2ZXTA

Crystal structure of tim40/mia40, a disulfide relay system in mitochondria, solved as mbp fusion protein
Total Genus 127
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
127
sequence length
451
structure length
451
Chain Sequence
EEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSVPGRGSIEGRPEFAYNPDTGEINWDCPCLGGMAHGPCGEEFKSAFSCFVYSEAEPKGIDCVEKFQHMQDCFRKYPEHYAEQLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport
molecule keywords Maltose-binding periplasmic protein, LINKER, Mitochondrial i
publication title Structural basis of yeast Tim40/Mia40 as an oxidative translocator in the mitochondrial intermembrane space.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
total genus 127
structure length 451
sequence length 451
ec nomenclature
pdb deposition date 2009-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
A PF06747 CHCH CHCH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2zxtA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2zxtA01
1LBCA 3T66A 4ZEFA 1IXGA 2ONKE 5DTBA 1B46A 3HV1A 3KN8A 1QW0A 3HO7A 4MFIA 4ZEKA 5JEIA 4WXJA 4JSOA 1NNFA 4O3CA 4DXUA 3RQTA 4KYEA 1JETA 1NKXA 1H44A 2REJA 4G8HA 2V93A 1BTJA 4NF5B 1Y1ZA 4POXA 4LUBA 5AE4A 1PB9A 3H06B 1PBPA 1ZKBA 2YLNA 3HSTA 5H8HB 3KSXA 3MVXA 1GTKA 4G2ZA 5CMBA 4MLQA 1UTHA 2A5SA 3H6UA 4R74A 3PUYE 2DS9A 3D4GA 1ELJA 2R6GE 1OLCA 1J1NA 4OEUA 3DP6A 3OELA 2OK2A 4G8MA 3CFXA 4GXAA 2VOZA 2RKMA 1NNTA 4F22A 2OBGA 4YZZA 4PP0A 4GL0A 3MBPA 3QAXA 3ILUB 5I57B 3Q25A 2DXYA 2Z23A 4TOZA 1LSTA 1FTMA 5K2XA 1B1XA 2F7BA 5AA2A 2D5WA 2OWSA 2XXPA 1RYXA 4YAHX 4OFLA 1P99A 3IOTA 3OOAA 1MY0A 2YJPA 3W9VA 5AA2D 3E13X 4ZZAA 1MXVA 5DVIA 4H8IA 1B7UA 1EU8A 1EZ9A 5DEXA 1QKBA 3W9WA 2HCAA 4IO6A 4NF8A 2HZLA 1LBBA 3EHSA 2F97A 4RYAA 1TWYA 3OXNA 4M1VA 3MVYA 4XTCQ 4G77A 2XHDA 1JW5A 1IXHA 4GXSB 3CSGA 3I5OA 3K00A 3RT8A 2DSFA 3N5LA 2I0CA 3RUMA 2D21A 2V3UA 2I3WA 4R9GA 1N7WA 4GF8A 2E1SA 3CG1A 3CRBA 1M5FA 1NH7A 1B32A 3VVFA 1MY4A 4ZE9A 3LBSA 3DELB 4IGTA 2FYIA 3HPIA 3U8QA 5K2YA 5CMCA 3KN7A 2XX8A 1A55A 2ZNTA 2AL5A 1N3XA 4Z7EA 3SDFA 3VXCA 2V3TA 1S9TA 2LAOA 4P11A 4U1OA 4MBPA 4TLMB 3LUYA 2HAUA 3C36A 2G93A 2DYXA 4LP2B 4OYVA 4F3GA 2NVUB 1H3DA 4EQBA 4R2BA 4QHQA 1Q1KA 1JW1A 4JDFA 3RTFB 3K01A 4QFNA 4ZEBA 4JB7A 2Q9TA 4NF8B 2XXVA 5L9OA 2ONSA 3PV0E 2DOJA 3TTNA 3VDFA 2DQVA 3BFTA 2XXIA 4BDOA 3O29A 4LZ5A 4AB6A 1DTGA 2QPQA 3MAMA 3S4UA 4ONYA 1OVBA 1UIUA 5AA4A 4WEPA 3A09A 3OD7A 3O6HA 3MC2A 1FQCA 2Y7KA 1LCTA 3PPOA 1HSEA 4PE5B 2XXXA 2H4IA 3IJXB 2IEEA 2RC8A 4F3BA 1B3HA 3R6UA 2PYYA 4NF6A 4NE4A 1D9VA 2VP1A 3FVOA 1P1OA 4U4SA 3U94A 5EHMA 3VV5A 3CR9A 2I49A 4KYSA 4R72A 4YKIA 3FZVA 2O7IA 5I59A 1H45A 3S9MC 3ZSFA 1B4HA 4NWCA 5L9MA 2X26A 1LCFA 2REGA 1I6BA 1B3GA 4OZ9A 3OSRA 4OFJA 5FTIA 3N6TA 4POWA 5I2NA 1P1NA 4F31B 2HAVA 3PPQA 2O69A 3MUQA 3QUJA 3L6HA 1MXWA 2Q2CA 2DWJA 3TKDA 3PUZE 3TQWA 2AYSA 3CVGA 5TPAA 1D3KA 4LZ8A 3T9VA 1VE4A 4Q8RA 1O7TA 5CBSA 3EN3A 2H99A 1POTA 3E9XA 4BDMA 4QFLA 2QS1A 4ZEDA 5EYFA 1EZPA 4NEDA 5AA4B 5IAIA 2ZNSA 4GFRA 2QL3A 3B6TA 5H8FB 4F3PA 3CFLA 3GBBA 4RA1A 3SEXA 1QUJA 4OQOA 4UA8A 5CMMA 2ESNA 4KCCA 2DXRA 3UP9A 2GH9A 5JTYB 4BDNA 4NF6B 1B58A 2H9BA 4NF4B 2PX1A 4DE8A 4XKRA 1B05A 2XD2A 3FVNA 3PPPA 3MZ9A 1D9YA 4R73A 1SW5A 1TFAA 1MQIA 3TZAA 1QJMA 4F1UA 4N07A 1MPCA 1WDNA 3IB1A 1B5HA 5I59B 3MP1A 4Q30B 2Z8FA 1GGGA 2XX7A 4ELRA 4C1UA 4KI0E 4JBZA 3RNNA 1D4NA 4IY6A 4BDLA 1BKAA 3T96B 2F5XA 1PB8A 4N13A 4FE8A 3FVKA 4FEBA 3S9NC 1R1NA 4FIMA 2VGQA 3O6IA 4BLAA 5A5XA 3U93A 4E0WA 4ESXA 4OHNA 4XXUA 1AMFA 3HHGA 2ANJA 3U92A 2XXHA 3C35A 2RINA 5TPAB 3ILTB 3MVWA 2ZXTA 4QF9A 2Q2AA 1Y3NA 5KDTB 4O3BA 1LAGE 1XVYA 2PVUA 3TTMA 3QIMA 2R9JA 3TEPA 1I6QA 5H8NA 4X1DA 1UQWA 4OFOA 3VLUA 3PD9A 4RJZA 2DWIA 2H5YA 1OQHA 4QFOA 2OJTA 1LGBC 3IORA 5CC2A 2DVZA 4DXCA 1MXYA 2XX9A 2QS4A 3KG2A 2KLFA 2AL4A 2YPNA 4R6KA 1URSA 1M5CA 3VLVA 2DE2A 1XVXA 3ZKKA 1DTZA 1MDP1 1OLAA 3KZGA 4H8JA 1AOVA 4O3AA 4R2FA 2CMOA 4AB5A 4XKPA 1B1HA 4EF1A 2OWTA 3USDA 4KFQA 3TAJA 3LR1A 2THIA 4KPTA 3K6XA 4I9DA 3K2DA 1MH3A 1Y3QA 4YMAA 1MM6A 4G68A 2GFEA 5A5XB 1SD3A 3R7XA 3DM0A 3IR1A 4OERA 2RC7A 2DE4A 4KD5A 4F18A 4BDRA 3FXUA 3V83A 3KOSA 1LAFE 2ZYOA 1DMBA 2XXUA 3BBRA 4F2QA 3ZS6A 1DOTA 3IOVA 1N0TA 3P7IA 2Q88A 3MPKA 2GHBA 1HSJA 1Z7ME 1FTJA 3UN6A 2P0SA 3K6VA 5M2VA 5I58A 3KGCA 3T9UA 3IB0A 2NWJA 3THIA 1QVSA 1T0KA 3TPAA 2F36A 2AIXA 5H8QA 3IX1A 4YKJA 2ZYMA 4JWYA 1I6AA 2Y7RA 3KJTA 4U22A 1JVXA 1B6HA 1MM7A 3SEUA 3M3LA 2F34A 3MZ1A 1IITA 4OENA 3KN3A 3UA8A 1WODA 1JEUA 4YB5A 3MW0A 2IA4A 3K1NA 1R6ZA 3L6GA 3FUZA 2HQ0A 2VD3A 3O66A 4RK9A 3O9PA 4C0RA 1US4A 1UTHB 2CZLA 3TTKA 5DVFA 3TCHA 4OETA 3B7DA 3LC8A 4G68B 3QXMA 4FEDA 4GRKA 4LA9A 4GVOA 4DXBA 5H8SA 4HCYA 3I3VA 3E3KA 1AIVA 3CFZA 1IEJA 2V3QA 1OQGA 3KEIA 3KJ7A 4XKQA 4FATA 1ZJLA 5J1DA 3K4UA 1JNFA 1R9QA 3MQ9A 3FD3A 5HBCA 1MY3A 4RK2A 3H6VA 5KZTA 2I3VA 4LZ7A 5AA2B 1YAEA 5I58B 3BFUA 4ISUA 3UIFA 3FV1A 3WAFA 2OCUA 3TUSA 1ZMGA 2W7YA 3OSQA 3FJGA 2A5TA 1AL3A 4I8CA 3RY3A 4JSDA 4U1ZA 3RLFE 5B7DA 2ZMBA 3FV2A 4OESA 4C1TA 5DEXB 3ODBA 1NNKA 3IK6B 2F6GA 1N7XA 5ISUA 2O68A 4XKNA 5KCJA 3GZGA 1YPNA 1LFHA 5ICTA 1SBPA 4TLLB 4RY1A 3OO8A 3SESA 1FTLA 1WVJA 3V8XB 3G3FA 1FQDA 4NWDA 2I48A 5FTHA 1ZLQA 4R6HA 2Y7IA 3G3GA 3EF7A 4H65A 3I6VA 3FVGA 4U21A 3H3GA 3U72A 2Q89A 3MP8A 1DPPA 3TYHA 4M4GA 1B51A 1B7HA 2DE3A 2Y84A 2R71A 4ZZEA 4FECA 4U23A 1N84A 3OEKA 2GHAA 2P1SA 4LQ5A 4KYDA 4F19A 2XXQA 3BKIB 1M5EA 4DLDA 2F6PA 4R6YA 3SEWA 3VXBA 4F29A 2Y7WA 3TODA 3MP6A 1L5TA 3PD8A 1I69A 3Q29A 3FASA 3VFJA 3TMGA 1JW4A 2A5TB 3N94A 3S9LC 1II5A 3HCQA 3C32A 3OO7A 3Q27A 3OO6A 1SW1A 3G3IA 3C4MA 1LAHE 3TTRA 1QUKA 1SQYA 4OVJA 1MPDA 5BUUA 4OEVA 2Q8JA 2RC9A 3JV9A 4HW8A 2PT1A 5KCJB 1CE2A 2ALUA 4MF3A 5FHOA 1VSOA 5DT6A 1VFEA 3FIRA 2UVHA 1MQHA 2NOOA 4R9FA 2ONRA 1RYOA 2QRYA 1Y4TA 4FJPA 3PU5A 2VHAA 4HTGA 4EDPA 2ABHA 4GL8A 4LONB 4DCYA 4F1VA 1IIWA 1Q35A 1Z7NE 3HN0A 2O84X 4DDDA 1YTVA 1A54A 3QK6A 5CM6A 3O28A 3SETA 2F78A 3PUVE 4H5GA 4RPNA 2UVIA 5L8DA 3S9EA 1USYH 3EHTA 3W15C 1IQ7A 4U4XA 3EHUA 2P2AA 4HCWA 1LAXA 1HSLA 1JVYA 1Y4CA 4JXIA 4H5FA 1NFTA 1LFGA 1URDA 2XXWA 1A99A 5AA3A 2F7AA 3MJNA 2DVCA 3G3JA 1MH4A 5I2NB 1QUIA 3EPEA 3OO9A 4EXLA 1Y1MA 2GRVA 1LLSA 1MQDA 4GIZA 3MVZA 2ZYKA 3LSWA 4X1BA 2NUVA 1EH3A 1B2HA 1BIYA 5ELVA 2V84A 1IZ1A 1GVCA 4XIGQ 3M3FA 4ELOA 1QULA 1YCJA 3VVEA 4G8NA 4X48A 1XT8A 1NL5A 2UXAA 1LFIA 3TELA 5CRYA 1MQGA 3DP8A 5L9SA 3PPNA 3O2AA 4PFYA 4FAJA 3IO4A 5DVJA 4QSDA 2QSXA 3JYRA 4YICA 4WKMA 5I57A 4H0WA 3V89B 1ZIUA 3M3KA 1OVTA 3EQ1A 3WAEA 4UACA 4GWOA 1N76A 3FATA 2PT2A 1SW4A 4IO5A 4IO2A 1XHYA 4PFTA 3ZKLA 3C31A 4G4PA 1ZU0A 2QS2A 2PMSA 3C9HA 4AQ4A 3MZBA 4HS7A 3UK4A 1NH8A 4F3SA 5AA1A 4U2RA 2O7UA 1H76A 2PBWA 3IAZA 5ICQA 2B3BA 2XXYA 3IJOB 5LOMA 3RN8A 4MH5A 1BP5A 4KCDA 2UYEA 3TQLA 1JEVA 3GLBA 2RCBA 3DP4A 3IOWA 1OMPA 3UORA 1Y9UA 3B6WA 1SI1A 3ONMA 3IL1B 4WEDA 4IY5A 3SEYA 3RTWB 5I2KA 1MRPA 1XS5A 4RPOA 4ZECA 1MPBA 4EF2A 5H8NB 2QJEA 4QRZA 5FHMA 2DP8A 4FORA 3CIJA 3G7WA 3K1MA 2DWAA 1IUDA 1CB6A 2HZKA 1FQAA 1NNPA 3N26A 2HEUA 1GR2A 2Z8DA 3KBRA 2QMXA 4DIGA 1GV8A 2B65A 5EHSA 3ECRA 1B5JA 4P0IA 2X7PA 4E0XA 1QKAA 1PC3A 4BDQA 2BJJX 4EXKA 4RXLA 1SYHA 1MXXA 3A3CA 2FA7A 1B40A 1BLFA 5HM4B 3DLNA 4EQ9A 1N3WA 3H6WA 4H6DA 3E4RA 5CBRA 2FNCA 1TT1A 3C33A 2F8DA 4IO4A 2HXWA 4P0GA 3O97A 3FGSA 4KQPA 2I4CA 5CI5A 1SYIA 1TXFA 4OWDA 1US5A 1S50A 4QSCA 4NTLA 3VLWA 2VD2A 4F1YA 4YB6A 5I2KB 2I6EA 2XXRA 1A7LA 2OLBA 4RNSA 3SKPA 2D3IA 3H4ZA 2RF1A 1P1UA 1H43A 1PEBA 3QSLA 2B3FA 1Y20A 1S7YA 3C34A 4IO7A 3T9HB 3M8UA 1ANFA 1PBQA 3RPWA 4F2OA 4LQ2A 2NXOA 1MDQA 3LSXA 1VR5A 5BWJA 1VFDA 4GQOA 5H8QB 5HPQA 2H25A 1B3EA 4YU0A 4GLIA 3KFMA 4X9TA 3FJ7A 4L17A 3OEMA 4H1XA 1R9LA 1UIVA 3U1OA 5ITPA 2F35A 3TTLA 1LB9A 1Y3PA 2ZNUA 3GBAA 1A8FA 1B3LA 1XOCA 4PQJA 4QFKA 3LSLA 5I84A 1KWHA 2RCAA 3PMXA 4KR5A 4JWXA 3FJMA 1DSNA 4PFUA 4IGRA 2WKYA 1IXCA 1UTBA 4TQUQ 4IO3A 1B0LA 1MG1A 3Q28A 5CMKA 3PUXE 2HFBA 4ELQA 3GXAA 1FTKA 5JK4A 1DPEA 4QFPA 5FHNA 5H8FA 3CG3A 3QYTA 1EZOA 1NMUA 3FXQA 3CSBA 3K6UA 3TCFA 4JWOA 1FTOA 4OTEA 2M8CA 5TU0A 1B9JA 5JTYA 2I4BA 4N6PA 2XXTA 3TDJA 4H67A 1A40A 4Z0IA 2G29A 4LVQA 3KOTA 4NF4A 4ZDMA 1O63A 4K3FA 2X7QA 4ECFA 1M5BA 1FQBA 3PGFA 1N04A 4KHZE 3K6WA 3G3HA 1SDXA 1USYE 3Q26A 3IO6A 4YMBA 3VE1B 3SERA 2ZYNA 2H98A 3T9XB 2V25A 1B7ZA 2O1LA 1FQEA 3K0VA 4LATA 3F11A 4DCXA 1MXUA 3JZJA 3MWBA 5TP9A 1M5DA 3PMWA 3PUWE 1B3FA 1A8EA 1IXIA 3H7MA 4ZS9A 2QS3A 1RKMA 1FQFA 4ZE8A 3S2VA 5I56A 3TFLA 4GOTA 2DWHA 3QUFA 4I1DA 4MLVA 2E0SA 3IOUA 4I62A 1P1QA 4G68C 4IB2A 4Q0CA 1UTBB 4GD5A 3CI8A 5KDTA 4YB7A 2I58A 5DYHA 3A3UA 3IB2A 4ESWA 4QSEA 3SEVA 3VVDA 1TFDA 4ND9A 2XD3A 3K1PA 1ZTYA 4OMBA 3H03A 4EUOA 1AH5A 1FW0A 2UYFA 3G3KA 1LB8A 3T93B 5F1QA 4PETA 1B4ZA 4YKKA 1JQFA 3V5AA 4Q5TA 3K02A 1PB7A 4ELPA 4DZ1A 1ZBMA 5F7VA 4NMYA 4F39A 3O6GA 4PFWA 4YKPA 4ZEIA 2Y7PA 2Z22A 4NF5A 2O1MA 1URGA 1MY2A 1SW2A 2OZZA 4THIA 5H8HA 1SVXB 3RT6B 2I0BA 5TP9B 1O64A 1PDAA 1F9BA 3KSJA 3H6TA 3OMBA 5IKBA 1FCKA 1P1WA 1POY1 2O51A 3PMVA 1MY1A 3LSFB 1SI0A 5I56B 3R26A 2F7CA 3B6QA 1MXZA 2Z8EA 3T22A 4EQ7A 1B52A 3FXRA 1B5IA 2O6AA 2UVGA 3HHFA 3D4CA 1XC1A 4OXVA 3UGWA 3RGYA 3PPRA 3N6UA 1ATGA 3TCGA 1MQJA 5B70A 1MS7A 3MPLA 3AXFA 3OENA 4R75A 1OIBA 1B0HA 2UVJA 2QMWA 5ITOA
chains in the Genus database with same CATH superfamily
1LBCA 3T66A 4ZEFA 1IXGA 3FBPA 1FBGA 3GYYA 2ONKE 5DTBA 1B46A 3HV1A 3KN8A 1QW0A 3HO7A 2KQZA 4MFIA 4ZEKA 1NV1A 5JEIA 4WXJA 4JSOA 1NNFA 4O3CA 4DXUA 1IMCA 3RQTA 4KYEA 1JETA 1NKXA 4OVPA 1H44A 1NUWA 2REJA 4G8HA 2V93A 1EYJA 1BTJA 4NF5B 1Y1ZA 4POXA 4LUBA 5AE4A 1FBPA 1PB9A 3H06B 1PBPA 1ZKBA 2YLNA 3HSTA 5H8HB 3KSXA 3MVXA 5FBPA 4NAPA 2F3BA 1GTKA 4G2ZA 5CMBA 4MLQA 1UTHA 2A5SA 3H6UA 4R74A 3PUYE 2DS9A 3D4GA 1ELJA 2R6GE 1OLCA 1J1NA 4OEUA 3DP6A 4KXPA 3OELA 2OK2A 4G8MA 3FXBA 3CFXA 4GXAA 1KZ8A 2VOZA 1INPA 2RKMA 1NNTA 4F22A 2OBGA 4HE0A 2HPGA 4YZZA 4PP0A 4GL0A 3MBPA 3QAXA 3ILUB 1JP4A 5I57B 3Q25A 2DXYA 5J16A 2Z23A 4TOZA 1LSTA 1FTMA 5K2XA 1B1XA 3IFCA 2F7BA 5AA2A 2ZZXA 2D5WA 2OWSA 2XXPA 1RYXA 3B50A 1FRPA 4YAHX 2Q74A 4OFLA 1P99A 3IOTA 3OOAA 1MY0A 2YJPA 4MNCA 3RYDA 1RDXA 3W9VA 4AS4A 5AA2D 3E13X 4ZZAA 1MXVA 5DVIA 3KBZA 4H8IA 4OVRA 1B7UA 1EU8A 1EZ9A 5DEXA 1QKBA 3W9WA 2HCAA 4IO6A 4NF8A 2XWIA 2HZLA 1LBBA 3EHSA 2F97A 4RYAA 1TWYA 3OXNA 4M1VA 3MVYA 2BJIA 4XTCQ 4G77A 2XHDA 1JW5A 1IXHA 4GXSB 3CSGA 3I5OA 4PE3A 3K00A 3RT8A 2DSFA 3N5LA 2I0CA 3RUMA 2D21A 2V3UA 2I3WA 5EYHA 4R9GA 1N7WA 3E79A 4GF8A 2E1SA 1LBVA 3CG1A 3CRBA 1M5FA 1NH7A 1B32A 1FPIA 3VVFA 1MY4A 4ZE9A 3LBSA 3DELB 4IGTA 1K9YA 4P3LA 4JVIA 2FYIA 3HPIA 3U8QA 5K2YA 5CMCA 5I7IA 3KN7A 4H45A 2XX8A 1A55A 2ZNTA 2AL5A 1N3XA 4Z7EA 3SDFA 3VXCA 2V3TA 1S9TA 2LAOA 4P11A 4DI3D 4U1OA 4MBPA 4TLMB 3LUYA 1NV0A 2HAUA 3C36A 2G93A 2DYXA 4LP2B 4GX4A 4OYVA 4F3GA 2NVUB 1H3DA 4EQBA 4R2BA 2MKZA 4QHQA 1Q1KA 1IMAA 1JW1A 4JDFA 3RTFB 3K01A 5I3SA 4QFNA 4ZEBA 4JB7A 2Q9TA 2QVUA 4NF8B 2XXVA 5L9OA 2ONSA 3PV0E 2DOJA 3TTNA 3VDFA 2DQVA 3BFTA 2XXIA 4BDOA 3O29A 4LZ5A 4AB6A 3EKIA 1DTGA 2QPQA 1CNQA 3MAMA 4O7MA 3S4UA 4ONYA 1OVBA 1UIUA 5AA4A 4WEPA 3A09A 3OD7A 3O6HA 3MC2A 1FQCA 2Y7KA 1LCTA 3PPOA 1HSEA 4PE5B 2XXXA 2H4IA 4O7IA 3IJXB 2IEEA 2RC8A 4F3BA 1B3HA 3R6UA 3ROJA 2PYYA 4NF6A 4NE4A 2JJKA 1D9VA 2VP1A 3FVOA 1P1OA 4U4SA 2KR0A 3U94A 1NV2A 5EHMA 3VV5A 3CR9A 5A5LA 5EQ8A 2I49A 4KYSA 4R72A 4YKIA 3FZVA 2O7IA 5I59A 1H45A 4PFRA 3S9MC 3ZSFA 1B4HA 1IMBA 4NWCA 5L9MA 2X26A 1DCUA 1LCFA 2REGA 3CHGA 1I6BA 1B3GA 4OZ9A 3OSRA 4OFJA 5FTIA 3N6TA 4POWA 5I2NA 1P1NA 4F31B 2HAVA 4GWYA 3PPQA 4FBPA 2O69A 3MUQA 3QUJA 3L6HA 1MXWA 2Q2CA 5IM2A 3NOHA 2DWJA 3TKDA 3PUZE 3TQWA 2AYSA 3CVGA 5TPAA 1D3KA 4LZ8A 3T9VA 1VE4A 4Q8RA 1O7TA 5CBSA 3EN3A 2H99A 1POTA 3E9XA 4QFLA 4BDMA 2QS1A 4ZEDA 5EYFA 4N4UA 1EZPA 4NEDA 5AA4B 5IAIA 2ZNSA 4GFRA 2QL3A 3B6TA 4N17A 5H8FB 4F3PA 4IR8A 3CFLA 3GBBA 4RA1A 5EYGA 4PDDA 3SEXA 5EQ9A 1IMDA 1QUJA 4G61A 4OQOA 4UA8A 5CMMA 2ESNA 4KCCA 2DXRA 3UP9A 3LUZA 2GH9A 2XA5A 5JTYB 4BDNA 4NF6B 1B58A 1EYKA 2H9BA 4NF4B 2PX1A 4DE8A 4I3YA 4XKRA 4N91A 4PCDA 1B05A 2XD2A 4GWWA 3FVNA 3PPPA 4MNIA 3MZ9A 1D9YA 4R73A 4GX3A 1SW5A 1TFAA 1MQIA 3TZAA 1QJMA 4F1UA 4N07A 1MPCA 1WDNA 3IB1A 1B5HA 5I59B 3MP1A 4Q30B 2Z8FA 1GGGA 2XX7A 4ELRA 1NUYA 4C1UA 4KI0E 4JBZA 3RNNA 1D4NA 4IY6A 2CZKA 4BDLA 1BKAA 3T96B 2F5XA 1PB8A 2WEFA 2Y5LA 4N13A 4FE8A 3FVKA 4FEBA 3S9NC 1R1NA 4FIMA 2VGQA 3O6IA 4NX1A 4BLAA 5A5XA 3U93A 4E0WA 4ESXA 4OHNA 4XXUA 4DI4B 1AMFA 3HHGA 2ANJA 3U92A 2XXHA 3C35A 2RINA 5TPAB 3ILTB 3MVWA 2ZXTA 4QF9A 2Q2AA 1Y3NA 3MYUA 5KDTB 4O3BA 1YYZA 1FJ9A 1LAGE 1XVYA 2PVUA 4P1LA 3TTMA 3QIMA 2R9JA 3TEPA 4NGUA 1I6QA 5H8NA 4X1DA 1UQWA 4OFOA 3VLUA 2P3VA 5ET8A 3PD9A 1FSAA 4RJZA 2DWIA 2H5YA 1LBWA 1AWBA 1OQHA 4QFOA 2OJTA 1LGBC 3IORA 1XI6A 5CC2A 2DVZA 4DXCA 4P1EA 1MXYA 2QVRA 4XF5A 2XX9A 2QS4A 3KG2A 3RPLA 2KLFA 2AL4A 2YPNA 4PFBA 2DDKA 4R6KA 1URSA 1M5CA 2WBDA 3VLVA 4NG7A 2DE2A 1XVXA 3ZKKA 1DTZA 1MDP1 1OLAA 3KZGA 4H8JA 1AOVA 4O3AA 4R2FA 2CMOA 4AB5A 4XKPA 1B1HA 4EF1A 2OWTA 1FPDA 2HXRA 2FIEA 3USDA 4KFQA 3TAJA 3LR1A 2THIA 2B4MA 4KPTA 3K6XA 4I9DA 3K2DA 1MH3A 1Y3QA 4YMAA 1FPEA 1MM6A 4G68A 2GFEA 5A5XB 1SD3A 3R7XA 3DM0A 3IR1A 3MSTA 4OERA 2RC7A 2DE4A 4KD5A 4F18A 4BDRA 3FXUA 3V83A 3KOSA 1LAFE 2ZYOA 4N6DA 1DMBA 2XXUA 3BBRA 4F2QA 3ZS6A 1DOTA 3E78A 3IOVA 1N0TA 3P7IA 2Q88A 3D1RA 4OA4A 3MPKA 2GHBA 1HSJA 1Z7ME 1FTJA 3UN6A 1LBXA 2ZZVA 2P0SA 3K6VA 5M2VA 5I58A 3KGCA 3T9UA 4UABA 4PFIA 3IB0A 2NWJA 3THIA 1QVSA 4PC9A 1NUXA 3TPAA 1T0KA 2F36A 2VPOA 2AIXA 5H8QA 2VT5A 3IX1A 4YKJA 2ZYMA 4JWYA 1I6AA 2Y7RA 3KJTA 4U22A 1JVXA 1B6HA 1FBEA 1MM7A 3SEUA 2OWZA 2F34A 3M3LA 1IITA 3MZ1A 4OENA 3KN3A 3UA8A 4PGNA 5ESYA 4NF0A 1WODA 1JEUA 4YB5A 3MW0A 2IA4A 3K1NA 1R6ZA 3L6GA 3FUZA 2FBPA 2HQ0A 2VD3A 3O66A 4PAFA 4RK9A 4OVQA 3O9PA 4C0RA 1US4A 1UTHB 2CZLA 4P8BA 3TTKA 1EYIA 4PBHA 3IFAA 5DVFA 3TCHA 3T1BA 4OETA 3B7DA 3LC8A 4G68B 3QXMA 4FEDA 4GRKA 4LA9A 4GVOA 1FPLA 2CZHA 4DXBA 5H8SA 4HCYA 3I3VA 3E3KA 1AIVA 3CFZA 1IEJA 4PDHA 2V3QA 1OQGA 3KEIA 3KJ7A 1FJ6A 4XKQA 4FATA 1ZJLA 5J1DA 3K4UA 1JNFA 1D9QA 1R9QA 3MQ9A 3FD3A 4JVCA 5HBCA 1YZ0A 1MY3A 4RK2A 3H6VA 5KZTA 4HE2A 5LDZA 4OANA 2I3VA 4LZ7A 5AA2B 1YAEA 5I58B 3BFUA 2CZIA 4ISUA 3UIFA 5IZ1A 1KA0A 3FV1A 3WAFA 2PFYA 2OCUA 4H46A 3TUSA 1ZMGA 4O8MA 4QXDA 2W7YA 1FBDA 3OSQA 3FJGA 2A5TA 1AL3A 2WYKA 4I8CA 3RY3A 4JSDA 4U1ZA 3RLFE 5B7DA 2ZMBA 3FV2A 4OESA 4C1TA 5DEXB 3ODBA 1NNKA 3IK6B 2F6GA 4N8GA 1N7XA 5ISUA 2O68A 4XKNA 2P3NA 5KCJA 1KA1A 5ET7A 3GZGA 1YPNA 1FPFA 1LFHA 1FBFA 4QBAA 5ICTA 1SBPA 4TLLB 4RY1A 3OO8A 1LBYA 3SESA 5IZZA 1FTLA 1WVJA 3V8XB 3G3FA 1FQDA 4NWDA 2I48A 5FTHA 1ZLQA 2CEYA 4OVTA 4R6HA 2Y7IA 4I40A 3G3GA 3EF7A 4H65A 3I6VA 3FVGA 4U21A 3H3GA 3U72A 2Q89A 3MP8A 1DPPA 3TYHA 4M4GA 1B51A 1B7HA 2DE3A 1DBZA 2Y84A 2R71A 4ZZEA 4FECA 4U23A 1N84A 5EQAA 3OEKA 2GHAA 2P1SA 4LQ5A 4KYDA 4F19A 2XXQA 3BKIB 1M5EA 4DLDA 2F6PA 4R6YA 3SEWA 3VXBA 4F29A 1G0IA 2GQ1A 2Y7WA 1BK4A 3TODA 3MP6A 1L5TA 3PD8A 1I69A 3Q29A 3FASA 3VFJA 3TMGA 1JW4A 2A5TB 3N94A 3S9LC 1II5A 3HCQA 3C32A 3OO7A 3Q27A 3OO6A 1SW1A 3G3IA 3C4MA 1LAHE 3TTRA 2Y5KA 1QUKA 1SQYA 4OVJA 2F3DA 1MPDA 5BUUA 4OEVA 4PTKA 2Q8JA 2RC9A 1RDYA 3JV9A 4HW8A 2PT1A 5KCJB 1IMEA 1CE2A 2ALUA 4MF3A 5FHOA 1VSOA 5DT6A 2FHYA 5ET6A 1VFEA 2WYPA 3FIRA 2UVHA 4NHBA 1MQHA 2L5VA 4GWSA 2QVVA 2NOOA 4R9FA 2ONRA 1RYOA 2QRYA 4MX6A 1Y4TA 2HHMA 1YXIA 4FJPA 3PU5A 2VHAA 4HTGA 4EDPA 2ABHA 4GBVA 2XWKA 4GL8A 4LONB 4DCYA 4F1VA 1IIWA 3ISPA 1Q35A 1Z7NE 3HN0A 3KC1A 2O84X 4DDDA 1YTVA 1A54A 3QK6A 5CM6A 3O28A 3SETA 2F78A 4MNPA 3PUVE 4H5GA 4N6KA 4RPNA 2UVIA 5L8DA 4NN3A 3S9EA 1USYH 3EHTA 3W15C 1IQ7A 4U4XA 3EHUA 2P2AA 2B4LA 4HCWA 1LAXA 1HSLA 1JVYA 1Y4CA 4JXIA 4N15A 4PGPA 4H5FA 1NFTA 1LFGA 1URDA 2XXWA 1NV5A 1A99A 5AA3A 2F7AA 3MJNA 2DVCA 3G3JA 1FPJA 1MH4A 5I2NB 1QUIA 1SPIA 3EPEA 3OO9A 4EXLA 1QGXA 1Y1MA 2GRVA 1LLSA 1MQDA 4GIZA 3MVZA 2ZYKA 3LSWA 4X1BA 2NUVA 1EH3A 1B2HA 1BIYA 5ELVA 2V84A 1IZ1A 1GVCA 4XIGQ 1G0HA 2R8TA 3M3FA 4ELOA 1QULA 1YCJA 3VVEA 4G8NA 4X48A 1XT8A 1NL5A 2UXAA 1LFIA 3TELA 5CRYA 1MQGA 4OVSA 3DP8A 5L9SA 3PPNA 1FPBA 3O2AA 4PFYA 4FAJA 3IO4A 5DVJA 4QSDA 2QSXA 3JYRA 4YICA 4WKMA 5I57A 4H0WA 3V89B 1ZIUA 3M3KA 3KC0A 1OVTA 3EQ1A 3WAEA 4UACA 4GWOA 1N76A 3BIGA 3FATA 2WBBA 2PT2A 3T0JA 1SW4A 4MHFA 4MJOA 4IO5A 4IO2A 1XHYA 4PFTA 3ZKLA 3C31A 4G4PA 1ZU0A 5ET5A 2QS2A 2PMSA 3C9HA 4AQ4A 3MZBA 4HS7A 3UK4A 1NH8A 4F3SA 5AA1A 4U2RA 4HE1A 4I3EA 2O7UA 2CEXA 1H76A 2PBWA 3IAZA 5ICQA 2B3BA 2XXYA 3IJOB 1DK4A 5LOMA 3RN8A 4MH5A 1BP5A 4JVDA 4KCDA 2UYEA 3TQLA 4GWZA 1JEVA 1RDZA 3GLBA 2RCBA 3DP4A 3IOWA 1OMPA 3UORA 1Y9UA 3B6WA 1SI1A 3ONMA 3IL1B 2FIXA 4MMPA 1NV7A 4WEDA 4IY5A 3SEYA 3RTWB 5I2KA 1MRPA 1XS5A 4RPOA 4ZECA 1MPBA 4EF2A 4XFEA 5H8NB 2QJEA 3SZPA 4QRZA 5FHMA 1NV4A 2DP8A 4FORA 3CIJA 2PCRA 3G7WA 3K1MA 2V4CA 2DWAA 1IUDA 1CB6A 2HZKA 1FQAA 3U65A 1NNPA 3N26A 3RPLB 2HEUA 1GR2A 2Z8DA 2QFLA 3KBRA 2QMXA 4DIGA 1GV8A 2B65A 5EHSA 3ECRA 1B5JA 4P9KA 4P0IA 5IGAA 2X7PA 4E0XA 1QKAA 1PC3A 1FPGA 5T3JA 4BDQA 2BJJX 4MCOA 4EXKA 1LBZA 4GWXA 4RXLA 1SYHA 1MXXA 3A3CA 2FA7A 1B40A 1BLFA 5HM4B 5I5PA 3DLNA 4EQ9A 1N3WA 3H6WA 4H6DA 3E4RA 5CBRA 4AS5A 2FNCA 1TT1A 4PF6A 3C33A 2F8DA 4IO4A 2HXWA 4P0GA 3O97A 3FGSA 1IMFA 4KQPA 4LN5A 2I4CA 5CI5A 2OX3A 1SYIA 4GX6A 1TXFA 4OWDA 1US5A 1S50A 4QSCA 4NTLA 3VLWA 5DW8A 2VD2A 4F1YA 1FPKA 4YB6A 1NV3A 5I2KB 2I6EA 2XXRA 1A7LA 2OLBA 4RNSA 3SKPA 2D3IA 3H4ZA 2RF1A 1FBCA 1P1UA 1H43A 1PEBA 3QSLA 2B3FA 1Y20A 1VDWA 1S7YA 3C34A 4IO7A 3T9HB 3M8UA 1ANFA 1PBQA 3RPWA 4F2OA 5EQ7A 4LQ2A 2ZZWA 2NXOA 1MDQA 3LSXA 4PBQA 1VR5A 4MEVA 5BWJA 1VFDA 4GQOA 5H8QB 5HPQA 2H25A 1B3EA 4YU0A 4GLIA 3KFMA 4P56A 4X9TA 5IZ3A 3FJ7A 4L17A 3OEMA 4H1XA 1R9LA 1UIVA 3U1OA 5ITPA 2F35A 4NQ8A 3TTLA 1LB9A 5LTCA 1Y3PA 2ZNUA 3GBAA 1A8FA 1B3LA 1XOCA 4PQJA 4QFKA 3LSLA 4N81A 5I84A 1KWHA 2RCAA 3PMXA 2XWOA 3QMFA 4KR5A 4JWXA 3FJMA 1DSNA 4PAKA 4PFUA 4IGRA 2WX9A 2WKYA 1IXCA 1UTBA 4TQUQ 4IO3A 1B0LA 1MG1A 3Q28A 4GBWA 5CMKA 3PUXE 2HFBA 4ELQA 3GXAA 1FTKA 5JK4A 1DPEA 4QFPA 5FHNA 4PAIA 5H8FA 3BIHA 3CG3A 3QYTA 1EZOA 2FVZA 4MAGA 1NMUA 3FXQA 3CSBA 3K6UA 3TCFA 4JWOA 1FTOA 4OTEA 3B8BA 2M8CA 5TU0A 1B9JA 5JTYA 2I4BA 4N6PA 2XXTA 3TDJA 4H67A 1A40A 4Z0IA 2XWVA 2G29A 4LVQA 3KOTA 4NF4A 4ZDMA 1O63A 4K3FA 2X7QA 4ECFA 1M5BA 1NUZA 1FQBA 3PGFA 1N04A 4KHZE 3K6WA 3G3HA 1K9ZA 1SDXA 1USYE 2PFZA 3Q26A 3IO6A 4YMBA 3VE1B 3SERA 2ZYNA 4HXVA 3LV0A 2H98A 3T9XB 2V25A 1B7ZA 2O1LA 1FQEA 3K0VA 4LATA 3F11A 4DCXA 1MXUA 3JZJA 4MIJA 3MWBA 5TP9A 1M5DA 3PMWA 3PUWE 5IZ3B 1B3FA 1A8EA 1IXIA 3H7MA 4ZS9A 2QS3A 1NI9A 5F24A 1RKMA 1FQFA 4ZE8A 3S2VA 2Q8MA 5I56A 3TFLA 1Q9DA 4GOTA 2DWHA 3QUFA 4I1DA 4MLVA 2E0SA 3IOUA 4I62A 2VPNA 1P1QA 4G68C 4IB2A 4Q0CA 1UTBB 4GD5A 3CI8A 5KDTA 4YB7A 2I58A 5DYHA 3A3UA 3IB2A 4ESWA 4QSEA 3SEVA 3VVDA 1TFDA 4ND9A 4GWUA 2XD3A 3K1PA 1ZTYA 4OMBA 4X8RA 3H03A 4EUOA 1AH5A 1FW0A 2UYFA 3G3KA 1LB8A 3T93B 5F1QA 4PETA 1B4ZA 3PTYA 4YKKA 4N8YA 1JQFA 3V5AA 4Q5TA 4XEQA 3K02A 1PB7A 4ELPA 4DZ1A 1ZBMA 5F7VA 4NMYA 4F39A 3O6GA 1LEVA 4PFWA 4YKPA 4ZEIA 2Y7PA 2Z22A 4NF5A 2O1MA 1URGA 1MY2A 1SW2A 2OZZA 4THIA 5H8HA 1SVXB 3RT6B 2I0BA 3HFUA 5TP9B 1O64A 1PDAA 1F9BA 3KSJA 3H6TA 3OMBA 5IKBA 1FCKA 1P1WA 1POY1 2XXKA 2O51A 3PMVA 1MY1A 3LSFB 4X04A 1SI0A 5I56B 3R26A 4P47A 2F7CA 3B6QA 1MXZA 2Z8EA 3T22A 1FBHA 4EQ7A 1B52A 3FXRA 1B5IA 2O6AA 2UVGA 3HHFA 3D4CA 1XC1A 4OXVA 3UGWA 3RGYA 3PPRA 3N6UA 1ATGA 4O94A 3TCGA 1MQJA 5B70A 3A29A 1MS7A 1FTAA 3MPLA 3AXFA 1NV6A 4PF8A 3OENA 4R75A 1OIBA 1B0HA 2UVJA 2QMWA 5ITOA
chains in the Genus database with same CATH topology
1LBCA 3T66A 4ZEFA 1IXGA 2ONKE 5DTBA 1B46A 3HV1A 3KN8A 1QW0A 3HO7A 4MFIA 4ZEKA 5JEIA 4WXJA 4JSOA 1NNFA 4O3CA 4DXUA 3RQTA 4KYEA 1JETA 1NKXA 1H44A 2REJA 4G8HA 2V93A 1BTJA 4NF5B 1Y1ZA 4POXA 4LUBA 5AE4A 1PB9A 3H06B 1PBPA 1ZKBA 2YLNA 3HSTA 5H8HB 3KSXA 3MVXA 1GTKA 4G2ZA 5CMBA 4MLQA 1UTHA 2A5SA 3H6UA 4R74A 3PUYE 2DS9A 3D4GA 1ELJA 2R6GE 1OLCA 1J1NA 4OEUA 3DP6A 3OELA 2OK2A 4G8MA 3CFXA 4GXAA 2VOZA 2RKMA 1NNTA 4F22A 2OBGA 4YZZA 4PP0A 4GL0A 3MBPA 3QAXA 3ILUB 5I57B 3Q25A 2DXYA 2Z23A 4TOZA 1LSTA 1FTMA 5K2XA 1B1XA 2F7BA 5AA2A 2D5WA 2OWSA 2XXPA 1RYXA 4YAHX 4OFLA 1P99A 3IOTA 3OOAA 1MY0A 2YJPA 3W9VA 5AA2D 3E13X 4ZZAA 1MXVA 5DVIA 4H8IA 1B7UA 1EU8A 1EZ9A 5DEXA 1QKBA 3W9WA 2HCAA 4IO6A 4NF8A 2HZLA 1LBBA 3EHSA 2F97A 4RYAA 1TWYA 3OXNA 4M1VA 3MVYA 4XTCQ 4G77A 2XHDA 1JW5A 1IXHA 4GXSB 3CSGA 3I5OA 3K00A 3RT8A 2DSFA 3N5LA 2I0CA 3RUMA 2D21A 2V3UA 2I3WA 4R9GA 1N7WA 4GF8A 2E1SA 3CG1A 3CRBA 1M5FA 1NH7A 1B32A 3VVFA 1MY4A 4ZE9A 3LBSA 3DELB 4IGTA 2FYIA 3HPIA 3U8QA 5K2YA 5CMCA 3KN7A 2XX8A 1A55A 2ZNTA 2AL5A 1N3XA 4Z7EA 3SDFA 3VXCA 2V3TA 1S9TA 2LAOA 4P11A 4U1OA 4MBPA 4TLMB 3LUYA 2HAUA 3C36A 2G93A 2DYXA 4LP2B 4OYVA 4F3GA 2NVUB 1H3DA 4EQBA 4R2BA 4QHQA 1Q1KA 1JW1A 4JDFA 3RTFB 3K01A 4QFNA 4ZEBA 4JB7A 2Q9TA 4NF8B 2XXVA 5L9OA 2ONSA 3PV0E 2DOJA 3TTNA 3VDFA 2DQVA 3BFTA 2XXIA 4BDOA 3O29A 4LZ5A 4AB6A 1DTGA 2QPQA 3MAMA 3S4UA 4ONYA 1OVBA 1UIUA 5AA4A 4WEPA 3A09A 3OD7A 3O6HA 3MC2A 1FQCA 2Y7KA 1LCTA 3PPOA 1HSEA 4PE5B 2XXXA 2H4IA 3IJXB 2IEEA 2RC8A 4F3BA 1B3HA 3R6UA 2PYYA 4NF6A 4NE4A 1D9VA 2VP1A 3FVOA 1P1OA 4U4SA 3U94A 5EHMA 3VV5A 3CR9A 2I49A 4KYSA 4R72A 4YKIA 3FZVA 2O7IA 5I59A 1H45A 3S9MC 3ZSFA 1B4HA 4NWCA 5L9MA 2X26A 1LCFA 2REGA 1I6BA 1B3GA 4OZ9A 3OSRA 4OFJA 5FTIA 3N6TA 4POWA 5I2NA 1P1NA 4F31B 2HAVA 3PPQA 2O69A 3MUQA 3QUJA 3L6HA 1MXWA 2Q2CA 2DWJA 3TKDA 3PUZE 3TQWA 2AYSA 3CVGA 5TPAA 1D3KA 4LZ8A 3T9VA 1VE4A 4Q8RA 1O7TA 5CBSA 3EN3A 2H99A 1POTA 3E9XA 4BDMA 4QFLA 2QS1A 4ZEDA 5EYFA 1EZPA 4NEDA 5AA4B 5IAIA 2ZNSA 4GFRA 2QL3A 3B6TA 5H8FB 4F3PA 3CFLA 3GBBA 4RA1A 3SEXA 1QUJA 4OQOA 4UA8A 5CMMA 2ESNA 4KCCA 2DXRA 3UP9A 2GH9A 5JTYB 4BDNA 4NF6B 1B58A 2H9BA 4NF4B 2PX1A 4DE8A 4XKRA 1B05A 2XD2A 3FVNA 3PPPA 3MZ9A 1D9YA 4R73A 1SW5A 1TFAA 1MQIA 3TZAA 1QJMA 4F1UA 4N07A 1MPCA 1WDNA 3IB1A 1B5HA 5I59B 3MP1A 4Q30B 2Z8FA 1GGGA 2XX7A 4ELRA 4C1UA 4KI0E 4JBZA 3RNNA 1D4NA 4IY6A 4BDLA 1BKAA 3T96B 2F5XA 1PB8A 4N13A 4FE8A 3FVKA 4FEBA 3S9NC 1R1NA 4FIMA 2VGQA 3O6IA 4BLAA 5A5XA 3U93A 4E0WA 4ESXA 4OHNA 4XXUA 1AMFA 3HHGA 2ANJA 3U92A 2XXHA 3C35A 2RINA 5TPAB 3ILTB 3MVWA 2ZXTA 4QF9A 2Q2AA 1Y3NA 5KDTB 4O3BA 1LAGE 1XVYA 2PVUA 3TTMA 3QIMA 2R9JA 3TEPA 1I6QA 5H8NA 4X1DA 1UQWA 4OFOA 3VLUA 3PD9A 4RJZA 2DWIA 2H5YA 1OQHA 4QFOA 2OJTA 1LGBC 3IORA 5CC2A 2DVZA 4DXCA 1MXYA 2XX9A 2QS4A 3KG2A 2KLFA 2AL4A 2YPNA 4R6KA 1URSA 1M5CA 3VLVA 2DE2A 1XVXA 3ZKKA 1DTZA 1MDP1 1OLAA 3KZGA 4H8JA 1AOVA 4O3AA 4R2FA 2CMOA 4AB5A 4XKPA 1B1HA 4EF1A 2OWTA 3USDA 4KFQA 3TAJA 3LR1A 2THIA 4KPTA 3K6XA 4I9DA 3K2DA 1MH3A 1Y3QA 4YMAA 1MM6A 4G68A 2GFEA 5A5XB 1SD3A 3R7XA 3DM0A 3IR1A 4OERA 2RC7A 2DE4A 4KD5A 4F18A 4BDRA 3FXUA 3V83A 3KOSA 1LAFE 2ZYOA 1DMBA 2XXUA 3BBRA 4F2QA 3ZS6A 1DOTA 3IOVA 1N0TA 3P7IA 2Q88A 3MPKA 2GHBA 1HSJA 1Z7ME 1FTJA 3UN6A 2P0SA 3K6VA 5M2VA 5I58A 3KGCA 3T9UA 3IB0A 2NWJA 3THIA 1QVSA 1T0KA 3TPAA 2F36A 2AIXA 5H8QA 3IX1A 4YKJA 2ZYMA 4JWYA 1I6AA 2Y7RA 3KJTA 4U22A 1JVXA 1B6HA 1MM7A 3SEUA 3M3LA 2F34A 3MZ1A 1IITA 4OENA 3KN3A 3UA8A 1WODA 1JEUA 4YB5A 3MW0A 2IA4A 3K1NA 1R6ZA 3L6GA 3FUZA 2HQ0A 2VD3A 3O66A 4RK9A 3O9PA 4C0RA 1US4A 1UTHB 2CZLA 3TTKA 5DVFA 3TCHA 4OETA 3B7DA 3LC8A 4G68B 3QXMA 4FEDA 4GRKA 4LA9A 4GVOA 4DXBA 5H8SA 4HCYA 3I3VA 3E3KA 1AIVA 3CFZA 1IEJA 2V3QA 1OQGA 3KEIA 3KJ7A 4XKQA 4FATA 1ZJLA 5J1DA 3K4UA 1JNFA 1R9QA 3MQ9A 3FD3A 5HBCA 1MY3A 4RK2A 3H6VA 5KZTA 2I3VA 4LZ7A 5AA2B 1YAEA 5I58B 3BFUA 4ISUA 3UIFA 3FV1A 3WAFA 2OCUA 3TUSA 1ZMGA 2W7YA 3OSQA 3FJGA 2A5TA 1AL3A 4I8CA 3RY3A 4JSDA 4U1ZA 3RLFE 5B7DA 2ZMBA 3FV2A 4OESA 4C1TA 5DEXB 3ODBA 1NNKA 3IK6B 2F6GA 1N7XA 5ISUA 2O68A 4XKNA 5KCJA 3GZGA 1YPNA 1LFHA 5ICTA 1SBPA 4TLLB 4RY1A 3OO8A 3SESA 1FTLA 1WVJA 3V8XB 3G3FA 1FQDA 4NWDA 2I48A 5FTHA 1ZLQA 4R6HA 2Y7IA 3G3GA 3EF7A 4H65A 3I6VA 3FVGA 4U21A 3H3GA 3U72A 2Q89A 3MP8A 1DPPA 3TYHA 4M4GA 1B51A 1B7HA 2DE3A 2Y84A 2R71A 4ZZEA 4FECA 4U23A 1N84A 3OEKA 2GHAA 2P1SA 4LQ5A 4KYDA 4F19A 2XXQA 3BKIB 1M5EA 4DLDA 2F6PA 4R6YA 3SEWA 3VXBA 4F29A 2Y7WA 3TODA 3MP6A 1L5TA 3PD8A 1I69A 3Q29A 3FASA 3VFJA 3TMGA 1JW4A 2A5TB 3N94A 3S9LC 1II5A 3HCQA 3C32A 3OO7A 3Q27A 3OO6A 1SW1A 3G3IA 3C4MA 1LAHE 3TTRA 1QUKA 1SQYA 4OVJA 1MPDA 5BUUA 4OEVA 2Q8JA 2RC9A 3JV9A 4HW8A 2PT1A 5KCJB 1CE2A 2ALUA 4MF3A 5FHOA 1VSOA 5DT6A 1VFEA 3FIRA 2UVHA 1MQHA 2NOOA 4R9FA 2ONRA 1RYOA 2QRYA 1Y4TA 4FJPA 3PU5A 2VHAA 4HTGA 4EDPA 2ABHA 4GL8A 4LONB 4DCYA 4F1VA 1IIWA 1Q35A 1Z7NE 3HN0A 2O84X 4DDDA 1YTVA 1A54A 3QK6A 5CM6A 3O28A 3SETA 2F78A 3PUVE 4H5GA 4RPNA 2UVIA 5L8DA 3S9EA 1USYH 3EHTA 3W15C 1IQ7A 4U4XA 3EHUA 2P2AA 4HCWA 1LAXA 1HSLA 1JVYA 1Y4CA 4JXIA 4H5FA 1NFTA 1LFGA 1URDA 2XXWA 1A99A 5AA3A 2F7AA 3MJNA 2DVCA 3G3JA 1MH4A 5I2NB 1QUIA 3EPEA 3OO9A 4EXLA 1Y1MA 2GRVA 1LLSA 1MQDA 4GIZA 3MVZA 2ZYKA 3LSWA 4X1BA 2NUVA 1EH3A 1B2HA 1BIYA 5ELVA 2V84A 1IZ1A 1GVCA 4XIGQ 3M3FA 4ELOA 1QULA 1YCJA 3VVEA 4G8NA 4X48A 1XT8A 1NL5A 2UXAA 1LFIA 3TELA 5CRYA 1MQGA 3DP8A 5L9SA 3PPNA 3O2AA 4PFYA 4FAJA 3IO4A 5DVJA 4QSDA 2QSXA 3JYRA 4YICA 4WKMA 5I57A 4H0WA 3V89B 1ZIUA 3M3KA 1OVTA 3EQ1A 3WAEA 4UACA 4GWOA 1N76A 3FATA 2PT2A 1SW4A 4IO5A 4IO2A 1XHYA 4PFTA 3ZKLA 3C31A 4G4PA 1ZU0A 2QS2A 2PMSA 3C9HA 4AQ4A 3MZBA 4HS7A 3UK4A 1NH8A 4F3SA 5AA1A 4U2RA 2O7UA 1H76A 2PBWA 3IAZA 5ICQA 2B3BA 2XXYA 3IJOB 5LOMA 3RN8A 4MH5A 1BP5A 4KCDA 2UYEA 3TQLA 1JEVA 3GLBA 2RCBA 3DP4A 3IOWA 1OMPA 3UORA 1Y9UA 3B6WA 1SI1A 3ONMA 3IL1B 4WEDA 4IY5A 3SEYA 3RTWB 5I2KA 1MRPA 1XS5A 4RPOA 4ZECA 1MPBA 4EF2A 5H8NB 2QJEA 4QRZA 5FHMA 2DP8A 4FORA 3CIJA 3G7WA 3K1MA 2DWAA 1IUDA 1CB6A 2HZKA 1FQAA 1NNPA 3N26A 2HEUA 1GR2A 2Z8DA 3KBRA 2QMXA 4DIGA 1GV8A 2B65A 5EHSA 3ECRA 1B5JA 4P0IA 2X7PA 4E0XA 1QKAA 1PC3A 4BDQA 2BJJX 4EXKA 4RXLA 1SYHA 1MXXA 3A3CA 2FA7A 1B40A 1BLFA 5HM4B 3DLNA 4EQ9A 1N3WA 3H6WA 4H6DA 3E4RA 5CBRA 2FNCA 1TT1A 3C33A 2F8DA 4IO4A 2HXWA 4P0GA 3O97A 3FGSA 4KQPA 2I4CA 5CI5A 1SYIA 1TXFA 4OWDA 1US5A 1S50A 4QSCA 4NTLA 3VLWA 2VD2A 4F1YA 4YB6A 5I2KB 2I6EA 2XXRA 1A7LA 2OLBA 4RNSA 3SKPA 2D3IA 3H4ZA 2RF1A 1P1UA 1H43A 1PEBA 3QSLA 2B3FA 1Y20A 1S7YA 3C34A 4IO7A 3T9HB 3M8UA 1ANFA 1PBQA 3RPWA 4F2OA 4LQ2A 2NXOA 1MDQA 3LSXA 1VR5A 5BWJA 1VFDA 4GQOA 5H8QB 5HPQA 2H25A 1B3EA 4YU0A 4GLIA 3KFMA 4X9TA 3FJ7A 4L17A 3OEMA 4H1XA 1R9LA 1UIVA 3U1OA 5ITPA 2F35A 3TTLA 1LB9A 1Y3PA 2ZNUA 3GBAA 1A8FA 1B3LA 1XOCA 4PQJA 4QFKA 3LSLA 5I84A 1KWHA 2RCAA 3PMXA 4KR5A 4JWXA 3FJMA 1DSNA 4PFUA 4IGRA 2WKYA 1IXCA 1UTBA 4TQUQ 4IO3A 1B0LA 1MG1A 3Q28A 5CMKA 3PUXE 2HFBA 4ELQA 3GXAA 1FTKA 5JK4A 1DPEA 4QFPA 5FHNA 5H8FA 3CG3A 3QYTA 1EZOA 1NMUA 3FXQA 3CSBA 3K6UA 3TCFA 4JWOA 1FTOA 4OTEA 2M8CA 5TU0A 1B9JA 5JTYA 2I4BA 4N6PA 2XXTA 3TDJA 4H67A 1A40A 4Z0IA 2G29A 4LVQA 3KOTA 4NF4A 4ZDMA 1O63A 4K3FA 2X7QA 4ECFA 1M5BA 1FQBA 3PGFA 1N04A 4KHZE 3K6WA 3G3HA 1SDXA 1USYE 3Q26A 3IO6A 4YMBA 3VE1B 3SERA 2ZYNA 2H98A 3T9XB 2V25A 1B7ZA 2O1LA 1FQEA 3K0VA 4LATA 3F11A 4DCXA 1MXUA 3JZJA 3MWBA 5TP9A 1M5DA 3PMWA 3PUWE 1B3FA 1A8EA 1IXIA 3H7MA 4ZS9A 2QS3A 1RKMA 1FQFA 4ZE8A 3S2VA 5I56A 3TFLA 4GOTA 2DWHA 3QUFA 4I1DA 4MLVA 2E0SA 3IOUA 4I62A 1P1QA 4G68C 4IB2A 4Q0CA 1UTBB 4GD5A 3CI8A 5KDTA 4YB7A 2I58A 5DYHA 3A3UA 3IB2A 4ESWA 4QSEA 3SEVA 3VVDA 1TFDA 4ND9A 2XD3A 3K1PA 1ZTYA 4OMBA 3H03A 4EUOA 1AH5A 1FW0A 2UYFA 3G3KA 1LB8A 3T93B 5F1QA 4PETA 1B4ZA 4YKKA 1JQFA 3V5AA 4Q5TA 3K02A 1PB7A 4ELPA 4DZ1A 1ZBMA 5F7VA 4NMYA 4F39A 3O6GA 4PFWA 4YKPA 4ZEIA 2Y7PA 2Z22A 4NF5A 2O1MA 1URGA 1MY2A 1SW2A 2OZZA 4THIA 5H8HA 1SVXB 3RT6B 2I0BA 5TP9B 1O64A 1PDAA 1F9BA 3KSJA 3H6TA 3OMBA 5IKBA 1FCKA 1P1WA 1POY1 2O51A 3PMVA 1MY1A 3LSFB 1SI0A 5I56B 3R26A 2F7CA 3B6QA 1MXZA 2Z8EA 3T22A 4EQ7A 1B52A 3FXRA 1B5IA 2O6AA 2UVGA 3HHFA 3D4CA 1XC1A 4OXVA 3UGWA 3RGYA 3PPRA 3N6UA 1ATGA 3TCGA 1MQJA 5B70A 1MS7A 3MPLA 3AXFA 3OENA 4R75A 1OIBA 1B0HA 2UVJA 2QMWA 5ITOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LBC A;  3T66 A;  4ZEF A;  1IXG A;  2ONK E;  5DTB A;  1B46 A;  3HV1 A;  3KN8 A;  1QW0 A;  3HO7 A;  4MFI A;  4ZEK A;  5JEI A;  4WXJ A;  4JSO A;  1NNF A;  4O3C A;  4DXU A;  3RQT A;  4KYE A;  1JET A;  1NKX A;  1H44 A;  2REJ A;  4G8H A;  2V93 A;  1BTJ A;  4NF5 B;  1Y1Z A;  4POX A;  4LUB A;  5AE4 A;  1PB9 A;  3H06 B;  1PBP A;  1ZKB A;  2YLN A;  3HST A;  5H8H B;  3KSX A;  3MVX A;  1GTK A;  4G2Z A;  5CMB A;  4MLQ A;  1UTH A;  2A5S A;  3H6U A;  4R74 A;  3PUY E;  2DS9 A;  3D4G A;  1ELJ A;  2R6G E;  1OLC A;  1J1N A;  4OEU A;  3DP6 A;  3OEL A;  2OK2 A;  4G8M A;  3CFX A;  4GXA A;  2VOZ A;  2RKM A;  1NNT A;  4F22 A;  2OBG A;  4YZZ A;  4PP0 A;  4GL0 A;  3MBP A;  3QAX A;  3ILU B;  5I57 B;  3Q25 A;  2DXY A;  2Z23 A;  4TOZ A;  1LST A;  1FTM A;  5K2X A;  1B1X A;  2F7B A;  5AA2 A;  2D5W A;  2OWS A;  2XXP A;  1RYX A;  4YAH X;  4OFL A;  1P99 A;  3IOT A;  3OOA A;  1MY0 A;  2YJP A;  3W9V A;  5AA2 D;  3E13 X;  4ZZA A;  1MXV A;  5DVI A;  4H8I A;  1B7U A;  1EU8 A;  1EZ9 A;  5DEX A;  1QKB A;  3W9W A;  2HCA A;  4IO6 A;  4NF8 A;  2HZL A;  1LBB A;  3EHS A;  2F97 A;  4RYA A;  1TWY A;  3OXN A;  4M1V A;  3MVY A;  4XTC Q;  4G77 A;  2XHD A;  1JW5 A;  1IXH A;  4GXS B;  3CSG A;  3I5O A;  3K00 A;  3RT8 A;  2DSF A;  3N5L A;  2I0C A;  3RUM A;  2D21 A;  2V3U A;  2I3W A;  4R9G A;  1N7W A;  4GF8 A;  2E1S A;  3CG1 A;  3CRB A;  1M5F A;  1NH7 A;  1B32 A;  3VVF A;  1MY4 A;  4ZE9 A;  3LBS A;  3DEL B;  4IGT A;  2FYI A;  3HPI A;  3U8Q A;  5K2Y A;  5CMC A;  3KN7 A;  2XX8 A;  1A55 A;  2ZNT A;  2AL5 A;  1N3X A;  4Z7E A;  3SDF A;  3VXC A;  2V3T A;  1S9T A;  2LAO A;  4P11 A;  4U1O A;  4MBP A;  4TLM B;  3LUY A;  2HAU A;  3C36 A;  2G93 A;  2DYX A;  4LP2 B;  4OYV A;  4F3G A;  2NVU B;  1H3D A;  4EQB A;  4R2B A;  4QHQ A;  1Q1K A;  1JW1 A;  4JDF A;  3RTF B;  3K01 A;  4QFN A;  4ZEB A;  4JB7 A;  2Q9T A;  4NF8 B;  2XXV A;  5L9O A;  2ONS A;  3PV0 E;  2DOJ A;  3TTN A;  3VDF A;  2DQV A;  3BFT A;  2XXI A;  4BDO A;  3O29 A;  4LZ5 A;  4AB6 A;  1DTG A;  2QPQ A;  3MAM A;  3S4U A;  4ONY A;  1OVB A;  1UIU A;  5AA4 A;  4WEP A;  3A09 A;  3OD7 A;  3O6H A;  3MC2 A;  1FQC A;  2Y7K A;  1LCT A;  3PPO A;  1HSE A;  4PE5 B;  2XXX A;  2H4I A;  3IJX B;  2IEE A;  2RC8 A;  4F3B A;  1B3H A;  3R6U A;  2PYY A;  4NF6 A;  4NE4 A;  1D9V A;  2VP1 A;  3FVO A;  1P1O A;  4U4S A;  3U94 A;  5EHM A;  3VV5 A;  3CR9 A;  2I49 A;  4KYS A;  4R72 A;  4YKI A;  3FZV A;  2O7I A;  5I59 A;  1H45 A;  3S9M C;  3ZSF A;  1B4H A;  4NWC A;  5L9M A;  2X26 A;  1LCF A;  2REG A;  1I6B A;  1B3G A;  4OZ9 A;  3OSR A;  4OFJ A;  5FTI A;  3N6T A;  4POW A;  5I2N A;  1P1N A;  4F31 B;  2HAV A;  3PPQ A;  2O69 A;  3MUQ A;  3QUJ A;  3L6H A;  1MXW A;  2Q2C A;  2DWJ A;  3TKD A;  3PUZ E;  3TQW A;  2AYS A;  3CVG A;  5TPA A;  1D3K A;  4LZ8 A;  3T9V A;  1VE4 A;  4Q8R A;  1O7T A;  5CBS A;  3EN3 A;  2H99 A;  1POT A;  3E9X A;  4BDM A;  4QFL A;  2QS1 A;  4ZED A;  5EYF A;  1EZP A;  4NED A;  5AA4 B;  5IAI A;  2ZNS A;  4GFR A;  2QL3 A;  3B6T A;  5H8F B;  4F3P A;  3CFL A;  3GBB A;  4RA1 A;  3SEX A;  1QUJ A;  4OQO A;  4UA8 A;  5CMM A;  2ESN A;  4KCC A;  2DXR A;  3UP9 A;  2GH9 A;  5JTY B;  4BDN A;  4NF6 B;  1B58 A;  2H9B A;  4NF4 B;  2PX1 A;  4DE8 A;  4XKR A;  1B05 A;  2XD2 A;  3FVN A;  3PPP A;  3MZ9 A;  1D9Y A;  4R73 A;  1SW5 A;  1TFA A;  1MQI A;  3TZA A;  1QJM A;  4F1U A;  4N07 A;  1MPC A;  1WDN A;  3IB1 A;  1B5H A;  5I59 B;  3MP1 A;  4Q30 B;  2Z8F A;  1GGG A;  2XX7 A;  4ELR A;  4C1U A;  4KI0 E;  4JBZ A;  3RNN A;  1D4N A;  4IY6 A;  4BDL A;  1BKA A;  3T96 B;  2F5X A;  1PB8 A;  4N13 A;  4FE8 A;  3FVK A;  4FEB A;  3S9N C;  1R1N A;  4FIM A;  2VGQ A;  3O6I A;  4BLA A;  5A5X A;  3U93 A;  4E0W A;  4ESX A;  4OHN A;  4XXU A;  1AMF A;  3HHG A;  2ANJ A;  3U92 A;  2XXH A;  3C35 A;  2RIN A;  5TPA B;  3ILT B;  3MVW A;  2ZXT A;  4QF9 A;  2Q2A A;  1Y3N A;  5KDT B;  4O3B A;  1LAG E;  1XVY A;  2PVU A;  3TTM A;  3QIM A;  2R9J A;  3TEP A;  1I6Q A;  5H8N A;  4X1D A;  1UQW A;  4OFO A;  3VLU A;  3PD9 A;  4RJZ A;  2DWI A;  2H5Y A;  1OQH A;  4QFO A;  2OJT A;  1LGB C;  3IOR A;  5CC2 A;  2DVZ A;  4DXC A;  1MXY A;  2XX9 A;  2QS4 A;  3KG2 A;  2KLF A;  2AL4 A;  2YPN A;  4R6K A;  1URS A;  1M5C A;  3VLV A;  2DE2 A;  1XVX A;  3ZKK A;  1DTZ A;  1MDP 1;  1OLA A;  3KZG A;  4H8J A;  1AOV A;  4O3A A;  4R2F A;  2CMO A;  4AB5 A;  4XKP A;  1B1H A;  4EF1 A;  2OWT A;  3USD A;  4KFQ A;  3TAJ A;  3LR1 A;  2THI A;  4KPT A;  3K6X A;  4I9D A;  3K2D A;  1MH3 A;  1Y3Q A;  4YMA A;  1MM6 A;  4G68 A;  2GFE A;  5A5X B;  1SD3 A;  3R7X A;  3DM0 A;  3IR1 A;  4OER A;  2RC7 A;  2DE4 A;  4KD5 A;  4F18 A;  4BDR A;  3FXU A;  3V83 A;  3KOS A;  1LAF E;  2ZYO A;  1DMB A;  2XXU A;  3BBR A;  4F2Q A;  3ZS6 A;  1DOT A;  3IOV A;  1N0T A;  3P7I A;  2Q88 A;  3MPK A;  2GHB A;  1HSJ A;  1Z7M E;  1FTJ A;  3UN6 A;  2P0S A;  3K6V A;  5M2V A;  5I58 A;  3KGC A;  3T9U A;  3IB0 A;  2NWJ A;  3THI A;  1QVS A;  1T0K A;  3TPA A;  2F36 A;  2AIX A;  5H8Q A;  3IX1 A;  4YKJ A;  2ZYM A;  4JWY A;  1I6A A;  2Y7R A;  3KJT A;  4U22 A;  1JVX A;  1B6H A;  1MM7 A;  3SEU A;  3M3L A;  2F34 A;  3MZ1 A;  1IIT A;  4OEN A;  3KN3 A;  3UA8 A;  1WOD A;  1JEU A;  4YB5 A;  3MW0 A;  2IA4 A;  3K1N A;  1R6Z A;  3L6G A;  3FUZ A;  2HQ0 A;  2VD3 A;  3O66 A;  4RK9 A;  3O9P A;  4C0R A;  1US4 A;  1UTH B;  2CZL A;  3TTK A;  5DVF A;  3TCH A;  4OET A;  3B7D A;  3LC8 A;  4G68 B;  3QXM A;  4FED A;  4GRK A;  4LA9 A;  4GVO A;  4DXB A;  5H8S A;  4HCY A;  3I3V A;  3E3K A;  1AIV A;  3CFZ A;  1IEJ A;  2V3Q A;  1OQG A;  3KEI A;  3KJ7 A;  4XKQ A;  4FAT A;  1ZJL A;  5J1D A;  3K4U A;  1JNF A;  1R9Q A;  3MQ9 A;  3FD3 A;  5HBC A;  1MY3 A;  4RK2 A;  3H6V A;  5KZT A;  2I3V A;  4LZ7 A;  5AA2 B;  1YAE A;  5I58 B;  3BFU A;  4ISU A;  3UIF A;  3FV1 A;  3WAF A;  2OCU A;  3TUS A;  1ZMG A;  2W7Y A;  3OSQ A;  3FJG A;  2A5T A;  1AL3 A;  4I8C A;  3RY3 A;  4JSD A;  4U1Z A;  3RLF E;  5B7D A;  2ZMB A;  3FV2 A;  4OES A;  4C1T A;  5DEX B;  3ODB A;  1NNK A;  3IK6 B;  2F6G A;  1N7X A;  5ISU A;  2O68 A;  4XKN A;  5KCJ A;  3GZG A;  1YPN A;  1LFH A;  5ICT A;  1SBP A;  4TLL B;  4RY1 A;  3OO8 A;  3SES A;  1FTL A;  1WVJ A;  3V8X B;  3G3F A;  1FQD A;  4NWD A;  2I48 A;  5FTH A;  1ZLQ A;  4R6H A;  2Y7I A;  3G3G A;  3EF7 A;  4H65 A;  3I6V A;  3FVG A;  4U21 A;  3H3G A;  3U72 A;  2Q89 A;  3MP8 A;  1DPP A;  3TYH A;  4M4G A;  1B51 A;  1B7H A;  2DE3 A;  2Y84 A;  2R71 A;  4ZZE A;  4FEC A;  4U23 A;  1N84 A;  3OEK A;  2GHA A;  2P1S A;  4LQ5 A;  4KYD A;  4F19 A;  2XXQ A;  3BKI B;  1M5E A;  4DLD A;  2F6P A;  4R6Y A;  3SEW A;  3VXB A;  4F29 A;  2Y7W A;  3TOD A;  3MP6 A;  1L5T A;  3PD8 A;  1I69 A;  3Q29 A;  3FAS A;  3VFJ A;  3TMG A;  1JW4 A;  2A5T B;  3N94 A;  3S9L C;  1II5 A;  3HCQ A;  3C32 A;  3OO7 A;  3Q27 A;  3OO6 A;  1SW1 A;  3G3I A;  3C4M A;  1LAH E;  3TTR A;  1QUK A;  1SQY A;  4OVJ A;  1MPD A;  5BUU A;  4OEV A;  2Q8J A;  2RC9 A;  3JV9 A;  4HW8 A;  2PT1 A;  5KCJ B;  1CE2 A;  2ALU A;  4MF3 A;  5FHO A;  1VSO A;  5DT6 A;  1VFE A;  3FIR A;  2UVH A;  1MQH A;  2NOO A;  4R9F A;  2ONR A;  1RYO A;  2QRY A;  1Y4T A;  4FJP A;  3PU5 A;  2VHA A;  4HTG A;  4EDP A;  2ABH A;  4GL8 A;  4LON B;  4DCY A;  4F1V A;  1IIW A;  1Q35 A;  1Z7N E;  3HN0 A;  2O84 X;  4DDD A;  1YTV A;  1A54 A;  3QK6 A;  5CM6 A;  3O28 A;  3SET A;  2F78 A;  3PUV E;  4H5G A;  4RPN A;  2UVI A;  5L8D A;  3S9E A;  1USY H;  3EHT A;  3W15 C;  1IQ7 A;  4U4X A;  3EHU A;  2P2A A;  4HCW A;  1LAX A;  1HSL A;  1JVY A;  1Y4C A;  4JXI A;  4H5F A;  1NFT A;  1LFG A;  1URD A;  2XXW A;  1A99 A;  5AA3 A;  2F7A A;  3MJN A;  2DVC A;  3G3J A;  1MH4 A;  5I2N B;  1QUI A;  3EPE A;  3OO9 A;  4EXL A;  1Y1M A;  2GRV A;  1LLS A;  1MQD A;  4GIZ A;  3MVZ A;  2ZYK A;  3LSW A;  4X1B A;  2NUV A;  1EH3 A;  1B2H A;  1BIY A;  5ELV A;  2V84 A;  1IZ1 A;  1GVC A;  4XIG Q;  3M3F A;  4ELO A;  1QUL A;  1YCJ A;  3VVE A;  4G8N A;  4X48 A;  1XT8 A;  1NL5 A;  2UXA A;  1LFI A;  3TEL A;  5CRY A;  1MQG A;  3DP8 A;  5L9S A;  3PPN A;  3O2A A;  4PFY A;  4FAJ A;  3IO4 A;  5DVJ A;  4QSD A;  2QSX A;  3JYR A;  4YIC A;  4WKM A;  5I57 A;  4H0W A;  3V89 B;  1ZIU A;  3M3K A;  1OVT A;  3EQ1 A;  3WAE A;  4UAC A;  4GWO A;  1N76 A;  3FAT A;  2PT2 A;  1SW4 A;  4IO5 A;  4IO2 A;  1XHY A;  4PFT A;  3ZKL A;  3C31 A;  4G4P A;  1ZU0 A;  2QS2 A;  2PMS A;  3C9H A;  4AQ4 A;  3MZB A;  4HS7 A;  3UK4 A;  1NH8 A;  4F3S A;  5AA1 A;  4U2R A;  2O7U A;  1H76 A;  2PBW A;  3IAZ A;  5ICQ A;  2B3B A;  2XXY A;  3IJO B;  5LOM A;  3RN8 A;  4MH5 A;  1BP5 A;  4KCD A;  2UYE A;  3TQL A;  1JEV A;  3GLB A;  2RCB A;  3DP4 A;  3IOW A;  1OMP A;  3UOR A;  1Y9U A;  3B6W A;  1SI1 A;  3ONM A;  3IL1 B;  4WED A;  4IY5 A;  3SEY A;  3RTW B;  5I2K A;  1MRP A;  1XS5 A;  4RPO A;  4ZEC A;  1MPB A;  4EF2 A;  5H8N B;  2QJE A;  4QRZ A;  5FHM A;  2DP8 A;  4FOR A;  3CIJ A;  3G7W A;  3K1M A;  2DWA A;  1IUD A;  1CB6 A;  2HZK A;  1FQA A;  1NNP A;  3N26 A;  2HEU A;  1GR2 A;  2Z8D A;  3KBR A;  2QMX A;  4DIG A;  1GV8 A;  2B65 A;  5EHS A;  3ECR A;  1B5J A;  4P0I A;  2X7P A;  4E0X A;  1QKA A;  1PC3 A;  4BDQ A;  2BJJ X;  4EXK A;  4RXL A;  1SYH A;  1MXX A;  3A3C A;  2FA7 A;  1B40 A;  1BLF A;  5HM4 B;  3DLN A;  4EQ9 A;  1N3W A;  3H6W A;  4H6D A;  3E4R A;  5CBR A;  2FNC A;  1TT1 A;  3C33 A;  2F8D A;  4IO4 A;  2HXW A;  4P0G A;  3O97 A;  3FGS A;  4KQP A;  2I4C A;  5CI5 A;  1SYI A;  1TXF A;  4OWD A;  1US5 A;  1S50 A;  4QSC A;  4NTL A;  3VLW A;  2VD2 A;  4F1Y A;  4YB6 A;  5I2K B;  2I6E A;  2XXR A;  1A7L A;  2OLB A;  4RNS A;  3SKP A;  2D3I A;  3H4Z A;  2RF1 A;  1P1U A;  1H43 A;  1PEB A;  3QSL A;  2B3F A;  1Y20 A;  1S7Y A;  3C34 A;  4IO7 A;  3T9H B;  3M8U A;  1ANF A;  1PBQ A;  3RPW A;  4F2O A;  4LQ2 A;  2NXO A;  1MDQ A;  3LSX A;  1VR5 A;  5BWJ A;  1VFD A;  4GQO A;  5H8Q B;  5HPQ A;  2H25 A;  1B3E A;  4YU0 A;  4GLI A;  3KFM A;  4X9T A;  3FJ7 A;  4L17 A;  3OEM A;  4H1X A;  1R9L A;  1UIV A;  3U1O A;  5ITP A;  2F35 A;  3TTL A;  1LB9 A;  1Y3P A;  2ZNU A;  3GBA A;  1A8F A;  1B3L A;  1XOC A;  4PQJ A;  4QFK A;  3LSL A;  5I84 A;  1KWH A;  2RCA A;  3PMX A;  4KR5 A;  4JWX A;  3FJM A;  1DSN A;  4PFU A;  4IGR A;  2WKY A;  1IXC A;  1UTB A;  4TQU Q;  4IO3 A;  1B0L A;  1MG1 A;  3Q28 A;  5CMK A;  3PUX E;  2HFB A;  4ELQ A;  3GXA A;  1FTK A;  5JK4 A;  1DPE A;  4QFP A;  5FHN A;  5H8F A;  3CG3 A;  3QYT A;  1EZO A;  1NMU A;  3FXQ A;  3CSB A;  3K6U A;  3TCF A;  4JWO A;  1FTO A;  4OTE A;  2M8C A;  5TU0 A;  1B9J A;  5JTY A;  2I4B A;  4N6P A;  2XXT A;  3TDJ A;  4H67 A;  1A40 A;  4Z0I A;  2G29 A;  4LVQ A;  3KOT A;  4NF4 A;  4ZDM A;  1O63 A;  4K3F A;  2X7Q A;  4ECF A;  1M5B A;  1FQB A;  3PGF A;  1N04 A;  4KHZ E;  3K6W A;  3G3H A;  1SDX A;  1USY E;  3Q26 A;  3IO6 A;  4YMB A;  3VE1 B;  3SER A;  2ZYN A;  2H98 A;  3T9X B;  2V25 A;  1B7Z A;  2O1L A;  1FQE A;  3K0V A;  4LAT A;  3F11 A;  4DCX A;  1MXU A;  3JZJ A;  3MWB A;  5TP9 A;  1M5D A;  3PMW A;  3PUW E;  1B3F A;  1A8E A;  1IXI A;  3H7M A;  4ZS9 A;  2QS3 A;  1RKM A;  1FQF A;  4ZE8 A;  3S2V A;  5I56 A;  3TFL A;  4GOT A;  2DWH A;  3QUF A;  4I1D A;  4MLV A;  2E0S A;  3IOU A;  4I62 A;  1P1Q A;  4G68 C;  4IB2 A;  4Q0C A;  1UTB B;  4GD5 A;  3CI8 A;  5KDT A;  4YB7 A;  2I58 A;  5DYH A;  3A3U A;  3IB2 A;  4ESW A;  4QSE A;  3SEV A;  3VVD A;  1TFD A;  4ND9 A;  2XD3 A;  3K1P A;  1ZTY A;  4OMB A;  3H03 A;  4EUO A;  1AH5 A;  1FW0 A;  2UYF A;  3G3K A;  1LB8 A;  3T93 B;  5F1Q A;  4PET A;  1B4Z A;  4YKK A;  1JQF A;  3V5A A;  4Q5T A;  3K02 A;  1PB7 A;  4ELP A;  4DZ1 A;  1ZBM A;  5F7V A;  4NMY A;  4F39 A;  3O6G A;  4PFW A;  4YKP A;  4ZEI A;  2Y7P A;  2Z22 A;  4NF5 A;  2O1M A;  1URG A;  1MY2 A;  1SW2 A;  2OZZ A;  4THI A;  5H8H A;  1SVX B;  3RT6 B;  2I0B A;  5TP9 B;  1O64 A;  1PDA A;  1F9B A;  3KSJ A;  3H6T A;  3OMB A;  5IKB A;  1FCK A;  1P1W A;  1POY 1;  2O51 A;  3PMV A;  1MY1 A;  3LSF B;  1SI0 A;  5I56 B;  3R26 A;  2F7C A;  3B6Q A;  1MXZ A;  2Z8E A;  3T22 A;  4EQ7 A;  1B52 A;  3FXR A;  1B5I A;  2O6A A;  2UVG A;  3HHF A;  3D4C A;  1XC1 A;  4OXV A;  3UGW A;  3RGY A;  3PPR A;  3N6U A;  1ATG A;  3TCG A;  1MQJ A;  5B70 A;  1MS7 A;  3MPL A;  3AXF A;  3OEN A;  4R75 A;  1OIB A;  1B0H A;  2UVJ A;  2QMW A;  5ITO A; 
#chains in the Genus database with same CATH topology
 1LBC A;  3T66 A;  4ZEF A;  1IXG A;  3FBP A;  1FBG A;  3GYY A;  2ONK E;  5DTB A;  1B46 A;  3HV1 A;  3KN8 A;  1QW0 A;  3HO7 A;  2KQZ A;  4MFI A;  4ZEK A;  1NV1 A;  5JEI A;  4WXJ A;  4JSO A;  1NNF A;  4O3C A;  4DXU A;  1IMC A;  3RQT A;  4KYE A;  1JET A;  1NKX A;  4OVP A;  1H44 A;  1NUW A;  2REJ A;  4G8H A;  2V93 A;  1EYJ A;  1BTJ A;  4NF5 B;  1Y1Z A;  4POX A;  4LUB A;  5AE4 A;  1FBP A;  1PB9 A;  3H06 B;  1PBP A;  1ZKB A;  2YLN A;  3HST A;  5H8H B;  3KSX A;  3MVX A;  5FBP A;  4NAP A;  2F3B A;  1GTK A;  4G2Z A;  5CMB A;  4MLQ A;  1UTH A;  2A5S A;  3H6U A;  4R74 A;  3PUY E;  2DS9 A;  3D4G A;  1ELJ A;  2R6G E;  1OLC A;  1J1N A;  4OEU A;  3DP6 A;  4KXP A;  3OEL A;  2OK2 A;  4G8M A;  3FXB A;  3CFX A;  4GXA A;  1KZ8 A;  2VOZ A;  1INP A;  2RKM A;  1NNT A;  4F22 A;  2OBG A;  4HE0 A;  2HPG A;  4YZZ A;  4PP0 A;  4GL0 A;  3MBP A;  3QAX A;  3ILU B;  1JP4 A;  5I57 B;  3Q25 A;  2DXY A;  5J16 A;  2Z23 A;  4TOZ A;  1LST A;  1FTM A;  5K2X A;  1B1X A;  3IFC A;  2F7B A;  5AA2 A;  2ZZX A;  2D5W A;  2OWS A;  2XXP A;  1RYX A;  3B50 A;  1FRP A;  4YAH X;  2Q74 A;  4OFL A;  1P99 A;  3IOT A;  3OOA A;  1MY0 A;  2YJP A;  4MNC A;  3RYD A;  1RDX A;  3W9V A;  4AS4 A;  5AA2 D;  3E13 X;  4ZZA A;  1MXV A;  5DVI A;  3KBZ A;  4H8I A;  4OVR A;  1B7U A;  1EU8 A;  1EZ9 A;  5DEX A;  1QKB A;  3W9W A;  2HCA A;  4IO6 A;  4NF8 A;  2XWI A;  2HZL A;  1LBB A;  3EHS A;  2F97 A;  4RYA A;  1TWY A;  3OXN A;  4M1V A;  3MVY A;  2BJI A;  4XTC Q;  4G77 A;  2XHD A;  1JW5 A;  1IXH A;  4GXS B;  3CSG A;  3I5O A;  4PE3 A;  3K00 A;  3RT8 A;  2DSF A;  3N5L A;  2I0C A;  3RUM A;  2D21 A;  2V3U A;  2I3W A;  5EYH A;  4R9G A;  1N7W A;  3E79 A;  4GF8 A;  2E1S A;  1LBV A;  3CG1 A;  3CRB A;  1M5F A;  1NH7 A;  1B32 A;  1FPI A;  3VVF A;  1MY4 A;  4ZE9 A;  3LBS A;  3DEL B;  4IGT A;  1K9Y A;  4P3L A;  4JVI A;  2FYI A;  3HPI A;  3U8Q A;  5K2Y A;  5CMC A;  5I7I A;  3KN7 A;  4H45 A;  2XX8 A;  1A55 A;  2ZNT A;  2AL5 A;  1N3X A;  4Z7E A;  3SDF A;  3VXC A;  2V3T A;  1S9T A;  2LAO A;  4P11 A;  4DI3 D;  4U1O A;  4MBP A;  4TLM B;  3LUY A;  1NV0 A;  2HAU A;  3C36 A;  2G93 A;  2DYX A;  4LP2 B;  4GX4 A;  4OYV A;  4F3G A;  2NVU B;  1H3D A;  4EQB A;  4R2B A;  2MKZ A;  4QHQ A;  1Q1K A;  1IMA A;  1JW1 A;  4JDF A;  3RTF B;  3K01 A;  5I3S A;  4QFN A;  4ZEB A;  4JB7 A;  2Q9T A;  2QVU A;  4NF8 B;  2XXV A;  5L9O A;  2ONS A;  3PV0 E;  2DOJ A;  3TTN A;  3VDF A;  2DQV A;  3BFT A;  2XXI A;  4BDO A;  3O29 A;  4LZ5 A;  4AB6 A;  3EKI A;  1DTG A;  2QPQ A;  1CNQ A;  3MAM A;  4O7M A;  3S4U A;  4ONY A;  1OVB A;  1UIU A;  5AA4 A;  4WEP A;  3A09 A;  3OD7 A;  3O6H A;  3MC2 A;  1FQC A;  2Y7K A;  1LCT A;  3PPO A;  1HSE A;  4PE5 B;  2XXX A;  2H4I A;  4O7I A;  3IJX B;  2IEE A;  2RC8 A;  4F3B A;  1B3H A;  3R6U A;  3ROJ A;  2PYY A;  4NF6 A;  4NE4 A;  2JJK A;  1D9V A;  2VP1 A;  3FVO A;  1P1O A;  4U4S A;  2KR0 A;  3U94 A;  1NV2 A;  5EHM A;  3VV5 A;  3CR9 A;  5A5L A;  5EQ8 A;  2I49 A;  4KYS A;  4R72 A;  4YKI A;  3FZV A;  2O7I A;  5I59 A;  1H45 A;  4PFR A;  3S9M C;  3ZSF A;  1B4H A;  1IMB A;  4NWC A;  5L9M A;  2X26 A;  1DCU A;  1LCF A;  2REG A;  3CHG A;  1I6B A;  1B3G A;  4OZ9 A;  3OSR A;  4OFJ A;  5FTI A;  3N6T A;  4POW A;  5I2N A;  1P1N A;  4F31 B;  2HAV A;  4GWY A;  3PPQ A;  4FBP A;  2O69 A;  3MUQ A;  3QUJ A;  3L6H A;  1MXW A;  2Q2C A;  5IM2 A;  3NOH A;  2DWJ A;  3TKD A;  3PUZ E;  3TQW A;  2AYS A;  3CVG A;  5TPA A;  1D3K A;  4LZ8 A;  3T9V A;  1VE4 A;  4Q8R A;  1O7T A;  5CBS A;  3EN3 A;  2H99 A;  1POT A;  3E9X A;  4QFL A;  4BDM A;  2QS1 A;  4ZED A;  5EYF A;  4N4U A;  1EZP A;  4NED A;  5AA4 B;  5IAI A;  2ZNS A;  4GFR A;  2QL3 A;  3B6T A;  4N17 A;  5H8F B;  4F3P A;  4IR8 A;  3CFL A;  3GBB A;  4RA1 A;  5EYG A;  4PDD A;  3SEX A;  5EQ9 A;  1IMD A;  1QUJ A;  4G61 A;  4OQO A;  4UA8 A;  5CMM A;  2ESN A;  4KCC A;  2DXR A;  3UP9 A;  3LUZ A;  2GH9 A;  2XA5 A;  5JTY B;  4BDN A;  4NF6 B;  1B58 A;  1EYK A;  2H9B A;  4NF4 B;  2PX1 A;  4DE8 A;  4I3Y A;  4XKR A;  4N91 A;  4PCD A;  1B05 A;  2XD2 A;  4GWW A;  3FVN A;  3PPP A;  4MNI A;  3MZ9 A;  1D9Y A;  4R73 A;  4GX3 A;  1SW5 A;  1TFA A;  1MQI A;  3TZA A;  1QJM A;  4F1U A;  4N07 A;  1MPC A;  1WDN A;  3IB1 A;  1B5H A;  5I59 B;  3MP1 A;  4Q30 B;  2Z8F A;  1GGG A;  2XX7 A;  4ELR A;  1NUY A;  4C1U A;  4KI0 E;  4JBZ A;  3RNN A;  1D4N A;  4IY6 A;  2CZK A;  4BDL A;  1BKA A;  3T96 B;  2F5X A;  1PB8 A;  2WEF A;  2Y5L A;  4N13 A;  4FE8 A;  3FVK A;  4FEB A;  3S9N C;  1R1N A;  4FIM A;  2VGQ A;  3O6I A;  4NX1 A;  4BLA A;  5A5X A;  3U93 A;  4E0W A;  4ESX A;  4OHN A;  4XXU A;  4DI4 B;  1AMF A;  3HHG A;  2ANJ A;  3U92 A;  2XXH A;  3C35 A;  2RIN A;  5TPA B;  3ILT B;  3MVW A;  2ZXT A;  4QF9 A;  2Q2A A;  1Y3N A;  3MYU A;  5KDT B;  4O3B A;  1YYZ A;  1FJ9 A;  1LAG E;  1XVY A;  2PVU A;  4P1L A;  3TTM A;  3QIM A;  2R9J A;  3TEP A;  4NGU A;  1I6Q A;  5H8N A;  4X1D A;  1UQW A;  4OFO A;  3VLU A;  2P3V A;  5ET8 A;  3PD9 A;  1FSA A;  4RJZ A;  2DWI A;  2H5Y A;  1LBW A;  1AWB A;  1OQH A;  4QFO A;  2OJT A;  1LGB C;  3IOR A;  1XI6 A;  5CC2 A;  2DVZ A;  4DXC A;  4P1E A;  1MXY A;  2QVR A;  4XF5 A;  2XX9 A;  2QS4 A;  3KG2 A;  3RPL A;  2KLF A;  2AL4 A;  2YPN A;  4PFB A;  2DDK A;  4R6K A;  1URS A;  1M5C A;  2WBD A;  3VLV A;  4NG7 A;  2DE2 A;  1XVX A;  3ZKK A;  1DTZ A;  1MDP 1;  1OLA A;  3KZG A;  4H8J A;  1AOV A;  4O3A A;  4R2F A;  2CMO A;  4AB5 A;  4XKP A;  1B1H A;  4EF1 A;  2OWT A;  1FPD A;  2HXR A;  2FIE A;  3USD A;  4KFQ A;  3TAJ A;  3LR1 A;  2THI A;  2B4M A;  4KPT A;  3K6X A;  4I9D A;  3K2D A;  1MH3 A;  1Y3Q A;  4YMA A;  1FPE A;  1MM6 A;  4G68 A;  2GFE A;  5A5X B;  1SD3 A;  3R7X A;  3DM0 A;  3IR1 A;  3MST A;  4OER A;  2RC7 A;  2DE4 A;  4KD5 A;  4F18 A;  4BDR A;  3FXU A;  3V83 A;  3KOS A;  1LAF E;  2ZYO A;  4N6D A;  1DMB A;  2XXU A;  3BBR A;  4F2Q A;  3ZS6 A;  1DOT A;  3E78 A;  3IOV A;  1N0T A;  3P7I A;  2Q88 A;  3D1R A;  4OA4 A;  3MPK A;  2GHB A;  1HSJ A;  1Z7M E;  1FTJ A;  3UN6 A;  1LBX A;  2ZZV A;  2P0S A;  3K6V A;  5M2V A;  5I58 A;  3KGC A;  3T9U A;  4UAB A;  4PFI A;  3IB0 A;  2NWJ A;  3THI A;  1QVS A;  4PC9 A;  1NUX A;  3TPA A;  1T0K A;  2F36 A;  2VPO A;  2AIX A;  5H8Q A;  2VT5 A;  3IX1 A;  4YKJ A;  2ZYM A;  4JWY A;  1I6A A;  2Y7R A;  3KJT A;  4U22 A;  1JVX A;  1B6H A;  1FBE A;  1MM7 A;  3SEU A;  2OWZ A;  2F34 A;  3M3L A;  1IIT A;  3MZ1 A;  4OEN A;  3KN3 A;  3UA8 A;  4PGN A;  5ESY A;  4NF0 A;  1WOD A;  1JEU A;  4YB5 A;  3MW0 A;  2IA4 A;  3K1N A;  1R6Z A;  3L6G A;  3FUZ A;  2FBP A;  2HQ0 A;  2VD3 A;  3O66 A;  4PAF A;  4RK9 A;  4OVQ A;  3O9P A;  4C0R A;  1US4 A;  1UTH B;  2CZL A;  4P8B A;  3TTK A;  1EYI A;  4PBH A;  3IFA A;  5DVF A;  3TCH A;  3T1B A;  4OET A;  3B7D A;  3LC8 A;  4G68 B;  3QXM A;  4FED A;  4GRK A;  4LA9 A;  4GVO A;  1FPL A;  2CZH A;  4DXB A;  5H8S A;  4HCY A;  3I3V A;  3E3K A;  1AIV A;  3CFZ A;  1IEJ A;  4PDH A;  2V3Q A;  1OQG A;  3KEI A;  3KJ7 A;  1FJ6 A;  4XKQ A;  4FAT A;  1ZJL A;  5J1D A;  3K4U A;  1JNF A;  1D9Q A;  1R9Q A;  3MQ9 A;  3FD3 A;  4JVC A;  5HBC A;  1YZ0 A;  1MY3 A;  4RK2 A;  3H6V A;  5KZT A;  4HE2 A;  5LDZ A;  4OAN A;  2I3V A;  4LZ7 A;  5AA2 B;  1YAE A;  5I58 B;  3BFU A;  2CZI A;  4ISU A;  3UIF A;  5IZ1 A;  1KA0 A;  3FV1 A;  3WAF A;  2PFY A;  2OCU A;  4H46 A;  3TUS A;  1ZMG A;  4O8M A;  4QXD A;  2W7Y A;  1FBD A;  3OSQ A;  3FJG A;  2A5T A;  1AL3 A;  2WYK A;  4I8C A;  3RY3 A;  4JSD A;  4U1Z A;  3RLF E;  5B7D A;  2ZMB A;  3FV2 A;  4OES A;  4C1T A;  5DEX B;  3ODB A;  1NNK A;  3IK6 B;  2F6G A;  4N8G A;  1N7X A;  5ISU A;  2O68 A;  4XKN A;  2P3N A;  5KCJ A;  1KA1 A;  5ET7 A;  3GZG A;  1YPN A;  1FPF A;  1LFH A;  1FBF A;  4QBA A;  5ICT A;  1SBP A;  4TLL B;  4RY1 A;  3OO8 A;  1LBY A;  3SES A;  5IZZ A;  1FTL A;  1WVJ A;  3V8X B;  3G3F A;  1FQD A;  4NWD A;  2I48 A;  5FTH A;  1ZLQ A;  2CEY A;  4OVT A;  4R6H A;  2Y7I A;  4I40 A;  3G3G A;  3EF7 A;  4H65 A;  3I6V A;  3FVG A;  4U21 A;  3H3G A;  3U72 A;  2Q89 A;  3MP8 A;  1DPP A;  3TYH A;  4M4G A;  1B51 A;  1B7H A;  2DE3 A;  1DBZ A;  2Y84 A;  2R71 A;  4ZZE A;  4FEC A;  4U23 A;  1N84 A;  5EQA A;  3OEK A;  2GHA A;  2P1S A;  4LQ5 A;  4KYD A;  4F19 A;  2XXQ A;  3BKI B;  1M5E A;  4DLD A;  2F6P A;  4R6Y A;  3SEW A;  3VXB A;  4F29 A;  1G0I A;  2GQ1 A;  2Y7W A;  1BK4 A;  3TOD A;  3MP6 A;  1L5T A;  3PD8 A;  1I69 A;  3Q29 A;  3FAS A;  3VFJ A;  3TMG A;  1JW4 A;  2A5T B;  3N94 A;  3S9L C;  1II5 A;  3HCQ A;  3C32 A;  3OO7 A;  3Q27 A;  3OO6 A;  1SW1 A;  3G3I A;  3C4M A;  1LAH E;  3TTR A;  2Y5K A;  1QUK A;  1SQY A;  4OVJ A;  2F3D A;  1MPD A;  5BUU A;  4OEV A;  4PTK A;  2Q8J A;  2RC9 A;  1RDY A;  3JV9 A;  4HW8 A;  2PT1 A;  5KCJ B;  1IME A;  1CE2 A;  2ALU A;  4MF3 A;  5FHO A;  1VSO A;  5DT6 A;  2FHY A;  5ET6 A;  1VFE A;  2WYP A;  3FIR A;  2UVH A;  4NHB A;  1MQH A;  2L5V A;  4GWS A;  2QVV A;  2NOO A;  4R9F A;  2ONR A;  1RYO A;  2QRY A;  4MX6 A;  1Y4T A;  2HHM A;  1YXI A;  4FJP A;  3PU5 A;  2VHA A;  4HTG A;  4EDP A;  2ABH A;  4GBV A;  2XWK A;  4GL8 A;  4LON B;  4DCY A;  4F1V A;  1IIW A;  3ISP A;  1Q35 A;  1Z7N E;  3HN0 A;  3KC1 A;  2O84 X;  4DDD A;  1YTV A;  1A54 A;  3QK6 A;  5CM6 A;  3O28 A;  3SET A;  2F78 A;  4MNP A;  3PUV E;  4H5G A;  4N6K A;  4RPN A;  2UVI A;  5L8D A;  4NN3 A;  3S9E A;  1USY H;  3EHT A;  3W15 C;  1IQ7 A;  4U4X A;  3EHU A;  2P2A A;  2B4L A;  4HCW A;  1LAX A;  1HSL A;  1JVY A;  1Y4C A;  4JXI A;  4N15 A;  4PGP A;  4H5F A;  1NFT A;  1LFG A;  1URD A;  2XXW A;  1NV5 A;  1A99 A;  5AA3 A;  2F7A A;  3MJN A;  2DVC A;  3G3J A;  1FPJ A;  1MH4 A;  5I2N B;  1QUI A;  1SPI A;  3EPE A;  3OO9 A;  4EXL A;  1QGX A;  1Y1M A;  2GRV A;  1LLS A;  1MQD A;  4GIZ A;  3MVZ A;  2ZYK A;  3LSW A;  4X1B A;  2NUV A;  1EH3 A;  1B2H A;  1BIY A;  5ELV A;  2V84 A;  1IZ1 A;  1GVC A;  4XIG Q;  1G0H A;  2R8T A;  3M3F A;  4ELO A;  1QUL A;  1YCJ A;  3VVE A;  4G8N A;  4X48 A;  1XT8 A;  1NL5 A;  2UXA A;  1LFI A;  3TEL A;  5CRY A;  1MQG A;  4OVS A;  3DP8 A;  5L9S A;  3PPN A;  1FPB A;  3O2A A;  4PFY A;  4FAJ A;  3IO4 A;  5DVJ A;  4QSD A;  2QSX A;  3JYR A;  4YIC A;  4WKM A;  5I57 A;  4H0W A;  3V89 B;  1ZIU A;  3M3K A;  3KC0 A;  1OVT A;  3EQ1 A;  3WAE A;  4UAC A;  4GWO A;  1N76 A;  3BIG A;  3FAT A;  2WBB A;  2PT2 A;  3T0J A;  1SW4 A;  4MHF A;  4MJO A;  4IO5 A;  4IO2 A;  1XHY A;  4PFT A;  3ZKL A;  3C31 A;  4G4P A;  1ZU0 A;  5ET5 A;  2QS2 A;  2PMS A;  3C9H A;  4AQ4 A;  3MZB A;  4HS7 A;  3UK4 A;  1NH8 A;  4F3S A;  5AA1 A;  4U2R A;  4HE1 A;  4I3E A;  2O7U A;  2CEX A;  1H76 A;  2PBW A;  3IAZ A;  5ICQ A;  2B3B A;  2XXY A;  3IJO B;  1DK4 A;  5LOM A;  3RN8 A;  4MH5 A;  1BP5 A;  4JVD A;  4KCD A;  2UYE A;  3TQL A;  4GWZ A;  1JEV A;  1RDZ A;  3GLB A;  2RCB A;  3DP4 A;  3IOW A;  1OMP A;  3UOR A;  1Y9U A;  3B6W A;  1SI1 A;  3ONM A;  3IL1 B;  2FIX A;  4MMP A;  1NV7 A;  4WED A;  4IY5 A;  3SEY A;  3RTW B;  5I2K A;  1MRP A;  1XS5 A;  4RPO A;  4ZEC A;  1MPB A;  4EF2 A;  4XFE A;  5H8N B;  2QJE A;  3SZP A;  4QRZ A;  5FHM A;  1NV4 A;  2DP8 A;  4FOR A;  3CIJ A;  2PCR A;  3G7W A;  3K1M A;  2V4C A;  2DWA A;  1IUD A;  1CB6 A;  2HZK A;  1FQA A;  3U65 A;  1NNP A;  3N26 A;  3RPL B;  2HEU A;  1GR2 A;  2Z8D A;  2QFL A;  3KBR A;  2QMX A;  4DIG A;  1GV8 A;  2B65 A;  5EHS A;  3ECR A;  1B5J A;  4P9K A;  4P0I A;  5IGA A;  2X7P A;  4E0X A;  1QKA A;  1PC3 A;  1FPG A;  5T3J A;  4BDQ A;  2BJJ X;  4MCO A;  4EXK A;  1LBZ A;  4GWX A;  4RXL A;  1SYH A;  1MXX A;  3A3C A;  2FA7 A;  1B40 A;  1BLF A;  5HM4 B;  5I5P A;  3DLN A;  4EQ9 A;  1N3W A;  3H6W A;  4H6D A;  3E4R A;  5CBR A;  4AS5 A;  2FNC A;  1TT1 A;  4PF6 A;  3C33 A;  2F8D A;  4IO4 A;  2HXW A;  4P0G A;  3O97 A;  3FGS A;  1IMF A;  4KQP A;  4LN5 A;  2I4C A;  5CI5 A;  2OX3 A;  1SYI A;  4GX6 A;  1TXF A;  4OWD A;  1US5 A;  1S50 A;  4QSC A;  4NTL A;  3VLW A;  5DW8 A;  2VD2 A;  4F1Y A;  1FPK A;  4YB6 A;  1NV3 A;  5I2K B;  2I6E A;  2XXR A;  1A7L A;  2OLB A;  4RNS A;  3SKP A;  2D3I A;  3H4Z A;  2RF1 A;  1FBC A;  1P1U A;  1H43 A;  1PEB A;  3QSL A;  2B3F A;  1Y20 A;  1VDW A;  1S7Y A;  3C34 A;  4IO7 A;  3T9H B;  3M8U A;  1ANF A;  1PBQ A;  3RPW A;  4F2O A;  5EQ7 A;  4LQ2 A;  2ZZW A;  2NXO A;  1MDQ A;  3LSX A;  4PBQ A;  1VR5 A;  4MEV A;  5BWJ A;  1VFD A;  4GQO A;  5H8Q B;  5HPQ A;  2H25 A;  1B3E A;  4YU0 A;  4GLI A;  3KFM A;  4P56 A;  4X9T A;  5IZ3 A;  3FJ7 A;  4L17 A;  3OEM A;  4H1X A;  1R9L A;  1UIV A;  3U1O A;  5ITP A;  2F35 A;  4NQ8 A;  3TTL A;  1LB9 A;  5LTC A;  1Y3P A;  2ZNU A;  3GBA A;  1A8F A;  1B3L A;  1XOC A;  4PQJ A;  4QFK A;  3LSL A;  4N81 A;  5I84 A;  1KWH A;  2RCA A;  3PMX A;  2XWO A;  3QMF A;  4KR5 A;  4JWX A;  3FJM A;  1DSN A;  4PAK A;  4PFU A;  4IGR A;  2WX9 A;  2WKY A;  1IXC A;  1UTB A;  4TQU Q;  4IO3 A;  1B0L A;  1MG1 A;  3Q28 A;  4GBW A;  5CMK A;  3PUX E;  2HFB A;  4ELQ A;  3GXA A;  1FTK A;  5JK4 A;  1DPE A;  4QFP A;  5FHN A;  4PAI A;  5H8F A;  3BIH A;  3CG3 A;  3QYT A;  1EZO A;  2FVZ A;  4MAG A;  1NMU A;  3FXQ A;  3CSB A;  3K6U A;  3TCF A;  4JWO A;  1FTO A;  4OTE A;  3B8B A;  2M8C A;  5TU0 A;  1B9J A;  5JTY A;  2I4B A;  4N6P A;  2XXT A;  3TDJ A;  4H67 A;  1A40 A;  4Z0I A;  2XWV A;  2G29 A;  4LVQ A;  3KOT A;  4NF4 A;  4ZDM A;  1O63 A;  4K3F A;  2X7Q A;  4ECF A;  1M5B A;  1NUZ A;  1FQB A;  3PGF A;  1N04 A;  4KHZ E;  3K6W A;  3G3H A;  1K9Z A;  1SDX A;  1USY E;  2PFZ A;  3Q26 A;  3IO6 A;  4YMB A;  3VE1 B;  3SER A;  2ZYN A;  4HXV A;  3LV0 A;  2H98 A;  3T9X B;  2V25 A;  1B7Z A;  2O1L A;  1FQE A;  3K0V A;  4LAT A;  3F11 A;  4DCX A;  1MXU A;  3JZJ A;  4MIJ A;  3MWB A;  5TP9 A;  1M5D A;  3PMW A;  3PUW E;  5IZ3 B;  1B3F A;  1A8E A;  1IXI A;  3H7M A;  4ZS9 A;  2QS3 A;  1NI9 A;  5F24 A;  1RKM A;  1FQF A;  4ZE8 A;  3S2V A;  2Q8M A;  5I56 A;  3TFL A;  1Q9D A;  4GOT A;  2DWH A;  3QUF A;  4I1D A;  4MLV A;  2E0S A;  3IOU A;  4I62 A;  2VPN A;  1P1Q A;  4G68 C;  4IB2 A;  4Q0C A;  1UTB B;  4GD5 A;  3CI8 A;  5KDT A;  4YB7 A;  2I58 A;  5DYH A;  3A3U A;  3IB2 A;  4ESW A;  4QSE A;  3SEV A;  3VVD A;  1TFD A;  4ND9 A;  4GWU A;  2XD3 A;  3K1P A;  1ZTY A;  4OMB A;  4X8R A;  3H03 A;  4EUO A;  1AH5 A;  1FW0 A;  2UYF A;  3G3K A;  1LB8 A;  3T93 B;  5F1Q A;  4PET A;  1B4Z A;  3PTY A;  4YKK A;  4N8Y A;  1JQF A;  3V5A A;  4Q5T A;  4XEQ A;  3K02 A;  1PB7 A;  4ELP A;  4DZ1 A;  1ZBM A;  5F7V A;  4NMY A;  4F39 A;  3O6G A;  1LEV A;  4PFW A;  4YKP A;  4ZEI A;  2Y7P A;  2Z22 A;  4NF5 A;  2O1M A;  1URG A;  1MY2 A;  1SW2 A;  2OZZ A;  4THI A;  5H8H A;  1SVX B;  3RT6 B;  2I0B A;  3HFU A;  5TP9 B;  1O64 A;  1PDA A;  1F9B A;  3KSJ A;  3H6T A;  3OMB A;  5IKB A;  1FCK A;  1P1W A;  1POY 1;  2XXK A;  2O51 A;  3PMV A;  1MY1 A;  3LSF B;  4X04 A;  1SI0 A;  5I56 B;  3R26 A;  4P47 A;  2F7C A;  3B6Q A;  1MXZ A;  2Z8E A;  3T22 A;  1FBH A;  4EQ7 A;  1B52 A;  3FXR A;  1B5I A;  2O6A A;  2UVG A;  3HHF A;  3D4C A;  1XC1 A;  4OXV A;  3UGW A;  3RGY A;  3PPR A;  3N6U A;  1ATG A;  4O94 A;  3TCG A;  1MQJ A;  5B70 A;  3A29 A;  1MS7 A;  1FTA A;  3MPL A;  3AXF A;  1NV6 A;  4PF8 A;  3OEN A;  4R75 A;  1OIB A;  1B0H A;  2UVJ A;  2QMW A;  5ITO A; 
#chains in the Genus database with same CATH homology
 1LBC A;  3T66 A;  4ZEF A;  1IXG A;  2ONK E;  5DTB A;  1B46 A;  3HV1 A;  3KN8 A;  1QW0 A;  3HO7 A;  4MFI A;  4ZEK A;  5JEI A;  4WXJ A;  4JSO A;  1NNF A;  4O3C A;  4DXU A;  3RQT A;  4KYE A;  1JET A;  1NKX A;  1H44 A;  2REJ A;  4G8H A;  2V93 A;  1BTJ A;  4NF5 B;  1Y1Z A;  4POX A;  4LUB A;  5AE4 A;  1PB9 A;  3H06 B;  1PBP A;  1ZKB A;  2YLN A;  3HST A;  5H8H B;  3KSX A;  3MVX A;  1GTK A;  4G2Z A;  5CMB A;  4MLQ A;  1UTH A;  2A5S A;  3H6U A;  4R74 A;  3PUY E;  2DS9 A;  3D4G A;  1ELJ A;  2R6G E;  1OLC A;  1J1N A;  4OEU A;  3DP6 A;  3OEL A;  2OK2 A;  4G8M A;  3CFX A;  4GXA A;  2VOZ A;  2RKM A;  1NNT A;  4F22 A;  2OBG A;  4YZZ A;  4PP0 A;  4GL0 A;  3MBP A;  3QAX A;  3ILU B;  5I57 B;  3Q25 A;  2DXY A;  2Z23 A;  4TOZ A;  1LST A;  1FTM A;  5K2X A;  1B1X A;  2F7B A;  5AA2 A;  2D5W A;  2OWS A;  2XXP A;  1RYX A;  4YAH X;  4OFL A;  1P99 A;  3IOT A;  3OOA A;  1MY0 A;  2YJP A;  3W9V A;  5AA2 D;  3E13 X;  4ZZA A;  1MXV A;  5DVI A;  4H8I A;  1B7U A;  1EU8 A;  1EZ9 A;  5DEX A;  1QKB A;  3W9W A;  2HCA A;  4IO6 A;  4NF8 A;  2HZL A;  1LBB A;  3EHS A;  2F97 A;  4RYA A;  1TWY A;  3OXN A;  4M1V A;  3MVY A;  4XTC Q;  4G77 A;  2XHD A;  1JW5 A;  1IXH A;  4GXS B;  3CSG A;  3I5O A;  3K00 A;  3RT8 A;  2DSF A;  3N5L A;  2I0C A;  3RUM A;  2D21 A;  2V3U A;  2I3W A;  4R9G A;  1N7W A;  4GF8 A;  2E1S A;  3CG1 A;  3CRB A;  1M5F A;  1NH7 A;  1B32 A;  3VVF A;  1MY4 A;  4ZE9 A;  3LBS A;  3DEL B;  4IGT A;  2FYI A;  3HPI A;  3U8Q A;  5K2Y A;  5CMC A;  3KN7 A;  2XX8 A;  1A55 A;  2ZNT A;  2AL5 A;  1N3X A;  4Z7E A;  3SDF A;  3VXC A;  2V3T A;  1S9T A;  2LAO A;  4P11 A;  4U1O A;  4MBP A;  4TLM B;  3LUY A;  2HAU A;  3C36 A;  2G93 A;  2DYX A;  4LP2 B;  4OYV A;  4F3G A;  2NVU B;  1H3D A;  4EQB A;  4R2B A;  4QHQ A;  1Q1K A;  1JW1 A;  4JDF A;  3RTF B;  3K01 A;  4QFN A;  4ZEB A;  4JB7 A;  2Q9T A;  4NF8 B;  2XXV A;  5L9O A;  2ONS A;  3PV0 E;  2DOJ A;  3TTN A;  3VDF A;  2DQV A;  3BFT A;  2XXI A;  4BDO A;  3O29 A;  4LZ5 A;  4AB6 A;  1DTG A;  2QPQ A;  3MAM A;  3S4U A;  4ONY A;  1OVB A;  1UIU A;  5AA4 A;  4WEP A;  3A09 A;  3OD7 A;  3O6H A;  3MC2 A;  1FQC A;  2Y7K A;  1LCT A;  3PPO A;  1HSE A;  4PE5 B;  2XXX A;  2H4I A;  3IJX B;  2IEE A;  2RC8 A;  4F3B A;  1B3H A;  3R6U A;  2PYY A;  4NF6 A;  4NE4 A;  1D9V A;  2VP1 A;  3FVO A;  1P1O A;  4U4S A;  3U94 A;  5EHM A;  3VV5 A;  3CR9 A;  2I49 A;  4KYS A;  4R72 A;  4YKI A;  3FZV A;  2O7I A;  5I59 A;  1H45 A;  3S9M C;  3ZSF A;  1B4H A;  4NWC A;  5L9M A;  2X26 A;  1LCF A;  2REG A;  1I6B A;  1B3G A;  4OZ9 A;  3OSR A;  4OFJ A;  5FTI A;  3N6T A;  4POW A;  5I2N A;  1P1N A;  4F31 B;  2HAV A;  3PPQ A;  2O69 A;  3MUQ A;  3QUJ A;  3L6H A;  1MXW A;  2Q2C A;  2DWJ A;  3TKD A;  3PUZ E;  3TQW A;  2AYS A;  3CVG A;  5TPA A;  1D3K A;  4LZ8 A;  3T9V A;  1VE4 A;  4Q8R A;  1O7T A;  5CBS A;  3EN3 A;  2H99 A;  1POT A;  3E9X A;  4BDM A;  4QFL A;  2QS1 A;  4ZED A;  5EYF A;  1EZP A;  4NED A;  5AA4 B;  5IAI A;  2ZNS A;  4GFR A;  2QL3 A;  3B6T A;  5H8F B;  4F3P A;  3CFL A;  3GBB A;  4RA1 A;  3SEX A;  1QUJ A;  4OQO A;  4UA8 A;  5CMM A;  2ESN A;  4KCC A;  2DXR A;  3UP9 A;  2GH9 A;  5JTY B;  4BDN A;  4NF6 B;  1B58 A;  2H9B A;  4NF4 B;  2PX1 A;  4DE8 A;  4XKR A;  1B05 A;  2XD2 A;  3FVN A;  3PPP A;  3MZ9 A;  1D9Y A;  4R73 A;  1SW5 A;  1TFA A;  1MQI A;  3TZA A;  1QJM A;  4F1U A;  4N07 A;  1MPC A;  1WDN A;  3IB1 A;  1B5H A;  5I59 B;  3MP1 A;  4Q30 B;  2Z8F A;  1GGG A;  2XX7 A;  4ELR A;  4C1U A;  4KI0 E;  4JBZ A;  3RNN A;  1D4N A;  4IY6 A;  4BDL A;  1BKA A;  3T96 B;  2F5X A;  1PB8 A;  4N13 A;  4FE8 A;  3FVK A;  4FEB A;  3S9N C;  1R1N A;  4FIM A;  2VGQ A;  3O6I A;  4BLA A;  5A5X A;  3U93 A;  4E0W A;  4ESX A;  4OHN A;  4XXU A;  1AMF A;  3HHG A;  2ANJ A;  3U92 A;  2XXH A;  3C35 A;  2RIN A;  5TPA B;  3ILT B;  3MVW A;  2ZXT A;  4QF9 A;  2Q2A A;  1Y3N A;  5KDT B;  4O3B A;  1LAG E;  1XVY A;  2PVU A;  3TTM A;  3QIM A;  2R9J A;  3TEP A;  1I6Q A;  5H8N A;  4X1D A;  1UQW A;  4OFO A;  3VLU A;  3PD9 A;  4RJZ A;  2DWI A;  2H5Y A;  1OQH A;  4QFO A;  2OJT A;  1LGB C;  3IOR A;  5CC2 A;  2DVZ A;  4DXC A;  1MXY A;  2XX9 A;  2QS4 A;  3KG2 A;  2KLF A;  2AL4 A;  2YPN A;  4R6K A;  1URS A;  1M5C A;  3VLV A;  2DE2 A;  1XVX A;  3ZKK A;  1DTZ A;  1MDP 1;  1OLA A;  3KZG A;  4H8J A;  1AOV A;  4O3A A;  4R2F A;  2CMO A;  4AB5 A;  4XKP A;  1B1H A;  4EF1 A;  2OWT A;  3USD A;  4KFQ A;  3TAJ A;  3LR1 A;  2THI A;  4KPT A;  3K6X A;  4I9D A;  3K2D A;  1MH3 A;  1Y3Q A;  4YMA A;  1MM6 A;  4G68 A;  2GFE A;  5A5X B;  1SD3 A;  3R7X A;  3DM0 A;  3IR1 A;  4OER A;  2RC7 A;  2DE4 A;  4KD5 A;  4F18 A;  4BDR A;  3FXU A;  3V83 A;  3KOS A;  1LAF E;  2ZYO A;  1DMB A;  2XXU A;  3BBR A;  4F2Q A;  3ZS6 A;  1DOT A;  3IOV A;  1N0T A;  3P7I A;  2Q88 A;  3MPK A;  2GHB A;  1HSJ A;  1Z7M E;  1FTJ A;  3UN6 A;  2P0S A;  3K6V A;  5M2V A;  5I58 A;  3KGC A;  3T9U A;  3IB0 A;  2NWJ A;  3THI A;  1QVS A;  1T0K A;  3TPA A;  2F36 A;  2AIX A;  5H8Q A;  3IX1 A;  4YKJ A;  2ZYM A;  4JWY A;  1I6A A;  2Y7R A;  3KJT A;  4U22 A;  1JVX A;  1B6H A;  1MM7 A;  3SEU A;  3M3L A;  2F34 A;  3MZ1 A;  1IIT A;  4OEN A;  3KN3 A;  3UA8 A;  1WOD A;  1JEU A;  4YB5 A;  3MW0 A;  2IA4 A;  3K1N A;  1R6Z A;  3L6G A;  3FUZ A;  2HQ0 A;  2VD3 A;  3O66 A;  4RK9 A;  3O9P A;  4C0R A;  1US4 A;  1UTH B;  2CZL A;  3TTK A;  5DVF A;  3TCH A;  4OET A;  3B7D A;  3LC8 A;  4G68 B;  3QXM A;  4FED A;  4GRK A;  4LA9 A;  4GVO A;  4DXB A;  5H8S A;  4HCY A;  3I3V A;  3E3K A;  1AIV A;  3CFZ A;  1IEJ A;  2V3Q A;  1OQG A;  3KEI A;  3KJ7 A;  4XKQ A;  4FAT A;  1ZJL A;  5J1D A;  3K4U A;  1JNF A;  1R9Q A;  3MQ9 A;  3FD3 A;  5HBC A;  1MY3 A;  4RK2 A;  3H6V A;  5KZT A;  2I3V A;  4LZ7 A;  5AA2 B;  1YAE A;  5I58 B;  3BFU A;  4ISU A;  3UIF A;  3FV1 A;  3WAF A;  2OCU A;  3TUS A;  1ZMG A;  2W7Y A;  3OSQ A;  3FJG A;  2A5T A;  1AL3 A;  4I8C A;  3RY3 A;  4JSD A;  4U1Z A;  3RLF E;  5B7D A;  2ZMB A;  3FV2 A;  4OES A;  4C1T A;  5DEX B;  3ODB A;  1NNK A;  3IK6 B;  2F6G A;  1N7X A;  5ISU A;  2O68 A;  4XKN A;  5KCJ A;  3GZG A;  1YPN A;  1LFH A;  5ICT A;  1SBP A;  4TLL B;  4RY1 A;  3OO8 A;  3SES A;  1FTL A;  1WVJ A;  3V8X B;  3G3F A;  1FQD A;  4NWD A;  2I48 A;  5FTH A;  1ZLQ A;  4R6H A;  2Y7I A;  3G3G A;  3EF7 A;  4H65 A;  3I6V A;  3FVG A;  4U21 A;  3H3G A;  3U72 A;  2Q89 A;  3MP8 A;  1DPP A;  3TYH A;  4M4G A;  1B51 A;  1B7H A;  2DE3 A;  2Y84 A;  2R71 A;  4ZZE A;  4FEC A;  4U23 A;  1N84 A;  3OEK A;  2GHA A;  2P1S A;  4LQ5 A;  4KYD A;  4F19 A;  2XXQ A;  3BKI B;  1M5E A;  4DLD A;  2F6P A;  4R6Y A;  3SEW A;  3VXB A;  4F29 A;  2Y7W A;  3TOD A;  3MP6 A;  1L5T A;  3PD8 A;  1I69 A;  3Q29 A;  3FAS A;  3VFJ A;  3TMG A;  1JW4 A;  2A5T B;  3N94 A;  3S9L C;  1II5 A;  3HCQ A;  3C32 A;  3OO7 A;  3Q27 A;  3OO6 A;  1SW1 A;  3G3I A;  3C4M A;  1LAH E;  3TTR A;  1QUK A;  1SQY A;  4OVJ A;  1MPD A;  5BUU A;  4OEV A;  2Q8J A;  2RC9 A;  3JV9 A;  4HW8 A;  2PT1 A;  5KCJ B;  1CE2 A;  2ALU A;  4MF3 A;  5FHO A;  1VSO A;  5DT6 A;  1VFE A;  3FIR A;  2UVH A;  1MQH A;  2NOO A;  4R9F A;  2ONR A;  1RYO A;  2QRY A;  1Y4T A;  4FJP A;  3PU5 A;  2VHA A;  4HTG A;  4EDP A;  2ABH A;  4GL8 A;  4LON B;  4DCY A;  4F1V A;  1IIW A;  1Q35 A;  1Z7N E;  3HN0 A;  2O84 X;  4DDD A;  1YTV A;  1A54 A;  3QK6 A;  5CM6 A;  3O28 A;  3SET A;  2F78 A;  3PUV E;  4H5G A;  4RPN A;  2UVI A;  5L8D A;  3S9E A;  1USY H;  3EHT A;  3W15 C;  1IQ7 A;  4U4X A;  3EHU A;  2P2A A;  4HCW A;  1LAX A;  1HSL A;  1JVY A;  1Y4C A;  4JXI A;  4H5F A;  1NFT A;  1LFG A;  1URD A;  2XXW A;  1A99 A;  5AA3 A;  2F7A A;  3MJN A;  2DVC A;  3G3J A;  1MH4 A;  5I2N B;  1QUI A;  3EPE A;  3OO9 A;  4EXL A;  1Y1M A;  2GRV A;  1LLS A;  1MQD A;  4GIZ A;  3MVZ A;  2ZYK A;  3LSW A;  4X1B A;  2NUV A;  1EH3 A;  1B2H A;  1BIY A;  5ELV A;  2V84 A;  1IZ1 A;  1GVC A;  4XIG Q;  3M3F A;  4ELO A;  1QUL A;  1YCJ A;  3VVE A;  4G8N A;  4X48 A;  1XT8 A;  1NL5 A;  2UXA A;  1LFI A;  3TEL A;  5CRY A;  1MQG A;  3DP8 A;  5L9S A;  3PPN A;  3O2A A;  4PFY A;  4FAJ A;  3IO4 A;  5DVJ A;  4QSD A;  2QSX A;  3JYR A;  4YIC A;  4WKM A;  5I57 A;  4H0W A;  3V89 B;  1ZIU A;  3M3K A;  1OVT A;  3EQ1 A;  3WAE A;  4UAC A;  4GWO A;  1N76 A;  3FAT A;  2PT2 A;  1SW4 A;  4IO5 A;  4IO2 A;  1XHY A;  4PFT A;  3ZKL A;  3C31 A;  4G4P A;  1ZU0 A;  2QS2 A;  2PMS A;  3C9H A;  4AQ4 A;  3MZB A;  4HS7 A;  3UK4 A;  1NH8 A;  4F3S A;  5AA1 A;  4U2R A;  2O7U A;  1H76 A;  2PBW A;  3IAZ A;  5ICQ A;  2B3B A;  2XXY A;  3IJO B;  5LOM A;  3RN8 A;  4MH5 A;  1BP5 A;  4KCD A;  2UYE A;  3TQL A;  1JEV A;  3GLB A;  2RCB A;  3DP4 A;  3IOW A;  1OMP A;  3UOR A;  1Y9U A;  3B6W A;  1SI1 A;  3ONM A;  3IL1 B;  4WED A;  4IY5 A;  3SEY A;  3RTW B;  5I2K A;  1MRP A;  1XS5 A;  4RPO A;  4ZEC A;  1MPB A;  4EF2 A;  5H8N B;  2QJE A;  4QRZ A;  5FHM A;  2DP8 A;  4FOR A;  3CIJ A;  3G7W A;  3K1M A;  2DWA A;  1IUD A;  1CB6 A;  2HZK A;  1FQA A;  1NNP A;  3N26 A;  2HEU A;  1GR2 A;  2Z8D A;  3KBR A;  2QMX A;  4DIG A;  1GV8 A;  2B65 A;  5EHS A;  3ECR A;  1B5J A;  4P0I A;  2X7P A;  4E0X A;  1QKA A;  1PC3 A;  4BDQ A;  2BJJ X;  4EXK A;  4RXL A;  1SYH A;  1MXX A;  3A3C A;  2FA7 A;  1B40 A;  1BLF A;  5HM4 B;  3DLN A;  4EQ9 A;  1N3W A;  3H6W A;  4H6D A;  3E4R A;  5CBR A;  2FNC A;  1TT1 A;  3C33 A;  2F8D A;  4IO4 A;  2HXW A;  4P0G A;  3O97 A;  3FGS A;  4KQP A;  2I4C A;  5CI5 A;  1SYI A;  1TXF A;  4OWD A;  1US5 A;  1S50 A;  4QSC A;  4NTL A;  3VLW A;  2VD2 A;  4F1Y A;  4YB6 A;  5I2K B;  2I6E A;  2XXR A;  1A7L A;  2OLB A;  4RNS A;  3SKP A;  2D3I A;  3H4Z A;  2RF1 A;  1P1U A;  1H43 A;  1PEB A;  3QSL A;  2B3F A;  1Y20 A;  1S7Y A;  3C34 A;  4IO7 A;  3T9H B;  3M8U A;  1ANF A;  1PBQ A;  3RPW A;  4F2O A;  4LQ2 A;  2NXO A;  1MDQ A;  3LSX A;  1VR5 A;  5BWJ A;  1VFD A;  4GQO A;  5H8Q B;  5HPQ A;  2H25 A;  1B3E A;  4YU0 A;  4GLI A;  3KFM A;  4X9T A;  3FJ7 A;  4L17 A;  3OEM A;  4H1X A;  1R9L A;  1UIV A;  3U1O A;  5ITP A;  2F35 A;  3TTL A;  1LB9 A;  1Y3P A;  2ZNU A;  3GBA A;  1A8F A;  1B3L A;  1XOC A;  4PQJ A;  4QFK A;  3LSL A;  5I84 A;  1KWH A;  2RCA A;  3PMX A;  4KR5 A;  4JWX A;  3FJM A;  1DSN A;  4PFU A;  4IGR A;  2WKY A;  1IXC A;  1UTB A;  4TQU Q;  4IO3 A;  1B0L A;  1MG1 A;  3Q28 A;  5CMK A;  3PUX E;  2HFB A;  4ELQ A;  3GXA A;  1FTK A;  5JK4 A;  1DPE A;  4QFP A;  5FHN A;  5H8F A;  3CG3 A;  3QYT A;  1EZO A;  1NMU A;  3FXQ A;  3CSB A;  3K6U A;  3TCF A;  4JWO A;  1FTO A;  4OTE A;  2M8C A;  5TU0 A;  1B9J A;  5JTY A;  2I4B A;  4N6P A;  2XXT A;  3TDJ A;  4H67 A;  1A40 A;  4Z0I A;  2G29 A;  4LVQ A;  3KOT A;  4NF4 A;  4ZDM A;  1O63 A;  4K3F A;  2X7Q A;  4ECF A;  1M5B A;  1FQB A;  3PGF A;  1N04 A;  4KHZ E;  3K6W A;  3G3H A;  1SDX A;  1USY E;  3Q26 A;  3IO6 A;  4YMB A;  3VE1 B;  3SER A;  2ZYN A;  2H98 A;  3T9X B;  2V25 A;  1B7Z A;  2O1L A;  1FQE A;  3K0V A;  4LAT A;  3F11 A;  4DCX A;  1MXU A;  3JZJ A;  3MWB A;  5TP9 A;  1M5D A;  3PMW A;  3PUW E;  1B3F A;  1A8E A;  1IXI A;  3H7M A;  4ZS9 A;  2QS3 A;  1RKM A;  1FQF A;  4ZE8 A;  3S2V A;  5I56 A;  3TFL A;  4GOT A;  2DWH A;  3QUF A;  4I1D A;  4MLV A;  2E0S A;  3IOU A;  4I62 A;  1P1Q A;  4G68 C;  4IB2 A;  4Q0C A;  1UTB B;  4GD5 A;  3CI8 A;  5KDT A;  4YB7 A;  2I58 A;  5DYH A;  3A3U A;  3IB2 A;  4ESW A;  4QSE A;  3SEV A;  3VVD A;  1TFD A;  4ND9 A;  2XD3 A;  3K1P A;  1ZTY A;  4OMB A;  3H03 A;  4EUO A;  1AH5 A;  1FW0 A;  2UYF A;  3G3K A;  1LB8 A;  3T93 B;  5F1Q A;  4PET A;  1B4Z A;  4YKK A;  1JQF A;  3V5A A;  4Q5T A;  3K02 A;  1PB7 A;  4ELP A;  4DZ1 A;  1ZBM A;  5F7V A;  4NMY A;  4F39 A;  3O6G A;  4PFW A;  4YKP A;  4ZEI A;  2Y7P A;  2Z22 A;  4NF5 A;  2O1M A;  1URG A;  1MY2 A;  1SW2 A;  2OZZ A;  4THI A;  5H8H A;  1SVX B;  3RT6 B;  2I0B A;  5TP9 B;  1O64 A;  1PDA A;  1F9B A;  3KSJ A;  3H6T A;  3OMB A;  5IKB A;  1FCK A;  1P1W A;  1POY 1;  2O51 A;  3PMV A;  1MY1 A;  3LSF B;  1SI0 A;  5I56 B;  3R26 A;  2F7C A;  3B6Q A;  1MXZ A;  2Z8E A;  3T22 A;  4EQ7 A;  1B52 A;  3FXR A;  1B5I A;  2O6A A;  2UVG A;  3HHF A;  3D4C A;  1XC1 A;  4OXV A;  3UGW A;  3RGY A;  3PPR A;  3N6U A;  1ATG A;  3TCG A;  1MQJ A;  5B70 A;  1MS7 A;  3MPL A;  3AXF A;  3OEN A;  4R75 A;  1OIB A;  1B0H A;  2UVJ A;  2QMW A;  5ITO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...