4P0GA

Crystal structure of mltf from pseudomonas aeruginosa complexed with bulgecin and muropeptide
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Lyase
molecule keywords Membrane-bound lytic murein transglycosylase F
publication title Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide
rcsb
source organism Pseudomonas aeruginosa
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA02
3N6TA 4NTLA 2RF1A 4TLMB 1M5BA 1MXXA 2Y7WA 3V89B 3GLBA 4KD5A 1P1UA 4XXUA 3K1PA 3EHSA 4QSCA 4DCXA 3EN3A 1I69A 2O69A 5KCJB 3MZ9A 2Y7KA 5AE4A 3IK6B 2VD3A 4LZ8A 1MM7A 4E0WA 1B0HA 3KN3A 4BDMA 2O68A 5KDTA 3FD3A 1MXWA 3CR9A 3P7IA 2O6AA 4NF8B 4OQOA 3TQLA 4WKMA 3TELA 3VVFA 5AA4B 2Y84A 4F31B 3W9WA 4MF3A 2XXHA 2Q8JA 4DE8A 3EQ1A 4GLIA 4ZEKA 3E3KA 1IUDA 2UYFA 3KN8A 3RY3A 4F3BA 5I58B 1LBBA 2UXAA 3OMBA 3IJOB 1Y4CA 1A55A 1LGBC 4GL0A 1IZ1A 1D9YA 2DWJA 4R9FA 2QJEA 3TTKA 3O6IA 2ZYNA 1XOCA 4U1OA 3DP4A 2GHBA 3H6TA 2QSXA 3FVNA 1PB7A 3UIFA 2XXQA 4FJPA 3OO9A 3SEWA 2I4CA 2I58A 1XS5A 2PT2A 2DE3A 3U92A 3CRBA 3JV9A 4ELRA 3E4RA 4NF4A 3CFLA 5JK4A 4H0WA 3CFXA 3U1OA 2LAOA 3EPEA 3U72A 1TFDA 4IO6A 1P1WA 5K2YA 4EUOA 5L9MA 3TTMA 3H6WA 2B65A 4HCWA 4Q5TA 3UN6A 2NUVA 4ONYA 4THIA 2QS3A 4FATA 2NOOA 4MLQA 3Q29A 2QMWA 1Y3PA 3LSFB 3B7DA 3GBAA 4BDLA 2RC8A 3PPOA 4GQOA 3K4UA 5KDTB 5KZTA 4QFPA 2Z23A 4YMAA 1MQJA 1B3HA 1N7XA 4TQUQ 5CRYA 5ITOA 4HTGA 1H3DA 1NNPA 3W9VA 3KEIA 5F7VA 4KYDA 4U21A 4U4SA 2OWSA 4LP2B 1B3EA 4KHZE 2M8CA 2XHDA 5I84A 1ZJLA 3ILTB 3RGYA 2DWIA 3DM0A 4TLLB 4R6YA 2F78A 4M4GA 3L6GA 1Y1ZA 4Z0IA 1NNFA 4YAHX 3K0VA 1B32A 3S4UA 2CZLA 5CC2A 3A3CA 2OLBA 3K1MA 2F6PA 1MS7A 3TQWA 1SD3A 4JXIA 4NF6A 2XX8A 4U23A 4FE8A 4KYSA 3RTFB 4IO3A 3FJGA 4GF8A 2FYIA 5ELVA 2G93A 3JYRA 3K1NA 3RPWA 2H98A 1LFHA 4EXLA 1MH3A 2Q89A 4F2OA 2I48A 2D21A 5TPAA 4PE5B 4POXA 1SI0A 5DYHA 2REGA 3USDA 3RTWB 2UVIA 3HO7A 3D4GA 2PVUA 3IB0A 4WXJA 3HSTA 1LLSA 3G3IA 4OYVA 1DTGA 2ONRA 3E13X 1D3KA 3SEVA 4JDFA 4F18A 2QMXA 3IAZA 1VFDA 1LSTA 4G68C 4H67A 4OEUA 3O29A 5I59A 3MBPA 1MG1A 2ZXTA 4KQPA 1MDP1 1PBPA 2DOJA 3GBBA 4LA9A 1N76A 2GH9A 3MW0A 1SW1A 2QS2A 4XIGQ 5I56A 3FJ7A 4U22A 4C1UA 2DP8A 1JETA 3O6HA 3RNNA 1MY4A 4EQBA 3UK4A 2XXRA 1IXCA 3N6UA 3SESA 2HAUA 1QUJA 1SDXA 1UIUA 1A7LA 4NF6B 5FTHA 4KCDA 1ZTYA 3PPNA 4H5GA 1LFGA 1SYHA 2H25A 3IR1A 1A8FA 3ZSFA 3R6UA 1YPNA 3ZKLA 4NEDA 3O9PA 3WAFA 3D4CA 4EQ9A 4Q30B 4MLVA 4FEDA 5TPAB 3O2AA 2VGQA 3N5LA 1B1XA 1R1NA 4R73A 4JSDA 1H76A 2G29A 3DELB 4RJZA 3VVEA 1Q1KA 2DXYA 1FW0A 3MQ9A 3O6GA 1QUIA 3C32A 4U2RA 1EU8A 2X7PA 2R9JA 3PPPA 4H65A 4DXBA 2DWHA 5I59B 3THIA 2ZYOA 3RT8A 1B05A 1MXYA 5ITPA 3T9VA 3GXAA 4ZDMA 5I56B 5JEIA 1BTJA 5DEXA 5F1QA 1ELJA 1RKMA 2HCAA 3QSLA 4DXCA 4E0XA 1MY3A 2OCUA 3UA8A 4N07A 1OMPA 3BFUA 3CSBA 2O7UA 3TAJA 2Y7IA 4KCCA 4BDRA 4QFLA 4F1YA 2I6EA 3OD7A 4OTEA 3A09A 2AYSA 4IGTA 3UORA 1B5HA 3EHTA 1SQYA 1BIYA 4NWCA 4WEDA 5LOMA 2O1MA 2XX7A 1PB9A 4DDDA 1QJMA 5CBSA 4RNSA 1YAEA 1DTZA 4ZEDA 5IAIA 1IQ7A 3H6UA 2XXVA 3QK6A 1USYH 3OELA 4JB7A 2QS1A 2P1SA 4X1BA 3TKDA 3CG3A 2UVJA 4JSOA 5H8SA 3VE1B 3ODBA 1NH7A 2A5TA 1FQCA 5I2KA 4FAJA 1QUKA 1URGA 1NNTA 4PP0A 3EF7A 1P99A 1JEVA 1IIWA 4KYEA 2V84A 4WEPA 1B40A 1B5IA 3C9HA 4OESA 2F5XA 3V5AA 3H3GA 2DSFA 3G3HA 1J1NA 3TTNA 5I57B 3OO8A 2H9BA 4G2ZA 3IX1A 1IITA 1ZMGA 2UYEA 2PMSA 2O51A 3MP6A 3QUJA 1MH4A 5DEXB 3VXBA 4LQ2A 4KR5A 2V3QA 2GHAA 3N94A 1I6QA 1QW0A 3FXRA 1SW4A 1BLFA 3KZGA 3LSLA 3SEUA 3TYHA 4TOZA 2DVZA 2H99A 2V93A 4GD5A 3KOTA 4BDNA 3I3VA 1N0TA 3IOUA 3H6VA 3QYTA 3CVGA 2R71A 1ZLQA 1ZU0A 1B5JA 1MXZA 5DVFA 3W15C 3H7MA 1M5DA 3MVZA 4MH5A 4LUBA 1US5A 2KLFA 4PQJA 1SYIA 1MQHA 3MPKA 3TFLA 1QULA 1JNFA 2Q2AA 3B6TA 4RK2A 2H5YA 2Z8DA 2Q9TA 4F2QA 5TP9A 2F7BA 4FIMA 4GIZA 4L17A 3IOWA 4ZEIA 2A5TB 3MPLA 1WVJA 5I2KB 1B46A 4N13A 3PV0E 4RY1A 1XVYA 4JWYA 1JVXA 1Y4TA 3H4ZA 3T9UA 4KI0E 1N7WA 4JBZA 4YKPA 3K01A 3FJMA 4U1ZA 5BWJA 4OFLA 1ZIUA 4NE4A 1VR5A 4XKRA 3KSXA 3OXNA 4QFNA 4YB6A 5DVJA 1P1QA 3VXCA 1QKBA 3FGSA 5H8QA 3ONMA 1B7ZA 1B1HA 4LQ5A 3TUSA 4PFTA 4HS7A 4RYAA 1TFAA 4EF2A 1M5CA 1JEUA 3LC8A 1PC3A 1TWYA 4H5FA 2NVUB 1NNKA 2ABHA 1LFIA 2F36A 3HCQA 4C0RA 5CMMA 4EQ7A 5JTYA 4OWDA 3T96B 3O28A 1Z7NE 1N04A 2F7AA 1EZ9A 3MZBA 1DPPA 3Q27A 3K6XA 2Q88A 3KFMA 3K02A 2O84X 4G4PA 1B52A 2AL5A 2F6GA 5EYFA 1NH8A 2IA4A 1NKXA 3KN7A 3FXQA 2ALUA 4O3BA 3LSXA 3QUFA 1FQBA 1NL5A 2DYXA 3UP9A 3OSRA 4ESXA 3MVWA 4QFKA 5ISUA 1H45A 5EHSA 4GOTA 3G3JA 3VDFA 5TP9B 4QFOA 2RC9A 2HFBA 4H8IA 1S9TA 3G3KA 3CIJA 2DQVA 4IO2A 3RLFE 3RT6B 1BKAA 5DTBA 3DP8A 1IXIA 1URDA 3FXUA 4H1XA 4NF4B 4I1DA 2XX9A 1OIBA 3TDJA 3TCHA 1MQDA 4PFWA 5AA2D 4QSDA 1NFTA 3PPRA 3DP6A 3BKIB 3PD9A 1D4NA 1Y1MA 2R6GE 4XKNA 1SI1A 4F1UA 3PUWE 2VD2A 1QKAA 5H8QB 1B58A 3TCFA 4K3FA 2IEEA 4RPNA 1B3FA 1Y3QA 1A54A 3FVGA 5AA1A 1B4ZA 5B7DA 3CG1A 1HSEA 4AB5A 2YJPA 3MJNA 1EZPA 5I2NA 1MM6A 3TEPA 1B3LA 5L8DA 2OWTA 2V3UA 1LCFA 1NMUA 1RYOA 2DWAA 2XXYA 1BP5A 4R2FA 4H8JA 4EXKA 2P0SA 4QRZA 3R26A 3S9LC 1GV8A 2CMOA 3IOVA 2I3VA 1FTJA 2HZLA 3TCGA 3O97A 4YB5A 3MP8A 4ELOA 1A40A 1POY1 3K6VA 5CI5A 2F35A 1SW5A 2VOZA 4R72A 3HHFA 3HV1A 4LZ5A 1GVCA 2RCAA 1IEJA 2I0CA 2HEUA 1FQAA 2Y7PA 5CMKA 1B7HA 3C34A 2XXWA 1OLCA 3BFTA 3B6QA 2REJA 3T9HB 3TTLA 1MDQA 2DS9A 5DVIA 2HXWA 1R6ZA 1POTA 1XT8A 1UIVA 3IB2A 4F39A 1RYXA 1O64A 1URSA 3PGFA 3PD8A 1Y3NA 2X26A 5AA3A 4P11A 3PMVA 5HM4B 1LAXA 5EHMA 1PBQA 1MPBA 3EHUA 3I5OA 4ELQA 4Q8RA 2XXTA 3FATA 3C35A 1CB6A 2F7CA 3L6HA 3Q28A 2DVCA 4HCYA 5L9SA 1R9LA 1TXFA 4GRKA 3OSQA 4NWDA 1PEBA 3FASA 1MQIA 2YLNA 2ZNSA 4YKJA 5I2NB 4AB6A 4O3AA 3IOTA 4QHQA 5IKBA 1LAFE 3E9XA 4KFQA 1P1OA 3IO6A 4F19A 5CMCA 4R9GA 4Z7EA 3KBRA 4UACA 4F3GA 4YICA 3IORA 5KCJA 1LB8A 2QPQA 4G8HA 4M1VA 3U8QA 5J1DA 4GXAA 3Q26A 4ISUA 3U94A 1P1NA 2ONKE 1MRPA 1AIVA 3MVXA 5A5XA 2THIA 4NF5A 3TODA 2FA7A 5HBCA 1B7UA 4LVQA 4ZEFA 2Z22A 3H03A 4YB7A 4YKIA 4R6KA 4OEVA 4H6DA 3O66A 1JW5A 1MXUA 1LAHE 4JWXA 3MVYA 2NXOA 3VLUA 1D9VA 2I49A 3PPQA 2QS4A 1WDNA 2HAVA 1ZBMA 4R75A 2E1SA 3VV5A 3CI8A 2AIXA 4ZZAA 3K00A 5H8NA 4OFOA 3KJ7A 2B3BA 3T93B 3JZJA 4OERA 2UVGA 5TU0A 2RINA 1PB8A 5ICQA 2VP1A 1EH3A 3FUZA 3S9NC 4X48A 1XHYA 3TMGA 2AL4A 4AQ4A 1Z7ME 3RUMA 4DXUA 4I8CA 5CM6A 2ONSA 4ZEBA 1N3XA 5K2XA 2V25A 5CMBA 4DZ1A 3R7XA 1SW2A 4F1VA 1I6AA 2PX1A 4YU0A 2WKYA 3MAMA 4R6HA 4EDPA 4OHNA 3OENA 4IY5A 5A5XB 1FCKA 4NF5B 4ZS9A 4YMBA 2XXUA 1FTKA 5FHOA 1WODA 2V3TA 1FQFA 3B6WA 3FVOA 4N6PA 1ZKBA 3A3UA 1UTBA 3PUYE 1MY1A 3QIMA 1FQDA 1US4A 1M5EA 1LBCA 2I4BA 3FIRA 1O63A 4ND9A 4OETA 1A8EA 3GZGA 3SDFA 1DSNA 3C4MA 2OBGA 4PFYA 4U4XA 1II5A 2DE2A 3UGWA 1F9BA 2RCBA 4YZZA 2PYYA 1YTVA 3OEMA 3I6VA 4G68A 5H8NB 1OVTA 2P2AA 2O7IA 3U93A 4GL8A 1B2HA 3BBRA 3G3GA 4ZZEA 1B4HA 1VSOA 1HSJA 1I6BA 1MPDA 3OEKA 3KOSA 3S2VA 5CBRA 2OJTA 4F22A 3HPIA 3WAEA 4F29A 4OZ9A 1L5TA 4GVOA 3TTRA 4RA1A 4IO5A 2W7YA 1GR2A 3C36A 5H8FA 3G7WA 1AH5A 1XC1A 2ZMBA 2ZYMA 1MY0A 5AA2A 1B9JA 3KSJA 5H8HA 4ELPA 1OVBA 4IY6A 3PUXE 2ANJA 4PFUA 3K6WA 1DMBA 1Q35A 4XKPA 1R9QA 1UTBB 4EF1A 1IXHA 3IJXB 1GTKA 1SBPA 4POWA 1TT1A 2RKMA 4QF9A 4BDQA 3SETA 2DXRA 4DCYA 4R74A 1USYE 2QL3A 1B6HA 1ATGA 4GFRA 1HSLA 3G3FA 3KG2A 1DPEA 5FHNA 3RN8A 2Z8EA 4X9TA 4G68B 2PT1A 4DIGA 2YPNA 1GGGA 1JW4A 1OQHA 3M8UA 3V83A 2HQ0A 2I3WA 1YCJA 3ZS6A 1QVSA 2BJJX 1OLAA 2F97A 2Z8FA 2ZNTA 4QSEA 2Q2CA 3MWBA 3ZKKA 3RQTA 3C33A 2DE4A 3FV2A 3VVDA 4G8NA 1MXVA 5HPQA 4YKKA 2VHAA 3LUYA 3SEXA 1FTOA 3C31A 5H8FB 2NWJA 4UA8A 1H43A 5JTYB 4IO7A 1B51A 1EZOA 5AA2B 4I62A 5H8HB 2GRVA 4MFIA 3M3FA 3DLNA 4I9DA 2E0SA 1B0LA 1FTMA 5B70A 4F3SA 5BUUA 4OENA 2PBWA 2XXIA 1FTLA 1LB9A 1VFEA 3K6UA 4OXVA 1DOTA 4XTCQ 3HHGA 4ECFA 3CFZA 3M3KA 2UVHA 1XVXA 1JQFA 4BDOA 3ECRA 1Y9UA 4C1TA 3PU5A 1OQGA 2GFEA 1AOVA 4JWOA 1H44A 1AMFA 3HN0A 4F3PA 3T22A 1IXGA 1UTHA 1N84A 3S9MC 3IL1B 2I0BA 1FQEA 3KJTA 4ZE9A 4IO4A 4GXSB 3F11A 3LR1A 3OO6A 3K2DA 3IO4A 2FNCA 4OVJA 3N26A 4ESWA 2ZYKA 3PUZE 4XKQA 1A99A 5FTIA 2X7QA 3VLWA 2F8DA 3M3LA 3OOAA 4GWOA 3SERA 3OO7A 1ANFA 3H06B 3PMWA 3TZAA 1LCTA 3SEYA 2D5WA 5DT6A 3PMXA 1KWHA 3ILUB 2H4IA 4PETA 1UQWA 1S7YA 1JW1A 3Q25A 3MC2A 1AL3A 3MZ1A 4HW8A 5I57A 3S9EA 3KGCA 2XXXA 3AXFA 2ESNA 1MQGA 4FECA 3FVKA 1SVXB 1O7TA 4IB2A 3TPAA 4G8MA 3PUVE 2Y7RA 1MPCA 4LATA 3LBSA 2A5SA 2HZKA 3QXMA 3V8XB 2QRYA 2ZNUA 4NF8A 3MP1A 4RK9A 2B3FA 5AA4A 3SKPA 3QAXA 3IB1A 4P0IA 3VLVA 2OK2A 5ICTA 1UTHB 2D3IA 3VFJA 5I58A 1Y20A 1S50A 4OMBA 4ZECA 4Q0CA 4RXLA 2F34A 4R2BA 4G77A 3T66A 4FEBA 4RPOA 4LZ7A 3FV1A 5FHMA 1MY2A 5M2VA 1B3GA 1LAGE 1M5FA 3FZVA 2XD2A 4KPTA 4O3CA 2XD3A 4FORA 4ZE8A 2O1LA 4NMYA 2RC7A 1VE4A 1CE2A 1T0KA 4IGRA 3T9XB 2XXPA 1JVYA 4LONB 4OFJA 3CSGA 4DLDA 1N3WA 2OZZA 1PDAA 3LSWA 4X1DA 5L9OA 3MUQA 4P0GA 4BLAA 4MBPA
chains in the Genus database with same CATH superfamily
3N6TA 4NTLA 2RF1A 4TLMB 1M5BA 1MXXA 2Y7WA 3V89B 3GLBA 4KD5A 1P1UA 4XXUA 3K1PA 3EHSA 4QSCA 4DCXA 3EN3A 1I69A 2O69A 5KCJB 3MZ9A 2PFZA 2Y7KA 4GWXA 3IK6B 5AE4A 2VD3A 1RDYA 4LZ8A 1MM7A 4E0WA 1B0HA 4MNPA 3KN3A 4BDMA 2O68A 4G61A 5KDTA 3FD3A 1MXWA 2XWVA 1FBGA 3CR9A 3P7IA 2O6AA 4NF8B 4OQOA 3TQLA 4WKMA 3TELA 3VVFA 5AA4B 5EYHA 2Y84A 4F31B 3W9WA 3KC0A 4MF3A 2XXHA 3B50A 2Q8JA 4DE8A 5ET8A 3EQ1A 4GLIA 4ZEKA 3E3KA 1IUDA 2UYFA 3KN8A 3RY3A 4F3BA 5I58B 1LBBA 2UXAA 3OMBA 3IJOB 1Y4CA 1A55A 1LGBC 4GL0A 1IZ1A 2Y5LA 1D9YA 3IFAA 2DWJA 4PE3A 4R9FA 2QJEA 3TTKA 3O6IA 2ZYNA 1XOCA 4U1OA 3DP4A 2GHBA 3H6TA 2QSXA 3FVNA 1PB7A 3UIFA 2XXQA 4NHBA 5I7IA 4FJPA 3OO9A 2KR0A 2I4CA 2I58A 3SEWA 1XS5A 2PT2A 2DE3A 3U92A 3CRBA 3JV9A 4ELRA 3E4RA 4NF4A 3CFLA 5JK4A 1FBEA 3CFXA 4H0WA 3U1OA 2LAOA 3EPEA 3U72A 1TFDA 4N6KA 4IO6A 1P1WA 5K2YA 4N4UA 4EUOA 5L9MA 3TTMA 1RDXA 3H6WA 2B65A 4HCWA 4Q5TA 3UN6A 2NUVA 2MKZA 4ONYA 4THIA 2QS3A 4XFEA 4FATA 2NOOA 4MLQA 3Q29A 3MYUA 2QMWA 1Y3PA 3LSFB 3B7DA 4MNCA 4MEVA 3GBAA 4BDLA 2RC8A 3PPOA 4GQOA 3K4UA 5KDTB 5KZTA 4QFPA 2Z23A 4YMAA 1MQJA 3BIHA 1B3HA 1N7XA 4TQUQ 5CRYA 5ITOA 4HTGA 1H3DA 1NNPA 3W9VA 1NV1A 3KEIA 5F7VA 4HE0A 4KYDA 4U21A 4U4SA 2OWSA 4LP2B 1B3EA 4KHZE 4OVRA 2M8CA 2XHDA 5I84A 1ZJLA 3ILTB 1JP4A 3SZPA 3RGYA 2DWIA 3DM0A 4N91A 4TLLB 4R6YA 2F78A 4M4GA 3L6GA 2XXKA 1Y1ZA 4Z0IA 1NNFA 4YAHX 1EYKA 3K0VA 1B32A 3S4UA 2CZLA 5CC2A 3A3CA 2OLBA 3K1MA 2F6PA 1MS7A 3TQWA 1SD3A 4JXIA 4NF6A 2XX8A 4U23A 4FE8A 4KYSA 4OANA 3RTFB 4IO3A 3FJGA 4GF8A 2FYIA 4N17A 5ELVA 2Y5KA 2G93A 3JYRA 3K1NA 1G0IA 3RPWA 2FIEA 2H98A 1LFHA 4EXLA 1MH3A 2OX3A 2Q89A 4F2OA 2I48A 2D21A 5TPAA 4PE5B 4PAIA 2VPNA 4POXA 1SI0A 5DYHA 2REGA 1FPDA 3USDA 3A29A 3RTWB 5A5LA 2UVIA 3HO7A 3D4GA 2PVUA 3IB0A 4WXJA 3HSTA 1LLSA 3G3IA 4OYVA 1DBZA 1DTGA 2ONRA 1IMEA 3E13X 1D3KA 3SEVA 4JDFA 2QMXA 4F18A 3IAZA 1VFDA 1LSTA 5EQ7A 4G68C 4H67A 4OEUA 3O29A 5I59A 3MBPA 1DCUA 1MG1A 2ZXTA 4KQPA 1MDP1 4P47A 1PBPA 2DOJA 4LA9A 1IMDA 3GBBA 1N76A 2GH9A 3MW0A 4NF0A 1SW1A 2QS2A 4XIGQ 5I56A 3FJ7A 4U22A 4C1UA 4GWWA 2DP8A 1JETA 3O6HA 4QBAA 3RNNA 1MY4A 4EQBA 1FJ6A 3UK4A 2XXRA 4PFRA 4X04A 1FPJA 1FJ9A 1IXCA 3N6UA 3SESA 1K9YA 1NUWA 2HAUA 4O8MA 1QUJA 5IZ1A 5ET7A 1SDXA 1UIUA 1A7LA 4NF6B 2Q8MA 5FTHA 4KCDA 1ZTYA 3PPNA 4H5GA 1LFGA 1SYHA 2H25A 3IR1A 1A8FA 3ZSFA 3R6UA 1YPNA 3ZKLA 2FIXA 4NEDA 3O9PA 3D4CA 3WAFA 4EQ9A 4Q30B 4MLVA 1AWBA 4GBVA 4FEDA 1KA1A 5TPAB 3O2AA 2VGQA 3N5LA 4MCOA 1B1XA 1R1NA 4R73A 5J16A 4JSDA 1H76A 2G29A 3DELB 4RJZA 3VVEA 1Q1KA 2DXYA 1FW0A 3MQ9A 3O6GA 1QUIA 1IMCA 3C32A 2F3DA 4U2RA 1EU8A 2X7PA 1EYIA 2R9JA 3T1BA 3PPPA 4H65A 1CNQA 4DXBA 2DWHA 5I59B 3THIA 2ZYOA 3RT8A 1B05A 1MXYA 1FBFA 4P3LA 5ITPA 3T9VA 3GXAA 4ZDMA 4DI3D 4I3EA 5I56B 5JEIA 1BTJA 5DEXA 5F1QA 1ELJA 1RKMA 2HCAA 3U65A 1FPIA 3QSLA 4DXCA 4E0XA 1MY3A 1KA0A 2OCUA 3UA8A 4N07A 4JVIA 1K9ZA 1OMPA 3BFUA 3CSBA 1NV7A 2O7UA 3TAJA 2Y7IA 2DDKA 4KCCA 5ESYA 4BDRA 4QFLA 4F1YA 4GWUA 2I6EA 3OD7A 4OTEA 5ET6A 3A09A 2AYSA 4IGTA 5IM2A 2QFLA 3UORA 1B5HA 3EHTA 1SQYA 1BIYA 4NWCA 4WEDA 5LOMA 2O1MA 2XX7A 1PB9A 4DDDA 1QJMA 5CBSA 4RNSA 1YAEA 1DTZA 4ZEDA 5IAIA 1IQ7A 3H6UA 2XXVA 3QK6A 1USYH 3B8BA 3OELA 4JB7A 2QS1A 2PCRA 2P1SA 4X1BA 2WBDA 3TKDA 2CZKA 3CG3A 5DW8A 2UVJA 4JSOA 5H8SA 3VE1B 3ODBA 1NH7A 2A5TA 5I5PA 1FQCA 5I2KA 4FAJA 1QUKA 1URGA 1NNTA 4PP0A 3EF7A 1P99A 1JEVA 1IIWA 4KYEA 5ET5A 5IZ3A 2V84A 5LDZA 4WEPA 4H46A 1B40A 1B5IA 3C9HA 4OESA 2F5XA 3V5AA 3H3GA 2DSFA 3G3HA 1J1NA 2XA5A 3TTNA 4N6DA 5I57B 3OO8A 2H9BA 4G2ZA 3IX1A 1IITA 1ZMGA 2UYEA 2PMSA 2O51A 2R8TA 3MP6A 3QUJA 1MH4A 2VT5A 5DEXB 3VXBA 4N8YA 4LQ2A 4KR5A 2V3QA 2GHAA 3N94A 1I6QA 1QW0A 3FXRA 4P1EA 3LUZA 1SW4A 1BLFA 3KZGA 3LSLA 3SEUA 2WYKA 3TYHA 4TOZA 2DVZA 2H99A 2V93A 4GD5A 3KOTA 1FBCA 4BDNA 3I3VA 1N0TA 3IOUA 3H6VA 3QYTA 3CVGA 2R71A 1ZLQA 5EQAA 5LTCA 3NOHA 1ZU0A 1B5JA 1MXZA 5DVFA 3W15C 3H7MA 1M5DA 3MVZA 4MH5A 2CEYA 1IMBA 4LUBA 1IMAA 1US5A 2KLFA 4PQJA 1SYIA 1MQHA 3MPKA 2P3NA 3TFLA 1QULA 1JNFA 2Q2AA 3B6TA 4RK2A 4GWZA 2H5YA 2Z8DA 2Q9TA 4F2QA 5TP9A 2F7BA 4FIMA 4GIZA 2F3BA 4L17A 3IOWA 4ZEIA 2A5TB 3MPLA 1WVJA 5I2KB 1B46A 4N13A 3PV0E 1LEVA 4RY1A 1XVYA 4JWYA 1JVXA 1Y4TA 3H4ZA 4I40A 3T9UA 4KI0E 1N7WA 5IZ3B 4JBZA 4YKPA 5F24A 3K01A 3FJMA 4U1ZA 5BWJA 4PGPA 4OFLA 1ZIUA 4NE4A 3RPLA 1VR5A 2FVZA 4XKRA 3KSXA 3OXNA 4QFNA 4YB6A 4O94A 5DVJA 1P1QA 3VXCA 1QKBA 3FGSA 5H8QA 3ONMA 2QVRA 1B7ZA 1B1HA 4LQ5A 3TUSA 4PFTA 4HS7A 4RYAA 1TFAA 1FBPA 4EF2A 4MNIA 1M5CA 2WX9A 1JEUA 3LC8A 1PC3A 1TWYA 2GQ1A 4H5FA 2NVUB 1NNKA 2ABHA 1LFIA 2F36A 3HCQA 4C0RA 5CMMA 4EQ7A 2OWZA 5JTYA 4OWDA 3IFCA 3T96B 3O28A 1Z7NE 1N04A 2F7AA 1EZ9A 1FPGA 3MZBA 1DPPA 3Q27A 3K6XA 2Q88A 3KFMA 3K02A 2O84X 4G4PA 1B52A 2AL5A 2F6GA 5EYFA 1NH8A 2IA4A 1NKXA 3KN7A 3FXQA 1LBZA 2ALUA 4O3BA 3LSXA 3QUFA 1FQBA 1NL5A 2DYXA 3UP9A 3OSRA 4ESXA 3MVWA 4QFKA 5ISUA 1H45A 5EHSA 1SPIA 4GOTA 3G3JA 3VDFA 5TP9B 4QFOA 2RC9A 2HFBA 4H8IA 1S9TA 4HXVA 3G3KA 3CIJA 2DQVA 4IO2A 3RLFE 3RT6B 1XI6A 1BKAA 5DTBA 3DP8A 1IXIA 1URDA 3FXUA 4H1XA 4NF4B 4I1DA 4NQ8A 2XX9A 1OIBA 3TDJA 3TCHA 1MQDA 2QVUA 4PFWA 5AA2D 4QSDA 1NFTA 4OVPA 4HE1A 3PPRA 3DP6A 3BKIB 3PD9A 3RPLB 1D4NA 1Y1MA 2R6GE 4XKNA 3ROJA 1SI1A 4F1UA 3PUWE 2VD2A 5EQ8A 1QKAA 5H8QB 1B58A 3TCFA 1YZ0A 4K3FA 2IEEA 4RPNA 1FPBA 4N15A 1B3FA 1Y3QA 1A54A 3FVGA 5AA1A 1B4ZA 2P3VA 3CHGA 5B7DA 3CG1A 1HSEA 4AB5A 2YJPA 3MJNA 1EZPA 5I2NA 1MM6A 1QGXA 3TEPA 3E78A 1B3LA 5L8DA 2OWTA 2V3UA 1LCFA 1NMUA 1RYOA 2DWAA 2XXYA 1BP5A 4R2FA 4H8JA 5EQ9A 4EXKA 2P0SA 4QRZA 3R26A 4PF6A 3S9LC 2FHYA 1GV8A 2CMOA 3IOVA 2I3VA 1FTJA 2HZLA 5I3SA 3TCGA 3O97A 1LBYA 4PDDA 4YB5A 3MP8A 4ELOA 1A40A 1POY1 3GYYA 3K6VA 5CI5A 3FBPA 2F35A 1SW5A 2VOZA 4PBHA 2WEFA 4R72A 3HHFA 3HV1A 4LZ5A 1GVCA 4GWYA 2RCAA 1IEJA 2I0CA 2HEUA 1FQAA 2Y7PA 5CMKA 1B7HA 3C34A 3FXBA 2XXWA 4MJOA 1OLCA 3BFTA 3B6QA 2REJA 3T9HB 3TTLA 1MDQA 2DS9A 2XWOA 5DVIA 4NN3A 2HXWA 1R6ZA 1POTA 1UIVA 1XT8A 3IB2A 2FBPA 4F39A 1RYXA 1O64A 1URSA 3PGFA 3PD8A 1Y3NA 2X26A 5AA3A 4P11A 3PMVA 2ZZWA 5HM4B 1LAXA 5EHMA 1PBQA 3ISPA 1MPBA 3EHUA 3I5OA 4ELQA 4Q8RA 2XXTA 4LN5A 3FATA 3C35A 1CB6A 2F7CA 4HE2A 3L6HA 3Q28A 2DVCA 4HCYA 5L9SA 1R9LA 1TXFA 4GRKA 3OSQA 4NWDA 2KQZA 1PEBA 3FASA 1MQIA 2YLNA 2ZNSA 4YKJA 5I2NB 2WBBA 4AB6A 4O3AA 3IOTA 4QHQA 5IKBA 1LAFE 3E9XA 4KFQA 1P1OA 3IO6A 4F19A 5CMCA 4R9GA 4AS4A 4Z7EA 3EKIA 3KBRA 4UACA 1LBVA 4F3GA 4YICA 4XF5A 3T0JA 3IORA 5KCJA 1LB8A 2QPQA 4G8HA 4M1VA 3U8QA 4N8GA 5J1DA 4GXAA 3Q26A 4ISUA 3U94A 1P1NA 2ONKE 1MRPA 4X8RA 1AIVA 3MVXA 5A5XA 2THIA 5IZZA 4NF5A 1VDWA 3TODA 2FA7A 2JJKA 5HBCA 1B7UA 1LBWA 4LVQA 4ZEFA 2Z22A 3H03A 4YB7A 4YKIA 4R6KA 4OEVA 1BK4A 1NV5A 3KBZA 1FBDA 4DI4B 4H6DA 5FBPA 3O66A 2CEXA 1JW5A 1MXUA 1LAHE 4JWXA 5IGAA 1Q9DA 3MVYA 2NXOA 3VLUA 1D9VA 4QXDA 2I49A 3PPQA 2QS4A 1WDNA 2VPOA 2HAVA 1ZBMA 4R75A 2E1SA 3VV5A 3CI8A 2AIXA 4ZZAA 4GX6A 3K00A 5H8NA 3D1RA 4OFOA 3KJ7A 2B3BA 3LV0A 1FPKA 3T93B 3JZJA 4GBWA 4OERA 2UVGA 5TU0A 2RINA 1PB8A 5ICQA 2VP1A 1EH3A 3FUZA 3S9NC 4X48A 1XHYA 4P8BA 3TMGA 2AL4A 4AQ4A 1Z7ME 3RUMA 4DXUA 4I8CA 3HFUA 5CM6A 2ONSA 4KXPA 4OVQA 4MAGA 4ZEBA 1N3XA 5K2XA 2V25A 5CMBA 4DZ1A 3R7XA 1SW2A 4F1VA 4OVSA 1I6AA 2PX1A 4YU0A 4R6HA 2WKYA 3MAMA 4EDPA 4OHNA 4N81A 3OENA 4IY5A 5A5XB 2WYPA 1FCKA 4NF5B 4ZS9A 4YMBA 2XXUA 1FTKA 5FHOA 1WODA 2V3TA 1FQFA 3B6WA 3FVOA 1IMFA 4N6PA 1ZKBA 3A3UA 2L5VA 1UTBA 3PUYE 1FBHA 1MY1A 3QIMA 1FQDA 1US4A 1M5EA 1LBCA 2I4BA 4IR8A 3FIRA 1O63A 4ND9A 4OETA 1A8EA 3GZGA 3SDFA 1DSNA 3C4MA 2OBGA 4PFYA 4U4XA 1II5A 2DE2A 3UGWA 1NI9A 1F9BA 2RCBA 4YZZA 2PYYA 4PC9A 1YTVA 3OEMA 3I6VA 4G68A 4P56A 5H8NB 1OVTA 4JVDA 2P2AA 2O7IA 3U93A 4GL8A 1B2HA 3BBRA 3G3GA 4ZZEA 4PFBA 1NV2A 1B4HA 1VSOA 1HSJA 1I6BA 1MPDA 3OEKA 4MMPA 3KOSA 4MX6A 3S2VA 5CBRA 2OJTA 4F22A 3HPIA 4O7MA 3WAEA 4UABA 4F29A 4OZ9A 1L5TA 4GVOA 3TTRA 4RA1A 4IO5A 2W7YA 2QVVA 1GR2A 3C36A 5H8FA 3G7WA 2PFYA 1AH5A 1XC1A 2ZMBA 2ZYMA 1MY0A 5AA2A 1B9JA 3KSJA 2V4CA 5H8HA 4ELPA 1OVBA 4IY6A 3PUXE 2ANJA 4PFUA 3K6WA 1DMBA 1FPLA 1Q35A 4XKPA 1R9QA 1UTBB 4XEQA 4EF1A 1IXHA 3IJXB 1GTKA 4PBQA 4JVCA 1SBPA 4POWA 2B4MA 1TT1A 2ZZVA 2RKMA 4PFIA 1G0HA 4QF9A 4BDQA 1NV3A 3SETA 2DXRA 4DCYA 4R74A 1USYE 2QL3A 3MSTA 1B6HA 1ATGA 2BJIA 4GFRA 1HSLA 3G3FA 4P1LA 3KG2A 1YYZA 1DPEA 5FHNA 3BIGA 3RN8A 2Z8EA 4X9TA 4G68B 2PT1A 4DIGA 2YPNA 1GGGA 4OA4A 1JW4A 1NUYA 1OQHA 3M8UA 3V83A 2CZIA 2HQ0A 2I3WA 1YCJA 3ZS6A 1QVSA 2BJJX 1OLAA 2F97A 1FPEA 3E79A 2Z8FA 2ZNTA 4QSEA 2Q2CA 3MWBA 3ZKKA 3RQTA 3C33A 2DE4A 3FV2A 3VVDA 4G8NA 1MXVA 4GWSA 5HPQA 4YKKA 4NGUA 4I3YA 2VHAA 1FSAA 3LUYA 3SEXA 1FTOA 3C31A 5H8FB 2NWJA 4UA8A 1H43A 5JTYB 5EYGA 2HXRA 4IO7A 1B51A 1EZOA 5AA2B 1KZ8A 4I62A 4PDHA 2ZZXA 5H8HB 2B4LA 2GRVA 4MFIA 3M3FA 3DLNA 4I9DA 2E0SA 1B0LA 1FTMA 5B70A 4F3SA 5BUUA 4OENA 2PBWA 2XXIA 1FTLA 1LB9A 1D9QA 1VFEA 3K6UA 4OXVA 5T3JA 4PAKA 1DOTA 4XTCQ 3HHGA 4ECFA 3CFZA 4PF8A 3M3KA 2UVHA 1XVXA 1JQFA 4BDOA 1DK4A 3ECRA 4FBPA 4P9KA 1Y9UA 4C1TA 3PU5A 1OQGA 2GFEA 1AOVA 4JWOA 1H44A 2HPGA 1AMFA 3HN0A 4F3PA 1RDZA 1IXGA 3T22A 1UTHA 1N84A 3S9MC 3IL1B 2I0BA 1FQEA 3KJTA 4ZE9A 4IO4A 1NV6A 4GXSB 3F11A 3LR1A 3OO6A 3K2DA 4PAFA 3IO4A 4GX4A 4NG7A 2FNCA 4OVJA 3N26A 4ESWA 3RYDA 2HHMA 2ZYKA 3PUZE 4XKQA 1A99A 5FTIA 2X7QA 3VLWA 2F8DA 3M3LA 4AS5A 3OOAA 4GWOA 3SERA 3KC1A 3OO7A 1ANFA 3H06B 3PMWA 3TZAA 1EYJA 3PTYA 1LCTA 3SEYA 2D5WA 5DT6A 3PMXA 1KWHA 3ILUB 2H4IA 4PETA 1UQWA 1S7YA 3Q25A 1JW1A 4MIJA 1LBXA 3MC2A 1AL3A 3QMFA 3MZ1A 4HW8A 5I57A 3S9EA 2CZHA 3KGCA 4NX1A 2XXXA 4H45A 3AXFA 2Q74A 2ESNA 1MQGA 4FECA 4PTKA 3FVKA 1SVXB 1O7TA 2XWIA 4IB2A 3TPAA 4NAPA 4G8MA 3PUVE 2Y7RA 1MPCA 4LATA 1FPFA 3LBSA 2A5SA 2HZKA 1NUZA 3QXMA 1YXIA 3V8XB 2QRYA 2ZNUA 4NF8A 4OVTA 1FTAA 3MP1A 4RK9A 2B3FA 5AA4A 3SKPA 3QAXA 3IB1A 4P0IA 3VLVA 2OK2A 4MHFA 5ICTA 1UTHB 2D3IA 3VFJA 5I58A 1NV4A 1Y20A 1S50A 4OMBA 4ZECA 4Q0CA 1NV0A 4RXLA 1NUXA 4GX3A 1FRPA 2F34A 4O7IA 4R2BA 4G77A 3T66A 4FEBA 4RPOA 4LZ7A 3FV1A 5FHMA 1MY2A 5M2VA 1B3GA 1LAGE 1M5FA 3FZVA 4PGNA 1INPA 2XD2A 4KPTA 4O3CA 2XD3A 4FORA 4ZE8A 2O1LA 4NMYA 2RC7A 1VE4A 1CE2A 1T0KA 4IGRA 4PCDA 3T9XB 2XXPA 1JVYA 4LONB 4OFJA 3CSGA 4DLDA 1N3WA 2OZZA 1PDAA 3LSWA 2XWKA 4X1DA 5L9OA 3MUQA 4P0GA 4BLAA 4MBPA
chains in the Genus database with same CATH topology
3N6TA 4NTLA 2RF1A 4TLMB 1M5BA 1MXXA 2Y7WA 3V89B 3GLBA 4KD5A 1P1UA 4XXUA 3K1PA 3EHSA 4QSCA 4DCXA 3EN3A 1I69A 2O69A 5KCJB 3MZ9A 2Y7KA 5AE4A 3IK6B 2VD3A 4LZ8A 1MM7A 4E0WA 1B0HA 3KN3A 4BDMA 2O68A 5KDTA 3FD3A 1MXWA 3CR9A 3P7IA 2O6AA 4NF8B 4OQOA 3TQLA 4WKMA 3TELA 3VVFA 5AA4B 2Y84A 4F31B 3W9WA 4MF3A 2XXHA 2Q8JA 4DE8A 3EQ1A 4GLIA 4ZEKA 3E3KA 1IUDA 2UYFA 3KN8A 3RY3A 4F3BA 5I58B 1LBBA 2UXAA 3OMBA 3IJOB 1Y4CA 1A55A 1LGBC 4GL0A 1IZ1A 1D9YA 2DWJA 4R9FA 2QJEA 3TTKA 3O6IA 2ZYNA 1XOCA 4U1OA 3DP4A 2GHBA 3H6TA 2QSXA 3FVNA 1PB7A 3UIFA 2XXQA 4FJPA 3OO9A 3SEWA 2I4CA 2I58A 1XS5A 2PT2A 2DE3A 3U92A 3CRBA 3JV9A 4ELRA 3E4RA 4NF4A 3CFLA 5JK4A 4H0WA 3CFXA 3U1OA 2LAOA 3EPEA 3U72A 1TFDA 4IO6A 1P1WA 5K2YA 4EUOA 5L9MA 3TTMA 3H6WA 2B65A 4HCWA 4Q5TA 3UN6A 2NUVA 4ONYA 4THIA 2QS3A 4FATA 2NOOA 4MLQA 3Q29A 2QMWA 1Y3PA 3LSFB 3B7DA 3GBAA 4BDLA 2RC8A 3PPOA 4GQOA 3K4UA 5KDTB 5KZTA 4QFPA 2Z23A 4YMAA 1MQJA 1B3HA 1N7XA 4TQUQ 5CRYA 5ITOA 4HTGA 1H3DA 1NNPA 3W9VA 3KEIA 5F7VA 4KYDA 4U21A 4U4SA 2OWSA 4LP2B 1B3EA 4KHZE 2M8CA 2XHDA 5I84A 1ZJLA 3ILTB 3RGYA 2DWIA 3DM0A 4TLLB 4R6YA 2F78A 4M4GA 3L6GA 1Y1ZA 4Z0IA 1NNFA 4YAHX 3K0VA 1B32A 3S4UA 2CZLA 5CC2A 3A3CA 2OLBA 3K1MA 2F6PA 1MS7A 3TQWA 1SD3A 4JXIA 4NF6A 2XX8A 4U23A 4FE8A 4KYSA 3RTFB 4IO3A 3FJGA 4GF8A 2FYIA 5ELVA 2G93A 3JYRA 3K1NA 3RPWA 2H98A 1LFHA 4EXLA 1MH3A 2Q89A 4F2OA 2I48A 2D21A 5TPAA 4PE5B 4POXA 1SI0A 5DYHA 2REGA 3USDA 3RTWB 2UVIA 3HO7A 3D4GA 2PVUA 3IB0A 4WXJA 3HSTA 1LLSA 3G3IA 4OYVA 1DTGA 2ONRA 3E13X 1D3KA 3SEVA 4JDFA 4F18A 2QMXA 3IAZA 1VFDA 1LSTA 4G68C 4H67A 4OEUA 3O29A 5I59A 3MBPA 1MG1A 2ZXTA 4KQPA 1MDP1 1PBPA 2DOJA 3GBBA 4LA9A 1N76A 2GH9A 3MW0A 1SW1A 2QS2A 4XIGQ 5I56A 3FJ7A 4U22A 4C1UA 2DP8A 1JETA 3O6HA 3RNNA 1MY4A 4EQBA 3UK4A 2XXRA 1IXCA 3N6UA 3SESA 2HAUA 1QUJA 1SDXA 1UIUA 1A7LA 4NF6B 5FTHA 4KCDA 1ZTYA 3PPNA 4H5GA 1LFGA 1SYHA 2H25A 3IR1A 1A8FA 3ZSFA 3R6UA 1YPNA 3ZKLA 4NEDA 3O9PA 3WAFA 3D4CA 4EQ9A 4Q30B 4MLVA 4FEDA 5TPAB 3O2AA 2VGQA 3N5LA 1B1XA 1R1NA 4R73A 4JSDA 1H76A 2G29A 3DELB 4RJZA 3VVEA 1Q1KA 2DXYA 1FW0A 3MQ9A 3O6GA 1QUIA 3C32A 4U2RA 1EU8A 2X7PA 2R9JA 3PPPA 4H65A 4DXBA 2DWHA 5I59B 3THIA 2ZYOA 3RT8A 1B05A 1MXYA 5ITPA 3T9VA 3GXAA 4ZDMA 5I56B 5JEIA 1BTJA 5DEXA 5F1QA 1ELJA 1RKMA 2HCAA 3QSLA 4DXCA 4E0XA 1MY3A 2OCUA 3UA8A 4N07A 1OMPA 3BFUA 3CSBA 2O7UA 3TAJA 2Y7IA 4KCCA 4BDRA 4QFLA 4F1YA 2I6EA 3OD7A 4OTEA 3A09A 2AYSA 4IGTA 3UORA 1B5HA 3EHTA 1SQYA 1BIYA 4NWCA 4WEDA 5LOMA 2O1MA 2XX7A 1PB9A 4DDDA 1QJMA 5CBSA 4RNSA 1YAEA 1DTZA 4ZEDA 5IAIA 1IQ7A 3H6UA 2XXVA 3QK6A 1USYH 3OELA 4JB7A 2QS1A 2P1SA 4X1BA 3TKDA 3CG3A 2UVJA 4JSOA 5H8SA 3VE1B 3ODBA 1NH7A 2A5TA 1FQCA 5I2KA 4FAJA 1QUKA 1URGA 1NNTA 4PP0A 3EF7A 1P99A 1JEVA 1IIWA 4KYEA 2V84A 4WEPA 1B40A 1B5IA 3C9HA 4OESA 2F5XA 3V5AA 3H3GA 2DSFA 3G3HA 1J1NA 3TTNA 5I57B 3OO8A 2H9BA 4G2ZA 3IX1A 1IITA 1ZMGA 2UYEA 2PMSA 2O51A 3MP6A 3QUJA 1MH4A 5DEXB 3VXBA 4LQ2A 4KR5A 2V3QA 2GHAA 3N94A 1I6QA 1QW0A 3FXRA 1SW4A 1BLFA 3KZGA 3LSLA 3SEUA 3TYHA 4TOZA 2DVZA 2H99A 2V93A 4GD5A 3KOTA 4BDNA 3I3VA 1N0TA 3IOUA 3H6VA 3QYTA 3CVGA 2R71A 1ZLQA 1ZU0A 1B5JA 1MXZA 5DVFA 3W15C 3H7MA 1M5DA 3MVZA 4MH5A 4LUBA 1US5A 2KLFA 4PQJA 1SYIA 1MQHA 3MPKA 3TFLA 1QULA 1JNFA 2Q2AA 3B6TA 4RK2A 2H5YA 2Z8DA 2Q9TA 4F2QA 5TP9A 2F7BA 4FIMA 4GIZA 4L17A 3IOWA 4ZEIA 2A5TB 3MPLA 1WVJA 5I2KB 1B46A 4N13A 3PV0E 4RY1A 1XVYA 4JWYA 1JVXA 1Y4TA 3H4ZA 3T9UA 4KI0E 1N7WA 4JBZA 4YKPA 3K01A 3FJMA 4U1ZA 5BWJA 4OFLA 1ZIUA 4NE4A 1VR5A 4XKRA 3KSXA 3OXNA 4QFNA 4YB6A 5DVJA 1P1QA 3VXCA 1QKBA 3FGSA 5H8QA 3ONMA 1B7ZA 1B1HA 4LQ5A 3TUSA 4PFTA 4HS7A 4RYAA 1TFAA 4EF2A 1M5CA 1JEUA 3LC8A 1PC3A 1TWYA 4H5FA 2NVUB 1NNKA 2ABHA 1LFIA 2F36A 3HCQA 4C0RA 5CMMA 4EQ7A 5JTYA 4OWDA 3T96B 3O28A 1Z7NE 1N04A 2F7AA 1EZ9A 3MZBA 1DPPA 3Q27A 3K6XA 2Q88A 3KFMA 3K02A 2O84X 4G4PA 1B52A 2AL5A 2F6GA 5EYFA 1NH8A 2IA4A 1NKXA 3KN7A 3FXQA 2ALUA 4O3BA 3LSXA 3QUFA 1FQBA 1NL5A 2DYXA 3UP9A 3OSRA 4ESXA 3MVWA 4QFKA 5ISUA 1H45A 5EHSA 4GOTA 3G3JA 3VDFA 5TP9B 4QFOA 2RC9A 2HFBA 4H8IA 1S9TA 3G3KA 3CIJA 2DQVA 4IO2A 3RLFE 3RT6B 1BKAA 5DTBA 3DP8A 1IXIA 1URDA 3FXUA 4H1XA 4NF4B 4I1DA 2XX9A 1OIBA 3TDJA 3TCHA 1MQDA 4PFWA 5AA2D 4QSDA 1NFTA 3PPRA 3DP6A 3BKIB 3PD9A 1D4NA 1Y1MA 2R6GE 4XKNA 1SI1A 4F1UA 3PUWE 2VD2A 1QKAA 5H8QB 1B58A 3TCFA 4K3FA 2IEEA 4RPNA 1B3FA 1Y3QA 1A54A 3FVGA 5AA1A 1B4ZA 5B7DA 3CG1A 1HSEA 4AB5A 2YJPA 3MJNA 1EZPA 5I2NA 1MM6A 3TEPA 1B3LA 5L8DA 2OWTA 2V3UA 1LCFA 1NMUA 1RYOA 2DWAA 2XXYA 1BP5A 4R2FA 4H8JA 4EXKA 2P0SA 4QRZA 3R26A 3S9LC 1GV8A 2CMOA 3IOVA 2I3VA 1FTJA 2HZLA 3TCGA 3O97A 4YB5A 3MP8A 4ELOA 1A40A 1POY1 3K6VA 5CI5A 2F35A 1SW5A 2VOZA 4R72A 3HHFA 3HV1A 4LZ5A 1GVCA 2RCAA 1IEJA 2I0CA 2HEUA 1FQAA 2Y7PA 5CMKA 1B7HA 3C34A 2XXWA 1OLCA 3BFTA 3B6QA 2REJA 3T9HB 3TTLA 1MDQA 2DS9A 5DVIA 2HXWA 1R6ZA 1POTA 1XT8A 1UIVA 3IB2A 4F39A 1RYXA 1O64A 1URSA 3PGFA 3PD8A 1Y3NA 2X26A 5AA3A 4P11A 3PMVA 5HM4B 1LAXA 5EHMA 1PBQA 1MPBA 3EHUA 3I5OA 4ELQA 4Q8RA 2XXTA 3FATA 3C35A 1CB6A 2F7CA 3L6HA 3Q28A 2DVCA 4HCYA 5L9SA 1R9LA 1TXFA 4GRKA 3OSQA 4NWDA 1PEBA 3FASA 1MQIA 2YLNA 2ZNSA 4YKJA 5I2NB 4AB6A 4O3AA 3IOTA 4QHQA 5IKBA 1LAFE 3E9XA 4KFQA 1P1OA 3IO6A 4F19A 5CMCA 4R9GA 4Z7EA 3KBRA 4UACA 4F3GA 4YICA 3IORA 5KCJA 1LB8A 2QPQA 4G8HA 4M1VA 3U8QA 5J1DA 4GXAA 3Q26A 4ISUA 3U94A 1P1NA 2ONKE 1MRPA 1AIVA 3MVXA 5A5XA 2THIA 4NF5A 3TODA 2FA7A 5HBCA 1B7UA 4LVQA 4ZEFA 2Z22A 3H03A 4YB7A 4YKIA 4R6KA 4OEVA 4H6DA 3O66A 1JW5A 1MXUA 1LAHE 4JWXA 3MVYA 2NXOA 3VLUA 1D9VA 2I49A 3PPQA 2QS4A 1WDNA 2HAVA 1ZBMA 4R75A 2E1SA 3VV5A 3CI8A 2AIXA 4ZZAA 3K00A 5H8NA 4OFOA 3KJ7A 2B3BA 3T93B 3JZJA 4OERA 2UVGA 5TU0A 2RINA 1PB8A 5ICQA 2VP1A 1EH3A 3FUZA 3S9NC 4X48A 1XHYA 3TMGA 2AL4A 4AQ4A 1Z7ME 3RUMA 4DXUA 4I8CA 5CM6A 2ONSA 4ZEBA 1N3XA 5K2XA 2V25A 5CMBA 4DZ1A 3R7XA 1SW2A 4F1VA 1I6AA 2PX1A 4YU0A 2WKYA 3MAMA 4R6HA 4EDPA 4OHNA 3OENA 4IY5A 5A5XB 1FCKA 4NF5B 4ZS9A 4YMBA 2XXUA 1FTKA 5FHOA 1WODA 2V3TA 1FQFA 3B6WA 3FVOA 4N6PA 1ZKBA 3A3UA 1UTBA 3PUYE 1MY1A 3QIMA 1FQDA 1US4A 1M5EA 1LBCA 2I4BA 3FIRA 1O63A 4ND9A 4OETA 1A8EA 3GZGA 3SDFA 1DSNA 3C4MA 2OBGA 4PFYA 4U4XA 1II5A 2DE2A 3UGWA 1F9BA 2RCBA 4YZZA 2PYYA 1YTVA 3OEMA 3I6VA 4G68A 5H8NB 1OVTA 2P2AA 2O7IA 3U93A 4GL8A 1B2HA 3BBRA 3G3GA 4ZZEA 1B4HA 1VSOA 1HSJA 1I6BA 1MPDA 3OEKA 3KOSA 3S2VA 5CBRA 2OJTA 4F22A 3HPIA 3WAEA 4F29A 4OZ9A 1L5TA 4GVOA 3TTRA 4RA1A 4IO5A 2W7YA 1GR2A 3C36A 5H8FA 3G7WA 1AH5A 1XC1A 2ZMBA 2ZYMA 1MY0A 5AA2A 1B9JA 3KSJA 5H8HA 4ELPA 1OVBA 4IY6A 3PUXE 2ANJA 4PFUA 3K6WA 1DMBA 1Q35A 4XKPA 1R9QA 1UTBB 4EF1A 1IXHA 3IJXB 1GTKA 1SBPA 4POWA 1TT1A 2RKMA 4QF9A 4BDQA 3SETA 2DXRA 4DCYA 4R74A 1USYE 2QL3A 1B6HA 1ATGA 4GFRA 1HSLA 3G3FA 3KG2A 1DPEA 5FHNA 3RN8A 2Z8EA 4X9TA 4G68B 2PT1A 4DIGA 2YPNA 1GGGA 1JW4A 1OQHA 3M8UA 3V83A 2HQ0A 2I3WA 1YCJA 3ZS6A 1QVSA 2BJJX 1OLAA 2F97A 2Z8FA 2ZNTA 4QSEA 2Q2CA 3MWBA 3ZKKA 3RQTA 3C33A 2DE4A 3FV2A 3VVDA 4G8NA 1MXVA 5HPQA 4YKKA 2VHAA 3LUYA 3SEXA 1FTOA 3C31A 5H8FB 2NWJA 4UA8A 1H43A 5JTYB 4IO7A 1B51A 1EZOA 5AA2B 4I62A 5H8HB 2GRVA 4MFIA 3M3FA 3DLNA 4I9DA 2E0SA 1B0LA 1FTMA 5B70A 4F3SA 5BUUA 4OENA 2PBWA 2XXIA 1FTLA 1LB9A 1VFEA 3K6UA 4OXVA 1DOTA 4XTCQ 3HHGA 4ECFA 3CFZA 3M3KA 2UVHA 1XVXA 1JQFA 4BDOA 3ECRA 1Y9UA 4C1TA 3PU5A 1OQGA 2GFEA 1AOVA 4JWOA 1H44A 1AMFA 3HN0A 4F3PA 3T22A 1IXGA 1UTHA 1N84A 3S9MC 3IL1B 2I0BA 1FQEA 3KJTA 4ZE9A 4IO4A 4GXSB 3F11A 3LR1A 3OO6A 3K2DA 3IO4A 2FNCA 4OVJA 3N26A 4ESWA 2ZYKA 3PUZE 4XKQA 1A99A 5FTIA 2X7QA 3VLWA 2F8DA 3M3LA 3OOAA 4GWOA 3SERA 3OO7A 1ANFA 3H06B 3PMWA 3TZAA 1LCTA 3SEYA 2D5WA 5DT6A 3PMXA 1KWHA 3ILUB 2H4IA 4PETA 1UQWA 1S7YA 1JW1A 3Q25A 3MC2A 1AL3A 3MZ1A 4HW8A 5I57A 3S9EA 3KGCA 2XXXA 3AXFA 2ESNA 1MQGA 4FECA 3FVKA 1SVXB 1O7TA 4IB2A 3TPAA 4G8MA 3PUVE 2Y7RA 1MPCA 4LATA 3LBSA 2A5SA 2HZKA 3QXMA 3V8XB 2QRYA 2ZNUA 4NF8A 3MP1A 4RK9A 2B3FA 5AA4A 3SKPA 3QAXA 3IB1A 4P0IA 3VLVA 2OK2A 5ICTA 1UTHB 2D3IA 3VFJA 5I58A 1Y20A 1S50A 4OMBA 4ZECA 4Q0CA 4RXLA 2F34A 4R2BA 4G77A 3T66A 4FEBA 4RPOA 4LZ7A 3FV1A 5FHMA 1MY2A 5M2VA 1B3GA 1LAGE 1M5FA 3FZVA 2XD2A 4KPTA 4O3CA 2XD3A 4FORA 4ZE8A 2O1LA 4NMYA 2RC7A 1VE4A 1CE2A 1T0KA 4IGRA 3T9XB 2XXPA 1JVYA 4LONB 4OFJA 3CSGA 4DLDA 1N3WA 2OZZA 1PDAA 3LSWA 4X1DA 5L9OA 3MUQA 4P0GA 4BLAA 4MBPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3N6T A;  4NTL A;  2RF1 A;  4TLM B;  1M5B A;  1MXX A;  2Y7W A;  3V89 B;  3GLB A;  4KD5 A;  1P1U A;  4XXU A;  3K1P A;  3EHS A;  4QSC A;  4DCX A;  3EN3 A;  1I69 A;  2O69 A;  5KCJ B;  3MZ9 A;  2Y7K A;  5AE4 A;  3IK6 B;  2VD3 A;  4LZ8 A;  1MM7 A;  4E0W A;  1B0H A;  3KN3 A;  4BDM A;  2O68 A;  5KDT A;  3FD3 A;  1MXW A;  3CR9 A;  3P7I A;  2O6A A;  4NF8 B;  4OQO A;  3TQL A;  4WKM A;  3TEL A;  3VVF A;  5AA4 B;  2Y84 A;  4F31 B;  3W9W A;  4MF3 A;  2XXH A;  2Q8J A;  4DE8 A;  3EQ1 A;  4GLI A;  4ZEK A;  3E3K A;  1IUD A;  2UYF A;  3KN8 A;  3RY3 A;  4F3B A;  5I58 B;  1LBB A;  2UXA A;  3OMB A;  3IJO B;  1Y4C A;  1A55 A;  1LGB C;  4GL0 A;  1IZ1 A;  1D9Y A;  2DWJ A;  4R9F A;  2QJE A;  3TTK A;  3O6I A;  2ZYN A;  1XOC A;  4U1O A;  3DP4 A;  2GHB A;  3H6T A;  2QSX A;  3FVN A;  1PB7 A;  3UIF A;  2XXQ A;  4FJP A;  3OO9 A;  3SEW A;  2I4C A;  2I58 A;  1XS5 A;  2PT2 A;  2DE3 A;  3U92 A;  3CRB A;  3JV9 A;  4ELR A;  3E4R A;  4NF4 A;  3CFL A;  5JK4 A;  4H0W A;  3CFX A;  3U1O A;  2LAO A;  3EPE A;  3U72 A;  1TFD A;  4IO6 A;  1P1W A;  5K2Y A;  4EUO A;  5L9M A;  3TTM A;  3H6W A;  2B65 A;  4HCW A;  4Q5T A;  3UN6 A;  2NUV A;  4ONY A;  4THI A;  2QS3 A;  4FAT A;  2NOO A;  4MLQ A;  3Q29 A;  2QMW A;  1Y3P A;  3LSF B;  3B7D A;  3GBA A;  4BDL A;  2RC8 A;  3PPO A;  4GQO A;  3K4U A;  5KDT B;  5KZT A;  4QFP A;  2Z23 A;  4YMA A;  1MQJ A;  1B3H A;  1N7X A;  4TQU Q;  5CRY A;  5ITO A;  4HTG A;  1H3D A;  1NNP A;  3W9V A;  3KEI A;  5F7V A;  4KYD A;  4U21 A;  4U4S A;  2OWS A;  4LP2 B;  1B3E A;  4KHZ E;  2M8C A;  2XHD A;  5I84 A;  1ZJL A;  3ILT B;  3RGY A;  2DWI A;  3DM0 A;  4TLL B;  4R6Y A;  2F78 A;  4M4G A;  3L6G A;  1Y1Z A;  4Z0I A;  1NNF A;  4YAH X;  3K0V A;  1B32 A;  3S4U A;  2CZL A;  5CC2 A;  3A3C A;  2OLB A;  3K1M A;  2F6P A;  1MS7 A;  3TQW A;  1SD3 A;  4JXI A;  4NF6 A;  2XX8 A;  4U23 A;  4FE8 A;  4KYS A;  3RTF B;  4IO3 A;  3FJG A;  4GF8 A;  2FYI A;  5ELV A;  2G93 A;  3JYR A;  3K1N A;  3RPW A;  2H98 A;  1LFH A;  4EXL A;  1MH3 A;  2Q89 A;  4F2O A;  2I48 A;  2D21 A;  5TPA A;  4PE5 B;  4POX A;  1SI0 A;  5DYH A;  2REG A;  3USD A;  3RTW B;  2UVI A;  3HO7 A;  3D4G A;  2PVU A;  3IB0 A;  4WXJ A;  3HST A;  1LLS A;  3G3I A;  4OYV A;  1DTG A;  2ONR A;  3E13 X;  1D3K A;  3SEV A;  4JDF A;  4F18 A;  2QMX A;  3IAZ A;  1VFD A;  1LST A;  4G68 C;  4H67 A;  4OEU A;  3O29 A;  5I59 A;  3MBP A;  1MG1 A;  2ZXT A;  4KQP A;  1MDP 1;  1PBP A;  2DOJ A;  3GBB A;  4LA9 A;  1N76 A;  2GH9 A;  3MW0 A;  1SW1 A;  2QS2 A;  4XIG Q;  5I56 A;  3FJ7 A;  4U22 A;  4C1U A;  2DP8 A;  1JET A;  3O6H A;  3RNN A;  1MY4 A;  4EQB A;  3UK4 A;  2XXR A;  1IXC A;  3N6U A;  3SES A;  2HAU A;  1QUJ A;  1SDX A;  1UIU A;  1A7L A;  4NF6 B;  5FTH A;  4KCD A;  1ZTY A;  3PPN A;  4H5G A;  1LFG A;  1SYH A;  2H25 A;  3IR1 A;  1A8F A;  3ZSF A;  3R6U A;  1YPN A;  3ZKL A;  4NED A;  3O9P A;  3WAF A;  3D4C A;  4EQ9 A;  4Q30 B;  4MLV A;  4FED A;  5TPA B;  3O2A A;  2VGQ A;  3N5L A;  1B1X A;  1R1N A;  4R73 A;  4JSD A;  1H76 A;  2G29 A;  3DEL B;  4RJZ A;  3VVE A;  1Q1K A;  2DXY A;  1FW0 A;  3MQ9 A;  3O6G A;  1QUI A;  3C32 A;  4U2R A;  1EU8 A;  2X7P A;  2R9J A;  3PPP A;  4H65 A;  4DXB A;  2DWH A;  5I59 B;  3THI A;  2ZYO A;  3RT8 A;  1B05 A;  1MXY A;  5ITP A;  3T9V A;  3GXA A;  4ZDM A;  5I56 B;  5JEI A;  1BTJ A;  5DEX A;  5F1Q A;  1ELJ A;  1RKM A;  2HCA A;  3QSL A;  4DXC A;  4E0X A;  1MY3 A;  2OCU A;  3UA8 A;  4N07 A;  1OMP A;  3BFU A;  3CSB A;  2O7U A;  3TAJ A;  2Y7I A;  4KCC A;  4BDR A;  4QFL A;  4F1Y A;  2I6E A;  3OD7 A;  4OTE A;  3A09 A;  2AYS A;  4IGT A;  3UOR A;  1B5H A;  3EHT A;  1SQY A;  1BIY A;  4NWC A;  4WED A;  5LOM A;  2O1M A;  2XX7 A;  1PB9 A;  4DDD A;  1QJM A;  5CBS A;  4RNS A;  1YAE A;  1DTZ A;  4ZED A;  5IAI A;  1IQ7 A;  3H6U A;  2XXV A;  3QK6 A;  1USY H;  3OEL A;  4JB7 A;  2QS1 A;  2P1S A;  4X1B A;  3TKD A;  3CG3 A;  2UVJ A;  4JSO A;  5H8S A;  3VE1 B;  3ODB A;  1NH7 A;  2A5T A;  1FQC A;  5I2K A;  4FAJ A;  1QUK A;  1URG A;  1NNT A;  4PP0 A;  3EF7 A;  1P99 A;  1JEV A;  1IIW A;  4KYE A;  2V84 A;  4WEP A;  1B40 A;  1B5I A;  3C9H A;  4OES A;  2F5X A;  3V5A A;  3H3G A;  2DSF A;  3G3H A;  1J1N A;  3TTN A;  5I57 B;  3OO8 A;  2H9B A;  4G2Z A;  3IX1 A;  1IIT A;  1ZMG A;  2UYE A;  2PMS A;  2O51 A;  3MP6 A;  3QUJ A;  1MH4 A;  5DEX B;  3VXB A;  4LQ2 A;  4KR5 A;  2V3Q A;  2GHA A;  3N94 A;  1I6Q A;  1QW0 A;  3FXR A;  1SW4 A;  1BLF A;  3KZG A;  3LSL A;  3SEU A;  3TYH A;  4TOZ A;  2DVZ A;  2H99 A;  2V93 A;  4GD5 A;  3KOT A;  4BDN A;  3I3V A;  1N0T A;  3IOU A;  3H6V A;  3QYT A;  3CVG A;  2R71 A;  1ZLQ A;  1ZU0 A;  1B5J A;  1MXZ A;  5DVF A;  3W15 C;  3H7M A;  1M5D A;  3MVZ A;  4MH5 A;  4LUB A;  1US5 A;  2KLF A;  4PQJ A;  1SYI A;  1MQH A;  3MPK A;  3TFL A;  1QUL A;  1JNF A;  2Q2A A;  3B6T A;  4RK2 A;  2H5Y A;  2Z8D A;  2Q9T A;  4F2Q A;  5TP9 A;  2F7B A;  4FIM A;  4GIZ A;  4L17 A;  3IOW A;  4ZEI A;  2A5T B;  3MPL A;  1WVJ A;  5I2K B;  1B46 A;  4N13 A;  3PV0 E;  4RY1 A;  1XVY A;  4JWY A;  1JVX A;  1Y4T A;  3H4Z A;  3T9U A;  4KI0 E;  1N7W A;  4JBZ A;  4YKP A;  3K01 A;  3FJM A;  4U1Z A;  5BWJ A;  4OFL A;  1ZIU A;  4NE4 A;  1VR5 A;  4XKR A;  3KSX A;  3OXN A;  4QFN A;  4YB6 A;  5DVJ A;  1P1Q A;  3VXC A;  1QKB A;  3FGS A;  5H8Q A;  3ONM A;  1B7Z A;  1B1H A;  4LQ5 A;  3TUS A;  4PFT A;  4HS7 A;  4RYA A;  1TFA A;  4EF2 A;  1M5C A;  1JEU A;  3LC8 A;  1PC3 A;  1TWY A;  4H5F A;  2NVU B;  1NNK A;  2ABH A;  1LFI A;  2F36 A;  3HCQ A;  4C0R A;  5CMM A;  4EQ7 A;  5JTY A;  4OWD A;  3T96 B;  3O28 A;  1Z7N E;  1N04 A;  2F7A A;  1EZ9 A;  3MZB A;  1DPP A;  3Q27 A;  3K6X A;  2Q88 A;  3KFM A;  3K02 A;  2O84 X;  4G4P A;  1B52 A;  2AL5 A;  2F6G A;  5EYF A;  1NH8 A;  2IA4 A;  1NKX A;  3KN7 A;  3FXQ A;  2ALU A;  4O3B A;  3LSX A;  3QUF A;  1FQB A;  1NL5 A;  2DYX A;  3UP9 A;  3OSR A;  4ESX A;  3MVW A;  4QFK A;  5ISU A;  1H45 A;  5EHS A;  4GOT A;  3G3J A;  3VDF A;  5TP9 B;  4QFO A;  2RC9 A;  2HFB A;  4H8I A;  1S9T A;  3G3K A;  3CIJ A;  2DQV A;  4IO2 A;  3RLF E;  3RT6 B;  1BKA A;  5DTB A;  3DP8 A;  1IXI A;  1URD A;  3FXU A;  4H1X A;  4NF4 B;  4I1D A;  2XX9 A;  1OIB A;  3TDJ A;  3TCH A;  1MQD A;  4PFW A;  5AA2 D;  4QSD A;  1NFT A;  3PPR A;  3DP6 A;  3BKI B;  3PD9 A;  1D4N A;  1Y1M A;  2R6G E;  4XKN A;  1SI1 A;  4F1U A;  3PUW E;  2VD2 A;  1QKA A;  5H8Q B;  1B58 A;  3TCF A;  4K3F A;  2IEE A;  4RPN A;  1B3F A;  1Y3Q A;  1A54 A;  3FVG A;  5AA1 A;  1B4Z A;  5B7D A;  3CG1 A;  1HSE A;  4AB5 A;  2YJP A;  3MJN A;  1EZP A;  5I2N A;  1MM6 A;  3TEP A;  1B3L A;  5L8D A;  2OWT A;  2V3U A;  1LCF A;  1NMU A;  1RYO A;  2DWA A;  2XXY A;  1BP5 A;  4R2F A;  4H8J A;  4EXK A;  2P0S A;  4QRZ A;  3R26 A;  3S9L C;  1GV8 A;  2CMO A;  3IOV A;  2I3V A;  1FTJ A;  2HZL A;  3TCG A;  3O97 A;  4YB5 A;  3MP8 A;  4ELO A;  1A40 A;  1POY 1;  3K6V A;  5CI5 A;  2F35 A;  1SW5 A;  2VOZ A;  4R72 A;  3HHF A;  3HV1 A;  4LZ5 A;  1GVC A;  2RCA A;  1IEJ A;  2I0C A;  2HEU A;  1FQA A;  2Y7P A;  5CMK A;  1B7H A;  3C34 A;  2XXW A;  1OLC A;  3BFT A;  3B6Q A;  2REJ A;  3T9H B;  3TTL A;  1MDQ A;  2DS9 A;  5DVI A;  2HXW A;  1R6Z A;  1POT A;  1XT8 A;  1UIV A;  3IB2 A;  4F39 A;  1RYX A;  1O64 A;  1URS A;  3PGF A;  3PD8 A;  1Y3N A;  2X26 A;  5AA3 A;  4P11 A;  3PMV A;  5HM4 B;  1LAX A;  5EHM A;  1PBQ A;  1MPB A;  3EHU A;  3I5O A;  4ELQ A;  4Q8R A;  2XXT A;  3FAT A;  3C35 A;  1CB6 A;  2F7C A;  3L6H A;  3Q28 A;  2DVC A;  4HCY A;  5L9S A;  1R9L A;  1TXF A;  4GRK A;  3OSQ A;  4NWD A;  1PEB A;  3FAS A;  1MQI A;  2YLN A;  2ZNS A;  4YKJ A;  5I2N B;  4AB6 A;  4O3A A;  3IOT A;  4QHQ A;  5IKB A;  1LAF E;  3E9X A;  4KFQ A;  1P1O A;  3IO6 A;  4F19 A;  5CMC A;  4R9G A;  4Z7E A;  3KBR A;  4UAC A;  4F3G A;  4YIC A;  3IOR A;  5KCJ A;  1LB8 A;  2QPQ A;  4G8H A;  4M1V A;  3U8Q A;  5J1D A;  4GXA A;  3Q26 A;  4ISU A;  3U94 A;  1P1N A;  2ONK E;  1MRP A;  1AIV A;  3MVX A;  5A5X A;  2THI A;  4NF5 A;  3TOD A;  2FA7 A;  5HBC A;  1B7U A;  4LVQ A;  4ZEF A;  2Z22 A;  3H03 A;  4YB7 A;  4YKI A;  4R6K A;  4OEV A;  4H6D A;  3O66 A;  1JW5 A;  1MXU A;  1LAH E;  4JWX A;  3MVY A;  2NXO A;  3VLU A;  1D9V A;  2I49 A;  3PPQ A;  2QS4 A;  1WDN A;  2HAV A;  1ZBM A;  4R75 A;  2E1S A;  3VV5 A;  3CI8 A;  2AIX A;  4ZZA A;  3K00 A;  5H8N A;  4OFO A;  3KJ7 A;  2B3B A;  3T93 B;  3JZJ A;  4OER A;  2UVG A;  5TU0 A;  2RIN A;  1PB8 A;  5ICQ A;  2VP1 A;  1EH3 A;  3FUZ A;  3S9N C;  4X48 A;  1XHY A;  3TMG A;  2AL4 A;  4AQ4 A;  1Z7M E;  3RUM A;  4DXU A;  4I8C A;  5CM6 A;  2ONS A;  4ZEB A;  1N3X A;  5K2X A;  2V25 A;  5CMB A;  4DZ1 A;  3R7X A;  1SW2 A;  4F1V A;  1I6A A;  2PX1 A;  4YU0 A;  2WKY A;  3MAM A;  4R6H A;  4EDP A;  4OHN A;  3OEN A;  4IY5 A;  5A5X B;  1FCK A;  4NF5 B;  4ZS9 A;  4YMB A;  2XXU A;  1FTK A;  5FHO A;  1WOD A;  2V3T A;  1FQF A;  3B6W A;  3FVO A;  4N6P A;  1ZKB A;  3A3U A;  1UTB A;  3PUY E;  1MY1 A;  3QIM A;  1FQD A;  1US4 A;  1M5E A;  1LBC A;  2I4B A;  3FIR A;  1O63 A;  4ND9 A;  4OET A;  1A8E A;  3GZG A;  3SDF A;  1DSN A;  3C4M A;  2OBG A;  4PFY A;  4U4X A;  1II5 A;  2DE2 A;  3UGW A;  1F9B A;  2RCB A;  4YZZ A;  2PYY A;  1YTV A;  3OEM A;  3I6V A;  4G68 A;  5H8N B;  1OVT A;  2P2A A;  2O7I A;  3U93 A;  4GL8 A;  1B2H A;  3BBR A;  3G3G A;  4ZZE A;  1B4H A;  1VSO A;  1HSJ A;  1I6B A;  1MPD A;  3OEK A;  3KOS A;  3S2V A;  5CBR A;  2OJT A;  4F22 A;  3HPI A;  3WAE A;  4F29 A;  4OZ9 A;  1L5T A;  4GVO A;  3TTR A;  4RA1 A;  4IO5 A;  2W7Y A;  1GR2 A;  3C36 A;  5H8F A;  3G7W A;  1AH5 A;  1XC1 A;  2ZMB A;  2ZYM A;  1MY0 A;  5AA2 A;  1B9J A;  3KSJ A;  5H8H A;  4ELP A;  1OVB A;  4IY6 A;  3PUX E;  2ANJ A;  4PFU A;  3K6W A;  1DMB A;  1Q35 A;  4XKP A;  1R9Q A;  1UTB B;  4EF1 A;  1IXH A;  3IJX B;  1GTK A;  1SBP A;  4POW A;  1TT1 A;  2RKM A;  4QF9 A;  4BDQ A;  3SET A;  2DXR A;  4DCY A;  4R74 A;  1USY E;  2QL3 A;  1B6H A;  1ATG A;  4GFR A;  1HSL A;  3G3F A;  3KG2 A;  1DPE A;  5FHN A;  3RN8 A;  2Z8E A;  4X9T A;  4G68 B;  2PT1 A;  4DIG A;  2YPN A;  1GGG A;  1JW4 A;  1OQH A;  3M8U A;  3V83 A;  2HQ0 A;  2I3W A;  1YCJ A;  3ZS6 A;  1QVS A;  2BJJ X;  1OLA A;  2F97 A;  2Z8F A;  2ZNT A;  4QSE A;  2Q2C A;  3MWB A;  3ZKK A;  3RQT A;  3C33 A;  2DE4 A;  3FV2 A;  3VVD A;  4G8N A;  1MXV A;  5HPQ A;  4YKK A;  2VHA A;  3LUY A;  3SEX A;  1FTO A;  3C31 A;  5H8F B;  2NWJ A;  4UA8 A;  1H43 A;  5JTY B;  4IO7 A;  1B51 A;  1EZO A;  5AA2 B;  4I62 A;  5H8H B;  2GRV A;  4MFI A;  3M3F A;  3DLN A;  4I9D A;  2E0S A;  1B0L A;  1FTM A;  5B70 A;  4F3S A;  5BUU A;  4OEN A;  2PBW A;  2XXI A;  1FTL A;  1LB9 A;  1VFE A;  3K6U A;  4OXV A;  1DOT A;  4XTC Q;  3HHG A;  4ECF A;  3CFZ A;  3M3K A;  2UVH A;  1XVX A;  1JQF A;  4BDO A;  3ECR A;  1Y9U A;  4C1T A;  3PU5 A;  1OQG A;  2GFE A;  1AOV A;  4JWO A;  1H44 A;  1AMF A;  3HN0 A;  4F3P A;  3T22 A;  1IXG A;  1UTH A;  1N84 A;  3S9M C;  3IL1 B;  2I0B A;  1FQE A;  3KJT A;  4ZE9 A;  4IO4 A;  4GXS B;  3F11 A;  3LR1 A;  3OO6 A;  3K2D A;  3IO4 A;  2FNC A;  4OVJ A;  3N26 A;  4ESW A;  2ZYK A;  3PUZ E;  4XKQ A;  1A99 A;  5FTI A;  2X7Q A;  3VLW A;  2F8D A;  3M3L A;  3OOA A;  4GWO A;  3SER A;  3OO7 A;  1ANF A;  3H06 B;  3PMW A;  3TZA A;  1LCT A;  3SEY A;  2D5W A;  5DT6 A;  3PMX A;  1KWH A;  3ILU B;  2H4I A;  4PET A;  1UQW A;  1S7Y A;  1JW1 A;  3Q25 A;  3MC2 A;  1AL3 A;  3MZ1 A;  4HW8 A;  5I57 A;  3S9E A;  3KGC A;  2XXX A;  3AXF A;  2ESN A;  1MQG A;  4FEC A;  3FVK A;  1SVX B;  1O7T A;  4IB2 A;  3TPA A;  4G8M A;  3PUV E;  2Y7R A;  1MPC A;  4LAT A;  3LBS A;  2A5S A;  2HZK A;  3QXM A;  3V8X B;  2QRY A;  2ZNU A;  4NF8 A;  3MP1 A;  4RK9 A;  2B3F A;  5AA4 A;  3SKP A;  3QAX A;  3IB1 A;  4P0I A;  3VLV A;  2OK2 A;  5ICT A;  1UTH B;  2D3I A;  3VFJ A;  5I58 A;  1Y20 A;  1S50 A;  4OMB A;  4ZEC A;  4Q0C A;  4RXL A;  2F34 A;  4R2B A;  4G77 A;  3T66 A;  4FEB A;  4RPO A;  4LZ7 A;  3FV1 A;  5FHM A;  1MY2 A;  5M2V A;  1B3G A;  1LAG E;  1M5F A;  3FZV A;  2XD2 A;  4KPT A;  4O3C A;  2XD3 A;  4FOR A;  4ZE8 A;  2O1L A;  4NMY A;  2RC7 A;  1VE4 A;  1CE2 A;  1T0K A;  4IGR A;  3T9X B;  2XXP A;  1JVY A;  4LON B;  4OFJ A;  3CSG A;  4DLD A;  1N3W A;  2OZZ A;  1PDA A;  3LSW A;  4X1D A;  5L9O A;  3MUQ A;  4P0G A;  4BLA A;  4MBP A; 
#chains in the Genus database with same CATH topology
 3N6T A;  4NTL A;  2RF1 A;  4TLM B;  1M5B A;  1MXX A;  2Y7W A;  3V89 B;  3GLB A;  4KD5 A;  1P1U A;  4XXU A;  3K1P A;  3EHS A;  4QSC A;  4DCX A;  3EN3 A;  1I69 A;  2O69 A;  5KCJ B;  3MZ9 A;  2PFZ A;  2Y7K A;  4GWX A;  3IK6 B;  5AE4 A;  2VD3 A;  1RDY A;  4LZ8 A;  1MM7 A;  4E0W A;  1B0H A;  4MNP A;  3KN3 A;  4BDM A;  2O68 A;  4G61 A;  5KDT A;  3FD3 A;  1MXW A;  2XWV A;  1FBG A;  3CR9 A;  3P7I A;  2O6A A;  4NF8 B;  4OQO A;  3TQL A;  4WKM A;  3TEL A;  3VVF A;  5AA4 B;  5EYH A;  2Y84 A;  4F31 B;  3W9W A;  3KC0 A;  4MF3 A;  2XXH A;  3B50 A;  2Q8J A;  4DE8 A;  5ET8 A;  3EQ1 A;  4GLI A;  4ZEK A;  3E3K A;  1IUD A;  2UYF A;  3KN8 A;  3RY3 A;  4F3B A;  5I58 B;  1LBB A;  2UXA A;  3OMB A;  3IJO B;  1Y4C A;  1A55 A;  1LGB C;  4GL0 A;  1IZ1 A;  2Y5L A;  1D9Y A;  3IFA A;  2DWJ A;  4PE3 A;  4R9F A;  2QJE A;  3TTK A;  3O6I A;  2ZYN A;  1XOC A;  4U1O A;  3DP4 A;  2GHB A;  3H6T A;  2QSX A;  3FVN A;  1PB7 A;  3UIF A;  2XXQ A;  4NHB A;  5I7I A;  4FJP A;  3OO9 A;  2KR0 A;  2I4C A;  2I58 A;  3SEW A;  1XS5 A;  2PT2 A;  2DE3 A;  3U92 A;  3CRB A;  3JV9 A;  4ELR A;  3E4R A;  4NF4 A;  3CFL A;  5JK4 A;  1FBE A;  3CFX A;  4H0W A;  3U1O A;  2LAO A;  3EPE A;  3U72 A;  1TFD A;  4N6K A;  4IO6 A;  1P1W A;  5K2Y A;  4N4U A;  4EUO A;  5L9M A;  3TTM A;  1RDX A;  3H6W A;  2B65 A;  4HCW A;  4Q5T A;  3UN6 A;  2NUV A;  2MKZ A;  4ONY A;  4THI A;  2QS3 A;  4XFE A;  4FAT A;  2NOO A;  4MLQ A;  3Q29 A;  3MYU A;  2QMW A;  1Y3P A;  3LSF B;  3B7D A;  4MNC A;  4MEV A;  3GBA A;  4BDL A;  2RC8 A;  3PPO A;  4GQO A;  3K4U A;  5KDT B;  5KZT A;  4QFP A;  2Z23 A;  4YMA A;  1MQJ A;  3BIH A;  1B3H A;  1N7X A;  4TQU Q;  5CRY A;  5ITO A;  4HTG A;  1H3D A;  1NNP A;  3W9V A;  1NV1 A;  3KEI A;  5F7V A;  4HE0 A;  4KYD A;  4U21 A;  4U4S A;  2OWS A;  4LP2 B;  1B3E A;  4KHZ E;  4OVR A;  2M8C A;  2XHD A;  5I84 A;  1ZJL A;  3ILT B;  1JP4 A;  3SZP A;  3RGY A;  2DWI A;  3DM0 A;  4N91 A;  4TLL B;  4R6Y A;  2F78 A;  4M4G A;  3L6G A;  2XXK A;  1Y1Z A;  4Z0I A;  1NNF A;  4YAH X;  1EYK A;  3K0V A;  1B32 A;  3S4U A;  2CZL A;  5CC2 A;  3A3C A;  2OLB A;  3K1M A;  2F6P A;  1MS7 A;  3TQW A;  1SD3 A;  4JXI A;  4NF6 A;  2XX8 A;  4U23 A;  4FE8 A;  4KYS A;  4OAN A;  3RTF B;  4IO3 A;  3FJG A;  4GF8 A;  2FYI A;  4N17 A;  5ELV A;  2Y5K A;  2G93 A;  3JYR A;  3K1N A;  1G0I A;  3RPW A;  2FIE A;  2H98 A;  1LFH A;  4EXL A;  1MH3 A;  2OX3 A;  2Q89 A;  4F2O A;  2I48 A;  2D21 A;  5TPA A;  4PE5 B;  4PAI A;  2VPN A;  4POX A;  1SI0 A;  5DYH A;  2REG A;  1FPD A;  3USD A;  3A29 A;  3RTW B;  5A5L A;  2UVI A;  3HO7 A;  3D4G A;  2PVU A;  3IB0 A;  4WXJ A;  3HST A;  1LLS A;  3G3I A;  4OYV A;  1DBZ A;  1DTG A;  2ONR A;  1IME A;  3E13 X;  1D3K A;  3SEV A;  4JDF A;  2QMX A;  4F18 A;  3IAZ A;  1VFD A;  1LST A;  5EQ7 A;  4G68 C;  4H67 A;  4OEU A;  3O29 A;  5I59 A;  3MBP A;  1DCU A;  1MG1 A;  2ZXT A;  4KQP A;  1MDP 1;  4P47 A;  1PBP A;  2DOJ A;  4LA9 A;  1IMD A;  3GBB A;  1N76 A;  2GH9 A;  3MW0 A;  4NF0 A;  1SW1 A;  2QS2 A;  4XIG Q;  5I56 A;  3FJ7 A;  4U22 A;  4C1U A;  4GWW A;  2DP8 A;  1JET A;  3O6H A;  4QBA A;  3RNN A;  1MY4 A;  4EQB A;  1FJ6 A;  3UK4 A;  2XXR A;  4PFR A;  4X04 A;  1FPJ A;  1FJ9 A;  1IXC A;  3N6U A;  3SES A;  1K9Y A;  1NUW A;  2HAU A;  4O8M A;  1QUJ A;  5IZ1 A;  5ET7 A;  1SDX A;  1UIU A;  1A7L A;  4NF6 B;  2Q8M A;  5FTH A;  4KCD A;  1ZTY A;  3PPN A;  4H5G A;  1LFG A;  1SYH A;  2H25 A;  3IR1 A;  1A8F A;  3ZSF A;  3R6U A;  1YPN A;  3ZKL A;  2FIX A;  4NED A;  3O9P A;  3D4C A;  3WAF A;  4EQ9 A;  4Q30 B;  4MLV A;  1AWB A;  4GBV A;  4FED A;  1KA1 A;  5TPA B;  3O2A A;  2VGQ A;  3N5L A;  4MCO A;  1B1X A;  1R1N A;  4R73 A;  5J16 A;  4JSD A;  1H76 A;  2G29 A;  3DEL B;  4RJZ A;  3VVE A;  1Q1K A;  2DXY A;  1FW0 A;  3MQ9 A;  3O6G A;  1QUI A;  1IMC A;  3C32 A;  2F3D A;  4U2R A;  1EU8 A;  2X7P A;  1EYI A;  2R9J A;  3T1B A;  3PPP A;  4H65 A;  1CNQ A;  4DXB A;  2DWH A;  5I59 B;  3THI A;  2ZYO A;  3RT8 A;  1B05 A;  1MXY A;  1FBF A;  4P3L A;  5ITP A;  3T9V A;  3GXA A;  4ZDM A;  4DI3 D;  4I3E A;  5I56 B;  5JEI A;  1BTJ A;  5DEX A;  5F1Q A;  1ELJ A;  1RKM A;  2HCA A;  3U65 A;  1FPI A;  3QSL A;  4DXC A;  4E0X A;  1MY3 A;  1KA0 A;  2OCU A;  3UA8 A;  4N07 A;  4JVI A;  1K9Z A;  1OMP A;  3BFU A;  3CSB A;  1NV7 A;  2O7U A;  3TAJ A;  2Y7I A;  2DDK A;  4KCC A;  5ESY A;  4BDR A;  4QFL A;  4F1Y A;  4GWU A;  2I6E A;  3OD7 A;  4OTE A;  5ET6 A;  3A09 A;  2AYS A;  4IGT A;  5IM2 A;  2QFL A;  3UOR A;  1B5H A;  3EHT A;  1SQY A;  1BIY A;  4NWC A;  4WED A;  5LOM A;  2O1M A;  2XX7 A;  1PB9 A;  4DDD A;  1QJM A;  5CBS A;  4RNS A;  1YAE A;  1DTZ A;  4ZED A;  5IAI A;  1IQ7 A;  3H6U A;  2XXV A;  3QK6 A;  1USY H;  3B8B A;  3OEL A;  4JB7 A;  2QS1 A;  2PCR A;  2P1S A;  4X1B A;  2WBD A;  3TKD A;  2CZK A;  3CG3 A;  5DW8 A;  2UVJ A;  4JSO A;  5H8S A;  3VE1 B;  3ODB A;  1NH7 A;  2A5T A;  5I5P A;  1FQC A;  5I2K A;  4FAJ A;  1QUK A;  1URG A;  1NNT A;  4PP0 A;  3EF7 A;  1P99 A;  1JEV A;  1IIW A;  4KYE A;  5ET5 A;  5IZ3 A;  2V84 A;  5LDZ A;  4WEP A;  4H46 A;  1B40 A;  1B5I A;  3C9H A;  4OES A;  2F5X A;  3V5A A;  3H3G A;  2DSF A;  3G3H A;  1J1N A;  2XA5 A;  3TTN A;  4N6D A;  5I57 B;  3OO8 A;  2H9B A;  4G2Z A;  3IX1 A;  1IIT A;  1ZMG A;  2UYE A;  2PMS A;  2O51 A;  2R8T A;  3MP6 A;  3QUJ A;  1MH4 A;  2VT5 A;  5DEX B;  3VXB A;  4N8Y A;  4LQ2 A;  4KR5 A;  2V3Q A;  2GHA A;  3N94 A;  1I6Q A;  1QW0 A;  3FXR A;  4P1E A;  3LUZ A;  1SW4 A;  1BLF A;  3KZG A;  3LSL A;  3SEU A;  2WYK A;  3TYH A;  4TOZ A;  2DVZ A;  2H99 A;  2V93 A;  4GD5 A;  3KOT A;  1FBC A;  4BDN A;  3I3V A;  1N0T A;  3IOU A;  3H6V A;  3QYT A;  3CVG A;  2R71 A;  1ZLQ A;  5EQA A;  5LTC A;  3NOH A;  1ZU0 A;  1B5J A;  1MXZ A;  5DVF A;  3W15 C;  3H7M A;  1M5D A;  3MVZ A;  4MH5 A;  2CEY A;  1IMB A;  4LUB A;  1IMA A;  1US5 A;  2KLF A;  4PQJ A;  1SYI A;  1MQH A;  3MPK A;  2P3N A;  3TFL A;  1QUL A;  1JNF A;  2Q2A A;  3B6T A;  4RK2 A;  4GWZ A;  2H5Y A;  2Z8D A;  2Q9T A;  4F2Q A;  5TP9 A;  2F7B A;  4FIM A;  4GIZ A;  2F3B A;  4L17 A;  3IOW A;  4ZEI A;  2A5T B;  3MPL A;  1WVJ A;  5I2K B;  1B46 A;  4N13 A;  3PV0 E;  1LEV A;  4RY1 A;  1XVY A;  4JWY A;  1JVX A;  1Y4T A;  3H4Z A;  4I40 A;  3T9U A;  4KI0 E;  1N7W A;  5IZ3 B;  4JBZ A;  4YKP A;  5F24 A;  3K01 A;  3FJM A;  4U1Z A;  5BWJ A;  4PGP A;  4OFL A;  1ZIU A;  4NE4 A;  3RPL A;  1VR5 A;  2FVZ A;  4XKR A;  3KSX A;  3OXN A;  4QFN A;  4YB6 A;  4O94 A;  5DVJ A;  1P1Q A;  3VXC A;  1QKB A;  3FGS A;  5H8Q A;  3ONM A;  2QVR A;  1B7Z A;  1B1H A;  4LQ5 A;  3TUS A;  4PFT A;  4HS7 A;  4RYA A;  1TFA A;  1FBP A;  4EF2 A;  4MNI A;  1M5C A;  2WX9 A;  1JEU A;  3LC8 A;  1PC3 A;  1TWY A;  2GQ1 A;  4H5F A;  2NVU B;  1NNK A;  2ABH A;  1LFI A;  2F36 A;  3HCQ A;  4C0R A;  5CMM A;  4EQ7 A;  2OWZ A;  5JTY A;  4OWD A;  3IFC A;  3T96 B;  3O28 A;  1Z7N E;  1N04 A;  2F7A A;  1EZ9 A;  1FPG A;  3MZB A;  1DPP A;  3Q27 A;  3K6X A;  2Q88 A;  3KFM A;  3K02 A;  2O84 X;  4G4P A;  1B52 A;  2AL5 A;  2F6G A;  5EYF A;  1NH8 A;  2IA4 A;  1NKX A;  3KN7 A;  3FXQ A;  1LBZ A;  2ALU A;  4O3B A;  3LSX A;  3QUF A;  1FQB A;  1NL5 A;  2DYX A;  3UP9 A;  3OSR A;  4ESX A;  3MVW A;  4QFK A;  5ISU A;  1H45 A;  5EHS A;  1SPI A;  4GOT A;  3G3J A;  3VDF A;  5TP9 B;  4QFO A;  2RC9 A;  2HFB A;  4H8I A;  1S9T A;  4HXV A;  3G3K A;  3CIJ A;  2DQV A;  4IO2 A;  3RLF E;  3RT6 B;  1XI6 A;  1BKA A;  5DTB A;  3DP8 A;  1IXI A;  1URD A;  3FXU A;  4H1X A;  4NF4 B;  4I1D A;  4NQ8 A;  2XX9 A;  1OIB A;  3TDJ A;  3TCH A;  1MQD A;  2QVU A;  4PFW A;  5AA2 D;  4QSD A;  1NFT A;  4OVP A;  4HE1 A;  3PPR A;  3DP6 A;  3BKI B;  3PD9 A;  3RPL B;  1D4N A;  1Y1M A;  2R6G E;  4XKN A;  3ROJ A;  1SI1 A;  4F1U A;  3PUW E;  2VD2 A;  5EQ8 A;  1QKA A;  5H8Q B;  1B58 A;  3TCF A;  1YZ0 A;  4K3F A;  2IEE A;  4RPN A;  1FPB A;  4N15 A;  1B3F A;  1Y3Q A;  1A54 A;  3FVG A;  5AA1 A;  1B4Z A;  2P3V A;  3CHG A;  5B7D A;  3CG1 A;  1HSE A;  4AB5 A;  2YJP A;  3MJN A;  1EZP A;  5I2N A;  1MM6 A;  1QGX A;  3TEP A;  3E78 A;  1B3L A;  5L8D A;  2OWT A;  2V3U A;  1LCF A;  1NMU A;  1RYO A;  2DWA A;  2XXY A;  1BP5 A;  4R2F A;  4H8J A;  5EQ9 A;  4EXK A;  2P0S A;  4QRZ A;  3R26 A;  4PF6 A;  3S9L C;  2FHY A;  1GV8 A;  2CMO A;  3IOV A;  2I3V A;  1FTJ A;  2HZL A;  5I3S A;  3TCG A;  3O97 A;  1LBY A;  4PDD A;  4YB5 A;  3MP8 A;  4ELO A;  1A40 A;  1POY 1;  3GYY A;  3K6V A;  5CI5 A;  3FBP A;  2F35 A;  1SW5 A;  2VOZ A;  4PBH A;  2WEF A;  4R72 A;  3HHF A;  3HV1 A;  4LZ5 A;  1GVC A;  4GWY A;  2RCA A;  1IEJ A;  2I0C A;  2HEU A;  1FQA A;  2Y7P A;  5CMK A;  1B7H A;  3C34 A;  3FXB A;  2XXW A;  4MJO A;  1OLC A;  3BFT A;  3B6Q A;  2REJ A;  3T9H B;  3TTL A;  1MDQ A;  2DS9 A;  2XWO A;  5DVI A;  4NN3 A;  2HXW A;  1R6Z A;  1POT A;  1UIV A;  1XT8 A;  3IB2 A;  2FBP A;  4F39 A;  1RYX A;  1O64 A;  1URS A;  3PGF A;  3PD8 A;  1Y3N A;  2X26 A;  5AA3 A;  4P11 A;  3PMV A;  2ZZW A;  5HM4 B;  1LAX A;  5EHM A;  1PBQ A;  3ISP A;  1MPB A;  3EHU A;  3I5O A;  4ELQ A;  4Q8R A;  2XXT A;  4LN5 A;  3FAT A;  3C35 A;  1CB6 A;  2F7C A;  4HE2 A;  3L6H A;  3Q28 A;  2DVC A;  4HCY A;  5L9S A;  1R9L A;  1TXF A;  4GRK A;  3OSQ A;  4NWD A;  2KQZ A;  1PEB A;  3FAS A;  1MQI A;  2YLN A;  2ZNS A;  4YKJ A;  5I2N B;  2WBB A;  4AB6 A;  4O3A A;  3IOT A;  4QHQ A;  5IKB A;  1LAF E;  3E9X A;  4KFQ A;  1P1O A;  3IO6 A;  4F19 A;  5CMC A;  4R9G A;  4AS4 A;  4Z7E A;  3EKI A;  3KBR A;  4UAC A;  1LBV A;  4F3G A;  4YIC A;  4XF5 A;  3T0J A;  3IOR A;  5KCJ A;  1LB8 A;  2QPQ A;  4G8H A;  4M1V A;  3U8Q A;  4N8G A;  5J1D A;  4GXA A;  3Q26 A;  4ISU A;  3U94 A;  1P1N A;  2ONK E;  1MRP A;  4X8R A;  1AIV A;  3MVX A;  5A5X A;  2THI A;  5IZZ A;  4NF5 A;  1VDW A;  3TOD A;  2FA7 A;  2JJK A;  5HBC A;  1B7U A;  1LBW A;  4LVQ A;  4ZEF A;  2Z22 A;  3H03 A;  4YB7 A;  4YKI A;  4R6K A;  4OEV A;  1BK4 A;  1NV5 A;  3KBZ A;  1FBD A;  4DI4 B;  4H6D A;  5FBP A;  3O66 A;  2CEX A;  1JW5 A;  1MXU A;  1LAH E;  4JWX A;  5IGA A;  1Q9D A;  3MVY A;  2NXO A;  3VLU A;  1D9V A;  4QXD A;  2I49 A;  3PPQ A;  2QS4 A;  1WDN A;  2VPO A;  2HAV A;  1ZBM A;  4R75 A;  2E1S A;  3VV5 A;  3CI8 A;  2AIX A;  4ZZA A;  4GX6 A;  3K00 A;  5H8N A;  3D1R A;  4OFO A;  3KJ7 A;  2B3B A;  3LV0 A;  1FPK A;  3T93 B;  3JZJ A;  4GBW A;  4OER A;  2UVG A;  5TU0 A;  2RIN A;  1PB8 A;  5ICQ A;  2VP1 A;  1EH3 A;  3FUZ A;  3S9N C;  4X48 A;  1XHY A;  4P8B A;  3TMG A;  2AL4 A;  4AQ4 A;  1Z7M E;  3RUM A;  4DXU A;  4I8C A;  3HFU A;  5CM6 A;  2ONS A;  4KXP A;  4OVQ A;  4MAG A;  4ZEB A;  1N3X A;  5K2X A;  2V25 A;  5CMB A;  4DZ1 A;  3R7X A;  1SW2 A;  4F1V A;  4OVS A;  1I6A A;  2PX1 A;  4YU0 A;  4R6H A;  2WKY A;  3MAM A;  4EDP A;  4OHN A;  4N81 A;  3OEN A;  4IY5 A;  5A5X B;  2WYP A;  1FCK A;  4NF5 B;  4ZS9 A;  4YMB A;  2XXU A;  1FTK A;  5FHO A;  1WOD A;  2V3T A;  1FQF A;  3B6W A;  3FVO A;  1IMF A;  4N6P A;  1ZKB A;  3A3U A;  2L5V A;  1UTB A;  3PUY E;  1FBH A;  1MY1 A;  3QIM A;  1FQD A;  1US4 A;  1M5E A;  1LBC A;  2I4B A;  4IR8 A;  3FIR A;  1O63 A;  4ND9 A;  4OET A;  1A8E A;  3GZG A;  3SDF A;  1DSN A;  3C4M A;  2OBG A;  4PFY A;  4U4X A;  1II5 A;  2DE2 A;  3UGW A;  1NI9 A;  1F9B A;  2RCB A;  4YZZ A;  2PYY A;  4PC9 A;  1YTV A;  3OEM A;  3I6V A;  4G68 A;  4P56 A;  5H8N B;  1OVT A;  4JVD A;  2P2A A;  2O7I A;  3U93 A;  4GL8 A;  1B2H A;  3BBR A;  3G3G A;  4ZZE A;  4PFB A;  1NV2 A;  1B4H A;  1VSO A;  1HSJ A;  1I6B A;  1MPD A;  3OEK A;  4MMP A;  3KOS A;  4MX6 A;  3S2V A;  5CBR A;  2OJT A;  4F22 A;  3HPI A;  4O7M A;  3WAE A;  4UAB A;  4F29 A;  4OZ9 A;  1L5T A;  4GVO A;  3TTR A;  4RA1 A;  4IO5 A;  2W7Y A;  2QVV A;  1GR2 A;  3C36 A;  5H8F A;  3G7W A;  2PFY A;  1AH5 A;  1XC1 A;  2ZMB A;  2ZYM A;  1MY0 A;  5AA2 A;  1B9J A;  3KSJ A;  2V4C A;  5H8H A;  4ELP A;  1OVB A;  4IY6 A;  3PUX E;  2ANJ A;  4PFU A;  3K6W A;  1DMB A;  1FPL A;  1Q35 A;  4XKP A;  1R9Q A;  1UTB B;  4XEQ A;  4EF1 A;  1IXH A;  3IJX B;  1GTK A;  4PBQ A;  4JVC A;  1SBP A;  4POW A;  2B4M A;  1TT1 A;  2ZZV A;  2RKM A;  4PFI A;  1G0H A;  4QF9 A;  4BDQ A;  1NV3 A;  3SET A;  2DXR A;  4DCY A;  4R74 A;  1USY E;  2QL3 A;  3MST A;  1B6H A;  1ATG A;  2BJI A;  4GFR A;  1HSL A;  3G3F A;  4P1L A;  3KG2 A;  1YYZ A;  1DPE A;  5FHN A;  3BIG A;  3RN8 A;  2Z8E A;  4X9T A;  4G68 B;  2PT1 A;  4DIG A;  2YPN A;  1GGG A;  4OA4 A;  1JW4 A;  1NUY A;  1OQH A;  3M8U A;  3V83 A;  2CZI A;  2HQ0 A;  2I3W A;  1YCJ A;  3ZS6 A;  1QVS A;  2BJJ X;  1OLA A;  2F97 A;  1FPE A;  3E79 A;  2Z8F A;  2ZNT A;  4QSE A;  2Q2C A;  3MWB A;  3ZKK A;  3RQT A;  3C33 A;  2DE4 A;  3FV2 A;  3VVD A;  4G8N A;  1MXV A;  4GWS A;  5HPQ A;  4YKK A;  4NGU A;  4I3Y A;  2VHA A;  1FSA A;  3LUY A;  3SEX A;  1FTO A;  3C31 A;  5H8F B;  2NWJ A;  4UA8 A;  1H43 A;  5JTY B;  5EYG A;  2HXR A;  4IO7 A;  1B51 A;  1EZO A;  5AA2 B;  1KZ8 A;  4I62 A;  4PDH A;  2ZZX A;  5H8H B;  2B4L A;  2GRV A;  4MFI A;  3M3F A;  3DLN A;  4I9D A;  2E0S A;  1B0L A;  1FTM A;  5B70 A;  4F3S A;  5BUU A;  4OEN A;  2PBW A;  2XXI A;  1FTL A;  1LB9 A;  1D9Q A;  1VFE A;  3K6U A;  4OXV A;  5T3J A;  4PAK A;  1DOT A;  4XTC Q;  3HHG A;  4ECF A;  3CFZ A;  4PF8 A;  3M3K A;  2UVH A;  1XVX A;  1JQF A;  4BDO A;  1DK4 A;  3ECR A;  4FBP A;  4P9K A;  1Y9U A;  4C1T A;  3PU5 A;  1OQG A;  2GFE A;  1AOV A;  4JWO A;  1H44 A;  2HPG A;  1AMF A;  3HN0 A;  4F3P A;  1RDZ A;  1IXG A;  3T22 A;  1UTH A;  1N84 A;  3S9M C;  3IL1 B;  2I0B A;  1FQE A;  3KJT A;  4ZE9 A;  4IO4 A;  1NV6 A;  4GXS B;  3F11 A;  3LR1 A;  3OO6 A;  3K2D A;  4PAF A;  3IO4 A;  4GX4 A;  4NG7 A;  2FNC A;  4OVJ A;  3N26 A;  4ESW A;  3RYD A;  2HHM A;  2ZYK A;  3PUZ E;  4XKQ A;  1A99 A;  5FTI A;  2X7Q A;  3VLW A;  2F8D A;  3M3L A;  4AS5 A;  3OOA A;  4GWO A;  3SER A;  3KC1 A;  3OO7 A;  1ANF A;  3H06 B;  3PMW A;  3TZA A;  1EYJ A;  3PTY A;  1LCT A;  3SEY A;  2D5W A;  5DT6 A;  3PMX A;  1KWH A;  3ILU B;  2H4I A;  4PET A;  1UQW A;  1S7Y A;  3Q25 A;  1JW1 A;  4MIJ A;  1LBX A;  3MC2 A;  1AL3 A;  3QMF A;  3MZ1 A;  4HW8 A;  5I57 A;  3S9E A;  2CZH A;  3KGC A;  4NX1 A;  2XXX A;  4H45 A;  3AXF A;  2Q74 A;  2ESN A;  1MQG A;  4FEC A;  4PTK A;  3FVK A;  1SVX B;  1O7T A;  2XWI A;  4IB2 A;  3TPA A;  4NAP A;  4G8M A;  3PUV E;  2Y7R A;  1MPC A;  4LAT A;  1FPF A;  3LBS A;  2A5S A;  2HZK A;  1NUZ A;  3QXM A;  1YXI A;  3V8X B;  2QRY A;  2ZNU A;  4NF8 A;  4OVT A;  1FTA A;  3MP1 A;  4RK9 A;  2B3F A;  5AA4 A;  3SKP A;  3QAX A;  3IB1 A;  4P0I A;  3VLV A;  2OK2 A;  4MHF A;  5ICT A;  1UTH B;  2D3I A;  3VFJ A;  5I58 A;  1NV4 A;  1Y20 A;  1S50 A;  4OMB A;  4ZEC A;  4Q0C A;  1NV0 A;  4RXL A;  1NUX A;  4GX3 A;  1FRP A;  2F34 A;  4O7I A;  4R2B A;  4G77 A;  3T66 A;  4FEB A;  4RPO A;  4LZ7 A;  3FV1 A;  5FHM A;  1MY2 A;  5M2V A;  1B3G A;  1LAG E;  1M5F A;  3FZV A;  4PGN A;  1INP A;  2XD2 A;  4KPT A;  4O3C A;  2XD3 A;  4FOR A;  4ZE8 A;  2O1L A;  4NMY A;  2RC7 A;  1VE4 A;  1CE2 A;  1T0K A;  4IGR A;  4PCD A;  3T9X B;  2XXP A;  1JVY A;  4LON B;  4OFJ A;  3CSG A;  4DLD A;  1N3W A;  2OZZ A;  1PDA A;  3LSW A;  2XWK A;  4X1D A;  5L9O A;  3MUQ A;  4P0G A;  4BLA A;  4MBP A; 
#chains in the Genus database with same CATH homology
 3N6T A;  4NTL A;  2RF1 A;  4TLM B;  1M5B A;  1MXX A;  2Y7W A;  3V89 B;  3GLB A;  4KD5 A;  1P1U A;  4XXU A;  3K1P A;  3EHS A;  4QSC A;  4DCX A;  3EN3 A;  1I69 A;  2O69 A;  5KCJ B;  3MZ9 A;  2Y7K A;  5AE4 A;  3IK6 B;  2VD3 A;  4LZ8 A;  1MM7 A;  4E0W A;  1B0H A;  3KN3 A;  4BDM A;  2O68 A;  5KDT A;  3FD3 A;  1MXW A;  3CR9 A;  3P7I A;  2O6A A;  4NF8 B;  4OQO A;  3TQL A;  4WKM A;  3TEL A;  3VVF A;  5AA4 B;  2Y84 A;  4F31 B;  3W9W A;  4MF3 A;  2XXH A;  2Q8J A;  4DE8 A;  3EQ1 A;  4GLI A;  4ZEK A;  3E3K A;  1IUD A;  2UYF A;  3KN8 A;  3RY3 A;  4F3B A;  5I58 B;  1LBB A;  2UXA A;  3OMB A;  3IJO B;  1Y4C A;  1A55 A;  1LGB C;  4GL0 A;  1IZ1 A;  1D9Y A;  2DWJ A;  4R9F A;  2QJE A;  3TTK A;  3O6I A;  2ZYN A;  1XOC A;  4U1O A;  3DP4 A;  2GHB A;  3H6T A;  2QSX A;  3FVN A;  1PB7 A;  3UIF A;  2XXQ A;  4FJP A;  3OO9 A;  3SEW A;  2I4C A;  2I58 A;  1XS5 A;  2PT2 A;  2DE3 A;  3U92 A;  3CRB A;  3JV9 A;  4ELR A;  3E4R A;  4NF4 A;  3CFL A;  5JK4 A;  4H0W A;  3CFX A;  3U1O A;  2LAO A;  3EPE A;  3U72 A;  1TFD A;  4IO6 A;  1P1W A;  5K2Y A;  4EUO A;  5L9M A;  3TTM A;  3H6W A;  2B65 A;  4HCW A;  4Q5T A;  3UN6 A;  2NUV A;  4ONY A;  4THI A;  2QS3 A;  4FAT A;  2NOO A;  4MLQ A;  3Q29 A;  2QMW A;  1Y3P A;  3LSF B;  3B7D A;  3GBA A;  4BDL A;  2RC8 A;  3PPO A;  4GQO A;  3K4U A;  5KDT B;  5KZT A;  4QFP A;  2Z23 A;  4YMA A;  1MQJ A;  1B3H A;  1N7X A;  4TQU Q;  5CRY A;  5ITO A;  4HTG A;  1H3D A;  1NNP A;  3W9V A;  3KEI A;  5F7V A;  4KYD A;  4U21 A;  4U4S A;  2OWS A;  4LP2 B;  1B3E A;  4KHZ E;  2M8C A;  2XHD A;  5I84 A;  1ZJL A;  3ILT B;  3RGY A;  2DWI A;  3DM0 A;  4TLL B;  4R6Y A;  2F78 A;  4M4G A;  3L6G A;  1Y1Z A;  4Z0I A;  1NNF A;  4YAH X;  3K0V A;  1B32 A;  3S4U A;  2CZL A;  5CC2 A;  3A3C A;  2OLB A;  3K1M A;  2F6P A;  1MS7 A;  3TQW A;  1SD3 A;  4JXI A;  4NF6 A;  2XX8 A;  4U23 A;  4FE8 A;  4KYS A;  3RTF B;  4IO3 A;  3FJG A;  4GF8 A;  2FYI A;  5ELV A;  2G93 A;  3JYR A;  3K1N A;  3RPW A;  2H98 A;  1LFH A;  4EXL A;  1MH3 A;  2Q89 A;  4F2O A;  2I48 A;  2D21 A;  5TPA A;  4PE5 B;  4POX A;  1SI0 A;  5DYH A;  2REG A;  3USD A;  3RTW B;  2UVI A;  3HO7 A;  3D4G A;  2PVU A;  3IB0 A;  4WXJ A;  3HST A;  1LLS A;  3G3I A;  4OYV A;  1DTG A;  2ONR A;  3E13 X;  1D3K A;  3SEV A;  4JDF A;  4F18 A;  2QMX A;  3IAZ A;  1VFD A;  1LST A;  4G68 C;  4H67 A;  4OEU A;  3O29 A;  5I59 A;  3MBP A;  1MG1 A;  2ZXT A;  4KQP A;  1MDP 1;  1PBP A;  2DOJ A;  3GBB A;  4LA9 A;  1N76 A;  2GH9 A;  3MW0 A;  1SW1 A;  2QS2 A;  4XIG Q;  5I56 A;  3FJ7 A;  4U22 A;  4C1U A;  2DP8 A;  1JET A;  3O6H A;  3RNN A;  1MY4 A;  4EQB A;  3UK4 A;  2XXR A;  1IXC A;  3N6U A;  3SES A;  2HAU A;  1QUJ A;  1SDX A;  1UIU A;  1A7L A;  4NF6 B;  5FTH A;  4KCD A;  1ZTY A;  3PPN A;  4H5G A;  1LFG A;  1SYH A;  2H25 A;  3IR1 A;  1A8F A;  3ZSF A;  3R6U A;  1YPN A;  3ZKL A;  4NED A;  3O9P A;  3WAF A;  3D4C A;  4EQ9 A;  4Q30 B;  4MLV A;  4FED A;  5TPA B;  3O2A A;  2VGQ A;  3N5L A;  1B1X A;  1R1N A;  4R73 A;  4JSD A;  1H76 A;  2G29 A;  3DEL B;  4RJZ A;  3VVE A;  1Q1K A;  2DXY A;  1FW0 A;  3MQ9 A;  3O6G A;  1QUI A;  3C32 A;  4U2R A;  1EU8 A;  2X7P A;  2R9J A;  3PPP A;  4H65 A;  4DXB A;  2DWH A;  5I59 B;  3THI A;  2ZYO A;  3RT8 A;  1B05 A;  1MXY A;  5ITP A;  3T9V A;  3GXA A;  4ZDM A;  5I56 B;  5JEI A;  1BTJ A;  5DEX A;  5F1Q A;  1ELJ A;  1RKM A;  2HCA A;  3QSL A;  4DXC A;  4E0X A;  1MY3 A;  2OCU A;  3UA8 A;  4N07 A;  1OMP A;  3BFU A;  3CSB A;  2O7U A;  3TAJ A;  2Y7I A;  4KCC A;  4BDR A;  4QFL A;  4F1Y A;  2I6E A;  3OD7 A;  4OTE A;  3A09 A;  2AYS A;  4IGT A;  3UOR A;  1B5H A;  3EHT A;  1SQY A;  1BIY A;  4NWC A;  4WED A;  5LOM A;  2O1M A;  2XX7 A;  1PB9 A;  4DDD A;  1QJM A;  5CBS A;  4RNS A;  1YAE A;  1DTZ A;  4ZED A;  5IAI A;  1IQ7 A;  3H6U A;  2XXV A;  3QK6 A;  1USY H;  3OEL A;  4JB7 A;  2QS1 A;  2P1S A;  4X1B A;  3TKD A;  3CG3 A;  2UVJ A;  4JSO A;  5H8S A;  3VE1 B;  3ODB A;  1NH7 A;  2A5T A;  1FQC A;  5I2K A;  4FAJ A;  1QUK A;  1URG A;  1NNT A;  4PP0 A;  3EF7 A;  1P99 A;  1JEV A;  1IIW A;  4KYE A;  2V84 A;  4WEP A;  1B40 A;  1B5I A;  3C9H A;  4OES A;  2F5X A;  3V5A A;  3H3G A;  2DSF A;  3G3H A;  1J1N A;  3TTN A;  5I57 B;  3OO8 A;  2H9B A;  4G2Z A;  3IX1 A;  1IIT A;  1ZMG A;  2UYE A;  2PMS A;  2O51 A;  3MP6 A;  3QUJ A;  1MH4 A;  5DEX B;  3VXB A;  4LQ2 A;  4KR5 A;  2V3Q A;  2GHA A;  3N94 A;  1I6Q A;  1QW0 A;  3FXR A;  1SW4 A;  1BLF A;  3KZG A;  3LSL A;  3SEU A;  3TYH A;  4TOZ A;  2DVZ A;  2H99 A;  2V93 A;  4GD5 A;  3KOT A;  4BDN A;  3I3V A;  1N0T A;  3IOU A;  3H6V A;  3QYT A;  3CVG A;  2R71 A;  1ZLQ A;  1ZU0 A;  1B5J A;  1MXZ A;  5DVF A;  3W15 C;  3H7M A;  1M5D A;  3MVZ A;  4MH5 A;  4LUB A;  1US5 A;  2KLF A;  4PQJ A;  1SYI A;  1MQH A;  3MPK A;  3TFL A;  1QUL A;  1JNF A;  2Q2A A;  3B6T A;  4RK2 A;  2H5Y A;  2Z8D A;  2Q9T A;  4F2Q A;  5TP9 A;  2F7B A;  4FIM A;  4GIZ A;  4L17 A;  3IOW A;  4ZEI A;  2A5T B;  3MPL A;  1WVJ A;  5I2K B;  1B46 A;  4N13 A;  3PV0 E;  4RY1 A;  1XVY A;  4JWY A;  1JVX A;  1Y4T A;  3H4Z A;  3T9U A;  4KI0 E;  1N7W A;  4JBZ A;  4YKP A;  3K01 A;  3FJM A;  4U1Z A;  5BWJ A;  4OFL A;  1ZIU A;  4NE4 A;  1VR5 A;  4XKR A;  3KSX A;  3OXN A;  4QFN A;  4YB6 A;  5DVJ A;  1P1Q A;  3VXC A;  1QKB A;  3FGS A;  5H8Q A;  3ONM A;  1B7Z A;  1B1H A;  4LQ5 A;  3TUS A;  4PFT A;  4HS7 A;  4RYA A;  1TFA A;  4EF2 A;  1M5C A;  1JEU A;  3LC8 A;  1PC3 A;  1TWY A;  4H5F A;  2NVU B;  1NNK A;  2ABH A;  1LFI A;  2F36 A;  3HCQ A;  4C0R A;  5CMM A;  4EQ7 A;  5JTY A;  4OWD A;  3T96 B;  3O28 A;  1Z7N E;  1N04 A;  2F7A A;  1EZ9 A;  3MZB A;  1DPP A;  3Q27 A;  3K6X A;  2Q88 A;  3KFM A;  3K02 A;  2O84 X;  4G4P A;  1B52 A;  2AL5 A;  2F6G A;  5EYF A;  1NH8 A;  2IA4 A;  1NKX A;  3KN7 A;  3FXQ A;  2ALU A;  4O3B A;  3LSX A;  3QUF A;  1FQB A;  1NL5 A;  2DYX A;  3UP9 A;  3OSR A;  4ESX A;  3MVW A;  4QFK A;  5ISU A;  1H45 A;  5EHS A;  4GOT A;  3G3J A;  3VDF A;  5TP9 B;  4QFO A;  2RC9 A;  2HFB A;  4H8I A;  1S9T A;  3G3K A;  3CIJ A;  2DQV A;  4IO2 A;  3RLF E;  3RT6 B;  1BKA A;  5DTB A;  3DP8 A;  1IXI A;  1URD A;  3FXU A;  4H1X A;  4NF4 B;  4I1D A;  2XX9 A;  1OIB A;  3TDJ A;  3TCH A;  1MQD A;  4PFW A;  5AA2 D;  4QSD A;  1NFT A;  3PPR A;  3DP6 A;  3BKI B;  3PD9 A;  1D4N A;  1Y1M A;  2R6G E;  4XKN A;  1SI1 A;  4F1U A;  3PUW E;  2VD2 A;  1QKA A;  5H8Q B;  1B58 A;  3TCF A;  4K3F A;  2IEE A;  4RPN A;  1B3F A;  1Y3Q A;  1A54 A;  3FVG A;  5AA1 A;  1B4Z A;  5B7D A;  3CG1 A;  1HSE A;  4AB5 A;  2YJP A;  3MJN A;  1EZP A;  5I2N A;  1MM6 A;  3TEP A;  1B3L A;  5L8D A;  2OWT A;  2V3U A;  1LCF A;  1NMU A;  1RYO A;  2DWA A;  2XXY A;  1BP5 A;  4R2F A;  4H8J A;  4EXK A;  2P0S A;  4QRZ A;  3R26 A;  3S9L C;  1GV8 A;  2CMO A;  3IOV A;  2I3V A;  1FTJ A;  2HZL A;  3TCG A;  3O97 A;  4YB5 A;  3MP8 A;  4ELO A;  1A40 A;  1POY 1;  3K6V A;  5CI5 A;  2F35 A;  1SW5 A;  2VOZ A;  4R72 A;  3HHF A;  3HV1 A;  4LZ5 A;  1GVC A;  2RCA A;  1IEJ A;  2I0C A;  2HEU A;  1FQA A;  2Y7P A;  5CMK A;  1B7H A;  3C34 A;  2XXW A;  1OLC A;  3BFT A;  3B6Q A;  2REJ A;  3T9H B;  3TTL A;  1MDQ A;  2DS9 A;  5DVI A;  2HXW A;  1R6Z A;  1POT A;  1XT8 A;  1UIV A;  3IB2 A;  4F39 A;  1RYX A;  1O64 A;  1URS A;  3PGF A;  3PD8 A;  1Y3N A;  2X26 A;  5AA3 A;  4P11 A;  3PMV A;  5HM4 B;  1LAX A;  5EHM A;  1PBQ A;  1MPB A;  3EHU A;  3I5O A;  4ELQ A;  4Q8R A;  2XXT A;  3FAT A;  3C35 A;  1CB6 A;  2F7C A;  3L6H A;  3Q28 A;  2DVC A;  4HCY A;  5L9S A;  1R9L A;  1TXF A;  4GRK A;  3OSQ A;  4NWD A;  1PEB A;  3FAS A;  1MQI A;  2YLN A;  2ZNS A;  4YKJ A;  5I2N B;  4AB6 A;  4O3A A;  3IOT A;  4QHQ A;  5IKB A;  1LAF E;  3E9X A;  4KFQ A;  1P1O A;  3IO6 A;  4F19 A;  5CMC A;  4R9G A;  4Z7E A;  3KBR A;  4UAC A;  4F3G A;  4YIC A;  3IOR A;  5KCJ A;  1LB8 A;  2QPQ A;  4G8H A;  4M1V A;  3U8Q A;  5J1D A;  4GXA A;  3Q26 A;  4ISU A;  3U94 A;  1P1N A;  2ONK E;  1MRP A;  1AIV A;  3MVX A;  5A5X A;  2THI A;  4NF5 A;  3TOD A;  2FA7 A;  5HBC A;  1B7U A;  4LVQ A;  4ZEF A;  2Z22 A;  3H03 A;  4YB7 A;  4YKI A;  4R6K A;  4OEV A;  4H6D A;  3O66 A;  1JW5 A;  1MXU A;  1LAH E;  4JWX A;  3MVY A;  2NXO A;  3VLU A;  1D9V A;  2I49 A;  3PPQ A;  2QS4 A;  1WDN A;  2HAV A;  1ZBM A;  4R75 A;  2E1S A;  3VV5 A;  3CI8 A;  2AIX A;  4ZZA A;  3K00 A;  5H8N A;  4OFO A;  3KJ7 A;  2B3B A;  3T93 B;  3JZJ A;  4OER A;  2UVG A;  5TU0 A;  2RIN A;  1PB8 A;  5ICQ A;  2VP1 A;  1EH3 A;  3FUZ A;  3S9N C;  4X48 A;  1XHY A;  3TMG A;  2AL4 A;  4AQ4 A;  1Z7M E;  3RUM A;  4DXU A;  4I8C A;  5CM6 A;  2ONS A;  4ZEB A;  1N3X A;  5K2X A;  2V25 A;  5CMB A;  4DZ1 A;  3R7X A;  1SW2 A;  4F1V A;  1I6A A;  2PX1 A;  4YU0 A;  2WKY A;  3MAM A;  4R6H A;  4EDP A;  4OHN A;  3OEN A;  4IY5 A;  5A5X B;  1FCK A;  4NF5 B;  4ZS9 A;  4YMB A;  2XXU A;  1FTK A;  5FHO A;  1WOD A;  2V3T A;  1FQF A;  3B6W A;  3FVO A;  4N6P A;  1ZKB A;  3A3U A;  1UTB A;  3PUY E;  1MY1 A;  3QIM A;  1FQD A;  1US4 A;  1M5E A;  1LBC A;  2I4B A;  3FIR A;  1O63 A;  4ND9 A;  4OET A;  1A8E A;  3GZG A;  3SDF A;  1DSN A;  3C4M A;  2OBG A;  4PFY A;  4U4X A;  1II5 A;  2DE2 A;  3UGW A;  1F9B A;  2RCB A;  4YZZ A;  2PYY A;  1YTV A;  3OEM A;  3I6V A;  4G68 A;  5H8N B;  1OVT A;  2P2A A;  2O7I A;  3U93 A;  4GL8 A;  1B2H A;  3BBR A;  3G3G A;  4ZZE A;  1B4H A;  1VSO A;  1HSJ A;  1I6B A;  1MPD A;  3OEK A;  3KOS A;  3S2V A;  5CBR A;  2OJT A;  4F22 A;  3HPI A;  3WAE A;  4F29 A;  4OZ9 A;  1L5T A;  4GVO A;  3TTR A;  4RA1 A;  4IO5 A;  2W7Y A;  1GR2 A;  3C36 A;  5H8F A;  3G7W A;  1AH5 A;  1XC1 A;  2ZMB A;  2ZYM A;  1MY0 A;  5AA2 A;  1B9J A;  3KSJ A;  5H8H A;  4ELP A;  1OVB A;  4IY6 A;  3PUX E;  2ANJ A;  4PFU A;  3K6W A;  1DMB A;  1Q35 A;  4XKP A;  1R9Q A;  1UTB B;  4EF1 A;  1IXH A;  3IJX B;  1GTK A;  1SBP A;  4POW A;  1TT1 A;  2RKM A;  4QF9 A;  4BDQ A;  3SET A;  2DXR A;  4DCY A;  4R74 A;  1USY E;  2QL3 A;  1B6H A;  1ATG A;  4GFR A;  1HSL A;  3G3F A;  3KG2 A;  1DPE A;  5FHN A;  3RN8 A;  2Z8E A;  4X9T A;  4G68 B;  2PT1 A;  4DIG A;  2YPN A;  1GGG A;  1JW4 A;  1OQH A;  3M8U A;  3V83 A;  2HQ0 A;  2I3W A;  1YCJ A;  3ZS6 A;  1QVS A;  2BJJ X;  1OLA A;  2F97 A;  2Z8F A;  2ZNT A;  4QSE A;  2Q2C A;  3MWB A;  3ZKK A;  3RQT A;  3C33 A;  2DE4 A;  3FV2 A;  3VVD A;  4G8N A;  1MXV A;  5HPQ A;  4YKK A;  2VHA A;  3LUY A;  3SEX A;  1FTO A;  3C31 A;  5H8F B;  2NWJ A;  4UA8 A;  1H43 A;  5JTY B;  4IO7 A;  1B51 A;  1EZO A;  5AA2 B;  4I62 A;  5H8H B;  2GRV A;  4MFI A;  3M3F A;  3DLN A;  4I9D A;  2E0S A;  1B0L A;  1FTM A;  5B70 A;  4F3S A;  5BUU A;  4OEN A;  2PBW A;  2XXI A;  1FTL A;  1LB9 A;  1VFE A;  3K6U A;  4OXV A;  1DOT A;  4XTC Q;  3HHG A;  4ECF A;  3CFZ A;  3M3K A;  2UVH A;  1XVX A;  1JQF A;  4BDO A;  3ECR A;  1Y9U A;  4C1T A;  3PU5 A;  1OQG A;  2GFE A;  1AOV A;  4JWO A;  1H44 A;  1AMF A;  3HN0 A;  4F3P A;  3T22 A;  1IXG A;  1UTH A;  1N84 A;  3S9M C;  3IL1 B;  2I0B A;  1FQE A;  3KJT A;  4ZE9 A;  4IO4 A;  4GXS B;  3F11 A;  3LR1 A;  3OO6 A;  3K2D A;  3IO4 A;  2FNC A;  4OVJ A;  3N26 A;  4ESW A;  2ZYK A;  3PUZ E;  4XKQ A;  1A99 A;  5FTI A;  2X7Q A;  3VLW A;  2F8D A;  3M3L A;  3OOA A;  4GWO A;  3SER A;  3OO7 A;  1ANF A;  3H06 B;  3PMW A;  3TZA A;  1LCT A;  3SEY A;  2D5W A;  5DT6 A;  3PMX A;  1KWH A;  3ILU B;  2H4I A;  4PET A;  1UQW A;  1S7Y A;  1JW1 A;  3Q25 A;  3MC2 A;  1AL3 A;  3MZ1 A;  4HW8 A;  5I57 A;  3S9E A;  3KGC A;  2XXX A;  3AXF A;  2ESN A;  1MQG A;  4FEC A;  3FVK A;  1SVX B;  1O7T A;  4IB2 A;  3TPA A;  4G8M A;  3PUV E;  2Y7R A;  1MPC A;  4LAT A;  3LBS A;  2A5S A;  2HZK A;  3QXM A;  3V8X B;  2QRY A;  2ZNU A;  4NF8 A;  3MP1 A;  4RK9 A;  2B3F A;  5AA4 A;  3SKP A;  3QAX A;  3IB1 A;  4P0I A;  3VLV A;  2OK2 A;  5ICT A;  1UTH B;  2D3I A;  3VFJ A;  5I58 A;  1Y20 A;  1S50 A;  4OMB A;  4ZEC A;  4Q0C A;  4RXL A;  2F34 A;  4R2B A;  4G77 A;  3T66 A;  4FEB A;  4RPO A;  4LZ7 A;  3FV1 A;  5FHM A;  1MY2 A;  5M2V A;  1B3G A;  1LAG E;  1M5F A;  3FZV A;  2XD2 A;  4KPT A;  4O3C A;  2XD3 A;  4FOR A;  4ZE8 A;  2O1L A;  4NMY A;  2RC7 A;  1VE4 A;  1CE2 A;  1T0K A;  4IGR A;  3T9X B;  2XXP A;  1JVY A;  4LON B;  4OFJ A;  3CSG A;  4DLD A;  1N3W A;  2OZZ A;  1PDA A;  3LSW A;  4X1D A;  5L9O A;  3MUQ A;  4P0G A;  4BLA A;  4MBP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...