5H8NB

Structure of the human glun1/glun2a lbd in complex with nam
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
285
structure length
282
Chain Sequence
TRLKIVTIHQEPFVYVKPTLSDGTCKEEFTVNGDPVKKVICTGPNDTSPGSPRHTVPQCCYGFCIDLLIKLARTMNFTYEVHLVADGKFGTQERVNKKEWNGMMGELLSGQADMIVAPLTINNERAQYIEFSKPFKYQGLTILVKKGTRITGINDPRLRNPSDKFIYATVKQSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSAVLEFEASQKCDLVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor ionotropic, NMDA 2A,Glutamate receptor io
publication title Positive Allosteric Modulators of GluN2A-Containing NMDARs with Distinct Modes of Action and Impacts on Circuit Function.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 79
structure length 282
sequence length 285
ec nomenclature
pdb deposition date 2015-12-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8nB01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 5h8nB02
1MPCA 2O7UA 1ZLQA 3HO7A 5CMCA 5KZTA 1N0TA 2HFBA 4AQ4A 1NNKA 3OENA 3CG3A 2Z8DA 2Q2CA 1XHYA 3WAFA 2O1MA 1LGBC 1FTMA 3O6IA 1R9LA 1YPNA 3VLUA 1Y3QA 1Y20A 3N6TA 2DS9A 3EN3A 4JWYA 2OZZA 4KI0E 1MQHA 2NWJA 2UVJA 1Y4CA 3KN3A 1QUIA 3KZGA 3CRBA 1N04A 3K02A 4RK9A 4JSDA 1MM7A 3O6HA 4ESXA 1JW1A 2X7PA 1PB8A 4ZEBA 1S9TA 3MVXA 5ISUA 4X48A 2O68A 1D4NA 2P1SA 2Z22A 3QSLA 2ZYOA 4U1ZA 1NH8A 3OEMA 4EQBA 4H6DA 4LONB 3HV1A 2ANJA 3ONMA 4G4PA 2G93A 3K6VA 1ZBMA 3ILTB 4IO3A 5H8SA 1HSLA 2AL4A 2HCAA 3O6GA 3Q27A 3MZBA 2F6PA 1ATGA 5DVJA 4N13A 4IO6A 2XXHA 2QJEA 4OEUA 3MW0A 4HCYA 4M4GA 1FTJA 2PT1A 4FIMA 4POWA 3EQ1A 2F8DA 1JNFA 4PFWA 5I58B 1OLAA 3G3HA 1A8FA 3ZKLA 3C33A 3IOVA 3QXMA 4U1OA 3H6VA 4GRKA 4OVJA 1Y1ZA 4X9TA 3FD3A 3VLVA 1ZJLA 2ONKE 1AIVA 5DEXB 4OXVA 3E3KA 3RGYA 1EZOA 2XXQA 1JVXA 5FTIA 3G3KA 1MXYA 3RT8A 4WKMA 2XXVA 3TTKA 2X26A 1FQDA 1MXWA 5JEIA 4G2ZA 3IOWA 1B6HA 4ELRA 3ZSFA 1JW4A 1OVBA 3MUQA 4BLAA 3ILUB 4N07A 3VE1B 2DP8A 2DWIA 1D9YA 3HHFA 3MPKA 5I58A 3SESA 3CG1A 1VFEA 4QFPA 4NWDA 4NF6B 3BFUA 2D5WA 1DOTA 4HS7A 2THIA 4YB6A 5DEXA 4NF4B 3WAEA 5AA2B 3G7WA 1P99A 1BKAA 2Y7IA 1O64A 3PMWA 4MFIA 1A7LA 1QKAA 3FVGA 3IOUA 4IO2A 2HAUA 1O63A 1MQGA 1DTZA 1VR5A 3H6UA 4MLVA 2E1SA 4F22A 3TPAA 3T96B 4TOZA 4MF3A 1PC3A 3LBSA 4HCWA 1I69A 3H7MA 3QIMA 4RA1A 1XC1A 2CZLA 4QSDA 4JWOA 1IUDA 1EZ9A 4EUOA 1LLSA 3USDA 4NF6A 1BLFA 1TWYA 2DSFA 4DLDA 2E0SA 1A99A 4MLQA 2B3BA 3TEPA 5I84A 4JSOA 2IA4A 4NF4A 3OELA 5AA2A 1WVJA 3I3VA 1GR2A 2Q9TA 2DYXA 2UYEA 1I6AA 3W9WA 4R2BA 2D3IA 2RINA 1D9VA 1FTLA 3MZ9A 2CMOA 2W7YA 1A8EA 1BTJA 3ODBA 4NF5B 2WKYA 1PBQA 1B7ZA 1NL5A 4F18A 1URSA 3I6VA 4OEVA 2ZMBA 1BIYA 4F19A 5TPAB 2NXOA 4IB2A 3FVKA 2V84A 1QUJA 2I3WA 4U4SA 3K2DA 3CFXA 4DIGA 3RNNA 1XOCA 2V25A 1B4HA 4H65A 4PFUA 5H8QB 4N6PA 3U92A 2Y7WA 1A40A 1YCJA 2Q88A 4X1BA 3V89B 2HZLA 3H6WA 3IR1A 3S4UA 4LZ7A 1T0KA 3HPIA 4GLIA 2OBGA 2F36A 2ZNTA 4FAJA 1OMPA 3KSXA 2QS2A 4DCXA 3K01A 4O3AA 3N94A 4NF5A 3RTFB 1B52A 3IAZA 1US5A 1AOVA 2PYYA 5TPAA 3UORA 1OQGA 3BBRA 3UA8A 1XS5A 4XKQA 5AA1A 5HPQA 1QW0A 3UK4A 1US4A 2ZNUA 3LUYA 3PUXE 3OEKA 2DWAA 4YMBA 3PUZE 5F1QA 3TELA 4JBZA 3BKIB 1B0HA 4QRZA 2F5XA 2Q2AA 4KHZE 3FV2A 4LQ5A 1GV8A 3SEUA 1L5TA 1MDP1 3ZKKA 2VHAA 2XXPA 3GXAA 4DDDA 4M1VA 3A09A 4QFNA 3C31A 1LBCA 1NNPA 5KCJB 2O6AA 4U21A 3K6UA 1HSJA 4OERA 4I8CA 2DVCA 5L9MA 2V3UA 4DE8A 1B3LA 1N76A 4DXCA 3SEVA 3DP4A 4IGRA 2F7CA 4EXKA 1Z7NE 2OLBA 2XX8A 3T22A 2HQ0A 2Y7PA 2B65A 3KFMA 3IO4A 4IY6A 4H5GA 4YB7A 4YU0A 3U93A 4LZ5A 1MQDA 3OSQA 1B7UA 4GOTA 1PB7A 2RCBA 5HBCA 1VE4A 2HXWA 3PGFA 1LAGE 3VVDA 3MP1A 4ESWA 4NTLA 4F2QA 1MS7A 3E4RA 3O9PA 3VXBA 4NEDA 1S50A 3CR9A 2Y7KA 4YZZA 2XXXA 4QSEA 5CBRA 2XX9A 1B3GA 3LSWA 5KCJA 1IITA 3MVZA 3H6TA 2REJA 2UVHA 1LBBA 1D3KA 2PMSA 2O1LA 5DTBA 5IKBA 3OD7A 4R6YA 3MVYA 1QVSA 2AIXA 2F97A 1N3WA 3E13X 2ONSA 2ZYNA 1FQAA 1YAEA 5BUUA 3UGWA 1UIUA 4EQ7A 4QFKA 1TXFA 2RCAA 5LOMA 2H25A 3T9XB 2OWTA 2XXRA 1A55A 4RNSA 1ZTYA 3QAXA 1LFGA 3M3LA 2F34A 4TLMB 4TQUQ 3Q29A 2DE3A 1P1QA 1ANFA 3IB0A 1MXZA 4E0WA 1M5DA 1B4ZA 4PE5B 5TU0A 2QS1A 4NF8B 3ECRA 3LSXA 2OWSA 3FXUA 3MZ1A 3DM0A 3CI8A 3SEWA 2ZYKA 2I4BA 3VVEA 1MY1A 2DQVA 3U94A 2F6GA 1JQFA 1KWHA 3RPWA 1TT1A 1FTOA 3V83A 2BJJX 1CE2A 3TQLA 4XKPA 3SEXA 3LSFB 4ONYA 5K2YA 4R75A 2VGQA 3CSBA 4R9GA 4FORA 2QMXA 4G8MA 4P0IA 2H4IA 5H8HB 4DXUA 3V5AA 4C0RA 1DPEA 4OFLA 2HEUA 2XHDA 2VOZA 4R73A 4OFOA 3EHSA 3C32A 1R9QA 3L6HA 5CBSA 4EDPA 1SQYA 3A3CA 3CFZA 2UVIA 4I9DA 3HCQA 3N5LA 4DXBA 2R6GE 4R9FA 4F3SA 1B58A 3I5OA 4KPTA 5ICTA 1OLCA 3CFLA 4FE8A 1MY3A 1FTKA 3DP6A 4F39A 4I62A 2O7IA 5IAIA 3JZJA 4F29A 4QSCA 1LFIA 1B32A 3IB1A 5L9SA 1P1WA 1SW1A 1LCFA 3FJMA 1YTVA 1MH3A 1MY0A 1EH3A 1SI1A 4OMBA 5DYHA 1MQIA 5H8HA 5DVIA 4OYVA 4JDFA 2RKMA 5L8DA 1URDA 4O3BA 3O2AA 5A5XB 3B7DA 2H9BA 2UYFA 2YLNA 3RTWB 3EHUA 3FZVA 1N7WA 5I2KB 2QS4A 3C9HA 5CRYA 4YKIA 1O7TA 2PT2A 3PD9A 3TCGA 3MP8A 2QSXA 2F7AA 3GBBA 2NUVA 3K0VA 3RLFE 1N7XA 3B6WA 3KJTA 4ELOA 1M5CA 3K4UA 1I6BA 4F1YA 3PUWE 2V93A 3B6QA 4YB5A 3TUSA 4KCCA 1MM6A 3PPNA 3TTLA 1Y4TA 3PV0E 4F31B 4ZZAA 2ZYMA 2GFEA 4RJZA 1MY4A 1H3DA 5A5XA 1DMBA 3RUMA 4IO5A 1XVXA 2XD3A 3PUVE 2YJPA 1B9JA 3G3IA 4XKNA 5L9OA 3EPEA 1MPBA 3T93B 1NKXA 4Q5TA 3K6XA 5I2KA 4WEPA 2PVUA 3S9MC 4F2OA 1XT8A 4Q0CA 1UIVA 1JVYA 3DLNA 2R71A 3G3GA 2I3VA 3TCFA 2Q89A 1PEBA 3VLWA 2QS3A 3FUZA 1PBPA 2Z23A 3TMGA 1DPPA 3FJ7A 3K6WA 5AA2D 2DWHA 1H44A 1LAXA 3MVWA 4AB5A 1QKBA 3MQ9A 3S9NC 1SBPA 4QFOA 4GF8A 1MH4A 4JB7A 1FCKA 3OO9A 2B3FA 1GTKA 4I1DA 4F3GA 4OWDA 3O29A 5CMBA 1QULA 3MC2A 4R6KA 5J1DA 3G3FA 2ESNA 3IX1A 1IXGA 3OO7A 5FTHA 1BP5A 4G77A 2UXAA 2V3QA 2DWJA 3C36A 1LCTA 1J1NA 1MRPA 1VSOA 4IO4A 3S2VA 4IGTA 2ABHA 4KD5A 4OTEA 4EF1A 1EZPA 2RC9A 5BWJA 2R9JA 4XXUA 3W15C 5FHOA 2I58A 2I0CA 3KN8A 5ELVA 2I49A 2F7BA 4R2FA 5H8QA 4ZEFA 4YMAA 2DXRA 2XXWA 1MG1A 4GVOA 5JTYB 1GGGA 5CC2A 2XD2A 4BDQA 4X1DA 5HM4B 1SW5A 3FGSA 1ZU0A 4GFRA 4G8HA 4FEDA 5CM6A 3OOAA 4GL8A 3TTRA 4H8JA 5M2VA 3DELB 4LUBA 4C1UA 4KCDA 4FATA 3JYRA 1M5FA 4QHQA 2OCUA 3KN7A 3GLBA 5I59B 3U72A 2XXYA 4FEBA 4ZE9A 1M5EA 1POY1 4HTGA 4IO7A 4ISUA 1P1OA 4YKJA 3TTNA 3FASA 4Q8RA 1SYIA 2XXUA 1AMFA 5DT6A 1RKMA 2NOOA 3T9VA 2VP1A 4G8NA 2DOJA 3AXFA 1OIBA 3O28A 4DZ1A 4F3PA 4UACA 1S7YA 2DE2A 3IB2A 3TCHA 5EYFA 3W9VA 4HW8A 1NFTA 1GVCA 4ZDMA 3M3FA 1B05A 4H8IA 5ITOA 2X7QA 5F7VA 1TFAA 2M8CA 5I56B 5FHNA 5I2NB 4ND9A 3C35A 3FIRA 1SW2A 4LQ2A 2V3TA 1MQJA 1WODA 2VD3A 4LP2B 1SI0A 1TFDA 4PFYA 5I59A 3PMXA 2H99A 4ELPA 4LZ8A 4G68B 1IXHA 4BDOA 3IL1B 2XXIA 4OENA 4QF9A 3KEIA 1MPDA 4MBPA 4EF2A 3R6UA 3VXCA 4F3BA 3IK6B 2RC8A 2Y84A 3BFTA 4YKKA 2G29A 3RT6B 3CVGA 2IEEA 4GXSB 4RK2A 4H67A 5I56A 5I2NA 1WDNA 4H5FA 5EHSA 2A5TB 1MXUA 3MBPA 4Z0IA 4ZEDA 1N84A 1B3FA 3Q26A 1Z7ME 3VDFA 4G68A 3TQWA 3IJXB 5B7DA 4RPNA 1FQFA 3K1MA 4GWOA 4GQOA 4ZZEA 3SKPA 4OHNA 4P0GA 2FA7A 3T9HB 3FXQA 4U22A 1B5JA 1IIWA 1DTGA 3HN0A 4GL0A 4C1TA 4H0WA 4F1UA 1AL3A 1UTHB 1MY2A 3OSRA 1B51A 4OZ9A 3ZS6A 1ELJA 3PD8A 4YICA 5EHMA 4OETA 4P11A 4UA8A 4LATA 5B70A 2Y7RA 2DXYA 3K00A 1IQ7A 2ZNSA 3SDFA 1B3HA 1ZIUA 2A5TA 3QYTA 2XXTA 1USYH 3UP9A 2F35A 3MJNA 4FJPA 3C34A 1CB6A 4YAHX 4WEDA 1LB8A 2I6EA 2RF1A 3T9UA 1VFDA 2F78A 1H76A 3RQTA 4IY5A 4NF8A 1R6ZA 3D4GA 3SETA 3OMBA 1UTHA 3TYHA 1N3XA 3IORA 1NNFA 4KYSA 1EU8A 1B0LA 2QPQA 1PDAA 3TZAA 1RYOA 3O66A 1FQEA 2HAVA 3QUJA 3TODA 4MH5A 1SW4A 3PU5A 3M8UA 4ELQA 3O97A 1Y3NA 1UQWA 1SYHA 2HZKA 2QL3A 1USYE 2FYIA 1JEUA 1LSTA 2Z8FA 2I4CA 1RYXA 4KYEA 1AH5A 4PETA 3QUFA 4AB6A 3FXRA 2QRYA 3HSTA 3VVFA 1NMUA 3THIA 4NE4A 1I6QA 2PX1A 3RN8A 3FJGA 2I0BA 3KBRA 5H8NB 1IXCA 3PMVA 3PPPA 3F11A 3Q28A 4BDLA 3KOTA 4EXLA 2LAOA 4PFTA 3UIFA 2A5SA 2GRVA 1B46A 2GH9A 3FVOA 2GHBA 2YPNA 3TKDA 3PPRA 3TAJA 3PPQA 3R26A 4XIGQ 1R1NA 1FW0A 4E0XA 2QMWA 4JXIA 1XVYA 5H8FB 1F9BA 4RY1A 3D4CA 3A3UA 1ZKBA 1B5HA 3VFJA 2D21A 1SDXA 3EHTA 3LR1A 5AE4A 4ECFA 3SEYA 5K2XA 4TLLB 2AL5A 1LB9A 4R6HA 4EQ9A 3K1PA 1MXVA 2RC7A 1LFHA 1IXIA 4LVQA 5H8NA 1Q1KA 4GIZA 1SD3A 2Z8EA 3C4MA 1URGA 5DVFA 3KSJA 1A54A 1B7HA 4R74A 1B1XA 3V8XB 2OJTA 2OK2A 3VV5A 2PBWA 3PPOA 3TTMA 2NVUB 3B6TA 5AA4B 4ZEKA 3JV9A 1II5A 1LAHE 4POXA 5FHMA 3OO6A 5H8FA 2P2AA 4THIA 1ZMGA 1B1HA 4PQJA 1Y9UA 4ZE8A 5KDTB 2O51A 4GD5A 1DSNA 2H5YA 2O84X 4KYDA 3E9XA 2I48A 1IEJA 2P0SA 3L6GA 5AA3A 3N6UA 4OESA 3GBAA 3FATA 3G3JA 3EF7A 4L17A 2Q8JA 2FNCA 4RXLA 3H4ZA 4K3FA 4JWXA 1JETA 3IO6A 4KR5A 3KJ7A 4U2RA 3H3GA 1SVXB 4ZECA 3KOSA 1QUKA 4R72A 4FECA 4LA9A 4RPOA 1OVTA 2UVGA 4RYAA 3N26A 1H43A 5AA4A 3FVNA 3IJOB 5JK4A 3T66A 1LAFE 3FV1A 2H98A 5CMMA 4OQOA 3KGCA 1QJMA 4GXAA 4XTCQ 1B5IA 5TP9B 3U1OA 1JW5A 5KDTA 4O3CA 1FQCA 5CI5A 2KLFA 1Y1MA 3MWBA 3PUYE 2XX7A 5CMKA 3UN6A 2ZXTA 4YKPA 3LSLA 1NH7A 5I57B 3TFLA 1UTBB 4PP0A 4WXJA 3K1NA 3OO8A 3R7XA 3HHGA 4QFLA 3SERA 1B40A 2VD2A 3MP6A 1B2HA 2DVZA 1HSEA 1FQBA 1JEVA 2GHAA 1Q35A 1MDQA 3U8QA 5ICQA 1P1UA 4XKRA 3MAMA 1H45A 4NMYA 3DP8A 4G68C 4ZS9A 2DE4A 3M3KA 4Q30B 3CIJA 3QK6A 1B3EA 1POTA 3RY3A 3MPLA 5ITPA 4DCYA 5TP9A 5JTYA 4Z7EA 4ZEIA 4U23A 3S9EA 4NWCA 2AYSA 3GZGA 1PB9A 2O69A 4BDNA 4BDRA 3H03A 1M5BA 4OFJA 5I57A 2REGA 3Q25A 4U4XA 1UTBA 1MXXA 3IOTA 3OXNA 2ALUA 1Y3PA 4KFQA 4H1XA 3CSGA 3KG2A 1NNTA 3S9LC 4KQPA 3LC8A 1P1NA 3H06B 3TDJA 1OQHA 4F1VA 1IZ1A 4BDMA 3P7IA 2ONRA
chains in the Genus database with same CATH superfamily
1MPCA 4OVRA 2O7UA 1ZLQA 2WEFA 4NHBA 3HO7A 5CMCA 5KZTA 4GWYA 1N0TA 2HFBA 4GWUA 4AQ4A 1NNKA 3OENA 4P8BA 3CG3A 2Z8DA 2Q2CA 1XHYA 4GWZA 3WAFA 2O1MA 1LGBC 1FTMA 3O6IA 1R9LA 1YPNA 1FTAA 3VLUA 1Y20A 1Y3QA 3N6TA 2DS9A 3EN3A 4JWYA 2OZZA 4KI0E 1MQHA 2NWJA 2UVJA 1Y4CA 3KN3A 1QUIA 4OANA 3KZGA 3CRBA 1N04A 3K02A 4RK9A 4JSDA 1MM7A 1LBWA 3O6HA 5IZ3A 4ESXA 1JW1A 3EKIA 5ET6A 4PBQA 2X7PA 1PB8A 4ZEBA 1S9TA 3MVXA 5ISUA 4X48A 2O68A 1D4NA 2P1SA 2Z22A 3QSLA 2ZYOA 4U1ZA 1NH8A 3OEMA 4EQBA 3RYDA 4H6DA 4LONB 3HV1A 2ANJA 1KA1A 3ONMA 4LN5A 4G4PA 2G93A 3K6VA 1ZBMA 5IM2A 3ILTB 4IO3A 5H8SA 1HSLA 2AL4A 2HCAA 3O6GA 3Q27A 3MZBA 4XEQA 2F6PA 1ATGA 5DVJA 4N13A 4IO6A 2XXHA 2QJEA 4OEUA 3MW0A 4HCYA 3LV0A 4M4GA 4PGNA 1FTJA 4PAIA 2PT1A 4FIMA 4POWA 3EQ1A 4DI3D 2F8DA 1JNFA 1KA0A 4PFWA 1DCUA 5I58B 4PFBA 1OLAA 3G3HA 1A8FA 3ZKLA 3C33A 3IOVA 4AS5A 3QXMA 4U1OA 3H6VA 4H46A 5I7IA 2WYKA 5IZ1A 4GRKA 4OVJA 1Y1ZA 4X9TA 3FD3A 3VLVA 1ZJLA 2ONKE 4NX1A 1AIVA 1FJ6A 5DEXB 1NV1A 4N81A 4OXVA 3E3KA 3RGYA 1EZOA 2XXQA 1JVXA 5FTIA 1BK4A 3G3KA 1MXYA 3RT8A 2PCRA 4WKMA 2XXVA 3TTKA 2X26A 1FQDA 4P47A 1MXWA 5JEIA 4G2ZA 3IOWA 1B6HA 4N8GA 4ELRA 3ZSFA 1JW4A 1OVBA 3MUQA 4BLAA 3ILUB 4N07A 3VE1B 2DP8A 2DWIA 1D9YA 3HHFA 3MPKA 5I58A 1FBCA 3SESA 1NUXA 3CG1A 1VFEA 5J16A 4QFPA 4NWDA 4NF6B 3QMFA 3BFUA 2D5WA 1DOTA 4HS7A 2THIA 4YB6A 5DEXA 4NF4B 2BJIA 3WAEA 5AA2B 1FPBA 3G7WA 1P99A 1BKAA 2Y7IA 1O64A 3PMWA 4MFIA 1NV6A 1A7LA 1QKAA 3FVGA 3IOUA 4IO2A 2HAUA 5FBPA 1O63A 1MQGA 1DTZA 1VR5A 3H6UA 3BIGA 4MLVA 5IZZA 2E1SA 3FBPA 4F22A 3TPAA 2Q8MA 3T96B 4TOZA 4MF3A 3LBSA 1PC3A 4GX3A 4HCWA 1DK4A 1I69A 3H7MA 4DI4B 3QIMA 1NV2A 4RA1A 1XC1A 2CZLA 2R8TA 4QSDA 4JWOA 1IUDA 4PAFA 1EZ9A 2KR0A 4EUOA 1LLSA 4NF6A 1BLFA 3USDA 1TWYA 1KZ8A 2DSFA 4DLDA 2E0SA 1A99A 4MLQA 1IMCA 2B3BA 3TEPA 5I84A 4JSOA 2IA4A 4NF4A 3OELA 5AA2A 1WVJA 3I3VA 1GR2A 2Q9TA 2DYXA 2UYEA 1I6AA 3W9WA 4R2BA 2D3IA 2RINA 1FBDA 5I5PA 1FPJA 1D9VA 1FTLA 3MZ9A 2CEXA 2CMOA 2W7YA 1A8EA 1BTJA 3ODBA 4NF5B 4N6DA 4XF5A 2WKYA 1PBQA 1B7ZA 1NL5A 4F18A 1URSA 3I6VA 4OEVA 2ZMBA 1BIYA 4NN3A 4F19A 5TPAB 2NXOA 4IB2A 3FVKA 2V84A 1AWBA 2ZZWA 1QUJA 2I3WA 4U4SA 3K2DA 3CFXA 4DIGA 3RNNA 1XOCA 2V25A 1B4HA 4H65A 4PFUA 4HE1A 5H8QB 4N6PA 3U92A 2Y7WA 1A40A 1YCJA 2Q88A 4X1BA 3V89B 2F3DA 2HZLA 3H6WA 1QGXA 3IR1A 3S4UA 4LZ7A 1T0KA 3HPIA 4GLIA 4O94A 2OBGA 2F36A 1LBXA 2ZZVA 2ZNTA 2Y5KA 4FAJA 1OMPA 3KSXA 2QS2A 2FIXA 4DCXA 3K01A 4O3AA 3N94A 1FBHA 1NV3A 4NF5A 3RTFB 4MEVA 1B52A 3IAZA 1US5A 1AOVA 3KC1A 2PYYA 5TPAA 3UORA 1SPIA 1OQGA 3BBRA 3UA8A 1FSAA 1XS5A 4XKQA 5AA1A 5HPQA 1QW0A 3UK4A 1US4A 2ZNUA 3LUYA 4I3YA 2XWKA 3HFUA 4JVCA 3PUXE 1VDWA 3OEKA 2DWAA 4YMBA 3PUZE 5F1QA 3TELA 4JBZA 3BKIB 1FBPA 1B0HA 4QRZA 2F5XA 2Q2AA 4KHZE 3FV2A 4LQ5A 1GV8A 3SEUA 3KC0A 1L5TA 1MDP1 4N4UA 4QXDA 3ZKKA 2VHAA 2XXPA 3GXAA 4DDDA 4M1VA 3A09A 4QFNA 3C31A 1LBCA 1NNPA 2XA5A 5KCJB 2O6AA 2QFLA 4U21A 3K6UA 1HSJA 4OERA 4I8CA 2DVCA 2VT5A 5L9MA 2V3UA 4DE8A 4GX4A 1B3LA 1N76A 4DXCA 3SEVA 3DP4A 4IGRA 2F7CA 1NV4A 4EXKA 1Z7NE 2OLBA 5EYHA 2XX8A 3T22A 2HQ0A 2Y7PA 2B65A 3KFMA 3IO4A 4IY6A 4H5GA 4PCDA 5LDZA 4YB7A 4YU0A 3U93A 4LZ5A 1MQDA 3OSQA 1B7UA 3MYUA 4GOTA 1PB7A 2RCBA 3CHGA 5HBCA 1VE4A 2HXWA 3PGFA 1LAGE 3VVDA 3MP1A 4ESWA 4NTLA 4F2QA 1MS7A 3E4RA 3O9PA 3VXBA 2HXRA 4NEDA 4PDDA 1S50A 3CR9A 2Y7KA 4YZZA 1EYIA 2XXXA 4QSEA 5CBRA 1IMFA 2XX9A 1B3GA 3LSWA 5KCJA 1IITA 3MVZA 4AS4A 3H6TA 2REJA 2UVHA 1LBBA 1D3KA 2PMSA 2O1LA 5DTBA 5IKBA 3LUZA 4NF0A 3OD7A 4N6KA 4R6YA 2ZZXA 3MVYA 1QVSA 2AIXA 2F97A 1N3WA 3E13X 2ONSA 3SZPA 4NGUA 2ZYNA 1FQAA 1YAEA 5A5LA 5BUUA 3UGWA 1IMAA 2ONRA 1UIUA 4EQ7A 4QFKA 1TXFA 1IMBA 2RCAA 5LOMA 2H25A 3T9XB 2OWTA 2XXRA 3NOHA 1A55A 4RNSA 1ZTYA 3QAXA 1LFGA 3M3LA 4GWXA 1YZ0A 2F34A 4TLMB 4TQUQ 2DDKA 3Q29A 2DE3A 1P1QA 1ANFA 3IB0A 1MXZA 3E78A 4E0WA 1M5DA 1B4ZA 4PE5B 5TU0A 2QS1A 4NF8B 3ECRA 3LSXA 1FPEA 4OVSA 2OWSA 1NV5A 2Y5LA 3FXUA 3MZ1A 3DM0A 3CI8A 3SEWA 2ZYKA 1FRPA 2I4BA 3VVEA 1MY1A 1YYZA 2DQVA 3U94A 2F6GA 1JQFA 1KWHA 3RPWA 1TT1A 1FTOA 3V83A 2BJJX 1CE2A 3A29A 3TQLA 4XKPA 3SEXA 3LSFB 4ONYA 5K2YA 4R75A 2VGQA 3CSBA 4R9GA 4FORA 2QMXA 4G8MA 4P0IA 2H4IA 5H8HB 4DXUA 3V5AA 4XFEA 1NI9A 4C0RA 1DPEA 4OFLA 2HEUA 2XHDA 2VOZA 2FHYA 4R73A 4OFOA 3EHSA 3GYYA 2HHMA 3C32A 4OVTA 1R9QA 3L6HA 5CBSA 4EDPA 1SQYA 3A3CA 3CFZA 2UVIA 4I9DA 3HCQA 3N5LA 4DXBA 2R6GE 4R9FA 4F3SA 1B58A 1EYKA 3I5OA 4KPTA 5ICTA 1NUWA 4PFRA 1OLCA 3CFLA 4FE8A 1MY3A 5IGAA 1FTKA 2WBBA 4MX6A 3DP6A 4F39A 4I62A 2FBPA 2O7IA 5IAIA 3JZJA 4F29A 4QSCA 1LFIA 1B32A 3IB1A 5L9SA 1P1WA 1SW1A 1LCFA 2OWZA 3FJMA 4G61A 1YTVA 2V4CA 1MH3A 4MNPA 1MY0A 1EH3A 1SI1A 4OMBA 5DYHA 1MQIA 5H8HA 5DVIA 3E79A 4GBWA 4OYVA 4JDFA 2FIEA 2RKMA 5L8DA 1URDA 4O3BA 3O2AA 4X04A 1K9YA 5A5XB 3B7DA 2H9BA 2UYFA 2VPOA 2WBDA 2YLNA 3RTWB 3U65A 3EHUA 3FZVA 1N7WA 1RDYA 5I2KB 2QS4A 3C9HA 5CRYA 4YKIA 1O7TA 2PT2A 3PD9A 3IFAA 3TCGA 3MP8A 4IR8A 2QSXA 2F7AA 3GBBA 2NUVA 3K0VA 4X8RA 3RLFE 1N7XA 5F24A 3B6WA 3KJTA 4ELOA 1M5CA 3K4UA 4O8MA 1I6BA 1CNQA 4F1YA 3PUWE 2V93A 3B6QA 4YB5A 3TUSA 4KCCA 1MM6A 3PPNA 3TTLA 1Y4TA 4GBVA 3PV0E 4F31B 4ZZAA 5ET7A 2ZYMA 2GFEA 1INPA 4RJZA 1MY4A 1H3DA 2CZKA 4MCOA 5A5XA 1DMBA 3RUMA 4IO5A 1XVXA 2XD3A 3PUVE 1FPIA 2YJPA 1B9JA 3G3IA 4XKNA 5L9OA 3EPEA 1MPBA 3T93B 1NKXA 4Q5TA 3K6XA 5I2KA 4WEPA 2PVUA 3S9MC 4F2OA 1XT8A 4Q0CA 1UIVA 3ISPA 1JVYA 3DLNA 2PFYA 2R71A 3G3GA 4PF8A 2I3VA 3TCFA 2Q89A 1PEBA 4MMPA 3VLWA 2QS3A 3FUZA 4HE2A 1FPLA 1PBPA 2Z23A 3TMGA 1DPPA 3FJ7A 2PFZA 3K6WA 5AA2D 2DWHA 1H44A 1LAXA 3MVWA 4OVQA 4AB5A 1QKBA 3MQ9A 3S9NC 1SBPA 4QFOA 4GF8A 1MH4A 4JB7A 1FCKA 3OO9A 2B3FA 1GTKA 4I1DA 4F3GA 4OWDA 3O29A 5CMBA 4PAKA 1QULA 3MC2A 3PTYA 4R6KA 5J1DA 3G3FA 2ESNA 1RDXA 3IX1A 1IXGA 3OO7A 5FTHA 1BP5A 4G77A 1EYJA 2UXAA 2V3QA 2DWJA 1FPGA 3C36A 1LCTA 1NUYA 1J1NA 1MRPA 3BIHA 1VSOA 4IO4A 3S2VA 4IGTA 2ABHA 4KD5A 4OTEA 4EF1A 1EZPA 2RC9A 5BWJA 2R9JA 4XXUA 3W15C 5FHOA 2I58A 2I0CA 3KN8A 5ELVA 2I49A 2F7BA 1DBZA 4R2FA 5H8QA 4ZEFA 4YMAA 2DXRA 2XXWA 1MG1A 4GVOA 5JTYB 3IFCA 1GGGA 5CC2A 2XD2A 4BDQA 4X1DA 5HM4B 2GQ1A 1SW5A 3FGSA 1ZU0A 4GFRA 4G8HA 4FEDA 5CM6A 3OOAA 4GL8A 3TTRA 4H8JA 5M2VA 3DELB 4I40A 4LUBA 4N17A 4C1UA 4MAGA 4KCDA 4FATA 3JYRA 1M5FA 4QHQA 2OCUA 3KN7A 3GLBA 5I59B 3U72A 2XXYA 4FEBA 4ZE9A 1M5EA 1POY1 4HTGA 4IO7A 4ISUA 1P1OA 4YKJA 3TTNA 3FASA 4Q8RA 1SYIA 2XXUA 1AMFA 4N91A 1FBGA 5DT6A 2FVZA 1RKMA 2NOOA 3T9VA 2VP1A 2MKZA 4G8NA 2DOJA 3AXFA 4NAPA 1OIBA 3ROJA 1K9ZA 4QBAA 3O28A 4DZ1A 4F3PA 4UACA 1FBFA 1S7YA 2DE2A 3IB2A 3TCHA 3D1RA 5EYFA 3W9VA 4HW8A 2WX9A 1NFTA 1GVCA 4ZDMA 3M3FA 1B05A 4H8IA 5ITOA 2X7QA 5F7VA 1TFAA 2M8CA 5I56B 5FHNA 5I2NB 5I3SA 4ND9A 3C35A 3FIRA 1SW2A 3B8BA 4LQ2A 2V3TA 1FJ9A 1MQJA 1WODA 2VD3A 4LP2B 1JP4A 1SI0A 1TFDA 4PFYA 5I59A 3PMXA 2H99A 4ELPA 4LZ8A 4G68B 1FBEA 1IXHA 4BDOA 3IL1B 2XXIA 4OA4A 4OENA 1XI6A 4QF9A 3KEIA 1LBVA 1MPDA 4MBPA 4EF2A 3R6UA 3VXCA 4F3BA 3IK6B 5EQ7A 2RC8A 2Y84A 3BFTA 4YKKA 2G29A 3RT6B 3CVGA 4O7MA 2IEEA 4GXSB 4RK2A 4H67A 5I56A 2XWIA 5I2NA 1WDNA 4H5FA 5EHSA 2A5TB 1MXUA 2WYPA 3MBPA 4Z0IA 4ZEDA 1N84A 2CZIA 1B3FA 3Q26A 5T3JA 1Z7ME 3VDFA 4G68A 3TQWA 3IJXB 5B7DA 4RPNA 4NG7A 1IMEA 1FQFA 3K1MA 4GWOA 4GQOA 4P56A 4ZZEA 4O7IA 4OHNA 4P0GA 2FA7A 3SKPA 3T9HB 3FXQA 4U22A 1B5JA 1IIWA 1DTGA 3HN0A 4GL0A 4C1TA 4H0WA 4PDHA 4F1UA 5EQAA 4JVIA 1AL3A 3T1BA 1UTHB 1MY2A 3OSRA 1B51A 4OZ9A 1D9QA 3ZS6A 1ELJA 3PD8A 4YICA 5EHMA 4OETA 4P11A 4UA8A 3RPLB 4LATA 5DW8A 5B70A 2Y7RA 2DXYA 1G0HA 2CZHA 3K00A 1IQ7A 2ZNSA 2HPGA 3SDFA 1B3HA 2L5VA 1ZIUA 2A5TA 3QYTA 2XXTA 1USYH 3UP9A 2F35A 3MJNA 4FJPA 4P3LA 3C34A 1CB6A 4YAHX 1NUZA 4PBHA 4WEDA 1LB8A 2I6EA 2RF1A 3T9UA 1VFDA 2F78A 5LTCA 1H76A 3RQTA 4IY5A 4NF8A 1R6ZA 3D4GA 1RDZA 3SETA 3OMBA 1UTHA 3TYHA 1N3XA 2B4LA 3IORA 4PGPA 1NNFA 4KYSA 1EU8A 1B0LA 2CEYA 2QPQA 1PDAA 3TZAA 1G0IA 3RPLA 1RYOA 3O66A 1FQEA 2HAVA 3QUJA 3TODA 4MH5A 1SW4A 3PU5A 3M8UA 4ELQA 2JJKA 3O97A 3B50A 1Y3NA 4PTKA 1UQWA 1SYHA 2HZKA 1NV7A 2QL3A 4PF6A 1USYE 2FYIA 1JEUA 1LSTA 2Z8FA 2I4CA 1RYXA 4KYEA 4GWWA 1AH5A 4OVPA 4PETA 5EQ9A 3QUFA 4AB6A 3FXRA 2QVRA 2QRYA 4HE0A 3HSTA 3VVFA 1FPKA 1NMUA 4I3EA 3THIA 4NE4A 1I6QA 2PX1A 3RN8A 3FJGA 2P3VA 2I0BA 3KBRA 5H8NB 1IXCA 3PMVA 3PPPA 3F11A 3Q28A 4BDLA 3KOTA 4EXLA 4N8YA 2LAOA 4PFTA 3UIFA 2A5SA 2GRVA 1B46A 2GH9A 3FVOA 2GHBA 2YPNA 3TKDA 5ET8A 3PPRA 1IMDA 3TAJA 3PPQA 3R26A 4XIGQ 3MSTA 1R1NA 1FW0A 4E0XA 4P1LA 2QMWA 4JXIA 1XVYA 5H8FB 1F9BA 4RY1A 3D4CA 4MNIA 3A3UA 1ZKBA 1B5HA 3VFJA 2QVUA 2D21A 1SDXA 3EHTA 3LR1A 5AE4A 4ECFA 1LEVA 3SEYA 5ET5A 3FXBA 5K2XA 4TLLB 2AL5A 1LB9A 4R6HA 4EQ9A 3K1PA 1MXVA 2RC7A 1LFHA 4PFIA 4H45A 1IXIA 4P1EA 4LVQA 5H8NA 1Q1KA 4GIZA 1SD3A 2Z8EA 2F3BA 5EYGA 3C4MA 5ESYA 4MIJA 2XWOA 1URGA 5DVFA 3KSJA 1A54A 1B7HA 4R74A 1B1XA 1FPFA 3V8XB 2OJTA 4PE3A 2OK2A 3VV5A 2PBWA 3PPOA 3TTMA 2NVUB 3B6TA 5AA4B 4ZEKA 3JV9A 1II5A 1LAHE 4POXA 5FHMA 3OO6A 5H8FA 2P2AA 4THIA 1ZMGA 1B1HA 4PQJA 1Y9UA 4ZE8A 5KDTB 2O51A 4MHFA 4PC9A 4GD5A 2XXKA 1DSNA 2H5YA 2O84X 4KYDA 3E9XA 1FPDA 2I48A 1IEJA 2P0SA 3L6GA 4GWSA 5AA3A 3N6UA 4OESA 3GBAA 3FATA 2P3NA 3G3JA 3EF7A 4L17A 2Q8JA 2FNCA 4RXLA 3H4ZA 4K3FA 4JWXA 1JETA 3IO6A 4KR5A 3KJ7A 4U2RA 3H3GA 1SVXB 4ZECA 3KOSA 1LBYA 1QUKA 4R72A 4FECA 4LA9A 1NV0A 4RPOA 1OVTA 2UVGA 4RYAA 3N26A 1H43A 5AA4A 2VPNA 3FVNA 2OX3A 2XWVA 3IJOB 5JK4A 4UABA 3T66A 1LAFE 1Q9DA 2H98A 3FV1A 2QVVA 5CMMA 4GX6A 4OQOA 3KGCA 1QJMA 4GXAA 4XTCQ 1B5IA 5TP9B 3U1OA 1JW5A 5KDTA 4O3CA 1FQCA 5CI5A 2B4MA 2KLFA 1Y1MA 3MWBA 4P9KA 3PUYE 2XX7A 5CMKA 3UN6A 2ZXTA 4YKPA 3LSLA 1NH7A 5I57B 3TFLA 1UTBB 4NQ8A 4PP0A 4WXJA 3K1NA 3OO8A 3R7XA 3HHGA 3KBZA 4QFLA 4MJOA 3SERA 1B40A 2VD2A 3MP6A 1B2HA 4HXVA 2DVZA 1HSEA 1FQBA 1JEVA 2GHAA 1Q35A 1MDQA 3U8QA 1LBZA 5ICQA 1P1UA 4XKRA 3MAMA 1H45A 4NMYA 3DP8A 4G68C 4ZS9A 2DE4A 3M3KA 4Q30B 3CIJA 3QK6A 1B3EA 1POTA 3RY3A 3MPLA 5ITPA 4DCYA 5TP9A 5JTYA 4Z7EA 4ZEIA 4U23A 3S9EA 4NWCA 4JVDA 2AYSA 3GZGA 1PB9A 2O69A 4BDNA 4BDRA 3H03A 1M5BA 2Q74A 4OFJA 5I57A 4N15A 2REGA 3Q25A 4U4XA 1UTBA 2KQZA 1MXXA 5IZ3B 3IOTA 3OXNA 2ALUA 1Y3PA 5EQ8A 4KFQA 4H1XA 3CSGA 3KG2A 1NNTA 3S9LC 4KQPA 3LC8A 1P1NA 4KXPA 3H06B 3T0JA 4MNCA 4FBPA 1OQHA 3TDJA 4F1VA 1IZ1A 4BDMA 3P7IA 1YXIA
chains in the Genus database with same CATH topology
1MPCA 2O7UA 1ZLQA 3HO7A 5CMCA 5KZTA 1N0TA 2HFBA 4AQ4A 1NNKA 3OENA 3CG3A 2Z8DA 2Q2CA 1XHYA 3WAFA 2O1MA 1LGBC 1FTMA 3O6IA 1R9LA 1YPNA 3VLUA 1Y3QA 1Y20A 3N6TA 2DS9A 3EN3A 4JWYA 2OZZA 4KI0E 1MQHA 2NWJA 2UVJA 1Y4CA 3KN3A 1QUIA 3KZGA 3CRBA 1N04A 3K02A 4RK9A 4JSDA 1MM7A 3O6HA 4ESXA 1JW1A 2X7PA 1PB8A 4ZEBA 1S9TA 3MVXA 5ISUA 4X48A 2O68A 1D4NA 2P1SA 2Z22A 3QSLA 2ZYOA 4U1ZA 1NH8A 3OEMA 4EQBA 4H6DA 4LONB 3HV1A 2ANJA 3ONMA 4G4PA 2G93A 3K6VA 1ZBMA 3ILTB 4IO3A 5H8SA 1HSLA 2AL4A 2HCAA 3O6GA 3Q27A 3MZBA 2F6PA 1ATGA 5DVJA 4N13A 4IO6A 2XXHA 2QJEA 4OEUA 3MW0A 4HCYA 4M4GA 1FTJA 2PT1A 4FIMA 4POWA 3EQ1A 2F8DA 1JNFA 4PFWA 5I58B 1OLAA 3G3HA 1A8FA 3ZKLA 3C33A 3IOVA 3QXMA 4U1OA 3H6VA 4GRKA 4OVJA 1Y1ZA 4X9TA 3FD3A 3VLVA 1ZJLA 2ONKE 1AIVA 5DEXB 4OXVA 3E3KA 3RGYA 1EZOA 2XXQA 1JVXA 5FTIA 3G3KA 1MXYA 3RT8A 4WKMA 2XXVA 3TTKA 2X26A 1FQDA 1MXWA 5JEIA 4G2ZA 3IOWA 1B6HA 4ELRA 3ZSFA 1JW4A 1OVBA 3MUQA 4BLAA 3ILUB 4N07A 3VE1B 2DP8A 2DWIA 1D9YA 3HHFA 3MPKA 5I58A 3SESA 3CG1A 1VFEA 4QFPA 4NWDA 4NF6B 3BFUA 2D5WA 1DOTA 4HS7A 2THIA 4YB6A 5DEXA 4NF4B 3WAEA 5AA2B 3G7WA 1P99A 1BKAA 2Y7IA 1O64A 3PMWA 4MFIA 1A7LA 1QKAA 3FVGA 3IOUA 4IO2A 2HAUA 1O63A 1MQGA 1DTZA 1VR5A 3H6UA 4MLVA 2E1SA 4F22A 3TPAA 3T96B 4TOZA 4MF3A 1PC3A 3LBSA 4HCWA 1I69A 3H7MA 3QIMA 4RA1A 1XC1A 2CZLA 4QSDA 4JWOA 1IUDA 1EZ9A 4EUOA 1LLSA 3USDA 4NF6A 1BLFA 1TWYA 2DSFA 4DLDA 2E0SA 1A99A 4MLQA 2B3BA 3TEPA 5I84A 4JSOA 2IA4A 4NF4A 3OELA 5AA2A 1WVJA 3I3VA 1GR2A 2Q9TA 2DYXA 2UYEA 1I6AA 3W9WA 4R2BA 2D3IA 2RINA 1D9VA 1FTLA 3MZ9A 2CMOA 2W7YA 1A8EA 1BTJA 3ODBA 4NF5B 2WKYA 1PBQA 1B7ZA 1NL5A 4F18A 1URSA 3I6VA 4OEVA 2ZMBA 1BIYA 4F19A 5TPAB 2NXOA 4IB2A 3FVKA 2V84A 1QUJA 2I3WA 4U4SA 3K2DA 3CFXA 4DIGA 3RNNA 1XOCA 2V25A 1B4HA 4H65A 4PFUA 5H8QB 4N6PA 3U92A 2Y7WA 1A40A 1YCJA 2Q88A 4X1BA 3V89B 2HZLA 3H6WA 3IR1A 3S4UA 4LZ7A 1T0KA 3HPIA 4GLIA 2OBGA 2F36A 2ZNTA 4FAJA 1OMPA 3KSXA 2QS2A 4DCXA 3K01A 4O3AA 3N94A 4NF5A 3RTFB 1B52A 3IAZA 1US5A 1AOVA 2PYYA 5TPAA 3UORA 1OQGA 3BBRA 3UA8A 1XS5A 4XKQA 5AA1A 5HPQA 1QW0A 3UK4A 1US4A 2ZNUA 3LUYA 3PUXE 3OEKA 2DWAA 4YMBA 3PUZE 5F1QA 3TELA 4JBZA 3BKIB 1B0HA 4QRZA 2F5XA 2Q2AA 4KHZE 3FV2A 4LQ5A 1GV8A 3SEUA 1L5TA 1MDP1 3ZKKA 2VHAA 2XXPA 3GXAA 4DDDA 4M1VA 3A09A 4QFNA 3C31A 1LBCA 1NNPA 5KCJB 2O6AA 4U21A 3K6UA 1HSJA 4OERA 4I8CA 2DVCA 5L9MA 2V3UA 4DE8A 1B3LA 1N76A 4DXCA 3SEVA 3DP4A 4IGRA 2F7CA 4EXKA 1Z7NE 2OLBA 2XX8A 3T22A 2HQ0A 2Y7PA 2B65A 3KFMA 3IO4A 4IY6A 4H5GA 4YB7A 4YU0A 3U93A 4LZ5A 1MQDA 3OSQA 1B7UA 4GOTA 1PB7A 2RCBA 5HBCA 1VE4A 2HXWA 3PGFA 1LAGE 3VVDA 3MP1A 4ESWA 4NTLA 4F2QA 1MS7A 3E4RA 3O9PA 3VXBA 4NEDA 1S50A 3CR9A 2Y7KA 4YZZA 2XXXA 4QSEA 5CBRA 2XX9A 1B3GA 3LSWA 5KCJA 1IITA 3MVZA 3H6TA 2REJA 2UVHA 1LBBA 1D3KA 2PMSA 2O1LA 5DTBA 5IKBA 3OD7A 4R6YA 3MVYA 1QVSA 2AIXA 2F97A 1N3WA 3E13X 2ONSA 2ZYNA 1FQAA 1YAEA 5BUUA 3UGWA 1UIUA 4EQ7A 4QFKA 1TXFA 2RCAA 5LOMA 2H25A 3T9XB 2OWTA 2XXRA 1A55A 4RNSA 1ZTYA 3QAXA 1LFGA 3M3LA 2F34A 4TLMB 4TQUQ 3Q29A 2DE3A 1P1QA 1ANFA 3IB0A 1MXZA 4E0WA 1M5DA 1B4ZA 4PE5B 5TU0A 2QS1A 4NF8B 3ECRA 3LSXA 2OWSA 3FXUA 3MZ1A 3DM0A 3CI8A 3SEWA 2ZYKA 2I4BA 3VVEA 1MY1A 2DQVA 3U94A 2F6GA 1JQFA 1KWHA 3RPWA 1TT1A 1FTOA 3V83A 2BJJX 1CE2A 3TQLA 4XKPA 3SEXA 3LSFB 4ONYA 5K2YA 4R75A 2VGQA 3CSBA 4R9GA 4FORA 2QMXA 4G8MA 4P0IA 2H4IA 5H8HB 4DXUA 3V5AA 4C0RA 1DPEA 4OFLA 2HEUA 2XHDA 2VOZA 4R73A 4OFOA 3EHSA 3C32A 1R9QA 3L6HA 5CBSA 4EDPA 1SQYA 3A3CA 3CFZA 2UVIA 4I9DA 3HCQA 3N5LA 4DXBA 2R6GE 4R9FA 4F3SA 1B58A 3I5OA 4KPTA 5ICTA 1OLCA 3CFLA 4FE8A 1MY3A 1FTKA 3DP6A 4F39A 4I62A 2O7IA 5IAIA 3JZJA 4F29A 4QSCA 1LFIA 1B32A 3IB1A 5L9SA 1P1WA 1SW1A 1LCFA 3FJMA 1YTVA 1MH3A 1MY0A 1EH3A 1SI1A 4OMBA 5DYHA 1MQIA 5H8HA 5DVIA 4OYVA 4JDFA 2RKMA 5L8DA 1URDA 4O3BA 3O2AA 5A5XB 3B7DA 2H9BA 2UYFA 2YLNA 3RTWB 3EHUA 3FZVA 1N7WA 5I2KB 2QS4A 3C9HA 5CRYA 4YKIA 1O7TA 2PT2A 3PD9A 3TCGA 3MP8A 2QSXA 2F7AA 3GBBA 2NUVA 3K0VA 3RLFE 1N7XA 3B6WA 3KJTA 4ELOA 1M5CA 3K4UA 1I6BA 4F1YA 3PUWE 2V93A 3B6QA 4YB5A 3TUSA 4KCCA 1MM6A 3PPNA 3TTLA 1Y4TA 3PV0E 4F31B 4ZZAA 2ZYMA 2GFEA 4RJZA 1MY4A 1H3DA 5A5XA 1DMBA 3RUMA 4IO5A 1XVXA 2XD3A 3PUVE 2YJPA 1B9JA 3G3IA 4XKNA 5L9OA 3EPEA 1MPBA 3T93B 1NKXA 4Q5TA 3K6XA 5I2KA 4WEPA 2PVUA 3S9MC 4F2OA 1XT8A 4Q0CA 1UIVA 1JVYA 3DLNA 2R71A 3G3GA 2I3VA 3TCFA 2Q89A 1PEBA 3VLWA 2QS3A 3FUZA 1PBPA 2Z23A 3TMGA 1DPPA 3FJ7A 3K6WA 5AA2D 2DWHA 1H44A 1LAXA 3MVWA 4AB5A 1QKBA 3MQ9A 3S9NC 1SBPA 4QFOA 4GF8A 1MH4A 4JB7A 1FCKA 3OO9A 2B3FA 1GTKA 4I1DA 4F3GA 4OWDA 3O29A 5CMBA 1QULA 3MC2A 4R6KA 5J1DA 3G3FA 2ESNA 3IX1A 1IXGA 3OO7A 5FTHA 1BP5A 4G77A 2UXAA 2V3QA 2DWJA 3C36A 1LCTA 1J1NA 1MRPA 1VSOA 4IO4A 3S2VA 4IGTA 2ABHA 4KD5A 4OTEA 4EF1A 1EZPA 2RC9A 5BWJA 2R9JA 4XXUA 3W15C 5FHOA 2I58A 2I0CA 3KN8A 5ELVA 2I49A 2F7BA 4R2FA 5H8QA 4ZEFA 4YMAA 2DXRA 2XXWA 1MG1A 4GVOA 5JTYB 1GGGA 5CC2A 2XD2A 4BDQA 4X1DA 5HM4B 1SW5A 3FGSA 1ZU0A 4GFRA 4G8HA 4FEDA 5CM6A 3OOAA 4GL8A 3TTRA 4H8JA 5M2VA 3DELB 4LUBA 4C1UA 4KCDA 4FATA 3JYRA 1M5FA 4QHQA 2OCUA 3KN7A 3GLBA 5I59B 3U72A 2XXYA 4FEBA 4ZE9A 1M5EA 1POY1 4HTGA 4IO7A 4ISUA 1P1OA 4YKJA 3TTNA 3FASA 4Q8RA 1SYIA 2XXUA 1AMFA 5DT6A 1RKMA 2NOOA 3T9VA 2VP1A 4G8NA 2DOJA 3AXFA 1OIBA 3O28A 4DZ1A 4F3PA 4UACA 1S7YA 2DE2A 3IB2A 3TCHA 5EYFA 3W9VA 4HW8A 1NFTA 1GVCA 4ZDMA 3M3FA 1B05A 4H8IA 5ITOA 2X7QA 5F7VA 1TFAA 2M8CA 5I56B 5FHNA 5I2NB 4ND9A 3C35A 3FIRA 1SW2A 4LQ2A 2V3TA 1MQJA 1WODA 2VD3A 4LP2B 1SI0A 1TFDA 4PFYA 5I59A 3PMXA 2H99A 4ELPA 4LZ8A 4G68B 1IXHA 4BDOA 3IL1B 2XXIA 4OENA 4QF9A 3KEIA 1MPDA 4MBPA 4EF2A 3R6UA 3VXCA 4F3BA 3IK6B 2RC8A 2Y84A 3BFTA 4YKKA 2G29A 3RT6B 3CVGA 2IEEA 4GXSB 4RK2A 4H67A 5I56A 5I2NA 1WDNA 4H5FA 5EHSA 2A5TB 1MXUA 3MBPA 4Z0IA 4ZEDA 1N84A 1B3FA 3Q26A 1Z7ME 3VDFA 4G68A 3TQWA 3IJXB 5B7DA 4RPNA 1FQFA 3K1MA 4GWOA 4GQOA 4ZZEA 3SKPA 4OHNA 4P0GA 2FA7A 3T9HB 3FXQA 4U22A 1B5JA 1IIWA 1DTGA 3HN0A 4GL0A 4C1TA 4H0WA 4F1UA 1AL3A 1UTHB 1MY2A 3OSRA 1B51A 4OZ9A 3ZS6A 1ELJA 3PD8A 4YICA 5EHMA 4OETA 4P11A 4UA8A 4LATA 5B70A 2Y7RA 2DXYA 3K00A 1IQ7A 2ZNSA 3SDFA 1B3HA 1ZIUA 2A5TA 3QYTA 2XXTA 1USYH 3UP9A 2F35A 3MJNA 4FJPA 3C34A 1CB6A 4YAHX 4WEDA 1LB8A 2I6EA 2RF1A 3T9UA 1VFDA 2F78A 1H76A 3RQTA 4IY5A 4NF8A 1R6ZA 3D4GA 3SETA 3OMBA 1UTHA 3TYHA 1N3XA 3IORA 1NNFA 4KYSA 1EU8A 1B0LA 2QPQA 1PDAA 3TZAA 1RYOA 3O66A 1FQEA 2HAVA 3QUJA 3TODA 4MH5A 1SW4A 3PU5A 3M8UA 4ELQA 3O97A 1Y3NA 1UQWA 1SYHA 2HZKA 2QL3A 1USYE 2FYIA 1JEUA 1LSTA 2Z8FA 2I4CA 1RYXA 4KYEA 1AH5A 4PETA 3QUFA 4AB6A 3FXRA 2QRYA 3HSTA 3VVFA 1NMUA 3THIA 4NE4A 1I6QA 2PX1A 3RN8A 3FJGA 2I0BA 3KBRA 5H8NB 1IXCA 3PMVA 3PPPA 3F11A 3Q28A 4BDLA 3KOTA 4EXLA 2LAOA 4PFTA 3UIFA 2A5SA 2GRVA 1B46A 2GH9A 3FVOA 2GHBA 2YPNA 3TKDA 3PPRA 3TAJA 3PPQA 3R26A 4XIGQ 1R1NA 1FW0A 4E0XA 2QMWA 4JXIA 1XVYA 5H8FB 1F9BA 4RY1A 3D4CA 3A3UA 1ZKBA 1B5HA 3VFJA 2D21A 1SDXA 3EHTA 3LR1A 5AE4A 4ECFA 3SEYA 5K2XA 4TLLB 2AL5A 1LB9A 4R6HA 4EQ9A 3K1PA 1MXVA 2RC7A 1LFHA 1IXIA 4LVQA 5H8NA 1Q1KA 4GIZA 1SD3A 2Z8EA 3C4MA 1URGA 5DVFA 3KSJA 1A54A 1B7HA 4R74A 1B1XA 3V8XB 2OJTA 2OK2A 3VV5A 2PBWA 3PPOA 3TTMA 2NVUB 3B6TA 5AA4B 4ZEKA 3JV9A 1II5A 1LAHE 4POXA 5FHMA 3OO6A 5H8FA 2P2AA 4THIA 1ZMGA 1B1HA 4PQJA 1Y9UA 4ZE8A 5KDTB 2O51A 4GD5A 1DSNA 2H5YA 2O84X 4KYDA 3E9XA 2I48A 1IEJA 2P0SA 3L6GA 5AA3A 3N6UA 4OESA 3GBAA 3FATA 3G3JA 3EF7A 4L17A 2Q8JA 2FNCA 4RXLA 3H4ZA 4K3FA 4JWXA 1JETA 3IO6A 4KR5A 3KJ7A 4U2RA 3H3GA 1SVXB 4ZECA 3KOSA 1QUKA 4R72A 4FECA 4LA9A 4RPOA 1OVTA 2UVGA 4RYAA 3N26A 1H43A 5AA4A 3FVNA 3IJOB 5JK4A 3T66A 1LAFE 3FV1A 2H98A 5CMMA 4OQOA 3KGCA 1QJMA 4GXAA 4XTCQ 1B5IA 5TP9B 3U1OA 1JW5A 5KDTA 4O3CA 1FQCA 5CI5A 2KLFA 1Y1MA 3MWBA 3PUYE 2XX7A 5CMKA 3UN6A 2ZXTA 4YKPA 3LSLA 1NH7A 5I57B 3TFLA 1UTBB 4PP0A 4WXJA 3K1NA 3OO8A 3R7XA 3HHGA 4QFLA 3SERA 1B40A 2VD2A 3MP6A 1B2HA 2DVZA 1HSEA 1FQBA 1JEVA 2GHAA 1Q35A 1MDQA 3U8QA 5ICQA 1P1UA 4XKRA 3MAMA 1H45A 4NMYA 3DP8A 4G68C 4ZS9A 2DE4A 3M3KA 4Q30B 3CIJA 3QK6A 1B3EA 1POTA 3RY3A 3MPLA 5ITPA 4DCYA 5TP9A 5JTYA 4Z7EA 4ZEIA 4U23A 3S9EA 4NWCA 2AYSA 3GZGA 1PB9A 2O69A 4BDNA 4BDRA 3H03A 1M5BA 4OFJA 5I57A 2REGA 3Q25A 4U4XA 1UTBA 1MXXA 3IOTA 3OXNA 2ALUA 1Y3PA 4KFQA 4H1XA 3CSGA 3KG2A 1NNTA 3S9LC 4KQPA 3LC8A 1P1NA 3H06B 3TDJA 1OQHA 4F1VA 1IZ1A 4BDMA 3P7IA 2ONRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MPC A;  2O7U A;  1ZLQ A;  3HO7 A;  5CMC A;  5KZT A;  1N0T A;  2HFB A;  4AQ4 A;  1NNK A;  3OEN A;  3CG3 A;  2Z8D A;  2Q2C A;  1XHY A;  3WAF A;  2O1M A;  1LGB C;  1FTM A;  3O6I A;  1R9L A;  1YPN A;  3VLU A;  1Y3Q A;  1Y20 A;  3N6T A;  2DS9 A;  3EN3 A;  4JWY A;  2OZZ A;  4KI0 E;  1MQH A;  2NWJ A;  2UVJ A;  1Y4C A;  3KN3 A;  1QUI A;  3KZG A;  3CRB A;  1N04 A;  3K02 A;  4RK9 A;  4JSD A;  1MM7 A;  3O6H A;  4ESX A;  1JW1 A;  2X7P A;  1PB8 A;  4ZEB A;  1S9T A;  3MVX A;  5ISU A;  4X48 A;  2O68 A;  1D4N A;  2P1S A;  2Z22 A;  3QSL A;  2ZYO A;  4U1Z A;  1NH8 A;  3OEM A;  4EQB A;  4H6D A;  4LON B;  3HV1 A;  2ANJ A;  3ONM A;  4G4P A;  2G93 A;  3K6V A;  1ZBM A;  3ILT B;  4IO3 A;  5H8S A;  1HSL A;  2AL4 A;  2HCA A;  3O6G A;  3Q27 A;  3MZB A;  2F6P A;  1ATG A;  5DVJ A;  4N13 A;  4IO6 A;  2XXH A;  2QJE A;  4OEU A;  3MW0 A;  4HCY A;  4M4G A;  1FTJ A;  2PT1 A;  4FIM A;  4POW A;  3EQ1 A;  2F8D A;  1JNF A;  4PFW A;  5I58 B;  1OLA A;  3G3H A;  1A8F A;  3ZKL A;  3C33 A;  3IOV A;  3QXM A;  4U1O A;  3H6V A;  4GRK A;  4OVJ A;  1Y1Z A;  4X9T A;  3FD3 A;  3VLV A;  1ZJL A;  2ONK E;  1AIV A;  5DEX B;  4OXV A;  3E3K A;  3RGY A;  1EZO A;  2XXQ A;  1JVX A;  5FTI A;  3G3K A;  1MXY A;  3RT8 A;  4WKM A;  2XXV A;  3TTK A;  2X26 A;  1FQD A;  1MXW A;  5JEI A;  4G2Z A;  3IOW A;  1B6H A;  4ELR A;  3ZSF A;  1JW4 A;  1OVB A;  3MUQ A;  4BLA A;  3ILU B;  4N07 A;  3VE1 B;  2DP8 A;  2DWI A;  1D9Y A;  3HHF A;  3MPK A;  5I58 A;  3SES A;  3CG1 A;  1VFE A;  4QFP A;  4NWD A;  4NF6 B;  3BFU A;  2D5W A;  1DOT A;  4HS7 A;  2THI A;  4YB6 A;  5DEX A;  4NF4 B;  3WAE A;  5AA2 B;  3G7W A;  1P99 A;  1BKA A;  2Y7I A;  1O64 A;  3PMW A;  4MFI A;  1A7L A;  1QKA A;  3FVG A;  3IOU A;  4IO2 A;  2HAU A;  1O63 A;  1MQG A;  1DTZ A;  1VR5 A;  3H6U A;  4MLV A;  2E1S A;  4F22 A;  3TPA A;  3T96 B;  4TOZ A;  4MF3 A;  1PC3 A;  3LBS A;  4HCW A;  1I69 A;  3H7M A;  3QIM A;  4RA1 A;  1XC1 A;  2CZL A;  4QSD A;  4JWO A;  1IUD A;  1EZ9 A;  4EUO A;  1LLS A;  3USD A;  4NF6 A;  1BLF A;  1TWY A;  2DSF A;  4DLD A;  2E0S A;  1A99 A;  4MLQ A;  2B3B A;  3TEP A;  5I84 A;  4JSO A;  2IA4 A;  4NF4 A;  3OEL A;  5AA2 A;  1WVJ A;  3I3V A;  1GR2 A;  2Q9T A;  2DYX A;  2UYE A;  1I6A A;  3W9W A;  4R2B A;  2D3I A;  2RIN A;  1D9V A;  1FTL A;  3MZ9 A;  2CMO A;  2W7Y A;  1A8E A;  1BTJ A;  3ODB A;  4NF5 B;  2WKY A;  1PBQ A;  1B7Z A;  1NL5 A;  4F18 A;  1URS A;  3I6V A;  4OEV A;  2ZMB A;  1BIY A;  4F19 A;  5TPA B;  2NXO A;  4IB2 A;  3FVK A;  2V84 A;  1QUJ A;  2I3W A;  4U4S A;  3K2D A;  3CFX A;  4DIG A;  3RNN A;  1XOC A;  2V25 A;  1B4H A;  4H65 A;  4PFU A;  5H8Q B;  4N6P A;  3U92 A;  2Y7W A;  1A40 A;  1YCJ A;  2Q88 A;  4X1B A;  3V89 B;  2HZL A;  3H6W A;  3IR1 A;  3S4U A;  4LZ7 A;  1T0K A;  3HPI A;  4GLI A;  2OBG A;  2F36 A;  2ZNT A;  4FAJ A;  1OMP A;  3KSX A;  2QS2 A;  4DCX A;  3K01 A;  4O3A A;  3N94 A;  4NF5 A;  3RTF B;  1B52 A;  3IAZ A;  1US5 A;  1AOV A;  2PYY A;  5TPA A;  3UOR A;  1OQG A;  3BBR A;  3UA8 A;  1XS5 A;  4XKQ A;  5AA1 A;  5HPQ A;  1QW0 A;  3UK4 A;  1US4 A;  2ZNU A;  3LUY A;  3PUX E;  3OEK A;  2DWA A;  4YMB A;  3PUZ E;  5F1Q A;  3TEL A;  4JBZ A;  3BKI B;  1B0H A;  4QRZ A;  2F5X A;  2Q2A A;  4KHZ E;  3FV2 A;  4LQ5 A;  1GV8 A;  3SEU A;  1L5T A;  1MDP 1;  3ZKK A;  2VHA A;  2XXP A;  3GXA A;  4DDD A;  4M1V A;  3A09 A;  4QFN A;  3C31 A;  1LBC A;  1NNP A;  5KCJ B;  2O6A A;  4U21 A;  3K6U A;  1HSJ A;  4OER A;  4I8C A;  2DVC A;  5L9M A;  2V3U A;  4DE8 A;  1B3L A;  1N76 A;  4DXC A;  3SEV A;  3DP4 A;  4IGR A;  2F7C A;  4EXK A;  1Z7N E;  2OLB A;  2XX8 A;  3T22 A;  2HQ0 A;  2Y7P A;  2B65 A;  3KFM A;  3IO4 A;  4IY6 A;  4H5G A;  4YB7 A;  4YU0 A;  3U93 A;  4LZ5 A;  1MQD A;  3OSQ A;  1B7U A;  4GOT A;  1PB7 A;  2RCB A;  5HBC A;  1VE4 A;  2HXW A;  3PGF A;  1LAG E;  3VVD A;  3MP1 A;  4ESW A;  4NTL A;  4F2Q A;  1MS7 A;  3E4R A;  3O9P A;  3VXB A;  4NED A;  1S50 A;  3CR9 A;  2Y7K A;  4YZZ A;  2XXX A;  4QSE A;  5CBR A;  2XX9 A;  1B3G A;  3LSW A;  5KCJ A;  1IIT A;  3MVZ A;  3H6T A;  2REJ A;  2UVH A;  1LBB A;  1D3K A;  2PMS A;  2O1L A;  5DTB A;  5IKB A;  3OD7 A;  4R6Y A;  3MVY A;  1QVS A;  2AIX A;  2F97 A;  1N3W A;  3E13 X;  2ONS A;  2ZYN A;  1FQA A;  1YAE A;  5BUU A;  3UGW A;  1UIU A;  4EQ7 A;  4QFK A;  1TXF A;  2RCA A;  5LOM A;  2H25 A;  3T9X B;  2OWT A;  2XXR A;  1A55 A;  4RNS A;  1ZTY A;  3QAX A;  1LFG A;  3M3L A;  2F34 A;  4TLM B;  4TQU Q;  3Q29 A;  2DE3 A;  1P1Q A;  1ANF A;  3IB0 A;  1MXZ A;  4E0W A;  1M5D A;  1B4Z A;  4PE5 B;  5TU0 A;  2QS1 A;  4NF8 B;  3ECR A;  3LSX A;  2OWS A;  3FXU A;  3MZ1 A;  3DM0 A;  3CI8 A;  3SEW A;  2ZYK A;  2I4B A;  3VVE A;  1MY1 A;  2DQV A;  3U94 A;  2F6G A;  1JQF A;  1KWH A;  3RPW A;  1TT1 A;  1FTO A;  3V83 A;  2BJJ X;  1CE2 A;  3TQL A;  4XKP A;  3SEX A;  3LSF B;  4ONY A;  5K2Y A;  4R75 A;  2VGQ A;  3CSB A;  4R9G A;  4FOR A;  2QMX A;  4G8M A;  4P0I A;  2H4I A;  5H8H B;  4DXU A;  3V5A A;  4C0R A;  1DPE A;  4OFL A;  2HEU A;  2XHD A;  2VOZ A;  4R73 A;  4OFO A;  3EHS A;  3C32 A;  1R9Q A;  3L6H A;  5CBS A;  4EDP A;  1SQY A;  3A3C A;  3CFZ A;  2UVI A;  4I9D A;  3HCQ A;  3N5L A;  4DXB A;  2R6G E;  4R9F A;  4F3S A;  1B58 A;  3I5O A;  4KPT A;  5ICT A;  1OLC A;  3CFL A;  4FE8 A;  1MY3 A;  1FTK A;  3DP6 A;  4F39 A;  4I62 A;  2O7I A;  5IAI A;  3JZJ A;  4F29 A;  4QSC A;  1LFI A;  1B32 A;  3IB1 A;  5L9S A;  1P1W A;  1SW1 A;  1LCF A;  3FJM A;  1YTV A;  1MH3 A;  1MY0 A;  1EH3 A;  1SI1 A;  4OMB A;  5DYH A;  1MQI A;  5H8H A;  5DVI A;  4OYV A;  4JDF A;  2RKM A;  5L8D A;  1URD A;  4O3B A;  3O2A A;  5A5X B;  3B7D A;  2H9B A;  2UYF A;  2YLN A;  3RTW B;  3EHU A;  3FZV A;  1N7W A;  5I2K B;  2QS4 A;  3C9H A;  5CRY A;  4YKI A;  1O7T A;  2PT2 A;  3PD9 A;  3TCG A;  3MP8 A;  2QSX A;  2F7A A;  3GBB A;  2NUV A;  3K0V A;  3RLF E;  1N7X A;  3B6W A;  3KJT A;  4ELO A;  1M5C A;  3K4U A;  1I6B A;  4F1Y A;  3PUW E;  2V93 A;  3B6Q A;  4YB5 A;  3TUS A;  4KCC A;  1MM6 A;  3PPN A;  3TTL A;  1Y4T A;  3PV0 E;  4F31 B;  4ZZA A;  2ZYM A;  2GFE A;  4RJZ A;  1MY4 A;  1H3D A;  5A5X A;  1DMB A;  3RUM A;  4IO5 A;  1XVX A;  2XD3 A;  3PUV E;  2YJP A;  1B9J A;  3G3I A;  4XKN A;  5L9O A;  3EPE A;  1MPB A;  3T93 B;  1NKX A;  4Q5T A;  3K6X A;  5I2K A;  4WEP A;  2PVU A;  3S9M C;  4F2O A;  1XT8 A;  4Q0C A;  1UIV A;  1JVY A;  3DLN A;  2R71 A;  3G3G A;  2I3V A;  3TCF A;  2Q89 A;  1PEB A;  3VLW A;  2QS3 A;  3FUZ A;  1PBP A;  2Z23 A;  3TMG A;  1DPP A;  3FJ7 A;  3K6W A;  5AA2 D;  2DWH A;  1H44 A;  1LAX A;  3MVW A;  4AB5 A;  1QKB A;  3MQ9 A;  3S9N C;  1SBP A;  4QFO A;  4GF8 A;  1MH4 A;  4JB7 A;  1FCK A;  3OO9 A;  2B3F A;  1GTK A;  4I1D A;  4F3G A;  4OWD A;  3O29 A;  5CMB A;  1QUL A;  3MC2 A;  4R6K A;  5J1D A;  3G3F A;  2ESN A;  3IX1 A;  1IXG A;  3OO7 A;  5FTH A;  1BP5 A;  4G77 A;  2UXA A;  2V3Q A;  2DWJ A;  3C36 A;  1LCT A;  1J1N A;  1MRP A;  1VSO A;  4IO4 A;  3S2V A;  4IGT A;  2ABH A;  4KD5 A;  4OTE A;  4EF1 A;  1EZP A;  2RC9 A;  5BWJ A;  2R9J A;  4XXU A;  3W15 C;  5FHO A;  2I58 A;  2I0C A;  3KN8 A;  5ELV A;  2I49 A;  2F7B A;  4R2F A;  5H8Q A;  4ZEF A;  4YMA A;  2DXR A;  2XXW A;  1MG1 A;  4GVO A;  5JTY B;  1GGG A;  5CC2 A;  2XD2 A;  4BDQ A;  4X1D A;  5HM4 B;  1SW5 A;  3FGS A;  1ZU0 A;  4GFR A;  4G8H A;  4FED A;  5CM6 A;  3OOA A;  4GL8 A;  3TTR A;  4H8J A;  5M2V A;  3DEL B;  4LUB A;  4C1U A;  4KCD A;  4FAT A;  3JYR A;  1M5F A;  4QHQ A;  2OCU A;  3KN7 A;  3GLB A;  5I59 B;  3U72 A;  2XXY A;  4FEB A;  4ZE9 A;  1M5E A;  1POY 1;  4HTG A;  4IO7 A;  4ISU A;  1P1O A;  4YKJ A;  3TTN A;  3FAS A;  4Q8R A;  1SYI A;  2XXU A;  1AMF A;  5DT6 A;  1RKM A;  2NOO A;  3T9V A;  2VP1 A;  4G8N A;  2DOJ A;  3AXF A;  1OIB A;  3O28 A;  4DZ1 A;  4F3P A;  4UAC A;  1S7Y A;  2DE2 A;  3IB2 A;  3TCH A;  5EYF A;  3W9V A;  4HW8 A;  1NFT A;  1GVC A;  4ZDM A;  3M3F A;  1B05 A;  4H8I A;  5ITO A;  2X7Q A;  5F7V A;  1TFA A;  2M8C A;  5I56 B;  5FHN A;  5I2N B;  4ND9 A;  3C35 A;  3FIR A;  1SW2 A;  4LQ2 A;  2V3T A;  1MQJ A;  1WOD A;  2VD3 A;  4LP2 B;  1SI0 A;  1TFD A;  4PFY A;  5I59 A;  3PMX A;  2H99 A;  4ELP A;  4LZ8 A;  4G68 B;  1IXH A;  4BDO A;  3IL1 B;  2XXI A;  4OEN A;  4QF9 A;  3KEI A;  1MPD A;  4MBP A;  4EF2 A;  3R6U A;  3VXC A;  4F3B A;  3IK6 B;  2RC8 A;  2Y84 A;  3BFT A;  4YKK A;  2G29 A;  3RT6 B;  3CVG A;  2IEE A;  4GXS B;  4RK2 A;  4H67 A;  5I56 A;  5I2N A;  1WDN A;  4H5F A;  5EHS A;  2A5T B;  1MXU A;  3MBP A;  4Z0I A;  4ZED A;  1N84 A;  1B3F A;  3Q26 A;  1Z7M E;  3VDF A;  4G68 A;  3TQW A;  3IJX B;  5B7D A;  4RPN A;  1FQF A;  3K1M A;  4GWO A;  4GQO A;  4ZZE A;  3SKP A;  4OHN A;  4P0G A;  2FA7 A;  3T9H B;  3FXQ A;  4U22 A;  1B5J A;  1IIW A;  1DTG A;  3HN0 A;  4GL0 A;  4C1T A;  4H0W A;  4F1U A;  1AL3 A;  1UTH B;  1MY2 A;  3OSR A;  1B51 A;  4OZ9 A;  3ZS6 A;  1ELJ A;  3PD8 A;  4YIC A;  5EHM A;  4OET A;  4P11 A;  4UA8 A;  4LAT A;  5B70 A;  2Y7R A;  2DXY A;  3K00 A;  1IQ7 A;  2ZNS A;  3SDF A;  1B3H A;  1ZIU A;  2A5T A;  3QYT A;  2XXT A;  1USY H;  3UP9 A;  2F35 A;  3MJN A;  4FJP A;  3C34 A;  1CB6 A;  4YAH X;  4WED A;  1LB8 A;  2I6E A;  2RF1 A;  3T9U A;  1VFD A;  2F78 A;  1H76 A;  3RQT A;  4IY5 A;  4NF8 A;  1R6Z A;  3D4G A;  3SET A;  3OMB A;  1UTH A;  3TYH A;  1N3X A;  3IOR A;  1NNF A;  4KYS A;  1EU8 A;  1B0L A;  2QPQ A;  1PDA A;  3TZA A;  1RYO A;  3O66 A;  1FQE A;  2HAV A;  3QUJ A;  3TOD A;  4MH5 A;  1SW4 A;  3PU5 A;  3M8U A;  4ELQ A;  3O97 A;  1Y3N A;  1UQW A;  1SYH A;  2HZK A;  2QL3 A;  1USY E;  2FYI A;  1JEU A;  1LST A;  2Z8F A;  2I4C A;  1RYX A;  4KYE A;  1AH5 A;  4PET A;  3QUF A;  4AB6 A;  3FXR A;  2QRY A;  3HST A;  3VVF A;  1NMU A;  3THI A;  4NE4 A;  1I6Q A;  2PX1 A;  3RN8 A;  3FJG A;  2I0B A;  3KBR A;  5H8N B;  1IXC A;  3PMV A;  3PPP A;  3F11 A;  3Q28 A;  4BDL A;  3KOT A;  4EXL A;  2LAO A;  4PFT A;  3UIF A;  2A5S A;  2GRV A;  1B46 A;  2GH9 A;  3FVO A;  2GHB A;  2YPN A;  3TKD A;  3PPR A;  3TAJ A;  3PPQ A;  3R26 A;  4XIG Q;  1R1N A;  1FW0 A;  4E0X A;  2QMW A;  4JXI A;  1XVY A;  5H8F B;  1F9B A;  4RY1 A;  3D4C A;  3A3U A;  1ZKB A;  1B5H A;  3VFJ A;  2D21 A;  1SDX A;  3EHT A;  3LR1 A;  5AE4 A;  4ECF A;  3SEY A;  5K2X A;  4TLL B;  2AL5 A;  1LB9 A;  4R6H A;  4EQ9 A;  3K1P A;  1MXV A;  2RC7 A;  1LFH A;  1IXI A;  4LVQ A;  5H8N A;  1Q1K A;  4GIZ A;  1SD3 A;  2Z8E A;  3C4M A;  1URG A;  5DVF A;  3KSJ A;  1A54 A;  1B7H A;  4R74 A;  1B1X A;  3V8X B;  2OJT A;  2OK2 A;  3VV5 A;  2PBW A;  3PPO A;  3TTM A;  2NVU B;  3B6T A;  5AA4 B;  4ZEK A;  3JV9 A;  1II5 A;  1LAH E;  4POX A;  5FHM A;  3OO6 A;  5H8F A;  2P2A A;  4THI A;  1ZMG A;  1B1H A;  4PQJ A;  1Y9U A;  4ZE8 A;  5KDT B;  2O51 A;  4GD5 A;  1DSN A;  2H5Y A;  2O84 X;  4KYD A;  3E9X A;  2I48 A;  1IEJ A;  2P0S A;  3L6G A;  5AA3 A;  3N6U A;  4OES A;  3GBA A;  3FAT A;  3G3J A;  3EF7 A;  4L17 A;  2Q8J A;  2FNC A;  4RXL A;  3H4Z A;  4K3F A;  4JWX A;  1JET A;  3IO6 A;  4KR5 A;  3KJ7 A;  4U2R A;  3H3G A;  1SVX B;  4ZEC A;  3KOS A;  1QUK A;  4R72 A;  4FEC A;  4LA9 A;  4RPO A;  1OVT A;  2UVG A;  4RYA A;  3N26 A;  1H43 A;  5AA4 A;  3FVN A;  3IJO B;  5JK4 A;  3T66 A;  1LAF E;  3FV1 A;  2H98 A;  5CMM A;  4OQO A;  3KGC A;  1QJM A;  4GXA A;  4XTC Q;  1B5I A;  5TP9 B;  3U1O A;  1JW5 A;  5KDT A;  4O3C A;  1FQC A;  5CI5 A;  2KLF A;  1Y1M A;  3MWB A;  3PUY E;  2XX7 A;  5CMK A;  3UN6 A;  2ZXT A;  4YKP A;  3LSL A;  1NH7 A;  5I57 B;  3TFL A;  1UTB B;  4PP0 A;  4WXJ A;  3K1N A;  3OO8 A;  3R7X A;  3HHG A;  4QFL A;  3SER A;  1B40 A;  2VD2 A;  3MP6 A;  1B2H A;  2DVZ A;  1HSE A;  1FQB A;  1JEV A;  2GHA A;  1Q35 A;  1MDQ A;  3U8Q A;  5ICQ A;  1P1U A;  4XKR A;  3MAM A;  1H45 A;  4NMY A;  3DP8 A;  4G68 C;  4ZS9 A;  2DE4 A;  3M3K A;  4Q30 B;  3CIJ A;  3QK6 A;  1B3E A;  1POT A;  3RY3 A;  3MPL A;  5ITP A;  4DCY A;  5TP9 A;  5JTY A;  4Z7E A;  4ZEI A;  4U23 A;  3S9E A;  4NWC A;  2AYS A;  3GZG A;  1PB9 A;  2O69 A;  4BDN A;  4BDR A;  3H03 A;  1M5B A;  4OFJ A;  5I57 A;  2REG A;  3Q25 A;  4U4X A;  1UTB A;  1MXX A;  3IOT A;  3OXN A;  2ALU A;  1Y3P A;  4KFQ A;  4H1X A;  3CSG A;  3KG2 A;  1NNT A;  3S9L C;  4KQP A;  3LC8 A;  1P1N A;  3H06 B;  3TDJ A;  1OQH A;  4F1V A;  1IZ1 A;  4BDM A;  3P7I A;  2ONR A; 
#chains in the Genus database with same CATH topology
 1MPC A;  4OVR A;  2O7U A;  1ZLQ A;  2WEF A;  4NHB A;  3HO7 A;  5CMC A;  5KZT A;  4GWY A;  1N0T A;  2HFB A;  4GWU A;  4AQ4 A;  1NNK A;  3OEN A;  4P8B A;  3CG3 A;  2Z8D A;  2Q2C A;  1XHY A;  4GWZ A;  3WAF A;  2O1M A;  1LGB C;  1FTM A;  3O6I A;  1R9L A;  1YPN A;  1FTA A;  3VLU A;  1Y20 A;  1Y3Q A;  3N6T A;  2DS9 A;  3EN3 A;  4JWY A;  2OZZ A;  4KI0 E;  1MQH A;  2NWJ A;  2UVJ A;  1Y4C A;  3KN3 A;  1QUI A;  4OAN A;  3KZG A;  3CRB A;  1N04 A;  3K02 A;  4RK9 A;  4JSD A;  1MM7 A;  1LBW A;  3O6H A;  5IZ3 A;  4ESX A;  1JW1 A;  3EKI A;  5ET6 A;  4PBQ A;  2X7P A;  1PB8 A;  4ZEB A;  1S9T A;  3MVX A;  5ISU A;  4X48 A;  2O68 A;  1D4N A;  2P1S A;  2Z22 A;  3QSL A;  2ZYO A;  4U1Z A;  1NH8 A;  3OEM A;  4EQB A;  3RYD A;  4H6D A;  4LON B;  3HV1 A;  2ANJ A;  1KA1 A;  3ONM A;  4LN5 A;  4G4P A;  2G93 A;  3K6V A;  1ZBM A;  5IM2 A;  3ILT B;  4IO3 A;  5H8S A;  1HSL A;  2AL4 A;  2HCA A;  3O6G A;  3Q27 A;  3MZB A;  4XEQ A;  2F6P A;  1ATG A;  5DVJ A;  4N13 A;  4IO6 A;  2XXH A;  2QJE A;  4OEU A;  3MW0 A;  4HCY A;  3LV0 A;  4M4G A;  4PGN A;  1FTJ A;  4PAI A;  2PT1 A;  4FIM A;  4POW A;  3EQ1 A;  4DI3 D;  2F8D A;  1JNF A;  1KA0 A;  4PFW A;  1DCU A;  5I58 B;  4PFB A;  1OLA A;  3G3H A;  1A8F A;  3ZKL A;  3C33 A;  3IOV A;  4AS5 A;  3QXM A;  4U1O A;  3H6V A;  4H46 A;  5I7I A;  2WYK A;  5IZ1 A;  4GRK A;  4OVJ A;  1Y1Z A;  4X9T A;  3FD3 A;  3VLV A;  1ZJL A;  2ONK E;  4NX1 A;  1AIV A;  1FJ6 A;  5DEX B;  1NV1 A;  4N81 A;  4OXV A;  3E3K A;  3RGY A;  1EZO A;  2XXQ A;  1JVX A;  5FTI A;  1BK4 A;  3G3K A;  1MXY A;  3RT8 A;  2PCR A;  4WKM A;  2XXV A;  3TTK A;  2X26 A;  1FQD A;  4P47 A;  1MXW A;  5JEI A;  4G2Z A;  3IOW A;  1B6H A;  4N8G A;  4ELR A;  3ZSF A;  1JW4 A;  1OVB A;  3MUQ A;  4BLA A;  3ILU B;  4N07 A;  3VE1 B;  2DP8 A;  2DWI A;  1D9Y A;  3HHF A;  3MPK A;  5I58 A;  1FBC A;  3SES A;  1NUX A;  3CG1 A;  1VFE A;  5J16 A;  4QFP A;  4NWD A;  4NF6 B;  3QMF A;  3BFU A;  2D5W A;  1DOT A;  4HS7 A;  2THI A;  4YB6 A;  5DEX A;  4NF4 B;  2BJI A;  3WAE A;  5AA2 B;  1FPB A;  3G7W A;  1P99 A;  1BKA A;  2Y7I A;  1O64 A;  3PMW A;  4MFI A;  1NV6 A;  1A7L A;  1QKA A;  3FVG A;  3IOU A;  4IO2 A;  2HAU A;  5FBP A;  1O63 A;  1MQG A;  1DTZ A;  1VR5 A;  3H6U A;  3BIG A;  4MLV A;  5IZZ A;  2E1S A;  3FBP A;  4F22 A;  3TPA A;  2Q8M A;  3T96 B;  4TOZ A;  4MF3 A;  3LBS A;  1PC3 A;  4GX3 A;  4HCW A;  1DK4 A;  1I69 A;  3H7M A;  4DI4 B;  3QIM A;  1NV2 A;  4RA1 A;  1XC1 A;  2CZL A;  2R8T A;  4QSD A;  4JWO A;  1IUD A;  4PAF A;  1EZ9 A;  2KR0 A;  4EUO A;  1LLS A;  4NF6 A;  1BLF A;  3USD A;  1TWY A;  1KZ8 A;  2DSF A;  4DLD A;  2E0S A;  1A99 A;  4MLQ A;  1IMC A;  2B3B A;  3TEP A;  5I84 A;  4JSO A;  2IA4 A;  4NF4 A;  3OEL A;  5AA2 A;  1WVJ A;  3I3V A;  1GR2 A;  2Q9T A;  2DYX A;  2UYE A;  1I6A A;  3W9W A;  4R2B A;  2D3I A;  2RIN A;  1FBD A;  5I5P A;  1FPJ A;  1D9V A;  1FTL A;  3MZ9 A;  2CEX A;  2CMO A;  2W7Y A;  1A8E A;  1BTJ A;  3ODB A;  4NF5 B;  4N6D A;  4XF5 A;  2WKY A;  1PBQ A;  1B7Z A;  1NL5 A;  4F18 A;  1URS A;  3I6V A;  4OEV A;  2ZMB A;  1BIY A;  4NN3 A;  4F19 A;  5TPA B;  2NXO A;  4IB2 A;  3FVK A;  2V84 A;  1AWB A;  2ZZW A;  1QUJ A;  2I3W A;  4U4S A;  3K2D A;  3CFX A;  4DIG A;  3RNN A;  1XOC A;  2V25 A;  1B4H A;  4H65 A;  4PFU A;  4HE1 A;  5H8Q B;  4N6P A;  3U92 A;  2Y7W A;  1A40 A;  1YCJ A;  2Q88 A;  4X1B A;  3V89 B;  2F3D A;  2HZL A;  3H6W A;  1QGX A;  3IR1 A;  3S4U A;  4LZ7 A;  1T0K A;  3HPI A;  4GLI A;  4O94 A;  2OBG A;  2F36 A;  1LBX A;  2ZZV A;  2ZNT A;  2Y5K A;  4FAJ A;  1OMP A;  3KSX A;  2QS2 A;  2FIX A;  4DCX A;  3K01 A;  4O3A A;  3N94 A;  1FBH A;  1NV3 A;  4NF5 A;  3RTF B;  4MEV A;  1B52 A;  3IAZ A;  1US5 A;  1AOV A;  3KC1 A;  2PYY A;  5TPA A;  3UOR A;  1SPI A;  1OQG A;  3BBR A;  3UA8 A;  1FSA A;  1XS5 A;  4XKQ A;  5AA1 A;  5HPQ A;  1QW0 A;  3UK4 A;  1US4 A;  2ZNU A;  3LUY A;  4I3Y A;  2XWK A;  3HFU A;  4JVC A;  3PUX E;  1VDW A;  3OEK A;  2DWA A;  4YMB A;  3PUZ E;  5F1Q A;  3TEL A;  4JBZ A;  3BKI B;  1FBP A;  1B0H A;  4QRZ A;  2F5X A;  2Q2A A;  4KHZ E;  3FV2 A;  4LQ5 A;  1GV8 A;  3SEU A;  3KC0 A;  1L5T A;  1MDP 1;  4N4U A;  4QXD A;  3ZKK A;  2VHA A;  2XXP A;  3GXA A;  4DDD A;  4M1V A;  3A09 A;  4QFN A;  3C31 A;  1LBC A;  1NNP A;  2XA5 A;  5KCJ B;  2O6A A;  2QFL A;  4U21 A;  3K6U A;  1HSJ A;  4OER A;  4I8C A;  2DVC A;  2VT5 A;  5L9M A;  2V3U A;  4DE8 A;  4GX4 A;  1B3L A;  1N76 A;  4DXC A;  3SEV A;  3DP4 A;  4IGR A;  2F7C A;  1NV4 A;  4EXK A;  1Z7N E;  2OLB A;  5EYH A;  2XX8 A;  3T22 A;  2HQ0 A;  2Y7P A;  2B65 A;  3KFM A;  3IO4 A;  4IY6 A;  4H5G A;  4PCD A;  5LDZ A;  4YB7 A;  4YU0 A;  3U93 A;  4LZ5 A;  1MQD A;  3OSQ A;  1B7U A;  3MYU A;  4GOT A;  1PB7 A;  2RCB A;  3CHG A;  5HBC A;  1VE4 A;  2HXW A;  3PGF A;  1LAG E;  3VVD A;  3MP1 A;  4ESW A;  4NTL A;  4F2Q A;  1MS7 A;  3E4R A;  3O9P A;  3VXB A;  2HXR A;  4NED A;  4PDD A;  1S50 A;  3CR9 A;  2Y7K A;  4YZZ A;  1EYI A;  2XXX A;  4QSE A;  5CBR A;  1IMF A;  2XX9 A;  1B3G A;  3LSW A;  5KCJ A;  1IIT A;  3MVZ A;  4AS4 A;  3H6T A;  2REJ A;  2UVH A;  1LBB A;  1D3K A;  2PMS A;  2O1L A;  5DTB A;  5IKB A;  3LUZ A;  4NF0 A;  3OD7 A;  4N6K A;  4R6Y A;  2ZZX A;  3MVY A;  1QVS A;  2AIX A;  2F97 A;  1N3W A;  3E13 X;  2ONS A;  3SZP A;  4NGU A;  2ZYN A;  1FQA A;  1YAE A;  5A5L A;  5BUU A;  3UGW A;  1IMA A;  2ONR A;  1UIU A;  4EQ7 A;  4QFK A;  1TXF A;  1IMB A;  2RCA A;  5LOM A;  2H25 A;  3T9X B;  2OWT A;  2XXR A;  3NOH A;  1A55 A;  4RNS A;  1ZTY A;  3QAX A;  1LFG A;  3M3L A;  4GWX A;  1YZ0 A;  2F34 A;  4TLM B;  4TQU Q;  2DDK A;  3Q29 A;  2DE3 A;  1P1Q A;  1ANF A;  3IB0 A;  1MXZ A;  3E78 A;  4E0W A;  1M5D A;  1B4Z A;  4PE5 B;  5TU0 A;  2QS1 A;  4NF8 B;  3ECR A;  3LSX A;  1FPE A;  4OVS A;  2OWS A;  1NV5 A;  2Y5L A;  3FXU A;  3MZ1 A;  3DM0 A;  3CI8 A;  3SEW A;  2ZYK A;  1FRP A;  2I4B A;  3VVE A;  1MY1 A;  1YYZ A;  2DQV A;  3U94 A;  2F6G A;  1JQF A;  1KWH A;  3RPW A;  1TT1 A;  1FTO A;  3V83 A;  2BJJ X;  1CE2 A;  3A29 A;  3TQL A;  4XKP A;  3SEX A;  3LSF B;  4ONY A;  5K2Y A;  4R75 A;  2VGQ A;  3CSB A;  4R9G A;  4FOR A;  2QMX A;  4G8M A;  4P0I A;  2H4I A;  5H8H B;  4DXU A;  3V5A A;  4XFE A;  1NI9 A;  4C0R A;  1DPE A;  4OFL A;  2HEU A;  2XHD A;  2VOZ A;  2FHY A;  4R73 A;  4OFO A;  3EHS A;  3GYY A;  2HHM A;  3C32 A;  4OVT A;  1R9Q A;  3L6H A;  5CBS A;  4EDP A;  1SQY A;  3A3C A;  3CFZ A;  2UVI A;  4I9D A;  3HCQ A;  3N5L A;  4DXB A;  2R6G E;  4R9F A;  4F3S A;  1B58 A;  1EYK A;  3I5O A;  4KPT A;  5ICT A;  1NUW A;  4PFR A;  1OLC A;  3CFL A;  4FE8 A;  1MY3 A;  5IGA A;  1FTK A;  2WBB A;  4MX6 A;  3DP6 A;  4F39 A;  4I62 A;  2FBP A;  2O7I A;  5IAI A;  3JZJ A;  4F29 A;  4QSC A;  1LFI A;  1B32 A;  3IB1 A;  5L9S A;  1P1W A;  1SW1 A;  1LCF A;  2OWZ A;  3FJM A;  4G61 A;  1YTV A;  2V4C A;  1MH3 A;  4MNP A;  1MY0 A;  1EH3 A;  1SI1 A;  4OMB A;  5DYH A;  1MQI A;  5H8H A;  5DVI A;  3E79 A;  4GBW A;  4OYV A;  4JDF A;  2FIE A;  2RKM A;  5L8D A;  1URD A;  4O3B A;  3O2A A;  4X04 A;  1K9Y A;  5A5X B;  3B7D A;  2H9B A;  2UYF A;  2VPO A;  2WBD A;  2YLN A;  3RTW B;  3U65 A;  3EHU A;  3FZV A;  1N7W A;  1RDY A;  5I2K B;  2QS4 A;  3C9H A;  5CRY A;  4YKI A;  1O7T A;  2PT2 A;  3PD9 A;  3IFA A;  3TCG A;  3MP8 A;  4IR8 A;  2QSX A;  2F7A A;  3GBB A;  2NUV A;  3K0V A;  4X8R A;  3RLF E;  1N7X A;  5F24 A;  3B6W A;  3KJT A;  4ELO A;  1M5C A;  3K4U A;  4O8M A;  1I6B A;  1CNQ A;  4F1Y A;  3PUW E;  2V93 A;  3B6Q A;  4YB5 A;  3TUS A;  4KCC A;  1MM6 A;  3PPN A;  3TTL A;  1Y4T A;  4GBV A;  3PV0 E;  4F31 B;  4ZZA A;  5ET7 A;  2ZYM A;  2GFE A;  1INP A;  4RJZ A;  1MY4 A;  1H3D A;  2CZK A;  4MCO A;  5A5X A;  1DMB A;  3RUM A;  4IO5 A;  1XVX A;  2XD3 A;  3PUV E;  1FPI A;  2YJP A;  1B9J A;  3G3I A;  4XKN A;  5L9O A;  3EPE A;  1MPB A;  3T93 B;  1NKX A;  4Q5T A;  3K6X A;  5I2K A;  4WEP A;  2PVU A;  3S9M C;  4F2O A;  1XT8 A;  4Q0C A;  1UIV A;  3ISP A;  1JVY A;  3DLN A;  2PFY A;  2R71 A;  3G3G A;  4PF8 A;  2I3V A;  3TCF A;  2Q89 A;  1PEB A;  4MMP A;  3VLW A;  2QS3 A;  3FUZ A;  4HE2 A;  1FPL A;  1PBP A;  2Z23 A;  3TMG A;  1DPP A;  3FJ7 A;  2PFZ A;  3K6W A;  5AA2 D;  2DWH A;  1H44 A;  1LAX A;  3MVW A;  4OVQ A;  4AB5 A;  1QKB A;  3MQ9 A;  3S9N C;  1SBP A;  4QFO A;  4GF8 A;  1MH4 A;  4JB7 A;  1FCK A;  3OO9 A;  2B3F A;  1GTK A;  4I1D A;  4F3G A;  4OWD A;  3O29 A;  5CMB A;  4PAK A;  1QUL A;  3MC2 A;  3PTY A;  4R6K A;  5J1D A;  3G3F A;  2ESN A;  1RDX A;  3IX1 A;  1IXG A;  3OO7 A;  5FTH A;  1BP5 A;  4G77 A;  1EYJ A;  2UXA A;  2V3Q A;  2DWJ A;  1FPG A;  3C36 A;  1LCT A;  1NUY A;  1J1N A;  1MRP A;  3BIH A;  1VSO A;  4IO4 A;  3S2V A;  4IGT A;  2ABH A;  4KD5 A;  4OTE A;  4EF1 A;  1EZP A;  2RC9 A;  5BWJ A;  2R9J A;  4XXU A;  3W15 C;  5FHO A;  2I58 A;  2I0C A;  3KN8 A;  5ELV A;  2I49 A;  2F7B A;  1DBZ A;  4R2F A;  5H8Q A;  4ZEF A;  4YMA A;  2DXR A;  2XXW A;  1MG1 A;  4GVO A;  5JTY B;  3IFC A;  1GGG A;  5CC2 A;  2XD2 A;  4BDQ A;  4X1D A;  5HM4 B;  2GQ1 A;  1SW5 A;  3FGS A;  1ZU0 A;  4GFR A;  4G8H A;  4FED A;  5CM6 A;  3OOA A;  4GL8 A;  3TTR A;  4H8J A;  5M2V A;  3DEL B;  4I40 A;  4LUB A;  4N17 A;  4C1U A;  4MAG A;  4KCD A;  4FAT A;  3JYR A;  1M5F A;  4QHQ A;  2OCU A;  3KN7 A;  3GLB A;  5I59 B;  3U72 A;  2XXY A;  4FEB A;  4ZE9 A;  1M5E A;  1POY 1;  4HTG A;  4IO7 A;  4ISU A;  1P1O A;  4YKJ A;  3TTN A;  3FAS A;  4Q8R A;  1SYI A;  2XXU A;  1AMF A;  4N91 A;  1FBG A;  5DT6 A;  2FVZ A;  1RKM A;  2NOO A;  3T9V A;  2VP1 A;  2MKZ A;  4G8N A;  2DOJ A;  3AXF A;  4NAP A;  1OIB A;  3ROJ A;  1K9Z A;  4QBA A;  3O28 A;  4DZ1 A;  4F3P A;  4UAC A;  1FBF A;  1S7Y A;  2DE2 A;  3IB2 A;  3TCH A;  3D1R A;  5EYF A;  3W9V A;  4HW8 A;  2WX9 A;  1NFT A;  1GVC A;  4ZDM A;  3M3F A;  1B05 A;  4H8I A;  5ITO A;  2X7Q A;  5F7V A;  1TFA A;  2M8C A;  5I56 B;  5FHN A;  5I2N B;  5I3S A;  4ND9 A;  3C35 A;  3FIR A;  1SW2 A;  3B8B A;  4LQ2 A;  2V3T A;  1FJ9 A;  1MQJ A;  1WOD A;  2VD3 A;  4LP2 B;  1JP4 A;  1SI0 A;  1TFD A;  4PFY A;  5I59 A;  3PMX A;  2H99 A;  4ELP A;  4LZ8 A;  4G68 B;  1FBE A;  1IXH A;  4BDO A;  3IL1 B;  2XXI A;  4OA4 A;  4OEN A;  1XI6 A;  4QF9 A;  3KEI A;  1LBV A;  1MPD A;  4MBP A;  4EF2 A;  3R6U A;  3VXC A;  4F3B A;  3IK6 B;  5EQ7 A;  2RC8 A;  2Y84 A;  3BFT A;  4YKK A;  2G29 A;  3RT6 B;  3CVG A;  4O7M A;  2IEE A;  4GXS B;  4RK2 A;  4H67 A;  5I56 A;  2XWI A;  5I2N A;  1WDN A;  4H5F A;  5EHS A;  2A5T B;  1MXU A;  2WYP A;  3MBP A;  4Z0I A;  4ZED A;  1N84 A;  2CZI A;  1B3F A;  3Q26 A;  5T3J A;  1Z7M E;  3VDF A;  4G68 A;  3TQW A;  3IJX B;  5B7D A;  4RPN A;  4NG7 A;  1IME A;  1FQF A;  3K1M A;  4GWO A;  4GQO A;  4P56 A;  4ZZE A;  4O7I A;  4OHN A;  4P0G A;  2FA7 A;  3SKP A;  3T9H B;  3FXQ A;  4U22 A;  1B5J A;  1IIW A;  1DTG A;  3HN0 A;  4GL0 A;  4C1T A;  4H0W A;  4PDH A;  4F1U A;  5EQA A;  4JVI A;  1AL3 A;  3T1B A;  1UTH B;  1MY2 A;  3OSR A;  1B51 A;  4OZ9 A;  1D9Q A;  3ZS6 A;  1ELJ A;  3PD8 A;  4YIC A;  5EHM A;  4OET A;  4P11 A;  4UA8 A;  3RPL B;  4LAT A;  5DW8 A;  5B70 A;  2Y7R A;  2DXY A;  1G0H A;  2CZH A;  3K00 A;  1IQ7 A;  2ZNS A;  2HPG A;  3SDF A;  1B3H A;  2L5V A;  1ZIU A;  2A5T A;  3QYT A;  2XXT A;  1USY H;  3UP9 A;  2F35 A;  3MJN A;  4FJP A;  4P3L A;  3C34 A;  1CB6 A;  4YAH X;  1NUZ A;  4PBH A;  4WED A;  1LB8 A;  2I6E A;  2RF1 A;  3T9U A;  1VFD A;  2F78 A;  5LTC A;  1H76 A;  3RQT A;  4IY5 A;  4NF8 A;  1R6Z A;  3D4G A;  1RDZ A;  3SET A;  3OMB A;  1UTH A;  3TYH A;  1N3X A;  2B4L A;  3IOR A;  4PGP A;  1NNF A;  4KYS A;  1EU8 A;  1B0L A;  2CEY A;  2QPQ A;  1PDA A;  3TZA A;  1G0I A;  3RPL A;  1RYO A;  3O66 A;  1FQE A;  2HAV A;  3QUJ A;  3TOD A;  4MH5 A;  1SW4 A;  3PU5 A;  3M8U A;  4ELQ A;  2JJK A;  3O97 A;  3B50 A;  1Y3N A;  4PTK A;  1UQW A;  1SYH A;  2HZK A;  1NV7 A;  2QL3 A;  4PF6 A;  1USY E;  2FYI A;  1JEU A;  1LST A;  2Z8F A;  2I4C A;  1RYX A;  4KYE A;  4GWW A;  1AH5 A;  4OVP A;  4PET A;  5EQ9 A;  3QUF A;  4AB6 A;  3FXR A;  2QVR A;  2QRY A;  4HE0 A;  3HST A;  3VVF A;  1FPK A;  1NMU A;  4I3E A;  3THI A;  4NE4 A;  1I6Q A;  2PX1 A;  3RN8 A;  3FJG A;  2P3V A;  2I0B A;  3KBR A;  5H8N B;  1IXC A;  3PMV A;  3PPP A;  3F11 A;  3Q28 A;  4BDL A;  3KOT A;  4EXL A;  4N8Y A;  2LAO A;  4PFT A;  3UIF A;  2A5S A;  2GRV A;  1B46 A;  2GH9 A;  3FVO A;  2GHB A;  2YPN A;  3TKD A;  5ET8 A;  3PPR A;  1IMD A;  3TAJ A;  3PPQ A;  3R26 A;  4XIG Q;  3MST A;  1R1N A;  1FW0 A;  4E0X A;  4P1L A;  2QMW A;  4JXI A;  1XVY A;  5H8F B;  1F9B A;  4RY1 A;  3D4C A;  4MNI A;  3A3U A;  1ZKB A;  1B5H A;  3VFJ A;  2QVU A;  2D21 A;  1SDX A;  3EHT A;  3LR1 A;  5AE4 A;  4ECF A;  1LEV A;  3SEY A;  5ET5 A;  3FXB A;  5K2X A;  4TLL B;  2AL5 A;  1LB9 A;  4R6H A;  4EQ9 A;  3K1P A;  1MXV A;  2RC7 A;  1LFH A;  4PFI A;  4H45 A;  1IXI A;  4P1E A;  4LVQ A;  5H8N A;  1Q1K A;  4GIZ A;  1SD3 A;  2Z8E A;  2F3B A;  5EYG A;  3C4M A;  5ESY A;  4MIJ A;  2XWO A;  1URG A;  5DVF A;  3KSJ A;  1A54 A;  1B7H A;  4R74 A;  1B1X A;  1FPF A;  3V8X B;  2OJT A;  4PE3 A;  2OK2 A;  3VV5 A;  2PBW A;  3PPO A;  3TTM A;  2NVU B;  3B6T A;  5AA4 B;  4ZEK A;  3JV9 A;  1II5 A;  1LAH E;  4POX A;  5FHM A;  3OO6 A;  5H8F A;  2P2A A;  4THI A;  1ZMG A;  1B1H A;  4PQJ A;  1Y9U A;  4ZE8 A;  5KDT B;  2O51 A;  4MHF A;  4PC9 A;  4GD5 A;  2XXK A;  1DSN A;  2H5Y A;  2O84 X;  4KYD A;  3E9X A;  1FPD A;  2I48 A;  1IEJ A;  2P0S A;  3L6G A;  4GWS A;  5AA3 A;  3N6U A;  4OES A;  3GBA A;  3FAT A;  2P3N A;  3G3J A;  3EF7 A;  4L17 A;  2Q8J A;  2FNC A;  4RXL A;  3H4Z A;  4K3F A;  4JWX A;  1JET A;  3IO6 A;  4KR5 A;  3KJ7 A;  4U2R A;  3H3G A;  1SVX B;  4ZEC A;  3KOS A;  1LBY A;  1QUK A;  4R72 A;  4FEC A;  4LA9 A;  1NV0 A;  4RPO A;  1OVT A;  2UVG A;  4RYA A;  3N26 A;  1H43 A;  5AA4 A;  2VPN A;  3FVN A;  2OX3 A;  2XWV A;  3IJO B;  5JK4 A;  4UAB A;  3T66 A;  1LAF E;  1Q9D A;  2H98 A;  3FV1 A;  2QVV A;  5CMM A;  4GX6 A;  4OQO A;  3KGC A;  1QJM A;  4GXA A;  4XTC Q;  1B5I A;  5TP9 B;  3U1O A;  1JW5 A;  5KDT A;  4O3C A;  1FQC A;  5CI5 A;  2B4M A;  2KLF A;  1Y1M A;  3MWB A;  4P9K A;  3PUY E;  2XX7 A;  5CMK A;  3UN6 A;  2ZXT A;  4YKP A;  3LSL A;  1NH7 A;  5I57 B;  3TFL A;  1UTB B;  4NQ8 A;  4PP0 A;  4WXJ A;  3K1N A;  3OO8 A;  3R7X A;  3HHG A;  3KBZ A;  4QFL A;  4MJO A;  3SER A;  1B40 A;  2VD2 A;  3MP6 A;  1B2H A;  4HXV A;  2DVZ A;  1HSE A;  1FQB A;  1JEV A;  2GHA A;  1Q35 A;  1MDQ A;  3U8Q A;  1LBZ A;  5ICQ A;  1P1U A;  4XKR A;  3MAM A;  1H45 A;  4NMY A;  3DP8 A;  4G68 C;  4ZS9 A;  2DE4 A;  3M3K A;  4Q30 B;  3CIJ A;  3QK6 A;  1B3E A;  1POT A;  3RY3 A;  3MPL A;  5ITP A;  4DCY A;  5TP9 A;  5JTY A;  4Z7E A;  4ZEI A;  4U23 A;  3S9E A;  4NWC A;  4JVD A;  2AYS A;  3GZG A;  1PB9 A;  2O69 A;  4BDN A;  4BDR A;  3H03 A;  1M5B A;  2Q74 A;  4OFJ A;  5I57 A;  4N15 A;  2REG A;  3Q25 A;  4U4X A;  1UTB A;  2KQZ A;  1MXX A;  5IZ3 B;  3IOT A;  3OXN A;  2ALU A;  1Y3P A;  5EQ8 A;  4KFQ A;  4H1X A;  3CSG A;  3KG2 A;  1NNT A;  3S9L C;  4KQP A;  3LC8 A;  1P1N A;  4KXP A;  3H06 B;  3T0J A;  4MNC A;  4FBP A;  1OQH A;  3TDJ A;  4F1V A;  1IZ1 A;  4BDM A;  3P7I A;  1YXI A; 
#chains in the Genus database with same CATH homology
 1MPC A;  2O7U A;  1ZLQ A;  3HO7 A;  5CMC A;  5KZT A;  1N0T A;  2HFB A;  4AQ4 A;  1NNK A;  3OEN A;  3CG3 A;  2Z8D A;  2Q2C A;  1XHY A;  3WAF A;  2O1M A;  1LGB C;  1FTM A;  3O6I A;  1R9L A;  1YPN A;  3VLU A;  1Y3Q A;  1Y20 A;  3N6T A;  2DS9 A;  3EN3 A;  4JWY A;  2OZZ A;  4KI0 E;  1MQH A;  2NWJ A;  2UVJ A;  1Y4C A;  3KN3 A;  1QUI A;  3KZG A;  3CRB A;  1N04 A;  3K02 A;  4RK9 A;  4JSD A;  1MM7 A;  3O6H A;  4ESX A;  1JW1 A;  2X7P A;  1PB8 A;  4ZEB A;  1S9T A;  3MVX A;  5ISU A;  4X48 A;  2O68 A;  1D4N A;  2P1S A;  2Z22 A;  3QSL A;  2ZYO A;  4U1Z A;  1NH8 A;  3OEM A;  4EQB A;  4H6D A;  4LON B;  3HV1 A;  2ANJ A;  3ONM A;  4G4P A;  2G93 A;  3K6V A;  1ZBM A;  3ILT B;  4IO3 A;  5H8S A;  1HSL A;  2AL4 A;  2HCA A;  3O6G A;  3Q27 A;  3MZB A;  2F6P A;  1ATG A;  5DVJ A;  4N13 A;  4IO6 A;  2XXH A;  2QJE A;  4OEU A;  3MW0 A;  4HCY A;  4M4G A;  1FTJ A;  2PT1 A;  4FIM A;  4POW A;  3EQ1 A;  2F8D A;  1JNF A;  4PFW A;  5I58 B;  1OLA A;  3G3H A;  1A8F A;  3ZKL A;  3C33 A;  3IOV A;  3QXM A;  4U1O A;  3H6V A;  4GRK A;  4OVJ A;  1Y1Z A;  4X9T A;  3FD3 A;  3VLV A;  1ZJL A;  2ONK E;  1AIV A;  5DEX B;  4OXV A;  3E3K A;  3RGY A;  1EZO A;  2XXQ A;  1JVX A;  5FTI A;  3G3K A;  1MXY A;  3RT8 A;  4WKM A;  2XXV A;  3TTK A;  2X26 A;  1FQD A;  1MXW A;  5JEI A;  4G2Z A;  3IOW A;  1B6H A;  4ELR A;  3ZSF A;  1JW4 A;  1OVB A;  3MUQ A;  4BLA A;  3ILU B;  4N07 A;  3VE1 B;  2DP8 A;  2DWI A;  1D9Y A;  3HHF A;  3MPK A;  5I58 A;  3SES A;  3CG1 A;  1VFE A;  4QFP A;  4NWD A;  4NF6 B;  3BFU A;  2D5W A;  1DOT A;  4HS7 A;  2THI A;  4YB6 A;  5DEX A;  4NF4 B;  3WAE A;  5AA2 B;  3G7W A;  1P99 A;  1BKA A;  2Y7I A;  1O64 A;  3PMW A;  4MFI A;  1A7L A;  1QKA A;  3FVG A;  3IOU A;  4IO2 A;  2HAU A;  1O63 A;  1MQG A;  1DTZ A;  1VR5 A;  3H6U A;  4MLV A;  2E1S A;  4F22 A;  3TPA A;  3T96 B;  4TOZ A;  4MF3 A;  1PC3 A;  3LBS A;  4HCW A;  1I69 A;  3H7M A;  3QIM A;  4RA1 A;  1XC1 A;  2CZL A;  4QSD A;  4JWO A;  1IUD A;  1EZ9 A;  4EUO A;  1LLS A;  3USD A;  4NF6 A;  1BLF A;  1TWY A;  2DSF A;  4DLD A;  2E0S A;  1A99 A;  4MLQ A;  2B3B A;  3TEP A;  5I84 A;  4JSO A;  2IA4 A;  4NF4 A;  3OEL A;  5AA2 A;  1WVJ A;  3I3V A;  1GR2 A;  2Q9T A;  2DYX A;  2UYE A;  1I6A A;  3W9W A;  4R2B A;  2D3I A;  2RIN A;  1D9V A;  1FTL A;  3MZ9 A;  2CMO A;  2W7Y A;  1A8E A;  1BTJ A;  3ODB A;  4NF5 B;  2WKY A;  1PBQ A;  1B7Z A;  1NL5 A;  4F18 A;  1URS A;  3I6V A;  4OEV A;  2ZMB A;  1BIY A;  4F19 A;  5TPA B;  2NXO A;  4IB2 A;  3FVK A;  2V84 A;  1QUJ A;  2I3W A;  4U4S A;  3K2D A;  3CFX A;  4DIG A;  3RNN A;  1XOC A;  2V25 A;  1B4H A;  4H65 A;  4PFU A;  5H8Q B;  4N6P A;  3U92 A;  2Y7W A;  1A40 A;  1YCJ A;  2Q88 A;  4X1B A;  3V89 B;  2HZL A;  3H6W A;  3IR1 A;  3S4U A;  4LZ7 A;  1T0K A;  3HPI A;  4GLI A;  2OBG A;  2F36 A;  2ZNT A;  4FAJ A;  1OMP A;  3KSX A;  2QS2 A;  4DCX A;  3K01 A;  4O3A A;  3N94 A;  4NF5 A;  3RTF B;  1B52 A;  3IAZ A;  1US5 A;  1AOV A;  2PYY A;  5TPA A;  3UOR A;  1OQG A;  3BBR A;  3UA8 A;  1XS5 A;  4XKQ A;  5AA1 A;  5HPQ A;  1QW0 A;  3UK4 A;  1US4 A;  2ZNU A;  3LUY A;  3PUX E;  3OEK A;  2DWA A;  4YMB A;  3PUZ E;  5F1Q A;  3TEL A;  4JBZ A;  3BKI B;  1B0H A;  4QRZ A;  2F5X A;  2Q2A A;  4KHZ E;  3FV2 A;  4LQ5 A;  1GV8 A;  3SEU A;  1L5T A;  1MDP 1;  3ZKK A;  2VHA A;  2XXP A;  3GXA A;  4DDD A;  4M1V A;  3A09 A;  4QFN A;  3C31 A;  1LBC A;  1NNP A;  5KCJ B;  2O6A A;  4U21 A;  3K6U A;  1HSJ A;  4OER A;  4I8C A;  2DVC A;  5L9M A;  2V3U A;  4DE8 A;  1B3L A;  1N76 A;  4DXC A;  3SEV A;  3DP4 A;  4IGR A;  2F7C A;  4EXK A;  1Z7N E;  2OLB A;  2XX8 A;  3T22 A;  2HQ0 A;  2Y7P A;  2B65 A;  3KFM A;  3IO4 A;  4IY6 A;  4H5G A;  4YB7 A;  4YU0 A;  3U93 A;  4LZ5 A;  1MQD A;  3OSQ A;  1B7U A;  4GOT A;  1PB7 A;  2RCB A;  5HBC A;  1VE4 A;  2HXW A;  3PGF A;  1LAG E;  3VVD A;  3MP1 A;  4ESW A;  4NTL A;  4F2Q A;  1MS7 A;  3E4R A;  3O9P A;  3VXB A;  4NED A;  1S50 A;  3CR9 A;  2Y7K A;  4YZZ A;  2XXX A;  4QSE A;  5CBR A;  2XX9 A;  1B3G A;  3LSW A;  5KCJ A;  1IIT A;  3MVZ A;  3H6T A;  2REJ A;  2UVH A;  1LBB A;  1D3K A;  2PMS A;  2O1L A;  5DTB A;  5IKB A;  3OD7 A;  4R6Y A;  3MVY A;  1QVS A;  2AIX A;  2F97 A;  1N3W A;  3E13 X;  2ONS A;  2ZYN A;  1FQA A;  1YAE A;  5BUU A;  3UGW A;  1UIU A;  4EQ7 A;  4QFK A;  1TXF A;  2RCA A;  5LOM A;  2H25 A;  3T9X B;  2OWT A;  2XXR A;  1A55 A;  4RNS A;  1ZTY A;  3QAX A;  1LFG A;  3M3L A;  2F34 A;  4TLM B;  4TQU Q;  3Q29 A;  2DE3 A;  1P1Q A;  1ANF A;  3IB0 A;  1MXZ A;  4E0W A;  1M5D A;  1B4Z A;  4PE5 B;  5TU0 A;  2QS1 A;  4NF8 B;  3ECR A;  3LSX A;  2OWS A;  3FXU A;  3MZ1 A;  3DM0 A;  3CI8 A;  3SEW A;  2ZYK A;  2I4B A;  3VVE A;  1MY1 A;  2DQV A;  3U94 A;  2F6G A;  1JQF A;  1KWH A;  3RPW A;  1TT1 A;  1FTO A;  3V83 A;  2BJJ X;  1CE2 A;  3TQL A;  4XKP A;  3SEX A;  3LSF B;  4ONY A;  5K2Y A;  4R75 A;  2VGQ A;  3CSB A;  4R9G A;  4FOR A;  2QMX A;  4G8M A;  4P0I A;  2H4I A;  5H8H B;  4DXU A;  3V5A A;  4C0R A;  1DPE A;  4OFL A;  2HEU A;  2XHD A;  2VOZ A;  4R73 A;  4OFO A;  3EHS A;  3C32 A;  1R9Q A;  3L6H A;  5CBS A;  4EDP A;  1SQY A;  3A3C A;  3CFZ A;  2UVI A;  4I9D A;  3HCQ A;  3N5L A;  4DXB A;  2R6G E;  4R9F A;  4F3S A;  1B58 A;  3I5O A;  4KPT A;  5ICT A;  1OLC A;  3CFL A;  4FE8 A;  1MY3 A;  1FTK A;  3DP6 A;  4F39 A;  4I62 A;  2O7I A;  5IAI A;  3JZJ A;  4F29 A;  4QSC A;  1LFI A;  1B32 A;  3IB1 A;  5L9S A;  1P1W A;  1SW1 A;  1LCF A;  3FJM A;  1YTV A;  1MH3 A;  1MY0 A;  1EH3 A;  1SI1 A;  4OMB A;  5DYH A;  1MQI A;  5H8H A;  5DVI A;  4OYV A;  4JDF A;  2RKM A;  5L8D A;  1URD A;  4O3B A;  3O2A A;  5A5X B;  3B7D A;  2H9B A;  2UYF A;  2YLN A;  3RTW B;  3EHU A;  3FZV A;  1N7W A;  5I2K B;  2QS4 A;  3C9H A;  5CRY A;  4YKI A;  1O7T A;  2PT2 A;  3PD9 A;  3TCG A;  3MP8 A;  2QSX A;  2F7A A;  3GBB A;  2NUV A;  3K0V A;  3RLF E;  1N7X A;  3B6W A;  3KJT A;  4ELO A;  1M5C A;  3K4U A;  1I6B A;  4F1Y A;  3PUW E;  2V93 A;  3B6Q A;  4YB5 A;  3TUS A;  4KCC A;  1MM6 A;  3PPN A;  3TTL A;  1Y4T A;  3PV0 E;  4F31 B;  4ZZA A;  2ZYM A;  2GFE A;  4RJZ A;  1MY4 A;  1H3D A;  5A5X A;  1DMB A;  3RUM A;  4IO5 A;  1XVX A;  2XD3 A;  3PUV E;  2YJP A;  1B9J A;  3G3I A;  4XKN A;  5L9O A;  3EPE A;  1MPB A;  3T93 B;  1NKX A;  4Q5T A;  3K6X A;  5I2K A;  4WEP A;  2PVU A;  3S9M C;  4F2O A;  1XT8 A;  4Q0C A;  1UIV A;  1JVY A;  3DLN A;  2R71 A;  3G3G A;  2I3V A;  3TCF A;  2Q89 A;  1PEB A;  3VLW A;  2QS3 A;  3FUZ A;  1PBP A;  2Z23 A;  3TMG A;  1DPP A;  3FJ7 A;  3K6W A;  5AA2 D;  2DWH A;  1H44 A;  1LAX A;  3MVW A;  4AB5 A;  1QKB A;  3MQ9 A;  3S9N C;  1SBP A;  4QFO A;  4GF8 A;  1MH4 A;  4JB7 A;  1FCK A;  3OO9 A;  2B3F A;  1GTK A;  4I1D A;  4F3G A;  4OWD A;  3O29 A;  5CMB A;  1QUL A;  3MC2 A;  4R6K A;  5J1D A;  3G3F A;  2ESN A;  3IX1 A;  1IXG A;  3OO7 A;  5FTH A;  1BP5 A;  4G77 A;  2UXA A;  2V3Q A;  2DWJ A;  3C36 A;  1LCT A;  1J1N A;  1MRP A;  1VSO A;  4IO4 A;  3S2V A;  4IGT A;  2ABH A;  4KD5 A;  4OTE A;  4EF1 A;  1EZP A;  2RC9 A;  5BWJ A;  2R9J A;  4XXU A;  3W15 C;  5FHO A;  2I58 A;  2I0C A;  3KN8 A;  5ELV A;  2I49 A;  2F7B A;  4R2F A;  5H8Q A;  4ZEF A;  4YMA A;  2DXR A;  2XXW A;  1MG1 A;  4GVO A;  5JTY B;  1GGG A;  5CC2 A;  2XD2 A;  4BDQ A;  4X1D A;  5HM4 B;  1SW5 A;  3FGS A;  1ZU0 A;  4GFR A;  4G8H A;  4FED A;  5CM6 A;  3OOA A;  4GL8 A;  3TTR A;  4H8J A;  5M2V A;  3DEL B;  4LUB A;  4C1U A;  4KCD A;  4FAT A;  3JYR A;  1M5F A;  4QHQ A;  2OCU A;  3KN7 A;  3GLB A;  5I59 B;  3U72 A;  2XXY A;  4FEB A;  4ZE9 A;  1M5E A;  1POY 1;  4HTG A;  4IO7 A;  4ISU A;  1P1O A;  4YKJ A;  3TTN A;  3FAS A;  4Q8R A;  1SYI A;  2XXU A;  1AMF A;  5DT6 A;  1RKM A;  2NOO A;  3T9V A;  2VP1 A;  4G8N A;  2DOJ A;  3AXF A;  1OIB A;  3O28 A;  4DZ1 A;  4F3P A;  4UAC A;  1S7Y A;  2DE2 A;  3IB2 A;  3TCH A;  5EYF A;  3W9V A;  4HW8 A;  1NFT A;  1GVC A;  4ZDM A;  3M3F A;  1B05 A;  4H8I A;  5ITO A;  2X7Q A;  5F7V A;  1TFA A;  2M8C A;  5I56 B;  5FHN A;  5I2N B;  4ND9 A;  3C35 A;  3FIR A;  1SW2 A;  4LQ2 A;  2V3T A;  1MQJ A;  1WOD A;  2VD3 A;  4LP2 B;  1SI0 A;  1TFD A;  4PFY A;  5I59 A;  3PMX A;  2H99 A;  4ELP A;  4LZ8 A;  4G68 B;  1IXH A;  4BDO A;  3IL1 B;  2XXI A;  4OEN A;  4QF9 A;  3KEI A;  1MPD A;  4MBP A;  4EF2 A;  3R6U A;  3VXC A;  4F3B A;  3IK6 B;  2RC8 A;  2Y84 A;  3BFT A;  4YKK A;  2G29 A;  3RT6 B;  3CVG A;  2IEE A;  4GXS B;  4RK2 A;  4H67 A;  5I56 A;  5I2N A;  1WDN A;  4H5F A;  5EHS A;  2A5T B;  1MXU A;  3MBP A;  4Z0I A;  4ZED A;  1N84 A;  1B3F A;  3Q26 A;  1Z7M E;  3VDF A;  4G68 A;  3TQW A;  3IJX B;  5B7D A;  4RPN A;  1FQF A;  3K1M A;  4GWO A;  4GQO A;  4ZZE A;  3SKP A;  4OHN A;  4P0G A;  2FA7 A;  3T9H B;  3FXQ A;  4U22 A;  1B5J A;  1IIW A;  1DTG A;  3HN0 A;  4GL0 A;  4C1T A;  4H0W A;  4F1U A;  1AL3 A;  1UTH B;  1MY2 A;  3OSR A;  1B51 A;  4OZ9 A;  3ZS6 A;  1ELJ A;  3PD8 A;  4YIC A;  5EHM A;  4OET A;  4P11 A;  4UA8 A;  4LAT A;  5B70 A;  2Y7R A;  2DXY A;  3K00 A;  1IQ7 A;  2ZNS A;  3SDF A;  1B3H A;  1ZIU A;  2A5T A;  3QYT A;  2XXT A;  1USY H;  3UP9 A;  2F35 A;  3MJN A;  4FJP A;  3C34 A;  1CB6 A;  4YAH X;  4WED A;  1LB8 A;  2I6E A;  2RF1 A;  3T9U A;  1VFD A;  2F78 A;  1H76 A;  3RQT A;  4IY5 A;  4NF8 A;  1R6Z A;  3D4G A;  3SET A;  3OMB A;  1UTH A;  3TYH A;  1N3X A;  3IOR A;  1NNF A;  4KYS A;  1EU8 A;  1B0L A;  2QPQ A;  1PDA A;  3TZA A;  1RYO A;  3O66 A;  1FQE A;  2HAV A;  3QUJ A;  3TOD A;  4MH5 A;  1SW4 A;  3PU5 A;  3M8U A;  4ELQ A;  3O97 A;  1Y3N A;  1UQW A;  1SYH A;  2HZK A;  2QL3 A;  1USY E;  2FYI A;  1JEU A;  1LST A;  2Z8F A;  2I4C A;  1RYX A;  4KYE A;  1AH5 A;  4PET A;  3QUF A;  4AB6 A;  3FXR A;  2QRY A;  3HST A;  3VVF A;  1NMU A;  3THI A;  4NE4 A;  1I6Q A;  2PX1 A;  3RN8 A;  3FJG A;  2I0B A;  3KBR A;  5H8N B;  1IXC A;  3PMV A;  3PPP A;  3F11 A;  3Q28 A;  4BDL A;  3KOT A;  4EXL A;  2LAO A;  4PFT A;  3UIF A;  2A5S A;  2GRV A;  1B46 A;  2GH9 A;  3FVO A;  2GHB A;  2YPN A;  3TKD A;  3PPR A;  3TAJ A;  3PPQ A;  3R26 A;  4XIG Q;  1R1N A;  1FW0 A;  4E0X A;  2QMW A;  4JXI A;  1XVY A;  5H8F B;  1F9B A;  4RY1 A;  3D4C A;  3A3U A;  1ZKB A;  1B5H A;  3VFJ A;  2D21 A;  1SDX A;  3EHT A;  3LR1 A;  5AE4 A;  4ECF A;  3SEY A;  5K2X A;  4TLL B;  2AL5 A;  1LB9 A;  4R6H A;  4EQ9 A;  3K1P A;  1MXV A;  2RC7 A;  1LFH A;  1IXI A;  4LVQ A;  5H8N A;  1Q1K A;  4GIZ A;  1SD3 A;  2Z8E A;  3C4M A;  1URG A;  5DVF A;  3KSJ A;  1A54 A;  1B7H A;  4R74 A;  1B1X A;  3V8X B;  2OJT A;  2OK2 A;  3VV5 A;  2PBW A;  3PPO A;  3TTM A;  2NVU B;  3B6T A;  5AA4 B;  4ZEK A;  3JV9 A;  1II5 A;  1LAH E;  4POX A;  5FHM A;  3OO6 A;  5H8F A;  2P2A A;  4THI A;  1ZMG A;  1B1H A;  4PQJ A;  1Y9U A;  4ZE8 A;  5KDT B;  2O51 A;  4GD5 A;  1DSN A;  2H5Y A;  2O84 X;  4KYD A;  3E9X A;  2I48 A;  1IEJ A;  2P0S A;  3L6G A;  5AA3 A;  3N6U A;  4OES A;  3GBA A;  3FAT A;  3G3J A;  3EF7 A;  4L17 A;  2Q8J A;  2FNC A;  4RXL A;  3H4Z A;  4K3F A;  4JWX A;  1JET A;  3IO6 A;  4KR5 A;  3KJ7 A;  4U2R A;  3H3G A;  1SVX B;  4ZEC A;  3KOS A;  1QUK A;  4R72 A;  4FEC A;  4LA9 A;  4RPO A;  1OVT A;  2UVG A;  4RYA A;  3N26 A;  1H43 A;  5AA4 A;  3FVN A;  3IJO B;  5JK4 A;  3T66 A;  1LAF E;  3FV1 A;  2H98 A;  5CMM A;  4OQO A;  3KGC A;  1QJM A;  4GXA A;  4XTC Q;  1B5I A;  5TP9 B;  3U1O A;  1JW5 A;  5KDT A;  4O3C A;  1FQC A;  5CI5 A;  2KLF A;  1Y1M A;  3MWB A;  3PUY E;  2XX7 A;  5CMK A;  3UN6 A;  2ZXT A;  4YKP A;  3LSL A;  1NH7 A;  5I57 B;  3TFL A;  1UTB B;  4PP0 A;  4WXJ A;  3K1N A;  3OO8 A;  3R7X A;  3HHG A;  4QFL A;  3SER A;  1B40 A;  2VD2 A;  3MP6 A;  1B2H A;  2DVZ A;  1HSE A;  1FQB A;  1JEV A;  2GHA A;  1Q35 A;  1MDQ A;  3U8Q A;  5ICQ A;  1P1U A;  4XKR A;  3MAM A;  1H45 A;  4NMY A;  3DP8 A;  4G68 C;  4ZS9 A;  2DE4 A;  3M3K A;  4Q30 B;  3CIJ A;  3QK6 A;  1B3E A;  1POT A;  3RY3 A;  3MPL A;  5ITP A;  4DCY A;  5TP9 A;  5JTY A;  4Z7E A;  4ZEI A;  4U23 A;  3S9E A;  4NWC A;  2AYS A;  3GZG A;  1PB9 A;  2O69 A;  4BDN A;  4BDR A;  3H03 A;  1M5B A;  4OFJ A;  5I57 A;  2REG A;  3Q25 A;  4U4X A;  1UTB A;  1MXX A;  3IOT A;  3OXN A;  2ALU A;  1Y3P A;  4KFQ A;  4H1X A;  3CSG A;  3KG2 A;  1NNT A;  3S9L C;  4KQP A;  3LC8 A;  1P1N A;  3H06 B;  3TDJ A;  1OQH A;  4F1V A;  1IZ1 A;  4BDM A;  3P7I A;  2ONR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...