTA 1B3GA 3VLVA 5JTYA 2Z8DA 3KG2A 1OLAA 2PT1A 3U72A 5I56B 2QS3A 4ZZEA 1J1NA 1LAHE 4JDFA 2I0BA 2GHAA 2RCBA 2A5TA 3T96B 4X1BA 3UIFA 4G2ZA 2P0SA 4RY1A 3U92A 5BUUA 4WXJA 1OVTA 3MJNA 1URGA 1SI0A 2YLNA 3KOSA 4HCYA 1O7TA 2HAVA 5DVJA 1XVXA 3MVXA 4GRKA 3JV9A 1AMFA 3W9VA 5FHOA 3TCHA 1Y1MA 1MQDA 1YTVA 3H03A 3LSLA 1MY2A 1LFHA 2Q2AA 3G3HA 1MM6A 4UA8A 1O63A 4XKQA 4Q5TA 2I3WA 3E13X 3JYRA 4E0WA 4WEPA 4KCDA 3K01A 1GR2A 3OMBA 1CE2A 5EYFA 2O7UA 2VD3A 4M1VA 2F7BA 2HEUA 2NUVA 2X7QA 5HBCA 4IO4A 3HPIA 2UVGA 4GIZA 1NNKA 1T0KA 4OFLA 2VP1A 1A7LA 3RNNA 4ECFA 4IB2A 4EQBA 3EHTA 4OMBA 4MH5A 5TP9A 4OEVA 5CM6A 4F1YA 5A5XA 4ZDMA 3OELA 2CZLA 5H8HA 5H8FB 1ANFA 1PEBA 1VSOA 5AA2D 2QRYA 3DLNA 4YB6A 1B3EA 2DS9A 4DIGA 5KCJA 4ELOA 1NFTA 2ZYOA 4LQ2A 1B40A 3PUVE 3TTLA 2Y84A 2O69A 3C9HA 1DTZA 4BDRA 3N26A 3EPEA 3G3IA 2VGQA 3TKDA 4Q8RA 4PE5B 4U2RA 4P0IA 3OO6A 4DZ1A 1A40A 1BKAA 2YJPA 1URSA 1MM7A 1B32A 5ITPA 3PPOA 3HV1A 3SKPA 4FATA 1MDQA 3OSRA 4I8CA 1PB8A 3ZKLA 4KYSA 1Y1ZA 1LB9A 3MP1A 5TPAB 4KYEA 3TELA 3CFXA 4DE8A 3G3KA 1M5DA 1Y4CA 1M5CA 3O9PA 1HSEA 3FGSA 3SEVA 2DVCA 2DSFA 3H6UA 5DT6A 4G8NA 2YPNA 4EQ7A 4G4PA 4IO5A 4KPTA 1ZJLA 2H98A 4O3CA 4JWYA 5TU0A 2O1LA 2OK2A 2ZNTA 4X9TA 4F1UA 2RKMA 3PU5A 1AH5A 2HZLA 4RK9A 2F35A 4QF9A 3HHFA 1P1UA 4DXUA 1UTHA 3TTNA 3OO9A 3K6WA 4QRZA 1H43A 1XOCA 2R9JA 1MY4A 3MUQA 3O6GA 5HM4B 1SD3A 4OHNA 2I58A 1BIYA 3N6TA 4F39A 3MP8A 4MF3A 3I5OA 3T66A 4XKPA 4GD5A 2ZYMA 2H5YA 3P7IA 4PFTA 3VXCA 4OFOA 3K2DA 1SDXA 2F5XA 3O97A 4LONB 3RTWB 1P99A 2AIXA 4F3PA 2GRVA 3M3KA 4NF5B 2PBWA 4ESXA 3FXRA 2P1SA 4NF8A 3TCGA 4NE4A 1JW5A 4LP2B 1B3HA 5ISUA 1FQEA 2I6EA 1GGGA 3ILTB 3B6QA 2DWJA 3SEYA 3SDFA 3FVNA 2HZKA 1TFAA 3K6VA 3O6HA 1ZKBA 3PMXA 4RA1A 4RPNA 1DTGA 2OLBA 2B3FA 3MVYA 3UGWA 4H65A 5I2NA 2GH9A 4FJPA 2FNCA 4DDDA 2GHBA 5H8QB 5AE4A 1GTKA 1SW4A 3C32A 3FUZA 4KYDA 1MXZA 5ITOA 1QVSA 3QUJA 3QK6A 5AA2A 2PMSA 1RYXA 3RUMA 2NXOA 2REJA 4YKPA 4ZE8A 1MG1A 5CMBA 4YICA 3OO7A 2ALUA 2XX7A 5FHMA 3FJGA 2DWHA 2ANJA 3WAFA 4F19A 3F11A 5JEIA 1US4A 1FQDA 5KDTB 4GL8A 2XXRA 1QKBA 1M5EA 2DOJA 3RT8A 4OQOA 1USYH 4BDOA 4C0RA 3FZVA 4YZZA 3O6IA 3UP9A 3TEPA 3MQ9A 3KBRA 2FA7A 5IAIA 4EQ9A 3T22A 3LUYA 2Y7PA 3VVDA 5AA4B 2B3BA 3IAZA 3K4UA 2QPQA 4RJZA 2A5SA 3IO4A 1MH4A 4RNSA 3IJXB 2Q8JA 2QMXA 3FD3A 4GFRA 3V83A 3QYTA 1LB8A 4RK2A 1N7XA 5EHSA 3DELB 1R1NA 1WDNA 1D9YA 3PV0E 3ZS6A 2F97A 4R6HA 3V89B 2Z8EA 2UXAA 3I3VA 1MY3A 1NNFA 2Y7KA 1NMUA 1ZLQA 1P1OA 1Z7ME 4LVQA 1IXIA 2PYYA 1ELJA 3GZGA 3SERA 4QFNA 3CG1A 1MS7A 2D21A 5DTBA 5CMCA 1Y9UA 1II5A 4QHQA 3MPLA 4LZ5A 2O6AA 2QS1A 2R6GE 2RC9A 4FIMA 4QFOA 4QFPA 2DE4A 1Q35A 2UVJA 1RKMA 3C31A 3MVWA 5CMKA 1Y4TA 1MQIA 1USYE 3V8XB 3TQLA 2OWSA 1H76A 2WKYA 4NEDA 3FJ7A 3OEMA 2DVZA 1NKXA 3KSJA 4OETA 4OENA 3K6XA 5H8NA 1VFEA 2HQ0A 1NNPA 4GL0A 4OEUA 4YB7A 4DXBA 2O7IA 2BJJX 4HTGA 3C4MA 4R2FA 1ZBMA 5DEXB 4HW8A 1URDA 2XXVA 3FV1A 1BTJA 1QUJA 5TP9B 3T9XB 5A5XB 1B4HA 1BP5A 5I84A 4IY5A 5FTHA 1FTLA 3ONMA 5H8HB 3QXMA 3ZKKA 1B3LA 2OBGA 3CSBA 3IX1A 4IO3A 3K0VA 3TDJA 1FTMA 4IO2A 4JBZA 1LAGE 3V5AA 5KCJB 4ZEKA 3S9LC 1MXXA 1JEUA 1FQFA 4BDMA 3LC8A 3IR1A 1P1NA 3K1MA 5I59B 3K02A 1WODA 3D4CA 1L5TA 2DYXA 2B65A 1Z7NE 3CI8A 1LFIA 1B5JA 1NH7A 4QSCA 4Z0IA 4JSDA 5DVIA 1VR5A 2O1MA 1AL3A 3RGYA 2V3UA 3S9NC 4TOZA 3LSXA 3HO7A 1FQBA 1DSNA 2Y7WA 5FHNA 3FXQA 3LBSA 3RTFB 2VD2A 3E4RA 3MAMA 3VXBA 3CFLA 1OVBA 2Q9TA 3KEIA 5ICQA 1H45A 5ICTA 2UVHA 5DYHA 1LCTA 5I57B 1A54A 4ELQA 1YCJA 1S50A 1SI1A 1MH3A 2F78A 5I58A 4AB5A 2ZYNA 1N3XA 2V3QA 2I48A 4GWOA 3O29A 4EXKA 3PPNA 4NF4B 3TMGA 3CRBA 2DWAA 3EHSA 4IGRA 3CSGA 1UTHB 3VVFA 1GVCA 3O2AA 3SEWA 4LATA 1FTOA 3H06B 3VFJA 2XXIA 3FVGA 1HSJA 3OXNA 1Q1KA 1FW0A 4G77A 4NTLA 5CBRA 3HHGA 4KQPA 2Y7IA 1A8EA 4TLMB 3FJMA 2VHAA 3KSXA 2G93A 3QSLA 2ONRA 2DP8A 4H8JA 4IO6A 4Q0CA 2H9BA 3LSFB 2R71A 1FTJA 3BFTA 4PFWA 1NL5A 3H7MA 5FTIA 3N6UA 1B6HA 4P0GA 3MVZA 5L9MA 4DCXA 4NF8B 1B5IA 4LQ5A 2DWIA 4NF6A 2X26A 1IXCA 3OD7A 1Y3PA 5CMMA 3EF7A 2XD2A 1SQYA 2UVIA 2XXHA 2XX9A 4OVJA 2Z22A 1B0LA 4YKIA 1VFDA 1QUIA 3T9VA 3FATA 5I2KA 2F8DA 3A3UA 1SVXB 4C1TA 4OZ9A 1LFGA 1CB6A 1S7YA 2OZZA 3OOAA 1JW1A 3N5LA 3TTRA 1OQHA 1B7ZA 2XXXA 3CIJA 4G8HA 2XXQA 3RQTA 2XHDA 4PP0A 3DM0A 1B1XA 3L6GA 1EZPA 4ZZAA 4U23A 4R6KA 4ZS9A 1SYIA 1JETA 3KZGA 5TPAA 4TQUQ 2NVUB 4F29A 2QSXA 3IJOB 1FCKA 1NNTA 5DVFA 1I6QA 1MXWA 1POY1 1A55A 1P1WA 4JB7A 3KGCA 3PMVA 1JVYA 1PB9A 2RINA 3VDFA 3SEUA 2NOOA 2RF1A 3T93B 1BLFA 1TT1A 2G29A 3ZSFA 2LAOA 4F3SA 4N13A 1XT8A 4TLLB 3UORA 3R26A 3U1OA 3RT6B 3N94A 1SW1A 3H3GA 3Q27A 4I62A 3S2VA 3ODBA 3THIA 1MPCA 4U1OA 2KLFA 3QIMA 1IITA 4YB5A 3QAXA 4LZ7A 3HN0A 1Y3QA 1MXYA 2DXYA 3OEKA 1N3WA 4MLQA 3RN8A 4I1DA 4KR5A 2I4BA 4GOTA 4OYVA 1EZ9A 4NF5A 4GF8A 4FEBA 1TFDA 1IQ7A 1M5BA 4BLAA 3IB0A 5M2VA 1ATGA 3S4UA 4L17A 4F2OA 4XKNA 4H0WA 4X48A 3B7DA 4U22A 3E3KA 2XXPA 3PUYE 3TAJA 2D3IA 4HCWA 4OESA 4XKRA 3FASA 3PMWA 3B6TA 3Q25A 2V93A 1QW0A 4XTCQ 2ZXTA 3FXUA 4RXLA 3Q26A 4QFKA 2XXYA 1LLSA 3M3LA 1MPDA 3U94A 1POTA 4OERA 3SEXA 2IA4A 3MW0A 4QFLA 2QJEA 2V3TA 4YKJA 2AL4A 3L6HA 3GLBA 5H8QA 1MQJA 3Q29A 4GLIA 3IB1A 4FECA 1B4ZA 3DP6A 4EF1A 2AYSA 3GXAA 4HS7A 3PUZE 2I4CA 5JTYB 4R74A 5CC2A 1Y20A 2PVUA 3JZJA 4F1VA 5ELVA 4G68A 2A5TB 1S9TA 1R9LA 3MZBA 1OQGA 3W9WA 4R2BA 1MY1A 1WVJA 4EUOA 2E0SA 1XHYA 4KFQA 5CI5A 3VLWA 5H8SA 2DXRA 1JW4A 4NWCA 5KDTA 1RYOA 3PGFA 3H6VA 1SW2A 1YPNA 3K6UA 2DE3A 2REGA 2ABHA 4G68C 1LGBC 5AA4A 1VE4A 1NH8A 2P2AA 4EF2A 1PDAA 2AL5A 1I6BA 4AQ4A 5F7VA 5JK4A 1IZ1A 4O3BA 4BDQA 4YKKA 4FAJA 1UIUA 3H6TA 4H5FA 3G3JA 1SBPA 1EH3A 1OIBA 1ZMGA 1D9VA 4R9GA 4YAHX 1B52A 1YAEA 4JWOA 5LOMA 3IL1B 1MPBA 1UTBA 1QULA 3TZAA 3KN7A 1OLCA 2DQVA
chains in the Genus database with same CATH superfamily
4DLDA 3UN6A 4U21A 4H46A 3SETA 1Y3NA 2XWOA 2X7PA 4M4GA 2IEEA 2CMOA 3LUZA 3OSQA 4YMBA 4O8MA 4MLVA 1P1QA 3TODA 4RYAA 4FEDA 4PC9A 2ZMBA 3M8UA 4XXUA 4OWDA 3R6UA 2CZKA 4R72A 2DE2A 3HSTA 2Y7RA 4H6DA 1N04A 1B1HA 4MBPA 1FPBA 3UA8A 5AA3A 1DK4A 2H99A 3DP4A 1ZU0A 3MYUA 3KN8A 1EYIA 4DXCA 3PPRA 1JVXA 5I58B 2VOZA 3MZ1A 4ELPA 1TWYA 1NV2A 1B58A 2XX8A 3EN3A 4ISUA 3S9MC 2F34A 2XXWA 3LR1A 4GWXA 4GWSA 4E0XA 4YMAA 3A3CA 3OO8A 2W7YA 3ILUB 5I56A 1D4NA 1MXUA 4THIA 2XXTA 3A09A 2HCAA 4G61A 4IO7A 3W15C 4ZEBA 3IORA 1ZIUA 1QJMA 1GV8A 1R6ZA 3GBAA 5DEXA 5K2XA 4P11A 4N4UA 4NWDA 2Q88A 1SW5A 4U1ZA 4WEDA 4OTEA 5CBSA 1I69A 4JSOA 2HFBA 4ND9A 1O64A 2QVRA 2XWVA 3U93A 5FBPA 1XVYA 4WKMA 1MXVA 2R8TA 4NN3A 4UACA 4K3FA 3H4ZA 2O51A 2OCUA 2O84X 4NF6B 1LBBA 2XXUA 3FVKA 4JWXA 4PBHA 3C33A 1XC1A 3CR9A 3QUFA 4P56A 2GFEA 2ZYKA 2ZZVA 1D3KA 3I6VA 3KN3A 2UYEA 5HPQA 4R9FA 4ZE9A 4U4XA 1B05A 3MSTA 1PB7A 2VPOA 5EHMA 3TTKA 2JJKA 3IK6B 1M5FA 5B7DA 3DP8A 1KWHA 5I2KB 1N0TA 3USDA 1UIVA 2F6GA 5I59A 1QKAA 2PT2A 4EDPA 4BDLA 4ESWA 4H67A 4PETA 2V84A 5F1QA 1MQHA 3GYYA 3TFLA 4GQOA 3VV5A 1B3FA 4F3GA 3CG3A 4AB6A 3KJTA 3B6WA 3OENA 3IO6A 5L9SA 1OMPA 1F9BA 1PBQA 5IKBA 1A8FA 4KHZE 2QMWA 1B9JA 2P3VA 4N6PA 1H44A 3ECRA 5H8FA 4OFJA 3RPWA 1A99A 5KZTA 4BDNA 2I0CA 3PUXE 4MFIA 4OXVA 2HHMA 2KQZA 5I57A 3G3GA 4Q30B 3UK4A 2FVZA 3U65A 1VDWA 2OJTA 1FPKA 3AXFA 4I3EA 3MPKA 4NF4A 1NV0A 2UYFA 4RPOA 4IY6A 5I2NB 2RCAA 4PCDA 3FV2A 1B46A 1FJ9A 5AA2B 1G0IA 4ZEDA 1QUKA 3O66A 4R73A 2I49A 1R9QA 1HSLA 2ONKE 4ZECA 3T9UA 3BBRA 3VLUA 3LV0A 4H1XA 4O3AA 1DPEA 4NQ8A 3TYHA 4F31B 3TCFA 4EXLA 4KD5A 3IOUA 5BWJA 3EQ1A 1DMBA 1NUXA 4HE0A 2I3VA 4JXIA 1KA0A 1JEVA 3HCQA 4X1DA 3ISPA 3R7XA 4HE2A 1FPFA 5ESYA 1IIWA 4H8IA 4PFYA 3TUSA 1FTKA 1H3DA 5L8DA 4NMYA 4PGPA 2V25A 1B2HA 4YU0A 5LDZA 4LA9A 4ONYA 4G8MA 2D5WA 1LCFA 4MEVA 3M3FA 4U4SA 3IOTA 3EHUA 4PFUA 1B5HA 3U8QA 3S9EA 2XD3A 1B7HA 3VVEA 2H4IA 2FYIA 4LUBA 2O68A 4KI0E 4JVCA 2NWJA 2OWTA 1IEJA 2HXWA 2PX1A 4MIJA 3IOVA 2XXKA 1IXHA 2M8CA 2H25A 3CVGA 4POWA 1LAXA 1N7WA 3TQWA 2Q89A 3CHGA 4R75A 1AIVA 1B51A 1I6AA 2Z23A 3FVOA 1US5A 4XIGQ 4GXSB 4FORA 4C1UA 3K00A 4G68B 4GWYA 2E1SA 1XS5A 4FE8A 2ESNA 4GWUA 4GVOA 3MP6A 2ONSA 1TXFA 4MNIA 2ZNUA 2RC8A 3C36A 5IZZA 4LZ8A 2THIA 3K1NA 4R6YA 1JP4A 4POXA 3Q28A 1FQCA 3C35A 1N76A 1DPPA 4ZEFA 3TTMA 4QBAA 4GXAA 5AA1A 4Z7EA 1LBCA 1B0HA 2RC7A 4PQJA 3KOTA 4F2QA 4N8GA 3PUWE 1DOTA 3KJ7A 2F7CA 4I9DA 3LSWA 4PDHA 5EYGA 3VE1B 2QS2A 4ELRA 1LAFE 3TPAA 4F18A 2CEXA 3PPQA 4XFEA 1N84A 4ZEIA 4O7MA 5H8NB 1MRPA 1LSTA 3PD9A 2OWZA 4O7IA 1FQAA 3BKIB 1IXGA 5CRYA 2QL3A 2QS4A 3PD8A 2Z8FA 1K9YA 1EZOA 4F22A 2F6PA 3IOWA 1IUDA 3G3FA 3O28A 4DCYA 4F3BA 5J1DA 1UTBB 4N07A 4XF5A 2QVUA 3RLFE 3BFUA 2Q74A 3MBPA 3IB2A 2HAUA 1SYHA 3T9HB 3K1PA 4QSDA 3SESA 1PBPA 1JNFA 3CFZA 4NAPA 3E9XA 1B7UA 3RY3A 3C34A 4H5GA 2Q2CA 3KC0A 5A5LA 2F7AA 1RDXA 1K9ZA 3FIRA 3H6WA 5K2YA 5IGAA 3G7WA 4QSEA 3KFMA 3WAEA 1ZTYA 5L9OA 1MDP1 2OX3A 1NUWA 4X8RA 4KCCA 3PPPA 4MAGA 3D4GA 2ZNSA 3MWBA 3MC2A 1PC3A 2F36A 4O94A 2CZIA 5B70A 1EU8A 4N6DA 1AOVA 3MZ9A 1UQWA 3GBBA 1MY0A 1JQFA 1MQGA 4IGTA 1B3GA 3VLVA 5JTYA 2Z8DA 3KG2A 1OLAA 2PT1A 3U72A 5I56B 2QS3A 4ZZEA 1J1NA 1LAHE 4JDFA 4UABA 2I0BA 2GHAA 2RCBA 2A5TA 4P9KA 3T96B 4X1BA 3UIFA 4G2ZA 2P0SA 4RY1A 3U92A 5BUUA 4WXJA 1OVTA 3MJNA 1URGA 1SI0A 2YLNA 2B4MA 3HFUA 3KOSA 4HCYA 1O7TA 2HAVA 4XEQA 4HXVA 4OVQA 5DVJA 1XVXA 3MVXA 4GRKA 3JV9A 5IZ3A 1AMFA 3W9VA 5FHOA 3TCHA 1Y1MA 1MQDA 4MMPA 1YTVA 3H03A 3LSLA 1MY2A 1IMFA 3QMFA 1LFHA 2Q2AA 3G3HA 1MM6A 4UA8A 3SZPA 1O63A 4LN5A 4XKQA 4Q5TA 5I3SA 2I3WA 4NHBA 3E13X 2Y5LA 1FBDA 4GX6A 3JYRA 4E0WA 4WEPA 4KCDA 4OA4A 1FPGA 3K01A 1GR2A 3OMBA 4PF6A 1CE2A 5EYFA 5EQ7A 2O7UA 2VD3A 4M1VA 2F7BA 4DI3D 2HEUA 2NUVA 2X7QA 5HBCA 4IO4A 3HPIA 2UVGA 4GIZA 1NNKA 4I3YA 1T0KA 3FXBA 4I40A 4OFLA 2VP1A 1A7LA 3RNNA 4ECFA 4IB2A 4EQBA 3EHTA 4OMBA 4MH5A 5TP9A 4OEVA 5CM6A 1NV5A 4F1YA 5A5XA 4ZDMA 3OELA 1YZ0A 1RDZA 2CZLA 4PDDA 3PTYA 5H8HA 5H8FB 1ANFA 1PEBA 1VSOA 5AA2D 1CNQA 1FPEA 2QRYA 3DLNA 4YB6A 1B3EA 2DS9A 4DIGA 4N81A 5KCJA 4FBPA 4ELOA 4PBQA 1NFTA 2ZYOA 4LQ2A 1B40A 3PUVE 3TTLA 2Y84A 2O69A 3C9HA 1DTZA 4BDRA 3N26A 3EPEA 3G3IA 2VGQA 1LBVA 3TKDA 1IMAA 4Q8RA 4PE5B 4U2RA 4P0IA 3OO6A 1YYZA 4DZ1A 1A40A 1BKAA 2YJPA 1URSA 1MM7A 1B32A 4OANA 5ITPA 1AWBA 3HV1A 3PPOA 3SKPA 4FATA 1Q9DA 1MDQA 3OSRA 1NUZA 4I8CA 1PB8A 3ZKLA 4KYSA 4PFRA 4IR8A 4KXPA 1Y1ZA 1LB9A 3MP1A 5TPAB 4KYEA 3TELA 3CFXA 5T3JA 4DE8A 3G3KA 1M5DA 1Y4CA 1M5CA 3O9PA 1HSEA 3FGSA 3SEVA 2DVCA 2DSFA 3H6UA 5DT6A 4G8NA 2YPNA 4EQ7A 4G4PA 4IO5A 4KPTA 1ZJLA 4MNCA 2PCRA 2H98A 1G0HA 4O3CA 4JWYA 5TU0A 2O1LA 2OK2A 2ZNTA 4X9TA 4F1UA 2RKMA 3PU5A 1AH5A 2HZLA 4RK9A 2F35A 4QF9A 3D1RA 3HHFA 1P1UA 4DXUA 1UTHA 3TTNA 3OO9A 1LEVA 3K6WA 4QRZA 1H43A 1XOCA 2R9JA 4N91A 1MY4A 3MUQA 3O6GA 5HM4B 1SD3A 4OHNA 2ZZWA 2I58A 1BIYA 3N6TA 4F39A 3MP8A 4MF3A 3I5OA 3T66A 4XKPA 3B50A 4GD5A 2ZYMA 2H5YA 1FBHA 3P7IA 4PFTA 3VXCA 4N15A 4OFOA 3K2DA 1SDXA 2F5XA 3O97A 4LONB 3RTWB 1P99A 2AIXA 4F3PA 2GRVA 3M3KA 4NF5B 2PBWA 2BJIA 1FPLA 4ESXA 3FXRA 2P1SA 4NF8A 3TCGA 4NE4A 2WYPA 1JW5A 4LP2B 1KZ8A 1B3HA 5ISUA 1FQEA 2XA5A 2I6EA 1GGGA 3ILTB 3B6QA 2DWJA 3SEYA 2WBBA 3SDFA 3FVNA 2HZKA 1TFAA 3K6VA 3O6HA 1ZKBA 3PMXA 4RA1A 4RPNA 1DTGA 2OLBA 2B3FA 3MVYA 2P3NA 3UGWA 1FPJA 4H65A 5I2NA 2GH9A 3RYDA 4FJPA 2FNCA 4DDDA 2GHBA 5H8QB 5AE4A 1GTKA 1NV6A 1SW4A 1FBGA 3C32A 3FUZA 4KYDA 1MXZA 5ITOA 1QVSA 5ET6A 3QUJA 3QK6A 5AA2A 2PMSA 1RYXA 3RUMA 2NXOA 2REJA 4YKPA 4ZE8A 1MG1A 5CMBA 4YICA 3OO7A 4NGUA 3E79A 4P3LA 2ALUA 2XX7A 1DCUA 5FHMA 3FJGA 2DWHA 3FBPA 2ANJA 3BIGA 3WAFA 4F19A 4OVTA 3F11A 5JEIA 1LBYA 1US4A 1FQDA 5KDTB 4GL8A 1LBWA 2XXRA 1QKBA 1M5EA 2DOJA 3RT8A 4OQOA 1USYH 4X04A 4BDOA 4C0RA 3FZVA 4YZZA 3O6IA 3UP9A 3TEPA 3MQ9A 3KBRA 2V4CA 2FA7A 5IAIA 4EQ9A 3T22A 3LUYA 2Y7PA 3VVDA 5AA4B 2B3BA 5EYHA 3IAZA 3K4UA 2QPQA 4RJZA 2HPGA 2A5SA 3IO4A 4PAFA 1MH4A 4GX4A 3KC1A 4RNSA 3IJXB 2Q8JA 2QMXA 3FD3A 4GFRA 3V83A 3QYTA 1LB8A 4RK2A 1N7XA 5EHSA 3DELB 1R1NA 1WDNA 1D9YA 4N8YA 3PV0E 3ZS6A 2F97A 4R6HA 3V89B 2Z8EA 2UXAA 4P47A 3I3VA 1MY3A 1NNFA 2Y7KA 1NMUA 1ZLQA 1P1OA 2PFZA 1Z7ME 4LVQA 1IXIA 2PYYA 1ELJA 1NUYA 3GZGA 3SERA 4QFNA 1NV3A 3CG1A 1MS7A 2L5VA 2D21A 5DTBA 5CMCA 1Y9UA 4GWZA 1II5A 4QHQA 3MPLA 5EQAA 4LZ5A 2O6AA 2QS1A 2R6GE 1INPA 2RC9A 4FIMA 4QFOA 4QFPA 5IZ3B 2DE4A 1Q35A 2UVJA 1RKMA 3C31A 3MVWA 5CMKA 2CZHA 1Y4TA 1MQIA 4OVRA 1USYE 3V8XB 3TQLA 2OWSA 1H76A 2WKYA 4NEDA 2KR0A 3FJ7A 3OEMA 2DVZA 1NKXA 3KSJA 4OETA 4OENA 3K6XA 3A29A 3T1BA 5H8NA 1VFEA 2HQ0A 5IM2A 1NNPA 4GL0A 2VT5A 4OEUA 1FBFA 4YB7A 2O7IA 4DXBA 4MCOA 2BJJX 4HTGA 2FBPA 3C4MA 4R2FA 1ZBMA 5DEXB 4P8BA 4HW8A 1URDA 3RPLA 2XXVA 3IFCA 3FV1A 1SPIA 1BTJA 1QUJA 5TP9B 3T9XB 5A5XB 1B4HA 1BP5A 5I84A 4GX3A 4IY5A 5FTHA 1FTLA 3ONMA 5H8HB 3QXMA 3ZKKA 1B3LA 2OBGA 3CSBA 2WX9A 3IX1A 4IO3A 3K0VA 3TDJA 1LBXA 1FTMA 4IO2A 4JBZA 1LAGE 3ROJA 3V5AA 5KCJB 1NI9A 1EYJA 4ZEKA 3S9LC 1MXXA 1JEUA 1FQFA 2DDKA 4BDMA 2QVVA 3LC8A 3IR1A 1P1NA 4MNPA 3K1MA 5ET5A 5I59B 3K02A 1WODA 2Y5KA 3D4CA 1L5TA 2DYXA 2B65A 1Z7NE 3CI8A 1LFIA 1B5JA 1NH7A 4HE1A 4QSCA 4Z0IA 4JSDA 5DVIA 1VR5A 2O1MA 4PGNA 1AL3A 3RGYA 3T0JA 1D9QA 2V3UA 4AS5A 3S9NC 4TOZA 3LSXA 3HO7A 1FQBA 1DSNA 2Y7WA 5FHNA 3FXQA 2FIEA 3LBSA 3RTFB 2VD2A 2CEYA 3E4RA 3MAMA 3VXBA 1NV7A 3CFLA 1OVBA 2Q9TA 3KEIA 5ICQA 1H45A 5ICTA 2UVHA 5DYHA 1LCTA 5I57B 1A54A 4ELQA 1YCJA 1FSAA 1S50A 1FJ6A 1SI1A 1MH3A 2F78A 5I58A 4AB5A 2ZYNA 1N3XA 2V3QA 2I48A 4GWOA 3O29A 4PTKA 4EXKA 3PPNA 4NF4B 3TMGA 4NX1A 3CRBA 5I5PA 2DWAA 3EHSA 4IGRA 3CSGA 1UTHB 3VVFA 1GVCA 3O2AA 3SEWA 4LATA 1FTOA 3H06B 2FHYA 3VFJA 4DI4B 2XXIA 3FVGA 1HSJA 3OXNA 1Q1KA 1FW0A 4G77A 4NTLA 5CBRA 3HHGA 4GWWA 4KQPA 2Y7IA 1A8EA 4TLMB 3FJMA 2VHAA 3KSXA 2G93A 3QSLA 3E78A 2ONRA 2DP8A 4H8JA 4IO6A 4MX6A 2WYKA 4Q0CA 2H9BA 3LSFB 2R71A 1FTJA 3BFTA 4PFWA 1NL5A 1IMEA 3H7MA 4NF0A 5FTIA 3N6UA 2FIXA 1B6HA 4P0GA 3MVZA 4GBWA 5L9MA 4MJOA 4DCXA 4NF8B 1B5IA 3NOHA 2Q8MA 4LQ5A 2DWIA 4NF6A 2X26A 1IXCA 1IMBA 1Y3PA 3OD7A 5CMMA 3EF7A 3BIHA 2XD2A 1SQYA 5DW8A 2UVIA 1FTAA 2XXHA 1LBZA 2XX9A 4OVJA 2Z22A 1B0LA 2F3DA 4YKIA 2WEFA 1VFDA 1QUIA 5EQ8A 3T9VA 1FBEA 3FATA 5I2KA 4N6KA 2F8DA 3A3UA 1SVXB 4C1TA 4OZ9A 1LFGA 1CB6A 1S7YA 2MKZA 2OZZA 3OOAA 1JW1A 3IFAA 3N5LA 3TTRA 1OQHA 1B7ZA 2XXXA 4N17A 3CIJA 4G8HA 2XXQA 3RQTA 2XHDA 4PP0A 3DM0A 1B1XA 3L6GA 1EZPA 4ZZAA 4U23A 5LTCA 4PFIA 4R6KA 4ZS9A 1SYIA 1JETA 3KZGA 5TPAA 4TQUQ 2NVUB 4F29A 2QSXA 3B8BA 3IJOB 1FCKA 1NV4A 1NNTA 5DVFA 1I6QA 1MXWA 1POY1 1A55A 2VPNA 1P1WA 4JB7A 3KGCA 3PMVA 4JVDA 2QFLA 1JVYA 2XWIA 4QXDA 4GBVA 1PB9A 2RINA 3VDFA 3SEUA 2NOOA 4PAIA 2RF1A 3T93B 1YXIA 1BLFA 1TT1A 2G29A 3ZSFA 2LAOA 4F3SA 4N13A 5EQ9A 1XT8A 4TLLB 3UORA 1IMCA 3R26A 3U1OA 1FPDA 3RT6B 5I7IA 3N94A 1SW1A 3H3GA 3Q27A 4I62A 3S2VA 3ODBA 3THIA 1MPCA 1FRPA 4U1OA 2GQ1A 2KLFA 1QGXA 3QIMA 1IITA 4YB5A 3QAXA 4LZ7A 3HN0A 1Y3QA 1MXYA 2DXYA 3OEKA 1N3WA 4MLQA 3RN8A 4I1DA 4KR5A 2I4BA 4GOTA 4OYVA 1EZ9A 4NF5A 4GF8A 4FEBA 1TFDA 1IQ7A 1M5BA 4PE3A 4BLAA 5IZ1A 3IB0A 5M2VA 1ATGA 4PFBA 3S4UA 4L17A 4F2OA 1IMDA 4XKNA 1XI6A 2F3BA 4H0WA 2PFYA 4X48A 3B7DA 4U22A 3E3KA 5F24A 2XXPA 3PUYE 3TAJA 1BK4A 2D3IA 4HCWA 4OESA 4XKRA 3FASA 3PMWA 3B6TA 3Q25A 2V93A 1QW0A 4XTCQ 2ZXTA 3FXUA 4RXLA 1EYKA 3Q26A 4JVIA 4QFKA 1DBZA 2XXYA 1LLSA 3M3LA 1KA1A 1MPDA 1FBPA 3U94A 1POTA 4OERA 3SEXA 2IA4A 3MW0A 4QFLA 2QJEA 2V3TA 4P1LA 4YKJA 2AL4A 3L6HA 3GLBA 5H8QA 1MQJA 3Q29A 4GLIA 3IB1A 4FECA 1B4ZA 3DP6A 4OVSA 4EF1A 2AYSA 3GXAA 4HS7A 3PUZE 4MHFA 2I4CA 4PF8A 5JTYB 5ET7A 4R74A 5CC2A 1Y20A 2PVUA 3JZJA 4F1VA 5ELVA 4G68A 2A5TB 1S9TA 1R9LA 3MZBA 1OQGA 3W9WA 4R2BA 3RPLB 1MY1A 1WVJA 4EUOA 2E0SA 2B4LA 1XHYA 4KFQA 5CI5A 3VLWA 5H8SA 2DXRA 1JW4A 4NWCA 5KDTA 1RYOA 3PGFA 2ZZXA 3H6VA 1SW2A 1YPNA 2WBDA 3K6UA 2DE3A 4H45A 2REGA 1FPIA 2ABHA 4NG7A 4G68C 4P1EA 1LGBC 5AA4A 5J16A 1VE4A 4PAKA 3KBZA 1NH8A 1RDYA 2P2AA 4EF2A 1PDAA 2AL5A 1I6BA 4AQ4A 5F7VA 4OVPA 3EKIA 1NV1A 5JK4A 1IZ1A 2HXRA 1FBCA 4O3BA 4BDQA 4YKKA 4FAJA 1UIUA 3H6TA 4H5FA 4AS4A 3G3JA 1SBPA 1EH3A 1OIBA 1ZMGA 2XWKA 1D9VA 4R9GA 4YAHX 5ET8A 1B52A 1YAEA 4JWOA 5LOMA 3IL1B 1MPBA 1UTBA 1QULA 3TZAA 3KN7A 1OLCA 2DQVA
chains in the Genus database with same CATH topology
4DLDA 3UN6A 4U21A 3SETA 1Y3NA 2X7PA 4M4GA 2IEEA 2CMOA 3OSQA 4YMBA 4MLVA 1P1QA 3TODA 4RYAA 4FEDA 2ZMBA 3M8UA 4XXUA 4OWDA 3R6UA 4R72A 2DE2A 3HSTA 2Y7RA 4H6DA 1N04A 1B1HA 4MBPA 3UA8A 5AA3A 2H99A 3DP4A 1ZU0A 3KN8A 4DXCA 3PPRA 1JVXA 5I58B 2VOZA 3MZ1A 4ELPA 1TWYA 2XX8A 1B58A 3EN3A 4ISUA 3S9MC 2F34A 2XXWA 3LR1A 4E0XA 4YMAA 3A3CA 3OO8A 2W7YA 3ILUB 5I56A 1D4NA 1MXUA 4THIA 2XXTA 3A09A 2HCAA 4IO7A 3W15C 4ZEBA 3IORA 1ZIUA 1QJMA 1GV8A 1R6ZA 3GBAA 5DEXA 5K2XA 4P11A 4NWDA 2Q88A 1SW5A 4U1ZA 4WEDA 4OTEA 5CBSA 1I69A 4JSOA 2HFBA 4ND9A 1O64A 3U93A 1XVYA 4WKMA 1MXVA 4UACA 4K3FA 3H4ZA 2O51A 2OCUA 2O84X 4NF6B 1LBBA 2XXUA 3FVKA 4JWXA 3C33A 1XC1A 3CR9A 3QUFA 2GFEA 2ZYKA 1D3KA 3I6VA 3KN3A 2UYEA 5HPQA 4R9FA 4ZE9A 4U4XA 1B05A 1PB7A 5EHMA 3TTKA 3IK6B 1M5FA 5B7DA 3DP8A 1KWHA 5I2KB 1N0TA 3USDA 1UIVA 2F6GA 5I59A 1QKAA 2PT2A 4EDPA 4BDLA 4ESWA 4H67A 4PETA 2V84A 5F1QA 1MQHA 3TFLA 4GQOA 3VV5A 1B3FA 4F3GA 3CG3A 4AB6A 3KJTA 3B6WA 3OENA 3IO6A 5L9SA 1OMPA 1F9BA 1PBQA 5IKBA 1A8FA 4KHZE 2QMWA 1B9JA 4N6PA 1H44A 3ECRA 5H8FA 4OFJA 3RPWA 1A99A 5KZTA 4BDNA 2I0CA 3PUXE 4MFIA 4OXVA 5I57A 3G3GA 4Q30B 3UK4A 2OJTA 3AXFA 3MPKA 4NF4A 2UYFA 4RPOA 4IY6A 5I2NB 2RCAA 3FV2A 1B46A 5AA2B 4ZEDA 1QUKA 3O66A 4R73A 2I49A 1R9QA 1HSLA 2ONKE 4ZECA 3T9UA 3BBRA 3VLUA 4H1XA 4O3AA 1DPEA 3TYHA 4F31B 3TCFA 4EXLA 4KD5A 3IOUA 5BWJA 3EQ1A 1DMBA 2I3VA 4JXIA 1JEVA 3HCQA 4X1DA 3R7XA 1IIWA 4H8IA 4PFYA 3TUSA 1FTKA 1H3DA 5L8DA 4NMYA 2V25A 1B2HA 4YU0A 4LA9A 4ONYA 4G8MA 2D5WA 1LCFA 3M3FA 4U4SA 3IOTA 3EHUA 4PFUA 1B5HA 3U8QA 3S9EA 2XD3A 1B7HA 3VVEA 2H4IA 2FYIA 4LUBA 2O68A 4KI0E 2NWJA 2OWTA 1IEJA 2HXWA 2PX1A 3IOVA 1IXHA 2M8CA 2H25A 3CVGA 4POWA 1LAXA 1N7WA 3TQWA 2Q89A 4R75A 1AIVA 1B51A 1I6AA 2Z23A 3FVOA 1US5A 4XIGQ 4GXSB 4FORA 4C1UA 3K00A 4G68B 2E1SA 1XS5A 4FE8A 2ESNA 4GVOA 3MP6A 2ONSA 1TXFA 2ZNUA 2RC8A 3C36A 4LZ8A 2THIA 3K1NA 4R6YA 4POXA 3Q28A 1FQCA 3C35A 1N76A 1DPPA 4ZEFA 3TTMA 4GXAA 5AA1A 4Z7EA 1LBCA 1B0HA 2RC7A 4PQJA 3KOTA 4F2QA 3PUWE 1DOTA 3KJ7A 2F7CA 4I9DA 3LSWA 3VE1B 2QS2A 4ELRA 1LAFE 3TPAA 4F18A 3PPQA 1N84A 4ZEIA 5H8NB 1MRPA 1LSTA 3PD9A 1FQAA 3BKIB 1IXGA 5CRYA 2QL3A 2QS4A 3PD8A 2Z8FA 1EZOA 4F22A 2F6PA 3IOWA 1IUDA 3G3FA 3O28A 4DCYA 4F3BA 5J1DA 1UTBB 4N07A 3RLFE 3BFUA 3MBPA 3IB2A 2HAUA 1SYHA 3T9HB 3K1PA 4QSDA 3SESA 1PBPA 1JNFA 3CFZA 3E9XA 1B7UA 3RY3A 3C34A 4H5GA 2Q2CA 2F7AA 3FIRA 3H6WA 5K2YA 3G7WA 4QSEA 3KFMA 3WAEA 1ZTYA 5L9OA 1MDP1 4KCCA 3PPPA 3D4GA 2ZNSA 3MWBA 3MC2A 1PC3A 2F36A 5B70A 1EU8A 1AOVA 3MZ9A 1UQWA 3GBBA 1MY0A 1JQFA 1MQGA 4IGTA 1B3GA 3VLVA 5JTYA 2Z8DA 3KG2A 1OLAA 2PT1A 3U72A 5I56B 2QS3A 4ZZEA 1J1NA 1LAHE 4JDFA 2I0BA 2GHAA 2RCBA 2A5TA 3T96B 4X1BA 3UIFA 4G2ZA 2P0SA 4RY1A 3U92A 5BUUA 4WXJA 1OVTA 3MJNA 1URGA 1SI0A 2YLNA 3KOSA 4HCYA 1O7TA 2HAVA 5DVJA 1XVXA 3MVXA 4GRKA 3JV9A 1AMFA 3W9VA 5FHOA 3TCHA 1Y1MA 1MQDA 1YTVA 3H03A 3LSLA 1MY2A 1LFHA 2Q2AA 3G3HA 1MM6A 4UA8A 1O63A 4XKQA 4Q5TA 2I3WA 3E13X 3JYRA 4E0WA 4WEPA 4KCDA 3K01A 1GR2A 3OMBA 1CE2A 5EYFA 2O7UA 2VD3A 4M1VA 2F7BA 2HEUA 2NUVA 2X7QA 5HBCA 4IO4A 3HPIA 2UVGA 4GIZA 1NNKA 1T0KA 4OFLA 2VP1A 1A7LA 3RNNA 4ECFA 4IB2A 4EQBA 3EHTA 4OMBA 4MH5A 5TP9A 4OEVA 5CM6A 4F1YA 5A5XA 4ZDMA 3OELA 2CZLA 5H8HA 5H8FB 1ANFA 1PEBA 1VSOA 5AA2D 2QRYA 3DLNA 4YB6A 1B3EA 2DS9A 4DIGA 5KCJA 4ELOA 1NFTA 2ZYOA 4LQ2A 1B40A 3PUVE 3TTLA 2Y84A 2O69A 3C9HA 1DTZA 4BDRA 3N26A 3EPEA 3G3IA 2VGQA 3TKDA 4Q8RA 4PE5B 4U2RA 4P0IA 3OO6A 4DZ1A 1A40A 1BKAA 2YJPA 1URSA 1MM7A 1B32A 5ITPA 3PPOA 3HV1A 3SKPA 4FATA 1MDQA 3OSRA 4I8CA 1PB8A 3ZKLA 4KYSA 1Y1ZA 1LB9A 3MP1A 5TPAB 4KYEA 3TELA 3CFXA 4DE8A 3G3KA 1M5DA 1Y4CA 1M5CA 3O9PA 1HSEA 3FGSA 3SEVA 2DVCA 2DSFA 3H6UA 5DT6A 4G8NA 2YPNA 4EQ7A 4G4PA 4IO5A 4KPTA 1ZJLA 2H98A 4O3CA 4JWYA 5TU0A 2O1LA 2OK2A 2ZNTA 4X9TA 4F1UA 2RKMA 3PU5A 1AH5A 2HZLA 4RK9A 2F35A 4QF9A 3HHFA 1P1UA 4DXUA 1UTHA 3TTNA 3OO9A 3K6WA 4QRZA 1H43A 1XOCA 2R9JA 1MY4A 3MUQA 3O6GA 5HM4B 1SD3A 4OHNA 2I58A 1BIYA 3N6TA 4F39A 3MP8A 4MF3A 3I5OA 3T66A 4XKPA 4GD5A 2ZYMA 2H5YA 3P7IA 4PFTA 3VXCA 4OFOA 3K2DA 1SDXA 2F5XA 3O97A 4LONB 3RTWB 1P99A 2AIXA 4F3PA 2GRVA 3M3KA 4NF5B 2PBWA 4ESXA 3FXRA 2P1SA 4NF8A 3TCGA 4NE4A 1JW5A 4LP2B 1B3HA 5ISUA 1FQEA 2I6EA 1GGGA 3ILTB 3B6QA 2DWJA 3SEYA 3SDFA 3FVNA 2HZKA 1TFAA 3K6VA 3O6HA 1ZKBA 3PMXA 4RA1A 4RPNA 1DTGA 2OLBA 2B3FA 3MVYA 3UGWA 4H65A 5I2NA 2GH9A 4FJPA 2FNCA 4DDDA 2GHBA 5H8QB 5AE4A 1GTKA 1SW4A 3C32A 3FUZA 4KYDA 1MXZA 5ITOA 1QVSA 3QUJA 3QK6A 5AA2A 2PMSA 1RYXA 3RUMA 2NXOA 2REJA 4YKPA 4ZE8A 1MG1A 5CMBA 4YICA 3OO7A 2ALUA 2XX7A 5FHMA 3FJGA 2DWHA 2ANJA 3WAFA 4F19A 3F11A 5JEIA 1US4A 1FQDA 5KDTB 4GL8A 2XXRA 1QKBA 1M5EA 2DOJA 3RT8A 4OQOA 1USYH 4BDOA 4C0RA 3FZVA 4YZZA 3O6IA 3UP9A 3TEPA 3MQ9A 3KBRA 2FA7A 5IAIA 4EQ9A 3T22A 3LUYA 2Y7PA 3VVDA 5AA4B 2B3BA 3IAZA 3K4UA 2QPQA 4RJZA 2A5SA 3IO4A 1MH4A 4RNSA 3IJXB 2Q8JA 2QMXA 3FD3A 4GFRA 3V83A 3QYTA 1LB8A 4RK2A 1N7XA 5EHSA 3DELB 1R1NA 1WDNA 1D9YA 3PV0E 3ZS6A 2F97A 4R6HA 3V89B 2Z8EA 2UXAA 3I3VA 1MY3A 1NNFA 2Y7KA 1NMUA 1ZLQA 1P1OA 1Z7ME 4LVQA 1IXIA 2PYYA 1ELJA 3GZGA 3SERA 4QFNA 3CG1A 1MS7A 2D21A 5DTBA 5CMCA 1Y9UA 1II5A 4QHQA 3MPLA 4LZ5A 2O6AA 2QS1A 2R6GE 2RC9A 4FIMA 4QFOA 4QFPA 2DE4A 1Q35A 2UVJA 1RKMA 3C31A 3MVWA 5CMKA 1Y4TA 1MQIA 1USYE 3V8XB 3TQLA 2OWSA 1H76A 2WKYA 4NEDA 3FJ7A 3OEMA 2DVZA 1NKXA 3KSJA 4OETA 4OENA 3K6XA 5H8NA 1VFEA 2HQ0A 1NNPA 4GL0A 4OEUA 4YB7A 4DXBA 2O7IA 2BJJX 4HTGA 3C4MA 4R2FA 1ZBMA 5DEXB 4HW8A 1URDA 2XXVA 3FV1A 1BTJA 1QUJA 5TP9B 3T9XB 5A5XB 1B4HA 1BP5A 5I84A 4IY5A 5FTHA 1FTLA 3ONMA 5H8HB 3QXMA 3ZKKA 1B3LA 2OBGA 3CSBA 3IX1A 4IO3A 3K0VA 3TDJA 1FTMA 4IO2A 4JBZA 1LAGE 3V5AA 5KCJB 4ZEKA 3S9LC 1MXXA 1JEUA 1FQFA 4BDMA 3LC8A 3IR1A 1P1NA 3K1MA 5I59B 3K02A 1WODA 3D4CA 1L5TA 2DYXA 2B65A 1Z7NE 3CI8A 1LFIA 1B5JA 1NH7A 4QSCA 4Z0IA 4JSDA 5DVIA 1VR5A 2O1MA 1AL3A 3RGYA 2V3UA 3S9NC 4TOZA 3LSXA 3HO7A 1FQBA 1DSNA 2Y7WA 5FHNA 3FXQA 3LBSA 3RTFB 2VD2A 3E4RA 3MAMA 3VXBA 3CFLA 1OVBA 2Q9TA 3KEIA 5ICQA 1H45A 5ICTA 2UVHA 5DYHA 1LCTA 5I57B 1A54A 4ELQA 1YCJA 1S50A 1SI1A 1MH3A 2F78A 5I58A 4AB5A 2ZYNA 1N3XA 2V3QA 2I48A 4GWOA 3O29A 4EXKA 3PPNA 4NF4B 3TMGA 3CRBA 2DWAA 3EHSA 4IGRA 3CSGA 1UTHB 3VVFA 1GVCA 3O2AA 3SEWA 4LATA 1FTOA 3H06B 3VFJA 2XXIA 3FVGA 1HSJA 3OXNA 1Q1KA 1FW0A 4G77A 4NTLA 5CBRA 3HHGA 4KQPA 2Y7IA 1A8EA 4TLMB 3FJMA 2VHAA 3KSXA 2G93A 3QSLA 2ONRA 2DP8A 4H8JA 4IO6A 4Q0CA 2H9BA 3LSFB 2R71A 1FTJA 3BFTA 4PFWA 1NL5A 3H7MA 5FTIA 3N6UA 1B6HA 4P0GA 3MVZA 5L9MA 4DCXA 4NF8B 1B5IA 4LQ5A 2DWIA 4NF6A 2X26A 1IXCA 3OD7A 1Y3PA 5CMMA 3EF7A 2XD2A 1SQYA 2UVIA 2XXHA 2XX9A 4OVJA 2Z22A 1B0LA 4YKIA 1VFDA 1QUIA 3T9VA 3FATA 5I2KA 2F8DA 3A3UA 1SVXB 4C1TA 4OZ9A 1LFGA 1CB6A 1S7YA 2OZZA 3OOAA 1JW1A 3N5LA 3TTRA 1OQHA 1B7ZA 2XXXA 3CIJA 4G8HA 2XXQA 3RQTA 2XHDA 4PP0A 3DM0A 1B1XA 3L6GA 1EZPA 4ZZAA 4U23A 4R6KA 4ZS9A 1SYIA 1JETA 3KZGA 5TPAA 4TQUQ 2NVUB 4F29A 2QSXA 3IJOB 1FCKA 1NNTA 5DVFA 1I6QA 1MXWA 1POY1 1A55A 1P1WA 4JB7A 3KGCA 3PMVA 1JVYA 1PB9A 2RINA 3VDFA 3SEUA 2NOOA 2RF1A 3T93B 1BLFA 1TT1A 2G29A 3ZSFA 2LAOA 4F3SA 4N13A 1XT8A 4TLLB 3UORA 3R26A 3U1OA 3RT6B 3N94A 1SW1A 3H3GA 3Q27A 4I62A 3S2VA 3ODBA 3THIA 1MPCA 4U1OA 2KLFA 3QIMA 1IITA 4YB5A 3QAXA 4LZ7A 3HN0A 1Y3QA 1MXYA 2DXYA 3OEKA 1N3WA 4MLQA 3RN8A 4I1DA 4KR5A 2I4BA 4GOTA 4OYVA 1EZ9A 4NF5A 4GF8A 4FEBA 1TFDA 1IQ7A 1M5BA 4BLAA 3IB0A 5M2VA 1ATGA 3S4UA 4L17A 4F2OA 4XKNA 4H0WA 4X48A 3B7DA 4U22A 3E3KA 2XXPA 3PUYE 3TAJA 2D3IA 4HCWA 4OESA 4XKRA 3FASA 3PMWA 3B6TA 3Q25A 2V93A 1QW0A 4XTCQ 2ZXTA 3FXUA 4RXLA 3Q26A 4QFKA 2XXYA 1LLSA 3M3LA 1MPDA 3U94A 1POTA 4OERA 3SEXA 2IA4A 3MW0A 4QFLA 2QJEA 2V3TA 4YKJA 2AL4A 3L6HA 3GLBA 5H8QA 1MQJA 3Q29A 4GLIA 3IB1A 4FECA 1B4ZA 3DP6A 4EF1A 2AYSA 3GXAA 4HS7A 3PUZE 2I4CA 5JTYB 4R74A 5CC2A 1Y20A 2PVUA 3JZJA 4F1VA 5ELVA 4G68A 2A5TB 1S9TA 1R9LA 3MZBA 1OQGA 3W9WA 4R2BA 1MY1A 1WVJA 4EUOA 2E0SA 1XHYA 4KFQA 5CI5A 3VLWA 5H8SA 2DXRA 1JW4A 4NWCA 5KDTA 1RYOA 3PGFA 3H6VA 1SW2A 1YPNA 3K6UA 2DE3A 2REGA 2ABHA 4G68C 1LGBC 5AA4A 1VE4A 1NH8A 2P2AA 4EF2A 1PDAA 2AL5A 1I6BA 4AQ4A 5F7VA 5JK4A 1IZ1A 4O3BA 4BDQA 4YKKA 4FAJA 1UIUA 3H6TA 4H5FA 3G3JA 1SBPA 1EH3A 1OIBA 1ZMGA 1D9VA 4R9GA 4YAHX 1B52A 1YAEA 4JWOA 5LOMA 3IL1B 1MPBA 1UTBA 1QULA 3TZAA 3KN7A 1OLCA 2DQVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DLD A;  3UN6 A;  4U21 A;  3SET A;  1Y3N A;  2X7P A;  4M4G A;  2IEE A;  2CMO A;  3OSQ A;  4YMB A;  4MLV A;  1P1Q A;  3TOD A;  4RYA A;  4FED A;  2ZMB A;  3M8U A;  4XXU A;  4OWD A;  3R6U A;  4R72 A;  2DE2 A;  3HST A;  2Y7R A;  4H6D A;  1N04 A;  1B1H A;  4MBP A;  3UA8 A;  5AA3 A;  2H99 A;  3DP4 A;  1ZU0 A;  3KN8 A;  4DXC A;  3PPR A;  1JVX A;  5I58 B;  2VOZ A;  3MZ1 A;  4ELP A;  1TWY A;  2XX8 A;  1B58 A;  3EN3 A;  4ISU A;  3S9M C;  2F34 A;  2XXW A;  3LR1 A;  4E0X A;  4YMA A;  3A3C A;  3OO8 A;  2W7Y A;  3ILU B;  5I56 A;  1D4N A;  1MXU A;  4THI A;  2XXT A;  3A09 A;  2HCA A;  4IO7 A;  3W15 C;  4ZEB A;  3IOR A;  1ZIU A;  1QJM A;  1GV8 A;  1R6Z A;  3GBA A;  5DEX A;  5K2X A;  4P11 A;  4NWD A;  2Q88 A;  1SW5 A;  4U1Z A;  4WED A;  4OTE A;  5CBS A;  1I69 A;  4JSO A;  2HFB A;  4ND9 A;  1O64 A;  3U93 A;  1XVY A;  4WKM A;  1MXV A;  4UAC A;  4K3F A;  3H4Z A;  2O51 A;  2OCU A;  2O84 X;  4NF6 B;  1LBB A;  2XXU A;  3FVK A;  4JWX A;  3C33 A;  1XC1 A;  3CR9 A;  3QUF A;  2GFE A;  2ZYK A;  1D3K A;  3I6V A;  3KN3 A;  2UYE A;  5HPQ A;  4R9F A;  4ZE9 A;  4U4X A;  1B05 A;  1PB7 A;  5EHM A;  3TTK A;  3IK6 B;  1M5F A;  5B7D A;  3DP8 A;  1KWH A;  5I2K B;  1N0T A;  3USD A;  1UIV A;  2F6G A;  5I59 A;  1QKA A;  2PT2 A;  4EDP A;  4BDL A;  4ESW A;  4H67 A;  4PET A;  2V84 A;  5F1Q A;  1MQH A;  3TFL A;  4GQO A;  3VV5 A;  1B3F A;  4F3G A;  3CG3 A;  4AB6 A;  3KJT A;  3B6W A;  3OEN A;  3IO6 A;  5L9S A;  1OMP A;  1F9B A;  1PBQ A;  5IKB A;  1A8F A;  4KHZ E;  2QMW A;  1B9J A;  4N6P A;  1H44 A;  3ECR A;  5H8F A;  4OFJ A;  3RPW A;  1A99 A;  5KZT A;  4BDN A;  2I0C A;  3PUX E;  4MFI A;  4OXV A;  5I57 A;  3G3G A;  4Q30 B;  3UK4 A;  2OJT A;  3AXF A;  3MPK A;  4NF4 A;  2UYF A;  4RPO A;  4IY6 A;  5I2N B;  2RCA A;  3FV2 A;  1B46 A;  5AA2 B;  4ZED A;  1QUK A;  3O66 A;  4R73 A;  2I49 A;  1R9Q A;  1HSL A;  2ONK E;  4ZEC A;  3T9U A;  3BBR A;  3VLU A;  4H1X A;  4O3A A;  1DPE A;  3TYH A;  4F31 B;  3TCF A;  4EXL A;  4KD5 A;  3IOU A;  5BWJ A;  3EQ1 A;  1DMB A;  2I3V A;  4JXI A;  1JEV A;  3HCQ A;  4X1D A;  3R7X A;  1IIW A;  4H8I A;  4PFY A;  3TUS A;  1FTK A;  1H3D A;  5L8D A;  4NMY A;  2V25 A;  1B2H A;  4YU0 A;  4LA9 A;  4ONY A;  4G8M A;  2D5W A;  1LCF A;  3M3F A;  4U4S A;  3IOT A;  3EHU A;  4PFU A;  1B5H A;  3U8Q A;  3S9E A;  2XD3 A;  1B7H A;  3VVE A;  2H4I A;  2FYI A;  4LUB A;  2O68 A;  4KI0 E;  2NWJ A;  2OWT A;  1IEJ A;  2HXW A;  2PX1 A;  3IOV A;  1IXH A;  2M8C A;  2H25 A;  3CVG A;  4POW A;  1LAX A;  1N7W A;  3TQW A;  2Q89 A;  4R75 A;  1AIV A;  1B51 A;  1I6A A;  2Z23 A;  3FVO A;  1US5 A;  4XIG Q;  4GXS B;  4FOR A;  4C1U A;  3K00 A;  4G68 B;  2E1S A;  1XS5 A;  4FE8 A;  2ESN A;  4GVO A;  3MP6 A;  2ONS A;  1TXF A;  2ZNU A;  2RC8 A;  3C36 A;  4LZ8 A;  2THI A;  3K1N A;  4R6Y A;  4POX A;  3Q28 A;  1FQC A;  3C35 A;  1N76 A;  1DPP A;  4ZEF A;  3TTM A;  4GXA A;  5AA1 A;  4Z7E A;  1LBC A;  1B0H A;  2RC7 A;  4PQJ A;  3KOT A;  4F2Q A;  3PUW E;  1DOT A;  3KJ7 A;  2F7C A;  4I9D A;  3LSW A;  3VE1 B;  2QS2 A;  4ELR A;  1LAF E;  3TPA A;  4F18 A;  3PPQ A;  1N84 A;  4ZEI A;  5H8N B;  1MRP A;  1LST A;  3PD9 A;  1FQA A;  3BKI B;  1IXG A;  5CRY A;  2QL3 A;  2QS4 A;  3PD8 A;  2Z8F A;  1EZO A;  4F22 A;  2F6P A;  3IOW A;  1IUD A;  3G3F A;  3O28 A;  4DCY A;  4F3B A;  5J1D A;  1UTB B;  4N07 A;  3RLF E;  3BFU A;  3MBP A;  3IB2 A;  2HAU A;  1SYH A;  3T9H B;  3K1P A;  4QSD A;  3SES A;  1PBP A;  1JNF A;  3CFZ A;  3E9X A;  1B7U A;  3RY3 A;  3C34 A;  4H5G A;  2Q2C A;  2F7A A;  3FIR A;  3H6W A;  5K2Y A;  3G7W A;  4QSE A;  3KFM A;  3WAE A;  1ZTY A;  5L9O A;  1MDP 1;  4KCC A;  3PPP A;  3D4G A;  2ZNS A;  3MWB A;  3MC2 A;  1PC3 A;  2F36 A;  5B70 A;  1EU8 A;  1AOV A;  3MZ9 A;  1UQW A;  3GBB A;  1MY0 A;  1JQF A;  1MQG A;  4IGT A;  1B3G A;  3VLV A;  5JTY A;  2Z8D A;  3KG2 A;  1OLA A;  2PT1 A;  3U72 A;  5I56 B;  2QS3 A;  4ZZE A;  1J1N A;  1LAH E;  4JDF A;  2I0B A;  2GHA A;  2RCB A;  2A5T A;  3T96 B;  4X1B A;  3UIF A;  4G2Z A;  2P0S A;  4RY1 A;  3U92 A;  5BUU A;  4WXJ A;  1OVT A;  3MJN A;  1URG A;  1SI0 A;  2YLN A;  3KOS A;  4HCY A;  1O7T A;  2HAV A;  5DVJ A;  1XVX A;  3MVX A;  4GRK A;  3JV9 A;  1AMF A;  3W9V A;  5FHO A;  3TCH A;  1Y1M A;  1MQD A;  1YTV A;  3H03 A;  3LSL A;  1MY2 A;  1LFH A;  2Q2A A;  3G3H A;  1MM6 A;  4UA8 A;  1O63 A;  4XKQ A;  4Q5T A;  2I3W A;  3E13 X;  3JYR A;  4E0W A;  4WEP A;  4KCD A;  3K01 A;  1GR2 A;  3OMB A;  1CE2 A;  5EYF A;  2O7U A;  2VD3 A;  4M1V A;  2F7B A;  2HEU A;  2NUV A;  2X7Q A;  5HBC A;  4IO4 A;  3HPI A;  2UVG A;  4GIZ A;  1NNK A;  1T0K A;  4OFL A;  2VP1 A;  1A7L A;  3RNN A;  4ECF A;  4IB2 A;  4EQB A;  3EHT A;  4OMB A;  4MH5 A;  5TP9 A;  4OEV A;  5CM6 A;  4F1Y A;  5A5X A;  4ZDM A;  3OEL A;  2CZL A;  5H8H A;  5H8F B;  1ANF A;  1PEB A;  1VSO A;  5AA2 D;  2QRY A;  3DLN A;  4YB6 A;  1B3E A;  2DS9 A;  4DIG A;  5KCJ A;  4ELO A;  1NFT A;  2ZYO A;  4LQ2 A;  1B40 A;  3PUV E;  3TTL A;  2Y84 A;  2O69 A;  3C9H A;  1DTZ A;  4BDR A;  3N26 A;  3EPE A;  3G3I A;  2VGQ A;  3TKD A;  4Q8R A;  4PE5 B;  4U2R A;  4P0I A;  3OO6 A;  4DZ1 A;  1A40 A;  1BKA A;  2YJP A;  1URS A;  1MM7 A;  1B32 A;  5ITP A;  3PPO A;  3HV1 A;  3SKP A;  4FAT A;  1MDQ A;  3OSR A;  4I8C A;  1PB8 A;  3ZKL A;  4KYS A;  1Y1Z A;  1LB9 A;  3MP1 A;  5TPA B;  4KYE A;  3TEL A;  3CFX A;  4DE8 A;  3G3K A;  1M5D A;  1Y4C A;  1M5C A;  3O9P A;  1HSE A;  3FGS A;  3SEV A;  2DVC A;  2DSF A;  3H6U A;  5DT6 A;  4G8N A;  2YPN A;  4EQ7 A;  4G4P A;  4IO5 A;  4KPT A;  1ZJL A;  2H98 A;  4O3C A;  4JWY A;  5TU0 A;  2O1L A;  2OK2 A;  2ZNT A;  4X9T A;  4F1U A;  2RKM A;  3PU5 A;  1AH5 A;  2HZL A;  4RK9 A;  2F35 A;  4QF9 A;  3HHF A;  1P1U A;  4DXU A;  1UTH A;  3TTN A;  3OO9 A;  3K6W A;  4QRZ A;  1H43 A;  1XOC A;  2R9J A;  1MY4 A;  3MUQ A;  3O6G A;  5HM4 B;  1SD3 A;  4OHN A;  2I58 A;  1BIY A;  3N6T A;  4F39 A;  3MP8 A;  4MF3 A;  3I5O A;  3T66 A;  4XKP A;  4GD5 A;  2ZYM A;  2H5Y A;  3P7I A;  4PFT A;  3VXC A;  4OFO A;  3K2D A;  1SDX A;  2F5X A;  3O97 A;  4LON B;  3RTW B;  1P99 A;  2AIX A;  4F3P A;  2GRV A;  3M3K A;  4NF5 B;  2PBW A;  4ESX A;  3FXR A;  2P1S A;  4NF8 A;  3TCG A;  4NE4 A;  1JW5 A;  4LP2 B;  1B3H A;  5ISU A;  1FQE A;  2I6E A;  1GGG A;  3ILT B;  3B6Q A;  2DWJ A;  3SEY A;  3SDF A;  3FVN A;  2HZK A;  1TFA A;  3K6V A;  3O6H A;  1ZKB A;  3PMX A;  4RA1 A;  4RPN A;  1DTG A;  2OLB A;  2B3F A;  3MVY A;  3UGW A;  4H65 A;  5I2N A;  2GH9 A;  4FJP A;  2FNC A;  4DDD A;  2GHB A;  5H8Q B;  5AE4 A;  1GTK A;  1SW4 A;  3C32 A;  3FUZ A;  4KYD A;  1MXZ A;  5ITO A;  1QVS A;  3QUJ A;  3QK6 A;  5AA2 A;  2PMS A;  1RYX A;  3RUM A;  2NXO A;  2REJ A;  4YKP A;  4ZE8 A;  1MG1 A;  5CMB A;  4YIC A;  3OO7 A;  2ALU A;  2XX7 A;  5FHM A;  3FJG A;  2DWH A;  2ANJ A;  3WAF A;  4F19 A;  3F11 A;  5JEI A;  1US4 A;  1FQD A;  5KDT B;  4GL8 A;  2XXR A;  1QKB A;  1M5E A;  2DOJ A;  3RT8 A;  4OQO A;  1USY H;  4BDO A;  4C0R A;  3FZV A;  4YZZ A;  3O6I A;  3UP9 A;  3TEP A;  3MQ9 A;  3KBR A;  2FA7 A;  5IAI A;  4EQ9 A;  3T22 A;  3LUY A;  2Y7P A;  3VVD A;  5AA4 B;  2B3B A;  3IAZ A;  3K4U A;  2QPQ A;  4RJZ A;  2A5S A;  3IO4 A;  1MH4 A;  4RNS A;  3IJX B;  2Q8J A;  2QMX A;  3FD3 A;  4GFR A;  3V83 A;  3QYT A;  1LB8 A;  4RK2 A;  1N7X A;  5EHS A;  3DEL B;  1R1N A;  1WDN A;  1D9Y A;  3PV0 E;  3ZS6 A;  2F97 A;  4R6H A;  3V89 B;  2Z8E A;  2UXA A;  3I3V A;  1MY3 A;  1NNF A;  2Y7K A;  1NMU A;  1ZLQ A;  1P1O A;  1Z7M E;  4LVQ A;  1IXI A;  2PYY A;  1ELJ A;  3GZG A;  3SER A;  4QFN A;  3CG1 A;  1MS7 A;  2D21 A;  5DTB A;  5CMC A;  1Y9U A;  1II5 A;  4QHQ A;  3MPL A;  4LZ5 A;  2O6A A;  2QS1 A;  2R6G E;  2RC9 A;  4FIM A;  4QFO A;  4QFP A;  2DE4 A;  1Q35 A;  2UVJ A;  1RKM A;  3C31 A;  3MVW A;  5CMK A;  1Y4T A;  1MQI A;  1USY E;  3V8X B;  3TQL A;  2OWS A;  1H76 A;  2WKY A;  4NED A;  3FJ7 A;  3OEM A;  2DVZ A;  1NKX A;  3KSJ A;  4OET A;  4OEN A;  3K6X A;  5H8N A;  1VFE A;  2HQ0 A;  1NNP A;  4GL0 A;  4OEU A;  4YB7 A;  4DXB A;  2O7I A;  2BJJ X;  4HTG A;  3C4M A;  4R2F A;  1ZBM A;  5DEX B;  4HW8 A;  1URD A;  2XXV A;  3FV1 A;  1BTJ A;  1QUJ A;  5TP9 B;  3T9X B;  5A5X B;  1B4H A;  1BP5 A;  5I84 A;  4IY5 A;  5FTH A;  1FTL A;  3ONM A;  5H8H B;  3QXM A;  3ZKK A;  1B3L A;  2OBG A;  3CSB A;  3IX1 A;  4IO3 A;  3K0V A;  3TDJ A;  1FTM A;  4IO2 A;  4JBZ A;  1LAG E;  3V5A A;  5KCJ B;  4ZEK A;  3S9L C;  1MXX A;  1JEU A;  1FQF A;  4BDM A;  3LC8 A;  3IR1 A;  1P1N A;  3K1M A;  5I59 B;  3K02 A;  1WOD A;  3D4C A;  1L5T A;  2DYX A;  2B65 A;  1Z7N E;  3CI8 A;  1LFI A;  1B5J A;  1NH7 A;  4QSC A;  4Z0I A;  4JSD A;  5DVI A;  1VR5 A;  2O1M A;  1AL3 A;  3RGY A;  2V3U A;  3S9N C;  4TOZ A;  3LSX A;  3HO7 A;  1FQB A;  1DSN A;  2Y7W A;  5FHN A;  3FXQ A;  3LBS A;  3RTF B;  2VD2 A;  3E4R A;  3MAM A;  3VXB A;  3CFL A;  1OVB A;  2Q9T A;  3KEI A;  5ICQ A;  1H45 A;  5ICT A;  2UVH A;  5DYH A;  1LCT A;  5I57 B;  1A54 A;  4ELQ A;  1YCJ A;  1S50 A;  1SI1 A;  1MH3 A;  2F78 A;  5I58 A;  4AB5 A;  2ZYN A;  1N3X A;  2V3Q A;  2I48 A;  4GWO A;  3O29 A;  4EXK A;  3PPN A;  4NF4 B;  3TMG A;  3CRB A;  2DWA A;  3EHS A;  4IGR A;  3CSG A;  1UTH B;  3VVF A;  1GVC A;  3O2A A;  3SEW A;  4LAT A;  1FTO A;  3H06 B;  3VFJ A;  2XXI A;  3FVG A;  1HSJ A;  3OXN A;  1Q1K A;  1FW0 A;  4G77 A;  4NTL A;  5CBR A;  3HHG A;  4KQP A;  2Y7I A;  1A8E A;  4TLM B;  3FJM A;  2VHA A;  3KSX A;  2G93 A;  3QSL A;  2ONR A;  2DP8 A;  4H8J A;  4IO6 A;  4Q0C A;  2H9B A;  3LSF B;  2R71 A;  1FTJ A;  3BFT A;  4PFW A;  1NL5 A;  3H7M A;  5FTI A;  3N6U A;  1B6H A;  4P0G A;  3MVZ A;  5L9M A;  4DCX A;  4NF8 B;  1B5I A;  4LQ5 A;  2DWI A;  4NF6 A;  2X26 A;  1IXC A;  3OD7 A;  1Y3P A;  5CMM A;  3EF7 A;  2XD2 A;  1SQY A;  2UVI A;  2XXH A;  2XX9 A;  4OVJ A;  2Z22 A;  1B0L A;  4YKI A;  1VFD A;  1QUI A;  3T9V A;  3FAT A;  5I2K A;  2F8D A;  3A3U A;  1SVX B;  4C1T A;  4OZ9 A;  1LFG A;  1CB6 A;  1S7Y A;  2OZZ A;  3OOA A;  1JW1 A;  3N5L A;  3TTR A;  1OQH A;  1B7Z A;  2XXX A;  3CIJ A;  4G8H A;  2XXQ A;  3RQT A;  2XHD A;  4PP0 A;  3DM0 A;  1B1X A;  3L6G A;  1EZP A;  4ZZA A;  4U23 A;  4R6K A;  4ZS9 A;  1SYI A;  1JET A;  3KZG A;  5TPA A;  4TQU Q;  2NVU B;  4F29 A;  2QSX A;  3IJO B;  1FCK A;  1NNT A;  5DVF A;  1I6Q A;  1MXW A;  1POY 1;  1A55 A;  1P1W A;  4JB7 A;  3KGC A;  3PMV A;  1JVY A;  1PB9 A;  2RIN A;  3VDF A;  3SEU A;  2NOO A;  2RF1 A;  3T93 B;  1BLF A;  1TT1 A;  2G29 A;  3ZSF A;  2LAO A;  4F3S A;  4N13 A;  1XT8 A;  4TLL B;  3UOR A;  3R26 A;  3U1O A;  3RT6 B;  3N94 A;  1SW1 A;  3H3G A;  3Q27 A;  4I62 A;  3S2V A;  3ODB A;  3THI A;  1MPC A;  4U1O A;  2KLF A;  3QIM A;  1IIT A;  4YB5 A;  3QAX A;  4LZ7 A;  3HN0 A;  1Y3Q A;  1MXY A;  2DXY A;  3OEK A;  1N3W A;  4MLQ A;  3RN8 A;  4I1D A;  4KR5 A;  2I4B A;  4GOT A;  4OYV A;  1EZ9 A;  4NF5 A;  4GF8 A;  4FEB A;  1TFD A;  1IQ7 A;  1M5B A;  4BLA A;  3IB0 A;  5M2V A;  1ATG A;  3S4U A;  4L17 A;  4F2O A;  4XKN A;  4H0W A;  4X48 A;  3B7D A;  4U22 A;  3E3K A;  2XXP A;  3PUY E;  3TAJ A;  2D3I A;  4HCW A;  4OES A;  4XKR A;  3FAS A;  3PMW A;  3B6T A;  3Q25 A;  2V93 A;  1QW0 A;  4XTC Q;  2ZXT A;  3FXU A;  4RXL A;  3Q26 A;  4QFK A;  2XXY A;  1LLS A;  3M3L A;  1MPD A;  3U94 A;  1POT A;  4OER A;  3SEX A;  2IA4 A;  3MW0 A;  4QFL A;  2QJE A;  2V3T A;  4YKJ A;  2AL4 A;  3L6H A;  3GLB A;  5H8Q A;  1MQJ A;  3Q29 A;  4GLI A;  3IB1 A;  4FEC A;  1B4Z A;  3DP6 A;  4EF1 A;  2AYS A;  3GXA A;  4HS7 A;  3PUZ E;  2I4C A;  5JTY B;  4R74 A;  5CC2 A;  1Y20 A;  2PVU A;  3JZJ A;  4F1V A;  5ELV A;  4G68 A;  2A5T B;  1S9T A;  1R9L A;  3MZB A;  1OQG A;  3W9W A;  4R2B A;  1MY1 A;  1WVJ A;  4EUO A;  2E0S A;  1XHY A;  4KFQ A;  5CI5 A;  3VLW A;  5H8S A;  2DXR A;  1JW4 A;  4NWC A;  5KDT A;  1RYO A;  3PGF A;  3H6V A;  1SW2 A;  1YPN A;  3K6U A;  2DE3 A;  2REG A;  2ABH A;  4G68 C;  1LGB C;  5AA4 A;  1VE4 A;  1NH8 A;  2P2A A;  4EF2 A;  1PDA A;  2AL5 A;  1I6B A;  4AQ4 A;  5F7V A;  5JK4 A;  1IZ1 A;  4O3B A;  4BDQ A;  4YKK A;  4FAJ A;  1UIU A;  3H6T A;  4H5F A;  3G3J A;  1SBP A;  1EH3 A;  1OIB A;  1ZMG A;  1D9V A;  4R9G A;  4YAH X;  1B52 A;  1YAE A;  4JWO A;  5LOM A;  3IL1 B;  1MPB A;  1UTB A;  1QUL A;  3TZA A;  3KN7 A;  1OLC A;  2DQV A; 
#chains in the Genus database with same CATH topology
 4DLD A;  3UN6 A;  4U21 A;  4H46 A;  3SET A;  1Y3N A;  2XWO A;  2X7P A;  4M4G A;  2IEE A;  2CMO A;  3LUZ A;  3OSQ A;  4YMB A;  4O8M A;  4MLV A;  1P1Q A;  3TOD A;  4RYA A;  4FED A;  4PC9 A;  2ZMB A;  3M8U A;  4XXU A;  4OWD A;  3R6U A;  2CZK A;  4R72 A;  2DE2 A;  3HST A;  2Y7R A;  4H6D A;  1N04 A;  1B1H A;  4MBP A;  1FPB A;  3UA8 A;  5AA3 A;  1DK4 A;  2H99 A;  3DP4 A;  1ZU0 A;  3MYU A;  3KN8 A;  1EYI A;  4DXC A;  3PPR A;  1JVX A;  5I58 B;  2VOZ A;  3MZ1 A;  4ELP A;  1TWY A;  1NV2 A;  1B58 A;  2XX8 A;  3EN3 A;  4ISU A;  3S9M C;  2F34 A;  2XXW A;  3LR1 A;  4GWX A;  4GWS A;  4E0X A;  4YMA A;  3A3C A;  3OO8 A;  2W7Y A;  3ILU B;  5I56 A;  1D4N A;  1MXU A;  4THI A;  2XXT A;  3A09 A;  2HCA A;  4G61 A;  4IO7 A;  3W15 C;  4ZEB A;  3IOR A;  1ZIU A;  1QJM A;  1GV8 A;  1R6Z A;  3GBA A;  5DEX A;  5K2X A;  4P11 A;  4N4U A;  4NWD A;  2Q88 A;  1SW5 A;  4U1Z A;  4WED A;  4OTE A;  5CBS A;  1I69 A;  4JSO A;  2HFB A;  4ND9 A;  1O64 A;  2QVR A;  2XWV A;  3U93 A;  5FBP A;  1XVY A;  4WKM A;  1MXV A;  2R8T A;  4NN3 A;  4UAC A;  4K3F A;  3H4Z A;  2O51 A;  2OCU A;  2O84 X;  4NF6 B;  1LBB A;  2XXU A;  3FVK A;  4JWX A;  4PBH A;  3C33 A;  1XC1 A;  3CR9 A;  3QUF A;  4P56 A;  2GFE A;  2ZYK A;  2ZZV A;  1D3K A;  3I6V A;  3KN3 A;  2UYE A;  5HPQ A;  4R9F A;  4ZE9 A;  4U4X A;  1B05 A;  3MST A;  1PB7 A;  2VPO A;  5EHM A;  3TTK A;  2JJK A;  3IK6 B;  1M5F A;  5B7D A;  3DP8 A;  1KWH A;  5I2K B;  1N0T A;  3USD A;  1UIV A;  2F6G A;  5I59 A;  1QKA A;  2PT2 A;  4EDP A;  4BDL A;  4ESW A;  4H67 A;  4PET A;  2V84 A;  5F1Q A;  1MQH A;  3GYY A;  3TFL A;  4GQO A;  3VV5 A;  1B3F A;  4F3G A;  3CG3 A;  4AB6 A;  3KJT A;  3B6W A;  3OEN A;  3IO6 A;  5L9S A;  1OMP A;  1F9B A;  1PBQ A;  5IKB A;  1A8F A;  4KHZ E;  2QMW A;  1B9J A;  2P3V A;  4N6P A;  1H44 A;  3ECR A;  5H8F A;  4OFJ A;  3RPW A;  1A99 A;  5KZT A;  4BDN A;  2I0C A;  3PUX E;  4MFI A;  4OXV A;  2HHM A;  2KQZ A;  5I57 A;  3G3G A;  4Q30 B;  3UK4 A;  2FVZ A;  3U65 A;  1VDW A;  2OJT A;  1FPK A;  3AXF A;  4I3E A;  3MPK A;  4NF4 A;  1NV0 A;  2UYF A;  4RPO A;  4IY6 A;  5I2N B;  2RCA A;  4PCD A;  3FV2 A;  1B46 A;  1FJ9 A;  5AA2 B;  1G0I A;  4ZED A;  1QUK A;  3O66 A;  4R73 A;  2I49 A;  1R9Q A;  1HSL A;  2ONK E;  4ZEC A;  3T9U A;  3BBR A;  3VLU A;  3LV0 A;  4H1X A;  4O3A A;  1DPE A;  4NQ8 A;  3TYH A;  4F31 B;  3TCF A;  4EXL A;  4KD5 A;  3IOU A;  5BWJ A;  3EQ1 A;  1DMB A;  1NUX A;  4HE0 A;  2I3V A;  4JXI A;  1KA0 A;  1JEV A;  3HCQ A;  4X1D A;  3ISP A;  3R7X A;  4HE2 A;  1FPF A;  5ESY A;  1IIW A;  4H8I A;  4PFY A;  3TUS A;  1FTK A;  1H3D A;  5L8D A;  4NMY A;  4PGP A;  2V25 A;  1B2H A;  4YU0 A;  5LDZ A;  4LA9 A;  4ONY A;  4G8M A;  2D5W A;  1LCF A;  4MEV A;  3M3F A;  4U4S A;  3IOT A;  3EHU A;  4PFU A;  1B5H A;  3U8Q A;  3S9E A;  2XD3 A;  1B7H A;  3VVE A;  2H4I A;  2FYI A;  4LUB A;  2O68 A;  4KI0 E;  4JVC A;  2NWJ A;  2OWT A;  1IEJ A;  2HXW A;  2PX1 A;  4MIJ A;  3IOV A;  2XXK A;  1IXH A;  2M8C A;  2H25 A;  3CVG A;  4POW A;  1LAX A;  1N7W A;  3TQW A;  2Q89 A;  3CHG A;  4R75 A;  1AIV A;  1B51 A;  1I6A A;  2Z23 A;  3FVO A;  1US5 A;  4XIG Q;  4GXS B;  4FOR A;  4C1U A;  3K00 A;  4G68 B;  4GWY A;  2E1S A;  1XS5 A;  4FE8 A;  2ESN A;  4GWU A;  4GVO A;  3MP6 A;  2ONS A;  1TXF A;  4MNI A;  2ZNU A;  2RC8 A;  3C36 A;  5IZZ A;  4LZ8 A;  2THI A;  3K1N A;  4R6Y A;  1JP4 A;  4POX A;  3Q28 A;  1FQC A;  3C35 A;  1N76 A;  1DPP A;  4ZEF A;  3TTM A;  4QBA A;  4GXA A;  5AA1 A;  4Z7E A;  1LBC A;  1B0H A;  2RC7 A;  4PQJ A;  3KOT A;  4F2Q A;  4N8G A;  3PUW E;  1DOT A;  3KJ7 A;  2F7C A;  4I9D A;  3LSW A;  4PDH A;  5EYG A;  3VE1 B;  2QS2 A;  4ELR A;  1LAF E;  3TPA A;  4F18 A;  2CEX A;  3PPQ A;  4XFE A;  1N84 A;  4ZEI A;  4O7M A;  5H8N B;  1MRP A;  1LST A;  3PD9 A;  2OWZ A;  4O7I A;  1FQA A;  3BKI B;  1IXG A;  5CRY A;  2QL3 A;  2QS4 A;  3PD8 A;  2Z8F A;  1K9Y A;  1EZO A;  4F22 A;  2F6P A;  3IOW A;  1IUD A;  3G3F A;  3O28 A;  4DCY A;  4F3B A;  5J1D A;  1UTB B;  4N07 A;  4XF5 A;  2QVU A;  3RLF E;  3BFU A;  2Q74 A;  3MBP A;  3IB2 A;  2HAU A;  1SYH A;  3T9H B;  3K1P A;  4QSD A;  3SES A;  1PBP A;  1JNF A;  3CFZ A;  4NAP A;  3E9X A;  1B7U A;  3RY3 A;  3C34 A;  4H5G A;  2Q2C A;  3KC0 A;  5A5L A;  2F7A A;  1RDX A;  1K9Z A;  3FIR A;  3H6W A;  5K2Y A;  5IGA A;  3G7W A;  4QSE A;  3KFM A;  3WAE A;  1ZTY A;  5L9O A;  1MDP 1;  2OX3 A;  1NUW A;  4X8R A;  4KCC A;  3PPP A;  4MAG A;  3D4G A;  2ZNS A;  3MWB A;  3MC2 A;  1PC3 A;  2F36 A;  4O94 A;  2CZI A;  5B70 A;  1EU8 A;  4N6D A;  1AOV A;  3MZ9 A;  1UQW A;  3GBB A;  1MY0 A;  1JQF A;  1MQG A;  4IGT A;  1B3G A;  3VLV A;  5JTY A;  2Z8D A;  3KG2 A;  1OLA A;  2PT1 A;  3U72 A;  5I56 B;  2QS3 A;  4ZZE A;  1J1N A;  1LAH E;  4JDF A;  4UAB A;  2I0B A;  2GHA A;  2RCB A;  2A5T A;  4P9K A;  3T96 B;  4X1B A;  3UIF A;  4G2Z A;  2P0S A;  4RY1 A;  3U92 A;  5BUU A;  4WXJ A;  1OVT A;  3MJN A;  1URG A;  1SI0 A;  2YLN A;  2B4M A;  3HFU A;  3KOS A;  4HCY A;  1O7T A;  2HAV A;  4XEQ A;  4HXV A;  4OVQ A;  5DVJ A;  1XVX A;  3MVX A;  4GRK A;  3JV9 A;  5IZ3 A;  1AMF A;  3W9V A;  5FHO A;  3TCH A;  1Y1M A;  1MQD A;  4MMP A;  1YTV A;  3H03 A;  3LSL A;  1MY2 A;  1IMF A;  3QMF A;  1LFH A;  2Q2A A;  3G3H A;  1MM6 A;  4UA8 A;  3SZP A;  1O63 A;  4LN5 A;  4XKQ A;  4Q5T A;  5I3S A;  2I3W A;  4NHB A;  3E13 X;  2Y5L A;  1FBD A;  4GX6 A;  3JYR A;  4E0W A;  4WEP A;  4KCD A;  4OA4 A;  1FPG A;  3K01 A;  1GR2 A;  3OMB A;  4PF6 A;  1CE2 A;  5EYF A;  5EQ7 A;  2O7U A;  2VD3 A;  4M1V A;  2F7B A;  4DI3 D;  2HEU A;  2NUV A;  2X7Q A;  5HBC A;  4IO4 A;  3HPI A;  2UVG A;  4GIZ A;  1NNK A;  4I3Y A;  1T0K A;  3FXB A;  4I40 A;  4OFL A;  2VP1 A;  1A7L A;  3RNN A;  4ECF A;  4IB2 A;  4EQB A;  3EHT A;  4OMB A;  4MH5 A;  5TP9 A;  4OEV A;  5CM6 A;  1NV5 A;  4F1Y A;  5A5X A;  4ZDM A;  3OEL A;  1YZ0 A;  1RDZ A;  2CZL A;  4PDD A;  3PTY A;  5H8H A;  5H8F B;  1ANF A;  1PEB A;  1VSO A;  5AA2 D;  1CNQ A;  1FPE A;  2QRY A;  3DLN A;  4YB6 A;  1B3E A;  2DS9 A;  4DIG A;  4N81 A;  5KCJ A;  4FBP A;  4ELO A;  4PBQ A;  1NFT A;  2ZYO A;  4LQ2 A;  1B40 A;  3PUV E;  3TTL A;  2Y84 A;  2O69 A;  3C9H A;  1DTZ A;  4BDR A;  3N26 A;  3EPE A;  3G3I A;  2VGQ A;  1LBV A;  3TKD A;  1IMA A;  4Q8R A;  4PE5 B;  4U2R A;  4P0I A;  3OO6 A;  1YYZ A;  4DZ1 A;  1A40 A;  1BKA A;  2YJP A;  1URS A;  1MM7 A;  1B32 A;  4OAN A;  5ITP A;  1AWB A;  3HV1 A;  3PPO A;  3SKP A;  4FAT A;  1Q9D A;  1MDQ A;  3OSR A;  1NUZ A;  4I8C A;  1PB8 A;  3ZKL A;  4KYS A;  4PFR A;  4IR8 A;  4KXP A;  1Y1Z A;  1LB9 A;  3MP1 A;  5TPA B;  4KYE A;  3TEL A;  3CFX A;  5T3J A;  4DE8 A;  3G3K A;  1M5D A;  1Y4C A;  1M5C A;  3O9P A;  1HSE A;  3FGS A;  3SEV A;  2DVC A;  2DSF A;  3H6U A;  5DT6 A;  4G8N A;  2YPN A;  4EQ7 A;  4G4P A;  4IO5 A;  4KPT A;  1ZJL A;  4MNC A;  2PCR A;  2H98 A;  1G0H A;  4O3C A;  4JWY A;  5TU0 A;  2O1L A;  2OK2 A;  2ZNT A;  4X9T A;  4F1U A;  2RKM A;  3PU5 A;  1AH5 A;  2HZL A;  4RK9 A;  2F35 A;  4QF9 A;  3D1R A;  3HHF A;  1P1U A;  4DXU A;  1UTH A;  3TTN A;  3OO9 A;  1LEV A;  3K6W A;  4QRZ A;  1H43 A;  1XOC A;  2R9J A;  4N91 A;  1MY4 A;  3MUQ A;  3O6G A;  5HM4 B;  1SD3 A;  4OHN A;  2ZZW A;  2I58 A;  1BIY A;  3N6T A;  4F39 A;  3MP8 A;  4MF3 A;  3I5O A;  3T66 A;  4XKP A;  3B50 A;  4GD5 A;  2ZYM A;  2H5Y A;  1FBH A;  3P7I A;  4PFT A;  3VXC A;  4N15 A;  4OFO A;  3K2D A;  1SDX A;  2F5X A;  3O97 A;  4LON B;  3RTW B;  1P99 A;  2AIX A;  4F3P A;  2GRV A;  3M3K A;  4NF5 B;  2PBW A;  2BJI A;  1FPL A;  4ESX A;  3FXR A;  2P1S A;  4NF8 A;  3TCG A;  4NE4 A;  2WYP A;  1JW5 A;  4LP2 B;  1KZ8 A;  1B3H A;  5ISU A;  1FQE A;  2XA5 A;  2I6E A;  1GGG A;  3ILT B;  3B6Q A;  2DWJ A;  3SEY A;  2WBB A;  3SDF A;  3FVN A;  2HZK A;  1TFA A;  3K6V A;  3O6H A;  1ZKB A;  3PMX A;  4RA1 A;  4RPN A;  1DTG A;  2OLB A;  2B3F A;  3MVY A;  2P3N A;  3UGW A;  1FPJ A;  4H65 A;  5I2N A;  2GH9 A;  3RYD A;  4FJP A;  2FNC A;  4DDD A;  2GHB A;  5H8Q B;  5AE4 A;  1GTK A;  1NV6 A;  1SW4 A;  1FBG A;  3C32 A;  3FUZ A;  4KYD A;  1MXZ A;  5ITO A;  1QVS A;  5ET6 A;  3QUJ A;  3QK6 A;  5AA2 A;  2PMS A;  1RYX A;  3RUM A;  2NXO A;  2REJ A;  4YKP A;  4ZE8 A;  1MG1 A;  5CMB A;  4YIC A;  3OO7 A;  4NGU A;  3E79 A;  4P3L A;  2ALU A;  2XX7 A;  1DCU A;  5FHM A;  3FJG A;  2DWH A;  3FBP A;  2ANJ A;  3BIG A;  3WAF A;  4F19 A;  4OVT A;  3F11 A;  5JEI A;  1LBY A;  1US4 A;  1FQD A;  5KDT B;  4GL8 A;  1LBW A;  2XXR A;  1QKB A;  1M5E A;  2DOJ A;  3RT8 A;  4OQO A;  1USY H;  4X04 A;  4BDO A;  4C0R A;  3FZV A;  4YZZ A;  3O6I A;  3UP9 A;  3TEP A;  3MQ9 A;  3KBR A;  2V4C A;  2FA7 A;  5IAI A;  4EQ9 A;  3T22 A;  3LUY A;  2Y7P A;  3VVD A;  5AA4 B;  2B3B A;  5EYH A;  3IAZ A;  3K4U A;  2QPQ A;  4RJZ A;  2HPG A;  2A5S A;  3IO4 A;  4PAF A;  1MH4 A;  4GX4 A;  3KC1 A;  4RNS A;  3IJX B;  2Q8J A;  2QMX A;  3FD3 A;  4GFR A;  3V83 A;  3QYT A;  1LB8 A;  4RK2 A;  1N7X A;  5EHS A;  3DEL B;  1R1N A;  1WDN A;  1D9Y A;  4N8Y A;  3PV0 E;  3ZS6 A;  2F97 A;  4R6H A;  3V89 B;  2Z8E A;  2UXA A;  4P47 A;  3I3V A;  1MY3 A;  1NNF A;  2Y7K A;  1NMU A;  1ZLQ A;  1P1O A;  2PFZ A;  1Z7M E;  4LVQ A;  1IXI A;  2PYY A;  1ELJ A;  1NUY A;  3GZG A;  3SER A;  4QFN A;  1NV3 A;  3CG1 A;  1MS7 A;  2L5V A;  2D21 A;  5DTB A;  5CMC A;  1Y9U A;  4GWZ A;  1II5 A;  4QHQ A;  3MPL A;  5EQA A;  4LZ5 A;  2O6A A;  2QS1 A;  2R6G E;  1INP A;  2RC9 A;  4FIM A;  4QFO A;  4QFP A;  5IZ3 B;  2DE4 A;  1Q35 A;  2UVJ A;  1RKM A;  3C31 A;  3MVW A;  5CMK A;  2CZH A;  1Y4T A;  1MQI A;  4OVR A;  1USY E;  3V8X B;  3TQL A;  2OWS A;  1H76 A;  2WKY A;  4NED A;  2KR0 A;  3FJ7 A;  3OEM A;  2DVZ A;  1NKX A;  3KSJ A;  4OET A;  4OEN A;  3K6X A;  3A29 A;  3T1B A;  5H8N A;  1VFE A;  2HQ0 A;  5IM2 A;  1NNP A;  4GL0 A;  2VT5 A;  4OEU A;  1FBF A;  4YB7 A;  2O7I A;  4DXB A;  4MCO A;  2BJJ X;  4HTG A;  2FBP A;  3C4M A;  4R2F A;  1ZBM A;  5DEX B;  4P8B A;  4HW8 A;  1URD A;  3RPL A;  2XXV A;  3IFC A;  3FV1 A;  1SPI A;  1BTJ A;  1QUJ A;  5TP9 B;  3T9X B;  5A5X B;  1B4H A;  1BP5 A;  5I84 A;  4GX3 A;  4IY5 A;  5FTH A;  1FTL A;  3ONM A;  5H8H B;  3QXM A;  3ZKK A;  1B3L A;  2OBG A;  3CSB A;  2WX9 A;  3IX1 A;  4IO3 A;  3K0V A;  3TDJ A;  1LBX A;  1FTM A;  4IO2 A;  4JBZ A;  1LAG E;  3ROJ A;  3V5A A;  5KCJ B;  1NI9 A;  1EYJ A;  4ZEK A;  3S9L C;  1MXX A;  1JEU A;  1FQF A;  2DDK A;  4BDM A;  2QVV A;  3LC8 A;  3IR1 A;  1P1N A;  4MNP A;  3K1M A;  5ET5 A;  5I59 B;  3K02 A;  1WOD A;  2Y5K A;  3D4C A;  1L5T A;  2DYX A;  2B65 A;  1Z7N E;  3CI8 A;  1LFI A;  1B5J A;  1NH7 A;  4HE1 A;  4QSC A;  4Z0I A;  4JSD A;  5DVI A;  1VR5 A;  2O1M A;  4PGN A;  1AL3 A;  3RGY A;  3T0J A;  1D9Q A;  2V3U A;  4AS5 A;  3S9N C;  4TOZ A;  3LSX A;  3HO7 A;  1FQB A;  1DSN A;  2Y7W A;  5FHN A;  3FXQ A;  2FIE A;  3LBS A;  3RTF B;  2VD2 A;  2CEY A;  3E4R A;  3MAM A;  3VXB A;  1NV7 A;  3CFL A;  1OVB A;  2Q9T A;  3KEI A;  5ICQ A;  1H45 A;  5ICT A;  2UVH A;  5DYH A;  1LCT A;  5I57 B;  1A54 A;  4ELQ A;  1YCJ A;  1FSA A;  1S50 A;  1FJ6 A;  1SI1 A;  1MH3 A;  2F78 A;  5I58 A;  4AB5 A;  2ZYN A;  1N3X A;  2V3Q A;  2I48 A;  4GWO A;  3O29 A;  4PTK A;  4EXK A;  3PPN A;  4NF4 B;  3TMG A;  4NX1 A;  3CRB A;  5I5P A;  2DWA A;  3EHS A;  4IGR A;  3CSG A;  1UTH B;  3VVF A;  1GVC A;  3O2A A;  3SEW A;  4LAT A;  1FTO A;  3H06 B;  2FHY A;  3VFJ A;  4DI4 B;  2XXI A;  3FVG A;  1HSJ A;  3OXN A;  1Q1K A;  1FW0 A;  4G77 A;  4NTL A;  5CBR A;  3HHG A;  4GWW A;  4KQP A;  2Y7I A;  1A8E A;  4TLM B;  3FJM A;  2VHA A;  3KSX A;  2G93 A;  3QSL A;  3E78 A;  2ONR A;  2DP8 A;  4H8J A;  4IO6 A;  4MX6 A;  2WYK A;  4Q0C A;  2H9B A;  3LSF B;  2R71 A;  1FTJ A;  3BFT A;  4PFW A;  1NL5 A;  1IME A;  3H7M A;  4NF0 A;  5FTI A;  3N6U A;  2FIX A;  1B6H A;  4P0G A;  3MVZ A;  4GBW A;  5L9M A;  4MJO A;  4DCX A;  4NF8 B;  1B5I A;  3NOH A;  2Q8M A;  4LQ5 A;  2DWI A;  4NF6 A;  2X26 A;  1IXC A;  1IMB A;  1Y3P A;  3OD7 A;  5CMM A;  3EF7 A;  3BIH A;  2XD2 A;  1SQY A;  5DW8 A;  2UVI A;  1FTA A;  2XXH A;  1LBZ A;  2XX9 A;  4OVJ A;  2Z22 A;  1B0L A;  2F3D A;  4YKI A;  2WEF A;  1VFD A;  1QUI A;  5EQ8 A;  3T9V A;  1FBE A;  3FAT A;  5I2K A;  4N6K A;  2F8D A;  3A3U A;  1SVX B;  4C1T A;  4OZ9 A;  1LFG A;  1CB6 A;  1S7Y A;  2MKZ A;  2OZZ A;  3OOA A;  1JW1 A;  3IFA A;  3N5L A;  3TTR A;  1OQH A;  1B7Z A;  2XXX A;  4N17 A;  3CIJ A;  4G8H A;  2XXQ A;  3RQT A;  2XHD A;  4PP0 A;  3DM0 A;  1B1X A;  3L6G A;  1EZP A;  4ZZA A;  4U23 A;  5LTC A;  4PFI A;  4R6K A;  4ZS9 A;  1SYI A;  1JET A;  3KZG A;  5TPA A;  4TQU Q;  2NVU B;  4F29 A;  2QSX A;  3B8B A;  3IJO B;  1FCK A;  1NV4 A;  1NNT A;  5DVF A;  1I6Q A;  1MXW A;  1POY 1;  1A55 A;  2VPN A;  1P1W A;  4JB7 A;  3KGC A;  3PMV A;  4JVD A;  2QFL A;  1JVY A;  2XWI A;  4QXD A;  4GBV A;  1PB9 A;  2RIN A;  3VDF A;  3SEU A;  2NOO A;  4PAI A;  2RF1 A;  3T93 B;  1YXI A;  1BLF A;  1TT1 A;  2G29 A;  3ZSF A;  2LAO A;  4F3S A;  4N13 A;  5EQ9 A;  1XT8 A;  4TLL B;  3UOR A;  1IMC A;  3R26 A;  3U1O A;  1FPD A;  3RT6 B;  5I7I A;  3N94 A;  1SW1 A;  3H3G A;  3Q27 A;  4I62 A;  3S2V A;  3ODB A;  3THI A;  1MPC A;  1FRP A;  4U1O A;  2GQ1 A;  2KLF A;  1QGX A;  3QIM A;  1IIT A;  4YB5 A;  3QAX A;  4LZ7 A;  3HN0 A;  1Y3Q A;  1MXY A;  2DXY A;  3OEK A;  1N3W A;  4MLQ A;  3RN8 A;  4I1D A;  4KR5 A;  2I4B A;  4GOT A;  4OYV A;  1EZ9 A;  4NF5 A;  4GF8 A;  4FEB A;  1TFD A;  1IQ7 A;  1M5B A;  4PE3 A;  4BLA A;  5IZ1 A;  3IB0 A;  5M2V A;  1ATG A;  4PFB A;  3S4U A;  4L17 A;  4F2O A;  1IMD A;  4XKN A;  1XI6 A;  2F3B A;  4H0W A;  2PFY A;  4X48 A;  3B7D A;  4U22 A;  3E3K A;  5F24 A;  2XXP A;  3PUY E;  3TAJ A;  1BK4 A;  2D3I A;  4HCW A;  4OES A;  4XKR A;  3FAS A;  3PMW A;  3B6T A;  3Q25 A;  2V93 A;  1QW0 A;  4XTC Q;  2ZXT A;  3FXU A;  4RXL A;  1EYK A;  3Q26 A;  4JVI A;  4QFK A;  1DBZ A;  2XXY A;  1LLS A;  3M3L A;  1KA1 A;  1MPD A;  1FBP A;  3U94 A;  1POT A;  4OER A;  3SEX A;  2IA4 A;  3MW0 A;  4QFL A;  2QJE A;  2V3T A;  4P1L A;  4YKJ A;  2AL4 A;  3L6H A;  3GLB A;  5H8Q A;  1MQJ A;  3Q29 A;  4GLI A;  3IB1 A;  4FEC A;  1B4Z A;  3DP6 A;  4OVS A;  4EF1 A;  2AYS A;  3GXA A;  4HS7 A;  3PUZ E;  4MHF A;  2I4C A;  4PF8 A;  5JTY B;  5ET7 A;  4R74 A;  5CC2 A;  1Y20 A;  2PVU A;  3JZJ A;  4F1V A;  5ELV A;  4G68 A;  2A5T B;  1S9T A;  1R9L A;  3MZB A;  1OQG A;  3W9W A;  4R2B A;  3RPL B;  1MY1 A;  1WVJ A;  4EUO A;  2E0S A;  2B4L A;  1XHY A;  4KFQ A;  5CI5 A;  3VLW A;  5H8S A;  2DXR A;  1JW4 A;  4NWC A;  5KDT A;  1RYO A;  3PGF A;  2ZZX A;  3H6V A;  1SW2 A;  1YPN A;  2WBD A;  3K6U A;  2DE3 A;  4H45 A;  2REG A;  1FPI A;  2ABH A;  4NG7 A;  4G68 C;  4P1E A;  1LGB C;  5AA4 A;  5J16 A;  1VE4 A;  4PAK A;  3KBZ A;  1NH8 A;  1RDY A;  2P2A A;  4EF2 A;  1PDA A;  2AL5 A;  1I6B A;  4AQ4 A;  5F7V A;  4OVP A;  3EKI A;  1NV1 A;  5JK4 A;  1IZ1 A;  2HXR A;  1FBC A;  4O3B A;  4BDQ A;  4YKK A;  4FAJ A;  1UIU A;  3H6T A;  4H5F A;  4AS4 A;  3G3J A;  1SBP A;  1EH3 A;  1OIB A;  1ZMG A;  2XWK A;  1D9V A;  4R9G A;  4YAH X;  5ET8 A;  1B52 A;  1YAE A;  4JWO A;  5LOM A;  3IL1 B;  1MPB A;  1UTB A;  1QUL A;  3TZA A;  3KN7 A;  1OLC A;  2DQV A; 
#chains in the Genus database with same CATH homology
 4DLD A;  3UN6 A;  4U21 A;  3SET A;  1Y3N A;  2X7P A;  4M4G A;  2IEE A;  2CMO A;  3OSQ A;  4YMB A;  4MLV A;  1P1Q A;  3TOD A;  4RYA A;  4FED A;  2ZMB A;  3M8U A;  4XXU A;  4OWD A;  3R6U A;  4R72 A;  2DE2 A;  3HST A;  2Y7R A;  4H6D A;  1N04 A;  1B1H A;  4MBP A;  3UA8 A;  5AA3 A;  2H99 A;  3DP4 A;  1ZU0 A;  3KN8 A;  4DXC A;  3PPR A;  1JVX A;  5I58 B;  2VOZ A;  3MZ1 A;  4ELP A;  1TWY A;  2XX8 A;  1B58 A;  3EN3 A;  4ISU A;  3S9M C;  2F34 A;  2XXW A;  3LR1 A;  4E0X A;  4YMA A;  3A3C A;  3OO8 A;  2W7Y A;  3ILU B;  5I56 A;  1D4N A;  1MXU A;  4THI A;  2XXT A;  3A09 A;  2HCA A;  4IO7 A;  3W15 C;  4ZEB A;  3IOR A;  1ZIU A;  1QJM A;  1GV8 A;  1R6Z A;  3GBA A;  5DEX A;  5K2X A;  4P11 A;  4NWD A;  2Q88 A;  1SW5 A;  4U1Z A;  4WED A;  4OTE A;  5CBS A;  1I69 A;  4JSO A;  2HFB A;  4ND9 A;  1O64 A;  3U93 A;  1XVY A;  4WKM A;  1MXV A;  4UAC A;  4K3F A;  3H4Z A;  2O51 A;  2OCU A;  2O84 X;  4NF6 B;  1LBB A;  2XXU A;  3FVK A;  4JWX A;  3C33 A;  1XC1 A;  3CR9 A;  3QUF A;  2GFE A;  2ZYK A;  1D3K A;  3I6V A;  3KN3 A;  2UYE A;  5HPQ A;  4R9F A;  4ZE9 A;  4U4X A;  1B05 A;  1PB7 A;  5EHM A;  3TTK A;  3IK6 B;  1M5F A;  5B7D A;  3DP8 A;  1KWH A;  5I2K B;  1N0T A;  3USD A;  1UIV A;  2F6G A;  5I59 A;  1QKA A;  2PT2 A;  4EDP A;  4BDL A;  4ESW A;  4H67 A;  4PET A;  2V84 A;  5F1Q A;  1MQH A;  3TFL A;  4GQO A;  3VV5 A;  1B3F A;  4F3G A;  3CG3 A;  4AB6 A;  3KJT A;  3B6W A;  3OEN A;  3IO6 A;  5L9S A;  1OMP A;  1F9B A;  1PBQ A;  5IKB A;  1A8F A;  4KHZ E;  2QMW A;  1B9J A;  4N6P A;  1H44 A;  3ECR A;  5H8F A;  4OFJ A;  3RPW A;  1A99 A;  5KZT A;  4BDN A;  2I0C A;  3PUX E;  4MFI A;  4OXV A;  5I57 A;  3G3G A;  4Q30 B;  3UK4 A;  2OJT A;  3AXF A;  3MPK A;  4NF4 A;  2UYF A;  4RPO A;  4IY6 A;  5I2N B;  2RCA A;  3FV2 A;  1B46 A;  5AA2 B;  4ZED A;  1QUK A;  3O66 A;  4R73 A;  2I49 A;  1R9Q A;  1HSL A;  2ONK E;  4ZEC A;  3T9U A;  3BBR A;  3VLU A;  4H1X A;  4O3A A;  1DPE A;  3TYH A;  4F31 B;  3TCF A;  4EXL A;  4KD5 A;  3IOU A;  5BWJ A;  3EQ1 A;  1DMB A;  2I3V A;  4JXI A;  1JEV A;  3HCQ A;  4X1D A;  3R7X A;  1IIW A;  4H8I A;  4PFY A;  3TUS A;  1FTK A;  1H3D A;  5L8D A;  4NMY A;  2V25 A;  1B2H A;  4YU0 A;  4LA9 A;  4ONY A;  4G8M A;  2D5W A;  1LCF A;  3M3F A;  4U4S A;  3IOT A;  3EHU A;  4PFU A;  1B5H A;  3U8Q A;  3S9E A;  2XD3 A;  1B7H A;  3VVE A;  2H4I A;  2FYI A;  4LUB A;  2O68 A;  4KI0 E;  2NWJ A;  2OWT A;  1IEJ A;  2HXW A;  2PX1 A;  3IOV A;  1IXH A;  2M8C A;  2H25 A;  3CVG A;  4POW A;  1LAX A;  1N7W A;  3TQW A;  2Q89 A;  4R75 A;  1AIV A;  1B51 A;  1I6A A;  2Z23 A;  3FVO A;  1US5 A;  4XIG Q;  4GXS B;  4FOR A;  4C1U A;  3K00 A;  4G68 B;  2E1S A;  1XS5 A;  4FE8 A;  2ESN A;  4GVO A;  3MP6 A;  2ONS A;  1TXF A;  2ZNU A;  2RC8 A;  3C36 A;  4LZ8 A;  2THI A;  3K1N A;  4R6Y A;  4POX A;  3Q28 A;  1FQC A;  3C35 A;  1N76 A;  1DPP A;  4ZEF A;  3TTM A;  4GXA A;  5AA1 A;  4Z7E A;  1LBC A;  1B0H A;  2RC7 A;  4PQJ A;  3KOT A;  4F2Q A;  3PUW E;  1DOT A;  3KJ7 A;  2F7C A;  4I9D A;  3LSW A;  3VE1 B;  2QS2 A;  4ELR A;  1LAF E;  3TPA A;  4F18 A;  3PPQ A;  1N84 A;  4ZEI A;  5H8N B;  1MRP A;  1LST A;  3PD9 A;  1FQA A;  3BKI B;  1IXG A;  5CRY A;  2QL3 A;  2QS4 A;  3PD8 A;  2Z8F A;  1EZO A;  4F22 A;  2F6P A;  3IOW A;  1IUD A;  3G3F A;  3O28 A;  4DCY A;  4F3B A;  5J1D A;  1UTB B;  4N07 A;  3RLF E;  3BFU A;  3MBP A;  3IB2 A;  2HAU A;  1SYH A;  3T9H B;  3K1P A;  4QSD A;  3SES A;  1PBP A;  1JNF A;  3CFZ A;  3E9X A;  1B7U A;  3RY3 A;  3C34 A;  4H5G A;  2Q2C A;  2F7A A;  3FIR A;  3H6W A;  5K2Y A;  3G7W A;  4QSE A;  3KFM A;  3WAE A;  1ZTY A;  5L9O A;  1MDP 1;  4KCC A;  3PPP A;  3D4G A;  2ZNS A;  3MWB A;  3MC2 A;  1PC3 A;  2F36 A;  5B70 A;  1EU8 A;  1AOV A;  3MZ9 A;  1UQW A;  3GBB A;  1MY0 A;  1JQF A;  1MQG A;  4IGT A;  1B3G A;  3VLV A;  5JTY A;  2Z8D A;  3KG2 A;  1OLA A;  2PT1 A;  3U72 A;  5I56 B;  2QS3 A;  4ZZE A;  1J1N A;  1LAH E;  4JDF A;  2I0B A;  2GHA A;  2RCB A;  2A5T A;  3T96 B;  4X1B A;  3UIF A;  4G2Z A;  2P0S A;  4RY1 A;  3U92 A;  5BUU A;  4WXJ A;  1OVT A;  3MJN A;  1URG A;  1SI0 A;  2YLN A;  3KOS A;  4HCY A;  1O7T A;  2HAV A;  5DVJ A;  1XVX A;  3MVX A;  4GRK A;  3JV9 A;  1AMF A;  3W9V A;  5FHO A;  3TCH A;  1Y1M A;  1MQD A;  1YTV A;  3H03 A;  3LSL A;  1MY2 A;  1LFH A;  2Q2A A;  3G3H A;  1MM6 A;  4UA8 A;  1O63 A;  4XKQ A;  4Q5T A;  2I3W A;  3E13 X;  3JYR A;  4E0W A;  4WEP A;  4KCD A;  3K01 A;  1GR2 A;  3OMB A;  1CE2 A;  5EYF A;  2O7U A;  2VD3 A;  4M1V A;  2F7B A;  2HEU A;  2NUV A;  2X7Q A;  5HBC A;  4IO4 A;  3HPI A;  2UVG A;  4GIZ A;  1NNK A;  1T0K A;  4OFL A;  2VP1 A;  1A7L A;  3RNN A;  4ECF A;  4IB2 A;  4EQB A;  3EHT A;  4OMB A;  4MH5 A;  5TP9 A;  4OEV A;  5CM6 A;  4F1Y A;  5A5X A;  4ZDM A;  3OEL A;  2CZL A;  5H8H A;  5H8F B;  1ANF A;  1PEB A;  1VSO A;  5AA2 D;  2QRY A;  3DLN A;  4YB6 A;  1B3E A;  2DS9 A;  4DIG A;  5KCJ A;  4ELO A;  1NFT A;  2ZYO A;  4LQ2 A;  1B40 A;  3PUV E;  3TTL A;  2Y84 A;  2O69 A;  3C9H A;  1DTZ A;  4BDR A;  3N26 A;  3EPE A;  3G3I A;  2VGQ A;  3TKD A;  4Q8R A;  4PE5 B;  4U2R A;  4P0I A;  3OO6 A;  4DZ1 A;  1A40 A;  1BKA A;  2YJP A;  1URS A;  1MM7 A;  1B32 A;  5ITP A;  3PPO A;  3HV1 A;  3SKP A;  4FAT A;  1MDQ A;  3OSR A;  4I8C A;  1PB8 A;  3ZKL A;  4KYS A;  1Y1Z A;  1LB9 A;  3MP1 A;  5TPA B;  4KYE A;  3TEL A;  3CFX A;  4DE8 A;  3G3K A;  1M5D A;  1Y4C A;  1M5C A;  3O9P A;  1HSE A;  3FGS A;  3SEV A;  2DVC A;  2DSF A;  3H6U A;  5DT6 A;  4G8N A;  2YPN A;  4EQ7 A;  4G4P A;  4IO5 A;  4KPT A;  1ZJL A;  2H98 A;  4O3C A;  4JWY A;  5TU0 A;  2O1L A;  2OK2 A;  2ZNT A;  4X9T A;  4F1U A;  2RKM A;  3PU5 A;  1AH5 A;  2HZL A;  4RK9 A;  2F35 A;  4QF9 A;  3HHF A;  1P1U A;  4DXU A;  1UTH A;  3TTN A;  3OO9 A;  3K6W A;  4QRZ A;  1H43 A;  1XOC A;  2R9J A;  1MY4 A;  3MUQ A;  3O6G A;  5HM4 B;  1SD3 A;  4OHN A;  2I58 A;  1BIY A;  3N6T A;  4F39 A;  3MP8 A;  4MF3 A;  3I5O A;  3T66 A;  4XKP A;  4GD5 A;  2ZYM A;  2H5Y A;  3P7I A;  4PFT A;  3VXC A;  4OFO A;  3K2D A;  1SDX A;  2F5X A;  3O97 A;  4LON B;  3RTW B;  1P99 A;  2AIX A;  4F3P A;  2GRV A;  3M3K A;  4NF5 B;  2PBW A;  4ESX A;  3FXR A;  2P1S A;  4NF8 A;  3TCG A;  4NE4 A;  1JW5 A;  4LP2 B;  1B3H A;  5ISU A;  1FQE A;  2I6E A;  1GGG A;  3ILT B;  3B6Q A;  2DWJ A;  3SEY A;  3SDF A;  3FVN A;  2HZK A;  1TFA A;  3K6V A;  3O6H A;  1ZKB A;  3PMX A;  4RA1 A;  4RPN A;  1DTG A;  2OLB A;  2B3F A;  3MVY A;  3UGW A;  4H65 A;  5I2N A;  2GH9 A;  4FJP A;  2FNC A;  4DDD A;  2GHB A;  5H8Q B;  5AE4 A;  1GTK A;  1SW4 A;  3C32 A;  3FUZ A;  4KYD A;  1MXZ A;  5ITO A;  1QVS A;  3QUJ A;  3QK6 A;  5AA2 A;  2PMS A;  1RYX A;  3RUM A;  2NXO A;  2REJ A;  4YKP A;  4ZE8 A;  1MG1 A;  5CMB A;  4YIC A;  3OO7 A;  2ALU A;  2XX7 A;  5FHM A;  3FJG A;  2DWH A;  2ANJ A;  3WAF A;  4F19 A;  3F11 A;  5JEI A;  1US4 A;  1FQD A;  5KDT B;  4GL8 A;  2XXR A;  1QKB A;  1M5E A;  2DOJ A;  3RT8 A;  4OQO A;  1USY H;  4BDO A;  4C0R A;  3FZV A;  4YZZ A;  3O6I A;  3UP9 A;  3TEP A;  3MQ9 A;  3KBR A;  2FA7 A;  5IAI A;  4EQ9 A;  3T22 A;  3LUY A;  2Y7P A;  3VVD A;  5AA4 B;  2B3B A;  3IAZ A;  3K4U A;  2QPQ A;  4RJZ A;  2A5S A;  3IO4 A;  1MH4 A;  4RNS A;  3IJX B;  2Q8J A;  2QMX A;  3FD3 A;  4GFR A;  3V83 A;  3QYT A;  1LB8 A;  4RK2 A;  1N7X A;  5EHS A;  3DEL B;  1R1N A;  1WDN A;  1D9Y A;  3PV0 E;  3ZS6 A;  2F97 A;  4R6H A;  3V89 B;  2Z8E A;  2UXA A;  3I3V A;  1MY3 A;  1NNF A;  2Y7K A;  1NMU A;  1ZLQ A;  1P1O A;  1Z7M E;  4LVQ A;  1IXI A;  2PYY A;  1ELJ A;  3GZG A;  3SER A;  4QFN A;  3CG1 A;  1MS7 A;  2D21 A;  5DTB A;  5CMC A;  1Y9U A;  1II5 A;  4QHQ A;  3MPL A;  4LZ5 A;  2O6A A;  2QS1 A;  2R6G E;  2RC9 A;  4FIM A;  4QFO A;  4QFP A;  2DE4 A;  1Q35 A;  2UVJ A;  1RKM A;  3C31 A;  3MVW A;  5CMK A;  1Y4T A;  1MQI A;  1USY E;  3V8X B;  3TQL A;  2OWS A;  1H76 A;  2WKY A;  4NED A;  3FJ7 A;  3OEM A;  2DVZ A;  1NKX A;  3KSJ A;  4OET A;  4OEN A;  3K6X A;  5H8N A;  1VFE A;  2HQ0 A;  1NNP A;  4GL0 A;  4OEU A;  4YB7 A;  4DXB A;  2O7I A;  2BJJ X;  4HTG A;  3C4M A;  4R2F A;  1ZBM A;  5DEX B;  4HW8 A;  1URD A;  2XXV A;  3FV1 A;  1BTJ A;  1QUJ A;  5TP9 B;  3T9X B;  5A5X B;  1B4H A;  1BP5 A;  5I84 A;  4IY5 A;  5FTH A;  1FTL A;  3ONM A;  5H8H B;  3QXM A;  3ZKK A;  1B3L A;  2OBG A;  3CSB A;  3IX1 A;  4IO3 A;  3K0V A;  3TDJ A;  1FTM A;  4IO2 A;  4JBZ A;  1LAG E;  3V5A A;  5KCJ B;  4ZEK A;  3S9L C;  1MXX A;  1JEU A;  1FQF A;  4BDM A;  3LC8 A;  3IR1 A;  1P1N A;  3K1M A;  5I59 B;  3K02 A;  1WOD A;  3D4C A;  1L5T A;  2DYX A;  2B65 A;  1Z7N E;  3CI8 A;  1LFI A;  1B5J A;  1NH7 A;  4QSC A;  4Z0I A;  4JSD A;  5DVI A;  1VR5 A;  2O1M A;  1AL3 A;  3RGY A;  2V3U A;  3S9N C;  4TOZ A;  3LSX A;  3HO7 A;  1FQB A;  1DSN A;  2Y7W A;  5FHN A;  3FXQ A;  3LBS A;  3RTF B;  2VD2 A;  3E4R A;  3MAM A;  3VXB A;  3CFL A;  1OVB A;  2Q9T A;  3KEI A;  5ICQ A;  1H45 A;  5ICT A;  2UVH A;  5DYH A;  1LCT A;  5I57 B;  1A54 A;  4ELQ A;  1YCJ A;  1S50 A;  1SI1 A;  1MH3 A;  2F78 A;  5I58 A;  4AB5 A;  2ZYN A;  1N3X A;  2V3Q A;  2I48 A;  4GWO A;  3O29 A;  4EXK A;  3PPN A;  4NF4 B;  3TMG A;  3CRB A;  2DWA A;  3EHS A;  4IGR A;  3CSG A;  1UTH B;  3VVF A;  1GVC A;  3O2A A;  3SEW A;  4LAT A;  1FTO A;  3H06 B;  3VFJ A;  2XXI A;  3FVG A;  1HSJ A;  3OXN A;  1Q1K A;  1FW0 A;  4G77 A;  4NTL A;  5CBR A;  3HHG A;  4KQP A;  2Y7I A;  1A8E A;  4TLM B;  3FJM A;  2VHA A;  3KSX A;  2G93 A;  3QSL A;  2ONR A;  2DP8 A;  4H8J A;  4IO6 A;  4Q0C A;  2H9B A;  3LSF B;  2R71 A;  1FTJ A;  3BFT A;  4PFW A;  1NL5 A;  3H7M A;  5FTI A;  3N6U A;  1B6H A;  4P0G A;  3MVZ A;  5L9M A;  4DCX A;  4NF8 B;  1B5I A;  4LQ5 A;  2DWI A;  4NF6 A;  2X26 A;  1IXC A;  3OD7 A;  1Y3P A;  5CMM A;  3EF7 A;  2XD2 A;  1SQY A;  2UVI A;  2XXH A;  2XX9 A;  4OVJ A;  2Z22 A;  1B0L A;  4YKI A;  1VFD A;  1QUI A;  3T9V A;  3FAT A;  5I2K A;  2F8D A;  3A3U A;  1SVX B;  4C1T A;  4OZ9 A;  1LFG A;  1CB6 A;  1S7Y A;  2OZZ A;  3OOA A;  1JW1 A;  3N5L A;  3TTR A;  1OQH A;  1B7Z A;  2XXX A;  3CIJ A;  4G8H A;  2XXQ A;  3RQT A;  2XHD A;  4PP0 A;  3DM0 A;  1B1X A;  3L6G A;  1EZP A;  4ZZA A;  4U23 A;  4R6K A;  4ZS9 A;  1SYI A;  1JET A;  3KZG A;  5TPA A;  4TQU Q;  2NVU B;  4F29 A;  2QSX A;  3IJO B;  1FCK A;  1NNT A;  5DVF A;  1I6Q A;  1MXW A;  1POY 1;  1A55 A;  1P1W A;  4JB7 A;  3KGC A;  3PMV A;  1JVY A;  1PB9 A;  2RIN A;  3VDF A;  3SEU A;  2NOO A;  2RF1 A;  3T93 B;  1BLF A;  1TT1 A;  2G29 A;  3ZSF A;  2LAO A;  4F3S A;  4N13 A;  1XT8 A;  4TLL B;  3UOR A;  3R26 A;  3U1O A;  3RT6 B;  3N94 A;  1SW1 A;  3H3G A;  3Q27 A;  4I62 A;  3S2V A;  3ODB A;  3THI A;  1MPC A;  4U1O A;  2KLF A;  3QIM A;  1IIT A;  4YB5 A;  3QAX A;  4LZ7 A;  3HN0 A;  1Y3Q A;  1MXY A;  2DXY A;  3OEK A;  1N3W A;  4MLQ A;  3RN8 A;  4I1D A;  4KR5 A;  2I4B A;  4GOT A;  4OYV A;  1EZ9 A;  4NF5 A;  4GF8 A;  4FEB A;  1TFD A;  1IQ7 A;  1M5B A;  4BLA A;  3IB0 A;  5M2V A;  1ATG A;  3S4U A;  4L17 A;  4F2O A;  4XKN A;  4H0W A;  4X48 A;  3B7D A;  4U22 A;  3E3K A;  2XXP A;  3PUY E;  3TAJ A;  2D3I A;  4HCW A;  4OES A;  4XKR A;  3FAS A;  3PMW A;  3B6T A;  3Q25 A;  2V93 A;  1QW0 A;  4XTC Q;  2ZXT A;  3FXU A;  4RXL A;  3Q26 A;  4QFK A;  2XXY A;  1LLS A;  3M3L A;  1MPD A;  3U94 A;  1POT A;  4OER A;  3SEX A;  2IA4 A;  3MW0 A;  4QFL A;  2QJE A;  2V3T A;  4YKJ A;  2AL4 A;  3L6H A;  3GLB A;  5H8Q A;  1MQJ A;  3Q29 A;  4GLI A;  3IB1 A;  4FEC A;  1B4Z A;  3DP6 A;  4EF1 A;  2AYS A;  3GXA A;  4HS7 A;  3PUZ E;  2I4C A;  5JTY B;  4R74 A;  5CC2 A;  1Y20 A;  2PVU A;  3JZJ A;  4F1V A;  5ELV A;  4G68 A;  2A5T B;  1S9T A;  1R9L A;  3MZB A;  1OQG A;  3W9W A;  4R2B A;  1MY1 A;  1WVJ A;  4EUO A;  2E0S A;  1XHY A;  4KFQ A;  5CI5 A;  3VLW A;  5H8S A;  2DXR A;  1JW4 A;  4NWC A;  5KDT A;  1RYO A;  3PGF A;  3H6V A;  1SW2 A;  1YPN A;  3K6U A;  2DE3 A;  2REG A;  2ABH A;  4G68 C;  1LGB C;  5AA4 A;  1VE4 A;  1NH8 A;  2P2A A;  4EF2 A;  1PDA A;  2AL5 A;  1I6B A;  4AQ4 A;  5F7V A;  5JK4 A;  1IZ1 A;  4O3B A;  4BDQ A;  4YKK A;  4FAJ A;  1UIU A;  3H6T A;  4H5F A;  3G3J A;  1SBP A;  1EH3 A;  1OIB A;  1ZMG A;  1D9V A;  4R9G A;  4YAH X;  1B52 A;  1YAE A;  4JWO A;  5LOM A;  3IL1 B;  1MPB A;  1UTB A;  1QUL A;  3TZA A;  3KN7 A;  1OLC A;  2DQV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...