4P0GA

Crystal structure of mltf from pseudomonas aeruginosa complexed with bulgecin and muropeptide
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords Membrane-bound lytic murein transglycosylase F
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA02
5CBSA 1SW5A 2P0SA 3L6HA 4PFWA 4PFYA 1HSLA 1MY3A 3QK6A 1MDQA 2X7QA 3OSRA 1ZJLA 1TFDA 4YKIA 3OEMA 1VR5A 4R6YA 3UA8A 4FATA 3USDA 4R2BA 4QFLA 1LBBA 2NUVA 3C36A 3IAZA 4EXKA 3MQ9A 3Q26A 3PUZE 5I57A 2I4BA 2ZYKA 3LSFB 4F39A 2V3TA 5M2VA 3ZS6A 5I2KA 2I0BA 3O97A 2IA4A 4QSCA 3FXUA 2Z8FA 4IB2A 4QFNA 2GHBA 1D4NA 1EZ9A 1II5A 1O63A 2RC7A 1LCFA 1USYE 3K6XA 2HZLA 4Z0IA 3FJMA 1Z7ME 3Q25A 4WEDA 2UVHA 1NH8A 2H98A 3SESA 4F1UA 3CFXA 2F5XA 5I56B 3SEYA 1JVXA 2DVZA 3R6UA 4OENA 3I5OA 4R6KA 5K2XA 1NNFA 1FQBA 3OSQA 1XOCA 4GRKA 1LFGA 1N04A 3O2AA 3TTNA 2FA7A 4F3PA 3TZAA 1URGA 4IO2A 2RCBA 1OLCA 3PPRA 4H5FA 3PUWE 4ESXA 5CMCA 3MZ9A 4HTGA 3OELA 2GRVA 2HXWA 3CRBA 4M4GA 4OQOA 2UVGA 4ONYA 2GH9A 1FTLA 1NNKA 2XXPA 3VLWA 1ELJA 2V93A 3IOVA 1PC3A 1IXHA 1WODA 2YPNA 1A8FA 2A5TB 3D4GA 2I0CA 3HCQA 4G8MA 3IO4A 3EQ1A 4WXJA 1KWHA 3OO6A 1US5A 4RPNA 3MVXA 4OZ9A 1AMFA 3U94A 2GFEA 5IAIA 3T93B 3VV5A 4DCYA 1NMUA 1PB8A 1NNTA 4UACA 5CBRA 2H5YA 1S7YA 1SI1A 1P1UA 2Q2AA 3HN0A 3T66A 1QUKA 2RINA 4LZ5A 4Q30B 1QUJA 3B6WA 1GVCA 1AIVA 2AIXA 1MXYA 2OCUA 1I6QA 2UXAA 3HPIA 3OMBA 1LCTA 2X26A 1UTBA 4H5GA 2OZZA 3L6GA 4G8NA 4ZDMA 5CMMA 4IO7A 3SKPA 2E0SA 2I49A 4ND9A 5TU0A 4R2FA 5AA4B 1GR2A 1M5DA 1MQGA 1P1WA 1RYOA 4RY1A 1FQFA 4GF8A 1N7XA 4BLAA 4Q5TA 1MXZA 3SEUA 3HV1A 3K01A 4LVQA 3UGWA 1ANFA 5AA2B 1TXFA 5H8FA 5I2NB 4U2RA 4R9FA 5I57B 2F7CA 4PFTA 3FXQA 4TLLB 1HSEA 4ISUA 3UORA 1O64A 2A5TA 5FTHA 1I69A 3HHFA 3W9WA 4HS7A 3PMWA 1ATGA 2QJEA 5J1DA 4Z7EA 1H44A 1QJMA 4IO3A 5TP9A 3A09A 1JETA 5K2YA 4EQBA 1IITA 1B6HA 3KN8A 4L17A 3Q29A 4YZZA 4E0XA 5AA3A 4DCXA 2HAVA 3H6TA 4GD5A 2F6GA 1OVBA 5TPAB 1B3HA 5B70A 3G3GA 3IORA 3UIFA 1VE4A 2OK2A 3QSLA 4KFQA 4FORA 5CMBA 1PB9A 1POTA 3PD9A 4KD5A 1B5HA 3MP8A 3RY3A 4KPTA 4JXIA 4OESA 1MM6A 5I59A 3PUVE 1CB6A 1MQJA 3G3FA 4F31B 1S50A 5L9MA 5KCJB 1H76A 2QMXA 3H6UA 2AL4A 2QS3A 3MPLA 4GWOA 4LQ2A 5KDTA 5TPAA 2V3QA 4E0WA 2Z8EA 2OLBA 3C31A 4YMAA 1TT1A 1US4A 2O84X 2ZMBA 3TCHA 4EQ7A 2XD3A 3TMGA 2R71A 3MUQA 1LGBC 4JDFA 4YKKA 4EDPA 2PT2A 4F19A 4ZECA 2B3BA 1XVXA 1B0LA 3Q27A 2H4IA 1EU8A 2X7PA 1B05A 2PT1A 2Q89A 3IJOB 2B65A 2M8CA 3LSWA 1FTKA 2THIA 4G8HA 4H1XA 4I1DA 3ZKLA 3VXBA 3SERA 1TFAA 1URSA 3C9HA 3GXAA 2DWJA 3IB1A 2HQ0A 3V5AA 4QRZA 4C1TA 1A99A 2LAOA 2V84A 4FEBA 1O7TA 1B4ZA 1D9YA 1LAXA 4BDNA 3G7WA 2QMWA 1EZPA 1B7ZA 1UIUA 2V25A 3KFMA 4G2ZA 3RN8A 1R6ZA 1YTVA 4G4PA 3H6VA 3C34A 4YU0A 4OFLA 4AB6A 2I3VA 3ODBA 4NF6A 3IOUA 3RNNA 3QAXA 1P1OA 5H8HB 1BIYA 4KCDA 2YJPA 2XX9A 4KR5A 1A55A 2CMOA 4FJPA 3MVYA 4KYSA 4ZEKA 1MRPA 2ANJA 4LA9A 2BJJX 3OO7A 3UP9A 4JSOA 3JYRA 2QS2A 4THIA 1SW2A 2NXOA 4KHZE 4KQPA 1IXGA 2XXTA 1XS5A 3VFJA 3PV0E 1POY1 5H8FB 3IK6B 2H25A 2QSXA 3CG1A 2PX1A 2VD3A 3H6WA 4RXLA 3TTKA 3IOWA 4IO6A 4XIGQ 1BLFA 4FEDA 3U92A 3BBRA 1YPNA 1ZBMA 2OWSA 3G3KA 3MWBA 4PFUA 4YB5A 3M3LA 3DP6A 3K00A 4DZ1A 1Y1MA 5L9OA 2XHDA 3DELB 1EZOA 1MXUA 2GHAA 3FZVA 3CSBA 4YB6A 5KCJA 3PUXE 3IR1A 4EXLA 3Q28A 5DEXB 3S2VA 4EQ9A 3VVEA 1P99A 4OYVA 3PU5A 4POXA 4GFRA 2ONKE 2XXYA 3TELA 1A54A 4YKPA 2YLNA 2REGA 3LC8A 3SETA 1Y4CA 2Z23A 5A5XB 1FTOA 1NKXA 3V89B 3TQLA 1CE2A 1BKAA 3MZBA 3KSXA 3PMVA 4G68B 4RK2A 1OIBA 1WDNA 1B32A 1DSNA 3H06B 3OD7A 4H6DA 1MY1A 3E3KA 1HSJA 5HBCA 4EF1A 2VD2A 4M1VA 3PMXA 2F8DA 2E1SA 3MJNA 1QKBA 2ZYMA 4ZEFA 4F2QA 4MBPA 3CR9A 5CRYA 1Z7NE 3THIA 2O1LA 5AA2A 2F36A 2DVCA 4IO4A 4NF8B 4O3BA 4OVJA 1MPDA 3VE1B 1IEJA 3K4UA 1B1XA 1N3XA 1Y20A 4ZEDA 5H8NB 4Q8RA 2RC8A 5CMKA 3I3VA 4MF3A 1ZU0A 3QXMA 1D9VA 1VSOA 2ZNTA 3LUYA 2DE3A 1QW0A 2HZKA 3CFLA 3IB2A 1GGGA 1TWYA 3N6TA 3MVZA 3HO7A 2UVJA 1MG1A 1R9LA 3CVGA 4GL8A 4QFOA 2F78A 4WEPA 1A40A 1JQFA 2F7BA 2O69A 2RF1A 4RPOA 4YKJA 4F1YA 4MLVA 1MY4A 4OERA 1VFEA 1SVXB 2Y7RA 3B7DA 2ZNUA 2W7YA 3ECRA 3H7MA 3ONMA 3H03A 4NE4A 1D3KA 4PETA 3KJTA 4PE5B 4ZZAA 3MW0A 4NTLA 4JWYA 2QS1A 4O3CA 3U1OA 4R6HA 3O28A 5JTYA 1M5EA 3HHGA 2O7UA 5DTBA 1R9QA 2ZXTA 2DWIA 1NH7A 1MXWA 3FIRA 4N07A 1Y1ZA 1B51A 3QUJA 1B5JA 4R73A 1B3FA 3W15C 3MZ1A 1IXIA 4NF8A 4ZZEA 3TAJA 4U1OA 4IO5A 2NOOA 4XKRA 4F18A 1UTHA 4NF4B 4OETA 1LBCA 3MBPA 3B6TA 4ECFA 3WAEA 1H43A 3FATA 5I84A 3IOTA 3EF7A 4OMBA 3LSXA 2I4CA 3BKIB 1L5TA 2DSFA 3KG2A 4G68A 4RJZA 1QUIA 2OBGA 1NFTA 2VGQA 1WVJA 2DP8A 5ICTA 4F3BA 5AA1A 1PDAA 1MH3A 3JZJA 3KN3A 3M3FA 4MH5A 3UN6A 1QKAA 1B1HA 4AB5A 3FD3A 3PD8A 4DIGA 5HM4B 4IGTA 3GBAA 3K1PA 4DLDA 4FAJA 1FTMA 1RYXA 1I6BA 1NL5A 2ZNSA 2HAUA 5I2KB 1DPEA 1ZKBA 1Y3PA 2Q8JA 4P0IA 1Y3NA 2QPQA 3RPWA 3A3CA 4MFIA 3W9VA 1JEUA 3EHUA 5EYFA 5I58B 3LBSA 3BFTA 4KYEA 3TFLA 3N94A 3D4CA 3K6VA 4RNSA 3TKDA 1EH3A 4P0GA 4C0RA 4MLQA 2QRYA 3P7IA 3HSTA 4BDRA 1IXCA 3DP8A 4JBZA 4O3AA 3KOSA 4ZS9A 2XD2A 4DXBA 2I3WA 3SEXA 3RGYA 2O1MA 4G77A 2G29A 3OOAA 3SEWA 4YMBA 3S9MC 2PVUA 3RT8A 2O7IA 2DQVA 3T9XB 1N3WA 5BUUA 1LFHA 4R72A 3IO6A 4F1VA 2WKYA 2D3IA 3OXNA 3LSLA 5F7VA 2RCAA 5AA4A 5L9SA 4OFJA 1Q35A 4PP0A 3PGFA 4C1UA 1ZTYA 1J1NA 3PPOA 5HPQA 4GLIA 3B6QA 4ZE8A 1B3LA 2DYXA 3U72A 3S9LC 3K1MA 5ITOA 3N6UA 2REJA 3T9HB 3KEIA 4ZE9A 1PB7A 2HFBA 3K0VA 5KZTA 3S9EA 2F6PA 3ILUB 4H67A 1USYH 2KLFA 1JW5A 2G93A 3EPEA 3FVNA 1MQIA 1GTKA 2H9BA 3DLNA 4ZEBA 3CG3A 3V83A 2Q2CA 3MP6A 1FTJA 1LFIA 3PPPA 1LAFE 4QSDA 4X48A 4EUOA 3OO9A 3CSGA 2Q9TA 2B3FA 1DPPA 1UTHB 1MDP1 3RTFB 4BDMA 1B9JA 3SDFA 4PQJA 1F9BA 3TEPA 1B7HA 1JNFA 2QS4A 3E9XA 4NWDA 1Q1KA 3N5LA 3O66A 4TQUQ 2XXRA 3A3UA 2NWJA 5B7DA 1QULA 2R6GE 3O9PA 3KN7A 4NMYA 4RK9A 4U23A 4X1DA 5EHSA 3T9UA 4F29A 1MPBA 5A5XA 1LLSA 1MXXA 2R9JA 3I6VA 3PPNA 4GIZA 2DE4A 2XXIA 1B2HA 4R74A 3C35A 3FVGA 4GXAA 3K2DA 5DEXA 2PBWA 2Y7PA 3RUMA 1GV8A 3OEKA 4QFPA 4DE8A 5DT6A 4OWDA 4U4XA 5FHMA 2F7AA 1A7LA 4LP2B 4IY6A 5I56A 3FUZA 4OTEA 2P1SA 5AE4A 4Q0CA 4EF2A 4OEUA 1FCKA 1XVYA 5FHNA 1OQGA 3KBRA 5H8SA 1N0TA 1LSTA 1R1NA 3O6GA 3OO8A 2DS9A 1H45A 4X1BA 1ZLQA 3VVFA 3G3IA 5JK4A 4NF4A 3ZSFA 1S9TA 4LUBA 3KGCA 1OMPA 2ALUA 3KJ7A 1I6AA 3IX1A 3R26A 2Z22A 5EHMA 2OJTA 1JEVA 5H8QB 2A5SA 3TCFA 3TTLA 4UA8A 5DVJA 4AQ4A 1OVTA 5CM6A 5IKBA 3BFUA 3DM0A 2ONRA 1PEBA 3H3GA 4N13A 4BDLA 2ABHA 2HEUA 4K3FA 3F11A 5I2NA 5H8HA 1AOVA 4H8IA 4QFKA 4U22A 4QF9A 1Y9UA 3EHSA 4TOZA 1IQ7A 1IZ1A 1Y4TA 1FQAA 2DXRA 2AL5A 2FNCA 3AXFA 3CIJA 3E4RA 3ILTB 3GBBA 3MAMA 2O51A 5FHOA 1B7UA 2D21A 2OWTA 1XC1A 2Y7KA 3SEVA 4F22A 2PMSA 3LR1A 3M8UA 4I62A 3K6UA 4XKQA 1MH4A 4JSDA 2DXYA 5AA2D 1Y3QA 4G68C 5ITPA 3FJGA 2Y7WA 2XXUA 3FVKA 4F3SA 3GZGA 2DWHA 2XXHA 1N7WA 1UQWA 1SI0A 1M5CA 2I58A 2ESNA 2PYYA 3K6WA 1A8EA 1SW1A 3T22A 1B4HA 2VP1A 2XXQA 4XKPA 3T96B 3K1NA 3RLFE 4KCCA 1PBQA 4HCYA 2UYEA 4LONB 4U21A 4JB7A 1LAGE 3TPAA 2XXWA 4LZ8A 5JEIA 1MPCA 2XXVA 2CZLA 3FV1A 3UK4A 1LAHE 5KDTB 4OFOA 1OLAA 1UIVA 1FQDA 1SQYA 4NF5B 3OENA 4FECA 4GQOA 2ZYOA 4H65A 4I9DA 5JTYB 3FGSA 3TQWA 4I8CA 1JVYA 2O68A 4POWA 3KSJA 3RQTA 4LZ7A 4WKMA 3VDFA 1B3GA 2NVUB 3FJ7A 3FASA 3M3KA 4ELQA 2RC9A 1N84A 4FE8A 5CI5A 1B58A 1M5FA 2D5WA 4NF5A 4YAHX 1XT8A 1ZIUA 1B52A 2Q88A 4IGRA 1P1QA 2UYFA 3C33A 3G3HA 4ELPA 5BWJA 4GVOA 3TUSA 2HCAA 3IB0A 3VLVA 4ZEIA 1SYIA 2XX7A 4JWOA 2I48A 4OHNA 3RTWB 4YB7A 1YAEA 3O29A 1URDA 4NWCA 3KZGA 4R75A 1MM7A 3MP1A 2Y84A 4LQ5A 3T9VA 4H0WA 5H8NA 1MY0A 1AH5A 2DE2A 4X9TA 5H8QA 3TODA 3O6IA 2V3UA 3TTMA 3EHTA 2F34A 4HCWA 2I6EA 4RYAA 3S4UA 1B5IA 1VFDA 1P1NA 1SBPA 2UVIA 1DTZA 3MC2A 4H8JA 5F1QA 4BDQA 5DYHA 4HW8A 5FTIA 3IL1B 1DOTA 5I58A 3E13X 3FVOA 2VOZA 5CC2A 3C32A 3FV2A 1B46A 3IJXB 3PUYE 4GOTA 1MY2A 4KI0E 3QUFA 4LATA 4OXVA 2XXXA 4KYDA 3CI8A 4N6PA 1MXVA 1UTBB 3MPKA 4TLMB 1PBPA 1H3DA 1SW4A 3G3JA 4GXSB 2IEEA 5DVFA 3QIMA 4BDOA 5ICQA 4NEDA 4OEVA 5DVIA 1FQCA 4IY5A 1B0HA 1FQEA 4ESWA 4YICA 3U8QA 1IUDA 2Y7IA 1IIWA 3C4MA 2H99A 4GL0A 3CFZA 3JV9A 2F97A 4FIMA 3QYTA 1M5BA 4F3GA 1B40A 1DTGA 4U1ZA 3GLBA 2ZYNA 2ONSA 1MS7A 4XTCQ 1JW1A 1SDXA 3N26A 5ELVA 2P2AA 1AL3A 4ELRA 1MQHA 1RKMA 2RKMA 3DP4A 5TP9B 4DDDA 4DXUA 2VHAA 2DWAA 3O6HA 3TTRA 2O6AA 3WAFA 3PPQA 3TCGA 4QSEA 4XXUA 1BP5A 1YCJA 3VVDA 1B3EA 3KOTA 3R7XA 1JW4A 1LB8A 3U93A 2DOJA 1MQDA 2XX8A 3ZKKA 3MVWA 3EN3A 4U4SA 1LB9A 4F2OA 5ISUA 3TDJA 1QVSA 1NNPA 2FYIA 4QHQA 5I59B 1FW0A 5LOMA 1T0KA 3VLUA 3V8XB 1N76A 5L8DA 1XHYA 4ELOA 1SYHA 1ZMGA 2AYSA 3RT6B 1OQHA 3FXRA 3TYHA 3K02A 3S9NC 4XKNA 2Z8DA 4JWXA 2QL3A 4NF6B 4R9GA 1SD3A 2F35A 1DMBA 3H4ZA 1BTJA 4P11A 4DXCA 4RA1A 3VXCA
chains in the Genus database with same CATH superfamily
1SW5A 1EYIA 1HSLA 3QK6A 3UA8A 4FATA 3C36A 1D9QA 3LSFB 4F39A 5M2VA 1FPLA 3CHGA 1LBVA 4IB2A 1O63A 4Z0IA 4PDDA 3SESA 4X8RA 3OSQA 1XOCA 4GRKA 1LFGA 2FA7A 4F3PA 1URGA 3PPRA 3PUWE 5CMCA 3MZ9A 3OELA 3IOVA 3HCQA 3OO6A 4RPNA 3MVXA 2L5VA 3T93B 4DCYA 1PB8A 1SI1A 3T66A 2ZZWA 4Q30B 1AIVA 3VLVA 1I6QA 3L6GA 4G8NA 4ZDMA 4HE1A 1N7XA 4Q5TA 1MXZA 5AA2B 4PTKA 5H8FA 4R9FA 2F7CA 3UORA 1HSEA 4ISUA 1O64A 3HHFA 1ATGA 5ESYA 3A09A 1JETA 5K2YA 4DCXA 2B4LA 2HAVA 3H6TA 4GD5A 3QSLA 5EQAA 4FORA 1PB9A 3PD9A 4GWXA 1B5HA 4KPTA 4F31B 1H76A 2QMXA 2QS3A 2QVUA 5TPAA 2V3QA 4YMAA 2O84X 2XD3A 2XWIA 4YKKA 2PT2A 4PAIA 4ZECA 2B3BA 1K9YA 1EU8A 4Z7EA 2B65A 2M8CA 1FTKA 3VXBA 1TFAA 3IB1A 3C9HA 4C1TA 2V84A 1O7TA 1LAXA 3G7WA 1B7ZA 2V25A 4PC9A 5KCJB 4G4PA 4YU0A 3C34A 3IOUA 1P1OA 5H8HB 2XX9A 1KA1A 4JSOA 3VFJA 3IK6B 2H25A 2QSXA 3CG1A 3TTKA 3IOWA 2OWSA 4YB5A 4DZ1A 3DP6A 1Y1MA 2XHDA 1EZOA 1MXUA 2V4CA 3CSBA 3IR1A 4YKPA 3B8BA 2REGA 4GWSA 5A5XB 1NKXA 3MZBA 3PMVA 1WDNA 3IFAA 3OD7A 4H6DA 1MY1A 3E3KA 2F8DA 1QKBA 4MBPA 3THIA 5AA2A 3VE1B 4NX1A 2PCRA 1VSOA 3N6TA 1GGGA 1MG1A 1R9LA 1JQFA 2F7BA 2RF1A 4MLVA 2WEFA 2W7YA 4NE4A 4MJOA 3MW0A 4JWYA 3U1OA 3O28A 2O7UA 5ET6A 1B51A 3MZ1A 4NF8A 4IO5A 2NOOA 1LBCA 4P56A 4ECFA 3FATA 4OMBA 4JVIA 2I4CA 4I3YA 3BKIB 1NFTA 1WVJA 2HXRA 3KN3A 5IZ3A 1FTMA 2ZNSA 3RPWA 1IMCA 1JEUA 5EYFA 3LBSA 4KYEA 4O7IA 4BDRA 3HSTA 1IXCA 3HFUA 4G77A 4YMBA 3OXNA 2RCAA 5IZZA 3PPOA 3S9LC 4GX3A 4ZE9A 2HFBA 4N8YA 5KZTA 4P1EA 3S9EA 4H67A 1USYH 1EYKA 2ZZXA 1JW5A 2G93A 2H9BA 3CG3A 1BK4A 4X48A 4EUOA 3BIHA 1MDP1 2KR0A 3SDFA 1JNFA 2QS4A 3E9XA 2XXRA 3A3UA 2R6GE 4NMYA 4MHFA 3T9UA 1MXXA 3I6VA 4R74A 5DEXA 2PBWA 4QFPA 4OWDA 4U4XA 4DI3D 4LP2B 4IY6A 2P1SA 4Q0CA 1XVYA 5H8SA 4X1BA 2DS9A 1ZLQA 3KGCA 3IX1A 5LTCA 3IFCA 2OJTA 3TCFA 2A5SA 1SPIA 3H3GA 1PEBA 2ABHA 5EQ8A 3F11A 4H8IA 4QFKA 4U22A 2FIXA 3AXFA 3E4RA 2FBPA 3SEVA 2D21A 3NOHA 3LR1A 3B50A 3K6UA 4JSDA 2DXYA 1Y3QA 2Y7WA 2XXUA 3FVKA 2DWHA 1UQWA 5I5PA 2VP1A 4KCCA 4JB7A 4PCDA 3TPAA 4NAPA 5JEIA 2Y5LA 1OLAA 1SQYA 4NF5B 4FECA 2QVRA 3RQTA 4PGPA 4WKMA 3FJ7A 4ELQA 1B58A 4YAHX 2HHMA 1IMFA 2Q88A 4GVOA 3IB0A 3O29A 4NWCA 4H0WA 5H8NA 1MY0A 4X9TA 3TODA 4HCWA 2I6EA 3MC2A 1SBPA 5F1QA 1DOTA 2B4MA 3E13X 4GOTA 4KI0E 2DDKA 2XXXA 4KYDA 3E79A 1UTBB 4PF8A 3MPKA 1SW4A 3G3JA 3QIMA 4NEDA 4OVPA 5DVIA 1FQCA 1FJ6A 3MSTA 4O94A 4GBWA 3JV9A 1M5BA 4U1ZA 3GLBA 4HE0A 1SDXA 4DDDA 3PPQA 4XXUA 1YCJA 1B3EA 3R7XA 1LB8A 2XX8A 3ZKKA 2Y5KA 3MVWA 5ISUA 1LB9A 3TDJA 5LOMA 1LBWA 1N76A 3FXRA 4G61A 4JWXA 2QL3A 4NF6B 4R9GA 2F35A 1DMBA 3H4ZA 3L6HA 1MY3A 2X7QA 1ZJLA 1TFDA 4NHBA 3OEMA 3IAZA 4EXKA 3Q26A 3PUZE 5A5LA 1FPKA 2FIEA 2ZYKA 2V3TA 3O97A 4QFNA 1D4NA 1II5A 2HZLA 4WEDA 1NH8A 4F1UA 4N6KA 3CFXA 5I56B 3SEYA 4R6KA 3ROJA 3O2AA 4IO2A 2RCBA 1OLCA 4H5FA 2GRVA 3KC0A 1Q9DA 2GH9A 1IXHA 1WODA 2YPNA 4PE3A 3D4GA 2I0CA 3IO4A 3EQ1A 1KWHA 3U94A 3A29A 2H5YA 1S7YA 3TUSA 2Q2AA 3HN0A 2RINA 1GVCA 2AIXA 2OCUA 2OWZA 3OMBA 2X26A 4H5GA 3LV0A 5CMMA 3SKPA 5AA4B 1NV6A 1FQFA 4GF8A 4RY1A 1ANFA 4U2RA 3KBZA 4PFTA 2A5TA 5FTHA 1I69A 1NV5A 5J1DA 2WBBA 4MNPA 4MIJA 1IITA 3KN8A 4L17A 3Q29A 1EYJA 5B70A 3UIFA 3IORA 1VE4A 3MP8A 4MAGA 5I59A 1CB6A 1MQJA 5L9MA 2AL4A 5KDTA 4LQ2A 5ET5A 2Z8EA 4EQ7A 2ZMBA 3TCHA 3MYUA 1LGBC 4H46A 1B0LA 3Q27A 1B05A 1T0KA 1URSA 2DWJA 5IM2A 2QMWA 1EZPA 1UIUA 5IGAA 3H6VA 4AB6A 2I3VA 3ODBA 4OVTA 3QAXA 1FBCA 2YJPA 4FJPA 4GWUA 3MVYA 4ZEKA 2ANJA 3UP9A 3OO7A 1FBPA 2QS2A 2XWOA 4IR8A 2XXTA 3PV0E 1POY1 5H8FB 4IO6A 4FEDA 3U92A 3M3LA 3T1BA 4EQ9A 3VVEA 3TELA 2YLNA 1Y4CA 2WBDA 3V89B 3TQLA 4RK2A 1B32A 5I3SA 4M1VA 3PMXA 2E1SA 3MJNA 2ZYMA 4IO4A 4O3BA 1B1XA 1AWBA 1N3XA 1Y20A 5H8NB 4MF3A 2DE3A 4F19A 3CFLA 1TWYA 3MVZA 2UVJA 2VPOA 4WEPA 1A40A 1NV1A 2CEYA 3LUZA 4OERA 2Y7RA 3ECRA 3ONMA 1D3KA 4NTLA 4NGUA 2QS1A 4R6HA 1INPA 2ZXTA 2DWIA 1MXWA 1B5JA 1B3FA 1FRPA 2VPNA 4U1OA 4XKRA 3B6TA 3WAEA 1H43A 3IOTA 4QXDA 4RJZA 2OBGA 2DP8A 1PDAA 1NUWA 3M3FA 3UN6A 1B1HA 4AB5A 1NV0A 1I6BA 1NL5A 5I2KB 4P0IA 1Y3NA 2P3VA 2F3BA 4MFIA 3N94A 3K6VA 3TKDA 2QRYA 3DP8A 4O3AA 1DCUA 4ZS9A 2I3WA 4QBAA 2PVUA 2DQVA 4R72A 4F1VA 5F7VA 5L9SA 4OFJA 1Q35A 4NN3A 1ZTYA 4JVCA 3U72A 3K1MA 2REJA 3K0VA 1KZ8A 3ILUB 2KLFA 3FVNA 1MQIA 3DLNA 3V83A 2Q2CA 1LFIA 4BDMA 1UTHB 1B9JA 1F9BA 1B7HA 5B7DA 1QULA 3O9PA 4MX6A 3KN7A 4RK9A 5EHSA 2R9JA 2DE4A 2XXIA 1B2HA 3C35A 4GXAA 2Y7PA 1GV8A 2F7AA 1FSAA 4OTEA 1FCKA 3KBRA 1R1NA 3VVFA 1H45A 5ET7A 2CZKA 1OMPA 3SZPA 5H8QB 5DVJA 1NV7A 4K3FA 3EHSA 1FQAA 2FNCA 3CIJA 2O51A 2Y7KA 4I62A 4XKQA 5AA2D 1MH4A 4G68C 5ITPA 4F3SA 2XXHA 2I58A 4GWYA 2PYYA 4NG7A 3K6WA 4P9KA 4NQ8A 3RLFE 4I40A 4HCYA 2UYEA 1LAGE 4LZ8A 1MPCA 2XXVA 3D1RA 2CZLA 1IMEA 4OFOA 1UIVA 4I9DA 3TQWA 1JVYA 3VDFA 3QMFA 3M3KA 2RC9A 4FE8A 1FBHA 1NUYA 4IGRA 4ELPA 5BWJA 1FPFA 2XWKA 1YAEA 3MP1A 2Y84A 1AH5A 3EHTA 3S4UA 1B5IA 1VFDA 1P1NA 4HW8A 3IL1B 4HE2A 5I58A 5CC2A 2VOZA 3IJXB 4LATA 1G0IA 4N6PA 4GXSB 5DVFA 3U8QA 1IIWA 4OA4A 2H99A 3CFZA 3QYTA 4F3GA 2ZYNA 3N26A 1RKMA 5TP9B 4NF0A 3O6HA 3WAFA 4QSEA 1BP5A 3VVDA 3KOTA 1FJ9A 3EN3A 1FW0A 3VLUA 3V8XB 5L8DA 1XHYA 1SYHA 1ZMGA 3TYHA 1BTJA 3VXCA 2P0SA 4YKIA 1VR5A 4R6YA 3USDA 4R2BA 4QFLA 1LBBA 2NUVA 3MQ9A 5I57A 2I0BA 2IA4A 4QSCA 3FXUA 1EZ9A 2RC7A 1USYE 3K6XA 3FJMA 2UVHA 2CEXA 3KC1A 2F5XA 2DVZA 3R6UA 3I5OA 1NNFA 1FQBA 3TTNA 3TZAA 1IMBA 2HXWA 3CRBA 4M4GA 2UVGA 4ONYA 1FTLA 1ELJA 2V93A 1NV3A 5ET8A 4G8MA 3VV5A 1NMUA 4UACA 1NNTA 2CZHA 1P1UA 4LZ5A 3B6WA 1MXYA 1LCTA 1UTBA 4MCOA 2E0SA 4ND9A 5TU0A 1GR2A 1MQGA 1RYOA 4N15A 3SEUA 3K01A 4LVQA 3UGWA 5I2NB 1TXFA 4TLLB 3FXQA 4PF6A 3W9WA 1QJMA 4IO3A 1B6HA 4E0XA 5AA3A 4PFRA 4MEVA 2F6GA 1B3HA 3G3GA 5CMBA 4KD5A 1G0HA 4HXVA 1MM6A 3PUVE 3G3FA 1S50A 3MPLA 4GWOA 1TT1A 3TMGA 2R71A 3MUQA 1XVXA 2X7PA 3IJOB 4G8HA 2THIA 4H1XA 4I1DA 1CNQA 2HQ0A 1A99A 4GWZA 1B4ZA 4BDNA 4JVDA 4G2ZA 3KFMA 1R6ZA 3RNNA 4N6DA 1BIYA 4KCDA 4KR5A 2CMOA 5EQ7A 4PAKA 3JYRA 4GX6A 4KQPA 1XS5A 4N4UA 2PX1A 2VD3A 4XIGQ 4PFIA 4PFUA 1YPNA 1ZBMA 3G3KA 1RDZA 5L9OA 3DELB 2BJIA 2GHAA 2P3NA 5KCJA 2MKZA 4EXLA 5DEXB 3S2VA 4OYVA 4POXA 4GFRA 2ONKE 3LC8A 2Z23A 1FTOA 1CE2A 4G68B 2FVZA 3KSXA 4PAFA 1OIBA 4GWWA 5EQ9A 4EF1A 5HBCA 2JJKA 3FXBA 3TEPA 5CRYA 2F36A 4NF8B 1MPDA 4AS4A 4Q8RA 2RC8A 3QXMA 2HZKA 3CVGA 4QFOA 4YKJA 3B7DA 3H7MA 1L5TA 4O3CA 5JTYA 5DTBA 3FIRA 1NH7A 4N07A 1Y1ZA 4R73A 4ZZEA 3MBPA 2ZZVA 3EF7A 3KG2A 4G68A 4P3LA 2VGQA 2XXKA 4OVSA 4AS5A 4F3BA 5AA1A 1DBZA 3JZJA 5HM4B 4IGTA 3K1PA 1LBXA 4DLDA 2HAUA 2Q8JA 3T0JA 2QPQA 3A3CA 5I58B 3BFTA 3TFLA 4MMPA 4RNSA 1EH3A 3P7IA 4JBZA 3KOSA 2XD2A 3RT8A 1LFHA 5BUUA 3IO6A 2D3IA 2F3DA 3PGFA 3B6QA 4ZE8A 1B3LA 5ITOA 3N6UA 3KEIA 1PB7A 1GTKA 4O8MA 1LAFE 2VT5A 4PQJA 4NWDA 3N5LA 3O66A 4X1DA 4U23A 4F29A 4OVQA 3PPNA 3FVGA 3K2DA 3RUMA 3OEKA 5DT6A 5FHMA 5I56A 3FUZA 5AE4A 4EF2A 5FHNA 2WYKA 3OO8A 2XA5A 1NI9A 3G3IA 4NF4A 3ZSFA 1S9TA 2ALUA 3R26A 1JEVA 5CM6A 3TTLA 5FBPA 4UA8A 4PDHA 3BFUA 2HEUA 5I2NA 5H8HA 1AOVA 4QF9A 1Y9UA 1IQ7A 2AL5A 3GBBA 3MAMA 1B7UA 2OWTA 2PMSA 3M8UA 4XF5A 3FJGA 1RDYA 2ESNA 1A8EA 1SW1A 1B4HA 2XXQA 4XKPA 3T96B 3K1NA 5DW8A 4U21A 4LONB 1IMDA 1NUZA 5KDTB 2QFLA 4H65A 1FPDA 2O68A 3KSJA 1NV2A 3FBPA 1B3GA 2NVUB 3FASA 2Q74A 1M5FA 2D5WA 1B52A 1P1QA 2UYFA 3G3HA 4ZEIA 4P8BA 1SYIA 2XX7A 4JWOA 2I48A 4YB7A 1URDA 3KZGA 3T9VA 3W9VA 2DE2A 3TTMA 5H8QA 3O6IA 2F34A 4RYAA 1DTZA 4H8JA 5DYHA 5FTIA 3C32A 3PUYE 1MXVA 4N8GA 4TLMB 1H3DA 2IEEA 2R8TA 5IZ1A 5ICQA 1B0HA 1FQEA 4ESWA 1LEVA 4PBQA 3C4MA 4GL0A 5F24A 1B40A 4XTCQ 1MS7A 1JW1A 5ELVA 2WYPA 5EYGA 1MQHA 3TTRA 3RPLB 4UABA 3U93A 4U4SA 1QVSA 1NNPA 2FYIA 5I59B 2XWVA 5J16A 1YXIA 2AYSA 1OQHA 3K02A 4XKNA 1YYZA 1SD3A 1NUXA 1FPJA 4PGNA 1DK4A 5CBSA 4PFWA 4PFYA 1MDQA 3OSRA 3E78A 2I4BA 4DI4B 3ZS6A 1FPBA 2Z8FA 2GHBA 1LCFA 1Z7ME 3Q25A 2H98A 5LDZA 1FPGA 1JVXA 1QGXA 5K2XA 4OENA 1N04A 4ESXA 4HTGA 4X04A 4OQOA 4OANA 1NNKA 2XXPA 3VLWA 1PC3A 1A8FA 2A5TB 4OVRA 4F2OA 4WXJA 1US5A 4OZ9A 1AMFA 5IAIA 2GFEA 5CBRA 1QUKA 1QUJA 2UXAA 3HPIA 2OZZA 4IO7A 2I49A 4R2FA 1M5DA 1P1WA 4BLAA 3HV1A 5I57B 4HS7A 3PMWA 2QJEA 1H44A 5TP9A 4YZZA 1OVBA 5TPAB 2OK2A 4KFQA 1POTA 3RY3A 4JXIA 4OESA 4MNIA 3H6UA 4E0WA 3C31A 2OLBA 1US4A 4JDFA 4EDPA 4N17A 2H4IA 2PT1A 2Q89A 3LSWA 3ZKLA 3SERA 3GXAA 3V5AA 4QRZA 2LAOA 4FEBA 2PFYA 1D9YA 4PBHA 1FBEA 4EQBA 3RN8A 2KQZA 1YTVA 4OFLA 4NF6A 4KYSA 3ISPA 1A55A 1MRPA 4LA9A 2BJJX 4THIA 1SW2A 2NXOA 4KHZE 1IXGA 5EYHA 1RDXA 3H6WA 4RXLA 1BLFA 3BBRA 3MWBA 3K00A 3FZVA 4YB6A 3PUXE 2HPGA 3Q28A 1P99A 3PU5A 2XXYA 1A54A 3SETA 1BKAA 1DSNA 3H06B 1HSJA 4N81A 2VD2A 4GBVA 4ZEFA 4F2QA 3CR9A 1Z7NE 2O1LA 2DVCA 4OVJA 1IEJA 3K4UA 4ZEDA 5CMKA 3I3VA 1ZU0A 1D9VA 2ZNTA 3LUYA 1QW0A 3IB2A 3HO7A 4GL8A 4FBPA 2F78A 2O69A 4RPOA 4F1YA 1MY4A 5ICTA 1VFEA 1SVXB 4O7MA 2ZNUA 3H03A 4PE5B 4PETA 3KJTA 4ZZAA 1M5EA 3HHGA 1R9QA 3QUJA 3W15C 1IXIA 3TAJA 4F18A 1UTHA 4NF4B 4OETA 3RYDA 5I84A 3LSXA 5IZ3B 2DSFA 1QUIA 1FPIA 1MH3A 4MH5A 1LBYA 1QKAA 4DIGA 3FD3A 3PD8A 4FAJA 3GBAA 1RYXA 2GQ1A 4P47A 1DPEA 1ZKBA 1Y3PA 3EHUA 3D4CA 1FPEA 4P0GA 4C0RA 4MLQA 4DXBA 3SEXA 3RGYA 2O1MA 2G29A 3OOAA 3SEWA 3S9MC 2O7IA 3T9XB 2CZIA 1N3WA 2WKYA 3LSLA 5AA4A 3U65A 4PP0A 4C1UA 1J1NA 5HPQA 4GLIA 2DYXA 3T9HB 4XFEA 2F6PA 3EPEA 4ZEBA 3MP6A 1FTJA 3PPPA 4QSDA 3OO9A 3CSGA 2Q9TA 2B3FA 1DPPA 3RTFB 1Q1KA 4TQUQ 2NWJA 5I2KA 1MPBA 5A5XA 1LLSA 4MNCA 4GIZA 4N91A 4DE8A 1FBGA 1JP4A 1FBDA 1A7LA 4OEUA 5T3JA 1OQGA 4GX4A 1N0TA 1LSTA 3O6GA 1YZ0A 5JK4A 4LUBA 3KJ7A 1I6AA 5EHMA 1IMAA 2Z22A 4AQ4A 1XI6A 5IKBA 1OVTA 3DM0A 2ONRA 4N13A 1FBFA 4BDLA 4TOZA 2DXRA 1IZ1A 1Y4TA 3ILTB 4I3EA 5FHOA 4F22A 1XC1A 2PFZA 5I7IA 3GZGA 1N7WA 1SI0A 1M5CA 2WX9A 3EKIA 3T22A 2QVVA 1PBQA 4LN5A 3RPLA 2XXWA 3FV1A 3UK4A 1LAHE 1FQDA 3OENA 4GQOA 2ZYOA 5JTYB 3FGSA 4I8CA 4POWA 4LZ7A 1N84A 5CI5A 4NF5A 1XT8A 1ZIUA 1VDWA 3C33A 2HCAA 4PFBA 4OHNA 3RTWB 4R75A 1MM7A 4LQ5A 2V3UA 2UVIA 4BDQA 3FVOA 3FV2A 1B46A 4KXPA 1MY2A 4OXVA 3QUFA 3CI8A 1PBPA 4BDOA 1LBZA 4OEVA 2FHYA 4IY5A 1FTAA 4YICA 1IUDA 2Y7IA 3PTYA 2F97A 4FIMA 1KA0A 4XEQA 1DTGA 4P1LA 2ONSA 4ELRA 2P2AA 1AL3A 4DXUA 2RKMA 3DP4A 2VHAA 2DWAA 2O6AA 3TCGA 1JW4A 3BIGA 2DOJA 1MQDA 4QHQA 1NV4A 2OX3A 4ELOA 4H45A 3RT6B 3S9NC 2Z8DA 2Q8MA 3GYYA 4P11A 1K9ZA 4DXCA 4RA1A
chains in the Genus database with same CATH topology
5CBSA 1SW5A 2P0SA 3L6HA 4PFWA 4PFYA 1HSLA 1MY3A 3QK6A 1MDQA 2X7QA 3OSRA 1ZJLA 1TFDA 4YKIA 3OEMA 1VR5A 4R6YA 3UA8A 4FATA 3USDA 4R2BA 4QFLA 1LBBA 2NUVA 3C36A 3IAZA 4EXKA 3MQ9A 3Q26A 3PUZE 5I57A 2I4BA 2ZYKA 3LSFB 4F39A 2V3TA 5M2VA 3ZS6A 5I2KA 2I0BA 3O97A 2IA4A 4QSCA 3FXUA 2Z8FA 4IB2A 4QFNA 2GHBA 1D4NA 1EZ9A 1II5A 1O63A 2RC7A 1LCFA 1USYE 3K6XA 2HZLA 4Z0IA 3FJMA 1Z7ME 3Q25A 4WEDA 2UVHA 1NH8A 2H98A 3SESA 4F1UA 3CFXA 2F5XA 5I56B 3SEYA 1JVXA 2DVZA 3R6UA 4OENA 3I5OA 4R6KA 5K2XA 1NNFA 1FQBA 3OSQA 1XOCA 4GRKA 1LFGA 1N04A 3O2AA 3TTNA 2FA7A 4F3PA 3TZAA 1URGA 4IO2A 2RCBA 1OLCA 3PPRA 4H5FA 3PUWE 4ESXA 5CMCA 3MZ9A 4HTGA 3OELA 2GRVA 2HXWA 3CRBA 4M4GA 4OQOA 2UVGA 4ONYA 2GH9A 1FTLA 1NNKA 2XXPA 3VLWA 1ELJA 2V93A 3IOVA 1PC3A 1IXHA 1WODA 2YPNA 1A8FA 2A5TB 3D4GA 2I0CA 3HCQA 4G8MA 3IO4A 3EQ1A 4WXJA 1KWHA 3OO6A 1US5A 4RPNA 3MVXA 4OZ9A 1AMFA 3U94A 2GFEA 5IAIA 3T93B 3VV5A 4DCYA 1NMUA 1PB8A 1NNTA 4UACA 5CBRA 2H5YA 1S7YA 1SI1A 1P1UA 2Q2AA 3HN0A 3T66A 1QUKA 2RINA 4LZ5A 4Q30B 1QUJA 3B6WA 1GVCA 1AIVA 2AIXA 1MXYA 2OCUA 1I6QA 2UXAA 3HPIA 3OMBA 1LCTA 2X26A 1UTBA 4H5GA 2OZZA 3L6GA 4G8NA 4ZDMA 5CMMA 4IO7A 3SKPA 2E0SA 2I49A 4ND9A 5TU0A 4R2FA 5AA4B 1GR2A 1M5DA 1MQGA 1P1WA 1RYOA 4RY1A 1FQFA 4GF8A 1N7XA 4BLAA 4Q5TA 1MXZA 3SEUA 3HV1A 3K01A 4LVQA 3UGWA 1ANFA 5AA2B 1TXFA 5H8FA 5I2NB 4U2RA 4R9FA 5I57B 2F7CA 4PFTA 3FXQA 4TLLB 1HSEA 4ISUA 3UORA 1O64A 2A5TA 5FTHA 1I69A 3HHFA 3W9WA 4HS7A 3PMWA 1ATGA 2QJEA 5J1DA 4Z7EA 1H44A 1QJMA 4IO3A 5TP9A 3A09A 1JETA 5K2YA 4EQBA 1IITA 1B6HA 3KN8A 4L17A 3Q29A 4YZZA 4E0XA 5AA3A 4DCXA 2HAVA 3H6TA 4GD5A 2F6GA 1OVBA 5TPAB 1B3HA 5B70A 3G3GA 3IORA 3UIFA 1VE4A 2OK2A 3QSLA 4KFQA 4FORA 5CMBA 1PB9A 1POTA 3PD9A 4KD5A 1B5HA 3MP8A 3RY3A 4KPTA 4JXIA 4OESA 1MM6A 5I59A 3PUVE 1CB6A 1MQJA 3G3FA 4F31B 1S50A 5L9MA 5KCJB 1H76A 2QMXA 3H6UA 2AL4A 2QS3A 3MPLA 4GWOA 4LQ2A 5KDTA 5TPAA 2V3QA 4E0WA 2Z8EA 2OLBA 3C31A 4YMAA 1TT1A 1US4A 2O84X 2ZMBA 3TCHA 4EQ7A 2XD3A 3TMGA 2R71A 3MUQA 1LGBC 4JDFA 4YKKA 4EDPA 2PT2A 4F19A 4ZECA 2B3BA 1XVXA 1B0LA 3Q27A 2H4IA 1EU8A 2X7PA 1B05A 2PT1A 2Q89A 3IJOB 2B65A 2M8CA 3LSWA 1FTKA 2THIA 4G8HA 4H1XA 4I1DA 3ZKLA 3VXBA 3SERA 1TFAA 1URSA 3C9HA 3GXAA 2DWJA 3IB1A 2HQ0A 3V5AA 4QRZA 4C1TA 1A99A 2LAOA 2V84A 4FEBA 1O7TA 1B4ZA 1D9YA 1LAXA 4BDNA 3G7WA 2QMWA 1EZPA 1B7ZA 1UIUA 2V25A 3KFMA 4G2ZA 3RN8A 1R6ZA 1YTVA 4G4PA 3H6VA 3C34A 4YU0A 4OFLA 4AB6A 2I3VA 3ODBA 4NF6A 3IOUA 3RNNA 3QAXA 1P1OA 5H8HB 1BIYA 4KCDA 2YJPA 2XX9A 4KR5A 1A55A 2CMOA 4FJPA 3MVYA 4KYSA 4ZEKA 1MRPA 2ANJA 4LA9A 2BJJX 3OO7A 3UP9A 4JSOA 3JYRA 2QS2A 4THIA 1SW2A 2NXOA 4KHZE 4KQPA 1IXGA 2XXTA 1XS5A 3VFJA 3PV0E 1POY1 5H8FB 3IK6B 2H25A 2QSXA 3CG1A 2PX1A 2VD3A 3H6WA 4RXLA 3TTKA 3IOWA 4IO6A 4XIGQ 1BLFA 4FEDA 3U92A 3BBRA 1YPNA 1ZBMA 2OWSA 3G3KA 3MWBA 4PFUA 4YB5A 3M3LA 3DP6A 3K00A 4DZ1A 1Y1MA 5L9OA 2XHDA 3DELB 1EZOA 1MXUA 2GHAA 3FZVA 3CSBA 4YB6A 5KCJA 3PUXE 3IR1A 4EXLA 3Q28A 5DEXB 3S2VA 4EQ9A 3VVEA 1P99A 4OYVA 3PU5A 4POXA 4GFRA 2ONKE 2XXYA 3TELA 1A54A 4YKPA 2YLNA 2REGA 3LC8A 3SETA 1Y4CA 2Z23A 5A5XB 1FTOA 1NKXA 3V89B 3TQLA 1CE2A 1BKAA 3MZBA 3KSXA 3PMVA 4G68B 4RK2A 1OIBA 1WDNA 1B32A 1DSNA 3H06B 3OD7A 4H6DA 1MY1A 3E3KA 1HSJA 5HBCA 4EF1A 2VD2A 4M1VA 3PMXA 2F8DA 2E1SA 3MJNA 1QKBA 2ZYMA 4ZEFA 4F2QA 4MBPA 3CR9A 5CRYA 1Z7NE 3THIA 2O1LA 5AA2A 2F36A 2DVCA 4IO4A 4NF8B 4O3BA 4OVJA 1MPDA 3VE1B 1IEJA 3K4UA 1B1XA 1N3XA 1Y20A 4ZEDA 5H8NB 4Q8RA 2RC8A 5CMKA 3I3VA 4MF3A 1ZU0A 3QXMA 1D9VA 1VSOA 2ZNTA 3LUYA 2DE3A 1QW0A 2HZKA 3CFLA 3IB2A 1GGGA 1TWYA 3N6TA 3MVZA 3HO7A 2UVJA 1MG1A 1R9LA 3CVGA 4GL8A 4QFOA 2F78A 4WEPA 1A40A 1JQFA 2F7BA 2O69A 2RF1A 4RPOA 4YKJA 4F1YA 4MLVA 1MY4A 4OERA 1VFEA 1SVXB 2Y7RA 3B7DA 2ZNUA 2W7YA 3ECRA 3H7MA 3ONMA 3H03A 4NE4A 1D3KA 4PETA 3KJTA 4PE5B 4ZZAA 3MW0A 4NTLA 4JWYA 2QS1A 4O3CA 3U1OA 4R6HA 3O28A 5JTYA 1M5EA 3HHGA 2O7UA 5DTBA 1R9QA 2ZXTA 2DWIA 1NH7A 1MXWA 3FIRA 4N07A 1Y1ZA 1B51A 3QUJA 1B5JA 4R73A 1B3FA 3W15C 3MZ1A 1IXIA 4NF8A 4ZZEA 3TAJA 4U1OA 4IO5A 2NOOA 4XKRA 4F18A 1UTHA 4NF4B 4OETA 1LBCA 3MBPA 3B6TA 4ECFA 3WAEA 1H43A 3FATA 5I84A 3IOTA 3EF7A 4OMBA 3LSXA 2I4CA 3BKIB 1L5TA 2DSFA 3KG2A 4G68A 4RJZA 1QUIA 2OBGA 1NFTA 2VGQA 1WVJA 2DP8A 5ICTA 4F3BA 5AA1A 1PDAA 1MH3A 3JZJA 3KN3A 3M3FA 4MH5A 3UN6A 1QKAA 1B1HA 4AB5A 3FD3A 3PD8A 4DIGA 5HM4B 4IGTA 3GBAA 3K1PA 4DLDA 4FAJA 1FTMA 1RYXA 1I6BA 1NL5A 2ZNSA 2HAUA 5I2KB 1DPEA 1ZKBA 1Y3PA 2Q8JA 4P0IA 1Y3NA 2QPQA 3RPWA 3A3CA 4MFIA 3W9VA 1JEUA 3EHUA 5EYFA 5I58B 3LBSA 3BFTA 4KYEA 3TFLA 3N94A 3D4CA 3K6VA 4RNSA 3TKDA 1EH3A 4P0GA 4C0RA 4MLQA 2QRYA 3P7IA 3HSTA 4BDRA 1IXCA 3DP8A 4JBZA 4O3AA 3KOSA 4ZS9A 2XD2A 4DXBA 2I3WA 3SEXA 3RGYA 2O1MA 4G77A 2G29A 3OOAA 3SEWA 4YMBA 3S9MC 2PVUA 3RT8A 2O7IA 2DQVA 3T9XB 1N3WA 5BUUA 1LFHA 4R72A 3IO6A 4F1VA 2WKYA 2D3IA 3OXNA 3LSLA 5F7VA 2RCAA 5AA4A 5L9SA 4OFJA 1Q35A 4PP0A 3PGFA 4C1UA 1ZTYA 1J1NA 3PPOA 5HPQA 4GLIA 3B6QA 4ZE8A 1B3LA 2DYXA 3U72A 3S9LC 3K1MA 5ITOA 3N6UA 2REJA 3T9HB 3KEIA 4ZE9A 1PB7A 2HFBA 3K0VA 5KZTA 3S9EA 2F6PA 3ILUB 4H67A 1USYH 2KLFA 1JW5A 2G93A 3EPEA 3FVNA 1MQIA 1GTKA 2H9BA 3DLNA 4ZEBA 3CG3A 3V83A 2Q2CA 3MP6A 1FTJA 1LFIA 3PPPA 1LAFE 4QSDA 4X48A 4EUOA 3OO9A 3CSGA 2Q9TA 2B3FA 1DPPA 1UTHB 1MDP1 3RTFB 4BDMA 1B9JA 3SDFA 4PQJA 1F9BA 3TEPA 1B7HA 1JNFA 2QS4A 3E9XA 4NWDA 1Q1KA 3N5LA 3O66A 4TQUQ 2XXRA 3A3UA 2NWJA 5B7DA 1QULA 2R6GE 3O9PA 3KN7A 4NMYA 4RK9A 4U23A 4X1DA 5EHSA 3T9UA 4F29A 1MPBA 5A5XA 1LLSA 1MXXA 2R9JA 3I6VA 3PPNA 4GIZA 2DE4A 2XXIA 1B2HA 4R74A 3C35A 3FVGA 4GXAA 3K2DA 5DEXA 2PBWA 2Y7PA 3RUMA 1GV8A 3OEKA 4QFPA 4DE8A 5DT6A 4OWDA 4U4XA 5FHMA 2F7AA 1A7LA 4LP2B 4IY6A 5I56A 3FUZA 4OTEA 2P1SA 5AE4A 4Q0CA 4EF2A 4OEUA 1FCKA 1XVYA 5FHNA 1OQGA 3KBRA 5H8SA 1N0TA 1LSTA 1R1NA 3O6GA 3OO8A 2DS9A 1H45A 4X1BA 1ZLQA 3VVFA 3G3IA 5JK4A 4NF4A 3ZSFA 1S9TA 4LUBA 3KGCA 1OMPA 2ALUA 3KJ7A 1I6AA 3IX1A 3R26A 2Z22A 5EHMA 2OJTA 1JEVA 5H8QB 2A5SA 3TCFA 3TTLA 4UA8A 5DVJA 4AQ4A 1OVTA 5CM6A 5IKBA 3BFUA 3DM0A 2ONRA 1PEBA 3H3GA 4N13A 4BDLA 2ABHA 2HEUA 4K3FA 3F11A 5I2NA 5H8HA 1AOVA 4H8IA 4QFKA 4U22A 4QF9A 1Y9UA 3EHSA 4TOZA 1IQ7A 1IZ1A 1Y4TA 1FQAA 2DXRA 2AL5A 2FNCA 3AXFA 3CIJA 3E4RA 3ILTB 3GBBA 3MAMA 2O51A 5FHOA 1B7UA 2D21A 2OWTA 1XC1A 2Y7KA 3SEVA 4F22A 2PMSA 3LR1A 3M8UA 4I62A 3K6UA 4XKQA 1MH4A 4JSDA 2DXYA 5AA2D 1Y3QA 4G68C 5ITPA 3FJGA 2Y7WA 2XXUA 3FVKA 4F3SA 3GZGA 2DWHA 2XXHA 1N7WA 1UQWA 1SI0A 1M5CA 2I58A 2ESNA 2PYYA 3K6WA 1A8EA 1SW1A 3T22A 1B4HA 2VP1A 2XXQA 4XKPA 3T96B 3K1NA 3RLFE 4KCCA 1PBQA 4HCYA 2UYEA 4LONB 4U21A 4JB7A 1LAGE 3TPAA 2XXWA 4LZ8A 5JEIA 1MPCA 2XXVA 2CZLA 3FV1A 3UK4A 1LAHE 5KDTB 4OFOA 1OLAA 1UIVA 1FQDA 1SQYA 4NF5B 3OENA 4FECA 4GQOA 2ZYOA 4H65A 4I9DA 5JTYB 3FGSA 3TQWA 4I8CA 1JVYA 2O68A 4POWA 3KSJA 3RQTA 4LZ7A 4WKMA 3VDFA 1B3GA 2NVUB 3FJ7A 3FASA 3M3KA 4ELQA 2RC9A 1N84A 4FE8A 5CI5A 1B58A 1M5FA 2D5WA 4NF5A 4YAHX 1XT8A 1ZIUA 1B52A 2Q88A 4IGRA 1P1QA 2UYFA 3C33A 3G3HA 4ELPA 5BWJA 4GVOA 3TUSA 2HCAA 3IB0A 3VLVA 4ZEIA 1SYIA 2XX7A 4JWOA 2I48A 4OHNA 3RTWB 4YB7A 1YAEA 3O29A 1URDA 4NWCA 3KZGA 4R75A 1MM7A 3MP1A 2Y84A 4LQ5A 3T9VA 4H0WA 5H8NA 1MY0A 1AH5A 2DE2A 4X9TA 5H8QA 3TODA 3O6IA 2V3UA 3TTMA 3EHTA 2F34A 4HCWA 2I6EA 4RYAA 3S4UA 1B5IA 1VFDA 1P1NA 1SBPA 2UVIA 1DTZA 3MC2A 4H8JA 5F1QA 4BDQA 5DYHA 4HW8A 5FTIA 3IL1B 1DOTA 5I58A 3E13X 3FVOA 2VOZA 5CC2A 3C32A 3FV2A 1B46A 3IJXB 3PUYE 4GOTA 1MY2A 4KI0E 3QUFA 4LATA 4OXVA 2XXXA 4KYDA 3CI8A 4N6PA 1MXVA 1UTBB 3MPKA 4TLMB 1PBPA 1H3DA 1SW4A 3G3JA 4GXSB 2IEEA 5DVFA 3QIMA 4BDOA 5ICQA 4NEDA 4OEVA 5DVIA 1FQCA 4IY5A 1B0HA 1FQEA 4ESWA 4YICA 3U8QA 1IUDA 2Y7IA 1IIWA 3C4MA 2H99A 4GL0A 3CFZA 3JV9A 2F97A 4FIMA 3QYTA 1M5BA 4F3GA 1B40A 1DTGA 4U1ZA 3GLBA 2ZYNA 2ONSA 1MS7A 4XTCQ 1JW1A 1SDXA 3N26A 5ELVA 2P2AA 1AL3A 4ELRA 1MQHA 1RKMA 2RKMA 3DP4A 5TP9B 4DDDA 4DXUA 2VHAA 2DWAA 3O6HA 3TTRA 2O6AA 3WAFA 3PPQA 3TCGA 4QSEA 4XXUA 1BP5A 1YCJA 3VVDA 1B3EA 3KOTA 3R7XA 1JW4A 1LB8A 3U93A 2DOJA 1MQDA 2XX8A 3ZKKA 3MVWA 3EN3A 4U4SA 1LB9A 4F2OA 5ISUA 3TDJA 1QVSA 1NNPA 2FYIA 4QHQA 5I59B 1FW0A 5LOMA 1T0KA 3VLUA 3V8XB 1N76A 5L8DA 1XHYA 4ELOA 1SYHA 1ZMGA 2AYSA 3RT6B 1OQHA 3FXRA 3TYHA 3K02A 3S9NC 4XKNA 2Z8DA 4JWXA 2QL3A 4NF6B 4R9GA 1SD3A 2F35A 1DMBA 3H4ZA 1BTJA 4P11A 4DXCA 4RA1A 3VXCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CBS A;  1SW5 A;  2P0S A;  3L6H A;  4PFW A;  4PFY A;  1HSL A;  1MY3 A;  3QK6 A;  1MDQ A;  2X7Q A;  3OSR A;  1ZJL A;  1TFD A;  4YKI A;  3OEM A;  1VR5 A;  4R6Y A;  3UA8 A;  4FAT A;  3USD A;  4R2B A;  4QFL A;  1LBB A;  2NUV A;  3C36 A;  3IAZ A;  4EXK A;  3MQ9 A;  3Q26 A;  3PUZ E;  5I57 A;  2I4B A;  2ZYK A;  3LSF B;  4F39 A;  2V3T A;  5M2V A;  3ZS6 A;  5I2K A;  2I0B A;  3O97 A;  2IA4 A;  4QSC A;  3FXU A;  2Z8F A;  4IB2 A;  4QFN A;  2GHB A;  1D4N A;  1EZ9 A;  1II5 A;  1O63 A;  2RC7 A;  1LCF A;  1USY E;  3K6X A;  2HZL A;  4Z0I A;  3FJM A;  1Z7M E;  3Q25 A;  4WED A;  2UVH A;  1NH8 A;  2H98 A;  3SES A;  4F1U A;  3CFX A;  2F5X A;  5I56 B;  3SEY A;  1JVX A;  2DVZ A;  3R6U A;  4OEN A;  3I5O A;  4R6K A;  5K2X A;  1NNF A;  1FQB A;  3OSQ A;  1XOC A;  4GRK A;  1LFG A;  1N04 A;  3O2A A;  3TTN A;  2FA7 A;  4F3P A;  3TZA A;  1URG A;  4IO2 A;  2RCB A;  1OLC A;  3PPR A;  4H5F A;  3PUW E;  4ESX A;  5CMC A;  3MZ9 A;  4HTG A;  3OEL A;  2GRV A;  2HXW A;  3CRB A;  4M4G A;  4OQO A;  2UVG A;  4ONY A;  2GH9 A;  1FTL A;  1NNK A;  2XXP A;  3VLW A;  1ELJ A;  2V93 A;  3IOV A;  1PC3 A;  1IXH A;  1WOD A;  2YPN A;  1A8F A;  2A5T B;  3D4G A;  2I0C A;  3HCQ A;  4G8M A;  3IO4 A;  3EQ1 A;  4WXJ A;  1KWH A;  3OO6 A;  1US5 A;  4RPN A;  3MVX A;  4OZ9 A;  1AMF A;  3U94 A;  2GFE A;  5IAI A;  3T93 B;  3VV5 A;  4DCY A;  1NMU A;  1PB8 A;  1NNT A;  4UAC A;  5CBR A;  2H5Y A;  1S7Y A;  1SI1 A;  1P1U A;  2Q2A A;  3HN0 A;  3T66 A;  1QUK A;  2RIN A;  4LZ5 A;  4Q30 B;  1QUJ A;  3B6W A;  1GVC A;  1AIV A;  2AIX A;  1MXY A;  2OCU A;  1I6Q A;  2UXA A;  3HPI A;  3OMB A;  1LCT A;  2X26 A;  1UTB A;  4H5G A;  2OZZ A;  3L6G A;  4G8N A;  4ZDM A;  5CMM A;  4IO7 A;  3SKP A;  2E0S A;  2I49 A;  4ND9 A;  5TU0 A;  4R2F A;  5AA4 B;  1GR2 A;  1M5D A;  1MQG A;  1P1W A;  1RYO A;  4RY1 A;  1FQF A;  4GF8 A;  1N7X A;  4BLA A;  4Q5T A;  1MXZ A;  3SEU A;  3HV1 A;  3K01 A;  4LVQ A;  3UGW A;  1ANF A;  5AA2 B;  1TXF A;  5H8F A;  5I2N B;  4U2R A;  4R9F A;  5I57 B;  2F7C A;  4PFT A;  3FXQ A;  4TLL B;  1HSE A;  4ISU A;  3UOR A;  1O64 A;  2A5T A;  5FTH A;  1I69 A;  3HHF A;  3W9W A;  4HS7 A;  3PMW A;  1ATG A;  2QJE A;  5J1D A;  4Z7E A;  1H44 A;  1QJM A;  4IO3 A;  5TP9 A;  3A09 A;  1JET A;  5K2Y A;  4EQB A;  1IIT A;  1B6H A;  3KN8 A;  4L17 A;  3Q29 A;  4YZZ A;  4E0X A;  5AA3 A;  4DCX A;  2HAV A;  3H6T A;  4GD5 A;  2F6G A;  1OVB A;  5TPA B;  1B3H A;  5B70 A;  3G3G A;  3IOR A;  3UIF A;  1VE4 A;  2OK2 A;  3QSL A;  4KFQ A;  4FOR A;  5CMB A;  1PB9 A;  1POT A;  3PD9 A;  4KD5 A;  1B5H A;  3MP8 A;  3RY3 A;  4KPT A;  4JXI A;  4OES A;  1MM6 A;  5I59 A;  3PUV E;  1CB6 A;  1MQJ A;  3G3F A;  4F31 B;  1S50 A;  5L9M A;  5KCJ B;  1H76 A;  2QMX A;  3H6U A;  2AL4 A;  2QS3 A;  3MPL A;  4GWO A;  4LQ2 A;  5KDT A;  5TPA A;  2V3Q A;  4E0W A;  2Z8E A;  2OLB A;  3C31 A;  4YMA A;  1TT1 A;  1US4 A;  2O84 X;  2ZMB A;  3TCH A;  4EQ7 A;  2XD3 A;  3TMG A;  2R71 A;  3MUQ A;  1LGB C;  4JDF A;  4YKK A;  4EDP A;  2PT2 A;  4F19 A;  4ZEC A;  2B3B A;  1XVX A;  1B0L A;  3Q27 A;  2H4I A;  1EU8 A;  2X7P A;  1B05 A;  2PT1 A;  2Q89 A;  3IJO B;  2B65 A;  2M8C A;  3LSW A;  1FTK A;  2THI A;  4G8H A;  4H1X A;  4I1D A;  3ZKL A;  3VXB A;  3SER A;  1TFA A;  1URS A;  3C9H A;  3GXA A;  2DWJ A;  3IB1 A;  2HQ0 A;  3V5A A;  4QRZ A;  4C1T A;  1A99 A;  2LAO A;  2V84 A;  4FEB A;  1O7T A;  1B4Z A;  1D9Y A;  1LAX A;  4BDN A;  3G7W A;  2QMW A;  1EZP A;  1B7Z A;  1UIU A;  2V25 A;  3KFM A;  4G2Z A;  3RN8 A;  1R6Z A;  1YTV A;  4G4P A;  3H6V A;  3C34 A;  4YU0 A;  4OFL A;  4AB6 A;  2I3V A;  3ODB A;  4NF6 A;  3IOU A;  3RNN A;  3QAX A;  1P1O A;  5H8H B;  1BIY A;  4KCD A;  2YJP A;  2XX9 A;  4KR5 A;  1A55 A;  2CMO A;  4FJP A;  3MVY A;  4KYS A;  4ZEK A;  1MRP A;  2ANJ A;  4LA9 A;  2BJJ X;  3OO7 A;  3UP9 A;  4JSO A;  3JYR A;  2QS2 A;  4THI A;  1SW2 A;  2NXO A;  4KHZ E;  4KQP A;  1IXG A;  2XXT A;  1XS5 A;  3VFJ A;  3PV0 E;  1POY 1;  5H8F B;  3IK6 B;  2H25 A;  2QSX A;  3CG1 A;  2PX1 A;  2VD3 A;  3H6W A;  4RXL A;  3TTK A;  3IOW A;  4IO6 A;  4XIG Q;  1BLF A;  4FED A;  3U92 A;  3BBR A;  1YPN A;  1ZBM A;  2OWS A;  3G3K A;  3MWB A;  4PFU A;  4YB5 A;  3M3L A;  3DP6 A;  3K00 A;  4DZ1 A;  1Y1M A;  5L9O A;  2XHD A;  3DEL B;  1EZO A;  1MXU A;  2GHA A;  3FZV A;  3CSB A;  4YB6 A;  5KCJ A;  3PUX E;  3IR1 A;  4EXL A;  3Q28 A;  5DEX B;  3S2V A;  4EQ9 A;  3VVE A;  1P99 A;  4OYV A;  3PU5 A;  4POX A;  4GFR A;  2ONK E;  2XXY A;  3TEL A;  1A54 A;  4YKP A;  2YLN A;  2REG A;  3LC8 A;  3SET A;  1Y4C A;  2Z23 A;  5A5X B;  1FTO A;  1NKX A;  3V89 B;  3TQL A;  1CE2 A;  1BKA A;  3MZB A;  3KSX A;  3PMV A;  4G68 B;  4RK2 A;  1OIB A;  1WDN A;  1B32 A;  1DSN A;  3H06 B;  3OD7 A;  4H6D A;  1MY1 A;  3E3K A;  1HSJ A;  5HBC A;  4EF1 A;  2VD2 A;  4M1V A;  3PMX A;  2F8D A;  2E1S A;  3MJN A;  1QKB A;  2ZYM A;  4ZEF A;  4F2Q A;  4MBP A;  3CR9 A;  5CRY A;  1Z7N E;  3THI A;  2O1L A;  5AA2 A;  2F36 A;  2DVC A;  4IO4 A;  4NF8 B;  4O3B A;  4OVJ A;  1MPD A;  3VE1 B;  1IEJ A;  3K4U A;  1B1X A;  1N3X A;  1Y20 A;  4ZED A;  5H8N B;  4Q8R A;  2RC8 A;  5CMK A;  3I3V A;  4MF3 A;  1ZU0 A;  3QXM A;  1D9V A;  1VSO A;  2ZNT A;  3LUY A;  2DE3 A;  1QW0 A;  2HZK A;  3CFL A;  3IB2 A;  1GGG A;  1TWY A;  3N6T A;  3MVZ A;  3HO7 A;  2UVJ A;  1MG1 A;  1R9L A;  3CVG A;  4GL8 A;  4QFO A;  2F78 A;  4WEP A;  1A40 A;  1JQF A;  2F7B A;  2O69 A;  2RF1 A;  4RPO A;  4YKJ A;  4F1Y A;  4MLV A;  1MY4 A;  4OER A;  1VFE A;  1SVX B;  2Y7R A;  3B7D A;  2ZNU A;  2W7Y A;  3ECR A;  3H7M A;  3ONM A;  3H03 A;  4NE4 A;  1D3K A;  4PET A;  3KJT A;  4PE5 B;  4ZZA A;  3MW0 A;  4NTL A;  4JWY A;  2QS1 A;  4O3C A;  3U1O A;  4R6H A;  3O28 A;  5JTY A;  1M5E A;  3HHG A;  2O7U A;  5DTB A;  1R9Q A;  2ZXT A;  2DWI A;  1NH7 A;  1MXW A;  3FIR A;  4N07 A;  1Y1Z A;  1B51 A;  3QUJ A;  1B5J A;  4R73 A;  1B3F A;  3W15 C;  3MZ1 A;  1IXI A;  4NF8 A;  4ZZE A;  3TAJ A;  4U1O A;  4IO5 A;  2NOO A;  4XKR A;  4F18 A;  1UTH A;  4NF4 B;  4OET A;  1LBC A;  3MBP A;  3B6T A;  4ECF A;  3WAE A;  1H43 A;  3FAT A;  5I84 A;  3IOT A;  3EF7 A;  4OMB A;  3LSX A;  2I4C A;  3BKI B;  1L5T A;  2DSF A;  3KG2 A;  4G68 A;  4RJZ A;  1QUI A;  2OBG A;  1NFT A;  2VGQ A;  1WVJ A;  2DP8 A;  5ICT A;  4F3B A;  5AA1 A;  1PDA A;  1MH3 A;  3JZJ A;  3KN3 A;  3M3F A;  4MH5 A;  3UN6 A;  1QKA A;  1B1H A;  4AB5 A;  3FD3 A;  3PD8 A;  4DIG A;  5HM4 B;  4IGT A;  3GBA A;  3K1P A;  4DLD A;  4FAJ A;  1FTM A;  1RYX A;  1I6B A;  1NL5 A;  2ZNS A;  2HAU A;  5I2K B;  1DPE A;  1ZKB A;  1Y3P A;  2Q8J A;  4P0I A;  1Y3N A;  2QPQ A;  3RPW A;  3A3C A;  4MFI A;  3W9V A;  1JEU A;  3EHU A;  5EYF A;  5I58 B;  3LBS A;  3BFT A;  4KYE A;  3TFL A;  3N94 A;  3D4C A;  3K6V A;  4RNS A;  3TKD A;  1EH3 A;  4P0G A;  4C0R A;  4MLQ A;  2QRY A;  3P7I A;  3HST A;  4BDR A;  1IXC A;  3DP8 A;  4JBZ A;  4O3A A;  3KOS A;  4ZS9 A;  2XD2 A;  4DXB A;  2I3W A;  3SEX A;  3RGY A;  2O1M A;  4G77 A;  2G29 A;  3OOA A;  3SEW A;  4YMB A;  3S9M C;  2PVU A;  3RT8 A;  2O7I A;  2DQV A;  3T9X B;  1N3W A;  5BUU A;  1LFH A;  4R72 A;  3IO6 A;  4F1V A;  2WKY A;  2D3I A;  3OXN A;  3LSL A;  5F7V A;  2RCA A;  5AA4 A;  5L9S A;  4OFJ A;  1Q35 A;  4PP0 A;  3PGF A;  4C1U A;  1ZTY A;  1J1N A;  3PPO A;  5HPQ A;  4GLI A;  3B6Q A;  4ZE8 A;  1B3L A;  2DYX A;  3U72 A;  3S9L C;  3K1M A;  5ITO A;  3N6U A;  2REJ A;  3T9H B;  3KEI A;  4ZE9 A;  1PB7 A;  2HFB A;  3K0V A;  5KZT A;  3S9E A;  2F6P A;  3ILU B;  4H67 A;  1USY H;  2KLF A;  1JW5 A;  2G93 A;  3EPE A;  3FVN A;  1MQI A;  1GTK A;  2H9B A;  3DLN A;  4ZEB A;  3CG3 A;  3V83 A;  2Q2C A;  3MP6 A;  1FTJ A;  1LFI A;  3PPP A;  1LAF E;  4QSD A;  4X48 A;  4EUO A;  3OO9 A;  3CSG A;  2Q9T A;  2B3F A;  1DPP A;  1UTH B;  1MDP 1;  3RTF B;  4BDM A;  1B9J A;  3SDF A;  4PQJ A;  1F9B A;  3TEP A;  1B7H A;  1JNF A;  2QS4 A;  3E9X A;  4NWD A;  1Q1K A;  3N5L A;  3O66 A;  4TQU Q;  2XXR A;  3A3U A;  2NWJ A;  5B7D A;  1QUL A;  2R6G E;  3O9P A;  3KN7 A;  4NMY A;  4RK9 A;  4U23 A;  4X1D A;  5EHS A;  3T9U A;  4F29 A;  1MPB A;  5A5X A;  1LLS A;  1MXX A;  2R9J A;  3I6V A;  3PPN A;  4GIZ A;  2DE4 A;  2XXI A;  1B2H A;  4R74 A;  3C35 A;  3FVG A;  4GXA A;  3K2D A;  5DEX A;  2PBW A;  2Y7P A;  3RUM A;  1GV8 A;  3OEK A;  4QFP A;  4DE8 A;  5DT6 A;  4OWD A;  4U4X A;  5FHM A;  2F7A A;  1A7L A;  4LP2 B;  4IY6 A;  5I56 A;  3FUZ A;  4OTE A;  2P1S A;  5AE4 A;  4Q0C A;  4EF2 A;  4OEU A;  1FCK A;  1XVY A;  5FHN A;  1OQG A;  3KBR A;  5H8S A;  1N0T A;  1LST A;  1R1N A;  3O6G A;  3OO8 A;  2DS9 A;  1H45 A;  4X1B A;  1ZLQ A;  3VVF A;  3G3I A;  5JK4 A;  4NF4 A;  3ZSF A;  1S9T A;  4LUB A;  3KGC A;  1OMP A;  2ALU A;  3KJ7 A;  1I6A A;  3IX1 A;  3R26 A;  2Z22 A;  5EHM A;  2OJT A;  1JEV A;  5H8Q B;  2A5S A;  3TCF A;  3TTL A;  4UA8 A;  5DVJ A;  4AQ4 A;  1OVT A;  5CM6 A;  5IKB A;  3BFU A;  3DM0 A;  2ONR A;  1PEB A;  3H3G A;  4N13 A;  4BDL A;  2ABH A;  2HEU A;  4K3F A;  3F11 A;  5I2N A;  5H8H A;  1AOV A;  4H8I A;  4QFK A;  4U22 A;  4QF9 A;  1Y9U A;  3EHS A;  4TOZ A;  1IQ7 A;  1IZ1 A;  1Y4T A;  1FQA A;  2DXR A;  2AL5 A;  2FNC A;  3AXF A;  3CIJ A;  3E4R A;  3ILT B;  3GBB A;  3MAM A;  2O51 A;  5FHO A;  1B7U A;  2D21 A;  2OWT A;  1XC1 A;  2Y7K A;  3SEV A;  4F22 A;  2PMS A;  3LR1 A;  3M8U A;  4I62 A;  3K6U A;  4XKQ A;  1MH4 A;  4JSD A;  2DXY A;  5AA2 D;  1Y3Q A;  4G68 C;  5ITP A;  3FJG A;  2Y7W A;  2XXU A;  3FVK A;  4F3S A;  3GZG A;  2DWH A;  2XXH A;  1N7W A;  1UQW A;  1SI0 A;  1M5C A;  2I58 A;  2ESN A;  2PYY A;  3K6W A;  1A8E A;  1SW1 A;  3T22 A;  1B4H A;  2VP1 A;  2XXQ A;  4XKP A;  3T96 B;  3K1N A;  3RLF E;  4KCC A;  1PBQ A;  4HCY A;  2UYE A;  4LON B;  4U21 A;  4JB7 A;  1LAG E;  3TPA A;  2XXW A;  4LZ8 A;  5JEI A;  1MPC A;  2XXV A;  2CZL A;  3FV1 A;  3UK4 A;  1LAH E;  5KDT B;  4OFO A;  1OLA A;  1UIV A;  1FQD A;  1SQY A;  4NF5 B;  3OEN A;  4FEC A;  4GQO A;  2ZYO A;  4H65 A;  4I9D A;  5JTY B;  3FGS A;  3TQW A;  4I8C A;  1JVY A;  2O68 A;  4POW A;  3KSJ A;  3RQT A;  4LZ7 A;  4WKM A;  3VDF A;  1B3G A;  2NVU B;  3FJ7 A;  3FAS A;  3M3K A;  4ELQ A;  2RC9 A;  1N84 A;  4FE8 A;  5CI5 A;  1B58 A;  1M5F A;  2D5W A;  4NF5 A;  4YAH X;  1XT8 A;  1ZIU A;  1B52 A;  2Q88 A;  4IGR A;  1P1Q A;  2UYF A;  3C33 A;  3G3H A;  4ELP A;  5BWJ A;  4GVO A;  3TUS A;  2HCA A;  3IB0 A;  3VLV A;  4ZEI A;  1SYI A;  2XX7 A;  4JWO A;  2I48 A;  4OHN A;  3RTW B;  4YB7 A;  1YAE A;  3O29 A;  1URD A;  4NWC A;  3KZG A;  4R75 A;  1MM7 A;  3MP1 A;  2Y84 A;  4LQ5 A;  3T9V A;  4H0W A;  5H8N A;  1MY0 A;  1AH5 A;  2DE2 A;  4X9T A;  5H8Q A;  3TOD A;  3O6I A;  2V3U A;  3TTM A;  3EHT A;  2F34 A;  4HCW A;  2I6E A;  4RYA A;  3S4U A;  1B5I A;  1VFD A;  1P1N A;  1SBP A;  2UVI A;  1DTZ A;  3MC2 A;  4H8J A;  5F1Q A;  4BDQ A;  5DYH A;  4HW8 A;  5FTI A;  3IL1 B;  1DOT A;  5I58 A;  3E13 X;  3FVO A;  2VOZ A;  5CC2 A;  3C32 A;  3FV2 A;  1B46 A;  3IJX B;  3PUY E;  4GOT A;  1MY2 A;  4KI0 E;  3QUF A;  4LAT A;  4OXV A;  2XXX A;  4KYD A;  3CI8 A;  4N6P A;  1MXV A;  1UTB B;  3MPK A;  4TLM B;  1PBP A;  1H3D A;  1SW4 A;  3G3J A;  4GXS B;  2IEE A;  5DVF A;  3QIM A;  4BDO A;  5ICQ A;  4NED A;  4OEV A;  5DVI A;  1FQC A;  4IY5 A;  1B0H A;  1FQE A;  4ESW A;  4YIC A;  3U8Q A;  1IUD A;  2Y7I A;  1IIW A;  3C4M A;  2H99 A;  4GL0 A;  3CFZ A;  3JV9 A;  2F97 A;  4FIM A;  3QYT A;  1M5B A;  4F3G A;  1B40 A;  1DTG A;  4U1Z A;  3GLB A;  2ZYN A;  2ONS A;  1MS7 A;  4XTC Q;  1JW1 A;  1SDX A;  3N26 A;  5ELV A;  2P2A A;  1AL3 A;  4ELR A;  1MQH A;  1RKM A;  2RKM A;  3DP4 A;  5TP9 B;  4DDD A;  4DXU A;  2VHA A;  2DWA A;  3O6H A;  3TTR A;  2O6A A;  3WAF A;  3PPQ A;  3TCG A;  4QSE A;  4XXU A;  1BP5 A;  1YCJ A;  3VVD A;  1B3E A;  3KOT A;  3R7X A;  1JW4 A;  1LB8 A;  3U93 A;  2DOJ A;  1MQD A;  2XX8 A;  3ZKK A;  3MVW A;  3EN3 A;  4U4S A;  1LB9 A;  4F2O A;  5ISU A;  3TDJ A;  1QVS A;  1NNP A;  2FYI A;  4QHQ A;  5I59 B;  1FW0 A;  5LOM A;  1T0K A;  3VLU A;  3V8X B;  1N76 A;  5L8D A;  1XHY A;  4ELO A;  1SYH A;  1ZMG A;  2AYS A;  3RT6 B;  1OQH A;  3FXR A;  3TYH A;  3K02 A;  3S9N C;  4XKN A;  2Z8D A;  4JWX A;  2QL3 A;  4NF6 B;  4R9G A;  1SD3 A;  2F35 A;  1DMB A;  3H4Z A;  1BTJ A;  4P11 A;  4DXC A;  4RA1 A;  3VXC A; 
#chains in the Genus database with same CATH topology
 1SW5 A;  1EYI A;  1HSL A;  3QK6 A;  3UA8 A;  4FAT A;  3C36 A;  1D9Q A;  3LSF B;  4F39 A;  5M2V A;  1FPL A;  3CHG A;  1LBV A;  4IB2 A;  1O63 A;  4Z0I A;  4PDD A;  3SES A;  4X8R A;  3OSQ A;  1XOC A;  4GRK A;  1LFG A;  2FA7 A;  4F3P A;  1URG A;  3PPR A;  3PUW E;  5CMC A;  3MZ9 A;  3OEL A;  3IOV A;  3HCQ A;  3OO6 A;  4RPN A;  3MVX A;  2L5V A;  3T93 B;  4DCY A;  1PB8 A;  1SI1 A;  3T66 A;  2ZZW A;  4Q30 B;  1AIV A;  3VLV A;  1I6Q A;  3L6G A;  4G8N A;  4ZDM A;  4HE1 A;  1N7X A;  4Q5T A;  1MXZ A;  5AA2 B;  4PTK A;  5H8F A;  4R9F A;  2F7C A;  3UOR A;  1HSE A;  4ISU A;  1O64 A;  3HHF A;  1ATG A;  5ESY A;  3A09 A;  1JET A;  5K2Y A;  4DCX A;  2B4L A;  2HAV A;  3H6T A;  4GD5 A;  3QSL A;  5EQA A;  4FOR A;  1PB9 A;  3PD9 A;  4GWX A;  1B5H A;  4KPT A;  4F31 B;  1H76 A;  2QMX A;  2QS3 A;  2QVU A;  5TPA A;  2V3Q A;  4YMA A;  2O84 X;  2XD3 A;  2XWI A;  4YKK A;  2PT2 A;  4PAI A;  4ZEC A;  2B3B A;  1K9Y A;  1EU8 A;  4Z7E A;  2B65 A;  2M8C A;  1FTK A;  3VXB A;  1TFA A;  3IB1 A;  3C9H A;  4C1T A;  2V84 A;  1O7T A;  1LAX A;  3G7W A;  1B7Z A;  2V25 A;  4PC9 A;  5KCJ B;  4G4P A;  4YU0 A;  3C34 A;  3IOU A;  1P1O A;  5H8H B;  2XX9 A;  1KA1 A;  4JSO A;  3VFJ A;  3IK6 B;  2H25 A;  2QSX A;  3CG1 A;  3TTK A;  3IOW A;  2OWS A;  4YB5 A;  4DZ1 A;  3DP6 A;  1Y1M A;  2XHD A;  1EZO A;  1MXU A;  2V4C A;  3CSB A;  3IR1 A;  4YKP A;  3B8B A;  2REG A;  4GWS A;  5A5X B;  1NKX A;  3MZB A;  3PMV A;  1WDN A;  3IFA A;  3OD7 A;  4H6D A;  1MY1 A;  3E3K A;  2F8D A;  1QKB A;  4MBP A;  3THI A;  5AA2 A;  3VE1 B;  4NX1 A;  2PCR A;  1VSO A;  3N6T A;  1GGG A;  1MG1 A;  1R9L A;  1JQF A;  2F7B A;  2RF1 A;  4MLV A;  2WEF A;  2W7Y A;  4NE4 A;  4MJO A;  3MW0 A;  4JWY A;  3U1O A;  3O28 A;  2O7U A;  5ET6 A;  1B51 A;  3MZ1 A;  4NF8 A;  4IO5 A;  2NOO A;  1LBC A;  4P56 A;  4ECF A;  3FAT A;  4OMB A;  4JVI A;  2I4C A;  4I3Y A;  3BKI B;  1NFT A;  1WVJ A;  2HXR A;  3KN3 A;  5IZ3 A;  1FTM A;  2ZNS A;  3RPW A;  1IMC A;  1JEU A;  5EYF A;  3LBS A;  4KYE A;  4O7I A;  4BDR A;  3HST A;  1IXC A;  3HFU A;  4G77 A;  4YMB A;  3OXN A;  2RCA A;  5IZZ A;  3PPO A;  3S9L C;  4GX3 A;  4ZE9 A;  2HFB A;  4N8Y A;  5KZT A;  4P1E A;  3S9E A;  4H67 A;  1USY H;  1EYK A;  2ZZX A;  1JW5 A;  2G93 A;  2H9B A;  3CG3 A;  1BK4 A;  4X48 A;  4EUO A;  3BIH A;  1MDP 1;  2KR0 A;  3SDF A;  1JNF A;  2QS4 A;  3E9X A;  2XXR A;  3A3U A;  2R6G E;  4NMY A;  4MHF A;  3T9U A;  1MXX A;  3I6V A;  4R74 A;  5DEX A;  2PBW A;  4QFP A;  4OWD A;  4U4X A;  4DI3 D;  4LP2 B;  4IY6 A;  2P1S A;  4Q0C A;  1XVY A;  5H8S A;  4X1B A;  2DS9 A;  1ZLQ A;  3KGC A;  3IX1 A;  5LTC A;  3IFC A;  2OJT A;  3TCF A;  2A5S A;  1SPI A;  3H3G A;  1PEB A;  2ABH A;  5EQ8 A;  3F11 A;  4H8I A;  4QFK A;  4U22 A;  2FIX A;  3AXF A;  3E4R A;  2FBP A;  3SEV A;  2D21 A;  3NOH A;  3LR1 A;  3B50 A;  3K6U A;  4JSD A;  2DXY A;  1Y3Q A;  2Y7W A;  2XXU A;  3FVK A;  2DWH A;  1UQW A;  5I5P A;  2VP1 A;  4KCC A;  4JB7 A;  4PCD A;  3TPA A;  4NAP A;  5JEI A;  2Y5L A;  1OLA A;  1SQY A;  4NF5 B;  4FEC A;  2QVR A;  3RQT A;  4PGP A;  4WKM A;  3FJ7 A;  4ELQ A;  1B58 A;  4YAH X;  2HHM A;  1IMF A;  2Q88 A;  4GVO A;  3IB0 A;  3O29 A;  4NWC A;  4H0W A;  5H8N A;  1MY0 A;  4X9T A;  3TOD A;  4HCW A;  2I6E A;  3MC2 A;  1SBP A;  5F1Q A;  1DOT A;  2B4M A;  3E13 X;  4GOT A;  4KI0 E;  2DDK A;  2XXX A;  4KYD A;  3E79 A;  1UTB B;  4PF8 A;  3MPK A;  1SW4 A;  3G3J A;  3QIM A;  4NED A;  4OVP A;  5DVI A;  1FQC A;  1FJ6 A;  3MST A;  4O94 A;  4GBW A;  3JV9 A;  1M5B A;  4U1Z A;  3GLB A;  4HE0 A;  1SDX A;  4DDD A;  3PPQ A;  4XXU A;  1YCJ A;  1B3E A;  3R7X A;  1LB8 A;  2XX8 A;  3ZKK A;  2Y5K A;  3MVW A;  5ISU A;  1LB9 A;  3TDJ A;  5LOM A;  1LBW A;  1N76 A;  3FXR A;  4G61 A;  4JWX A;  2QL3 A;  4NF6 B;  4R9G A;  2F35 A;  1DMB A;  3H4Z A;  3L6H A;  1MY3 A;  2X7Q A;  1ZJL A;  1TFD A;  4NHB A;  3OEM A;  3IAZ A;  4EXK A;  3Q26 A;  3PUZ E;  5A5L A;  1FPK A;  2FIE A;  2ZYK A;  2V3T A;  3O97 A;  4QFN A;  1D4N A;  1II5 A;  2HZL A;  4WED A;  1NH8 A;  4F1U A;  4N6K A;  3CFX A;  5I56 B;  3SEY A;  4R6K A;  3ROJ A;  3O2A A;  4IO2 A;  2RCB A;  1OLC A;  4H5F A;  2GRV A;  3KC0 A;  1Q9D A;  2GH9 A;  1IXH A;  1WOD A;  2YPN A;  4PE3 A;  3D4G A;  2I0C A;  3IO4 A;  3EQ1 A;  1KWH A;  3U94 A;  3A29 A;  2H5Y A;  1S7Y A;  3TUS A;  2Q2A A;  3HN0 A;  2RIN A;  1GVC A;  2AIX A;  2OCU A;  2OWZ A;  3OMB A;  2X26 A;  4H5G A;  3LV0 A;  5CMM A;  3SKP A;  5AA4 B;  1NV6 A;  1FQF A;  4GF8 A;  4RY1 A;  1ANF A;  4U2R A;  3KBZ A;  4PFT A;  2A5T A;  5FTH A;  1I69 A;  1NV5 A;  5J1D A;  2WBB A;  4MNP A;  4MIJ A;  1IIT A;  3KN8 A;  4L17 A;  3Q29 A;  1EYJ A;  5B70 A;  3UIF A;  3IOR A;  1VE4 A;  3MP8 A;  4MAG A;  5I59 A;  1CB6 A;  1MQJ A;  5L9M A;  2AL4 A;  5KDT A;  4LQ2 A;  5ET5 A;  2Z8E A;  4EQ7 A;  2ZMB A;  3TCH A;  3MYU A;  1LGB C;  4H46 A;  1B0L A;  3Q27 A;  1B05 A;  1T0K A;  1URS A;  2DWJ A;  5IM2 A;  2QMW A;  1EZP A;  1UIU A;  5IGA A;  3H6V A;  4AB6 A;  2I3V A;  3ODB A;  4OVT A;  3QAX A;  1FBC A;  2YJP A;  4FJP A;  4GWU A;  3MVY A;  4ZEK A;  2ANJ A;  3UP9 A;  3OO7 A;  1FBP A;  2QS2 A;  2XWO A;  4IR8 A;  2XXT A;  3PV0 E;  1POY 1;  5H8F B;  4IO6 A;  4FED A;  3U92 A;  3M3L A;  3T1B A;  4EQ9 A;  3VVE A;  3TEL A;  2YLN A;  1Y4C A;  2WBD A;  3V89 B;  3TQL A;  4RK2 A;  1B32 A;  5I3S A;  4M1V A;  3PMX A;  2E1S A;  3MJN A;  2ZYM A;  4IO4 A;  4O3B A;  1B1X A;  1AWB A;  1N3X A;  1Y20 A;  5H8N B;  4MF3 A;  2DE3 A;  4F19 A;  3CFL A;  1TWY A;  3MVZ A;  2UVJ A;  2VPO A;  4WEP A;  1A40 A;  1NV1 A;  2CEY A;  3LUZ A;  4OER A;  2Y7R A;  3ECR A;  3ONM A;  1D3K A;  4NTL A;  4NGU A;  2QS1 A;  4R6H A;  1INP A;  2ZXT A;  2DWI A;  1MXW A;  1B5J A;  1B3F A;  1FRP A;  2VPN A;  4U1O A;  4XKR A;  3B6T A;  3WAE A;  1H43 A;  3IOT A;  4QXD A;  4RJZ A;  2OBG A;  2DP8 A;  1PDA A;  1NUW A;  3M3F A;  3UN6 A;  1B1H A;  4AB5 A;  1NV0 A;  1I6B A;  1NL5 A;  5I2K B;  4P0I A;  1Y3N A;  2P3V A;  2F3B A;  4MFI A;  3N94 A;  3K6V A;  3TKD A;  2QRY A;  3DP8 A;  4O3A A;  1DCU A;  4ZS9 A;  2I3W A;  4QBA A;  2PVU A;  2DQV A;  4R72 A;  4F1V A;  5F7V A;  5L9S A;  4OFJ A;  1Q35 A;  4NN3 A;  1ZTY A;  4JVC A;  3U72 A;  3K1M A;  2REJ A;  3K0V A;  1KZ8 A;  3ILU B;  2KLF A;  3FVN A;  1MQI A;  3DLN A;  3V83 A;  2Q2C A;  1LFI A;  4BDM A;  1UTH B;  1B9J A;  1F9B A;  1B7H A;  5B7D A;  1QUL A;  3O9P A;  4MX6 A;  3KN7 A;  4RK9 A;  5EHS A;  2R9J A;  2DE4 A;  2XXI A;  1B2H A;  3C35 A;  4GXA A;  2Y7P A;  1GV8 A;  2F7A A;  1FSA A;  4OTE A;  1FCK A;  3KBR A;  1R1N A;  3VVF A;  1H45 A;  5ET7 A;  2CZK A;  1OMP A;  3SZP A;  5H8Q B;  5DVJ A;  1NV7 A;  4K3F A;  3EHS A;  1FQA A;  2FNC A;  3CIJ A;  2O51 A;  2Y7K A;  4I62 A;  4XKQ A;  5AA2 D;  1MH4 A;  4G68 C;  5ITP A;  4F3S A;  2XXH A;  2I58 A;  4GWY A;  2PYY A;  4NG7 A;  3K6W A;  4P9K A;  4NQ8 A;  3RLF E;  4I40 A;  4HCY A;  2UYE A;  1LAG E;  4LZ8 A;  1MPC A;  2XXV A;  3D1R A;  2CZL A;  1IME A;  4OFO A;  1UIV A;  4I9D A;  3TQW A;  1JVY A;  3VDF A;  3QMF A;  3M3K A;  2RC9 A;  4FE8 A;  1FBH A;  1NUY A;  4IGR A;  4ELP A;  5BWJ A;  1FPF A;  2XWK A;  1YAE A;  3MP1 A;  2Y84 A;  1AH5 A;  3EHT A;  3S4U A;  1B5I A;  1VFD A;  1P1N A;  4HW8 A;  3IL1 B;  4HE2 A;  5I58 A;  5CC2 A;  2VOZ A;  3IJX B;  4LAT A;  1G0I A;  4N6P A;  4GXS B;  5DVF A;  3U8Q A;  1IIW A;  4OA4 A;  2H99 A;  3CFZ A;  3QYT A;  4F3G A;  2ZYN A;  3N26 A;  1RKM A;  5TP9 B;  4NF0 A;  3O6H A;  3WAF A;  4QSE A;  1BP5 A;  3VVD A;  3KOT A;  1FJ9 A;  3EN3 A;  1FW0 A;  3VLU A;  3V8X B;  5L8D A;  1XHY A;  1SYH A;  1ZMG A;  3TYH A;  1BTJ A;  3VXC A;  2P0S A;  4YKI A;  1VR5 A;  4R6Y A;  3USD A;  4R2B A;  4QFL A;  1LBB A;  2NUV A;  3MQ9 A;  5I57 A;  2I0B A;  2IA4 A;  4QSC A;  3FXU A;  1EZ9 A;  2RC7 A;  1USY E;  3K6X A;  3FJM A;  2UVH A;  2CEX A;  3KC1 A;  2F5X A;  2DVZ A;  3R6U A;  3I5O A;  1NNF A;  1FQB A;  3TTN A;  3TZA A;  1IMB A;  2HXW A;  3CRB A;  4M4G A;  2UVG A;  4ONY A;  1FTL A;  1ELJ A;  2V93 A;  1NV3 A;  5ET8 A;  4G8M A;  3VV5 A;  1NMU A;  4UAC A;  1NNT A;  2CZH A;  1P1U A;  4LZ5 A;  3B6W A;  1MXY A;  1LCT A;  1UTB A;  4MCO A;  2E0S A;  4ND9 A;  5TU0 A;  1GR2 A;  1MQG A;  1RYO A;  4N15 A;  3SEU A;  3K01 A;  4LVQ A;  3UGW A;  5I2N B;  1TXF A;  4TLL B;  3FXQ A;  4PF6 A;  3W9W A;  1QJM A;  4IO3 A;  1B6H A;  4E0X A;  5AA3 A;  4PFR A;  4MEV A;  2F6G A;  1B3H A;  3G3G A;  5CMB A;  4KD5 A;  1G0H A;  4HXV A;  1MM6 A;  3PUV E;  3G3F A;  1S50 A;  3MPL A;  4GWO A;  1TT1 A;  3TMG A;  2R71 A;  3MUQ A;  1XVX A;  2X7P A;  3IJO B;  4G8H A;  2THI A;  4H1X A;  4I1D A;  1CNQ A;  2HQ0 A;  1A99 A;  4GWZ A;  1B4Z A;  4BDN A;  4JVD A;  4G2Z A;  3KFM A;  1R6Z A;  3RNN A;  4N6D A;  1BIY A;  4KCD A;  4KR5 A;  2CMO A;  5EQ7 A;  4PAK A;  3JYR A;  4GX6 A;  4KQP A;  1XS5 A;  4N4U A;  2PX1 A;  2VD3 A;  4XIG Q;  4PFI A;  4PFU A;  1YPN A;  1ZBM A;  3G3K A;  1RDZ A;  5L9O A;  3DEL B;  2BJI A;  2GHA A;  2P3N A;  5KCJ A;  2MKZ A;  4EXL A;  5DEX B;  3S2V A;  4OYV A;  4POX A;  4GFR A;  2ONK E;  3LC8 A;  2Z23 A;  1FTO A;  1CE2 A;  4G68 B;  2FVZ A;  3KSX A;  4PAF A;  1OIB A;  4GWW A;  5EQ9 A;  4EF1 A;  5HBC A;  2JJK A;  3FXB A;  3TEP A;  5CRY A;  2F36 A;  4NF8 B;  1MPD A;  4AS4 A;  4Q8R A;  2RC8 A;  3QXM A;  2HZK A;  3CVG A;  4QFO A;  4YKJ A;  3B7D A;  3H7M A;  1L5T A;  4O3C A;  5JTY A;  5DTB A;  3FIR A;  1NH7 A;  4N07 A;  1Y1Z A;  4R73 A;  4ZZE A;  3MBP A;  2ZZV A;  3EF7 A;  3KG2 A;  4G68 A;  4P3L A;  2VGQ A;  2XXK A;  4OVS A;  4AS5 A;  4F3B A;  5AA1 A;  1DBZ A;  3JZJ A;  5HM4 B;  4IGT A;  3K1P A;  1LBX A;  4DLD A;  2HAU A;  2Q8J A;  3T0J A;  2QPQ A;  3A3C A;  5I58 B;  3BFT A;  3TFL A;  4MMP A;  4RNS A;  1EH3 A;  3P7I A;  4JBZ A;  3KOS A;  2XD2 A;  3RT8 A;  1LFH A;  5BUU A;  3IO6 A;  2D3I A;  2F3D A;  3PGF A;  3B6Q A;  4ZE8 A;  1B3L A;  5ITO A;  3N6U A;  3KEI A;  1PB7 A;  1GTK A;  4O8M A;  1LAF E;  2VT5 A;  4PQJ A;  4NWD A;  3N5L A;  3O66 A;  4X1D A;  4U23 A;  4F29 A;  4OVQ A;  3PPN A;  3FVG A;  3K2D A;  3RUM A;  3OEK A;  5DT6 A;  5FHM A;  5I56 A;  3FUZ A;  5AE4 A;  4EF2 A;  5FHN A;  2WYK A;  3OO8 A;  2XA5 A;  1NI9 A;  3G3I A;  4NF4 A;  3ZSF A;  1S9T A;  2ALU A;  3R26 A;  1JEV A;  5CM6 A;  3TTL A;  5FBP A;  4UA8 A;  4PDH A;  3BFU A;  2HEU A;  5I2N A;  5H8H A;  1AOV A;  4QF9 A;  1Y9U A;  1IQ7 A;  2AL5 A;  3GBB A;  3MAM A;  1B7U A;  2OWT A;  2PMS A;  3M8U A;  4XF5 A;  3FJG A;  1RDY A;  2ESN A;  1A8E A;  1SW1 A;  1B4H A;  2XXQ A;  4XKP A;  3T96 B;  3K1N A;  5DW8 A;  4U21 A;  4LON B;  1IMD A;  1NUZ A;  5KDT B;  2QFL A;  4H65 A;  1FPD A;  2O68 A;  3KSJ A;  1NV2 A;  3FBP A;  1B3G A;  2NVU B;  3FAS A;  2Q74 A;  1M5F A;  2D5W A;  1B52 A;  1P1Q A;  2UYF A;  3G3H A;  4ZEI A;  4P8B A;  1SYI A;  2XX7 A;  4JWO A;  2I48 A;  4YB7 A;  1URD A;  3KZG A;  3T9V A;  3W9V A;  2DE2 A;  3TTM A;  5H8Q A;  3O6I A;  2F34 A;  4RYA A;  1DTZ A;  4H8J A;  5DYH A;  5FTI A;  3C32 A;  3PUY E;  1MXV A;  4N8G A;  4TLM B;  1H3D A;  2IEE A;  2R8T A;  5IZ1 A;  5ICQ A;  1B0H A;  1FQE A;  4ESW A;  1LEV A;  4PBQ A;  3C4M A;  4GL0 A;  5F24 A;  1B40 A;  4XTC Q;  1MS7 A;  1JW1 A;  5ELV A;  2WYP A;  5EYG A;  1MQH A;  3TTR A;  3RPL B;  4UAB A;  3U93 A;  4U4S A;  1QVS A;  1NNP A;  2FYI A;  5I59 B;  2XWV A;  5J16 A;  1YXI A;  2AYS A;  1OQH A;  3K02 A;  4XKN A;  1YYZ A;  1SD3 A;  1NUX A;  1FPJ A;  4PGN A;  1DK4 A;  5CBS A;  4PFW A;  4PFY A;  1MDQ A;  3OSR A;  3E78 A;  2I4B A;  4DI4 B;  3ZS6 A;  1FPB A;  2Z8F A;  2GHB A;  1LCF A;  1Z7M E;  3Q25 A;  2H98 A;  5LDZ A;  1FPG A;  1JVX A;  1QGX A;  5K2X A;  4OEN A;  1N04 A;  4ESX A;  4HTG A;  4X04 A;  4OQO A;  4OAN A;  1NNK A;  2XXP A;  3VLW A;  1PC3 A;  1A8F A;  2A5T B;  4OVR A;  4F2O A;  4WXJ A;  1US5 A;  4OZ9 A;  1AMF A;  5IAI A;  2GFE A;  5CBR A;  1QUK A;  1QUJ A;  2UXA A;  3HPI A;  2OZZ A;  4IO7 A;  2I49 A;  4R2F A;  1M5D A;  1P1W A;  4BLA A;  3HV1 A;  5I57 B;  4HS7 A;  3PMW A;  2QJE A;  1H44 A;  5TP9 A;  4YZZ A;  1OVB A;  5TPA B;  2OK2 A;  4KFQ A;  1POT A;  3RY3 A;  4JXI A;  4OES A;  4MNI A;  3H6U A;  4E0W A;  3C31 A;  2OLB A;  1US4 A;  4JDF A;  4EDP A;  4N17 A;  2H4I A;  2PT1 A;  2Q89 A;  3LSW A;  3ZKL A;  3SER A;  3GXA A;  3V5A A;  4QRZ A;  2LAO A;  4FEB A;  2PFY A;  1D9Y A;  4PBH A;  1FBE A;  4EQB A;  3RN8 A;  2KQZ A;  1YTV A;  4OFL A;  4NF6 A;  4KYS A;  3ISP A;  1A55 A;  1MRP A;  4LA9 A;  2BJJ X;  4THI A;  1SW2 A;  2NXO A;  4KHZ E;  1IXG A;  5EYH A;  1RDX A;  3H6W A;  4RXL A;  1BLF A;  3BBR A;  3MWB A;  3K00 A;  3FZV A;  4YB6 A;  3PUX E;  2HPG A;  3Q28 A;  1P99 A;  3PU5 A;  2XXY A;  1A54 A;  3SET A;  1BKA A;  1DSN A;  3H06 B;  1HSJ A;  4N81 A;  2VD2 A;  4GBV A;  4ZEF A;  4F2Q A;  3CR9 A;  1Z7N E;  2O1L A;  2DVC A;  4OVJ A;  1IEJ A;  3K4U A;  4ZED A;  5CMK A;  3I3V A;  1ZU0 A;  1D9V A;  2ZNT A;  3LUY A;  1QW0 A;  3IB2 A;  3HO7 A;  4GL8 A;  4FBP A;  2F78 A;  2O69 A;  4RPO A;  4F1Y A;  1MY4 A;  5ICT A;  1VFE A;  1SVX B;  4O7M A;  2ZNU A;  3H03 A;  4PE5 B;  4PET A;  3KJT A;  4ZZA A;  1M5E A;  3HHG A;  1R9Q A;  3QUJ A;  3W15 C;  1IXI A;  3TAJ A;  4F18 A;  1UTH A;  4NF4 B;  4OET A;  3RYD A;  5I84 A;  3LSX A;  5IZ3 B;  2DSF A;  1QUI A;  1FPI A;  1MH3 A;  4MH5 A;  1LBY A;  1QKA A;  4DIG A;  3FD3 A;  3PD8 A;  4FAJ A;  3GBA A;  1RYX A;  2GQ1 A;  4P47 A;  1DPE A;  1ZKB A;  1Y3P A;  3EHU A;  3D4C A;  1FPE A;  4P0G A;  4C0R A;  4MLQ A;  4DXB A;  3SEX A;  3RGY A;  2O1M A;  2G29 A;  3OOA A;  3SEW A;  3S9M C;  2O7I A;  3T9X B;  2CZI A;  1N3W A;  2WKY A;  3LSL A;  5AA4 A;  3U65 A;  4PP0 A;  4C1U A;  1J1N A;  5HPQ A;  4GLI A;  2DYX A;  3T9H B;  4XFE A;  2F6P A;  3EPE A;  4ZEB A;  3MP6 A;  1FTJ A;  3PPP A;  4QSD A;  3OO9 A;  3CSG A;  2Q9T A;  2B3F A;  1DPP A;  3RTF B;  1Q1K A;  4TQU Q;  2NWJ A;  5I2K A;  1MPB A;  5A5X A;  1LLS A;  4MNC A;  4GIZ A;  4N91 A;  4DE8 A;  1FBG A;  1JP4 A;  1FBD A;  1A7L A;  4OEU A;  5T3J A;  1OQG A;  4GX4 A;  1N0T A;  1LST A;  3O6G A;  1YZ0 A;  5JK4 A;  4LUB A;  3KJ7 A;  1I6A A;  5EHM A;  1IMA A;  2Z22 A;  4AQ4 A;  1XI6 A;  5IKB A;  1OVT A;  3DM0 A;  2ONR A;  4N13 A;  1FBF A;  4BDL A;  4TOZ A;  2DXR A;  1IZ1 A;  1Y4T A;  3ILT B;  4I3E A;  5FHO A;  4F22 A;  1XC1 A;  2PFZ A;  5I7I A;  3GZG A;  1N7W A;  1SI0 A;  1M5C A;  2WX9 A;  3EKI A;  3T22 A;  2QVV A;  1PBQ A;  4LN5 A;  3RPL A;  2XXW A;  3FV1 A;  3UK4 A;  1LAH E;  1FQD A;  3OEN A;  4GQO A;  2ZYO A;  5JTY B;  3FGS A;  4I8C A;  4POW A;  4LZ7 A;  1N84 A;  5CI5 A;  4NF5 A;  1XT8 A;  1ZIU A;  1VDW A;  3C33 A;  2HCA A;  4PFB A;  4OHN A;  3RTW B;  4R75 A;  1MM7 A;  4LQ5 A;  2V3U A;  2UVI A;  4BDQ A;  3FVO A;  3FV2 A;  1B46 A;  4KXP A;  1MY2 A;  4OXV A;  3QUF A;  3CI8 A;  1PBP A;  4BDO A;  1LBZ A;  4OEV A;  2FHY A;  4IY5 A;  1FTA A;  4YIC A;  1IUD A;  2Y7I A;  3PTY A;  2F97 A;  4FIM A;  1KA0 A;  4XEQ A;  1DTG A;  4P1L A;  2ONS A;  4ELR A;  2P2A A;  1AL3 A;  4DXU A;  2RKM A;  3DP4 A;  2VHA A;  2DWA A;  2O6A A;  3TCG A;  1JW4 A;  3BIG A;  2DOJ A;  1MQD A;  4QHQ A;  1NV4 A;  2OX3 A;  4ELO A;  4H45 A;  3RT6 B;  3S9N C;  2Z8D A;  2Q8M A;  3GYY A;  4P11 A;  1K9Z A;  4DXC A;  4RA1 A; 
#chains in the Genus database with same CATH homology
 5CBS A;  1SW5 A;  2P0S A;  3L6H A;  4PFW A;  4PFY A;  1HSL A;  1MY3 A;  3QK6 A;  1MDQ A;  2X7Q A;  3OSR A;  1ZJL A;  1TFD A;  4YKI A;  3OEM A;  1VR5 A;  4R6Y A;  3UA8 A;  4FAT A;  3USD A;  4R2B A;  4QFL A;  1LBB A;  2NUV A;  3C36 A;  3IAZ A;  4EXK A;  3MQ9 A;  3Q26 A;  3PUZ E;  5I57 A;  2I4B A;  2ZYK A;  3LSF B;  4F39 A;  2V3T A;  5M2V A;  3ZS6 A;  5I2K A;  2I0B A;  3O97 A;  2IA4 A;  4QSC A;  3FXU A;  2Z8F A;  4IB2 A;  4QFN A;  2GHB A;  1D4N A;  1EZ9 A;  1II5 A;  1O63 A;  2RC7 A;  1LCF A;  1USY E;  3K6X A;  2HZL A;  4Z0I A;  3FJM A;  1Z7M E;  3Q25 A;  4WED A;  2UVH A;  1NH8 A;  2H98 A;  3SES A;  4F1U A;  3CFX A;  2F5X A;  5I56 B;  3SEY A;  1JVX A;  2DVZ A;  3R6U A;  4OEN A;  3I5O A;  4R6K A;  5K2X A;  1NNF A;  1FQB A;  3OSQ A;  1XOC A;  4GRK A;  1LFG A;  1N04 A;  3O2A A;  3TTN A;  2FA7 A;  4F3P A;  3TZA A;  1URG A;  4IO2 A;  2RCB A;  1OLC A;  3PPR A;  4H5F A;  3PUW E;  4ESX A;  5CMC A;  3MZ9 A;  4HTG A;  3OEL A;  2GRV A;  2HXW A;  3CRB A;  4M4G A;  4OQO A;  2UVG A;  4ONY A;  2GH9 A;  1FTL A;  1NNK A;  2XXP A;  3VLW A;  1ELJ A;  2V93 A;  3IOV A;  1PC3 A;  1IXH A;  1WOD A;  2YPN A;  1A8F A;  2A5T B;  3D4G A;  2I0C A;  3HCQ A;  4G8M A;  3IO4 A;  3EQ1 A;  4WXJ A;  1KWH A;  3OO6 A;  1US5 A;  4RPN A;  3MVX A;  4OZ9 A;  1AMF A;  3U94 A;  2GFE A;  5IAI A;  3T93 B;  3VV5 A;  4DCY A;  1NMU A;  1PB8 A;  1NNT A;  4UAC A;  5CBR A;  2H5Y A;  1S7Y A;  1SI1 A;  1P1U A;  2Q2A A;  3HN0 A;  3T66 A;  1QUK A;  2RIN A;  4LZ5 A;  4Q30 B;  1QUJ A;  3B6W A;  1GVC A;  1AIV A;  2AIX A;  1MXY A;  2OCU A;  1I6Q A;  2UXA A;  3HPI A;  3OMB A;  1LCT A;  2X26 A;  1UTB A;  4H5G A;  2OZZ A;  3L6G A;  4G8N A;  4ZDM A;  5CMM A;  4IO7 A;  3SKP A;  2E0S A;  2I49 A;  4ND9 A;  5TU0 A;  4R2F A;  5AA4 B;  1GR2 A;  1M5D A;  1MQG A;  1P1W A;  1RYO A;  4RY1 A;  1FQF A;  4GF8 A;  1N7X A;  4BLA A;  4Q5T A;  1MXZ A;  3SEU A;  3HV1 A;  3K01 A;  4LVQ A;  3UGW A;  1ANF A;  5AA2 B;  1TXF A;  5H8F A;  5I2N B;  4U2R A;  4R9F A;  5I57 B;  2F7C A;  4PFT A;  3FXQ A;  4TLL B;  1HSE A;  4ISU A;  3UOR A;  1O64 A;  2A5T A;  5FTH A;  1I69 A;  3HHF A;  3W9W A;  4HS7 A;  3PMW A;  1ATG A;  2QJE A;  5J1D A;  4Z7E A;  1H44 A;  1QJM A;  4IO3 A;  5TP9 A;  3A09 A;  1JET A;  5K2Y A;  4EQB A;  1IIT A;  1B6H A;  3KN8 A;  4L17 A;  3Q29 A;  4YZZ A;  4E0X A;  5AA3 A;  4DCX A;  2HAV A;  3H6T A;  4GD5 A;  2F6G A;  1OVB A;  5TPA B;  1B3H A;  5B70 A;  3G3G A;  3IOR A;  3UIF A;  1VE4 A;  2OK2 A;  3QSL A;  4KFQ A;  4FOR A;  5CMB A;  1PB9 A;  1POT A;  3PD9 A;  4KD5 A;  1B5H A;  3MP8 A;  3RY3 A;  4KPT A;  4JXI A;  4OES A;  1MM6 A;  5I59 A;  3PUV E;  1CB6 A;  1MQJ A;  3G3F A;  4F31 B;  1S50 A;  5L9M A;  5KCJ B;  1H76 A;  2QMX A;  3H6U A;  2AL4 A;  2QS3 A;  3MPL A;  4GWO A;  4LQ2 A;  5KDT A;  5TPA A;  2V3Q A;  4E0W A;  2Z8E A;  2OLB A;  3C31 A;  4YMA A;  1TT1 A;  1US4 A;  2O84 X;  2ZMB A;  3TCH A;  4EQ7 A;  2XD3 A;  3TMG A;  2R71 A;  3MUQ A;  1LGB C;  4JDF A;  4YKK A;  4EDP A;  2PT2 A;  4F19 A;  4ZEC A;  2B3B A;  1XVX A;  1B0L A;  3Q27 A;  2H4I A;  1EU8 A;  2X7P A;  1B05 A;  2PT1 A;  2Q89 A;  3IJO B;  2B65 A;  2M8C A;  3LSW A;  1FTK A;  2THI A;  4G8H A;  4H1X A;  4I1D A;  3ZKL A;  3VXB A;  3SER A;  1TFA A;  1URS A;  3C9H A;  3GXA A;  2DWJ A;  3IB1 A;  2HQ0 A;  3V5A A;  4QRZ A;  4C1T A;  1A99 A;  2LAO A;  2V84 A;  4FEB A;  1O7T A;  1B4Z A;  1D9Y A;  1LAX A;  4BDN A;  3G7W A;  2QMW A;  1EZP A;  1B7Z A;  1UIU A;  2V25 A;  3KFM A;  4G2Z A;  3RN8 A;  1R6Z A;  1YTV A;  4G4P A;  3H6V A;  3C34 A;  4YU0 A;  4OFL A;  4AB6 A;  2I3V A;  3ODB A;  4NF6 A;  3IOU A;  3RNN A;  3QAX A;  1P1O A;  5H8H B;  1BIY A;  4KCD A;  2YJP A;  2XX9 A;  4KR5 A;  1A55 A;  2CMO A;  4FJP A;  3MVY A;  4KYS A;  4ZEK A;  1MRP A;  2ANJ A;  4LA9 A;  2BJJ X;  3OO7 A;  3UP9 A;  4JSO A;  3JYR A;  2QS2 A;  4THI A;  1SW2 A;  2NXO A;  4KHZ E;  4KQP A;  1IXG A;  2XXT A;  1XS5 A;  3VFJ A;  3PV0 E;  1POY 1;  5H8F B;  3IK6 B;  2H25 A;  2QSX A;  3CG1 A;  2PX1 A;  2VD3 A;  3H6W A;  4RXL A;  3TTK A;  3IOW A;  4IO6 A;  4XIG Q;  1BLF A;  4FED A;  3U92 A;  3BBR A;  1YPN A;  1ZBM A;  2OWS A;  3G3K A;  3MWB A;  4PFU A;  4YB5 A;  3M3L A;  3DP6 A;  3K00 A;  4DZ1 A;  1Y1M A;  5L9O A;  2XHD A;  3DEL B;  1EZO A;  1MXU A;  2GHA A;  3FZV A;  3CSB A;  4YB6 A;  5KCJ A;  3PUX E;  3IR1 A;  4EXL A;  3Q28 A;  5DEX B;  3S2V A;  4EQ9 A;  3VVE A;  1P99 A;  4OYV A;  3PU5 A;  4POX A;  4GFR A;  2ONK E;  2XXY A;  3TEL A;  1A54 A;  4YKP A;  2YLN A;  2REG A;  3LC8 A;  3SET A;  1Y4C A;  2Z23 A;  5A5X B;  1FTO A;  1NKX A;  3V89 B;  3TQL A;  1CE2 A;  1BKA A;  3MZB A;  3KSX A;  3PMV A;  4G68 B;  4RK2 A;  1OIB A;  1WDN A;  1B32 A;  1DSN A;  3H06 B;  3OD7 A;  4H6D A;  1MY1 A;  3E3K A;  1HSJ A;  5HBC A;  4EF1 A;  2VD2 A;  4M1V A;  3PMX A;  2F8D A;  2E1S A;  3MJN A;  1QKB A;  2ZYM A;  4ZEF A;  4F2Q A;  4MBP A;  3CR9 A;  5CRY A;  1Z7N E;  3THI A;  2O1L A;  5AA2 A;  2F36 A;  2DVC A;  4IO4 A;  4NF8 B;  4O3B A;  4OVJ A;  1MPD A;  3VE1 B;  1IEJ A;  3K4U A;  1B1X A;  1N3X A;  1Y20 A;  4ZED A;  5H8N B;  4Q8R A;  2RC8 A;  5CMK A;  3I3V A;  4MF3 A;  1ZU0 A;  3QXM A;  1D9V A;  1VSO A;  2ZNT A;  3LUY A;  2DE3 A;  1QW0 A;  2HZK A;  3CFL A;  3IB2 A;  1GGG A;  1TWY A;  3N6T A;  3MVZ A;  3HO7 A;  2UVJ A;  1MG1 A;  1R9L A;  3CVG A;  4GL8 A;  4QFO A;  2F78 A;  4WEP A;  1A40 A;  1JQF A;  2F7B A;  2O69 A;  2RF1 A;  4RPO A;  4YKJ A;  4F1Y A;  4MLV A;  1MY4 A;  4OER A;  1VFE A;  1SVX B;  2Y7R A;  3B7D A;  2ZNU A;  2W7Y A;  3ECR A;  3H7M A;  3ONM A;  3H03 A;  4NE4 A;  1D3K A;  4PET A;  3KJT A;  4PE5 B;  4ZZA A;  3MW0 A;  4NTL A;  4JWY A;  2QS1 A;  4O3C A;  3U1O A;  4R6H A;  3O28 A;  5JTY A;  1M5E A;  3HHG A;  2O7U A;  5DTB A;  1R9Q A;  2ZXT A;  2DWI A;  1NH7 A;  1MXW A;  3FIR A;  4N07 A;  1Y1Z A;  1B51 A;  3QUJ A;  1B5J A;  4R73 A;  1B3F A;  3W15 C;  3MZ1 A;  1IXI A;  4NF8 A;  4ZZE A;  3TAJ A;  4U1O A;  4IO5 A;  2NOO A;  4XKR A;  4F18 A;  1UTH A;  4NF4 B;  4OET A;  1LBC A;  3MBP A;  3B6T A;  4ECF A;  3WAE A;  1H43 A;  3FAT A;  5I84 A;  3IOT A;  3EF7 A;  4OMB A;  3LSX A;  2I4C A;  3BKI B;  1L5T A;  2DSF A;  3KG2 A;  4G68 A;  4RJZ A;  1QUI A;  2OBG A;  1NFT A;  2VGQ A;  1WVJ A;  2DP8 A;  5ICT A;  4F3B A;  5AA1 A;  1PDA A;  1MH3 A;  3JZJ A;  3KN3 A;  3M3F A;  4MH5 A;  3UN6 A;  1QKA A;  1B1H A;  4AB5 A;  3FD3 A;  3PD8 A;  4DIG A;  5HM4 B;  4IGT A;  3GBA A;  3K1P A;  4DLD A;  4FAJ A;  1FTM A;  1RYX A;  1I6B A;  1NL5 A;  2ZNS A;  2HAU A;  5I2K B;  1DPE A;  1ZKB A;  1Y3P A;  2Q8J A;  4P0I A;  1Y3N A;  2QPQ A;  3RPW A;  3A3C A;  4MFI A;  3W9V A;  1JEU A;  3EHU A;  5EYF A;  5I58 B;  3LBS A;  3BFT A;  4KYE A;  3TFL A;  3N94 A;  3D4C A;  3K6V A;  4RNS A;  3TKD A;  1EH3 A;  4P0G A;  4C0R A;  4MLQ A;  2QRY A;  3P7I A;  3HST A;  4BDR A;  1IXC A;  3DP8 A;  4JBZ A;  4O3A A;  3KOS A;  4ZS9 A;  2XD2 A;  4DXB A;  2I3W A;  3SEX A;  3RGY A;  2O1M A;  4G77 A;  2G29 A;  3OOA A;  3SEW A;  4YMB A;  3S9M C;  2PVU A;  3RT8 A;  2O7I A;  2DQV A;  3T9X B;  1N3W A;  5BUU A;  1LFH A;  4R72 A;  3IO6 A;  4F1V A;  2WKY A;  2D3I A;  3OXN A;  3LSL A;  5F7V A;  2RCA A;  5AA4 A;  5L9S A;  4OFJ A;  1Q35 A;  4PP0 A;  3PGF A;  4C1U A;  1ZTY A;  1J1N A;  3PPO A;  5HPQ A;  4GLI A;  3B6Q A;  4ZE8 A;  1B3L A;  2DYX A;  3U72 A;  3S9L C;  3K1M A;  5ITO A;  3N6U A;  2REJ A;  3T9H B;  3KEI A;  4ZE9 A;  1PB7 A;  2HFB A;  3K0V A;  5KZT A;  3S9E A;  2F6P A;  3ILU B;  4H67 A;  1USY H;  2KLF A;  1JW5 A;  2G93 A;  3EPE A;  3FVN A;  1MQI A;  1GTK A;  2H9B A;  3DLN A;  4ZEB A;  3CG3 A;  3V83 A;  2Q2C A;  3MP6 A;  1FTJ A;  1LFI A;  3PPP A;  1LAF E;  4QSD A;  4X48 A;  4EUO A;  3OO9 A;  3CSG A;  2Q9T A;  2B3F A;  1DPP A;  1UTH B;  1MDP 1;  3RTF B;  4BDM A;  1B9J A;  3SDF A;  4PQJ A;  1F9B A;  3TEP A;  1B7H A;  1JNF A;  2QS4 A;  3E9X A;  4NWD A;  1Q1K A;  3N5L A;  3O66 A;  4TQU Q;  2XXR A;  3A3U A;  2NWJ A;  5B7D A;  1QUL A;  2R6G E;  3O9P A;  3KN7 A;  4NMY A;  4RK9 A;  4U23 A;  4X1D A;  5EHS A;  3T9U A;  4F29 A;  1MPB A;  5A5X A;  1LLS A;  1MXX A;  2R9J A;  3I6V A;  3PPN A;  4GIZ A;  2DE4 A;  2XXI A;  1B2H A;  4R74 A;  3C35 A;  3FVG A;  4GXA A;  3K2D A;  5DEX A;  2PBW A;  2Y7P A;  3RUM A;  1GV8 A;  3OEK A;  4QFP A;  4DE8 A;  5DT6 A;  4OWD A;  4U4X A;  5FHM A;  2F7A A;  1A7L A;  4LP2 B;  4IY6 A;  5I56 A;  3FUZ A;  4OTE A;  2P1S A;  5AE4 A;  4Q0C A;  4EF2 A;  4OEU A;  1FCK A;  1XVY A;  5FHN A;  1OQG A;  3KBR A;  5H8S A;  1N0T A;  1LST A;  1R1N A;  3O6G A;  3OO8 A;  2DS9 A;  1H45 A;  4X1B A;  1ZLQ A;  3VVF A;  3G3I A;  5JK4 A;  4NF4 A;  3ZSF A;  1S9T A;  4LUB A;  3KGC A;  1OMP A;  2ALU A;  3KJ7 A;  1I6A A;  3IX1 A;  3R26 A;  2Z22 A;  5EHM A;  2OJT A;  1JEV A;  5H8Q B;  2A5S A;  3TCF A;  3TTL A;  4UA8 A;  5DVJ A;  4AQ4 A;  1OVT A;  5CM6 A;  5IKB A;  3BFU A;  3DM0 A;  2ONR A;  1PEB A;  3H3G A;  4N13 A;  4BDL A;  2ABH A;  2HEU A;  4K3F A;  3F11 A;  5I2N A;  5H8H A;  1AOV A;  4H8I A;  4QFK A;  4U22 A;  4QF9 A;  1Y9U A;  3EHS A;  4TOZ A;  1IQ7 A;  1IZ1 A;  1Y4T A;  1FQA A;  2DXR A;  2AL5 A;  2FNC A;  3AXF A;  3CIJ A;  3E4R A;  3ILT B;  3GBB A;  3MAM A;  2O51 A;  5FHO A;  1B7U A;  2D21 A;  2OWT A;  1XC1 A;  2Y7K A;  3SEV A;  4F22 A;  2PMS A;  3LR1 A;  3M8U A;  4I62 A;  3K6U A;  4XKQ A;  1MH4 A;  4JSD A;  2DXY A;  5AA2 D;  1Y3Q A;  4G68 C;  5ITP A;  3FJG A;  2Y7W A;  2XXU A;  3FVK A;  4F3S A;  3GZG A;  2DWH A;  2XXH A;  1N7W A;  1UQW A;  1SI0 A;  1M5C A;  2I58 A;  2ESN A;  2PYY A;  3K6W A;  1A8E A;  1SW1 A;  3T22 A;  1B4H A;  2VP1 A;  2XXQ A;  4XKP A;  3T96 B;  3K1N A;  3RLF E;  4KCC A;  1PBQ A;  4HCY A;  2UYE A;  4LON B;  4U21 A;  4JB7 A;  1LAG E;  3TPA A;  2XXW A;  4LZ8 A;  5JEI A;  1MPC A;  2XXV A;  2CZL A;  3FV1 A;  3UK4 A;  1LAH E;  5KDT B;  4OFO A;  1OLA A;  1UIV A;  1FQD A;  1SQY A;  4NF5 B;  3OEN A;  4FEC A;  4GQO A;  2ZYO A;  4H65 A;  4I9D A;  5JTY B;  3FGS A;  3TQW A;  4I8C A;  1JVY A;  2O68 A;  4POW A;  3KSJ A;  3RQT A;  4LZ7 A;  4WKM A;  3VDF A;  1B3G A;  2NVU B;  3FJ7 A;  3FAS A;  3M3K A;  4ELQ A;  2RC9 A;  1N84 A;  4FE8 A;  5CI5 A;  1B58 A;  1M5F A;  2D5W A;  4NF5 A;  4YAH X;  1XT8 A;  1ZIU A;  1B52 A;  2Q88 A;  4IGR A;  1P1Q A;  2UYF A;  3C33 A;  3G3H A;  4ELP A;  5BWJ A;  4GVO A;  3TUS A;  2HCA A;  3IB0 A;  3VLV A;  4ZEI A;  1SYI A;  2XX7 A;  4JWO A;  2I48 A;  4OHN A;  3RTW B;  4YB7 A;  1YAE A;  3O29 A;  1URD A;  4NWC A;  3KZG A;  4R75 A;  1MM7 A;  3MP1 A;  2Y84 A;  4LQ5 A;  3T9V A;  4H0W A;  5H8N A;  1MY0 A;  1AH5 A;  2DE2 A;  4X9T A;  5H8Q A;  3TOD A;  3O6I A;  2V3U A;  3TTM A;  3EHT A;  2F34 A;  4HCW A;  2I6E A;  4RYA A;  3S4U A;  1B5I A;  1VFD A;  1P1N A;  1SBP A;  2UVI A;  1DTZ A;  3MC2 A;  4H8J A;  5F1Q A;  4BDQ A;  5DYH A;  4HW8 A;  5FTI A;  3IL1 B;  1DOT A;  5I58 A;  3E13 X;  3FVO A;  2VOZ A;  5CC2 A;  3C32 A;  3FV2 A;  1B46 A;  3IJX B;  3PUY E;  4GOT A;  1MY2 A;  4KI0 E;  3QUF A;  4LAT A;  4OXV A;  2XXX A;  4KYD A;  3CI8 A;  4N6P A;  1MXV A;  1UTB B;  3MPK A;  4TLM B;  1PBP A;  1H3D A;  1SW4 A;  3G3J A;  4GXS B;  2IEE A;  5DVF A;  3QIM A;  4BDO A;  5ICQ A;  4NED A;  4OEV A;  5DVI A;  1FQC A;  4IY5 A;  1B0H A;  1FQE A;  4ESW A;  4YIC A;  3U8Q A;  1IUD A;  2Y7I A;  1IIW A;  3C4M A;  2H99 A;  4GL0 A;  3CFZ A;  3JV9 A;  2F97 A;  4FIM A;  3QYT A;  1M5B A;  4F3G A;  1B40 A;  1DTG A;  4U1Z A;  3GLB A;  2ZYN A;  2ONS A;  1MS7 A;  4XTC Q;  1JW1 A;  1SDX A;  3N26 A;  5ELV A;  2P2A A;  1AL3 A;  4ELR A;  1MQH A;  1RKM A;  2RKM A;  3DP4 A;  5TP9 B;  4DDD A;  4DXU A;  2VHA A;  2DWA A;  3O6H A;  3TTR A;  2O6A A;  3WAF A;  3PPQ A;  3TCG A;  4QSE A;  4XXU A;  1BP5 A;  1YCJ A;  3VVD A;  1B3E A;  3KOT A;  3R7X A;  1JW4 A;  1LB8 A;  3U93 A;  2DOJ A;  1MQD A;  2XX8 A;  3ZKK A;  3MVW A;  3EN3 A;  4U4S A;  1LB9 A;  4F2O A;  5ISU A;  3TDJ A;  1QVS A;  1NNP A;  2FYI A;  4QHQ A;  5I59 B;  1FW0 A;  5LOM A;  1T0K A;  3VLU A;  3V8X B;  1N76 A;  5L8D A;  1XHY A;  4ELO A;  1SYH A;  1ZMG A;  2AYS A;  3RT6 B;  1OQH A;  3FXR A;  3TYH A;  3K02 A;  3S9N C;  4XKN A;  2Z8D A;  4JWX A;  2QL3 A;  4NF6 B;  4R9G A;  1SD3 A;  2F35 A;  1DMB A;  3H4Z A;  1BTJ A;  4P11 A;  4DXC A;  4RA1 A;  3VXC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...