5H8NB

Structure of the human glun1/glun2a lbd in complex with nam
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
285
structure length
282
Chain Sequence
TRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor io
publication title Positive Allosteric Modulators of GluN2A-Containing NMDARs with Distinct Modes of Action and Impacts on Circuit Function.
pubmed doi rcsb
source organism Homo sapiens
total genus 79
structure length 282
sequence length 285
ec nomenclature
pdb deposition date 2015-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8nB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8nB02
4PFWA 3H3GA 2DS9A 2Z23A 1SI0A 1IUDA 3H4ZA 1HSEA 4MLVA 3T96B 3FJGA 4I8CA 1NKXA 5H8NB 1DTGA 2UXAA 3OELA 4IO3A 4PETA 4LP2B 2XD2A 2R9JA 4WXJA 3PUZE 3KN8A 3PMVA 5DYHA 4BDLA 4U1OA 3U92A 4ZDMA 3OO9A 5L9MA 4G68A 4MFIA 2P1SA 3PPQA 4QFOA 3JV9A 3K1NA 3N5LA 5AA2D 4IO6A 2F34A 1B7HA 3FATA 4EXLA 4Q0CA 1USYH 2PBWA 2V3TA 1UTHA 4GL8A 4XKNA 3KBRA 3Q26A 3MZ9A 1XS5A 3OSRA 5H8HB 3T9HB 1LAFE 3E3KA 1N04A 3FD3A 4YICA 2X26A 1EZOA 1PC3A 4NF6A 3MVWA 1MH4A 4NWDA 5JTYB 1B40A 4G8NA 3IJOB 4Z7EA 2Z22A 2D21A 1I6BA 3W9VA 4YMBA 3IK6B 3FVOA 1II5A 1EZ9A 1MXXA 1R1NA 3IORA 5CRYA 1B5HA 2PX1A 4GVOA 2RF1A 3IOWA 2DWHA 2OZZA 1OMPA 4RY1A 4F2QA 3CVGA 1BTJA 4FORA 1NMUA 4GIZA 1RYXA 4U21A 1MS7A 2I3VA 2IEEA 4WKMA 1SVXB 1JEUA 4G68B 5TPAA 3JYRA 5DVJA 1IZ1A 4PE5B 5ITOA 1USYE 1UTHB 2THIA 3TZAA 3QK6A 3VV5A 2VHAA 1AH5A 2F7AA 5CI5A 3HSTA 5KDTA 3VLVA 3VLWA 5AA2B 1FQFA 3V5AA 4R75A 4K3FA 4AB6A 3SEXA 2DYXA 3UGWA 4ZEDA 4KYEA 1LFIA 3MUQA 4R6HA 4BDMA 1MXUA 3GXAA 1MQHA 1LSTA 4R73A 3DP8A 2ALUA 1TXFA 4LONB 2YPNA 1T0KA 1YTVA 2AL5A 3D4GA 3C32A 4RPNA 1B7ZA 3FVNA 3S9NC 4KYDA 4EQ7A 1N3XA 2H9BA 1P99A 3CFXA 2XXTA 5H8FA 3TQLA 5AA3A 2VD2A 1JVYA 3KZGA 1DMBA 4XKPA 4YAHX 1FTLA 2DVZA 3QUFA 3GZGA 3K0VA 4OESA 2DQVA 1JW5A 4G8MA 3O6GA 4GXAA 2OBGA 1LGBC 3IR1A 2XX8A 4N6PA 1VR5A 4U4XA 1LFGA 1ZTYA 4UA8A 3EHUA 2OWSA 3USDA 4OMBA 3PPPA 3DP4A 1GTKA 2NXOA 3G3IA 4NF8B 3TTRA 5AA4A 1MXYA 3KOSA 4H5FA 2VOZA 3PPOA 2I4CA 3EF7A 3U1OA 4ELOA 3LR1A 3KOTA 4U23A 3Q25A 3C31A 4F3GA 3TTKA 1SYIA 1XC1A 1B3FA 3G3HA 4FEBA 4X1BA 1JW4A 4KI0E 4GL0A 3WAEA 2HZLA 3TTMA 3TCHA 3MW0A 2CZLA 3W9WA 2W7YA 3R7XA 4HTGA 3M8UA 3BFTA 1D3KA 1EZPA 2HQ0A 1GR2A 4G4PA 1GV8A 2HXWA 4DE8A 1QKBA 4YB6A 4EF1A 3HN0A 3B6QA 2QL3A 4LQ2A 3KGCA 1N76A 5AA4B 3I6VA 4U22A 4MH5A 5I56A 5CC2A 4FATA 3PMWA 3C4MA 2XXPA 3CI8A 1B3GA 2DXYA 2H99A 1Y4TA 2UVHA 4POWA 1CB6A 5TP9A 2D5WA 3KN7A 3PUXE 1PBPA 1ZMGA 3PGFA 1YPNA 4F19A 4RYAA 2V93A 2ONSA 1J1NA 4H5GA 5DTBA 1JNFA 3PPNA 2ZXTA 4YMAA 2ONRA 2HZKA 4QHQA 2ONKE 3TMGA 4E0XA 3HV1A 3LUYA 1FTMA 4QSCA 4RNSA 2HEUA 1UTBA 1Y20A 1ANFA 2R6GE 4FEDA 2F6PA 1POTA 3S9MC 3V83A 2IA4A 4BDOA 3EHTA 2H25A 1DOTA 4ECFA 1RKMA 2CMOA 4I1DA 5I56B 1US5A 1N7WA 4YZZA 4M1VA 4YKPA 5FHNA 2QPQA 1AL3A 4IGRA 3UP9A 1B52A 5I2KB 3DM0A 1XVXA 1I6AA 2HCAA 3DELB 4UACA 2QMWA 3KFMA 5HM4B 3KEIA 2I49A 1SYHA 4F3SA 3RY3A 4NEDA 1SDXA 2GHBA 1DPPA 1VFDA 4RK2A 4JB7A 5H8NA 4X48A 3T93B 1QULA 2A5SA 3IO4A 3QYTA 1Z7ME 4Z0IA 3SKPA 3ZKKA 3PPRA 2ESNA 1LBBA 4L17A 2REGA 2ZMBA 3TUSA 2NVUB 4KD5A 3H6TA 1LLSA 5H8HA 4ZEFA 4QFLA 2LAOA 4GXSB 5B70A 1Y1ZA 4R2FA 3FIRA 1UIVA 3BFUA 2XXQA 1O63A 5JTYA 2Q2CA 3LSWA 1MH3A 1P1QA 4HS7A 1JVXA 4JWYA 2F6GA 4R9FA 4RK9A 2ZYMA 1OLCA 3S9LC 3HO7A 3O97A 1VFEA 4RJZA 4WEPA 5H8SA 3LC8A 4KCDA 1YCJA 4LVQA 1M5DA 4G2ZA 3GBAA 3G3FA 4MF3A 4PFYA 4G68C 4TOZA 1Q1KA 4QFNA 1PDAA 2DE2A 3G7WA 1WODA 1BLFA 2DSFA 4FAJA 4OWDA 2RINA 1MDQA 5EHSA 3G3JA 3HPIA 2B3BA 1QUJA 2QSXA 5AA2A 2UYEA 3IOUA 5I59A 3VFJA 3C9HA 1B6HA 2O7IA 4THIA 4DLDA 3MC2A 1LB9A 1Y9UA 4HCYA 2O1LA 4ELQA 4XTCQ 2ZYOA 1ZBMA 1NNKA 3EN3A 4LZ5A 1Y1MA 1URGA 1IEJA 2XXWA 1NNTA 1B3EA 1NNPA 2Q88A 2UVIA 5K2XA 3TYHA 3A3CA 1MY0A 3KJ7A 1AOVA 3AXFA 2RC8A 3CG1A 2ZNUA 3OXNA 4M4GA 4EQBA 1A99A 3CRBA 3R6UA 3ECRA 3VDFA 4ZZAA 4XIGQ 4NWCA 1MPDA 1A8EA 4P0IA 2O7UA 4Q5TA 3IAZA 1ZJLA 2RCBA 3U93A 1FTJA 5DEXB 1FCKA 1IXIA 1VE4A 5ICQA 2P0SA 3K02A 4HW8A 3KSXA 5I59B 1B46A 4N07A 1DPEA 1LAHE 2F36A 5CMBA 3C36A 3LSLA 3IL1B 3ZKLA 1IITA 3TELA 5I2NA 3EQ1A 2QRYA 4NF8A 1IQ7A 3TAJA 2UVJA 3RGYA 2BJJX 1PB7A 4YB7A 2DOJA 1MQJA 2VGQA 3MP1A 3IO6A 2F8DA 1BKAA 4DCXA 4RA1A 4ZEKA 3TKDA 2FNCA 3DP6A 2HFBA 1GVCA 2DE4A 1AIVA 4GQOA 4IO5A 4EDPA 4P11A 4OYVA 4OHNA 4JDFA 1IIWA 4BDQA 1N3WA 5FTHA 4KR5A 4YB5A 4ZE8A 4ISUA 4BDNA 3MVZA 1LB8A 1H44A 1B4HA 3RNNA 4GRKA 3L6HA 4DCYA 5KZTA 4OTEA 4LZ8A 4EF2A 4DDDA 5I2NB 4X9TA 4G77A 5FTIA 3K1MA 4U4SA 1FTKA 5K2YA 2I0BA 3K4UA 3Q29A 2E0SA 3FJMA 1SQYA 4F3BA 4MLQA 2DWIA 4OEUA 3OD7A 1B58A 1MQIA 1OLAA 4H8JA 3MVXA 2KLFA 1O7TA 4POXA 2Y7KA 3RQTA 2NUVA 5TU0A 4BLAA 2ZYNA 3ILUB 4YKIA 4QFKA 3R26A 5FHMA 2YLNA 1PEBA 1S9TA 3O6HA 3UA8A 4C0RA 4R6KA 1IXCA 1AMFA 3B6TA 3H6WA 4JSDA 2QMXA 3L6GA 3UORA 3SEVA 5A5XA 5CM6A 3RN8A 3OO6A 2XXHA 4LA9A 3FV1A 1P1NA 4C1UA 2RKMA 5H8QA 1MXWA 4F29A 3IOVA 5DT6A 2G29A 4ND9A 5L8DA 3GLBA 3O6IA 5JEIA 1R9QA 1M5BA 5I2KA 5ISUA 3K6UA 1NH8A 2H4IA 1MPCA 4KPTA 1N0TA 4G8HA 4DXCA 3OENA 5DVIA 3FXQA 2O6AA 4F31B 3ILTB 2OCUA 5LOMA 4ZS9A 1MQDA 2GH9A 3SEWA 1B5JA 1SW2A 5A5XB 3MP6A 2I3WA 3B7DA 4GF8A 3OO8A 3TFLA 3T9VA 5HPQA 1B7UA 4PP0A 4ELPA 3MQ9A 1MY4A 2DXRA 4H67A 3JZJA 3BKIB 4PFTA 1JETA 4LUBA 5H8QB 1POY1 2V25A 2I0CA 3VVFA 3MJNA 1EU8A 5L9SA 5J1DA 5M2VA 2GRVA 1FQAA 4Q30B 3THIA 1BP5A 4OVJA 5F7VA 1US4A 3MBPA 4ZEIA 2XX9A 3TCGA 3IJXB 1RYOA 3HHGA 2H5YA 1H76A 4IY6A 2QJEA 3QXMA 1A40A 1PB9A 5ELVA 5B7DA 2QS4A 4R72A 3VLUA 1H3DA 2M8CA 4QSEA 5I84A 3UK4A 2V3UA 4U2RA 3Q28A 3OO7A 1MRPA 2Q9TA 3M3KA 3RUMA 2Q8JA 1LAGE 3RTWB 2Y84A 3EPEA 5KCJB 4Q8RA 5L9OA 3TCFA 2OLBA 3IB2A 3SDFA 3G3KA 1HSJA 4NE4A 3QAXA 3VXCA 5BUUA 1B3LA 2XXUA 1H43A 3TTLA 3E13X 3VVDA 1P1OA 4R9GA 3S2VA 1MY3A 3IOTA 3N26A 4H1XA 2PYYA 3H6VA 2OWTA 4F39A 1A7LA 3U72A 3MVYA 3T9XB 1OQHA 1QW0A 3MPLA 3FZVA 4JSOA 4AB5A 4TLLB 4DZ1A 4EQ9A 2V3QA 4QSDA 1URSA 1VSOA 4AQ4A 1MM6A 1SW4A 3OSQA 4ESWA 3TDJA 2Z8FA 3O29A 3H7MA 4R74A 2RC7A 3O66A 3O9PA 4RPOA 3FJ7A 4OXVA 1OVTA 1M5EA 2REJA 2VD3A 3FXUA 3RTFB 3SETA 1Y3PA 3K2DA 1D9VA 3RT6B 1B0HA 4P0GA 3MAMA 5JK4A 3CIJA 1B4ZA 1ELJA 3TEPA 3PMXA 3MWBA 3ZSFA 5AE4A 2O68A 4OFOA 5IAIA 5DEXA 3I5OA 1SD3A 3G3GA 2UVGA 4U1ZA 3SERA 4MBPA 1CE2A 4TQUQ 2ZNTA 3V8XB 4OFJA 3QIMA 2HAVA 2XXRA 1DTZA 1NNFA 2OK2A 3F11A 3SESA 2ZNSA 4LQ5A 4NF4B 2I58A 3O28A 4H0WA 2A5TA 4QFPA 1P1UA 1MM7A 3RPWA 2DP8A 3KSJA 4EUOA 4ZECA 2B3FA 3Q27A 2WKYA 2XXIA 1S7YA 4O3CA 1FQCA 4QRZA 1FTOA 4PFUA 1XHYA 1B0LA 3MP8A 3M3FA 1GGGA 1MPBA 1B9JA 5EYFA 3IB0A 4OENA 3KJTA 2F7CA 3FUZA 2DVCA 3A09A 1MY1A 3EHSA 2I6EA 1ZKBA 2I4BA 2PT1A 1B32A 1MY2A 1B1HA 2PMSA 3UIFA 2V84A 4ZE9A 3H06B 4LZ7A 3CSBA 1B3HA 2AL4A 3PUYE 2ANJA 1SW1A 4GOTA 3PD8A 4NMYA 3TPAA 2G93A 3LBSA 3KN3A 3LSXA 2QS2A 5ITPA 4NF6B 2FA7A 4X1DA 2XXYA 1IXGA 3K00A 4HCWA 3QSLA 1ZU0A 2H98A 2XX7A 2DWJA 4JWXA 2A5TB 2O69A 1YAEA 3HCQA 1A55A 4DXBA 3VE1B 3RT8A 1KWHA 1LFHA 3BBRA 3PV0E 4GWOA 2F78A 4OETA 3U94A 3N6UA 1B1XA 1OQGA 2PT2A 3TODA 5TPAB 4IO7A 3K6VA 4YU0A 3CR9A 3CG3A 4E0WA 2B65A 3PUVE 3OMBA 4H65A 3O2AA 3MPKA 2I48A 1QKAA 3CFLA 3FASA 3PU5A 3A3UA 1NH7A 2PVUA 2RC9A 4TLMB 1Z7NE 1EH3A 4DIGA 3GBBA 4ONYA 5KDTB 1A54A 1JW1A 2AIXA 3TQWA 4EXKA 2ZYKA 1B05A 3QUJA 1QUIA 3C34A 2F35A 4R6YA 3SEUA 3HHFA 4YKKA 5IKBA 2X7QA 4IGTA 3ONMA 5DVFA 2GFEA 1SW5A 3OEMA 2UYFA 1B5IA 1A8FA 3UN6A 4H6DA 2NOOA 4F18A 4KYSA 1XVYA 1QUKA 5F1QA 5CBRA 4OQOA 4ZZEA 1MG1A 5I57A 1TT1A 2O51A 1M5FA 3S9EA 5ICTA 2XXXA 4FIMA 2F97A 4OFLA 2XXVA 3W15C 4NTLA 1WDNA 5H8FB 2Y7PA 3E4RA 4KFQA 3KG2A 4NF5A 4BDRA 3K6WA 4F1UA 3VVEA 4OERA 4ZEBA 3RLFE 1N84A 3B6WA 1Y3QA 1P1WA 1LBCA 1F9BA 2VP1A 4YKJA 4O3AA 4O3BA 1FQEA 1R9LA 4FJPA 2O1MA 4R2BA 2ABHA 1L5TA 5I58A 1ZIUA 2F7BA 2R71A 3PUWE 1H45A 3T22A 3U8QA 3M3LA 2Q89A 5EHMA 2Q2AA 4F2OA 3LSFB 4H8IA 4KCCA 3TTNA 4DXUA 5I57B 3IX1A 3S4UA 3CFZA 1NFTA 1QJMA 2QS1A 2NWJA 1DSNA 1WVJA 3K1PA 2XD3A 1JQFA 3VXBA 4N13A 1TFAA 1IXHA 5KCJA 1LCTA 1I69A 4GD5A 3FXRA 1D9YA 1ZLQA 4JWOA 1UIUA 5CMMA 4GFRA 4NF5B 1B2HA 3E9XA 1B51A 2GHAA 3MZBA 2E1SA 5CMKA 1OIBA 3I3VA 1Q35A 1LAXA 2Z8EA 1FW0A 1NL5A 3FGSA 5HBCA 4PQJA 1ATGA 5I58B 3C35A 1PB8A 3N6TA 1URDA 3K01A 3C33A 1I6QA 1TFDA 1TWYA 3FVGA 2F5XA 2O84X 2X7PA 1SI1A 3CSGA 4IY5A 3WAFA 4LATA 4C1TA 3N94A 4I62A 4QF9A 2DWAA 4IO4A 3H03A 5TP9B 5AA1A 1D4NA 4GLIA 4F22A 1MXVA 5CMCA 2Y7IA 2RCAA 4F1YA 2Y7RA 4WEDA 2Z8DA 1FQBA 2OJTA 5CBSA 3D4CA 4XKQA 2YJPA 4JXIA 1XT8A 3ZS6A 3ODBA 3OEKA 1S50A 1QVSA 3P7IA 1Y4CA 4I9DA 3H6UA 3PD9A 1UTBB 3K6XA 1LCFA 4KHZE 3DLNA 2D3IA 5BWJA 4KQPA 4F3PA 4FE8A 3OOAA 1OVBA 3MZ1A 1MQGA 1Y3NA 2P2AA 3SEYA 1XOCA 3T9UA 1SBPA 2XHDA 1PBQA 5FHOA 1N7XA 3V89B 4OEVA 2AYSA 2DE3A 2Y7WA 4IB2A 4OZ9A 1FQDA 4XXUA 2FYIA 1M5CA 2QS3A 4ELRA 4FECA 1R6ZA 3FV2A 1JEVA 1MDP1 4JBZA 3T66A 4IO2A 1O64A 2HAUA 4XKRA 1HSLA 1BIYA 3IB1A 4NF4A 1MXZA 3FVKA 4RXLA 1UQWA 4ESXA 4F1VA
chains in the Genus database with same CATH superfamily
4PFWA 3H3GA 1NV2A 2DS9A 2Z23A 1SI0A 1IUDA 3H4ZA 1HSEA 4MLVA 3T96B 3FJGA 4I8CA 1NKXA 5H8NB 1DTGA 2UXAA 3OELA 4IO3A 4PETA 4LP2B 4P1LA 2XD2A 2R9JA 4WXJA 3PUZE 3KN8A 3PMVA 5DYHA 4BDLA 4U1OA 3U92A 4ZDMA 3OO9A 2QVUA 5L9MA 4G68A 4MFIA 2P1SA 3PPQA 4QFOA 4PDHA 1IMAA 3JV9A 3K1NA 3N5LA 5AA2D 4IO6A 2F34A 1B7HA 3FATA 4PFRA 4EXLA 4Q0CA 1USYH 2PBWA 2V3TA 1IMCA 1UTHA 4GL8A 4XKNA 3KBRA 3Q26A 3MZ9A 1XS5A 3OSRA 5H8HB 3T9HB 1LAFE 4PTKA 3E3KA 1N04A 4NN3A 3FD3A 4YICA 2X26A 1EZOA 1PC3A 4NF6A 3MVWA 1MH4A 4NWDA 5ET8A 5JTYB 2FBPA 1B40A 4G8NA 3IJOB 4P9KA 4Z7EA 1FPFA 2Z22A 2D21A 1I6BA 3W9VA 4YMBA 3IK6B 3FVOA 1II5A 1EZ9A 1MXXA 1R1NA 3IORA 5CRYA 1B5HA 2PX1A 4GVOA 3U65A 2RF1A 1RDYA 3IOWA 2DWHA 2OZZA 1OMPA 4RY1A 4F2QA 3CVGA 1BTJA 4FORA 1NMUA 4GIZA 1RYXA 4U21A 1MS7A 2I3VA 2IEEA 4WKMA 1SVXB 1JEUA 4G68B 5TPAA 1LBZA 1DCUA 3JYRA 5DVJA 1IZ1A 4PE5B 5ITOA 4NAPA 1USYE 1UTHB 2THIA 3TZAA 3QK6A 3VV5A 2VHAA 1AH5A 2F7AA 5CI5A 3HSTA 5KDTA 3VLVA 3VLWA 5AA2B 1FQFA 4H45A 5ET5A 3V5AA 4R75A 4K3FA 4AB6A 4P3LA 5I7IA 3SEXA 4MX6A 2DYXA 3UGWA 4HE1A 4ZEDA 4KYEA 1LFIA 3MUQA 1RDZA 4R6HA 4BDMA 4HE2A 4OVRA 1MXUA 3GXAA 2WEFA 4I3YA 1MQHA 3MYUA 1LSTA 2ZZVA 4R73A 2KQZA 2MKZA 3DP8A 2ALUA 1FBFA 1TXFA 4LONB 2YPNA 1T0KA 1YTVA 2AL5A 3D4GA 3C32A 4RPNA 1B7ZA 3FVNA 3S9NC 4KYDA 4EQ7A 1N3XA 2H9BA 1P99A 3CFXA 2XXTA 5H8FA 4PGPA 2WYPA 3TQLA 5AA3A 2VD2A 1JVYA 3KZGA 1DMBA 4XKPA 4YAHX 1FTLA 2DVZA 3QUFA 3GZGA 3K0VA 4OESA 2DQVA 1JW5A 4G8MA 3O6GA 4GXAA 4NHBA 2OBGA 1LGBC 3IR1A 2XX8A 4N6PA 1FBHA 1VR5A 4U4XA 1LFGA 1ZTYA 4UA8A 3EHUA 2OWSA 3USDA 4OMBA 3PPPA 3DP4A 1GTKA 2NXOA 3G3IA 4NF8B 3TTRA 5AA4A 1MXYA 3SZPA 3KOSA 4H5FA 2VOZA 3PPOA 2I4CA 3EF7A 3U1OA 4ELOA 4GX6A 3LR1A 3HFUA 3KOTA 1FBCA 4U23A 1LBXA 3Q25A 1LBWA 3C31A 4N15A 4F3GA 3TTKA 5A5LA 2WX9A 1SYIA 1XC1A 1B3FA 3G3HA 1FPGA 1VDWA 4FEBA 4X1BA 1JW4A 4KI0E 4GL0A 3WAEA 4X8RA 2HZLA 3TTMA 3TCHA 3MW0A 2CZLA 1FJ9A 3W9WA 2W7YA 3R7XA 4HTGA 3M8UA 3BFTA 1D3KA 4N4UA 1EZPA 2HQ0A 1GR2A 4G4PA 4PBHA 1GV8A 1INPA 2HXWA 4DE8A 2XWOA 1QKBA 4YB6A 4EF1A 3HN0A 3B6QA 2QL3A 4LQ2A 4P47A 3KGCA 1N76A 5AA4B 3I6VA 4U22A 4MH5A 5I56A 5CC2A 4FATA 3PMWA 3C4MA 2XXPA 3CI8A 1B3GA 2DXYA 2H99A 1Y4TA 2UVHA 4POWA 1CB6A 5TP9A 2D5WA 4X04A 3KN7A 3PUXE 2L5VA 1PBPA 1ZMGA 3PGFA 1YPNA 4F19A 4RYAA 2V93A 2ONSA 1J1NA 4H5GA 5DTBA 1NUYA 1JNFA 2R8TA 3PPNA 2ZXTA 4N8YA 4YMAA 2ONRA 2HZKA 4QHQA 2ONKE 3TMGA 4E0XA 3HV1A 4MCOA 1IMEA 3LUYA 1FTMA 4QSCA 4RNSA 2HEUA 1UTBA 1Y20A 1ANFA 2R6GE 4FEDA 2F6PA 1POTA 3S9MC 3V83A 2IA4A 1D9QA 4BDOA 4MJOA 4GX3A 3EHTA 3MSTA 1AWBA 2H25A 1DOTA 1DBZA 4ECFA 1RKMA 2CMOA 4I1DA 5I56B 5EQ9A 1US5A 1N7WA 4YZZA 4M1VA 4YKPA 5J16A 5FHNA 2QPQA 1AL3A 4IGRA 3UP9A 4PGNA 2FIEA 1B52A 5I2KB 3DM0A 1XVXA 1I6AA 2HCAA 3DELB 4UACA 2QMWA 2WYKA 2F3BA 3KFMA 5HM4B 3KEIA 5LDZA 2Q8MA 2I49A 1SYHA 4F3SA 3RY3A 4NEDA 1SDXA 2GHBA 1DPPA 1VFDA 4RK2A 4JB7A 5H8NA 4X48A 3T93B 1QULA 2QVRA 2A5SA 3IO4A 4XFEA 5EYGA 3QYTA 1Z7ME 2VPOA 3B8BA 4Z0IA 3SKPA 3ZKKA 2CEYA 2P3VA 1NV4A 1LBVA 3PPRA 2ESNA 1LBBA 4HXVA 4L17A 3FBPA 1FJ6A 2REGA 2ZMBA 3TUSA 2NVUB 4KD5A 3H6TA 4P1EA 1LLSA 5H8HA 4ZEFA 4QFLA 2LAOA 4GXSB 5B70A 1Y1ZA 4R2FA 4PC9A 3FIRA 1UIVA 5I3SA 3BFUA 2XXQA 1O63A 5JTYA 2Q2CA 3LSWA 1MH3A 1P1QA 4GBWA 4HS7A 1NV0A 1IMDA 1JVXA 4JWYA 2F6GA 4R9FA 4RK9A 2ZYMA 2CZHA 1OLCA 3S9LC 3HO7A 3O97A 1VFEA 4RJZA 4WEPA 5H8SA 3LC8A 4KCDA 1YCJA 4LVQA 1M5DA 4G2ZA 3GBAA 3G3FA 4MF3A 4PFYA 4G68C 1K9ZA 4TOZA 1Q1KA 4QFNA 1PDAA 2DE2A 2PCRA 3G7WA 1WODA 1BLFA 2DSFA 4FAJA 4OWDA 2RINA 1MDQA 5LTCA 5EHSA 3G3JA 3HPIA 2B3BA 1QUJA 1FPEA 2QSXA 5AA2A 2UYEA 1EYJA 3IOUA 5I59A 1DK4A 3VFJA 3C9HA 4JVIA 1B6HA 2O7IA 1FTAA 4THIA 1FBPA 4DLDA 2FHYA 3MC2A 2B4MA 1LB9A 1Y9UA 4HCYA 2O1LA 1FBDA 4ELQA 4XTCQ 2ZYOA 1NV5A 1ZBMA 1NNKA 4GWYA 1YXIA 3EN3A 4LZ5A 1Y1MA 1URGA 1IEJA 2XXWA 4NX1A 1NV1A 1NNTA 1B3EA 1NNPA 2Q88A 2UVIA 5K2XA 3TYHA 3A3CA 1MY0A 3KJ7A 1AOVA 1XI6A 2XA5A 4OVTA 3AXFA 2RC8A 3CG1A 2ZNUA 3OXNA 4M4GA 4EQBA 1A99A 3CRBA 3R6UA 1IMFA 3ECRA 4F1VA 5F24A 4ZZAA 3VDFA 4XIGQ 4NWCA 1MPDA 1A8EA 3ROJA 3EKIA 4P0IA 2O7UA 4Q5TA 3IAZA 1ZJLA 2RCBA 3U93A 1FTJA 2XWVA 5DEXB 2Y5LA 1FCKA 1IXIA 1VE4A 5ICQA 2VT5A 2OWZA 2P0SA 1Q9DA 3K02A 4HW8A 3KSXA 5I59B 1B46A 4N07A 1FPDA 1DPEA 1LAHE 2F36A 5CMBA 3C36A 3LSLA 3IL1B 1NUXA 3ZKLA 1IITA 3TELA 2HXRA 5I2NA 3EQ1A 2QRYA 2FIXA 4PBQA 4NF8A 1IQ7A 3PTYA 3TAJA 2UVJA 3RGYA 2BJJX 1PB7A 4YB7A 2DOJA 1MQJA 2VGQA 3MP1A 3IO6A 2F8DA 1BKAA 3NOHA 4DCXA 4RA1A 4ZEKA 3TKDA 2FNCA 3DP6A 2HFBA 1GVCA 2DE4A 1AIVA 4GQOA 4IO5A 4EDPA 4P11A 4OYVA 4OHNA 4JDFA 1IIWA 4BDQA 1N3WA 5FTHA 4KR5A 4YB5A 4ZE8A 4ISUA 4BDNA 3MVZA 1LB8A 1H44A 1B4HA 3RNNA 4GRKA 3L6HA 4DCYA 5KZTA 4OTEA 5I5PA 4LZ8A 2OX3A 4EF2A 4DDDA 5I2NB 4X9TA 4MNCA 4G77A 5FTIA 3K1MA 4U4SA 4MEVA 1FTKA 4PAKA 5K2YA 3KBZA 2I0BA 3K4UA 3Q29A 2E0SA 3FJMA 1FPJA 1SQYA 4F3BA 4MLQA 2DWIA 4OEUA 3OD7A 1B58A 1MQIA 1KZ8A 1FRPA 1OLAA 4H8JA 3MVXA 2KLFA 1O7TA 5IZ1A 4POXA 2Y7KA 3RQTA 1K9YA 5ET7A 4GWSA 2NUVA 5TU0A 4BLAA 2ZYNA 3ILUB 4YKIA 4QFKA 1YYZA 3R26A 5FHMA 2YLNA 1PEBA 1S9TA 4JVDA 3O6HA 4AS4A 3UA8A 2CZIA 4C0RA 4R6KA 1IXCA 1AMFA 3B6TA 3H6WA 2HPGA 4JSDA 2QMXA 3L6GA 3UORA 4OANA 3SEVA 5A5XA 5CM6A 4GBVA 3RN8A 3OO6A 1LEVA 4I40A 2XXHA 4XF5A 4LA9A 2FVZA 1KA0A 1P1NA 3FV1A 4C1UA 2RKMA 5H8QA 1MXWA 4F29A 4G61A 3IOVA 1FBEA 5DT6A 2G29A 4ND9A 4PE3A 5L8DA 3GLBA 2HHMA 5EQ8A 3O6IA 5JEIA 1NUZA 1R9QA 1M5BA 5I2KA 5ISUA 3K6UA 1NH8A 2H4IA 1MPCA 4KPTA 1N0TA 1YZ0A 4G8HA 4DXCA 3OENA 5DVIA 3FXQA 4N8GA 3GYYA 2O6AA 4F31B 3E79A 3ILTB 2PFYA 2OCUA 5LOMA 4ZS9A 4AS5A 1MQDA 2GH9A 3SEWA 1B5JA 1SW2A 4JVCA 5A5XB 3MP6A 3IFAA 2I3WA 3B7DA 4GF8A 1NV3A 3OO8A 3TFLA 4MNIA 3T9VA 5HPQA 1B7UA 4PP0A 4ELPA 3MQ9A 1MY4A 2DXRA 4H67A 3JZJA 3BKIB 4PFTA 1JETA 4LUBA 5H8QB 1POY1 2V25A 2I0CA 3VVFA 3MJNA 1EU8A 5L9SA 1IMBA 5J1DA 5M2VA 2GRVA 1FQAA 4Q30B 3THIA 1BP5A 4OVJA 5F7VA 1US4A 3MBPA 4ZEIA 2XX9A 3TCGA 3IJXB 1RYOA 3HHGA 2JJKA 4PFIA 2H5YA 2GQ1A 1H76A 4IY6A 2QJEA 3QXMA 1A40A 1PB9A 5ELVA 5B7DA 2QS4A 4R72A 3VLUA 1H3DA 2M8CA 4QSEA 1EYKA 5I84A 4GWZA 3UK4A 2V3UA 4U2RA 3Q28A 4IR8A 3OO7A 1MRPA 2Q9TA 3M3KA 3RUMA 2Q8JA 5IGAA 3BIHA 1LAGE 3RTWB 2Y84A 3EPEA 5KCJB 4OVQA 4Q8RA 5L9OA 3TCFA 2OLBA 3IB2A 2QVVA 3SDFA 3G3KA 2BJIA 1HSJA 4NE4A 3QAXA 3VXCA 5BUUA 1B3LA 2XXUA 4N17A 1H43A 3TTLA 4NG7A 4NF0A 3E13X 3VVDA 1P1OA 5T3JA 1FPKA 4R9GA 3S2VA 1MY3A 3IOTA 3N26A 4H1XA 2PYYA 3H6VA 2OWTA 4F39A 1A7LA 3T1BA 3U72A 3MVYA 3T9XB 1OQHA 3KC1A 1QW0A 3MPLA 3FZVA 4JSOA 4AB5A 4GWUA 4OVSA 4TLLB 4DZ1A 4EQ9A 2V3QA 4QSDA 5IZZA 1URSA 1VSOA 4AQ4A 1FPLA 3BIGA 1MM6A 1JP4A 1SW4A 4NQ8A 3OSQA 4ESWA 3TDJA 2Z8FA 2XWIA 2XWKA 3H7MA 3O29A 4N6DA 4R74A 2RC7A 3O66A 3O9PA 4RPOA 3FJ7A 4OXVA 1OVTA 1M5EA 5EQAA 2REJA 2VD3A 3FXUA 3RTFB 3SETA 1Y3PA 3K2DA 1D9VA 3RT6B 3D1RA 1B0HA 4P0GA 3MAMA 5JK4A 3CIJA 1B4ZA 1ELJA 3TEPA 3PMXA 3MWBA 3ZSFA 5AE4A 2O68A 4OFOA 5IAIA 5DEXA 3I5OA 4PAFA 1SD3A 3G3GA 2UVGA 1BK4A 4U1ZA 4LN5A 3SERA 4MBPA 1CE2A 4TQUQ 2ZNTA 3V8XB 4OFJA 3QIMA 3IFCA 2HAVA 4PF8A 3T0JA 2XXRA 2WBBA 1DTZA 1NNFA 2OK2A 3F11A 4GX4A 3SESA 2ZNSA 4LQ5A 4NF4B 2I58A 3O28A 4H0WA 2A5TA 4QFPA 1P1UA 1MM7A 3RPWA 1FBGA 2DP8A 3KSJA 4EUOA 4ZECA 2B3FA 1FSAA 3Q27A 2WKYA 2XXIA 1S7YA 4O3CA 1FQCA 4QRZA 1FTOA 4PFUA 1XHYA 1B0LA 3MP8A 3M3FA 1GGGA 1MPBA 5IZ3A 1B9JA 3CHGA 5EYFA 3IB0A 4O7IA 4OENA 3LV0A 3KJTA 4N6KA 2F7CA 3FUZA 2DVCA 3A09A 1MY1A 3EHSA 2I6EA 4N81A 1ZKBA 2I4BA 2PT1A 1B32A 1MY2A 1B1HA 2PMSA 3UIFA 2V84A 2ZZWA 4ZE9A 3H06B 4LZ7A 3CSBA 1B3HA 2AL4A 4O94A 3PUYE 2ZZXA 2ANJA 1SW1A 4GOTA 4PF6A 3PD8A 4NMYA 3TPAA 5ESYA 4DI4B 2G93A 3LBSA 3KN3A 3LSXA 4QXDA 2VPNA 2QS2A 5ITPA 4NF6B 4FBPA 2FA7A 4X1DA 2XXYA 1IXGA 4PDDA 3K00A 3QMFA 4HCWA 3QSLA 1ZU0A 2H98A 2XX7A 2DWJA 4JWXA 2A5TB 2O69A 1YAEA 3HCQA 4MIJA 1A55A 5ET6A 4DXBA 2XXKA 3VE1B 3RT8A 2DDKA 1KWHA 1LFHA 3BBRA 4PAIA 3PV0E 4GWOA 2F78A 4OETA 3U94A 3RPLA 3N6UA 1B1XA 1OQGA 2PT2A 3TODA 5TPAB 4IO7A 3K6VA 4KXPA 4YU0A 3CR9A 3CG3A 5IZ3B 4E0WA 2B65A 3PUVE 3OMBA 4UABA 4H65A 3O2AA 3MPKA 2I48A 1QKAA 3CFLA 3FASA 3PU5A 3A3UA 1NH7A 2PVUA 2RC9A 4TLMB 1Z7NE 1EH3A 4DIGA 3GBBA 4ONYA 5KDTB 1A54A 1JW1A 2AIXA 5DW8A 3TQWA 4EXKA 2ZYKA 1B05A 3QUJA 4GWWA 1QUIA 3LUZA 3C34A 2F35A 4R6YA 3SEUA 4QBAA 3HHFA 3RYDA 4YKKA 5IKBA 4I3EA 2X7QA 4IGTA 3ONMA 5DVFA 2GFEA 1SW5A 3OEMA 2UYFA 1NV7A 1B5IA 1A8FA 1QGXA 4P8BA 3UN6A 3B50A 4H6DA 2NOOA 4HE0A 4F18A 4KYSA 1XVYA 1QUKA 5F1QA 3RPLB 2B4LA 5CBRA 4OQOA 5EQ7A 4ZZEA 1MG1A 5I57A 2PFZA 1TT1A 1CNQA 4ESXA 2O51A 1M5FA 5FBPA 3S9EA 1FPIA 2Y5KA 5ICTA 2XXXA 4DI3D 4FIMA 2F97A 4OFLA 4O8MA 2XXVA 1NV6A 4MHFA 3W15C 4NTLA 1WDNA 5H8FB 2Y7PA 2F3DA 3E4RA 4KFQA 3KG2A 4NF5A 4BDRA 3K6WA 4F1UA 1LBYA 3VVEA 4OERA 4ZEBA 3RLFE 4PCDA 1N84A 3B6WA 3A29A 2QFLA 1Y3QA 1P1WA 1LBCA 1F9BA 2VP1A 4YKJA 4O3AA 4O3BA 1FQEA 1R9LA 4FJPA 2O1MA 4R2BA 2ABHA 1L5TA 5I58A 1ZIUA 4MAGA 2F7BA 2R71A 4NGUA 3PUWE 1H45A 3T22A 3U8QA 3M3LA 1KA1A 2Q89A 5EHMA 4GWXA 1SPIA 2Q2AA 2Q74A 3LSFB 4F2OA 4XEQA 4H8IA 4KCCA 3TTNA 4DXUA 1NUWA 5I57B 3IX1A 3S4UA 3CFZA 1NFTA 4H46A 1QJMA 2CZKA 2QS1A 2NWJA 1DSNA 1WVJA 3K1PA 4P56A 2XD3A 1JQFA 3VXBA 4N13A 1TFAA 4O7MA 1IXHA 5KCJA 1G0HA 4MMPA 1LCTA 1I69A 4GD5A 3FXRA 1D9YA 1ZLQA 4JWOA 1UIUA 5CMMA 4GFRA 4NF5B 1B2HA 3E9XA 2KR0A 1B51A 2GHAA 3MZBA 2E1SA 4PFBA 5CMKA 1OIBA 3I3VA 3KC0A 1Q35A 1LAXA 2Z8EA 5EYHA 1FW0A 1NL5A 3FGSA 5HBCA 4PQJA 1ATGA 5I58B 3FXBA 3C35A 1PB8A 3N6TA 1URDA 3K01A 3C33A 1I6QA 1TFDA 1TWYA 3FVGA 5IM2A 2F5XA 2O84X 2X7PA 1SI1A 3CSGA 4IY5A 3E78A 3WAFA 4LATA 4C1TA 3N94A 1RDXA 4I62A 2P3NA 4QF9A 2DWAA 4IO4A 3H03A 5TP9B 5AA1A 1D4NA 4GLIA 4F22A 1MXVA 5CMCA 2Y7IA 4OVPA 2RCAA 4F1YA 2Y7RA 4WEDA 4N91A 2Z8DA 1FQBA 2OJTA 5CBSA 3D4CA 4XKQA 2YJPA 4JXIA 1EYIA 1XT8A 3ZS6A 3ODBA 3OEKA 1S50A 1QVSA 3ISPA 3P7IA 1Y4CA 4I9DA 3H6UA 4OA4A 3PD9A 1UTBB 3K6XA 1LCFA 4KHZE 3DLNA 2D3IA 5BWJA 4KQPA 4F3PA 4FE8A 3OOAA 1G0IA 1OVBA 3MZ1A 1MQGA 1Y3NA 2P2AA 3SEYA 1XOCA 3T9UA 1SBPA 2XHDA 1PBQA 5FHOA 1N7XA 3V89B 1FPBA 4OEVA 2AYSA 2DE3A 2Y7WA 4IB2A 4OZ9A 2WBDA 1FQDA 4XXUA 2FYIA 1M5CA 2QS3A 4ELRA 4MNPA 4FECA 1R6ZA 3FV2A 1JEVA 1MDP1 1NI9A 2CEXA 4JBZA 3T66A 4IO2A 1O64A 2HAUA 4XKRA 1HSLA 2V4CA 4NF4A 1MXZA 4RXLA 3FVKA 1UQWA 1BIYA 3IB1A
chains in the Genus database with same CATH topology
4PFWA 3H3GA 2DS9A 2Z23A 1SI0A 1IUDA 3H4ZA 1HSEA 4MLVA 3T96B 3FJGA 4I8CA 1NKXA 5H8NB 1DTGA 2UXAA 3OELA 4IO3A 4PETA 4LP2B 2XD2A 2R9JA 4WXJA 3PUZE 3KN8A 3PMVA 5DYHA 4BDLA 4U1OA 3U92A 4ZDMA 3OO9A 5L9MA 4G68A 4MFIA 2P1SA 3PPQA 4QFOA 3JV9A 3K1NA 3N5LA 5AA2D 4IO6A 2F34A 1B7HA 3FATA 4EXLA 4Q0CA 1USYH 2PBWA 2V3TA 1UTHA 4GL8A 4XKNA 3KBRA 3Q26A 3MZ9A 1XS5A 3OSRA 5H8HB 3T9HB 1LAFE 3E3KA 1N04A 3FD3A 4YICA 2X26A 1EZOA 1PC3A 4NF6A 3MVWA 1MH4A 4NWDA 5JTYB 1B40A 4G8NA 3IJOB 4Z7EA 2Z22A 2D21A 1I6BA 3W9VA 4YMBA 3IK6B 3FVOA 1II5A 1EZ9A 1MXXA 1R1NA 3IORA 5CRYA 1B5HA 2PX1A 4GVOA 2RF1A 3IOWA 2DWHA 2OZZA 1OMPA 4RY1A 4F2QA 3CVGA 1BTJA 4FORA 1NMUA 4GIZA 1RYXA 4U21A 1MS7A 2I3VA 2IEEA 4WKMA 1SVXB 1JEUA 4G68B 5TPAA 3JYRA 5DVJA 1IZ1A 4PE5B 5ITOA 1USYE 1UTHB 2THIA 3TZAA 3QK6A 3VV5A 2VHAA 1AH5A 2F7AA 5CI5A 3HSTA 5KDTA 3VLVA 3VLWA 5AA2B 1FQFA 3V5AA 4R75A 4K3FA 4AB6A 3SEXA 2DYXA 3UGWA 4ZEDA 4KYEA 1LFIA 3MUQA 4R6HA 4BDMA 1MXUA 3GXAA 1MQHA 1LSTA 4R73A 3DP8A 2ALUA 1TXFA 4LONB 2YPNA 1T0KA 1YTVA 2AL5A 3D4GA 3C32A 4RPNA 1B7ZA 3FVNA 3S9NC 4KYDA 4EQ7A 1N3XA 2H9BA 1P99A 3CFXA 2XXTA 5H8FA 3TQLA 5AA3A 2VD2A 1JVYA 3KZGA 1DMBA 4XKPA 4YAHX 1FTLA 2DVZA 3QUFA 3GZGA 3K0VA 4OESA 2DQVA 1JW5A 4G8MA 3O6GA 4GXAA 2OBGA 1LGBC 3IR1A 2XX8A 4N6PA 1VR5A 4U4XA 1LFGA 1ZTYA 4UA8A 3EHUA 2OWSA 3USDA 4OMBA 3PPPA 3DP4A 1GTKA 2NXOA 3G3IA 4NF8B 3TTRA 5AA4A 1MXYA 3KOSA 4H5FA 2VOZA 3PPOA 2I4CA 3EF7A 3U1OA 4ELOA 3LR1A 3KOTA 4U23A 3Q25A 3C31A 4F3GA 3TTKA 1SYIA 1XC1A 1B3FA 3G3HA 4FEBA 4X1BA 1JW4A 4KI0E 4GL0A 3WAEA 2HZLA 3TTMA 3TCHA 3MW0A 2CZLA 3W9WA 2W7YA 3R7XA 4HTGA 3M8UA 3BFTA 1D3KA 1EZPA 2HQ0A 1GR2A 4G4PA 1GV8A 2HXWA 4DE8A 1QKBA 4YB6A 4EF1A 3HN0A 3B6QA 2QL3A 4LQ2A 3KGCA 1N76A 5AA4B 3I6VA 4U22A 4MH5A 5I56A 5CC2A 4FATA 3PMWA 3C4MA 2XXPA 3CI8A 1B3GA 2DXYA 2H99A 1Y4TA 2UVHA 4POWA 1CB6A 5TP9A 2D5WA 3KN7A 3PUXE 1PBPA 1ZMGA 3PGFA 1YPNA 4F19A 4RYAA 2V93A 2ONSA 1J1NA 4H5GA 5DTBA 1JNFA 3PPNA 2ZXTA 4YMAA 2ONRA 2HZKA 4QHQA 2ONKE 3TMGA 4E0XA 3HV1A 3LUYA 1FTMA 4QSCA 4RNSA 2HEUA 1UTBA 1Y20A 1ANFA 2R6GE 4FEDA 2F6PA 1POTA 3S9MC 3V83A 2IA4A 4BDOA 3EHTA 2H25A 1DOTA 4ECFA 1RKMA 2CMOA 4I1DA 5I56B 1US5A 1N7WA 4YZZA 4M1VA 4YKPA 5FHNA 2QPQA 1AL3A 4IGRA 3UP9A 1B52A 5I2KB 3DM0A 1XVXA 1I6AA 2HCAA 3DELB 4UACA 2QMWA 3KFMA 5HM4B 3KEIA 2I49A 1SYHA 4F3SA 3RY3A 4NEDA 1SDXA 2GHBA 1DPPA 1VFDA 4RK2A 4JB7A 5H8NA 4X48A 3T93B 1QULA 2A5SA 3IO4A 3QYTA 1Z7ME 4Z0IA 3SKPA 3ZKKA 3PPRA 2ESNA 1LBBA 4L17A 2REGA 2ZMBA 3TUSA 2NVUB 4KD5A 3H6TA 1LLSA 5H8HA 4ZEFA 4QFLA 2LAOA 4GXSB 5B70A 1Y1ZA 4R2FA 3FIRA 1UIVA 3BFUA 2XXQA 1O63A 5JTYA 2Q2CA 3LSWA 1MH3A 1P1QA 4HS7A 1JVXA 4JWYA 2F6GA 4R9FA 4RK9A 2ZYMA 1OLCA 3S9LC 3HO7A 3O97A 1VFEA 4RJZA 4WEPA 5H8SA 3LC8A 4KCDA 1YCJA 4LVQA 1M5DA 4G2ZA 3GBAA 3G3FA 4MF3A 4PFYA 4G68C 4TOZA 1Q1KA 4QFNA 1PDAA 2DE2A 3G7WA 1WODA 1BLFA 2DSFA 4FAJA 4OWDA 2RINA 1MDQA 5EHSA 3G3JA 3HPIA 2B3BA 1QUJA 2QSXA 5AA2A 2UYEA 3IOUA 5I59A 3VFJA 3C9HA 1B6HA 2O7IA 4THIA 4DLDA 3MC2A 1LB9A 1Y9UA 4HCYA 2O1LA 4ELQA 4XTCQ 2ZYOA 1ZBMA 1NNKA 3EN3A 4LZ5A 1Y1MA 1URGA 1IEJA 2XXWA 1NNTA 1B3EA 1NNPA 2Q88A 2UVIA 5K2XA 3TYHA 3A3CA 1MY0A 3KJ7A 1AOVA 3AXFA 2RC8A 3CG1A 2ZNUA 3OXNA 4M4GA 4EQBA 1A99A 3CRBA 3R6UA 3ECRA 3VDFA 4ZZAA 4XIGQ 4NWCA 1MPDA 1A8EA 4P0IA 2O7UA 4Q5TA 3IAZA 1ZJLA 2RCBA 3U93A 1FTJA 5DEXB 1FCKA 1IXIA 1VE4A 5ICQA 2P0SA 3K02A 4HW8A 3KSXA 5I59B 1B46A 4N07A 1DPEA 1LAHE 2F36A 5CMBA 3C36A 3LSLA 3IL1B 3ZKLA 1IITA 3TELA 5I2NA 3EQ1A 2QRYA 4NF8A 1IQ7A 3TAJA 2UVJA 3RGYA 2BJJX 1PB7A 4YB7A 2DOJA 1MQJA 2VGQA 3MP1A 3IO6A 2F8DA 1BKAA 4DCXA 4RA1A 4ZEKA 3TKDA 2FNCA 3DP6A 2HFBA 1GVCA 2DE4A 1AIVA 4GQOA 4IO5A 4EDPA 4P11A 4OYVA 4OHNA 4JDFA 1IIWA 4BDQA 1N3WA 5FTHA 4KR5A 4YB5A 4ZE8A 4ISUA 4BDNA 3MVZA 1LB8A 1H44A 1B4HA 3RNNA 4GRKA 3L6HA 4DCYA 5KZTA 4OTEA 4LZ8A 4EF2A 4DDDA 5I2NB 4X9TA 4G77A 5FTIA 3K1MA 4U4SA 1FTKA 5K2YA 2I0BA 3K4UA 3Q29A 2E0SA 3FJMA 1SQYA 4F3BA 4MLQA 2DWIA 4OEUA 3OD7A 1B58A 1MQIA 1OLAA 4H8JA 3MVXA 2KLFA 1O7TA 4POXA 2Y7KA 3RQTA 2NUVA 5TU0A 4BLAA 2ZYNA 3ILUB 4YKIA 4QFKA 3R26A 5FHMA 2YLNA 1PEBA 1S9TA 3O6HA 3UA8A 4C0RA 4R6KA 1IXCA 1AMFA 3B6TA 3H6WA 4JSDA 2QMXA 3L6GA 3UORA 3SEVA 5A5XA 5CM6A 3RN8A 3OO6A 2XXHA 4LA9A 3FV1A 1P1NA 4C1UA 2RKMA 5H8QA 1MXWA 4F29A 3IOVA 5DT6A 2G29A 4ND9A 5L8DA 3GLBA 3O6IA 5JEIA 1R9QA 1M5BA 5I2KA 5ISUA 3K6UA 1NH8A 2H4IA 1MPCA 4KPTA 1N0TA 4G8HA 4DXCA 3OENA 5DVIA 3FXQA 2O6AA 4F31B 3ILTB 2OCUA 5LOMA 4ZS9A 1MQDA 2GH9A 3SEWA 1B5JA 1SW2A 5A5XB 3MP6A 2I3WA 3B7DA 4GF8A 3OO8A 3TFLA 3T9VA 5HPQA 1B7UA 4PP0A 4ELPA 3MQ9A 1MY4A 2DXRA 4H67A 3JZJA 3BKIB 4PFTA 1JETA 4LUBA 5H8QB 1POY1 2V25A 2I0CA 3VVFA 3MJNA 1EU8A 5L9SA 5J1DA 5M2VA 2GRVA 1FQAA 4Q30B 3THIA 1BP5A 4OVJA 5F7VA 1US4A 3MBPA 4ZEIA 2XX9A 3TCGA 3IJXB 1RYOA 3HHGA 2H5YA 1H76A 4IY6A 2QJEA 3QXMA 1A40A 1PB9A 5ELVA 5B7DA 2QS4A 4R72A 3VLUA 1H3DA 2M8CA 4QSEA 5I84A 3UK4A 2V3UA 4U2RA 3Q28A 3OO7A 1MRPA 2Q9TA 3M3KA 3RUMA 2Q8JA 1LAGE 3RTWB 2Y84A 3EPEA 5KCJB 4Q8RA 5L9OA 3TCFA 2OLBA 3IB2A 3SDFA 3G3KA 1HSJA 4NE4A 3QAXA 3VXCA 5BUUA 1B3LA 2XXUA 1H43A 3TTLA 3E13X 3VVDA 1P1OA 4R9GA 3S2VA 1MY3A 3IOTA 3N26A 4H1XA 2PYYA 3H6VA 2OWTA 4F39A 1A7LA 3U72A 3MVYA 3T9XB 1OQHA 1QW0A 3MPLA 3FZVA 4JSOA 4AB5A 4TLLB 4DZ1A 4EQ9A 2V3QA 4QSDA 1URSA 1VSOA 4AQ4A 1MM6A 1SW4A 3OSQA 4ESWA 3TDJA 2Z8FA 3O29A 3H7MA 4R74A 2RC7A 3O66A 3O9PA 4RPOA 3FJ7A 4OXVA 1OVTA 1M5EA 2REJA 2VD3A 3FXUA 3RTFB 3SETA 1Y3PA 3K2DA 1D9VA 3RT6B 1B0HA 4P0GA 3MAMA 5JK4A 3CIJA 1B4ZA 1ELJA 3TEPA 3PMXA 3MWBA 3ZSFA 5AE4A 2O68A 4OFOA 5IAIA 5DEXA 3I5OA 1SD3A 3G3GA 2UVGA 4U1ZA 3SERA 4MBPA 1CE2A 4TQUQ 2ZNTA 3V8XB 4OFJA 3QIMA 2HAVA 2XXRA 1DTZA 1NNFA 2OK2A 3F11A 3SESA 2ZNSA 4LQ5A 4NF4B 2I58A 3O28A 4H0WA 2A5TA 4QFPA 1P1UA 1MM7A 3RPWA 2DP8A 3KSJA 4EUOA 4ZECA 2B3FA 3Q27A 2WKYA 2XXIA 1S7YA 4O3CA 1FQCA 4QRZA 1FTOA 4PFUA 1XHYA 1B0LA 3MP8A 3M3FA 1GGGA 1MPBA 1B9JA 5EYFA 3IB0A 4OENA 3KJTA 2F7CA 3FUZA 2DVCA 3A09A 1MY1A 3EHSA 2I6EA 1ZKBA 2I4BA 2PT1A 1B32A 1MY2A 1B1HA 2PMSA 3UIFA 2V84A 4ZE9A 3H06B 4LZ7A 3CSBA 1B3HA 2AL4A 3PUYE 2ANJA 1SW1A 4GOTA 3PD8A 4NMYA 3TPAA 2G93A 3LBSA 3KN3A 3LSXA 2QS2A 5ITPA 4NF6B 2FA7A 4X1DA 2XXYA 1IXGA 3K00A 4HCWA 3QSLA 1ZU0A 2H98A 2XX7A 2DWJA 4JWXA 2A5TB 2O69A 1YAEA 3HCQA 1A55A 4DXBA 3VE1B 3RT8A 1KWHA 1LFHA 3BBRA 3PV0E 4GWOA 2F78A 4OETA 3U94A 3N6UA 1B1XA 1OQGA 2PT2A 3TODA 5TPAB 4IO7A 3K6VA 4YU0A 3CR9A 3CG3A 4E0WA 2B65A 3PUVE 3OMBA 4H65A 3O2AA 3MPKA 2I48A 1QKAA 3CFLA 3FASA 3PU5A 3A3UA 1NH7A 2PVUA 2RC9A 4TLMB 1Z7NE 1EH3A 4DIGA 3GBBA 4ONYA 5KDTB 1A54A 1JW1A 2AIXA 3TQWA 4EXKA 2ZYKA 1B05A 3QUJA 1QUIA 3C34A 2F35A 4R6YA 3SEUA 3HHFA 4YKKA 5IKBA 2X7QA 4IGTA 3ONMA 5DVFA 2GFEA 1SW5A 3OEMA 2UYFA 1B5IA 1A8FA 3UN6A 4H6DA 2NOOA 4F18A 4KYSA 1XVYA 1QUKA 5F1QA 5CBRA 4OQOA 4ZZEA 1MG1A 5I57A 1TT1A 2O51A 1M5FA 3S9EA 5ICTA 2XXXA 4FIMA 2F97A 4OFLA 2XXVA 3W15C 4NTLA 1WDNA 5H8FB 2Y7PA 3E4RA 4KFQA 3KG2A 4NF5A 4BDRA 3K6WA 4F1UA 3VVEA 4OERA 4ZEBA 3RLFE 1N84A 3B6WA 1Y3QA 1P1WA 1LBCA 1F9BA 2VP1A 4YKJA 4O3AA 4O3BA 1FQEA 1R9LA 4FJPA 2O1MA 4R2BA 2ABHA 1L5TA 5I58A 1ZIUA 2F7BA 2R71A 3PUWE 1H45A 3T22A 3U8QA 3M3LA 2Q89A 5EHMA 2Q2AA 4F2OA 3LSFB 4H8IA 4KCCA 3TTNA 4DXUA 5I57B 3IX1A 3S4UA 3CFZA 1NFTA 1QJMA 2QS1A 2NWJA 1DSNA 1WVJA 3K1PA 2XD3A 1JQFA 3VXBA 4N13A 1TFAA 1IXHA 5KCJA 1LCTA 1I69A 4GD5A 3FXRA 1D9YA 1ZLQA 4JWOA 1UIUA 5CMMA 4GFRA 4NF5B 1B2HA 3E9XA 1B51A 2GHAA 3MZBA 2E1SA 5CMKA 1OIBA 3I3VA 1Q35A 1LAXA 2Z8EA 1FW0A 1NL5A 3FGSA 5HBCA 4PQJA 1ATGA 5I58B 3C35A 1PB8A 3N6TA 1URDA 3K01A 3C33A 1I6QA 1TFDA 1TWYA 3FVGA 2F5XA 2O84X 2X7PA 1SI1A 3CSGA 4IY5A 3WAFA 4LATA 4C1TA 3N94A 4I62A 4QF9A 2DWAA 4IO4A 3H03A 5TP9B 5AA1A 1D4NA 4GLIA 4F22A 1MXVA 5CMCA 2Y7IA 2RCAA 4F1YA 2Y7RA 4WEDA 2Z8DA 1FQBA 2OJTA 5CBSA 3D4CA 4XKQA 2YJPA 4JXIA 1XT8A 3ZS6A 3ODBA 3OEKA 1S50A 1QVSA 3P7IA 1Y4CA 4I9DA 3H6UA 3PD9A 1UTBB 3K6XA 1LCFA 4KHZE 3DLNA 2D3IA 5BWJA 4KQPA 4F3PA 4FE8A 3OOAA 1OVBA 3MZ1A 1MQGA 1Y3NA 2P2AA 3SEYA 1XOCA 3T9UA 1SBPA 2XHDA 1PBQA 5FHOA 1N7XA 3V89B 4OEVA 2AYSA 2DE3A 2Y7WA 4IB2A 4OZ9A 1FQDA 4XXUA 2FYIA 1M5CA 2QS3A 4ELRA 4FECA 1R6ZA 3FV2A 1JEVA 1MDP1 4JBZA 3T66A 4IO2A 1O64A 2HAUA 4XKRA 1HSLA 1BIYA 3IB1A 4NF4A 1MXZA 3FVKA 4RXLA 1UQWA 4ESXA 4F1VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PFW A;  3H3G A;  2DS9 A;  2Z23 A;  1SI0 A;  1IUD A;  3H4Z A;  1HSE A;  4MLV A;  3T96 B;  3FJG A;  4I8C A;  1NKX A;  5H8N B;  1DTG A;  2UXA A;  3OEL A;  4IO3 A;  4PET A;  4LP2 B;  2XD2 A;  2R9J A;  4WXJ A;  3PUZ E;  3KN8 A;  3PMV A;  5DYH A;  4BDL A;  4U1O A;  3U92 A;  4ZDM A;  3OO9 A;  5L9M A;  4G68 A;  4MFI A;  2P1S A;  3PPQ A;  4QFO A;  3JV9 A;  3K1N A;  3N5L A;  5AA2 D;  4IO6 A;  2F34 A;  1B7H A;  3FAT A;  4EXL A;  4Q0C A;  1USY H;  2PBW A;  2V3T A;  1UTH A;  4GL8 A;  4XKN A;  3KBR A;  3Q26 A;  3MZ9 A;  1XS5 A;  3OSR A;  5H8H B;  3T9H B;  1LAF E;  3E3K A;  1N04 A;  3FD3 A;  4YIC A;  2X26 A;  1EZO A;  1PC3 A;  4NF6 A;  3MVW A;  1MH4 A;  4NWD A;  5JTY B;  1B40 A;  4G8N A;  3IJO B;  4Z7E A;  2Z22 A;  2D21 A;  1I6B A;  3W9V A;  4YMB A;  3IK6 B;  3FVO A;  1II5 A;  1EZ9 A;  1MXX A;  1R1N A;  3IOR A;  5CRY A;  1B5H A;  2PX1 A;  4GVO A;  2RF1 A;  3IOW A;  2DWH A;  2OZZ A;  1OMP A;  4RY1 A;  4F2Q A;  3CVG A;  1BTJ A;  4FOR A;  1NMU A;  4GIZ A;  1RYX A;  4U21 A;  1MS7 A;  2I3V A;  2IEE A;  4WKM A;  1SVX B;  1JEU A;  4G68 B;  5TPA A;  3JYR A;  5DVJ A;  1IZ1 A;  4PE5 B;  5ITO A;  1USY E;  1UTH B;  2THI A;  3TZA A;  3QK6 A;  3VV5 A;  2VHA A;  1AH5 A;  2F7A A;  5CI5 A;  3HST A;  5KDT A;  3VLV A;  3VLW A;  5AA2 B;  1FQF A;  3V5A A;  4R75 A;  4K3F A;  4AB6 A;  3SEX A;  2DYX A;  3UGW A;  4ZED A;  4KYE A;  1LFI A;  3MUQ A;  4R6H A;  4BDM A;  1MXU A;  3GXA A;  1MQH A;  1LST A;  4R73 A;  3DP8 A;  2ALU A;  1TXF A;  4LON B;  2YPN A;  1T0K A;  1YTV A;  2AL5 A;  3D4G A;  3C32 A;  4RPN A;  1B7Z A;  3FVN A;  3S9N C;  4KYD A;  4EQ7 A;  1N3X A;  2H9B A;  1P99 A;  3CFX A;  2XXT A;  5H8F A;  3TQL A;  5AA3 A;  2VD2 A;  1JVY A;  3KZG A;  1DMB A;  4XKP A;  4YAH X;  1FTL A;  2DVZ A;  3QUF A;  3GZG A;  3K0V A;  4OES A;  2DQV A;  1JW5 A;  4G8M A;  3O6G A;  4GXA A;  2OBG A;  1LGB C;  3IR1 A;  2XX8 A;  4N6P A;  1VR5 A;  4U4X A;  1LFG A;  1ZTY A;  4UA8 A;  3EHU A;  2OWS A;  3USD A;  4OMB A;  3PPP A;  3DP4 A;  1GTK A;  2NXO A;  3G3I A;  4NF8 B;  3TTR A;  5AA4 A;  1MXY A;  3KOS A;  4H5F A;  2VOZ A;  3PPO A;  2I4C A;  3EF7 A;  3U1O A;  4ELO A;  3LR1 A;  3KOT A;  4U23 A;  3Q25 A;  3C31 A;  4F3G A;  3TTK A;  1SYI A;  1XC1 A;  1B3F A;  3G3H A;  4FEB A;  4X1B A;  1JW4 A;  4KI0 E;  4GL0 A;  3WAE A;  2HZL A;  3TTM A;  3TCH A;  3MW0 A;  2CZL A;  3W9W A;  2W7Y A;  3R7X A;  4HTG A;  3M8U A;  3BFT A;  1D3K A;  1EZP A;  2HQ0 A;  1GR2 A;  4G4P A;  1GV8 A;  2HXW A;  4DE8 A;  1QKB A;  4YB6 A;  4EF1 A;  3HN0 A;  3B6Q A;  2QL3 A;  4LQ2 A;  3KGC A;  1N76 A;  5AA4 B;  3I6V A;  4U22 A;  4MH5 A;  5I56 A;  5CC2 A;  4FAT A;  3PMW A;  3C4M A;  2XXP A;  3CI8 A;  1B3G A;  2DXY A;  2H99 A;  1Y4T A;  2UVH A;  4POW A;  1CB6 A;  5TP9 A;  2D5W A;  3KN7 A;  3PUX E;  1PBP A;  1ZMG A;  3PGF A;  1YPN A;  4F19 A;  4RYA A;  2V93 A;  2ONS A;  1J1N A;  4H5G A;  5DTB A;  1JNF A;  3PPN A;  2ZXT A;  4YMA A;  2ONR A;  2HZK A;  4QHQ A;  2ONK E;  3TMG A;  4E0X A;  3HV1 A;  3LUY A;  1FTM A;  4QSC A;  4RNS A;  2HEU A;  1UTB A;  1Y20 A;  1ANF A;  2R6G E;  4FED A;  2F6P A;  1POT A;  3S9M C;  3V83 A;  2IA4 A;  4BDO A;  3EHT A;  2H25 A;  1DOT A;  4ECF A;  1RKM A;  2CMO A;  4I1D A;  5I56 B;  1US5 A;  1N7W A;  4YZZ A;  4M1V A;  4YKP A;  5FHN A;  2QPQ A;  1AL3 A;  4IGR A;  3UP9 A;  1B52 A;  5I2K B;  3DM0 A;  1XVX A;  1I6A A;  2HCA A;  3DEL B;  4UAC A;  2QMW A;  3KFM A;  5HM4 B;  3KEI A;  2I49 A;  1SYH A;  4F3S A;  3RY3 A;  4NED A;  1SDX A;  2GHB A;  1DPP A;  1VFD A;  4RK2 A;  4JB7 A;  5H8N A;  4X48 A;  3T93 B;  1QUL A;  2A5S A;  3IO4 A;  3QYT A;  1Z7M E;  4Z0I A;  3SKP A;  3ZKK A;  3PPR A;  2ESN A;  1LBB A;  4L17 A;  2REG A;  2ZMB A;  3TUS A;  2NVU B;  4KD5 A;  3H6T A;  1LLS A;  5H8H A;  4ZEF A;  4QFL A;  2LAO A;  4GXS B;  5B70 A;  1Y1Z A;  4R2F A;  3FIR A;  1UIV A;  3BFU A;  2XXQ A;  1O63 A;  5JTY A;  2Q2C A;  3LSW A;  1MH3 A;  1P1Q A;  4HS7 A;  1JVX A;  4JWY A;  2F6G A;  4R9F A;  4RK9 A;  2ZYM A;  1OLC A;  3S9L C;  3HO7 A;  3O97 A;  1VFE A;  4RJZ A;  4WEP A;  5H8S A;  3LC8 A;  4KCD A;  1YCJ A;  4LVQ A;  1M5D A;  4G2Z A;  3GBA A;  3G3F A;  4MF3 A;  4PFY A;  4G68 C;  4TOZ A;  1Q1K A;  4QFN A;  1PDA A;  2DE2 A;  3G7W A;  1WOD A;  1BLF A;  2DSF A;  4FAJ A;  4OWD A;  2RIN A;  1MDQ A;  5EHS A;  3G3J A;  3HPI A;  2B3B A;  1QUJ A;  2QSX A;  5AA2 A;  2UYE A;  3IOU A;  5I59 A;  3VFJ A;  3C9H A;  1B6H A;  2O7I A;  4THI A;  4DLD A;  3MC2 A;  1LB9 A;  1Y9U A;  4HCY A;  2O1L A;  4ELQ A;  4XTC Q;  2ZYO A;  1ZBM A;  1NNK A;  3EN3 A;  4LZ5 A;  1Y1M A;  1URG A;  1IEJ A;  2XXW A;  1NNT A;  1B3E A;  1NNP A;  2Q88 A;  2UVI A;  5K2X A;  3TYH A;  3A3C A;  1MY0 A;  3KJ7 A;  1AOV A;  3AXF A;  2RC8 A;  3CG1 A;  2ZNU A;  3OXN A;  4M4G A;  4EQB A;  1A99 A;  3CRB A;  3R6U A;  3ECR A;  3VDF A;  4ZZA A;  4XIG Q;  4NWC A;  1MPD A;  1A8E A;  4P0I A;  2O7U A;  4Q5T A;  3IAZ A;  1ZJL A;  2RCB A;  3U93 A;  1FTJ A;  5DEX B;  1FCK A;  1IXI A;  1VE4 A;  5ICQ A;  2P0S A;  3K02 A;  4HW8 A;  3KSX A;  5I59 B;  1B46 A;  4N07 A;  1DPE A;  1LAH E;  2F36 A;  5CMB A;  3C36 A;  3LSL A;  3IL1 B;  3ZKL A;  1IIT A;  3TEL A;  5I2N A;  3EQ1 A;  2QRY A;  4NF8 A;  1IQ7 A;  3TAJ A;  2UVJ A;  3RGY A;  2BJJ X;  1PB7 A;  4YB7 A;  2DOJ A;  1MQJ A;  2VGQ A;  3MP1 A;  3IO6 A;  2F8D A;  1BKA A;  4DCX A;  4RA1 A;  4ZEK A;  3TKD A;  2FNC A;  3DP6 A;  2HFB A;  1GVC A;  2DE4 A;  1AIV A;  4GQO A;  4IO5 A;  4EDP A;  4P11 A;  4OYV A;  4OHN A;  4JDF A;  1IIW A;  4BDQ A;  1N3W A;  5FTH A;  4KR5 A;  4YB5 A;  4ZE8 A;  4ISU A;  4BDN A;  3MVZ A;  1LB8 A;  1H44 A;  1B4H A;  3RNN A;  4GRK A;  3L6H A;  4DCY A;  5KZT A;  4OTE A;  4LZ8 A;  4EF2 A;  4DDD A;  5I2N B;  4X9T A;  4G77 A;  5FTI A;  3K1M A;  4U4S A;  1FTK A;  5K2Y A;  2I0B A;  3K4U A;  3Q29 A;  2E0S A;  3FJM A;  1SQY A;  4F3B A;  4MLQ A;  2DWI A;  4OEU A;  3OD7 A;  1B58 A;  1MQI A;  1OLA A;  4H8J A;  3MVX A;  2KLF A;  1O7T A;  4POX A;  2Y7K A;  3RQT A;  2NUV A;  5TU0 A;  4BLA A;  2ZYN A;  3ILU B;  4YKI A;  4QFK A;  3R26 A;  5FHM A;  2YLN A;  1PEB A;  1S9T A;  3O6H A;  3UA8 A;  4C0R A;  4R6K A;  1IXC A;  1AMF A;  3B6T A;  3H6W A;  4JSD A;  2QMX A;  3L6G A;  3UOR A;  3SEV A;  5A5X A;  5CM6 A;  3RN8 A;  3OO6 A;  2XXH A;  4LA9 A;  3FV1 A;  1P1N A;  4C1U A;  2RKM A;  5H8Q A;  1MXW A;  4F29 A;  3IOV A;  5DT6 A;  2G29 A;  4ND9 A;  5L8D A;  3GLB A;  3O6I A;  5JEI A;  1R9Q A;  1M5B A;  5I2K A;  5ISU A;  3K6U A;  1NH8 A;  2H4I A;  1MPC A;  4KPT A;  1N0T A;  4G8H A;  4DXC A;  3OEN A;  5DVI A;  3FXQ A;  2O6A A;  4F31 B;  3ILT B;  2OCU A;  5LOM A;  4ZS9 A;  1MQD A;  2GH9 A;  3SEW A;  1B5J A;  1SW2 A;  5A5X B;  3MP6 A;  2I3W A;  3B7D A;  4GF8 A;  3OO8 A;  3TFL A;  3T9V A;  5HPQ A;  1B7U A;  4PP0 A;  4ELP A;  3MQ9 A;  1MY4 A;  2DXR A;  4H67 A;  3JZJ A;  3BKI B;  4PFT A;  1JET A;  4LUB A;  5H8Q B;  1POY 1;  2V25 A;  2I0C A;  3VVF A;  3MJN A;  1EU8 A;  5L9S A;  5J1D A;  5M2V A;  2GRV A;  1FQA A;  4Q30 B;  3THI A;  1BP5 A;  4OVJ A;  5F7V A;  1US4 A;  3MBP A;  4ZEI A;  2XX9 A;  3TCG A;  3IJX B;  1RYO A;  3HHG A;  2H5Y A;  1H76 A;  4IY6 A;  2QJE A;  3QXM A;  1A40 A;  1PB9 A;  5ELV A;  5B7D A;  2QS4 A;  4R72 A;  3VLU A;  1H3D A;  2M8C A;  4QSE A;  5I84 A;  3UK4 A;  2V3U A;  4U2R A;  3Q28 A;  3OO7 A;  1MRP A;  2Q9T A;  3M3K A;  3RUM A;  2Q8J A;  1LAG E;  3RTW B;  2Y84 A;  3EPE A;  5KCJ B;  4Q8R A;  5L9O A;  3TCF A;  2OLB A;  3IB2 A;  3SDF A;  3G3K A;  1HSJ A;  4NE4 A;  3QAX A;  3VXC A;  5BUU A;  1B3L A;  2XXU A;  1H43 A;  3TTL A;  3E13 X;  3VVD A;  1P1O A;  4R9G A;  3S2V A;  1MY3 A;  3IOT A;  3N26 A;  4H1X A;  2PYY A;  3H6V A;  2OWT A;  4F39 A;  1A7L A;  3U72 A;  3MVY A;  3T9X B;  1OQH A;  1QW0 A;  3MPL A;  3FZV A;  4JSO A;  4AB5 A;  4TLL B;  4DZ1 A;  4EQ9 A;  2V3Q A;  4QSD A;  1URS A;  1VSO A;  4AQ4 A;  1MM6 A;  1SW4 A;  3OSQ A;  4ESW A;  3TDJ A;  2Z8F A;  3O29 A;  3H7M A;  4R74 A;  2RC7 A;  3O66 A;  3O9P A;  4RPO A;  3FJ7 A;  4OXV A;  1OVT A;  1M5E A;  2REJ A;  2VD3 A;  3FXU A;  3RTF B;  3SET A;  1Y3P A;  3K2D A;  1D9V A;  3RT6 B;  1B0H A;  4P0G A;  3MAM A;  5JK4 A;  3CIJ A;  1B4Z A;  1ELJ A;  3TEP A;  3PMX A;  3MWB A;  3ZSF A;  5AE4 A;  2O68 A;  4OFO A;  5IAI A;  5DEX A;  3I5O A;  1SD3 A;  3G3G A;  2UVG A;  4U1Z A;  3SER A;  4MBP A;  1CE2 A;  4TQU Q;  2ZNT A;  3V8X B;  4OFJ A;  3QIM A;  2HAV A;  2XXR A;  1DTZ A;  1NNF A;  2OK2 A;  3F11 A;  3SES A;  2ZNS A;  4LQ5 A;  4NF4 B;  2I58 A;  3O28 A;  4H0W A;  2A5T A;  4QFP A;  1P1U A;  1MM7 A;  3RPW A;  2DP8 A;  3KSJ A;  4EUO A;  4ZEC A;  2B3F A;  3Q27 A;  2WKY A;  2XXI A;  1S7Y A;  4O3C A;  1FQC A;  4QRZ A;  1FTO A;  4PFU A;  1XHY A;  1B0L A;  3MP8 A;  3M3F A;  1GGG A;  1MPB A;  1B9J A;  5EYF A;  3IB0 A;  4OEN A;  3KJT A;  2F7C A;  3FUZ A;  2DVC A;  3A09 A;  1MY1 A;  3EHS A;  2I6E A;  1ZKB A;  2I4B A;  2PT1 A;  1B32 A;  1MY2 A;  1B1H A;  2PMS A;  3UIF A;  2V84 A;  4ZE9 A;  3H06 B;  4LZ7 A;  3CSB A;  1B3H A;  2AL4 A;  3PUY E;  2ANJ A;  1SW1 A;  4GOT A;  3PD8 A;  4NMY A;  3TPA A;  2G93 A;  3LBS A;  3KN3 A;  3LSX A;  2QS2 A;  5ITP A;  4NF6 B;  2FA7 A;  4X1D A;  2XXY A;  1IXG A;  3K00 A;  4HCW A;  3QSL A;  1ZU0 A;  2H98 A;  2XX7 A;  2DWJ A;  4JWX A;  2A5T B;  2O69 A;  1YAE A;  3HCQ A;  1A55 A;  4DXB A;  3VE1 B;  3RT8 A;  1KWH A;  1LFH A;  3BBR A;  3PV0 E;  4GWO A;  2F78 A;  4OET A;  3U94 A;  3N6U A;  1B1X A;  1OQG A;  2PT2 A;  3TOD A;  5TPA B;  4IO7 A;  3K6V A;  4YU0 A;  3CR9 A;  3CG3 A;  4E0W A;  2B65 A;  3PUV E;  3OMB A;  4H65 A;  3O2A A;  3MPK A;  2I48 A;  1QKA A;  3CFL A;  3FAS A;  3PU5 A;  3A3U A;  1NH7 A;  2PVU A;  2RC9 A;  4TLM B;  1Z7N E;  1EH3 A;  4DIG A;  3GBB A;  4ONY A;  5KDT B;  1A54 A;  1JW1 A;  2AIX A;  3TQW A;  4EXK A;  2ZYK A;  1B05 A;  3QUJ A;  1QUI A;  3C34 A;  2F35 A;  4R6Y A;  3SEU A;  3HHF A;  4YKK A;  5IKB A;  2X7Q A;  4IGT A;  3ONM A;  5DVF A;  2GFE A;  1SW5 A;  3OEM A;  2UYF A;  1B5I A;  1A8F A;  3UN6 A;  4H6D A;  2NOO A;  4F18 A;  4KYS A;  1XVY A;  1QUK A;  5F1Q A;  5CBR A;  4OQO A;  4ZZE A;  1MG1 A;  5I57 A;  1TT1 A;  2O51 A;  1M5F A;  3S9E A;  5ICT A;  2XXX A;  4FIM A;  2F97 A;  4OFL A;  2XXV A;  3W15 C;  4NTL A;  1WDN A;  5H8F B;  2Y7P A;  3E4R A;  4KFQ A;  3KG2 A;  4NF5 A;  4BDR A;  3K6W A;  4F1U A;  3VVE A;  4OER A;  4ZEB A;  3RLF E;  1N84 A;  3B6W A;  1Y3Q A;  1P1W A;  1LBC A;  1F9B A;  2VP1 A;  4YKJ A;  4O3A A;  4O3B A;  1FQE A;  1R9L A;  4FJP A;  2O1M A;  4R2B A;  2ABH A;  1L5T A;  5I58 A;  1ZIU A;  2F7B A;  2R71 A;  3PUW E;  1H45 A;  3T22 A;  3U8Q A;  3M3L A;  2Q89 A;  5EHM A;  2Q2A A;  4F2O A;  3LSF B;  4H8I A;  4KCC A;  3TTN A;  4DXU A;  5I57 B;  3IX1 A;  3S4U A;  3CFZ A;  1NFT A;  1QJM A;  2QS1 A;  2NWJ A;  1DSN A;  1WVJ A;  3K1P A;  2XD3 A;  1JQF A;  3VXB A;  4N13 A;  1TFA A;  1IXH A;  5KCJ A;  1LCT A;  1I69 A;  4GD5 A;  3FXR A;  1D9Y A;  1ZLQ A;  4JWO A;  1UIU A;  5CMM A;  4GFR A;  4NF5 B;  1B2H A;  3E9X A;  1B51 A;  2GHA A;  3MZB A;  2E1S A;  5CMK A;  1OIB A;  3I3V A;  1Q35 A;  1LAX A;  2Z8E A;  1FW0 A;  1NL5 A;  3FGS A;  5HBC A;  4PQJ A;  1ATG A;  5I58 B;  3C35 A;  1PB8 A;  3N6T A;  1URD A;  3K01 A;  3C33 A;  1I6Q A;  1TFD A;  1TWY A;  3FVG A;  2F5X A;  2O84 X;  2X7P A;  1SI1 A;  3CSG A;  4IY5 A;  3WAF A;  4LAT A;  4C1T A;  3N94 A;  4I62 A;  4QF9 A;  2DWA A;  4IO4 A;  3H03 A;  5TP9 B;  5AA1 A;  1D4N A;  4GLI A;  4F22 A;  1MXV A;  5CMC A;  2Y7I A;  2RCA A;  4F1Y A;  2Y7R A;  4WED A;  2Z8D A;  1FQB A;  2OJT A;  5CBS A;  3D4C A;  4XKQ A;  2YJP A;  4JXI A;  1XT8 A;  3ZS6 A;  3ODB A;  3OEK A;  1S50 A;  1QVS A;  3P7I A;  1Y4C A;  4I9D A;  3H6U A;  3PD9 A;  1UTB B;  3K6X A;  1LCF A;  4KHZ E;  3DLN A;  2D3I A;  5BWJ A;  4KQP A;  4F3P A;  4FE8 A;  3OOA A;  1OVB A;  3MZ1 A;  1MQG A;  1Y3N A;  2P2A A;  3SEY A;  1XOC A;  3T9U A;  1SBP A;  2XHD A;  1PBQ A;  5FHO A;  1N7X A;  3V89 B;  4OEV A;  2AYS A;  2DE3 A;  2Y7W A;  4IB2 A;  4OZ9 A;  1FQD A;  4XXU A;  2FYI A;  1M5C A;  2QS3 A;  4ELR A;  4FEC A;  1R6Z A;  3FV2 A;  1JEV A;  1MDP 1;  4JBZ A;  3T66 A;  4IO2 A;  1O64 A;  2HAU A;  4XKR A;  1HSL A;  1BIY A;  3IB1 A;  4NF4 A;  1MXZ A;  3FVK A;  4RXL A;  1UQW A;  4ESX A;  4F1V A; 
#chains in the Genus database with same CATH topology
 4PFW A;  3H3G A;  1NV2 A;  2DS9 A;  2Z23 A;  1SI0 A;  1IUD A;  3H4Z A;  1HSE A;  4MLV A;  3T96 B;  3FJG A;  4I8C A;  1NKX A;  5H8N B;  1DTG A;  2UXA A;  3OEL A;  4IO3 A;  4PET A;  4LP2 B;  4P1L A;  2XD2 A;  2R9J A;  4WXJ A;  3PUZ E;  3KN8 A;  3PMV A;  5DYH A;  4BDL A;  4U1O A;  3U92 A;  4ZDM A;  3OO9 A;  2QVU A;  5L9M A;  4G68 A;  4MFI A;  2P1S A;  3PPQ A;  4QFO A;  4PDH A;  1IMA A;  3JV9 A;  3K1N A;  3N5L A;  5AA2 D;  4IO6 A;  2F34 A;  1B7H A;  3FAT A;  4PFR A;  4EXL A;  4Q0C A;  1USY H;  2PBW A;  2V3T A;  1IMC A;  1UTH A;  4GL8 A;  4XKN A;  3KBR A;  3Q26 A;  3MZ9 A;  1XS5 A;  3OSR A;  5H8H B;  3T9H B;  1LAF E;  4PTK A;  3E3K A;  1N04 A;  4NN3 A;  3FD3 A;  4YIC A;  2X26 A;  1EZO A;  1PC3 A;  4NF6 A;  3MVW A;  1MH4 A;  4NWD A;  5ET8 A;  5JTY B;  2FBP A;  1B40 A;  4G8N A;  3IJO B;  4P9K A;  4Z7E A;  1FPF A;  2Z22 A;  2D21 A;  1I6B A;  3W9V A;  4YMB A;  3IK6 B;  3FVO A;  1II5 A;  1EZ9 A;  1MXX A;  1R1N A;  3IOR A;  5CRY A;  1B5H A;  2PX1 A;  4GVO A;  3U65 A;  2RF1 A;  1RDY A;  3IOW A;  2DWH A;  2OZZ A;  1OMP A;  4RY1 A;  4F2Q A;  3CVG A;  1BTJ A;  4FOR A;  1NMU A;  4GIZ A;  1RYX A;  4U21 A;  1MS7 A;  2I3V A;  2IEE A;  4WKM A;  1SVX B;  1JEU A;  4G68 B;  5TPA A;  1LBZ A;  1DCU A;  3JYR A;  5DVJ A;  1IZ1 A;  4PE5 B;  5ITO A;  4NAP A;  1USY E;  1UTH B;  2THI A;  3TZA A;  3QK6 A;  3VV5 A;  2VHA A;  1AH5 A;  2F7A A;  5CI5 A;  3HST A;  5KDT A;  3VLV A;  3VLW A;  5AA2 B;  1FQF A;  4H45 A;  5ET5 A;  3V5A A;  4R75 A;  4K3F A;  4AB6 A;  4P3L A;  5I7I A;  3SEX A;  4MX6 A;  2DYX A;  3UGW A;  4HE1 A;  4ZED A;  4KYE A;  1LFI A;  3MUQ A;  1RDZ A;  4R6H A;  4BDM A;  4HE2 A;  4OVR A;  1MXU A;  3GXA A;  2WEF A;  4I3Y A;  1MQH A;  3MYU A;  1LST A;  2ZZV A;  4R73 A;  2KQZ A;  2MKZ A;  3DP8 A;  2ALU A;  1FBF A;  1TXF A;  4LON B;  2YPN A;  1T0K A;  1YTV A;  2AL5 A;  3D4G A;  3C32 A;  4RPN A;  1B7Z A;  3FVN A;  3S9N C;  4KYD A;  4EQ7 A;  1N3X A;  2H9B A;  1P99 A;  3CFX A;  2XXT A;  5H8F A;  4PGP A;  2WYP A;  3TQL A;  5AA3 A;  2VD2 A;  1JVY A;  3KZG A;  1DMB A;  4XKP A;  4YAH X;  1FTL A;  2DVZ A;  3QUF A;  3GZG A;  3K0V A;  4OES A;  2DQV A;  1JW5 A;  4G8M A;  3O6G A;  4GXA A;  4NHB A;  2OBG A;  1LGB C;  3IR1 A;  2XX8 A;  4N6P A;  1FBH A;  1VR5 A;  4U4X A;  1LFG A;  1ZTY A;  4UA8 A;  3EHU A;  2OWS A;  3USD A;  4OMB A;  3PPP A;  3DP4 A;  1GTK A;  2NXO A;  3G3I A;  4NF8 B;  3TTR A;  5AA4 A;  1MXY A;  3SZP A;  3KOS A;  4H5F A;  2VOZ A;  3PPO A;  2I4C A;  3EF7 A;  3U1O A;  4ELO A;  4GX6 A;  3LR1 A;  3HFU A;  3KOT A;  1FBC A;  4U23 A;  1LBX A;  3Q25 A;  1LBW A;  3C31 A;  4N15 A;  4F3G A;  3TTK A;  5A5L A;  2WX9 A;  1SYI A;  1XC1 A;  1B3F A;  3G3H A;  1FPG A;  1VDW A;  4FEB A;  4X1B A;  1JW4 A;  4KI0 E;  4GL0 A;  3WAE A;  4X8R A;  2HZL A;  3TTM A;  3TCH A;  3MW0 A;  2CZL A;  1FJ9 A;  3W9W A;  2W7Y A;  3R7X A;  4HTG A;  3M8U A;  3BFT A;  1D3K A;  4N4U A;  1EZP A;  2HQ0 A;  1GR2 A;  4G4P A;  4PBH A;  1GV8 A;  1INP A;  2HXW A;  4DE8 A;  2XWO A;  1QKB A;  4YB6 A;  4EF1 A;  3HN0 A;  3B6Q A;  2QL3 A;  4LQ2 A;  4P47 A;  3KGC A;  1N76 A;  5AA4 B;  3I6V A;  4U22 A;  4MH5 A;  5I56 A;  5CC2 A;  4FAT A;  3PMW A;  3C4M A;  2XXP A;  3CI8 A;  1B3G A;  2DXY A;  2H99 A;  1Y4T A;  2UVH A;  4POW A;  1CB6 A;  5TP9 A;  2D5W A;  4X04 A;  3KN7 A;  3PUX E;  2L5V A;  1PBP A;  1ZMG A;  3PGF A;  1YPN A;  4F19 A;  4RYA A;  2V93 A;  2ONS A;  1J1N A;  4H5G A;  5DTB A;  1NUY A;  1JNF A;  2R8T A;  3PPN A;  2ZXT A;  4N8Y A;  4YMA A;  2ONR A;  2HZK A;  4QHQ A;  2ONK E;  3TMG A;  4E0X A;  3HV1 A;  4MCO A;  1IME A;  3LUY A;  1FTM A;  4QSC A;  4RNS A;  2HEU A;  1UTB A;  1Y20 A;  1ANF A;  2R6G E;  4FED A;  2F6P A;  1POT A;  3S9M C;  3V83 A;  2IA4 A;  1D9Q A;  4BDO A;  4MJO A;  4GX3 A;  3EHT A;  3MST A;  1AWB A;  2H25 A;  1DOT A;  1DBZ A;  4ECF A;  1RKM A;  2CMO A;  4I1D A;  5I56 B;  5EQ9 A;  1US5 A;  1N7W A;  4YZZ A;  4M1V A;  4YKP A;  5J16 A;  5FHN A;  2QPQ A;  1AL3 A;  4IGR A;  3UP9 A;  4PGN A;  2FIE A;  1B52 A;  5I2K B;  3DM0 A;  1XVX A;  1I6A A;  2HCA A;  3DEL B;  4UAC A;  2QMW A;  2WYK A;  2F3B A;  3KFM A;  5HM4 B;  3KEI A;  5LDZ A;  2Q8M A;  2I49 A;  1SYH A;  4F3S A;  3RY3 A;  4NED A;  1SDX A;  2GHB A;  1DPP A;  1VFD A;  4RK2 A;  4JB7 A;  5H8N A;  4X48 A;  3T93 B;  1QUL A;  2QVR A;  2A5S A;  3IO4 A;  4XFE A;  5EYG A;  3QYT A;  1Z7M E;  2VPO A;  3B8B A;  4Z0I A;  3SKP A;  3ZKK A;  2CEY A;  2P3V A;  1NV4 A;  1LBV A;  3PPR A;  2ESN A;  1LBB A;  4HXV A;  4L17 A;  3FBP A;  1FJ6 A;  2REG A;  2ZMB A;  3TUS A;  2NVU B;  4KD5 A;  3H6T A;  4P1E A;  1LLS A;  5H8H A;  4ZEF A;  4QFL A;  2LAO A;  4GXS B;  5B70 A;  1Y1Z A;  4R2F A;  4PC9 A;  3FIR A;  1UIV A;  5I3S A;  3BFU A;  2XXQ A;  1O63 A;  5JTY A;  2Q2C A;  3LSW A;  1MH3 A;  1P1Q A;  4GBW A;  4HS7 A;  1NV0 A;  1IMD A;  1JVX A;  4JWY A;  2F6G A;  4R9F A;  4RK9 A;  2ZYM A;  2CZH A;  1OLC A;  3S9L C;  3HO7 A;  3O97 A;  1VFE A;  4RJZ A;  4WEP A;  5H8S A;  3LC8 A;  4KCD A;  1YCJ A;  4LVQ A;  1M5D A;  4G2Z A;  3GBA A;  3G3F A;  4MF3 A;  4PFY A;  4G68 C;  1K9Z A;  4TOZ A;  1Q1K A;  4QFN A;  1PDA A;  2DE2 A;  2PCR A;  3G7W A;  1WOD A;  1BLF A;  2DSF A;  4FAJ A;  4OWD A;  2RIN A;  1MDQ A;  5LTC A;  5EHS A;  3G3J A;  3HPI A;  2B3B A;  1QUJ A;  1FPE A;  2QSX A;  5AA2 A;  2UYE A;  1EYJ A;  3IOU A;  5I59 A;  1DK4 A;  3VFJ A;  3C9H A;  4JVI A;  1B6H A;  2O7I A;  1FTA A;  4THI A;  1FBP A;  4DLD A;  2FHY A;  3MC2 A;  2B4M A;  1LB9 A;  1Y9U A;  4HCY A;  2O1L A;  1FBD A;  4ELQ A;  4XTC Q;  2ZYO A;  1NV5 A;  1ZBM A;  1NNK A;  4GWY A;  1YXI A;  3EN3 A;  4LZ5 A;  1Y1M A;  1URG A;  1IEJ A;  2XXW A;  4NX1 A;  1NV1 A;  1NNT A;  1B3E A;  1NNP A;  2Q88 A;  2UVI A;  5K2X A;  3TYH A;  3A3C A;  1MY0 A;  3KJ7 A;  1AOV A;  1XI6 A;  2XA5 A;  4OVT A;  3AXF A;  2RC8 A;  3CG1 A;  2ZNU A;  3OXN A;  4M4G A;  4EQB A;  1A99 A;  3CRB A;  3R6U A;  1IMF A;  3ECR A;  4F1V A;  5F24 A;  4ZZA A;  3VDF A;  4XIG Q;  4NWC A;  1MPD A;  1A8E A;  3ROJ A;  3EKI A;  4P0I A;  2O7U A;  4Q5T A;  3IAZ A;  1ZJL A;  2RCB A;  3U93 A;  1FTJ A;  2XWV A;  5DEX B;  2Y5L A;  1FCK A;  1IXI A;  1VE4 A;  5ICQ A;  2VT5 A;  2OWZ A;  2P0S A;  1Q9D A;  3K02 A;  4HW8 A;  3KSX A;  5I59 B;  1B46 A;  4N07 A;  1FPD A;  1DPE A;  1LAH E;  2F36 A;  5CMB A;  3C36 A;  3LSL A;  3IL1 B;  1NUX A;  3ZKL A;  1IIT A;  3TEL A;  2HXR A;  5I2N A;  3EQ1 A;  2QRY A;  2FIX A;  4PBQ A;  4NF8 A;  1IQ7 A;  3PTY A;  3TAJ A;  2UVJ A;  3RGY A;  2BJJ X;  1PB7 A;  4YB7 A;  2DOJ A;  1MQJ A;  2VGQ A;  3MP1 A;  3IO6 A;  2F8D A;  1BKA A;  3NOH A;  4DCX A;  4RA1 A;  4ZEK A;  3TKD A;  2FNC A;  3DP6 A;  2HFB A;  1GVC A;  2DE4 A;  1AIV A;  4GQO A;  4IO5 A;  4EDP A;  4P11 A;  4OYV A;  4OHN A;  4JDF A;  1IIW A;  4BDQ A;  1N3W A;  5FTH A;  4KR5 A;  4YB5 A;  4ZE8 A;  4ISU A;  4BDN A;  3MVZ A;  1LB8 A;  1H44 A;  1B4H A;  3RNN A;  4GRK A;  3L6H A;  4DCY A;  5KZT A;  4OTE A;  5I5P A;  4LZ8 A;  2OX3 A;  4EF2 A;  4DDD A;  5I2N B;  4X9T A;  4MNC A;  4G77 A;  5FTI A;  3K1M A;  4U4S A;  4MEV A;  1FTK A;  4PAK A;  5K2Y A;  3KBZ A;  2I0B A;  3K4U A;  3Q29 A;  2E0S A;  3FJM A;  1FPJ A;  1SQY A;  4F3B A;  4MLQ A;  2DWI A;  4OEU A;  3OD7 A;  1B58 A;  1MQI A;  1KZ8 A;  1FRP A;  1OLA A;  4H8J A;  3MVX A;  2KLF A;  1O7T A;  5IZ1 A;  4POX A;  2Y7K A;  3RQT A;  1K9Y A;  5ET7 A;  4GWS A;  2NUV A;  5TU0 A;  4BLA A;  2ZYN A;  3ILU B;  4YKI A;  4QFK A;  1YYZ A;  3R26 A;  5FHM A;  2YLN A;  1PEB A;  1S9T A;  4JVD A;  3O6H A;  4AS4 A;  3UA8 A;  2CZI A;  4C0R A;  4R6K A;  1IXC A;  1AMF A;  3B6T A;  3H6W A;  2HPG A;  4JSD A;  2QMX A;  3L6G A;  3UOR A;  4OAN A;  3SEV A;  5A5X A;  5CM6 A;  4GBV A;  3RN8 A;  3OO6 A;  1LEV A;  4I40 A;  2XXH A;  4XF5 A;  4LA9 A;  2FVZ A;  1KA0 A;  1P1N A;  3FV1 A;  4C1U A;  2RKM A;  5H8Q A;  1MXW A;  4F29 A;  4G61 A;  3IOV A;  1FBE A;  5DT6 A;  2G29 A;  4ND9 A;  4PE3 A;  5L8D A;  3GLB A;  2HHM A;  5EQ8 A;  3O6I A;  5JEI A;  1NUZ A;  1R9Q A;  1M5B A;  5I2K A;  5ISU A;  3K6U A;  1NH8 A;  2H4I A;  1MPC A;  4KPT A;  1N0T A;  1YZ0 A;  4G8H A;  4DXC A;  3OEN A;  5DVI A;  3FXQ A;  4N8G A;  3GYY A;  2O6A A;  4F31 B;  3E79 A;  3ILT B;  2PFY A;  2OCU A;  5LOM A;  4ZS9 A;  4AS5 A;  1MQD A;  2GH9 A;  3SEW A;  1B5J A;  1SW2 A;  4JVC A;  5A5X B;  3MP6 A;  3IFA A;  2I3W A;  3B7D A;  4GF8 A;  1NV3 A;  3OO8 A;  3TFL A;  4MNI A;  3T9V A;  5HPQ A;  1B7U A;  4PP0 A;  4ELP A;  3MQ9 A;  1MY4 A;  2DXR A;  4H67 A;  3JZJ A;  3BKI B;  4PFT A;  1JET A;  4LUB A;  5H8Q B;  1POY 1;  2V25 A;  2I0C A;  3VVF A;  3MJN A;  1EU8 A;  5L9S A;  1IMB A;  5J1D A;  5M2V A;  2GRV A;  1FQA A;  4Q30 B;  3THI A;  1BP5 A;  4OVJ A;  5F7V A;  1US4 A;  3MBP A;  4ZEI A;  2XX9 A;  3TCG A;  3IJX B;  1RYO A;  3HHG A;  2JJK A;  4PFI A;  2H5Y A;  2GQ1 A;  1H76 A;  4IY6 A;  2QJE A;  3QXM A;  1A40 A;  1PB9 A;  5ELV A;  5B7D A;  2QS4 A;  4R72 A;  3VLU A;  1H3D A;  2M8C A;  4QSE A;  1EYK A;  5I84 A;  4GWZ A;  3UK4 A;  2V3U A;  4U2R A;  3Q28 A;  4IR8 A;  3OO7 A;  1MRP A;  2Q9T A;  3M3K A;  3RUM A;  2Q8J A;  5IGA A;  3BIH A;  1LAG E;  3RTW B;  2Y84 A;  3EPE A;  5KCJ B;  4OVQ A;  4Q8R A;  5L9O A;  3TCF A;  2OLB A;  3IB2 A;  2QVV A;  3SDF A;  3G3K A;  2BJI A;  1HSJ A;  4NE4 A;  3QAX A;  3VXC A;  5BUU A;  1B3L A;  2XXU A;  4N17 A;  1H43 A;  3TTL A;  4NG7 A;  4NF0 A;  3E13 X;  3VVD A;  1P1O A;  5T3J A;  1FPK A;  4R9G A;  3S2V A;  1MY3 A;  3IOT A;  3N26 A;  4H1X A;  2PYY A;  3H6V A;  2OWT A;  4F39 A;  1A7L A;  3T1B A;  3U72 A;  3MVY A;  3T9X B;  1OQH A;  3KC1 A;  1QW0 A;  3MPL A;  3FZV A;  4JSO A;  4AB5 A;  4GWU A;  4OVS A;  4TLL B;  4DZ1 A;  4EQ9 A;  2V3Q A;  4QSD A;  5IZZ A;  1URS A;  1VSO A;  4AQ4 A;  1FPL A;  3BIG A;  1MM6 A;  1JP4 A;  1SW4 A;  4NQ8 A;  3OSQ A;  4ESW A;  3TDJ A;  2Z8F A;  2XWI A;  2XWK A;  3H7M A;  3O29 A;  4N6D A;  4R74 A;  2RC7 A;  3O66 A;  3O9P A;  4RPO A;  3FJ7 A;  4OXV A;  1OVT A;  1M5E A;  5EQA A;  2REJ A;  2VD3 A;  3FXU A;  3RTF B;  3SET A;  1Y3P A;  3K2D A;  1D9V A;  3RT6 B;  3D1R A;  1B0H A;  4P0G A;  3MAM A;  5JK4 A;  3CIJ A;  1B4Z A;  1ELJ A;  3TEP A;  3PMX A;  3MWB A;  3ZSF A;  5AE4 A;  2O68 A;  4OFO A;  5IAI A;  5DEX A;  3I5O A;  4PAF A;  1SD3 A;  3G3G A;  2UVG A;  1BK4 A;  4U1Z A;  4LN5 A;  3SER A;  4MBP A;  1CE2 A;  4TQU Q;  2ZNT A;  3V8X B;  4OFJ A;  3QIM A;  3IFC A;  2HAV A;  4PF8 A;  3T0J A;  2XXR A;  2WBB A;  1DTZ A;  1NNF A;  2OK2 A;  3F11 A;  4GX4 A;  3SES A;  2ZNS A;  4LQ5 A;  4NF4 B;  2I58 A;  3O28 A;  4H0W A;  2A5T A;  4QFP A;  1P1U A;  1MM7 A;  3RPW A;  1FBG A;  2DP8 A;  3KSJ A;  4EUO A;  4ZEC A;  2B3F A;  1FSA A;  3Q27 A;  2WKY A;  2XXI A;  1S7Y A;  4O3C A;  1FQC A;  4QRZ A;  1FTO A;  4PFU A;  1XHY A;  1B0L A;  3MP8 A;  3M3F A;  1GGG A;  1MPB A;  5IZ3 A;  1B9J A;  3CHG A;  5EYF A;  3IB0 A;  4O7I A;  4OEN A;  3LV0 A;  3KJT A;  4N6K A;  2F7C A;  3FUZ A;  2DVC A;  3A09 A;  1MY1 A;  3EHS A;  2I6E A;  4N81 A;  1ZKB A;  2I4B A;  2PT1 A;  1B32 A;  1MY2 A;  1B1H A;  2PMS A;  3UIF A;  2V84 A;  2ZZW A;  4ZE9 A;  3H06 B;  4LZ7 A;  3CSB A;  1B3H A;  2AL4 A;  4O94 A;  3PUY E;  2ZZX A;  2ANJ A;  1SW1 A;  4GOT A;  4PF6 A;  3PD8 A;  4NMY A;  3TPA A;  5ESY A;  4DI4 B;  2G93 A;  3LBS A;  3KN3 A;  3LSX A;  4QXD A;  2VPN A;  2QS2 A;  5ITP A;  4NF6 B;  4FBP A;  2FA7 A;  4X1D A;  2XXY A;  1IXG A;  4PDD A;  3K00 A;  3QMF A;  4HCW A;  3QSL A;  1ZU0 A;  2H98 A;  2XX7 A;  2DWJ A;  4JWX A;  2A5T B;  2O69 A;  1YAE A;  3HCQ A;  4MIJ A;  1A55 A;  5ET6 A;  4DXB A;  2XXK A;  3VE1 B;  3RT8 A;  2DDK A;  1KWH A;  1LFH A;  3BBR A;  4PAI A;  3PV0 E;  4GWO A;  2F78 A;  4OET A;  3U94 A;  3RPL A;  3N6U A;  1B1X A;  1OQG A;  2PT2 A;  3TOD A;  5TPA B;  4IO7 A;  3K6V A;  4KXP A;  4YU0 A;  3CR9 A;  3CG3 A;  5IZ3 B;  4E0W A;  2B65 A;  3PUV E;  3OMB A;  4UAB A;  4H65 A;  3O2A A;  3MPK A;  2I48 A;  1QKA A;  3CFL A;  3FAS A;  3PU5 A;  3A3U A;  1NH7 A;  2PVU A;  2RC9 A;  4TLM B;  1Z7N E;  1EH3 A;  4DIG A;  3GBB A;  4ONY A;  5KDT B;  1A54 A;  1JW1 A;  2AIX A;  5DW8 A;  3TQW A;  4EXK A;  2ZYK A;  1B05 A;  3QUJ A;  4GWW A;  1QUI A;  3LUZ A;  3C34 A;  2F35 A;  4R6Y A;  3SEU A;  4QBA A;  3HHF A;  3RYD A;  4YKK A;  5IKB A;  4I3E A;  2X7Q A;  4IGT A;  3ONM A;  5DVF A;  2GFE A;  1SW5 A;  3OEM A;  2UYF A;  1NV7 A;  1B5I A;  1A8F A;  1QGX A;  4P8B A;  3UN6 A;  3B50 A;  4H6D A;  2NOO A;  4HE0 A;  4F18 A;  4KYS A;  1XVY A;  1QUK A;  5F1Q A;  3RPL B;  2B4L A;  5CBR A;  4OQO A;  5EQ7 A;  4ZZE A;  1MG1 A;  5I57 A;  2PFZ A;  1TT1 A;  1CNQ A;  4ESX A;  2O51 A;  1M5F A;  5FBP A;  3S9E A;  1FPI A;  2Y5K A;  5ICT A;  2XXX A;  4DI3 D;  4FIM A;  2F97 A;  4OFL A;  4O8M A;  2XXV A;  1NV6 A;  4MHF A;  3W15 C;  4NTL A;  1WDN A;  5H8F B;  2Y7P A;  2F3D A;  3E4R A;  4KFQ A;  3KG2 A;  4NF5 A;  4BDR A;  3K6W A;  4F1U A;  1LBY A;  3VVE A;  4OER A;  4ZEB A;  3RLF E;  4PCD A;  1N84 A;  3B6W A;  3A29 A;  2QFL A;  1Y3Q A;  1P1W A;  1LBC A;  1F9B A;  2VP1 A;  4YKJ A;  4O3A A;  4O3B A;  1FQE A;  1R9L A;  4FJP A;  2O1M A;  4R2B A;  2ABH A;  1L5T A;  5I58 A;  1ZIU A;  4MAG A;  2F7B A;  2R71 A;  4NGU A;  3PUW E;  1H45 A;  3T22 A;  3U8Q A;  3M3L A;  1KA1 A;  2Q89 A;  5EHM A;  4GWX A;  1SPI A;  2Q2A A;  2Q74 A;  3LSF B;  4F2O A;  4XEQ A;  4H8I A;  4KCC A;  3TTN A;  4DXU A;  1NUW A;  5I57 B;  3IX1 A;  3S4U A;  3CFZ A;  1NFT A;  4H46 A;  1QJM A;  2CZK A;  2QS1 A;  2NWJ A;  1DSN A;  1WVJ A;  3K1P A;  4P56 A;  2XD3 A;  1JQF A;  3VXB A;  4N13 A;  1TFA A;  4O7M A;  1IXH A;  5KCJ A;  1G0H A;  4MMP A;  1LCT A;  1I69 A;  4GD5 A;  3FXR A;  1D9Y A;  1ZLQ A;  4JWO A;  1UIU A;  5CMM A;  4GFR A;  4NF5 B;  1B2H A;  3E9X A;  2KR0 A;  1B51 A;  2GHA A;  3MZB A;  2E1S A;  4PFB A;  5CMK A;  1OIB A;  3I3V A;  3KC0 A;  1Q35 A;  1LAX A;  2Z8E A;  5EYH A;  1FW0 A;  1NL5 A;  3FGS A;  5HBC A;  4PQJ A;  1ATG A;  5I58 B;  3FXB A;  3C35 A;  1PB8 A;  3N6T A;  1URD A;  3K01 A;  3C33 A;  1I6Q A;  1TFD A;  1TWY A;  3FVG A;  5IM2 A;  2F5X A;  2O84 X;  2X7P A;  1SI1 A;  3CSG A;  4IY5 A;  3E78 A;  3WAF A;  4LAT A;  4C1T A;  3N94 A;  1RDX A;  4I62 A;  2P3N A;  4QF9 A;  2DWA A;  4IO4 A;  3H03 A;  5TP9 B;  5AA1 A;  1D4N A;  4GLI A;  4F22 A;  1MXV A;  5CMC A;  2Y7I A;  4OVP A;  2RCA A;  4F1Y A;  2Y7R A;  4WED A;  4N91 A;  2Z8D A;  1FQB A;  2OJT A;  5CBS A;  3D4C A;  4XKQ A;  2YJP A;  4JXI A;  1EYI A;  1XT8 A;  3ZS6 A;  3ODB A;  3OEK A;  1S50 A;  1QVS A;  3ISP A;  3P7I A;  1Y4C A;  4I9D A;  3H6U A;  4OA4 A;  3PD9 A;  1UTB B;  3K6X A;  1LCF A;  4KHZ E;  3DLN A;  2D3I A;  5BWJ A;  4KQP A;  4F3P A;  4FE8 A;  3OOA A;  1G0I A;  1OVB A;  3MZ1 A;  1MQG A;  1Y3N A;  2P2A A;  3SEY A;  1XOC A;  3T9U A;  1SBP A;  2XHD A;  1PBQ A;  5FHO A;  1N7X A;  3V89 B;  1FPB A;  4OEV A;  2AYS A;  2DE3 A;  2Y7W A;  4IB2 A;  4OZ9 A;  2WBD A;  1FQD A;  4XXU A;  2FYI A;  1M5C A;  2QS3 A;  4ELR A;  4MNP A;  4FEC A;  1R6Z A;  3FV2 A;  1JEV A;  1MDP 1;  1NI9 A;  2CEX A;  4JBZ A;  3T66 A;  4IO2 A;  1O64 A;  2HAU A;  4XKR A;  1HSL A;  2V4C A;  4NF4 A;  1MXZ A;  4RXL A;  3FVK A;  1UQW A;  1BIY A;  3IB1 A; 
#chains in the Genus database with same CATH homology
 4PFW A;  3H3G A;  2DS9 A;  2Z23 A;  1SI0 A;  1IUD A;  3H4Z A;  1HSE A;  4MLV A;  3T96 B;  3FJG A;  4I8C A;  1NKX A;  5H8N B;  1DTG A;  2UXA A;  3OEL A;  4IO3 A;  4PET A;  4LP2 B;  2XD2 A;  2R9J A;  4WXJ A;  3PUZ E;  3KN8 A;  3PMV A;  5DYH A;  4BDL A;  4U1O A;  3U92 A;  4ZDM A;  3OO9 A;  5L9M A;  4G68 A;  4MFI A;  2P1S A;  3PPQ A;  4QFO A;  3JV9 A;  3K1N A;  3N5L A;  5AA2 D;  4IO6 A;  2F34 A;  1B7H A;  3FAT A;  4EXL A;  4Q0C A;  1USY H;  2PBW A;  2V3T A;  1UTH A;  4GL8 A;  4XKN A;  3KBR A;  3Q26 A;  3MZ9 A;  1XS5 A;  3OSR A;  5H8H B;  3T9H B;  1LAF E;  3E3K A;  1N04 A;  3FD3 A;  4YIC A;  2X26 A;  1EZO A;  1PC3 A;  4NF6 A;  3MVW A;  1MH4 A;  4NWD A;  5JTY B;  1B40 A;  4G8N A;  3IJO B;  4Z7E A;  2Z22 A;  2D21 A;  1I6B A;  3W9V A;  4YMB A;  3IK6 B;  3FVO A;  1II5 A;  1EZ9 A;  1MXX A;  1R1N A;  3IOR A;  5CRY A;  1B5H A;  2PX1 A;  4GVO A;  2RF1 A;  3IOW A;  2DWH A;  2OZZ A;  1OMP A;  4RY1 A;  4F2Q A;  3CVG A;  1BTJ A;  4FOR A;  1NMU A;  4GIZ A;  1RYX A;  4U21 A;  1MS7 A;  2I3V A;  2IEE A;  4WKM A;  1SVX B;  1JEU A;  4G68 B;  5TPA A;  3JYR A;  5DVJ A;  1IZ1 A;  4PE5 B;  5ITO A;  1USY E;  1UTH B;  2THI A;  3TZA A;  3QK6 A;  3VV5 A;  2VHA A;  1AH5 A;  2F7A A;  5CI5 A;  3HST A;  5KDT A;  3VLV A;  3VLW A;  5AA2 B;  1FQF A;  3V5A A;  4R75 A;  4K3F A;  4AB6 A;  3SEX A;  2DYX A;  3UGW A;  4ZED A;  4KYE A;  1LFI A;  3MUQ A;  4R6H A;  4BDM A;  1MXU A;  3GXA A;  1MQH A;  1LST A;  4R73 A;  3DP8 A;  2ALU A;  1TXF A;  4LON B;  2YPN A;  1T0K A;  1YTV A;  2AL5 A;  3D4G A;  3C32 A;  4RPN A;  1B7Z A;  3FVN A;  3S9N C;  4KYD A;  4EQ7 A;  1N3X A;  2H9B A;  1P99 A;  3CFX A;  2XXT A;  5H8F A;  3TQL A;  5AA3 A;  2VD2 A;  1JVY A;  3KZG A;  1DMB A;  4XKP A;  4YAH X;  1FTL A;  2DVZ A;  3QUF A;  3GZG A;  3K0V A;  4OES A;  2DQV A;  1JW5 A;  4G8M A;  3O6G A;  4GXA A;  2OBG A;  1LGB C;  3IR1 A;  2XX8 A;  4N6P A;  1VR5 A;  4U4X A;  1LFG A;  1ZTY A;  4UA8 A;  3EHU A;  2OWS A;  3USD A;  4OMB A;  3PPP A;  3DP4 A;  1GTK A;  2NXO A;  3G3I A;  4NF8 B;  3TTR A;  5AA4 A;  1MXY A;  3KOS A;  4H5F A;  2VOZ A;  3PPO A;  2I4C A;  3EF7 A;  3U1O A;  4ELO A;  3LR1 A;  3KOT A;  4U23 A;  3Q25 A;  3C31 A;  4F3G A;  3TTK A;  1SYI A;  1XC1 A;  1B3F A;  3G3H A;  4FEB A;  4X1B A;  1JW4 A;  4KI0 E;  4GL0 A;  3WAE A;  2HZL A;  3TTM A;  3TCH A;  3MW0 A;  2CZL A;  3W9W A;  2W7Y A;  3R7X A;  4HTG A;  3M8U A;  3BFT A;  1D3K A;  1EZP A;  2HQ0 A;  1GR2 A;  4G4P A;  1GV8 A;  2HXW A;  4DE8 A;  1QKB A;  4YB6 A;  4EF1 A;  3HN0 A;  3B6Q A;  2QL3 A;  4LQ2 A;  3KGC A;  1N76 A;  5AA4 B;  3I6V A;  4U22 A;  4MH5 A;  5I56 A;  5CC2 A;  4FAT A;  3PMW A;  3C4M A;  2XXP A;  3CI8 A;  1B3G A;  2DXY A;  2H99 A;  1Y4T A;  2UVH A;  4POW A;  1CB6 A;  5TP9 A;  2D5W A;  3KN7 A;  3PUX E;  1PBP A;  1ZMG A;  3PGF A;  1YPN A;  4F19 A;  4RYA A;  2V93 A;  2ONS A;  1J1N A;  4H5G A;  5DTB A;  1JNF A;  3PPN A;  2ZXT A;  4YMA A;  2ONR A;  2HZK A;  4QHQ A;  2ONK E;  3TMG A;  4E0X A;  3HV1 A;  3LUY A;  1FTM A;  4QSC A;  4RNS A;  2HEU A;  1UTB A;  1Y20 A;  1ANF A;  2R6G E;  4FED A;  2F6P A;  1POT A;  3S9M C;  3V83 A;  2IA4 A;  4BDO A;  3EHT A;  2H25 A;  1DOT A;  4ECF A;  1RKM A;  2CMO A;  4I1D A;  5I56 B;  1US5 A;  1N7W A;  4YZZ A;  4M1V A;  4YKP A;  5FHN A;  2QPQ A;  1AL3 A;  4IGR A;  3UP9 A;  1B52 A;  5I2K B;  3DM0 A;  1XVX A;  1I6A A;  2HCA A;  3DEL B;  4UAC A;  2QMW A;  3KFM A;  5HM4 B;  3KEI A;  2I49 A;  1SYH A;  4F3S A;  3RY3 A;  4NED A;  1SDX A;  2GHB A;  1DPP A;  1VFD A;  4RK2 A;  4JB7 A;  5H8N A;  4X48 A;  3T93 B;  1QUL A;  2A5S A;  3IO4 A;  3QYT A;  1Z7M E;  4Z0I A;  3SKP A;  3ZKK A;  3PPR A;  2ESN A;  1LBB A;  4L17 A;  2REG A;  2ZMB A;  3TUS A;  2NVU B;  4KD5 A;  3H6T A;  1LLS A;  5H8H A;  4ZEF A;  4QFL A;  2LAO A;  4GXS B;  5B70 A;  1Y1Z A;  4R2F A;  3FIR A;  1UIV A;  3BFU A;  2XXQ A;  1O63 A;  5JTY A;  2Q2C A;  3LSW A;  1MH3 A;  1P1Q A;  4HS7 A;  1JVX A;  4JWY A;  2F6G A;  4R9F A;  4RK9 A;  2ZYM A;  1OLC A;  3S9L C;  3HO7 A;  3O97 A;  1VFE A;  4RJZ A;  4WEP A;  5H8S A;  3LC8 A;  4KCD A;  1YCJ A;  4LVQ A;  1M5D A;  4G2Z A;  3GBA A;  3G3F A;  4MF3 A;  4PFY A;  4G68 C;  4TOZ A;  1Q1K A;  4QFN A;  1PDA A;  2DE2 A;  3G7W A;  1WOD A;  1BLF A;  2DSF A;  4FAJ A;  4OWD A;  2RIN A;  1MDQ A;  5EHS A;  3G3J A;  3HPI A;  2B3B A;  1QUJ A;  2QSX A;  5AA2 A;  2UYE A;  3IOU A;  5I59 A;  3VFJ A;  3C9H A;  1B6H A;  2O7I A;  4THI A;  4DLD A;  3MC2 A;  1LB9 A;  1Y9U A;  4HCY A;  2O1L A;  4ELQ A;  4XTC Q;  2ZYO A;  1ZBM A;  1NNK A;  3EN3 A;  4LZ5 A;  1Y1M A;  1URG A;  1IEJ A;  2XXW A;  1NNT A;  1B3E A;  1NNP A;  2Q88 A;  2UVI A;  5K2X A;  3TYH A;  3A3C A;  1MY0 A;  3KJ7 A;  1AOV A;  3AXF A;  2RC8 A;  3CG1 A;  2ZNU A;  3OXN A;  4M4G A;  4EQB A;  1A99 A;  3CRB A;  3R6U A;  3ECR A;  3VDF A;  4ZZA A;  4XIG Q;  4NWC A;  1MPD A;  1A8E A;  4P0I A;  2O7U A;  4Q5T A;  3IAZ A;  1ZJL A;  2RCB A;  3U93 A;  1FTJ A;  5DEX B;  1FCK A;  1IXI A;  1VE4 A;  5ICQ A;  2P0S A;  3K02 A;  4HW8 A;  3KSX A;  5I59 B;  1B46 A;  4N07 A;  1DPE A;  1LAH E;  2F36 A;  5CMB A;  3C36 A;  3LSL A;  3IL1 B;  3ZKL A;  1IIT A;  3TEL A;  5I2N A;  3EQ1 A;  2QRY A;  4NF8 A;  1IQ7 A;  3TAJ A;  2UVJ A;  3RGY A;  2BJJ X;  1PB7 A;  4YB7 A;  2DOJ A;  1MQJ A;  2VGQ A;  3MP1 A;  3IO6 A;  2F8D A;  1BKA A;  4DCX A;  4RA1 A;  4ZEK A;  3TKD A;  2FNC A;  3DP6 A;  2HFB A;  1GVC A;  2DE4 A;  1AIV A;  4GQO A;  4IO5 A;  4EDP A;  4P11 A;  4OYV A;  4OHN A;  4JDF A;  1IIW A;  4BDQ A;  1N3W A;  5FTH A;  4KR5 A;  4YB5 A;  4ZE8 A;  4ISU A;  4BDN A;  3MVZ A;  1LB8 A;  1H44 A;  1B4H A;  3RNN A;  4GRK A;  3L6H A;  4DCY A;  5KZT A;  4OTE A;  4LZ8 A;  4EF2 A;  4DDD A;  5I2N B;  4X9T A;  4G77 A;  5FTI A;  3K1M A;  4U4S A;  1FTK A;  5K2Y A;  2I0B A;  3K4U A;  3Q29 A;  2E0S A;  3FJM A;  1SQY A;  4F3B A;  4MLQ A;  2DWI A;  4OEU A;  3OD7 A;  1B58 A;  1MQI A;  1OLA A;  4H8J A;  3MVX A;  2KLF A;  1O7T A;  4POX A;  2Y7K A;  3RQT A;  2NUV A;  5TU0 A;  4BLA A;  2ZYN A;  3ILU B;  4YKI A;  4QFK A;  3R26 A;  5FHM A;  2YLN A;  1PEB A;  1S9T A;  3O6H A;  3UA8 A;  4C0R A;  4R6K A;  1IXC A;  1AMF A;  3B6T A;  3H6W A;  4JSD A;  2QMX A;  3L6G A;  3UOR A;  3SEV A;  5A5X A;  5CM6 A;  3RN8 A;  3OO6 A;  2XXH A;  4LA9 A;  3FV1 A;  1P1N A;  4C1U A;  2RKM A;  5H8Q A;  1MXW A;  4F29 A;  3IOV A;  5DT6 A;  2G29 A;  4ND9 A;  5L8D A;  3GLB A;  3O6I A;  5JEI A;  1R9Q A;  1M5B A;  5I2K A;  5ISU A;  3K6U A;  1NH8 A;  2H4I A;  1MPC A;  4KPT A;  1N0T A;  4G8H A;  4DXC A;  3OEN A;  5DVI A;  3FXQ A;  2O6A A;  4F31 B;  3ILT B;  2OCU A;  5LOM A;  4ZS9 A;  1MQD A;  2GH9 A;  3SEW A;  1B5J A;  1SW2 A;  5A5X B;  3MP6 A;  2I3W A;  3B7D A;  4GF8 A;  3OO8 A;  3TFL A;  3T9V A;  5HPQ A;  1B7U A;  4PP0 A;  4ELP A;  3MQ9 A;  1MY4 A;  2DXR A;  4H67 A;  3JZJ A;  3BKI B;  4PFT A;  1JET A;  4LUB A;  5H8Q B;  1POY 1;  2V25 A;  2I0C A;  3VVF A;  3MJN A;  1EU8 A;  5L9S A;  5J1D A;  5M2V A;  2GRV A;  1FQA A;  4Q30 B;  3THI A;  1BP5 A;  4OVJ A;  5F7V A;  1US4 A;  3MBP A;  4ZEI A;  2XX9 A;  3TCG A;  3IJX B;  1RYO A;  3HHG A;  2H5Y A;  1H76 A;  4IY6 A;  2QJE A;  3QXM A;  1A40 A;  1PB9 A;  5ELV A;  5B7D A;  2QS4 A;  4R72 A;  3VLU A;  1H3D A;  2M8C A;  4QSE A;  5I84 A;  3UK4 A;  2V3U A;  4U2R A;  3Q28 A;  3OO7 A;  1MRP A;  2Q9T A;  3M3K A;  3RUM A;  2Q8J A;  1LAG E;  3RTW B;  2Y84 A;  3EPE A;  5KCJ B;  4Q8R A;  5L9O A;  3TCF A;  2OLB A;  3IB2 A;  3SDF A;  3G3K A;  1HSJ A;  4NE4 A;  3QAX A;  3VXC A;  5BUU A;  1B3L A;  2XXU A;  1H43 A;  3TTL A;  3E13 X;  3VVD A;  1P1O A;  4R9G A;  3S2V A;  1MY3 A;  3IOT A;  3N26 A;  4H1X A;  2PYY A;  3H6V A;  2OWT A;  4F39 A;  1A7L A;  3U72 A;  3MVY A;  3T9X B;  1OQH A;  1QW0 A;  3MPL A;  3FZV A;  4JSO A;  4AB5 A;  4TLL B;  4DZ1 A;  4EQ9 A;  2V3Q A;  4QSD A;  1URS A;  1VSO A;  4AQ4 A;  1MM6 A;  1SW4 A;  3OSQ A;  4ESW A;  3TDJ A;  2Z8F A;  3O29 A;  3H7M A;  4R74 A;  2RC7 A;  3O66 A;  3O9P A;  4RPO A;  3FJ7 A;  4OXV A;  1OVT A;  1M5E A;  2REJ A;  2VD3 A;  3FXU A;  3RTF B;  3SET A;  1Y3P A;  3K2D A;  1D9V A;  3RT6 B;  1B0H A;  4P0G A;  3MAM A;  5JK4 A;  3CIJ A;  1B4Z A;  1ELJ A;  3TEP A;  3PMX A;  3MWB A;  3ZSF A;  5AE4 A;  2O68 A;  4OFO A;  5IAI A;  5DEX A;  3I5O A;  1SD3 A;  3G3G A;  2UVG A;  4U1Z A;  3SER A;  4MBP A;  1CE2 A;  4TQU Q;  2ZNT A;  3V8X B;  4OFJ A;  3QIM A;  2HAV A;  2XXR A;  1DTZ A;  1NNF A;  2OK2 A;  3F11 A;  3SES A;  2ZNS A;  4LQ5 A;  4NF4 B;  2I58 A;  3O28 A;  4H0W A;  2A5T A;  4QFP A;  1P1U A;  1MM7 A;  3RPW A;  2DP8 A;  3KSJ A;  4EUO A;  4ZEC A;  2B3F A;  3Q27 A;  2WKY A;  2XXI A;  1S7Y A;  4O3C A;  1FQC A;  4QRZ A;  1FTO A;  4PFU A;  1XHY A;  1B0L A;  3MP8 A;  3M3F A;  1GGG A;  1MPB A;  1B9J A;  5EYF A;  3IB0 A;  4OEN A;  3KJT A;  2F7C A;  3FUZ A;  2DVC A;  3A09 A;  1MY1 A;  3EHS A;  2I6E A;  1ZKB A;  2I4B A;  2PT1 A;  1B32 A;  1MY2 A;  1B1H A;  2PMS A;  3UIF A;  2V84 A;  4ZE9 A;  3H06 B;  4LZ7 A;  3CSB A;  1B3H A;  2AL4 A;  3PUY E;  2ANJ A;  1SW1 A;  4GOT A;  3PD8 A;  4NMY A;  3TPA A;  2G93 A;  3LBS A;  3KN3 A;  3LSX A;  2QS2 A;  5ITP A;  4NF6 B;  2FA7 A;  4X1D A;  2XXY A;  1IXG A;  3K00 A;  4HCW A;  3QSL A;  1ZU0 A;  2H98 A;  2XX7 A;  2DWJ A;  4JWX A;  2A5T B;  2O69 A;  1YAE A;  3HCQ A;  1A55 A;  4DXB A;  3VE1 B;  3RT8 A;  1KWH A;  1LFH A;  3BBR A;  3PV0 E;  4GWO A;  2F78 A;  4OET A;  3U94 A;  3N6U A;  1B1X A;  1OQG A;  2PT2 A;  3TOD A;  5TPA B;  4IO7 A;  3K6V A;  4YU0 A;  3CR9 A;  3CG3 A;  4E0W A;  2B65 A;  3PUV E;  3OMB A;  4H65 A;  3O2A A;  3MPK A;  2I48 A;  1QKA A;  3CFL A;  3FAS A;  3PU5 A;  3A3U A;  1NH7 A;  2PVU A;  2RC9 A;  4TLM B;  1Z7N E;  1EH3 A;  4DIG A;  3GBB A;  4ONY A;  5KDT B;  1A54 A;  1JW1 A;  2AIX A;  3TQW A;  4EXK A;  2ZYK A;  1B05 A;  3QUJ A;  1QUI A;  3C34 A;  2F35 A;  4R6Y A;  3SEU A;  3HHF A;  4YKK A;  5IKB A;  2X7Q A;  4IGT A;  3ONM A;  5DVF A;  2GFE A;  1SW5 A;  3OEM A;  2UYF A;  1B5I A;  1A8F A;  3UN6 A;  4H6D A;  2NOO A;  4F18 A;  4KYS A;  1XVY A;  1QUK A;  5F1Q A;  5CBR A;  4OQO A;  4ZZE A;  1MG1 A;  5I57 A;  1TT1 A;  2O51 A;  1M5F A;  3S9E A;  5ICT A;  2XXX A;  4FIM A;  2F97 A;  4OFL A;  2XXV A;  3W15 C;  4NTL A;  1WDN A;  5H8F B;  2Y7P A;  3E4R A;  4KFQ A;  3KG2 A;  4NF5 A;  4BDR A;  3K6W A;  4F1U A;  3VVE A;  4OER A;  4ZEB A;  3RLF E;  1N84 A;  3B6W A;  1Y3Q A;  1P1W A;  1LBC A;  1F9B A;  2VP1 A;  4YKJ A;  4O3A A;  4O3B A;  1FQE A;  1R9L A;  4FJP A;  2O1M A;  4R2B A;  2ABH A;  1L5T A;  5I58 A;  1ZIU A;  2F7B A;  2R71 A;  3PUW E;  1H45 A;  3T22 A;  3U8Q A;  3M3L A;  2Q89 A;  5EHM A;  2Q2A A;  4F2O A;  3LSF B;  4H8I A;  4KCC A;  3TTN A;  4DXU A;  5I57 B;  3IX1 A;  3S4U A;  3CFZ A;  1NFT A;  1QJM A;  2QS1 A;  2NWJ A;  1DSN A;  1WVJ A;  3K1P A;  2XD3 A;  1JQF A;  3VXB A;  4N13 A;  1TFA A;  1IXH A;  5KCJ A;  1LCT A;  1I69 A;  4GD5 A;  3FXR A;  1D9Y A;  1ZLQ A;  4JWO A;  1UIU A;  5CMM A;  4GFR A;  4NF5 B;  1B2H A;  3E9X A;  1B51 A;  2GHA A;  3MZB A;  2E1S A;  5CMK A;  1OIB A;  3I3V A;  1Q35 A;  1LAX A;  2Z8E A;  1FW0 A;  1NL5 A;  3FGS A;  5HBC A;  4PQJ A;  1ATG A;  5I58 B;  3C35 A;  1PB8 A;  3N6T A;  1URD A;  3K01 A;  3C33 A;  1I6Q A;  1TFD A;  1TWY A;  3FVG A;  2F5X A;  2O84 X;  2X7P A;  1SI1 A;  3CSG A;  4IY5 A;  3WAF A;  4LAT A;  4C1T A;  3N94 A;  4I62 A;  4QF9 A;  2DWA A;  4IO4 A;  3H03 A;  5TP9 B;  5AA1 A;  1D4N A;  4GLI A;  4F22 A;  1MXV A;  5CMC A;  2Y7I A;  2RCA A;  4F1Y A;  2Y7R A;  4WED A;  2Z8D A;  1FQB A;  2OJT A;  5CBS A;  3D4C A;  4XKQ A;  2YJP A;  4JXI A;  1XT8 A;  3ZS6 A;  3ODB A;  3OEK A;  1S50 A;  1QVS A;  3P7I A;  1Y4C A;  4I9D A;  3H6U A;  3PD9 A;  1UTB B;  3K6X A;  1LCF A;  4KHZ E;  3DLN A;  2D3I A;  5BWJ A;  4KQP A;  4F3P A;  4FE8 A;  3OOA A;  1OVB A;  3MZ1 A;  1MQG A;  1Y3N A;  2P2A A;  3SEY A;  1XOC A;  3T9U A;  1SBP A;  2XHD A;  1PBQ A;  5FHO A;  1N7X A;  3V89 B;  4OEV A;  2AYS A;  2DE3 A;  2Y7W A;  4IB2 A;  4OZ9 A;  1FQD A;  4XXU A;  2FYI A;  1M5C A;  2QS3 A;  4ELR A;  4FEC A;  1R6Z A;  3FV2 A;  1JEV A;  1MDP 1;  4JBZ A;  3T66 A;  4IO2 A;  1O64 A;  2HAU A;  4XKR A;  1HSL A;  1BIY A;  3IB1 A;  4NF4 A;  1MXZ A;  3FVK A;  4RXL A;  1UQW A;  4ESX A;  4F1V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...