4ZZAA

Raffinose and panose binding protein from bifidobacterium animalis subsp. lactis bl-04, bound with raffinose, selenomethionine derivative
Total Genus 122
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
122
sequence length
380
structure length
364
Chain Sequence
VTLDFFQFKAEAADWFKQAAQEFEKENPDIRININRVPDVITFNGDYSFGTFAASGVFHDFTDDPLVSELNEGMVNIAKNLVQTSDPAKKRLYGLPFAGNASGYIYNKDLFRKVGLDPDNPPQTWDEFIAMLKKFRDAGINPVQATLADAWTTQAPLASLAGTLVPESEYAALKSGDTTFKQIWTEPIEKEIELFKYADSEKGVTYQQGTQNFAKGTAAIIPLGTYAIPQITMVNKDIDLGFAQMPATNDASKQILTAGDDVILTMGANSRHKEQSMRFIRFLMSKKQLENYADAQSAITPLKETYFGNKALEPVRPFFESNRVADFCDHYIPSSINIGGYLQSAIMSGNVNQFIDSMQNEWNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar binding protein of ABC transporter system
publication title An ATP Binding Cassette Transporter Mediates the Uptake of alpha-(1,6)-Linked Dietary Oligosaccharides in Bifidobacterium and Correlates with Competitive Growth on These Substrates.
pubmed doi rcsb
source organism Bifidobacterium animalis subsp. lactis bl-04
molecule tags Transport protein
total genus 122
structure length 364
sequence length 380
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zzaA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4zzaA02
4F3GA 1MY0A 3VXCA 1QKAA 1LFGA 4OFJA 3RTWB 3FVGA 3IL1B 2PMSA 4F1YA 3KOTA 1N0TA 3PD8A 2ONSA 4PFUA 3S2VA 3CFZA 1B05A 2R71A 3RLFE 3LUYA 2QMWA 1XT8A 1MM7A 1HSLA 2DOJA 3FVOA 4YMAA 1B3EA 1Z7NE 1ZMGA 5CMBA 3MUQA 4PP0A 5ISUA 1SW5A 3O66A 3MPKA 4AB6A 1QJMA 4MLVA 4EXLA 3QIMA 4XKQA 3TCGA 3VVDA 5DT6A 3C36A 2I4BA 1XS5A 2RCAA 4QFLA 3S9NC 2NOOA 3KSJA 3N6UA 2UYEA 2XXPA 1NL5A 1UTHB 3KFMA 4AQ4A 4O3CA 2V3QA 4IO4A 3G3HA 2ALUA 4P0IA 3U72A 3K2DA 2VGQA 3MJNA 5I84A 4F22A 1QUIA 1A99A 1B3HA 1A55A 2QS4A 3OEMA 1HSJA 3VVEA 2W7YA 2GRVA 4F29A 2RINA 1M5CA 2X7QA 3EF7A 2RC7A 4Z7EA 5CMCA 1T0KA 3CVGA 4OWDA 3R6UA 2E1SA 2ZYOA 3G3IA 4YKJA 3C31A 2D5WA 4FIMA 3ODBA 1SW2A 4TLLB 1GTKA 2B65A 2G29A 3LSLA 3U1OA 3SERA 4GRKA 1JW1A 1AIVA 1B58A 4QFOA 4F31B 4U21A 4JDFA 1N7XA 4YZZA 3FV2A 4H5GA 2Q9TA 1SQYA 3EHUA 4IO3A 4H67A 1O63A 1SYHA 1Y1ZA 5I58A 4POWA 3K01A 4IO7A 4IB2A 4QFPA 2XX9A 2DQVA 3U93A 2AIXA 4FAJA 1JW4A 1VFEA 1UTBA 2ONKE 1AL3A 4YB7A 4YKPA 2Y7WA 3T96B 1OVBA 1LFIA 3ZKLA 3LC8A 4LATA 2NXOA 2V3UA 1EH3A 1IXIA 3FXQA 1I69A 1D3KA 3T9VA 1SW1A 5K2YA 3K1MA 4GXSB 4KYEA 1SI0A 3R7XA 1LSTA 4MFIA 2GFEA 4O3AA 2GHAA 4ESXA 1RYOA 1FQBA 2I4CA 1MQDA 3TFLA 4RXLA 3W9WA 4U23A 2I0CA 5EHMA 1ZIUA 4OTEA 4Q5TA 3ONMA 4OMBA 5CMMA 4EF2A 5JTYA 2UVGA 1FCKA 4NF4B 3C35A 2DWJA 2QS3A 4I62A 1IEJA 1LCFA 3Q29A 3ZKKA 2HZKA 4G8NA 5B70A 2Y7IA 5FTIA 1JEVA 5ITPA 1XOCA 1AMFA 3VV5A 4F2QA 4BDNA 2DE3A 3UP9A 4EQBA 5IAIA 5DEXB 3GBAA 4BDOA 3I3VA 1CB6A 2Q8JA 3FJGA 1P1UA 3W9VA 2PX1A 3V89B 3FZVA 4I1DA 4R75A 3LR1A 1VR5A 1ZKBA 4F2OA 4GFRA 3RT8A 2VD3A 5TU0A 3TODA 4RK9A 4JSDA 4KR5A 1Y3NA 2F35A 3TCHA 3C33A 3HN0A 3RGYA 4DXBA 5I2NA 4ECFA 1B7UA 2DS9A 3DELB 1URSA 4U4SA 1LAGE 3K6VA 2XXWA 4ZEIA 3C4MA 4R9GA 4YU0A 1Y3QA 3SDFA 3UN6A 1Y4TA 3B6QA 4HTGA 1R1NA 1B51A 4TQUQ 1O64A 1LGBC 3H7MA 3BFUA 4LUBA 4P0GA 2Y84A 3TPAA 4QFNA 1YPNA 2Z8EA 3IR1A 3T22A 4KHZE 4EXKA 4NF5A 4ZE9A 2VHAA 5EYFA 4NF8A 3D4GA 1FTMA 1OIBA 1BIYA 2ZYNA 3M3FA 3N26A 1MG1A 3SEXA 1FQCA 1D9VA 4PETA 1MXUA 2QMXA 3KN8A 3Q25A 4R6HA 3H06B 1SW4A 1N04A 4GL0A 4OESA 3MVZA 1S50A 2DWAA 3GLBA 3LSFB 3QYTA 4GIZA 3HHFA 3JYRA 1DTGA 3N94A 3EPEA 4ELQA 1OVTA 2QS2A 2XD2A 5L9OA 3UK4A 2LAOA 3MAMA 4G68C 2REGA 3HCQA 3B6TA 3LSXA 3MZBA 1MS7A 5FTHA 3OO8A 1IITA 3DP6A 5I2NB 4RY1A 3FIRA 4EQ9A 4OYVA 2V93A 3OD7A 4LQ2A 4KYDA 1NNTA 3E13X 2Z8DA 1PBQA 4GOTA 2ANJA 2OWTA 1FTJA 3CSBA 3QSLA 3CG3A 5I59B 3H6VA 1LBCA 1B3LA 2NWJA 3THIA 4NF8B 1MXWA 2XD3A 1IXHA 3K6XA 1TXFA 3GZGA 2XXYA 2I3VA 4YKIA 1MDQA 3OXNA 4L17A 1UTHA 4LQ5A 3RPWA 5AA2D 4ONYA 1QKBA 3FVNA 1SYIA 1F9BA 4KFQA 3PUVE 4QSDA 2XX7A 4E0XA 1MPDA 2H25A 1JQFA 5CI5A 1XHYA 3QXMA 4GVOA 3CRBA 1A8EA 4H65A 1SVXB 4R6KA 1VE4A 3GXAA 4JBZA 2O51A 4DZ1A 2CZLA 4G8MA 3OENA 1B40A 3IB1A 4GQOA 5TP9B 4ZEBA 1O7TA 2RF1A 2A5SA 4DXCA 1NH7A 5DVIA 2XXTA 2HCAA 1NH8A 3DP8A 4WEPA 5DYHA 1I6BA 1MQJA 1B52A 3IK6B 4JXIA 5A5XB 1B9JA 5FHNA 5F7VA 3T9XB 5L9MA 1LCTA 3O2AA 2E0SA 1H45A 3QK6A 3KJ7A 3JZJA 1IIWA 3H6WA 3O6HA 2Q88A 3WAEA 5BWJA 5H8QB 1N84A 4Q0CA 2HXWA 1BP5A 2XXRA 2F34A 3G7WA 1AOVA 1UIUA 4LP2B 1ZTYA 2YLNA 1Q1KA 2OBGA 2WKYA 2DVZA 2F78A 3KZGA 4G8HA 4M4GA 2ZNTA 4F1VA 4FJPA 2I6EA 1S9TA 3O6IA 3PUWE 3F11A 1MQIA 1UQWA 1B7ZA 3TZAA 2F97A 5KCJB 1DPPA 2QSXA 4N07A 5ICTA 3D4CA 4RJZA 2PT2A 3QAXA 4F3SA 3UIFA 1ZU0A 4U1ZA 4FATA 1PB9A 3SEWA 2XXUA 4NF4A 5AA4A 3MW0A 4ZEKA 1JVYA 2V3TA 1NNPA 3A3UA 1XC1A 3FJ7A 3O6GA 2VD2A 3FASA 1FQFA 5KZTA 3S9LC 2HAUA 4C1TA 4ELPA 4OERA 1ELJA 2DWHA 4XKRA 3HPIA 4IGTA 4WEDA 3BFTA 3MVXA 4IO2A 1JNFA 1YAEA 3MZ1A 5DEXA 4LONB 4ESWA 3CSGA 3Q26A 4PFWA 4EQ7A 3M3KA 1DTZA 1B6HA 2F36A 5HM4B 4EDPA 5KDTA 4DCXA 3PPQA 2O84X 3DP4A 2OZZA 4OFOA 4C0RA 1TT1A 1D9YA 1II5A 4I9DA 1US4A 1EZOA 3G3KA 4KCDA 4JWYA 3IJXB 1DPEA 4OEVA 3G3FA 2REJA 1BLFA 2ZYMA 2XHDA 3OEKA 3R26A 2QL3A 1B7HA 4RA1A 5AA3A 3PPPA 1SDXA 3TCFA 3O28A 3EN3A 4FE8A 4XXUA 2QPQA 4Q30B 1M5FA 4RK2A 5ITOA 1US5A 1Q35A 4DCYA 2NVUB 4YB5A 3KN3A 5L8DA 3MZ9A 4NE4A 1SD3A 4U2RA 1B46A 1EZPA 4ZDMA 5H8NA 5AA2B 1ANFA 3TYHA 3KN7A 2ONRA 2DE4A 2Q2AA 3K6WA 3KGCA 5AA4B 2UYFA 4U22A 3Q27A 3OELA 1Y20A 4NEDA 4RNSA 3OMBA 2XXQA 3HSTA 1MPCA 3FXUA 2KLFA 1MXXA 3HV1A 2AL5A 1L5TA 3IO6A 1QW0A 3PPOA 3FATA 5BUUA 4KD5A 2F7CA 5M2VA 1J1NA 5DVFA 1B4ZA 4WKMA 2X26A 3OSRA 5KDTB 4WXJA 2XXIA 3PUZE 4YMBA 3O9PA 3KJTA 1USYE 4ZS9A 2F6GA 2O1MA 4H8JA 1B0LA 3AXFA 1B3FA 1USYH 3RT6B 3MQ9A 3VLWA 3T9UA 2H4IA 3WAFA 2ZNSA 3IOWA 1UIVA 1FW0A 5ICQA 3PUXE 2ZNUA 1IXCA 3TKDA 1GGGA 1B0HA 2I58A 2CMOA 5H8NB 4JB7A 5I59A 4OXVA 2B3BA 5AE4A 3CG1A 3TDJA 4BDRA 4QF9A 2Z8FA 3OO6A 4QSCA 2XXXA 1FTOA 2P2AA 4F19A 2R9JA 5DTBA 5HBCA 1PC3A 3PMXA 1EU8A 1MH3A 4EF1A 4BDLA 3K1NA 2D3IA 2Y7PA 4O3BA 3Q28A 5IKBA 1QULA 4LVQA 3KG2A 4POXA 5I2KB 1M5EA 4PFTA 1B5HA 4FECA 3HO7A 4G2ZA 3TAJA 3E3KA 3IOTA 4UACA 4NWDA 3MVWA 4YICA 4IGRA 4N13A 3UGWA 3IOUA 2Q89A 5TP9A 4Q8RA 1B2HA 3IOVA 1LAXA 3U94A 1EZ9A 4MLQA 2Q2CA 2D21A 3N6TA 3T9HB 1Y1MA 2QRYA 3TMGA 5A5XA 2H5YA 4OEUA 1FTLA 3PMVA 1P99A 1LB9A 1R9QA 3QUFA 1KWHA 2DXRA 4OHNA 3BKIB 1A7LA 1SI1A 4DIGA 4R73A 4H6DA 4F3PA 5J1DA 1OLCA 2BJJX 1B3GA 5CM6A 4X48A 2AL4A 2DYXA 1PDAA 5TPAB 2OCUA 2QS1A 1MDP1 5H8QA 3PPNA 2UVHA 1MY3A 1TFDA 2M8CA 4KQPA 3ZSFA 3IORA 3MWBA 3A3CA 2OWSA 4QHQA 1URGA 4JSOA 1VSOA 1RKMA 4R2BA 3GBBA 3FUZA 2F8DA 3S4UA 3PMWA 2H99A 2RKMA 1NKXA 2ZXTA 1B1XA 1H76A 5JK4A 4LZ8A 4C1UA 1PBPA 4JWOA 5JEIA 4QSEA 3MBPA 4RPNA 1B5JA 1BKAA 3CIJA 5KCJA 4GLIA 4GWOA 4OZ9A 2GH9A 1URDA 3VVFA 1LAHE 1MH4A 3UORA 2PBWA 3MPLA 3RY3A 2UVIA 1I6AA 3VLUA 2I48A 1FQEA 4ZZEA 4I8CA 2G93A 4DDDA 1PEBA 1R6ZA 1POY1 4OETA 1MQHA 3FJMA 3FXRA 2O6AA 1JETA 5H8FB 4UA8A 1JEUA 2NUVA 4ZEFA 4KPTA 4F18A 2RC9A 2XX8A 4DE8A 4NF6A 3IB2A 1FQAA 1P1OA 3N5LA 3CR9A 1QUKA 4BLAA 2F6PA 1N7WA 4OQOA 3IO4A 3C34A 1H43A 4ND9A 2ESNA 4LZ7A 4R9FA 4DLDA 3PPRA 2RC8A 2X7PA 2HEUA 4PFYA 3H03A 2P0SA 2PVUA 4QRZA 3RNNA 4PE5B 2DXYA 3M8UA 3CI8A 1FTKA 4ZZAA 1GV8A 1POTA 4MH5A 2H9BA 4KCCA 5K2XA 4H1XA 1NMUA 3I6VA 1XVXA 5AA2A 3MC2A 3PUYE 3PV0E 4X9TA 3K1PA 4K3FA 3TUSA 3T66A 3G3JA 3IB0A 5B7DA 4R6YA 3MP1A 3VDFA 2FNCA 3LBSA 1BTJA 1Y4CA 3JV9A 4Z0IA 1VFDA 2FYIA 3O97A 3OO7A 3OSQA 4YAHX 1ZLQA 2B3FA 3A09A 1N3WA 1PB7A 5F1QA 3VXBA 3SKPA 2H98A 2F5XA 3TQWA 1S7YA 2VP1A 2YJPA 5FHOA 3DLNA 3PGFA 1PB8A 4NF6B 2ZYKA 3KEIA 3U8QA 2FA7A 5ELVA 3UA8A 2HFBA 1MY2A 1Z7ME 1ZBMA 3PD9A 4G77A 4GD5A 2DVCA 3S9MC 2I3WA 2DE2A 2V84A 3M3LA 4THIA 1M5DA 3TQLA 5CC2A 1MRPA 4XKPA 4KYSA 4NTLA 1YTVA 4GXAA 1MXYA 4YB6A 1TFAA 1N76A 4DXUA 4MBPA 4E0WA 3IAZA 3SESA 2V25A 3CFLA 4LA9A 5L9SA 2DP8A 1JW5A 5FHMA 3E4RA 1A40A 3MP6A 3FD3A 1H44A 1LB8A 2I49A 3FVKA 1B5IA 5I57A 4KI0E 3S9EA 1NNFA 3SETA 4NWCA 1ATGA 2Z23A 2HAVA 3OOAA 1MXVA 3H6TA 1OMPA 3L6GA 1MY4A 1WVJA 2GHBA 3VE1B 2OJTA 1P1QA 2RCBA 3CFXA 5H8SA 3SEVA 2UXAA 1Y3PA 2XXVA 1MQGA 2I0BA 1GR2A 4XTCQ 2O68A 4R74A 4YKKA 3RQTA 1JVXA 4JWXA 3I5OA 5I2KA 3U92A 2F7AA 5I58B 3IJOB 2Y7RA 1B32A 4XIGQ 2ABHA 3USDA 2O1LA 1XVYA 3V8XB 1UTBB 4IY5A 1NNKA 1B4HA 1MPBA 3TTRA 3IX1A 1IUDA 2QJEA 4ISUA 5HPQA 3TTMA 1MXZA 1R9LA 4FEBA 5CBSA 1IZ1A 4HW8A 3K4UA 1ZJLA 3H4ZA 1OQHA 3ILTB 5LOMA 3DM0A 3RTFB 5AA1A 1LBBA 4ZEDA 4P11A 2HQ0A 1MY1A 5CBRA 4GF8A 4H8IA 3FGSA 3K0VA 3O29A 4F1UA 1WODA 2Z22A 4M1VA 3KOSA 3TTNA 4EUOA 5I57B 3RN8A 2Y7KA 3ZS6A 1MM6A 1P1NA 3ILUB 5TPAA 5JTYB 1GVCA 4OVJA 3BBRA 3TTKA 4R72A 2A5TA 3K6UA 4G68A 1N3XA 1HSEA 3V5AA 1DSNA 4PQJA 1Y9UA 2YPNA 5DVJA 4U4XA 2O7IA 2VOZA 4R2FA 3TELA 1DMBA 2DWIA 3G3GA 3MP8A 3VFJA 4RYAA 3HHGA 1LAFE 4QFKA 1IXGA 3LSWA 4OENA 3P7IA 3C9HA 4ELOA 4HCWA 3L6HA 4G4PA 1NFTA 3TEPA 1YCJA 4X1DA 4F3BA 1IQ7A 1OLAA 1WDNA 5EHSA 1OQGA 4RPOA 4U1OA 4TOZA 2R6GE 3K00A 3H3GA 3TTLA 5I56A 3K02A 2F7BA 2UVJA 2AYSA 1D4NA 4H0WA 4NMYA 2OLBA 5CRYA 2P1SA 3B6WA 3PU5A 5H8HA 2XXHA 3EHTA 2HZLA 3KBRA 2O69A 2OK2A 4XKNA 4ZE8A 2PT1A 1DOTA 4BDMA 4X1BA 2ZMBA 2DSFA 4BDQA 3T93B 1LLSA 4AB5A 1LFHA 1B1HA 5H8FA 3E9XA 4MF3A 3ECRA 4ELRA 4TLMB 3QUJA 4F39A 1AH5A 4LZ5A 1A54A 4IO5A 1P1WA 2IEEA 4H5FA 2A5TB 4G68B 4NF5B 1QVSA 3EQ1A 4HS7A 1A8FA 5CMKA 3SEUA 3W15C 2O7UA 1SBPA 3KSXA 1FQDA 4IY6A 2IA4A 3SEYA 3OO9A 1RYXA 3RUMA 3B7DA 2THIA 3FV1A 3VLVA 1H3DA 3V83A 4ZECA 1QUJA 1CE2A 3MVYA 4FEDA 5I56B 4FORA 1I6QA 4HCYA 4IO6A 1M5BA 4OFLA 5H8HB 3C32A 4GL8A 1TWYA 4N6PA 2PYYA 3EHSA 3H6UA
chains in the Genus database with same CATH superfamily
4F3GA 4MX6A 1MY0A 3VXCA 4I3EA 1QKAA 1LFGA 4OFJA 3RTWB 3FVGA 3IL1B 2PMSA 4F1YA 4MJOA 3KOTA 2PFYA 4PBHA 1N0TA 3PD8A 2ONSA 4PFUA 3S2VA 3CFZA 1B05A 2R71A 3RLFE 3LUYA 2QMWA 1XT8A 1MM7A 1HSLA 2DOJA 3FVOA 4YMAA 1B3EA 1Z7NE 1ZMGA 5CMBA 3MUQA 1K9YA 4PP0A 5IM2A 5ISUA 1SW5A 3O66A 3MPKA 4AB6A 1QJMA 5LTCA 4MLVA 4EXLA 3QIMA 4XKQA 3TCGA 3VVDA 5DT6A 3C36A 2I4BA 1XS5A 1KA0A 2RCAA 4QFLA 3S9NC 2NOOA 3KSJA 3N6UA 2UYEA 2XXPA 1NL5A 4OVTA 1UTHB 3KFMA 3ROJA 4AQ4A 4O3CA 2V3QA 4IO4A 3G3HA 2ALUA 2FHYA 4P0IA 3U72A 3K2DA 2VGQA 3MJNA 5I84A 4F22A 1QUIA 1A99A 1B3HA 1A55A 2QS4A 3OEMA 1HSJA 3VVEA 2W7YA 2GRVA 2JJKA 1RDYA 4F29A 2RINA 1M5CA 2X7QA 4NHBA 3EF7A 2RC7A 4Z7EA 5CMCA 1T0KA 3CVGA 4OWDA 3R6UA 2E1SA 2ZYOA 2OX3A 3G3IA 4YKJA 1Q9DA 3C31A 2D5WA 4FIMA 3ODBA 1SW2A 4TLLB 1GTKA 2B65A 2G29A 3HFUA 3LSLA 3U1OA 3SERA 2ZZWA 4PFIA 4GRKA 1JW1A 1AIVA 1B58A 4QFOA 4F31B 4U21A 4PGPA 3SZPA 4JDFA 1N7XA 4YZZA 3FV2A 4G61A 4H5GA 2Q9TA 1K9ZA 1SQYA 3EHUA 1YYZA 4IO3A 4H67A 1O63A 1SYHA 4N91A 1Y1ZA 5I58A 4POWA 1FJ6A 3K01A 4IO7A 4IB2A 4QFPA 2XX9A 2DQVA 3U93A 2AIXA 4FAJA 1JW4A 1VFEA 1UTBA 2ONKE 3FBPA 1AL3A 5EYGA 3BIGA 4YB7A 4YKPA 2Y7WA 3T96B 1OVBA 1LFIA 3ZKLA 3LC8A 4LATA 2NXOA 2V3UA 4MIJA 1EH3A 1IXIA 3FXQA 1I69A 1D3KA 3T9VA 1SW1A 5K2YA 3K1MA 4GXSB 4KYEA 1SI0A 3R7XA 3BIHA 1LSTA 4X04A 4MFIA 4KXPA 2GFEA 4O3AA 2GHAA 5ET6A 4ESXA 1RYOA 1G0HA 1FQBA 2I4CA 1MQDA 3TFLA 4RXLA 3W9WA 4U23A 4DI4B 5ET5A 2I0CA 5EHMA 1ZIUA 4OTEA 4Q5TA 3ONMA 4OMBA 5CMMA 4EF2A 5JTYA 4GBVA 1FTAA 2UVGA 2P3VA 1FCKA 4NF4B 1EYKA 3C35A 2ZZVA 2DWJA 2QS3A 4I62A 1IEJA 1LCFA 3Q29A 3ZKKA 2B4LA 2HZKA 4MMPA 4G8NA 5ESYA 5B70A 2Y7IA 5FTIA 1NV1A 2P3NA 1JEVA 5ITPA 1XOCA 1AMFA 3VV5A 4F2QA 4BDNA 2DE3A 3UP9A 4EQBA 5IAIA 3PTYA 5DEXB 3GBAA 4MNPA 4BDOA 3I3VA 1CB6A 2Q8JA 4H45A 2GQ1A 1FBGA 3FJGA 1FPGA 1P1UA 3W9VA 2PX1A 3V89B 1FBPA 1QGXA 1FBEA 3FZVA 4I1DA 4R75A 3LR1A 3LV0A 1FPFA 1VR5A 1INPA 4HE0A 1ZKBA 4PTKA 1DK4A 1LBZA 4F2OA 4GFRA 3RT8A 2VD3A 5TU0A 3TODA 4RK9A 4JSDA 4KR5A 1Y3NA 2F35A 2OWZA 3TCHA 3C33A 3HN0A 3RGYA 4DXBA 5I2NA 4OVRA 4ECFA 1B7UA 2DS9A 3DELB 1URSA 4U4SA 1LAGE 3K6VA 2XXWA 4ZEIA 3C4MA 4R9GA 4YU0A 1Y3QA 3SDFA 3UN6A 1Y4TA 3B6QA 2KR0A 4HTGA 1R1NA 1B51A 3CHGA 4TQUQ 1O64A 1LGBC 3H7MA 3BFUA 4LUBA 4P0GA 2Y84A 4QFNA 3TPAA 1YPNA 2Z8EA 3IR1A 3T22A 4KHZE 4EXKA 4NF5A 4ZE9A 2VHAA 5EYFA 4NF8A 3D4GA 1FTMA 1OIBA 1BIYA 2ZYNA 3M3FA 3N26A 2B4MA 1MG1A 3SEXA 1FQCA 1D9VA 4PETA 1MXUA 1FPBA 1NV5A 2QMXA 3KN8A 1FBFA 2F3BA 3Q25A 4R6HA 1IMBA 3H06B 1SW4A 1N04A 4GL0A 5EYHA 4OESA 4HXVA 3MVZA 1S50A 2DWAA 3GLBA 3LSFB 3QYTA 4GIZA 3HHFA 3JYRA 1DTGA 2QVRA 3N94A 3EPEA 4ELQA 1OVTA 2QS2A 2XD2A 5L9OA 3UK4A 2LAOA 3MAMA 4G68C 4P9KA 2REGA 3HCQA 2CZHA 4NG7A 3B6TA 3LSXA 3MZBA 1MS7A 5FTHA 3OO8A 5LDZA 1IITA 3DP6A 5I2NB 4RY1A 3FIRA 4EQ9A 4OYVA 2V93A 3OD7A 4LQ2A 4PC9A 4KYDA 1NNTA 3E13X 2Z8DA 1PBQA 4GOTA 1FJ9A 2ANJA 2OWTA 1FTJA 3CSBA 3QSLA 3CG3A 5I59B 3H6VA 1LBCA 1B3LA 2NWJA 2WYKA 3THIA 4N4UA 1NUWA 4NF8B 1MXWA 2XD3A 1IXHA 3K6XA 1TXFA 4PCDA 3GZGA 2XXYA 2I3VA 4YKIA 1MDQA 3OXNA 4L17A 3EKIA 1UTHA 4LQ5A 3RPWA 1DBZA 5AA2D 4I3YA 4ONYA 1QKBA 3FVNA 1SYIA 1F9BA 5EQ7A 4KFQA 3PUVE 4QSDA 2XX7A 4E0XA 1MPDA 2H25A 1JQFA 1NV6A 5CI5A 1XHYA 3QXMA 4GVOA 3CRBA 1A8EA 4H65A 1SVXB 1LBYA 4R6KA 1VE4A 3GXAA 4JBZA 2O51A 4DZ1A 2CZLA 1EYIA 1FPIA 4G8MA 3OENA 1B40A 3IB1A 4GQOA 5TP9B 4ZEBA 1O7TA 2RF1A 2A5SA 4FBPA 4DXCA 1NH7A 5DVIA 1XI6A 2XXTA 2HCAA 1NH8A 3DP8A 4P1EA 4WEPA 5DYHA 1I6BA 3B8BA 1G0IA 1MQJA 1B52A 3IK6B 4JXIA 5A5XB 1FSAA 1B9JA 5FHNA 2WBDA 2FBPA 5F7VA 3D1RA 3T9XB 5L9MA 1LCTA 1FPDA 3O2AA 2E0SA 1H45A 3QK6A 3KJ7A 3JZJA 1IIWA 3H6WA 3O6HA 2Q88A 3WAEA 3E79A 5BWJA 1IMAA 5H8QB 2PFZA 1N84A 1IMEA 4Q0CA 2HXWA 1BP5A 2XXRA 2F34A 3G7WA 1AOVA 1UIUA 4LP2B 1ZTYA 2YLNA 1Q1KA 2OBGA 2WKYA 2DVZA 1LBVA 2F78A 3KZGA 4G8HA 4M4GA 2ZNTA 4F1VA 4FJPA 2I6EA 4O7MA 2HHMA 1S9TA 4LN5A 1RDZA 3O6IA 3PUWE 3F11A 1MQIA 1UQWA 1B7ZA 2Q74A 3TZAA 2F97A 5KCJB 1DPPA 2QSXA 4N07A 5ICTA 3D4CA 1NUXA 2FIXA 2VPNA 4RJZA 2PT2A 3MYUA 3QAXA 4F3SA 3UIFA 1ZU0A 4U1ZA 4FATA 1PB9A 3SEWA 2XXUA 4NF4A 5AA4A 3MW0A 4ZEKA 1JVYA 2V3TA 1NNPA 1FPLA 3A3UA 1XC1A 3FJ7A 3O6GA 2VD2A 3FASA 1FQFA 5KZTA 3S9LC 2HAUA 4C1TA 4ELPA 4OERA 1ELJA 2CZIA 2DWHA 4XKRA 3HPIA 5IZ3B 2Y5KA 4IGTA 4WEDA 3BFTA 3MVXA 4IO2A 4N15A 1JNFA 1YAEA 4GWXA 3MZ1A 5DEXA 4LONB 4ESWA 3CSGA 3Q26A 4PFWA 4EQ7A 3M3KA 3IFAA 4NN3A 1DTZA 1B6HA 4O94A 2F36A 5HM4B 4EDPA 5KDTA 4DCXA 3PPQA 2O84X 3DP4A 2OZZA 5EQAA 4OFOA 4C0RA 1TT1A 2WYPA 5IZZA 1D9YA 1II5A 4JVIA 4I9DA 1SPIA 1US4A 2CZKA 1EZOA 3G3KA 2F3DA 4KCDA 4JWYA 3IJXB 1DPEA 4OEVA 2XXKA 3G3FA 2REJA 1BLFA 2ZYMA 2XHDA 3OEKA 3R26A 2QL3A 1B7HA 4RA1A 5AA3A 3PPPA 2R8TA 1SDXA 3TCFA 3O28A 3EN3A 4FE8A 4XXUA 4PDHA 2QPQA 4Q30B 1M5FA 4RK2A 5ITOA 2FIEA 1US5A 1Q35A 4DCYA 2NVUB 4YB5A 3KN3A 5L8DA 1CNQA 3MZ9A 4NE4A 1SD3A 4U2RA 1B46A 1EZPA 4N81A 4ZDMA 5H8NA 5AA2B 1ANFA 3TYHA 3KN7A 2ONRA 2DE4A 2Q2AA 3K6WA 3KGCA 5AA4B 1KA1A 2UYFA 4U22A 3Q27A 3OELA 1Y20A 4NEDA 4RNSA 3OMBA 2XXQA 3HSTA 4MAGA 1MPCA 3FXUA 2KLFA 1MXXA 5A5LA 3HV1A 2AL5A 1L5TA 3IO6A 1QW0A 3PPOA 3KC0A 3FATA 5BUUA 4KD5A 2F7CA 5M2VA 1J1NA 5DVFA 1B4ZA 4N6KA 4WKMA 2X26A 3OSRA 5KDTB 4WXJA 2XXIA 3PUZE 4PAFA 4YMBA 3O9PA 3KJTA 1USYE 4ZS9A 2F6GA 2O1MA 4H8JA 1B0LA 3AXFA 4UABA 1B3FA 1USYH 3RT6B 3MQ9A 3VLWA 4PFBA 4P8BA 3T9UA 2H4IA 3WAFA 2ZNSA 3IOWA 2V4CA 1UIVA 1FW0A 5ICQA 3PUXE 2ZNUA 1IXCA 3TKDA 4I40A 1YXIA 4XF5A 3E78A 1GGGA 1B0HA 2I58A 5IGAA 2CMOA 2FVZA 1YZ0A 5H8NB 4JB7A 5I59A 4OXVA 4NAPA 2B3BA 5AE4A 1LEVA 3CG1A 3TDJA 4BDRA 4QF9A 2Z8FA 3OO6A 4QSCA 3RPLA 2XXXA 1FTOA 2P2AA 4F19A 2R9JA 5DTBA 5HBCA 1PC3A 3PMXA 1EU8A 1MH3A 4EF1A 5EQ8A 4IR8A 4BDLA 3K1NA 2D3IA 4PF6A 2Y7PA 4O3BA 3Q28A 5IKBA 1QULA 4LVQA 3KG2A 4POXA 5I2KB 1M5EA 4PFTA 1B5HA 4FECA 3HO7A 4G2ZA 1NI9A 3TAJA 3E3KA 3IOTA 4UACA 4NWDA 3MVWA 4YICA 4IGRA 4N13A 4O8MA 3UGWA 3IOUA 2Q89A 2XA5A 5TP9A 4JVCA 4Q8RA 1B2HA 3IOVA 4OVSA 3KBZA 2VT5A 4QBAA 4OA4A 4GWYA 1LAXA 3U94A 1EZ9A 4MLQA 2Q2CA 2D21A 4PAKA 3N6TA 3T9HB 1Y1MA 2QRYA 3TMGA 5A5XA 2H5YA 4OEUA 1FTLA 3PMVA 1P99A 1LB9A 1R9QA 3QUFA 1KWHA 2DXRA 1IMDA 4OHNA 3BKIB 1A7LA 1SI1A 4DIGA 4R73A 1D9QA 4H6DA 4F3PA 5F24A 5J1DA 3RPLB 1NV2A 1OLCA 2BJJX 1B3GA 5CM6A 4X48A 2AL4A 2DYXA 1PDAA 5TPAB 2OCUA 3LUZA 2QS1A 1MDP1 5H8QA 3PPNA 2UVHA 1MY3A 1TFDA 2M8CA 4KQPA 3ZSFA 3IORA 3MWBA 4GWZA 4MEVA 3A3CA 2OWSA 4QHQA 1URGA 4JSOA 1VSOA 1RKMA 4R2BA 3GBBA 3FUZA 5ET8A 2F8DA 3S4UA 3PMWA 4GX4A 4MHFA 2H99A 2RKMA 1NKXA 2ZXTA 1B1XA 1H76A 5JK4A 4LZ8A 4C1UA 2ZZXA 1PBPA 4JWOA 5JEIA 4QSEA 3MBPA 4RPNA 1B5JA 1BKAA 3CIJA 5KCJA 4GLIA 4GWOA 4OZ9A 2GH9A 1URDA 3VVFA 1LAHE 2WEFA 1MH4A 4PBQA 3UORA 2PBWA 3MPLA 3RY3A 2UVIA 1I6AA 4GWUA 3VLUA 4PE3A 2I48A 1NV7A 1FQEA 4ZZEA 5EQ9A 4I8CA 4JVDA 2VPOA 1FBDA 5IZ3A 4MNCA 2G93A 4DDDA 1PEBA 1R6ZA 4PAIA 1POY1 4OETA 1MQHA 3FJMA 3FXRA 2O6AA 4PGNA 1JETA 5H8FB 4N17A 4UA8A 1LBWA 2L5VA 1JEUA 2NUVA 4ZEFA 4KPTA 4F18A 2RC9A 4OVQA 2XX8A 4DE8A 4NF6A 3IB2A 1FQAA 4AS4A 1P1OA 3N5LA 3CR9A 1QUKA 4BLAA 2F6PA 2QVVA 3T1BA 1N7WA 2WBBA 4OQOA 3IO4A 4PF8A 3C34A 1H43A 4ND9A 2ESNA 4LZ7A 4R9FA 3KC1A 4DLDA 3PPRA 2RC8A 2X7PA 2HEUA 4PFYA 3H03A 2P0SA 2PVUA 4QRZA 2QVUA 3RNNA 5DW8A 4PE5B 2DXYA 1IMFA 3M8UA 3CI8A 1FTKA 4ZZAA 1GV8A 1POTA 4MH5A 2H9BA 1EYJA 4KCCA 5K2XA 4H1XA 2MKZA 1FPKA 1NMUA 3I6VA 1XVXA 2XWKA 5AA2A 3MC2A 4NX1A 3PUYE 3PV0E 4X9TA 3K1PA 4K3FA 3TUSA 3T66A 3G3JA 3IB0A 5B7DA 4R6YA 3MP1A 3VDFA 2FNCA 3LBSA 1BTJA 1Y4CA 3JV9A 4Z0IA 1VFDA 3IFCA 2FYIA 3O97A 3OO7A 3OSQA 4YAHX 1ZLQA 2B3FA 3A09A 1N3WA 4N8GA 1PB7A 5F1QA 3VXBA 3SKPA 4GX6A 5FBPA 2H98A 2F5XA 3TQWA 1S7YA 1FBCA 4QXDA 2VP1A 2YJPA 5FHOA 3DLNA 4PFRA 2QFLA 3PGFA 4MNIA 1PB8A 4NF6B 2ZYKA 3KEIA 3U8QA 2XWVA 2FA7A 5ELVA 3UA8A 2HFBA 1MY2A 1Z7ME 1ZBMA 3PD9A 4G77A 4GD5A 2DVCA 3S9MC 2I3WA 2DE2A 2V84A 3M3LA 4THIA 3MSTA 1M5DA 3TQLA 5CC2A 1MRPA 4XKPA 4KYSA 4NTLA 1YTVA 2Q8MA 4GXAA 4N6DA 1MXYA 4YB6A 1TFAA 1N76A 4DXUA 4MBPA 4NGUA 4E0WA 3IAZA 1VDWA 3SESA 2V25A 3CFLA 4LA9A 2XWIA 4P1LA 5L9SA 2DP8A 1JW5A 5FHMA 3E4RA 3NOHA 1A40A 3MP6A 3FD3A 5T3JA 1H44A 1LB8A 2I49A 3FVKA 1B5IA 1JP4A 5I57A 4KI0E 3S9EA 1NNFA 3SETA 3U65A 4NWCA 1ATGA 2Z23A 2HAVA 3OOAA 1MXVA 2Y5LA 3H6TA 1OMPA 3L6GA 1MY4A 1WVJA 2GHBA 4XFEA 3VE1B 1NV3A 2PCRA 2OJTA 1P1QA 2RCBA 3CFXA 4GWWA 5H8SA 3SEVA 2UXAA 1Y3PA 2XWOA 2XXVA 1MQGA 2I0BA 1GR2A 1RDXA 4XTCQ 2O68A 4R74A 4YKKA 3RQTA 2CEXA 1JVXA 4HE2A 1NV0A 4JWXA 3I5OA 5I2KA 3U92A 2F7AA 5I58B 3IJOB 4H46A 2Y7RA 1B32A 4XIGQ 2ABHA 4HE1A 3USDA 2O1LA 1XVYA 3V8XB 1UTBB 4IY5A 1NNKA 3B50A 1B4HA 1MPBA 4O7IA 3IX1A 3TTRA 5J16A 1IUDA 1FBHA 4P3LA 2QJEA 4ISUA 4AS5A 5HPQA 3TTMA 1MXZA 1R9LA 4FEBA 5CBSA 1IZ1A 4HW8A 3K4UA 1ZJLA 5IZ1A 3H4ZA 1OQHA 3ILTB 5LOMA 3DM0A 3RTFB 5AA1A 1LBBA 1LBXA 4ZEDA 4P11A 5I5PA 2HQ0A 1MY1A 5CBRA 4GF8A 4H8IA 2BJIA 3FGSA 3K0VA 3O29A 4F1UA 1WODA 4GBWA 2Z22A 4XEQA 4M1VA 3KOSA 3TTNA 4OVPA 4EUOA 3FXBA 5I57B 3GYYA 3RN8A 2Y7KA 3ZS6A 1MM6A 1P1NA 3ILUB 5TPAA 5JTYB 4NF0A 1GVCA 4OVJA 3BBRA 3TTKA 4R72A 1KZ8A 2A5TA 3K6UA 4G68A 1N3XA 1HSEA 3V5AA 1DSNA 4PQJA 1Y9UA 2YPNA 5DVJA 4U4XA 2O7IA 2VOZA 3ISPA 4R2FA 3TELA 1DCUA 1DMBA 1BK4A 2DWIA 3G3GA 3MP8A 3RYDA 3VFJA 1AWBA 4MCOA 3HHGA 4GX3A 4RYAA 1LAFE 4QFKA 1IXGA 1IMCA 3LSWA 4OENA 3P7IA 3C9HA 4ELOA 4HCWA 3L6HA 4G4PA 1NFTA 3TEPA 1YCJA 4X1DA 4F3BA 1IQ7A 1OLAA 1WDNA 5EHSA 1OQGA 4RPOA 4U1OA 4TOZA 1NV4A 2R6GE 3K00A 3H3GA 2DDKA 3TTLA 5I56A 3K02A 2F7BA 2UVJA 2AYSA 1D4NA 1NUZA 4NMYA 4H0WA 1NUYA 2OLBA 5CRYA 2P1SA 3B6WA 3PU5A 5H8HA 2XXHA 3EHTA 2HZLA 3KBRA 2O69A 2OK2A 3QMFA 2KQZA 4XKNA 5I3SA 4GWSA 4ZE8A 2PT1A 1FPEA 1DOTA 4BDMA 4X1BA 2ZMBA 2DSFA 4BDQA 4N8YA 3T93B 5I7IA 1LLSA 4AB5A 5ET7A 1LFHA 1B1HA 5H8FA 3E9XA 4MF3A 3ECRA 4X8RA 4ELRA 4TLMB 2CEYA 2HXRA 3QUJA 4F39A 1AH5A 4LZ5A 1A54A 1FRPA 4IO5A 2HPGA 1P1WA 2IEEA 4H5FA 2A5TB 2WX9A 4G68B 4NF5B 1QVSA 4P47A 3EQ1A 4HS7A 1A8FA 5CMKA 3SEUA 4OANA 3W15C 2O7UA 1SBPA 3KSXA 1FQDA 4IY6A 2IA4A 3SEYA 3OO9A 1RYXA 3T0JA 1FPJA 3RUMA 4P56A 3B7DA 2THIA 3FV1A 3VLVA 1H3DA 3V83A 4ZECA 1QUJA 1CE2A 3MVYA 4DI3D 4FEDA 5I56B 4FORA 4PDDA 1I6QA 4HCYA 4IO6A 4NQ8A 1M5BA 4OFLA 5H8HB 3C32A 4GL8A 1TWYA 3A29A 4N6PA 2PYYA 3EHSA 3H6UA
chains in the Genus database with same CATH topology
4F3GA 1MY0A 3VXCA 1QKAA 1LFGA 4OFJA 3RTWB 3FVGA 3IL1B 2PMSA 4F1YA 3KOTA 1N0TA 3PD8A 2ONSA 4PFUA 3S2VA 3CFZA 1B05A 2R71A 3RLFE 3LUYA 2QMWA 1XT8A 1MM7A 1HSLA 2DOJA 3FVOA 4YMAA 1B3EA 1Z7NE 1ZMGA 5CMBA 3MUQA 4PP0A 5ISUA 1SW5A 3O66A 3MPKA 4AB6A 1QJMA 4MLVA 4EXLA 3QIMA 4XKQA 3TCGA 3VVDA 5DT6A 3C36A 2I4BA 1XS5A 2RCAA 4QFLA 3S9NC 2NOOA 3KSJA 3N6UA 2UYEA 2XXPA 1NL5A 1UTHB 3KFMA 4AQ4A 4O3CA 2V3QA 4IO4A 3G3HA 2ALUA 4P0IA 3U72A 3K2DA 2VGQA 3MJNA 5I84A 4F22A 1QUIA 1A99A 1B3HA 1A55A 2QS4A 3OEMA 1HSJA 3VVEA 2W7YA 2GRVA 4F29A 2RINA 1M5CA 2X7QA 3EF7A 2RC7A 4Z7EA 5CMCA 1T0KA 3CVGA 4OWDA 3R6UA 2E1SA 2ZYOA 3G3IA 4YKJA 3C31A 2D5WA 4FIMA 3ODBA 1SW2A 4TLLB 1GTKA 2B65A 2G29A 3LSLA 3U1OA 3SERA 4GRKA 1JW1A 1AIVA 1B58A 4QFOA 4F31B 4U21A 4JDFA 1N7XA 4YZZA 3FV2A 4H5GA 2Q9TA 1SQYA 3EHUA 4IO3A 4H67A 1O63A 1SYHA 1Y1ZA 5I58A 4POWA 3K01A 4IO7A 4IB2A 4QFPA 2XX9A 2DQVA 3U93A 2AIXA 4FAJA 1JW4A 1VFEA 1UTBA 2ONKE 1AL3A 4YB7A 4YKPA 2Y7WA 3T96B 1OVBA 1LFIA 3ZKLA 3LC8A 4LATA 2NXOA 2V3UA 1EH3A 1IXIA 3FXQA 1I69A 1D3KA 3T9VA 1SW1A 5K2YA 3K1MA 4GXSB 4KYEA 1SI0A 3R7XA 1LSTA 4MFIA 2GFEA 4O3AA 2GHAA 4ESXA 1RYOA 1FQBA 2I4CA 1MQDA 3TFLA 4RXLA 3W9WA 4U23A 2I0CA 5EHMA 1ZIUA 4OTEA 4Q5TA 3ONMA 4OMBA 5CMMA 4EF2A 5JTYA 2UVGA 1FCKA 4NF4B 3C35A 2DWJA 2QS3A 4I62A 1IEJA 1LCFA 3Q29A 3ZKKA 2HZKA 4G8NA 5B70A 2Y7IA 5FTIA 1JEVA 5ITPA 1XOCA 1AMFA 3VV5A 4F2QA 4BDNA 2DE3A 3UP9A 4EQBA 5IAIA 5DEXB 3GBAA 4BDOA 3I3VA 1CB6A 2Q8JA 3FJGA 1P1UA 3W9VA 2PX1A 3V89B 3FZVA 4I1DA 4R75A 3LR1A 1VR5A 1ZKBA 4F2OA 4GFRA 3RT8A 2VD3A 5TU0A 3TODA 4RK9A 4JSDA 4KR5A 1Y3NA 2F35A 3TCHA 3C33A 3HN0A 3RGYA 4DXBA 5I2NA 4ECFA 1B7UA 2DS9A 3DELB 1URSA 4U4SA 1LAGE 3K6VA 2XXWA 4ZEIA 3C4MA 4R9GA 4YU0A 1Y3QA 3SDFA 3UN6A 1Y4TA 3B6QA 4HTGA 1R1NA 1B51A 4TQUQ 1O64A 1LGBC 3H7MA 3BFUA 4LUBA 4P0GA 2Y84A 3TPAA 4QFNA 1YPNA 2Z8EA 3IR1A 3T22A 4KHZE 4EXKA 4NF5A 4ZE9A 2VHAA 5EYFA 4NF8A 3D4GA 1FTMA 1OIBA 1BIYA 2ZYNA 3M3FA 3N26A 1MG1A 3SEXA 1FQCA 1D9VA 4PETA 1MXUA 2QMXA 3KN8A 3Q25A 4R6HA 3H06B 1SW4A 1N04A 4GL0A 4OESA 3MVZA 1S50A 2DWAA 3GLBA 3LSFB 3QYTA 4GIZA 3HHFA 3JYRA 1DTGA 3N94A 3EPEA 4ELQA 1OVTA 2QS2A 2XD2A 5L9OA 3UK4A 2LAOA 3MAMA 4G68C 2REGA 3HCQA 3B6TA 3LSXA 3MZBA 1MS7A 5FTHA 3OO8A 1IITA 3DP6A 5I2NB 4RY1A 3FIRA 4EQ9A 4OYVA 2V93A 3OD7A 4LQ2A 4KYDA 1NNTA 3E13X 2Z8DA 1PBQA 4GOTA 2ANJA 2OWTA 1FTJA 3CSBA 3QSLA 3CG3A 5I59B 3H6VA 1LBCA 1B3LA 2NWJA 3THIA 4NF8B 1MXWA 2XD3A 1IXHA 3K6XA 1TXFA 3GZGA 2XXYA 2I3VA 4YKIA 1MDQA 3OXNA 4L17A 1UTHA 4LQ5A 3RPWA 5AA2D 4ONYA 1QKBA 3FVNA 1SYIA 1F9BA 4KFQA 3PUVE 4QSDA 2XX7A 4E0XA 1MPDA 2H25A 1JQFA 5CI5A 1XHYA 3QXMA 4GVOA 3CRBA 1A8EA 4H65A 1SVXB 4R6KA 1VE4A 3GXAA 4JBZA 2O51A 4DZ1A 2CZLA 4G8MA 3OENA 1B40A 3IB1A 4GQOA 5TP9B 4ZEBA 1O7TA 2RF1A 2A5SA 4DXCA 1NH7A 5DVIA 2XXTA 2HCAA 1NH8A 3DP8A 4WEPA 5DYHA 1I6BA 1MQJA 1B52A 3IK6B 4JXIA 5A5XB 1B9JA 5FHNA 5F7VA 3T9XB 5L9MA 1LCTA 3O2AA 2E0SA 1H45A 3QK6A 3KJ7A 3JZJA 1IIWA 3H6WA 3O6HA 2Q88A 3WAEA 5BWJA 5H8QB 1N84A 4Q0CA 2HXWA 1BP5A 2XXRA 2F34A 3G7WA 1AOVA 1UIUA 4LP2B 1ZTYA 2YLNA 1Q1KA 2OBGA 2WKYA 2DVZA 2F78A 3KZGA 4G8HA 4M4GA 2ZNTA 4F1VA 4FJPA 2I6EA 1S9TA 3O6IA 3PUWE 3F11A 1MQIA 1UQWA 1B7ZA 3TZAA 2F97A 5KCJB 1DPPA 2QSXA 4N07A 5ICTA 3D4CA 4RJZA 2PT2A 3QAXA 4F3SA 3UIFA 1ZU0A 4U1ZA 4FATA 1PB9A 3SEWA 2XXUA 4NF4A 5AA4A 3MW0A 4ZEKA 1JVYA 2V3TA 1NNPA 3A3UA 1XC1A 3FJ7A 3O6GA 2VD2A 3FASA 1FQFA 5KZTA 3S9LC 2HAUA 4C1TA 4ELPA 4OERA 1ELJA 2DWHA 4XKRA 3HPIA 4IGTA 4WEDA 3BFTA 3MVXA 4IO2A 1JNFA 1YAEA 3MZ1A 5DEXA 4LONB 4ESWA 3CSGA 3Q26A 4PFWA 4EQ7A 3M3KA 1DTZA 1B6HA 2F36A 5HM4B 4EDPA 5KDTA 4DCXA 3PPQA 2O84X 3DP4A 2OZZA 4OFOA 4C0RA 1TT1A 1D9YA 1II5A 4I9DA 1US4A 1EZOA 3G3KA 4KCDA 4JWYA 3IJXB 1DPEA 4OEVA 3G3FA 2REJA 1BLFA 2ZYMA 2XHDA 3OEKA 3R26A 2QL3A 1B7HA 4RA1A 5AA3A 3PPPA 1SDXA 3TCFA 3O28A 3EN3A 4FE8A 4XXUA 2QPQA 4Q30B 1M5FA 4RK2A 5ITOA 1US5A 1Q35A 4DCYA 2NVUB 4YB5A 3KN3A 5L8DA 3MZ9A 4NE4A 1SD3A 4U2RA 1B46A 1EZPA 4ZDMA 5H8NA 5AA2B 1ANFA 3TYHA 3KN7A 2ONRA 2DE4A 2Q2AA 3K6WA 3KGCA 5AA4B 2UYFA 4U22A 3Q27A 3OELA 1Y20A 4NEDA 4RNSA 3OMBA 2XXQA 3HSTA 1MPCA 3FXUA 2KLFA 1MXXA 3HV1A 2AL5A 1L5TA 3IO6A 1QW0A 3PPOA 3FATA 5BUUA 4KD5A 2F7CA 5M2VA 1J1NA 5DVFA 1B4ZA 4WKMA 2X26A 3OSRA 5KDTB 4WXJA 2XXIA 3PUZE 4YMBA 3O9PA 3KJTA 1USYE 4ZS9A 2F6GA 2O1MA 4H8JA 1B0LA 3AXFA 1B3FA 1USYH 3RT6B 3MQ9A 3VLWA 3T9UA 2H4IA 3WAFA 2ZNSA 3IOWA 1UIVA 1FW0A 5ICQA 3PUXE 2ZNUA 1IXCA 3TKDA 1GGGA 1B0HA 2I58A 2CMOA 5H8NB 4JB7A 5I59A 4OXVA 2B3BA 5AE4A 3CG1A 3TDJA 4BDRA 4QF9A 2Z8FA 3OO6A 4QSCA 2XXXA 1FTOA 2P2AA 4F19A 2R9JA 5DTBA 5HBCA 1PC3A 3PMXA 1EU8A 1MH3A 4EF1A 4BDLA 3K1NA 2D3IA 2Y7PA 4O3BA 3Q28A 5IKBA 1QULA 4LVQA 3KG2A 4POXA 5I2KB 1M5EA 4PFTA 1B5HA 4FECA 3HO7A 4G2ZA 3TAJA 3E3KA 3IOTA 4UACA 4NWDA 3MVWA 4YICA 4IGRA 4N13A 3UGWA 3IOUA 2Q89A 5TP9A 4Q8RA 1B2HA 3IOVA 1LAXA 3U94A 1EZ9A 4MLQA 2Q2CA 2D21A 3N6TA 3T9HB 1Y1MA 2QRYA 3TMGA 5A5XA 2H5YA 4OEUA 1FTLA 3PMVA 1P99A 1LB9A 1R9QA 3QUFA 1KWHA 2DXRA 4OHNA 3BKIB 1A7LA 1SI1A 4DIGA 4R73A 4H6DA 4F3PA 5J1DA 1OLCA 2BJJX 1B3GA 5CM6A 4X48A 2AL4A 2DYXA 1PDAA 5TPAB 2OCUA 2QS1A 1MDP1 5H8QA 3PPNA 2UVHA 1MY3A 1TFDA 2M8CA 4KQPA 3ZSFA 3IORA 3MWBA 3A3CA 2OWSA 4QHQA 1URGA 4JSOA 1VSOA 1RKMA 4R2BA 3GBBA 3FUZA 2F8DA 3S4UA 3PMWA 2H99A 2RKMA 1NKXA 2ZXTA 1B1XA 1H76A 5JK4A 4LZ8A 4C1UA 1PBPA 4JWOA 5JEIA 4QSEA 3MBPA 4RPNA 1B5JA 1BKAA 3CIJA 5KCJA 4GLIA 4GWOA 4OZ9A 2GH9A 1URDA 3VVFA 1LAHE 1MH4A 3UORA 2PBWA 3MPLA 3RY3A 2UVIA 1I6AA 3VLUA 2I48A 1FQEA 4ZZEA 4I8CA 2G93A 4DDDA 1PEBA 1R6ZA 1POY1 4OETA 1MQHA 3FJMA 3FXRA 2O6AA 1JETA 5H8FB 4UA8A 1JEUA 2NUVA 4ZEFA 4KPTA 4F18A 2RC9A 2XX8A 4DE8A 4NF6A 3IB2A 1FQAA 1P1OA 3N5LA 3CR9A 1QUKA 4BLAA 2F6PA 1N7WA 4OQOA 3IO4A 3C34A 1H43A 4ND9A 2ESNA 4LZ7A 4R9FA 4DLDA 3PPRA 2RC8A 2X7PA 2HEUA 4PFYA 3H03A 2P0SA 2PVUA 4QRZA 3RNNA 4PE5B 2DXYA 3M8UA 3CI8A 1FTKA 4ZZAA 1GV8A 1POTA 4MH5A 2H9BA 4KCCA 5K2XA 4H1XA 1NMUA 3I6VA 1XVXA 5AA2A 3MC2A 3PUYE 3PV0E 4X9TA 3K1PA 4K3FA 3TUSA 3T66A 3G3JA 3IB0A 5B7DA 4R6YA 3MP1A 3VDFA 2FNCA 3LBSA 1BTJA 1Y4CA 3JV9A 4Z0IA 1VFDA 2FYIA 3O97A 3OO7A 3OSQA 4YAHX 1ZLQA 2B3FA 3A09A 1N3WA 1PB7A 5F1QA 3VXBA 3SKPA 2H98A 2F5XA 3TQWA 1S7YA 2VP1A 2YJPA 5FHOA 3DLNA 3PGFA 1PB8A 4NF6B 2ZYKA 3KEIA 3U8QA 2FA7A 5ELVA 3UA8A 2HFBA 1MY2A 1Z7ME 1ZBMA 3PD9A 4G77A 4GD5A 2DVCA 3S9MC 2I3WA 2DE2A 2V84A 3M3LA 4THIA 1M5DA 3TQLA 5CC2A 1MRPA 4XKPA 4KYSA 4NTLA 1YTVA 4GXAA 1MXYA 4YB6A 1TFAA 1N76A 4DXUA 4MBPA 4E0WA 3IAZA 3SESA 2V25A 3CFLA 4LA9A 5L9SA 2DP8A 1JW5A 5FHMA 3E4RA 1A40A 3MP6A 3FD3A 1H44A 1LB8A 2I49A 3FVKA 1B5IA 5I57A 4KI0E 3S9EA 1NNFA 3SETA 4NWCA 1ATGA 2Z23A 2HAVA 3OOAA 1MXVA 3H6TA 1OMPA 3L6GA 1MY4A 1WVJA 2GHBA 3VE1B 2OJTA 1P1QA 2RCBA 3CFXA 5H8SA 3SEVA 2UXAA 1Y3PA 2XXVA 1MQGA 2I0BA 1GR2A 4XTCQ 2O68A 4R74A 4YKKA 3RQTA 1JVXA 4JWXA 3I5OA 5I2KA 3U92A 2F7AA 5I58B 3IJOB 2Y7RA 1B32A 4XIGQ 2ABHA 3USDA 2O1LA 1XVYA 3V8XB 1UTBB 4IY5A 1NNKA 1B4HA 1MPBA 3TTRA 3IX1A 1IUDA 2QJEA 4ISUA 5HPQA 3TTMA 1MXZA 1R9LA 4FEBA 5CBSA 1IZ1A 4HW8A 3K4UA 1ZJLA 3H4ZA 1OQHA 3ILTB 5LOMA 3DM0A 3RTFB 5AA1A 1LBBA 4ZEDA 4P11A 2HQ0A 1MY1A 5CBRA 4GF8A 4H8IA 3FGSA 3K0VA 3O29A 4F1UA 1WODA 2Z22A 4M1VA 3KOSA 3TTNA 4EUOA 5I57B 3RN8A 2Y7KA 3ZS6A 1MM6A 1P1NA 3ILUB 5TPAA 5JTYB 1GVCA 4OVJA 3BBRA 3TTKA 4R72A 2A5TA 3K6UA 4G68A 1N3XA 1HSEA 3V5AA 1DSNA 4PQJA 1Y9UA 2YPNA 5DVJA 4U4XA 2O7IA 2VOZA 4R2FA 3TELA 1DMBA 2DWIA 3G3GA 3MP8A 3VFJA 4RYAA 3HHGA 1LAFE 4QFKA 1IXGA 3LSWA 4OENA 3P7IA 3C9HA 4ELOA 4HCWA 3L6HA 4G4PA 1NFTA 3TEPA 1YCJA 4X1DA 4F3BA 1IQ7A 1OLAA 1WDNA 5EHSA 1OQGA 4RPOA 4U1OA 4TOZA 2R6GE 3K00A 3H3GA 3TTLA 5I56A 3K02A 2F7BA 2UVJA 2AYSA 1D4NA 4H0WA 4NMYA 2OLBA 5CRYA 2P1SA 3B6WA 3PU5A 5H8HA 2XXHA 3EHTA 2HZLA 3KBRA 2O69A 2OK2A 4XKNA 4ZE8A 2PT1A 1DOTA 4BDMA 4X1BA 2ZMBA 2DSFA 4BDQA 3T93B 1LLSA 4AB5A 1LFHA 1B1HA 5H8FA 3E9XA 4MF3A 3ECRA 4ELRA 4TLMB 3QUJA 4F39A 1AH5A 4LZ5A 1A54A 4IO5A 1P1WA 2IEEA 4H5FA 2A5TB 4G68B 4NF5B 1QVSA 3EQ1A 4HS7A 1A8FA 5CMKA 3SEUA 3W15C 2O7UA 1SBPA 3KSXA 1FQDA 4IY6A 2IA4A 3SEYA 3OO9A 1RYXA 3RUMA 3B7DA 2THIA 3FV1A 3VLVA 1H3DA 3V83A 4ZECA 1QUJA 1CE2A 3MVYA 4FEDA 5I56B 4FORA 1I6QA 4HCYA 4IO6A 1M5BA 4OFLA 5H8HB 3C32A 4GL8A 1TWYA 4N6PA 2PYYA 3EHSA 3H6UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F3G A;  1MY0 A;  3VXC A;  1QKA A;  1LFG A;  4OFJ A;  3RTW B;  3FVG A;  3IL1 B;  2PMS A;  4F1Y A;  3KOT A;  1N0T A;  3PD8 A;  2ONS A;  4PFU A;  3S2V A;  3CFZ A;  1B05 A;  2R71 A;  3RLF E;  3LUY A;  2QMW A;  1XT8 A;  1MM7 A;  1HSL A;  2DOJ A;  3FVO A;  4YMA A;  1B3E A;  1Z7N E;  1ZMG A;  5CMB A;  3MUQ A;  4PP0 A;  5ISU A;  1SW5 A;  3O66 A;  3MPK A;  4AB6 A;  1QJM A;  4MLV A;  4EXL A;  3QIM A;  4XKQ A;  3TCG A;  3VVD A;  5DT6 A;  3C36 A;  2I4B A;  1XS5 A;  2RCA A;  4QFL A;  3S9N C;  2NOO A;  3KSJ A;  3N6U A;  2UYE A;  2XXP A;  1NL5 A;  1UTH B;  3KFM A;  4AQ4 A;  4O3C A;  2V3Q A;  4IO4 A;  3G3H A;  2ALU A;  4P0I A;  3U72 A;  3K2D A;  2VGQ A;  3MJN A;  5I84 A;  4F22 A;  1QUI A;  1A99 A;  1B3H A;  1A55 A;  2QS4 A;  3OEM A;  1HSJ A;  3VVE A;  2W7Y A;  2GRV A;  4F29 A;  2RIN A;  1M5C A;  2X7Q A;  3EF7 A;  2RC7 A;  4Z7E A;  5CMC A;  1T0K A;  3CVG A;  4OWD A;  3R6U A;  2E1S A;  2ZYO A;  3G3I A;  4YKJ A;  3C31 A;  2D5W A;  4FIM A;  3ODB A;  1SW2 A;  4TLL B;  1GTK A;  2B65 A;  2G29 A;  3LSL A;  3U1O A;  3SER A;  4GRK A;  1JW1 A;  1AIV A;  1B58 A;  4QFO A;  4F31 B;  4U21 A;  4JDF A;  1N7X A;  4YZZ A;  3FV2 A;  4H5G A;  2Q9T A;  1SQY A;  3EHU A;  4IO3 A;  4H67 A;  1O63 A;  1SYH A;  1Y1Z A;  5I58 A;  4POW A;  3K01 A;  4IO7 A;  4IB2 A;  4QFP A;  2XX9 A;  2DQV A;  3U93 A;  2AIX A;  4FAJ A;  1JW4 A;  1VFE A;  1UTB A;  2ONK E;  1AL3 A;  4YB7 A;  4YKP A;  2Y7W A;  3T96 B;  1OVB A;  1LFI A;  3ZKL A;  3LC8 A;  4LAT A;  2NXO A;  2V3U A;  1EH3 A;  1IXI A;  3FXQ A;  1I69 A;  1D3K A;  3T9V A;  1SW1 A;  5K2Y A;  3K1M A;  4GXS B;  4KYE A;  1SI0 A;  3R7X A;  1LST A;  4MFI A;  2GFE A;  4O3A A;  2GHA A;  4ESX A;  1RYO A;  1FQB A;  2I4C A;  1MQD A;  3TFL A;  4RXL A;  3W9W A;  4U23 A;  2I0C A;  5EHM A;  1ZIU A;  4OTE A;  4Q5T A;  3ONM A;  4OMB A;  5CMM A;  4EF2 A;  5JTY A;  2UVG A;  1FCK A;  4NF4 B;  3C35 A;  2DWJ A;  2QS3 A;  4I62 A;  1IEJ A;  1LCF A;  3Q29 A;  3ZKK A;  2HZK A;  4G8N A;  5B70 A;  2Y7I A;  5FTI A;  1JEV A;  5ITP A;  1XOC A;  1AMF A;  3VV5 A;  4F2Q A;  4BDN A;  2DE3 A;  3UP9 A;  4EQB A;  5IAI A;  5DEX B;  3GBA A;  4BDO A;  3I3V A;  1CB6 A;  2Q8J A;  3FJG A;  1P1U A;  3W9V A;  2PX1 A;  3V89 B;  3FZV A;  4I1D A;  4R75 A;  3LR1 A;  1VR5 A;  1ZKB A;  4F2O A;  4GFR A;  3RT8 A;  2VD3 A;  5TU0 A;  3TOD A;  4RK9 A;  4JSD A;  4KR5 A;  1Y3N A;  2F35 A;  3TCH A;  3C33 A;  3HN0 A;  3RGY A;  4DXB A;  5I2N A;  4ECF A;  1B7U A;  2DS9 A;  3DEL B;  1URS A;  4U4S A;  1LAG E;  3K6V A;  2XXW A;  4ZEI A;  3C4M A;  4R9G A;  4YU0 A;  1Y3Q A;  3SDF A;  3UN6 A;  1Y4T A;  3B6Q A;  4HTG A;  1R1N A;  1B51 A;  4TQU Q;  1O64 A;  1LGB C;  3H7M A;  3BFU A;  4LUB A;  4P0G A;  2Y84 A;  3TPA A;  4QFN A;  1YPN A;  2Z8E A;  3IR1 A;  3T22 A;  4KHZ E;  4EXK A;  4NF5 A;  4ZE9 A;  2VHA A;  5EYF A;  4NF8 A;  3D4G A;  1FTM A;  1OIB A;  1BIY A;  2ZYN A;  3M3F A;  3N26 A;  1MG1 A;  3SEX A;  1FQC A;  1D9V A;  4PET A;  1MXU A;  2QMX A;  3KN8 A;  3Q25 A;  4R6H A;  3H06 B;  1SW4 A;  1N04 A;  4GL0 A;  4OES A;  3MVZ A;  1S50 A;  2DWA A;  3GLB A;  3LSF B;  3QYT A;  4GIZ A;  3HHF A;  3JYR A;  1DTG A;  3N94 A;  3EPE A;  4ELQ A;  1OVT A;  2QS2 A;  2XD2 A;  5L9O A;  3UK4 A;  2LAO A;  3MAM A;  4G68 C;  2REG A;  3HCQ A;  3B6T A;  3LSX A;  3MZB A;  1MS7 A;  5FTH A;  3OO8 A;  1IIT A;  3DP6 A;  5I2N B;  4RY1 A;  3FIR A;  4EQ9 A;  4OYV A;  2V93 A;  3OD7 A;  4LQ2 A;  4KYD A;  1NNT A;  3E13 X;  2Z8D A;  1PBQ A;  4GOT A;  2ANJ A;  2OWT A;  1FTJ A;  3CSB A;  3QSL A;  3CG3 A;  5I59 B;  3H6V A;  1LBC A;  1B3L A;  2NWJ A;  3THI A;  4NF8 B;  1MXW A;  2XD3 A;  1IXH A;  3K6X A;  1TXF A;  3GZG A;  2XXY A;  2I3V A;  4YKI A;  1MDQ A;  3OXN A;  4L17 A;  1UTH A;  4LQ5 A;  3RPW A;  5AA2 D;  4ONY A;  1QKB A;  3FVN A;  1SYI A;  1F9B A;  4KFQ A;  3PUV E;  4QSD A;  2XX7 A;  4E0X A;  1MPD A;  2H25 A;  1JQF A;  5CI5 A;  1XHY A;  3QXM A;  4GVO A;  3CRB A;  1A8E A;  4H65 A;  1SVX B;  4R6K A;  1VE4 A;  3GXA A;  4JBZ A;  2O51 A;  4DZ1 A;  2CZL A;  4G8M A;  3OEN A;  1B40 A;  3IB1 A;  4GQO A;  5TP9 B;  4ZEB A;  1O7T A;  2RF1 A;  2A5S A;  4DXC A;  1NH7 A;  5DVI A;  2XXT A;  2HCA A;  1NH8 A;  3DP8 A;  4WEP A;  5DYH A;  1I6B A;  1MQJ A;  1B52 A;  3IK6 B;  4JXI A;  5A5X B;  1B9J A;  5FHN A;  5F7V A;  3T9X B;  5L9M A;  1LCT A;  3O2A A;  2E0S A;  1H45 A;  3QK6 A;  3KJ7 A;  3JZJ A;  1IIW A;  3H6W A;  3O6H A;  2Q88 A;  3WAE A;  5BWJ A;  5H8Q B;  1N84 A;  4Q0C A;  2HXW A;  1BP5 A;  2XXR A;  2F34 A;  3G7W A;  1AOV A;  1UIU A;  4LP2 B;  1ZTY A;  2YLN A;  1Q1K A;  2OBG A;  2WKY A;  2DVZ A;  2F78 A;  3KZG A;  4G8H A;  4M4G A;  2ZNT A;  4F1V A;  4FJP A;  2I6E A;  1S9T A;  3O6I A;  3PUW E;  3F11 A;  1MQI A;  1UQW A;  1B7Z A;  3TZA A;  2F97 A;  5KCJ B;  1DPP A;  2QSX A;  4N07 A;  5ICT A;  3D4C A;  4RJZ A;  2PT2 A;  3QAX A;  4F3S A;  3UIF A;  1ZU0 A;  4U1Z A;  4FAT A;  1PB9 A;  3SEW A;  2XXU A;  4NF4 A;  5AA4 A;  3MW0 A;  4ZEK A;  1JVY A;  2V3T A;  1NNP A;  3A3U A;  1XC1 A;  3FJ7 A;  3O6G A;  2VD2 A;  3FAS A;  1FQF A;  5KZT A;  3S9L C;  2HAU A;  4C1T A;  4ELP A;  4OER A;  1ELJ A;  2DWH A;  4XKR A;  3HPI A;  4IGT A;  4WED A;  3BFT A;  3MVX A;  4IO2 A;  1JNF A;  1YAE A;  3MZ1 A;  5DEX A;  4LON B;  4ESW A;  3CSG A;  3Q26 A;  4PFW A;  4EQ7 A;  3M3K A;  1DTZ A;  1B6H A;  2F36 A;  5HM4 B;  4EDP A;  5KDT A;  4DCX A;  3PPQ A;  2O84 X;  3DP4 A;  2OZZ A;  4OFO A;  4C0R A;  1TT1 A;  1D9Y A;  1II5 A;  4I9D A;  1US4 A;  1EZO A;  3G3K A;  4KCD A;  4JWY A;  3IJX B;  1DPE A;  4OEV A;  3G3F A;  2REJ A;  1BLF A;  2ZYM A;  2XHD A;  3OEK A;  3R26 A;  2QL3 A;  1B7H A;  4RA1 A;  5AA3 A;  3PPP A;  1SDX A;  3TCF A;  3O28 A;  3EN3 A;  4FE8 A;  4XXU A;  2QPQ A;  4Q30 B;  1M5F A;  4RK2 A;  5ITO A;  1US5 A;  1Q35 A;  4DCY A;  2NVU B;  4YB5 A;  3KN3 A;  5L8D A;  3MZ9 A;  4NE4 A;  1SD3 A;  4U2R A;  1B46 A;  1EZP A;  4ZDM A;  5H8N A;  5AA2 B;  1ANF A;  3TYH A;  3KN7 A;  2ONR A;  2DE4 A;  2Q2A A;  3K6W A;  3KGC A;  5AA4 B;  2UYF A;  4U22 A;  3Q27 A;  3OEL A;  1Y20 A;  4NED A;  4RNS A;  3OMB A;  2XXQ A;  3HST A;  1MPC A;  3FXU A;  2KLF A;  1MXX A;  3HV1 A;  2AL5 A;  1L5T A;  3IO6 A;  1QW0 A;  3PPO A;  3FAT A;  5BUU A;  4KD5 A;  2F7C A;  5M2V A;  1J1N A;  5DVF A;  1B4Z A;  4WKM A;  2X26 A;  3OSR A;  5KDT B;  4WXJ A;  2XXI A;  3PUZ E;  4YMB A;  3O9P A;  3KJT A;  1USY E;  4ZS9 A;  2F6G A;  2O1M A;  4H8J A;  1B0L A;  3AXF A;  1B3F A;  1USY H;  3RT6 B;  3MQ9 A;  3VLW A;  3T9U A;  2H4I A;  3WAF A;  2ZNS A;  3IOW A;  1UIV A;  1FW0 A;  5ICQ A;  3PUX E;  2ZNU A;  1IXC A;  3TKD A;  1GGG A;  1B0H A;  2I58 A;  2CMO A;  5H8N B;  4JB7 A;  5I59 A;  4OXV A;  2B3B A;  5AE4 A;  3CG1 A;  3TDJ A;  4BDR A;  4QF9 A;  2Z8F A;  3OO6 A;  4QSC A;  2XXX A;  1FTO A;  2P2A A;  4F19 A;  2R9J A;  5DTB A;  5HBC A;  1PC3 A;  3PMX A;  1EU8 A;  1MH3 A;  4EF1 A;  4BDL A;  3K1N A;  2D3I A;  2Y7P A;  4O3B A;  3Q28 A;  5IKB A;  1QUL A;  4LVQ A;  3KG2 A;  4POX A;  5I2K B;  1M5E A;  4PFT A;  1B5H A;  4FEC A;  3HO7 A;  4G2Z A;  3TAJ A;  3E3K A;  3IOT A;  4UAC A;  4NWD A;  3MVW A;  4YIC A;  4IGR A;  4N13 A;  3UGW A;  3IOU A;  2Q89 A;  5TP9 A;  4Q8R A;  1B2H A;  3IOV A;  1LAX A;  3U94 A;  1EZ9 A;  4MLQ A;  2Q2C A;  2D21 A;  3N6T A;  3T9H B;  1Y1M A;  2QRY A;  3TMG A;  5A5X A;  2H5Y A;  4OEU A;  1FTL A;  3PMV A;  1P99 A;  1LB9 A;  1R9Q A;  3QUF A;  1KWH A;  2DXR A;  4OHN A;  3BKI B;  1A7L A;  1SI1 A;  4DIG A;  4R73 A;  4H6D A;  4F3P A;  5J1D A;  1OLC A;  2BJJ X;  1B3G A;  5CM6 A;  4X48 A;  2AL4 A;  2DYX A;  1PDA A;  5TPA B;  2OCU A;  2QS1 A;  1MDP 1;  5H8Q A;  3PPN A;  2UVH A;  1MY3 A;  1TFD A;  2M8C A;  4KQP A;  3ZSF A;  3IOR A;  3MWB A;  3A3C A;  2OWS A;  4QHQ A;  1URG A;  4JSO A;  1VSO A;  1RKM A;  4R2B A;  3GBB A;  3FUZ A;  2F8D A;  3S4U A;  3PMW A;  2H99 A;  2RKM A;  1NKX A;  2ZXT A;  1B1X A;  1H76 A;  5JK4 A;  4LZ8 A;  4C1U A;  1PBP A;  4JWO A;  5JEI A;  4QSE A;  3MBP A;  4RPN A;  1B5J A;  1BKA A;  3CIJ A;  5KCJ A;  4GLI A;  4GWO A;  4OZ9 A;  2GH9 A;  1URD A;  3VVF A;  1LAH E;  1MH4 A;  3UOR A;  2PBW A;  3MPL A;  3RY3 A;  2UVI A;  1I6A A;  3VLU A;  2I48 A;  1FQE A;  4ZZE A;  4I8C A;  2G93 A;  4DDD A;  1PEB A;  1R6Z A;  1POY 1;  4OET A;  1MQH A;  3FJM A;  3FXR A;  2O6A A;  1JET A;  5H8F B;  4UA8 A;  1JEU A;  2NUV A;  4ZEF A;  4KPT A;  4F18 A;  2RC9 A;  2XX8 A;  4DE8 A;  4NF6 A;  3IB2 A;  1FQA A;  1P1O A;  3N5L A;  3CR9 A;  1QUK A;  4BLA A;  2F6P A;  1N7W A;  4OQO A;  3IO4 A;  3C34 A;  1H43 A;  4ND9 A;  2ESN A;  4LZ7 A;  4R9F A;  4DLD A;  3PPR A;  2RC8 A;  2X7P A;  2HEU A;  4PFY A;  3H03 A;  2P0S A;  2PVU A;  4QRZ A;  3RNN A;  4PE5 B;  2DXY A;  3M8U A;  3CI8 A;  1FTK A;  4ZZA A;  1GV8 A;  1POT A;  4MH5 A;  2H9B A;  4KCC A;  5K2X A;  4H1X A;  1NMU A;  3I6V A;  1XVX A;  5AA2 A;  3MC2 A;  3PUY E;  3PV0 E;  4X9T A;  3K1P A;  4K3F A;  3TUS A;  3T66 A;  3G3J A;  3IB0 A;  5B7D A;  4R6Y A;  3MP1 A;  3VDF A;  2FNC A;  3LBS A;  1BTJ A;  1Y4C A;  3JV9 A;  4Z0I A;  1VFD A;  2FYI A;  3O97 A;  3OO7 A;  3OSQ A;  4YAH X;  1ZLQ A;  2B3F A;  3A09 A;  1N3W A;  1PB7 A;  5F1Q A;  3VXB A;  3SKP A;  2H98 A;  2F5X A;  3TQW A;  1S7Y A;  2VP1 A;  2YJP A;  5FHO A;  3DLN A;  3PGF A;  1PB8 A;  4NF6 B;  2ZYK A;  3KEI A;  3U8Q A;  2FA7 A;  5ELV A;  3UA8 A;  2HFB A;  1MY2 A;  1Z7M E;  1ZBM A;  3PD9 A;  4G77 A;  4GD5 A;  2DVC A;  3S9M C;  2I3W A;  2DE2 A;  2V84 A;  3M3L A;  4THI A;  1M5D A;  3TQL A;  5CC2 A;  1MRP A;  4XKP A;  4KYS A;  4NTL A;  1YTV A;  4GXA A;  1MXY A;  4YB6 A;  1TFA A;  1N76 A;  4DXU A;  4MBP A;  4E0W A;  3IAZ A;  3SES A;  2V25 A;  3CFL A;  4LA9 A;  5L9S A;  2DP8 A;  1JW5 A;  5FHM A;  3E4R A;  1A40 A;  3MP6 A;  3FD3 A;  1H44 A;  1LB8 A;  2I49 A;  3FVK A;  1B5I A;  5I57 A;  4KI0 E;  3S9E A;  1NNF A;  3SET A;  4NWC A;  1ATG A;  2Z23 A;  2HAV A;  3OOA A;  1MXV A;  3H6T A;  1OMP A;  3L6G A;  1MY4 A;  1WVJ A;  2GHB A;  3VE1 B;  2OJT A;  1P1Q A;  2RCB A;  3CFX A;  5H8S A;  3SEV A;  2UXA A;  1Y3P A;  2XXV A;  1MQG A;  2I0B A;  1GR2 A;  4XTC Q;  2O68 A;  4R74 A;  4YKK A;  3RQT A;  1JVX A;  4JWX A;  3I5O A;  5I2K A;  3U92 A;  2F7A A;  5I58 B;  3IJO B;  2Y7R A;  1B32 A;  4XIG Q;  2ABH A;  3USD A;  2O1L A;  1XVY A;  3V8X B;  1UTB B;  4IY5 A;  1NNK A;  1B4H A;  1MPB A;  3TTR A;  3IX1 A;  1IUD A;  2QJE A;  4ISU A;  5HPQ A;  3TTM A;  1MXZ A;  1R9L A;  4FEB A;  5CBS A;  1IZ1 A;  4HW8 A;  3K4U A;  1ZJL A;  3H4Z A;  1OQH A;  3ILT B;  5LOM A;  3DM0 A;  3RTF B;  5AA1 A;  1LBB A;  4ZED A;  4P11 A;  2HQ0 A;  1MY1 A;  5CBR A;  4GF8 A;  4H8I A;  3FGS A;  3K0V A;  3O29 A;  4F1U A;  1WOD A;  2Z22 A;  4M1V A;  3KOS A;  3TTN A;  4EUO A;  5I57 B;  3RN8 A;  2Y7K A;  3ZS6 A;  1MM6 A;  1P1N A;  3ILU B;  5TPA A;  5JTY B;  1GVC A;  4OVJ A;  3BBR A;  3TTK A;  4R72 A;  2A5T A;  3K6U A;  4G68 A;  1N3X A;  1HSE A;  3V5A A;  1DSN A;  4PQJ A;  1Y9U A;  2YPN A;  5DVJ A;  4U4X A;  2O7I A;  2VOZ A;  4R2F A;  3TEL A;  1DMB A;  2DWI A;  3G3G A;  3MP8 A;  3VFJ A;  4RYA A;  3HHG A;  1LAF E;  4QFK A;  1IXG A;  3LSW A;  4OEN A;  3P7I A;  3C9H A;  4ELO A;  4HCW A;  3L6H A;  4G4P A;  1NFT A;  3TEP A;  1YCJ A;  4X1D A;  4F3B A;  1IQ7 A;  1OLA A;  1WDN A;  5EHS A;  1OQG A;  4RPO A;  4U1O A;  4TOZ A;  2R6G E;  3K00 A;  3H3G A;  3TTL A;  5I56 A;  3K02 A;  2F7B A;  2UVJ A;  2AYS A;  1D4N A;  4H0W A;  4NMY A;  2OLB A;  5CRY A;  2P1S A;  3B6W A;  3PU5 A;  5H8H A;  2XXH A;  3EHT A;  2HZL A;  3KBR A;  2O69 A;  2OK2 A;  4XKN A;  4ZE8 A;  2PT1 A;  1DOT A;  4BDM A;  4X1B A;  2ZMB A;  2DSF A;  4BDQ A;  3T93 B;  1LLS A;  4AB5 A;  1LFH A;  1B1H A;  5H8F A;  3E9X A;  4MF3 A;  3ECR A;  4ELR A;  4TLM B;  3QUJ A;  4F39 A;  1AH5 A;  4LZ5 A;  1A54 A;  4IO5 A;  1P1W A;  2IEE A;  4H5F A;  2A5T B;  4G68 B;  4NF5 B;  1QVS A;  3EQ1 A;  4HS7 A;  1A8F A;  5CMK A;  3SEU A;  3W15 C;  2O7U A;  1SBP A;  3KSX A;  1FQD A;  4IY6 A;  2IA4 A;  3SEY A;  3OO9 A;  1RYX A;  3RUM A;  3B7D A;  2THI A;  3FV1 A;  3VLV A;  1H3D A;  3V83 A;  4ZEC A;  1QUJ A;  1CE2 A;  3MVY A;  4FED A;  5I56 B;  4FOR A;  1I6Q A;  4HCY A;  4IO6 A;  1M5B A;  4OFL A;  5H8H B;  3C32 A;  4GL8 A;  1TWY A;  4N6P A;  2PYY A;  3EHS A;  3H6U A; 
#chains in the Genus database with same CATH topology
 4F3G A;  4MX6 A;  1MY0 A;  3VXC A;  4I3E A;  1QKA A;  1LFG A;  4OFJ A;  3RTW B;  3FVG A;  3IL1 B;  2PMS A;  4F1Y A;  4MJO A;  3KOT A;  2PFY A;  4PBH A;  1N0T A;  3PD8 A;  2ONS A;  4PFU A;  3S2V A;  3CFZ A;  1B05 A;  2R71 A;  3RLF E;  3LUY A;  2QMW A;  1XT8 A;  1MM7 A;  1HSL A;  2DOJ A;  3FVO A;  4YMA A;  1B3E A;  1Z7N E;  1ZMG A;  5CMB A;  3MUQ A;  1K9Y A;  4PP0 A;  5IM2 A;  5ISU A;  1SW5 A;  3O66 A;  3MPK A;  4AB6 A;  1QJM A;  5LTC A;  4MLV A;  4EXL A;  3QIM A;  4XKQ A;  3TCG A;  3VVD A;  5DT6 A;  3C36 A;  2I4B A;  1XS5 A;  1KA0 A;  2RCA A;  4QFL A;  3S9N C;  2NOO A;  3KSJ A;  3N6U A;  2UYE A;  2XXP A;  1NL5 A;  4OVT A;  1UTH B;  3KFM A;  3ROJ A;  4AQ4 A;  4O3C A;  2V3Q A;  4IO4 A;  3G3H A;  2ALU A;  2FHY A;  4P0I A;  3U72 A;  3K2D A;  2VGQ A;  3MJN A;  5I84 A;  4F22 A;  1QUI A;  1A99 A;  1B3H A;  1A55 A;  2QS4 A;  3OEM A;  1HSJ A;  3VVE A;  2W7Y A;  2GRV A;  2JJK A;  1RDY A;  4F29 A;  2RIN A;  1M5C A;  2X7Q A;  4NHB A;  3EF7 A;  2RC7 A;  4Z7E A;  5CMC A;  1T0K A;  3CVG A;  4OWD A;  3R6U A;  2E1S A;  2ZYO A;  2OX3 A;  3G3I A;  4YKJ A;  1Q9D A;  3C31 A;  2D5W A;  4FIM A;  3ODB A;  1SW2 A;  4TLL B;  1GTK A;  2B65 A;  2G29 A;  3HFU A;  3LSL A;  3U1O A;  3SER A;  2ZZW A;  4PFI A;  4GRK A;  1JW1 A;  1AIV A;  1B58 A;  4QFO A;  4F31 B;  4U21 A;  4PGP A;  3SZP A;  4JDF A;  1N7X A;  4YZZ A;  3FV2 A;  4G61 A;  4H5G A;  2Q9T A;  1K9Z A;  1SQY A;  3EHU A;  1YYZ A;  4IO3 A;  4H67 A;  1O63 A;  1SYH A;  4N91 A;  1Y1Z A;  5I58 A;  4POW A;  1FJ6 A;  3K01 A;  4IO7 A;  4IB2 A;  4QFP A;  2XX9 A;  2DQV A;  3U93 A;  2AIX A;  4FAJ A;  1JW4 A;  1VFE A;  1UTB A;  2ONK E;  3FBP A;  1AL3 A;  5EYG A;  3BIG A;  4YB7 A;  4YKP A;  2Y7W A;  3T96 B;  1OVB A;  1LFI A;  3ZKL A;  3LC8 A;  4LAT A;  2NXO A;  2V3U A;  4MIJ A;  1EH3 A;  1IXI A;  3FXQ A;  1I69 A;  1D3K A;  3T9V A;  1SW1 A;  5K2Y A;  3K1M A;  4GXS B;  4KYE A;  1SI0 A;  3R7X A;  3BIH A;  1LST A;  4X04 A;  4MFI A;  4KXP A;  2GFE A;  4O3A A;  2GHA A;  5ET6 A;  4ESX A;  1RYO A;  1G0H A;  1FQB A;  2I4C A;  1MQD A;  3TFL A;  4RXL A;  3W9W A;  4U23 A;  4DI4 B;  5ET5 A;  2I0C A;  5EHM A;  1ZIU A;  4OTE A;  4Q5T A;  3ONM A;  4OMB A;  5CMM A;  4EF2 A;  5JTY A;  4GBV A;  1FTA A;  2UVG A;  2P3V A;  1FCK A;  4NF4 B;  1EYK A;  3C35 A;  2ZZV A;  2DWJ A;  2QS3 A;  4I62 A;  1IEJ A;  1LCF A;  3Q29 A;  3ZKK A;  2B4L A;  2HZK A;  4MMP A;  4G8N A;  5ESY A;  5B70 A;  2Y7I A;  5FTI A;  1NV1 A;  2P3N A;  1JEV A;  5ITP A;  1XOC A;  1AMF A;  3VV5 A;  4F2Q A;  4BDN A;  2DE3 A;  3UP9 A;  4EQB A;  5IAI A;  3PTY A;  5DEX B;  3GBA A;  4MNP A;  4BDO A;  3I3V A;  1CB6 A;  2Q8J A;  4H45 A;  2GQ1 A;  1FBG A;  3FJG A;  1FPG A;  1P1U A;  3W9V A;  2PX1 A;  3V89 B;  1FBP A;  1QGX A;  1FBE A;  3FZV A;  4I1D A;  4R75 A;  3LR1 A;  3LV0 A;  1FPF A;  1VR5 A;  1INP A;  4HE0 A;  1ZKB A;  4PTK A;  1DK4 A;  1LBZ A;  4F2O A;  4GFR A;  3RT8 A;  2VD3 A;  5TU0 A;  3TOD A;  4RK9 A;  4JSD A;  4KR5 A;  1Y3N A;  2F35 A;  2OWZ A;  3TCH A;  3C33 A;  3HN0 A;  3RGY A;  4DXB A;  5I2N A;  4OVR A;  4ECF A;  1B7U A;  2DS9 A;  3DEL B;  1URS A;  4U4S A;  1LAG E;  3K6V A;  2XXW A;  4ZEI A;  3C4M A;  4R9G A;  4YU0 A;  1Y3Q A;  3SDF A;  3UN6 A;  1Y4T A;  3B6Q A;  2KR0 A;  4HTG A;  1R1N A;  1B51 A;  3CHG A;  4TQU Q;  1O64 A;  1LGB C;  3H7M A;  3BFU A;  4LUB A;  4P0G A;  2Y84 A;  4QFN A;  3TPA A;  1YPN A;  2Z8E A;  3IR1 A;  3T22 A;  4KHZ E;  4EXK A;  4NF5 A;  4ZE9 A;  2VHA A;  5EYF A;  4NF8 A;  3D4G A;  1FTM A;  1OIB A;  1BIY A;  2ZYN A;  3M3F A;  3N26 A;  2B4M A;  1MG1 A;  3SEX A;  1FQC A;  1D9V A;  4PET A;  1MXU A;  1FPB A;  1NV5 A;  2QMX A;  3KN8 A;  1FBF A;  2F3B A;  3Q25 A;  4R6H A;  1IMB A;  3H06 B;  1SW4 A;  1N04 A;  4GL0 A;  5EYH A;  4OES A;  4HXV A;  3MVZ A;  1S50 A;  2DWA A;  3GLB A;  3LSF B;  3QYT A;  4GIZ A;  3HHF A;  3JYR A;  1DTG A;  2QVR A;  3N94 A;  3EPE A;  4ELQ A;  1OVT A;  2QS2 A;  2XD2 A;  5L9O A;  3UK4 A;  2LAO A;  3MAM A;  4G68 C;  4P9K A;  2REG A;  3HCQ A;  2CZH A;  4NG7 A;  3B6T A;  3LSX A;  3MZB A;  1MS7 A;  5FTH A;  3OO8 A;  5LDZ A;  1IIT A;  3DP6 A;  5I2N B;  4RY1 A;  3FIR A;  4EQ9 A;  4OYV A;  2V93 A;  3OD7 A;  4LQ2 A;  4PC9 A;  4KYD A;  1NNT A;  3E13 X;  2Z8D A;  1PBQ A;  4GOT A;  1FJ9 A;  2ANJ A;  2OWT A;  1FTJ A;  3CSB A;  3QSL A;  3CG3 A;  5I59 B;  3H6V A;  1LBC A;  1B3L A;  2NWJ A;  2WYK A;  3THI A;  4N4U A;  1NUW A;  4NF8 B;  1MXW A;  2XD3 A;  1IXH A;  3K6X A;  1TXF A;  4PCD A;  3GZG A;  2XXY A;  2I3V A;  4YKI A;  1MDQ A;  3OXN A;  4L17 A;  3EKI A;  1UTH A;  4LQ5 A;  3RPW A;  1DBZ A;  5AA2 D;  4I3Y A;  4ONY A;  1QKB A;  3FVN A;  1SYI A;  1F9B A;  5EQ7 A;  4KFQ A;  3PUV E;  4QSD A;  2XX7 A;  4E0X A;  1MPD A;  2H25 A;  1JQF A;  1NV6 A;  5CI5 A;  1XHY A;  3QXM A;  4GVO A;  3CRB A;  1A8E A;  4H65 A;  1SVX B;  1LBY A;  4R6K A;  1VE4 A;  3GXA A;  4JBZ A;  2O51 A;  4DZ1 A;  2CZL A;  1EYI A;  1FPI A;  4G8M A;  3OEN A;  1B40 A;  3IB1 A;  4GQO A;  5TP9 B;  4ZEB A;  1O7T A;  2RF1 A;  2A5S A;  4FBP A;  4DXC A;  1NH7 A;  5DVI A;  1XI6 A;  2XXT A;  2HCA A;  1NH8 A;  3DP8 A;  4P1E A;  4WEP A;  5DYH A;  1I6B A;  3B8B A;  1G0I A;  1MQJ A;  1B52 A;  3IK6 B;  4JXI A;  5A5X B;  1FSA A;  1B9J A;  5FHN A;  2WBD A;  2FBP A;  5F7V A;  3D1R A;  3T9X B;  5L9M A;  1LCT A;  1FPD A;  3O2A A;  2E0S A;  1H45 A;  3QK6 A;  3KJ7 A;  3JZJ A;  1IIW A;  3H6W A;  3O6H A;  2Q88 A;  3WAE A;  3E79 A;  5BWJ A;  1IMA A;  5H8Q B;  2PFZ A;  1N84 A;  1IME A;  4Q0C A;  2HXW A;  1BP5 A;  2XXR A;  2F34 A;  3G7W A;  1AOV A;  1UIU A;  4LP2 B;  1ZTY A;  2YLN A;  1Q1K A;  2OBG A;  2WKY A;  2DVZ A;  1LBV A;  2F78 A;  3KZG A;  4G8H A;  4M4G A;  2ZNT A;  4F1V A;  4FJP A;  2I6E A;  4O7M A;  2HHM A;  1S9T A;  4LN5 A;  1RDZ A;  3O6I A;  3PUW E;  3F11 A;  1MQI A;  1UQW A;  1B7Z A;  2Q74 A;  3TZA A;  2F97 A;  5KCJ B;  1DPP A;  2QSX A;  4N07 A;  5ICT A;  3D4C A;  1NUX A;  2FIX A;  2VPN A;  4RJZ A;  2PT2 A;  3MYU A;  3QAX A;  4F3S A;  3UIF A;  1ZU0 A;  4U1Z A;  4FAT A;  1PB9 A;  3SEW A;  2XXU A;  4NF4 A;  5AA4 A;  3MW0 A;  4ZEK A;  1JVY A;  2V3T A;  1NNP A;  1FPL A;  3A3U A;  1XC1 A;  3FJ7 A;  3O6G A;  2VD2 A;  3FAS A;  1FQF A;  5KZT A;  3S9L C;  2HAU A;  4C1T A;  4ELP A;  4OER A;  1ELJ A;  2CZI A;  2DWH A;  4XKR A;  3HPI A;  5IZ3 B;  2Y5K A;  4IGT A;  4WED A;  3BFT A;  3MVX A;  4IO2 A;  4N15 A;  1JNF A;  1YAE A;  4GWX A;  3MZ1 A;  5DEX A;  4LON B;  4ESW A;  3CSG A;  3Q26 A;  4PFW A;  4EQ7 A;  3M3K A;  3IFA A;  4NN3 A;  1DTZ A;  1B6H A;  4O94 A;  2F36 A;  5HM4 B;  4EDP A;  5KDT A;  4DCX A;  3PPQ A;  2O84 X;  3DP4 A;  2OZZ A;  5EQA A;  4OFO A;  4C0R A;  1TT1 A;  2WYP A;  5IZZ A;  1D9Y A;  1II5 A;  4JVI A;  4I9D A;  1SPI A;  1US4 A;  2CZK A;  1EZO A;  3G3K A;  2F3D A;  4KCD A;  4JWY A;  3IJX B;  1DPE A;  4OEV A;  2XXK A;  3G3F A;  2REJ A;  1BLF A;  2ZYM A;  2XHD A;  3OEK A;  3R26 A;  2QL3 A;  1B7H A;  4RA1 A;  5AA3 A;  3PPP A;  2R8T A;  1SDX A;  3TCF A;  3O28 A;  3EN3 A;  4FE8 A;  4XXU A;  4PDH A;  2QPQ A;  4Q30 B;  1M5F A;  4RK2 A;  5ITO A;  2FIE A;  1US5 A;  1Q35 A;  4DCY A;  2NVU B;  4YB5 A;  3KN3 A;  5L8D A;  1CNQ A;  3MZ9 A;  4NE4 A;  1SD3 A;  4U2R A;  1B46 A;  1EZP A;  4N81 A;  4ZDM A;  5H8N A;  5AA2 B;  1ANF A;  3TYH A;  3KN7 A;  2ONR A;  2DE4 A;  2Q2A A;  3K6W A;  3KGC A;  5AA4 B;  1KA1 A;  2UYF A;  4U22 A;  3Q27 A;  3OEL A;  1Y20 A;  4NED A;  4RNS A;  3OMB A;  2XXQ A;  3HST A;  4MAG A;  1MPC A;  3FXU A;  2KLF A;  1MXX A;  5A5L A;  3HV1 A;  2AL5 A;  1L5T A;  3IO6 A;  1QW0 A;  3PPO A;  3KC0 A;  3FAT A;  5BUU A;  4KD5 A;  2F7C A;  5M2V A;  1J1N A;  5DVF A;  1B4Z A;  4N6K A;  4WKM A;  2X26 A;  3OSR A;  5KDT B;  4WXJ A;  2XXI A;  3PUZ E;  4PAF A;  4YMB A;  3O9P A;  3KJT A;  1USY E;  4ZS9 A;  2F6G A;  2O1M A;  4H8J A;  1B0L A;  3AXF A;  4UAB A;  1B3F A;  1USY H;  3RT6 B;  3MQ9 A;  3VLW A;  4PFB A;  4P8B A;  3T9U A;  2H4I A;  3WAF A;  2ZNS A;  3IOW A;  2V4C A;  1UIV A;  1FW0 A;  5ICQ A;  3PUX E;  2ZNU A;  1IXC A;  3TKD A;  4I40 A;  1YXI A;  4XF5 A;  3E78 A;  1GGG A;  1B0H A;  2I58 A;  5IGA A;  2CMO A;  2FVZ A;  1YZ0 A;  5H8N B;  4JB7 A;  5I59 A;  4OXV A;  4NAP A;  2B3B A;  5AE4 A;  1LEV A;  3CG1 A;  3TDJ A;  4BDR A;  4QF9 A;  2Z8F A;  3OO6 A;  4QSC A;  3RPL A;  2XXX A;  1FTO A;  2P2A A;  4F19 A;  2R9J A;  5DTB A;  5HBC A;  1PC3 A;  3PMX A;  1EU8 A;  1MH3 A;  4EF1 A;  5EQ8 A;  4IR8 A;  4BDL A;  3K1N A;  2D3I A;  4PF6 A;  2Y7P A;  4O3B A;  3Q28 A;  5IKB A;  1QUL A;  4LVQ A;  3KG2 A;  4POX A;  5I2K B;  1M5E A;  4PFT A;  1B5H A;  4FEC A;  3HO7 A;  4G2Z A;  1NI9 A;  3TAJ A;  3E3K A;  3IOT A;  4UAC A;  4NWD A;  3MVW A;  4YIC A;  4IGR A;  4N13 A;  4O8M A;  3UGW A;  3IOU A;  2Q89 A;  2XA5 A;  5TP9 A;  4JVC A;  4Q8R A;  1B2H A;  3IOV A;  4OVS A;  3KBZ A;  2VT5 A;  4QBA A;  4OA4 A;  4GWY A;  1LAX A;  3U94 A;  1EZ9 A;  4MLQ A;  2Q2C A;  2D21 A;  4PAK A;  3N6T A;  3T9H B;  1Y1M A;  2QRY A;  3TMG A;  5A5X A;  2H5Y A;  4OEU A;  1FTL A;  3PMV A;  1P99 A;  1LB9 A;  1R9Q A;  3QUF A;  1KWH A;  2DXR A;  1IMD A;  4OHN A;  3BKI B;  1A7L A;  1SI1 A;  4DIG A;  4R73 A;  1D9Q A;  4H6D A;  4F3P A;  5F24 A;  5J1D A;  3RPL B;  1NV2 A;  1OLC A;  2BJJ X;  1B3G A;  5CM6 A;  4X48 A;  2AL4 A;  2DYX A;  1PDA A;  5TPA B;  2OCU A;  3LUZ A;  2QS1 A;  1MDP 1;  5H8Q A;  3PPN A;  2UVH A;  1MY3 A;  1TFD A;  2M8C A;  4KQP A;  3ZSF A;  3IOR A;  3MWB A;  4GWZ A;  4MEV A;  3A3C A;  2OWS A;  4QHQ A;  1URG A;  4JSO A;  1VSO A;  1RKM A;  4R2B A;  3GBB A;  3FUZ A;  5ET8 A;  2F8D A;  3S4U A;  3PMW A;  4GX4 A;  4MHF A;  2H99 A;  2RKM A;  1NKX A;  2ZXT A;  1B1X A;  1H76 A;  5JK4 A;  4LZ8 A;  4C1U A;  2ZZX A;  1PBP A;  4JWO A;  5JEI A;  4QSE A;  3MBP A;  4RPN A;  1B5J A;  1BKA A;  3CIJ A;  5KCJ A;  4GLI A;  4GWO A;  4OZ9 A;  2GH9 A;  1URD A;  3VVF A;  1LAH E;  2WEF A;  1MH4 A;  4PBQ A;  3UOR A;  2PBW A;  3MPL A;  3RY3 A;  2UVI A;  1I6A A;  4GWU A;  3VLU A;  4PE3 A;  2I48 A;  1NV7 A;  1FQE A;  4ZZE A;  5EQ9 A;  4I8C A;  4JVD A;  2VPO A;  1FBD A;  5IZ3 A;  4MNC A;  2G93 A;  4DDD A;  1PEB A;  1R6Z A;  4PAI A;  1POY 1;  4OET A;  1MQH A;  3FJM A;  3FXR A;  2O6A A;  4PGN A;  1JET A;  5H8F B;  4N17 A;  4UA8 A;  1LBW A;  2L5V A;  1JEU A;  2NUV A;  4ZEF A;  4KPT A;  4F18 A;  2RC9 A;  4OVQ A;  2XX8 A;  4DE8 A;  4NF6 A;  3IB2 A;  1FQA A;  4AS4 A;  1P1O A;  3N5L A;  3CR9 A;  1QUK A;  4BLA A;  2F6P A;  2QVV A;  3T1B A;  1N7W A;  2WBB A;  4OQO A;  3IO4 A;  4PF8 A;  3C34 A;  1H43 A;  4ND9 A;  2ESN A;  4LZ7 A;  4R9F A;  3KC1 A;  4DLD A;  3PPR A;  2RC8 A;  2X7P A;  2HEU A;  4PFY A;  3H03 A;  2P0S A;  2PVU A;  4QRZ A;  2QVU A;  3RNN A;  5DW8 A;  4PE5 B;  2DXY A;  1IMF A;  3M8U A;  3CI8 A;  1FTK A;  4ZZA A;  1GV8 A;  1POT A;  4MH5 A;  2H9B A;  1EYJ A;  4KCC A;  5K2X A;  4H1X A;  2MKZ A;  1FPK A;  1NMU A;  3I6V A;  1XVX A;  2XWK A;  5AA2 A;  3MC2 A;  4NX1 A;  3PUY E;  3PV0 E;  4X9T A;  3K1P A;  4K3F A;  3TUS A;  3T66 A;  3G3J A;  3IB0 A;  5B7D A;  4R6Y A;  3MP1 A;  3VDF A;  2FNC A;  3LBS A;  1BTJ A;  1Y4C A;  3JV9 A;  4Z0I A;  1VFD A;  3IFC A;  2FYI A;  3O97 A;  3OO7 A;  3OSQ A;  4YAH X;  1ZLQ A;  2B3F A;  3A09 A;  1N3W A;  4N8G A;  1PB7 A;  5F1Q A;  3VXB A;  3SKP A;  4GX6 A;  5FBP A;  2H98 A;  2F5X A;  3TQW A;  1S7Y A;  1FBC A;  4QXD A;  2VP1 A;  2YJP A;  5FHO A;  3DLN A;  4PFR A;  2QFL A;  3PGF A;  4MNI A;  1PB8 A;  4NF6 B;  2ZYK A;  3KEI A;  3U8Q A;  2XWV A;  2FA7 A;  5ELV A;  3UA8 A;  2HFB A;  1MY2 A;  1Z7M E;  1ZBM A;  3PD9 A;  4G77 A;  4GD5 A;  2DVC A;  3S9M C;  2I3W A;  2DE2 A;  2V84 A;  3M3L A;  4THI A;  3MST A;  1M5D A;  3TQL A;  5CC2 A;  1MRP A;  4XKP A;  4KYS A;  4NTL A;  1YTV A;  2Q8M A;  4GXA A;  4N6D A;  1MXY A;  4YB6 A;  1TFA A;  1N76 A;  4DXU A;  4MBP A;  4NGU A;  4E0W A;  3IAZ A;  1VDW A;  3SES A;  2V25 A;  3CFL A;  4LA9 A;  2XWI A;  4P1L A;  5L9S A;  2DP8 A;  1JW5 A;  5FHM A;  3E4R A;  3NOH A;  1A40 A;  3MP6 A;  3FD3 A;  5T3J A;  1H44 A;  1LB8 A;  2I49 A;  3FVK A;  1B5I A;  1JP4 A;  5I57 A;  4KI0 E;  3S9E A;  1NNF A;  3SET A;  3U65 A;  4NWC A;  1ATG A;  2Z23 A;  2HAV A;  3OOA A;  1MXV A;  2Y5L A;  3H6T A;  1OMP A;  3L6G A;  1MY4 A;  1WVJ A;  2GHB A;  4XFE A;  3VE1 B;  1NV3 A;  2PCR A;  2OJT A;  1P1Q A;  2RCB A;  3CFX A;  4GWW A;  5H8S A;  3SEV A;  2UXA A;  1Y3P A;  2XWO A;  2XXV A;  1MQG A;  2I0B A;  1GR2 A;  1RDX A;  4XTC Q;  2O68 A;  4R74 A;  4YKK A;  3RQT A;  2CEX A;  1JVX A;  4HE2 A;  1NV0 A;  4JWX A;  3I5O A;  5I2K A;  3U92 A;  2F7A A;  5I58 B;  3IJO B;  4H46 A;  2Y7R A;  1B32 A;  4XIG Q;  2ABH A;  4HE1 A;  3USD A;  2O1L A;  1XVY A;  3V8X B;  1UTB B;  4IY5 A;  1NNK A;  3B50 A;  1B4H A;  1MPB A;  4O7I A;  3IX1 A;  3TTR A;  5J16 A;  1IUD A;  1FBH A;  4P3L A;  2QJE A;  4ISU A;  4AS5 A;  5HPQ A;  3TTM A;  1MXZ A;  1R9L A;  4FEB A;  5CBS A;  1IZ1 A;  4HW8 A;  3K4U A;  1ZJL A;  5IZ1 A;  3H4Z A;  1OQH A;  3ILT B;  5LOM A;  3DM0 A;  3RTF B;  5AA1 A;  1LBB A;  1LBX A;  4ZED A;  4P11 A;  5I5P A;  2HQ0 A;  1MY1 A;  5CBR A;  4GF8 A;  4H8I A;  2BJI A;  3FGS A;  3K0V A;  3O29 A;  4F1U A;  1WOD A;  4GBW A;  2Z22 A;  4XEQ A;  4M1V A;  3KOS A;  3TTN A;  4OVP A;  4EUO A;  3FXB A;  5I57 B;  3GYY A;  3RN8 A;  2Y7K A;  3ZS6 A;  1MM6 A;  1P1N A;  3ILU B;  5TPA A;  5JTY B;  4NF0 A;  1GVC A;  4OVJ A;  3BBR A;  3TTK A;  4R72 A;  1KZ8 A;  2A5T A;  3K6U A;  4G68 A;  1N3X A;  1HSE A;  3V5A A;  1DSN A;  4PQJ A;  1Y9U A;  2YPN A;  5DVJ A;  4U4X A;  2O7I A;  2VOZ A;  3ISP A;  4R2F A;  3TEL A;  1DCU A;  1DMB A;  1BK4 A;  2DWI A;  3G3G A;  3MP8 A;  3RYD A;  3VFJ A;  1AWB A;  4MCO A;  3HHG A;  4GX3 A;  4RYA A;  1LAF E;  4QFK A;  1IXG A;  1IMC A;  3LSW A;  4OEN A;  3P7I A;  3C9H A;  4ELO A;  4HCW A;  3L6H A;  4G4P A;  1NFT A;  3TEP A;  1YCJ A;  4X1D A;  4F3B A;  1IQ7 A;  1OLA A;  1WDN A;  5EHS A;  1OQG A;  4RPO A;  4U1O A;  4TOZ A;  1NV4 A;  2R6G E;  3K00 A;  3H3G A;  2DDK A;  3TTL A;  5I56 A;  3K02 A;  2F7B A;  2UVJ A;  2AYS A;  1D4N A;  1NUZ A;  4NMY A;  4H0W A;  1NUY A;  2OLB A;  5CRY A;  2P1S A;  3B6W A;  3PU5 A;  5H8H A;  2XXH A;  3EHT A;  2HZL A;  3KBR A;  2O69 A;  2OK2 A;  3QMF A;  2KQZ A;  4XKN A;  5I3S A;  4GWS A;  4ZE8 A;  2PT1 A;  1FPE A;  1DOT A;  4BDM A;  4X1B A;  2ZMB A;  2DSF A;  4BDQ A;  4N8Y A;  3T93 B;  5I7I A;  1LLS A;  4AB5 A;  5ET7 A;  1LFH A;  1B1H A;  5H8F A;  3E9X A;  4MF3 A;  3ECR A;  4X8R A;  4ELR A;  4TLM B;  2CEY A;  2HXR A;  3QUJ A;  4F39 A;  1AH5 A;  4LZ5 A;  1A54 A;  1FRP A;  4IO5 A;  2HPG A;  1P1W A;  2IEE A;  4H5F A;  2A5T B;  2WX9 A;  4G68 B;  4NF5 B;  1QVS A;  4P47 A;  3EQ1 A;  4HS7 A;  1A8F A;  5CMK A;  3SEU A;  4OAN A;  3W15 C;  2O7U A;  1SBP A;  3KSX A;  1FQD A;  4IY6 A;  2IA4 A;  3SEY A;  3OO9 A;  1RYX A;  3T0J A;  1FPJ A;  3RUM A;  4P56 A;  3B7D A;  2THI A;  3FV1 A;  3VLV A;  1H3D A;  3V83 A;  4ZEC A;  1QUJ A;  1CE2 A;  3MVY A;  4DI3 D;  4FED A;  5I56 B;  4FOR A;  4PDD A;  1I6Q A;  4HCY A;  4IO6 A;  4NQ8 A;  1M5B A;  4OFL A;  5H8H B;  3C32 A;  4GL8 A;  1TWY A;  3A29 A;  4N6P A;  2PYY A;  3EHS A;  3H6U A; 
#chains in the Genus database with same CATH homology
 4F3G A;  1MY0 A;  3VXC A;  1QKA A;  1LFG A;  4OFJ A;  3RTW B;  3FVG A;  3IL1 B;  2PMS A;  4F1Y A;  3KOT A;  1N0T A;  3PD8 A;  2ONS A;  4PFU A;  3S2V A;  3CFZ A;  1B05 A;  2R71 A;  3RLF E;  3LUY A;  2QMW A;  1XT8 A;  1MM7 A;  1HSL A;  2DOJ A;  3FVO A;  4YMA A;  1B3E A;  1Z7N E;  1ZMG A;  5CMB A;  3MUQ A;  4PP0 A;  5ISU A;  1SW5 A;  3O66 A;  3MPK A;  4AB6 A;  1QJM A;  4MLV A;  4EXL A;  3QIM A;  4XKQ A;  3TCG A;  3VVD A;  5DT6 A;  3C36 A;  2I4B A;  1XS5 A;  2RCA A;  4QFL A;  3S9N C;  2NOO A;  3KSJ A;  3N6U A;  2UYE A;  2XXP A;  1NL5 A;  1UTH B;  3KFM A;  4AQ4 A;  4O3C A;  2V3Q A;  4IO4 A;  3G3H A;  2ALU A;  4P0I A;  3U72 A;  3K2D A;  2VGQ A;  3MJN A;  5I84 A;  4F22 A;  1QUI A;  1A99 A;  1B3H A;  1A55 A;  2QS4 A;  3OEM A;  1HSJ A;  3VVE A;  2W7Y A;  2GRV A;  4F29 A;  2RIN A;  1M5C A;  2X7Q A;  3EF7 A;  2RC7 A;  4Z7E A;  5CMC A;  1T0K A;  3CVG A;  4OWD A;  3R6U A;  2E1S A;  2ZYO A;  3G3I A;  4YKJ A;  3C31 A;  2D5W A;  4FIM A;  3ODB A;  1SW2 A;  4TLL B;  1GTK A;  2B65 A;  2G29 A;  3LSL A;  3U1O A;  3SER A;  4GRK A;  1JW1 A;  1AIV A;  1B58 A;  4QFO A;  4F31 B;  4U21 A;  4JDF A;  1N7X A;  4YZZ A;  3FV2 A;  4H5G A;  2Q9T A;  1SQY A;  3EHU A;  4IO3 A;  4H67 A;  1O63 A;  1SYH A;  1Y1Z A;  5I58 A;  4POW A;  3K01 A;  4IO7 A;  4IB2 A;  4QFP A;  2XX9 A;  2DQV A;  3U93 A;  2AIX A;  4FAJ A;  1JW4 A;  1VFE A;  1UTB A;  2ONK E;  1AL3 A;  4YB7 A;  4YKP A;  2Y7W A;  3T96 B;  1OVB A;  1LFI A;  3ZKL A;  3LC8 A;  4LAT A;  2NXO A;  2V3U A;  1EH3 A;  1IXI A;  3FXQ A;  1I69 A;  1D3K A;  3T9V A;  1SW1 A;  5K2Y A;  3K1M A;  4GXS B;  4KYE A;  1SI0 A;  3R7X A;  1LST A;  4MFI A;  2GFE A;  4O3A A;  2GHA A;  4ESX A;  1RYO A;  1FQB A;  2I4C A;  1MQD A;  3TFL A;  4RXL A;  3W9W A;  4U23 A;  2I0C A;  5EHM A;  1ZIU A;  4OTE A;  4Q5T A;  3ONM A;  4OMB A;  5CMM A;  4EF2 A;  5JTY A;  2UVG A;  1FCK A;  4NF4 B;  3C35 A;  2DWJ A;  2QS3 A;  4I62 A;  1IEJ A;  1LCF A;  3Q29 A;  3ZKK A;  2HZK A;  4G8N A;  5B70 A;  2Y7I A;  5FTI A;  1JEV A;  5ITP A;  1XOC A;  1AMF A;  3VV5 A;  4F2Q A;  4BDN A;  2DE3 A;  3UP9 A;  4EQB A;  5IAI A;  5DEX B;  3GBA A;  4BDO A;  3I3V A;  1CB6 A;  2Q8J A;  3FJG A;  1P1U A;  3W9V A;  2PX1 A;  3V89 B;  3FZV A;  4I1D A;  4R75 A;  3LR1 A;  1VR5 A;  1ZKB A;  4F2O A;  4GFR A;  3RT8 A;  2VD3 A;  5TU0 A;  3TOD A;  4RK9 A;  4JSD A;  4KR5 A;  1Y3N A;  2F35 A;  3TCH A;  3C33 A;  3HN0 A;  3RGY A;  4DXB A;  5I2N A;  4ECF A;  1B7U A;  2DS9 A;  3DEL B;  1URS A;  4U4S A;  1LAG E;  3K6V A;  2XXW A;  4ZEI A;  3C4M A;  4R9G A;  4YU0 A;  1Y3Q A;  3SDF A;  3UN6 A;  1Y4T A;  3B6Q A;  4HTG A;  1R1N A;  1B51 A;  4TQU Q;  1O64 A;  1LGB C;  3H7M A;  3BFU A;  4LUB A;  4P0G A;  2Y84 A;  3TPA A;  4QFN A;  1YPN A;  2Z8E A;  3IR1 A;  3T22 A;  4KHZ E;  4EXK A;  4NF5 A;  4ZE9 A;  2VHA A;  5EYF A;  4NF8 A;  3D4G A;  1FTM A;  1OIB A;  1BIY A;  2ZYN A;  3M3F A;  3N26 A;  1MG1 A;  3SEX A;  1FQC A;  1D9V A;  4PET A;  1MXU A;  2QMX A;  3KN8 A;  3Q25 A;  4R6H A;  3H06 B;  1SW4 A;  1N04 A;  4GL0 A;  4OES A;  3MVZ A;  1S50 A;  2DWA A;  3GLB A;  3LSF B;  3QYT A;  4GIZ A;  3HHF A;  3JYR A;  1DTG A;  3N94 A;  3EPE A;  4ELQ A;  1OVT A;  2QS2 A;  2XD2 A;  5L9O A;  3UK4 A;  2LAO A;  3MAM A;  4G68 C;  2REG A;  3HCQ A;  3B6T A;  3LSX A;  3MZB A;  1MS7 A;  5FTH A;  3OO8 A;  1IIT A;  3DP6 A;  5I2N B;  4RY1 A;  3FIR A;  4EQ9 A;  4OYV A;  2V93 A;  3OD7 A;  4LQ2 A;  4KYD A;  1NNT A;  3E13 X;  2Z8D A;  1PBQ A;  4GOT A;  2ANJ A;  2OWT A;  1FTJ A;  3CSB A;  3QSL A;  3CG3 A;  5I59 B;  3H6V A;  1LBC A;  1B3L A;  2NWJ A;  3THI A;  4NF8 B;  1MXW A;  2XD3 A;  1IXH A;  3K6X A;  1TXF A;  3GZG A;  2XXY A;  2I3V A;  4YKI A;  1MDQ A;  3OXN A;  4L17 A;  1UTH A;  4LQ5 A;  3RPW A;  5AA2 D;  4ONY A;  1QKB A;  3FVN A;  1SYI A;  1F9B A;  4KFQ A;  3PUV E;  4QSD A;  2XX7 A;  4E0X A;  1MPD A;  2H25 A;  1JQF A;  5CI5 A;  1XHY A;  3QXM A;  4GVO A;  3CRB A;  1A8E A;  4H65 A;  1SVX B;  4R6K A;  1VE4 A;  3GXA A;  4JBZ A;  2O51 A;  4DZ1 A;  2CZL A;  4G8M A;  3OEN A;  1B40 A;  3IB1 A;  4GQO A;  5TP9 B;  4ZEB A;  1O7T A;  2RF1 A;  2A5S A;  4DXC A;  1NH7 A;  5DVI A;  2XXT A;  2HCA A;  1NH8 A;  3DP8 A;  4WEP A;  5DYH A;  1I6B A;  1MQJ A;  1B52 A;  3IK6 B;  4JXI A;  5A5X B;  1B9J A;  5FHN A;  5F7V A;  3T9X B;  5L9M A;  1LCT A;  3O2A A;  2E0S A;  1H45 A;  3QK6 A;  3KJ7 A;  3JZJ A;  1IIW A;  3H6W A;  3O6H A;  2Q88 A;  3WAE A;  5BWJ A;  5H8Q B;  1N84 A;  4Q0C A;  2HXW A;  1BP5 A;  2XXR A;  2F34 A;  3G7W A;  1AOV A;  1UIU A;  4LP2 B;  1ZTY A;  2YLN A;  1Q1K A;  2OBG A;  2WKY A;  2DVZ A;  2F78 A;  3KZG A;  4G8H A;  4M4G A;  2ZNT A;  4F1V A;  4FJP A;  2I6E A;  1S9T A;  3O6I A;  3PUW E;  3F11 A;  1MQI A;  1UQW A;  1B7Z A;  3TZA A;  2F97 A;  5KCJ B;  1DPP A;  2QSX A;  4N07 A;  5ICT A;  3D4C A;  4RJZ A;  2PT2 A;  3QAX A;  4F3S A;  3UIF A;  1ZU0 A;  4U1Z A;  4FAT A;  1PB9 A;  3SEW A;  2XXU A;  4NF4 A;  5AA4 A;  3MW0 A;  4ZEK A;  1JVY A;  2V3T A;  1NNP A;  3A3U A;  1XC1 A;  3FJ7 A;  3O6G A;  2VD2 A;  3FAS A;  1FQF A;  5KZT A;  3S9L C;  2HAU A;  4C1T A;  4ELP A;  4OER A;  1ELJ A;  2DWH A;  4XKR A;  3HPI A;  4IGT A;  4WED A;  3BFT A;  3MVX A;  4IO2 A;  1JNF A;  1YAE A;  3MZ1 A;  5DEX A;  4LON B;  4ESW A;  3CSG A;  3Q26 A;  4PFW A;  4EQ7 A;  3M3K A;  1DTZ A;  1B6H A;  2F36 A;  5HM4 B;  4EDP A;  5KDT A;  4DCX A;  3PPQ A;  2O84 X;  3DP4 A;  2OZZ A;  4OFO A;  4C0R A;  1TT1 A;  1D9Y A;  1II5 A;  4I9D A;  1US4 A;  1EZO A;  3G3K A;  4KCD A;  4JWY A;  3IJX B;  1DPE A;  4OEV A;  3G3F A;  2REJ A;  1BLF A;  2ZYM A;  2XHD A;  3OEK A;  3R26 A;  2QL3 A;  1B7H A;  4RA1 A;  5AA3 A;  3PPP A;  1SDX A;  3TCF A;  3O28 A;  3EN3 A;  4FE8 A;  4XXU A;  2QPQ A;  4Q30 B;  1M5F A;  4RK2 A;  5ITO A;  1US5 A;  1Q35 A;  4DCY A;  2NVU B;  4YB5 A;  3KN3 A;  5L8D A;  3MZ9 A;  4NE4 A;  1SD3 A;  4U2R A;  1B46 A;  1EZP A;  4ZDM A;  5H8N A;  5AA2 B;  1ANF A;  3TYH A;  3KN7 A;  2ONR A;  2DE4 A;  2Q2A A;  3K6W A;  3KGC A;  5AA4 B;  2UYF A;  4U22 A;  3Q27 A;  3OEL A;  1Y20 A;  4NED A;  4RNS A;  3OMB A;  2XXQ A;  3HST A;  1MPC A;  3FXU A;  2KLF A;  1MXX A;  3HV1 A;  2AL5 A;  1L5T A;  3IO6 A;  1QW0 A;  3PPO A;  3FAT A;  5BUU A;  4KD5 A;  2F7C A;  5M2V A;  1J1N A;  5DVF A;  1B4Z A;  4WKM A;  2X26 A;  3OSR A;  5KDT B;  4WXJ A;  2XXI A;  3PUZ E;  4YMB A;  3O9P A;  3KJT A;  1USY E;  4ZS9 A;  2F6G A;  2O1M A;  4H8J A;  1B0L A;  3AXF A;  1B3F A;  1USY H;  3RT6 B;  3MQ9 A;  3VLW A;  3T9U A;  2H4I A;  3WAF A;  2ZNS A;  3IOW A;  1UIV A;  1FW0 A;  5ICQ A;  3PUX E;  2ZNU A;  1IXC A;  3TKD A;  1GGG A;  1B0H A;  2I58 A;  2CMO A;  5H8N B;  4JB7 A;  5I59 A;  4OXV A;  2B3B A;  5AE4 A;  3CG1 A;  3TDJ A;  4BDR A;  4QF9 A;  2Z8F A;  3OO6 A;  4QSC A;  2XXX A;  1FTO A;  2P2A A;  4F19 A;  2R9J A;  5DTB A;  5HBC A;  1PC3 A;  3PMX A;  1EU8 A;  1MH3 A;  4EF1 A;  4BDL A;  3K1N A;  2D3I A;  2Y7P A;  4O3B A;  3Q28 A;  5IKB A;  1QUL A;  4LVQ A;  3KG2 A;  4POX A;  5I2K B;  1M5E A;  4PFT A;  1B5H A;  4FEC A;  3HO7 A;  4G2Z A;  3TAJ A;  3E3K A;  3IOT A;  4UAC A;  4NWD A;  3MVW A;  4YIC A;  4IGR A;  4N13 A;  3UGW A;  3IOU A;  2Q89 A;  5TP9 A;  4Q8R A;  1B2H A;  3IOV A;  1LAX A;  3U94 A;  1EZ9 A;  4MLQ A;  2Q2C A;  2D21 A;  3N6T A;  3T9H B;  1Y1M A;  2QRY A;  3TMG A;  5A5X A;  2H5Y A;  4OEU A;  1FTL A;  3PMV A;  1P99 A;  1LB9 A;  1R9Q A;  3QUF A;  1KWH A;  2DXR A;  4OHN A;  3BKI B;  1A7L A;  1SI1 A;  4DIG A;  4R73 A;  4H6D A;  4F3P A;  5J1D A;  1OLC A;  2BJJ X;  1B3G A;  5CM6 A;  4X48 A;  2AL4 A;  2DYX A;  1PDA A;  5TPA B;  2OCU A;  2QS1 A;  1MDP 1;  5H8Q A;  3PPN A;  2UVH A;  1MY3 A;  1TFD A;  2M8C A;  4KQP A;  3ZSF A;  3IOR A;  3MWB A;  3A3C A;  2OWS A;  4QHQ A;  1URG A;  4JSO A;  1VSO A;  1RKM A;  4R2B A;  3GBB A;  3FUZ A;  2F8D A;  3S4U A;  3PMW A;  2H99 A;  2RKM A;  1NKX A;  2ZXT A;  1B1X A;  1H76 A;  5JK4 A;  4LZ8 A;  4C1U A;  1PBP A;  4JWO A;  5JEI A;  4QSE A;  3MBP A;  4RPN A;  1B5J A;  1BKA A;  3CIJ A;  5KCJ A;  4GLI A;  4GWO A;  4OZ9 A;  2GH9 A;  1URD A;  3VVF A;  1LAH E;  1MH4 A;  3UOR A;  2PBW A;  3MPL A;  3RY3 A;  2UVI A;  1I6A A;  3VLU A;  2I48 A;  1FQE A;  4ZZE A;  4I8C A;  2G93 A;  4DDD A;  1PEB A;  1R6Z A;  1POY 1;  4OET A;  1MQH A;  3FJM A;  3FXR A;  2O6A A;  1JET A;  5H8F B;  4UA8 A;  1JEU A;  2NUV A;  4ZEF A;  4KPT A;  4F18 A;  2RC9 A;  2XX8 A;  4DE8 A;  4NF6 A;  3IB2 A;  1FQA A;  1P1O A;  3N5L A;  3CR9 A;  1QUK A;  4BLA A;  2F6P A;  1N7W A;  4OQO A;  3IO4 A;  3C34 A;  1H43 A;  4ND9 A;  2ESN A;  4LZ7 A;  4R9F A;  4DLD A;  3PPR A;  2RC8 A;  2X7P A;  2HEU A;  4PFY A;  3H03 A;  2P0S A;  2PVU A;  4QRZ A;  3RNN A;  4PE5 B;  2DXY A;  3M8U A;  3CI8 A;  1FTK A;  4ZZA A;  1GV8 A;  1POT A;  4MH5 A;  2H9B A;  4KCC A;  5K2X A;  4H1X A;  1NMU A;  3I6V A;  1XVX A;  5AA2 A;  3MC2 A;  3PUY E;  3PV0 E;  4X9T A;  3K1P A;  4K3F A;  3TUS A;  3T66 A;  3G3J A;  3IB0 A;  5B7D A;  4R6Y A;  3MP1 A;  3VDF A;  2FNC A;  3LBS A;  1BTJ A;  1Y4C A;  3JV9 A;  4Z0I A;  1VFD A;  2FYI A;  3O97 A;  3OO7 A;  3OSQ A;  4YAH X;  1ZLQ A;  2B3F A;  3A09 A;  1N3W A;  1PB7 A;  5F1Q A;  3VXB A;  3SKP A;  2H98 A;  2F5X A;  3TQW A;  1S7Y A;  2VP1 A;  2YJP A;  5FHO A;  3DLN A;  3PGF A;  1PB8 A;  4NF6 B;  2ZYK A;  3KEI A;  3U8Q A;  2FA7 A;  5ELV A;  3UA8 A;  2HFB A;  1MY2 A;  1Z7M E;  1ZBM A;  3PD9 A;  4G77 A;  4GD5 A;  2DVC A;  3S9M C;  2I3W A;  2DE2 A;  2V84 A;  3M3L A;  4THI A;  1M5D A;  3TQL A;  5CC2 A;  1MRP A;  4XKP A;  4KYS A;  4NTL A;  1YTV A;  4GXA A;  1MXY A;  4YB6 A;  1TFA A;  1N76 A;  4DXU A;  4MBP A;  4E0W A;  3IAZ A;  3SES A;  2V25 A;  3CFL A;  4LA9 A;  5L9S A;  2DP8 A;  1JW5 A;  5FHM A;  3E4R A;  1A40 A;  3MP6 A;  3FD3 A;  1H44 A;  1LB8 A;  2I49 A;  3FVK A;  1B5I A;  5I57 A;  4KI0 E;  3S9E A;  1NNF A;  3SET A;  4NWC A;  1ATG A;  2Z23 A;  2HAV A;  3OOA A;  1MXV A;  3H6T A;  1OMP A;  3L6G A;  1MY4 A;  1WVJ A;  2GHB A;  3VE1 B;  2OJT A;  1P1Q A;  2RCB A;  3CFX A;  5H8S A;  3SEV A;  2UXA A;  1Y3P A;  2XXV A;  1MQG A;  2I0B A;  1GR2 A;  4XTC Q;  2O68 A;  4R74 A;  4YKK A;  3RQT A;  1JVX A;  4JWX A;  3I5O A;  5I2K A;  3U92 A;  2F7A A;  5I58 B;  3IJO B;  2Y7R A;  1B32 A;  4XIG Q;  2ABH A;  3USD A;  2O1L A;  1XVY A;  3V8X B;  1UTB B;  4IY5 A;  1NNK A;  1B4H A;  1MPB A;  3TTR A;  3IX1 A;  1IUD A;  2QJE A;  4ISU A;  5HPQ A;  3TTM A;  1MXZ A;  1R9L A;  4FEB A;  5CBS A;  1IZ1 A;  4HW8 A;  3K4U A;  1ZJL A;  3H4Z A;  1OQH A;  3ILT B;  5LOM A;  3DM0 A;  3RTF B;  5AA1 A;  1LBB A;  4ZED A;  4P11 A;  2HQ0 A;  1MY1 A;  5CBR A;  4GF8 A;  4H8I A;  3FGS A;  3K0V A;  3O29 A;  4F1U A;  1WOD A;  2Z22 A;  4M1V A;  3KOS A;  3TTN A;  4EUO A;  5I57 B;  3RN8 A;  2Y7K A;  3ZS6 A;  1MM6 A;  1P1N A;  3ILU B;  5TPA A;  5JTY B;  1GVC A;  4OVJ A;  3BBR A;  3TTK A;  4R72 A;  2A5T A;  3K6U A;  4G68 A;  1N3X A;  1HSE A;  3V5A A;  1DSN A;  4PQJ A;  1Y9U A;  2YPN A;  5DVJ A;  4U4X A;  2O7I A;  2VOZ A;  4R2F A;  3TEL A;  1DMB A;  2DWI A;  3G3G A;  3MP8 A;  3VFJ A;  4RYA A;  3HHG A;  1LAF E;  4QFK A;  1IXG A;  3LSW A;  4OEN A;  3P7I A;  3C9H A;  4ELO A;  4HCW A;  3L6H A;  4G4P A;  1NFT A;  3TEP A;  1YCJ A;  4X1D A;  4F3B A;  1IQ7 A;  1OLA A;  1WDN A;  5EHS A;  1OQG A;  4RPO A;  4U1O A;  4TOZ A;  2R6G E;  3K00 A;  3H3G A;  3TTL A;  5I56 A;  3K02 A;  2F7B A;  2UVJ A;  2AYS A;  1D4N A;  4H0W A;  4NMY A;  2OLB A;  5CRY A;  2P1S A;  3B6W A;  3PU5 A;  5H8H A;  2XXH A;  3EHT A;  2HZL A;  3KBR A;  2O69 A;  2OK2 A;  4XKN A;  4ZE8 A;  2PT1 A;  1DOT A;  4BDM A;  4X1B A;  2ZMB A;  2DSF A;  4BDQ A;  3T93 B;  1LLS A;  4AB5 A;  1LFH A;  1B1H A;  5H8F A;  3E9X A;  4MF3 A;  3ECR A;  4ELR A;  4TLM B;  3QUJ A;  4F39 A;  1AH5 A;  4LZ5 A;  1A54 A;  4IO5 A;  1P1W A;  2IEE A;  4H5F A;  2A5T B;  4G68 B;  4NF5 B;  1QVS A;  3EQ1 A;  4HS7 A;  1A8F A;  5CMK A;  3SEU A;  3W15 C;  2O7U A;  1SBP A;  3KSX A;  1FQD A;  4IY6 A;  2IA4 A;  3SEY A;  3OO9 A;  1RYX A;  3RUM A;  3B7D A;  2THI A;  3FV1 A;  3VLV A;  1H3D A;  3V83 A;  4ZEC A;  1QUJ A;  1CE2 A;  3MVY A;  4FED A;  5I56 B;  4FOR A;  1I6Q A;  4HCY A;  4IO6 A;  1M5B A;  4OFL A;  5H8H B;  3C32 A;  4GL8 A;  1TWY A;  4N6P A;  2PYY A;  3EHS A;  3H6U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...