4P0GA

Crystal structure of mltf from pseudomonas aeruginosa complexed with bulgecin and muropeptide
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
molecule keywords Membrane-bound lytic murein transglycosylase F
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA02
2D5WA 2I4CA 2P0SA 4YICA 1L5TA 5I56A 3TQLA 5CMBA 5H8SA 1UTBB 5EHMA 4F1YA 2ANJA 2DWHA 4MBPA 4ZEDA 2B3FA 4KYSA 3O28A 2YJPA 2XXRA 4RJZA 5EYFA 3VE1B 5H8FB 2XXIA 2OK2A 3ILUB 3O66A 4OZ9A 4UA8A 3ZSFA 2UYFA 4F1VA 2I0CA 4U4SA 1TWYA 1H45A 1LAHE 2V25A 3KN7A 2NWJA 1FTJA 4YB7A 5TPAA 3FD3A 1B3GA 2OLBA 1P1NA 1IXGA 2RC7A 3G3IA 3JV9A 4ZZAA 2Z23A 5FHNA 3RT8A 2G93A 1B2HA 4KPTA 3SEUA 2UVJA 3B6WA 3MVYA 3MZ9A 4GQOA 4H5GA 1QUKA 2NUVA 2PVUA 1URDA 3RT6B 3SEYA 5AA4B 3S2VA 3T93B 2V3QA 1LFGA 2F6PA 2FYIA 3LSWA 1B7UA 4F3GA 4ZEFA 1LFHA 1UIVA 4FEDA 3K6VA 1MDP1 1MY0A 3ODBA 4U23A 4EQBA 4FEBA 4FAJA 3KSJA 1LCTA 1FQDA 2QS3A 3G3GA 3O6IA 1B5JA 3OSQA 2Z22A 3FUZA 3MP1A 4QSDA 3GBBA 4R2FA 3LUYA 3HHFA 2DE4A 2O7UA 1FQAA 4OWDA 4R75A 3WAEA 3ZKKA 4DIGA 2NOOA 2F34A 2PMSA 5LOMA 2DE3A 2Y7IA 1BIYA 3DLNA 2Q2CA 4GL8A 2AL4A 1ZU0A 1NFTA 2Y7WA 3C4MA 1N04A 3PMVA 3IOVA 5ISUA 2G29A 2QS1A 1ELJA 1B0HA 1FTOA 1MQDA 3EQ1A 4ND9A 3EN3A 5I2NB 3MVXA 1P1WA 2H5YA 3OD7A 1SBPA 4G8MA 3S4UA 3VVFA 5I59B 2OCUA 3WAFA 4DXUA 3IL1B 1N7XA 4NWDA 4O3BA 3PPRA 4Q30B 2I3WA 3D4GA 1P99A 2DOJA 4LQ5A 1SW5A 2ONSA 1B1XA 3C36A 2UVHA 3K00A 1FTMA 4IO4A 5HM4B 5IKBA 3RY3A 1BP5A 1TXFA 1SI1A 1URGA 2R6GE 3CG3A 1NNPA 4H65A 4PFYA 4F19A 3U92A 4OYVA 4DDDA 4QSCA 1ZMGA 4WEPA 2Y84A 3UA8A 1LFIA 4EXKA 4OERA 2DP8A 4AQ4A 5B70A 1MQHA 4RPNA 2GHAA 4DLDA 4EDPA 3K01A 1B4ZA 4G68A 2KLFA 2Z8DA 3CI8A 3UN6A 1MG1A 3BFTA 3QXMA 5CBSA 4KI0E 2Q8JA 1US4A 2I48A 3K6UA 2RC9A 3T9VA 3TDJA 5AA4A 1DPEA 3TQWA 4BLAA 3QYTA 2A5TB 1SW2A 4H1XA 1USYE 1MXYA 4DCXA 4H8IA 1B3FA 2B65A 1NL5A 4FORA 4JXIA 4N6PA 5CMKA 4UACA 4RA1A 3IJXB 5KZTA 3HO7A 3SEWA 2REJA 1FQCA 4LONB 1T0KA 3MP8A 1B0LA 3EHTA 1QKBA 3K6WA 1JEUA 3KN3A 3KFMA 1I6AA 3SKPA 1N76A 1CB6A 2H25A 2AYSA 3IAZA 2QRYA 3G7WA 3U72A 3VV5A 1DOTA 4OXVA 4NF6A 2HFBA 5TP9B 1B5IA 2A5TA 4E0XA 3S9NC 1NNFA 2HQ0A 1UTBA 1JW4A 4I1DA 3TTLA 4U1ZA 4FECA 1FW0A 4I8CA 3T9UA 2O68A 5H8NA 5CM6A 1P1UA 4DXCA 1ZLQA 4PQJA 3R7XA 3K0VA 4R6KA 5KCJA 3VLWA 4GVOA 4JSOA 3FV2A 3K2DA 4LZ5A 3HN0A 2DQVA 3KSXA 2PYYA 5I57A 1AL3A 3GXAA 2H99A 1II5A 3DM0A 1A8FA 4TQUQ 3TELA 3VFJA 2Z8EA 2OBGA 5M2VA 3TAJA 1B3LA 3TFLA 5DYHA 1SW4A 3E9XA 5L9MA 2I58A 1I6BA 2R9JA 3MUQA 2Z8FA 3QSLA 4X1BA 1N3XA 5I59A 4QFLA 2XX7A 3C32A 1ZTYA 3KG2A 4HCYA 1URSA 4IGRA 3TCFA 3L6HA 3IJOB 3VVDA 1CE2A 3IB1A 4KCCA 3MPLA 2I0BA 4BDLA 1BLFA 3TMGA 1B4HA 4OFOA 5KDTB 2XXTA 4PFTA 1SI0A 3E13X 5CBRA 5JEIA 1B3HA 3N5LA 3K1PA 1B32A 1PBPA 1LAXA 2XXYA 3KJ7A 2QJEA 3OSRA 1SQYA 1F9BA 4H6DA 4U22A 1LB9A 2VD3A 3R26A 4H8JA 4P0GA 1GV8A 4OFJA 1OMPA 1KWHA 1R9QA 3H6UA 3S9EA 1B6HA 1XVYA 2PX1A 4WKMA 4ZEBA 4R6YA 4ESXA 3F11A 2V84A 1NH8A 3ECRA 4Q5TA 3VVEA 3HHGA 3MZBA 1MY2A 1H44A 4QFOA 4F3SA 4F31B 3O6GA 1FQEA 1XHYA 3EPEA 4KQPA 5I84A 3IB0A 3KJTA 4POXA 1B05A 1Y9UA 1LGBC 3EF7A 3FXUA 4G2ZA 2XX8A 2PT2A 5DTBA 2ZMBA 3BKIB 3N94A 3CSBA 3FASA 1SW1A 2OZZA 1LB8A 4JWXA 4U4XA 5TPAB 4JWYA 4HTGA 1MXVA 3RNNA 1MH4A 2XXWA 1LAFE 2GFEA 4BDMA 3OEKA 3OO8A 1B5HA 5H8FA 4ZE8A 4YMAA 2AIXA 4C1TA 4LATA 4XTCQ 5HBCA 3GZGA 1TT1A 3MQ9A 3T9XB 5ICQA 4OHNA 4G8NA 2IEEA 5FTHA 2O6AA 3VLVA 2X7PA 2QL3A 3TUSA 2UVIA 3H6TA 1GTKA 1A8EA 1UTHA 3Q27A 3A3UA 3M3LA 3OENA 2W7YA 1HSLA 3LC8A 3ONMA 2HEUA 4ELRA 5BUUA 2LAOA 4IB2A 4IO6A 3U93A 4ELQA 1IEJA 5DVJA 5B7DA 5TU0A 2GRVA 5AA2D 4U2RA 4P0IA 3V83A 1PC3A 3OXNA 1SD3A 3U94A 3V89B 4IGTA 4JDFA 2AL5A 4LUBA 4OENA 1GGGA 1OQGA 1SVXB 1LBBA 1VFEA 3G3HA 1LBCA 1M5EA 3C31A 4NF5B 4R74A 4BDQA 1VE4A 5FHOA 1FCKA 5I58B 1ATGA 2BJJX 3H03A 5I2KA 5H8QB 1XOCA 1SYIA 4IO2A 4JB7A 1D9YA 1UIUA 1XC1A 3DP8A 4NF8A 4OESA 4BDNA 5KCJB 1ZIUA 4NE4A 3THIA 3QUFA 1Y1MA 2GHBA 1IZ1A 4OVJA 1ZKBA 3OO6A 4PE5B 5CMCA 2RCAA 5HPQA 1OLAA 2HZLA 3M3FA 3KBRA 3V8XB 3IK6B 3DELB 4RXLA 5CI5A 4ELOA 2XXXA 1N7WA 1M5CA 2D3IA 4FE8A 4OTEA 3PPQA 3RTFB 4NWCA 4KYEA 3I5OA 2DVCA 1A54A 4XKPA 5F1QA 5JTYB 4O3AA 3O97A 3OO9A 2ZYMA 3K1NA 3B6TA 5J1DA 3MW0A 4GLIA 3SETA 2QS4A 4NF4A 1JVYA 2XXVA 1JETA 2H9BA 1IXIA 3BBRA 3O2AA 3OO7A 4GFRA 2F6GA 1PEBA 1EU8A 3RPWA 1MH3A 3VLUA 2Q88A 1ANFA 2R71A 1O7TA 3W9VA 1BTJA 1Y1ZA 1N0TA 1UQWA 3HCQA 4QFNA 4RK2A 4RPOA 3SDFA 1FQFA 3QIMA 4G8HA 1OIBA 3Q25A 4RY1A 4YKIA 4G4PA 2YPNA 5ELVA 1IQ7A 1J1NA 4H0WA 2I6EA 4KYDA 1PB7A 2F7AA 2UXAA 2V3TA 1R1NA 2XHDA 3E4RA 3N26A 3PUVE 4LZ8A 1GVCA 1R9LA 4XIGQ 5ITPA 4OQOA 4KD5A 4C0RA 2Q89A 1MQJA 3MVWA 3PPOA 4E0WA 5JTYA 1A55A 3VDFA 1NNKA 2XXUA 5A5XB 3DP6A 3QUJA 1D4NA 2RCBA 4QF9A 4THIA 1TFAA 2Q2AA 4LVQA 3IR1A 3FATA 4H5FA 1MXUA 4Q0CA 2ESNA 1QW0A 2RINA 3MPKA 4YB5A 4C1UA 2ZYKA 4QSEA 1EZ9A 1NH7A 3H6VA 4RNSA 4YKPA 1OVBA 2WKYA 5H8QA 5H8HA 4HCWA 3W9WA 2H98A 3H3GA 3HPIA 3OELA 3PV0E 4JSDA 2XXQA 4L17A 4ONYA 5AA2A 4EXLA 3FV1A 3KN8A 4PFWA 4POWA 3TCGA 4U1OA 1B52A 2FA7A 1A99A 3MP6A 1JEVA 1RKMA 3SESA 1S50A 1B51A 5H8HB 1YAEA 4GD5A 3TKDA 1LLSA 1RYXA 3M3KA 2D21A 4IY5A 1DTGA 3K1MA 4NTLA 1Z7ME 4QHQA 2ZNUA 3TTRA 2I4BA 2QMWA 5K2YA 1MXWA 1JNFA 1QUIA 3QK6A 4EQ9A 3FZVA 5AE4A 4H67A 1O63A 2Y7RA 3ILTB 3PUZE 1YPNA 4ISUA 4DXBA 3CR9A 4Z7EA 4F3PA 1WVJA 2V93A 3PD9A 4MLQA 4ESWA 3KEIA 3A09A 3C33A 4R73A 1FQBA 4KFQA 3FXRA 1QVSA 2VHAA 5FHMA 4WXJA 2RF1A 3IORA 4TLLB 2ZNSA 2I3VA 4RK9A 1QKAA 2H4IA 3Q26A 4TOZA 1VR5A 3PGFA 4HW8A 1MQGA 2IA4A 5F7VA 1JVXA 3MJNA 4F39A 2B3BA 3MBPA 4DCYA 3TZAA 3CFZA 4F2QA 1H3DA 3H4ZA 2DWJA 2F35A 3TYHA 1AMFA 4ELPA 1DTZA 3IO4A 3MZ1A 1D3KA 4NF4B 1NNTA 3CIJA 4IY6A 3SERA 4EUOA 1VFDA 3H7MA 1RYOA 4OEUA 4LP2B 5AA2B 5DEXB 3KGCA 5ICTA 3PUWE 4FJPA 4YKKA 3RGYA 1QUJA 4R72A 4YMBA 2VGQA 4PFUA 3ZS6A 1M5DA 3IB2A 1NMUA 1XT8A 4YAHX 3MVZA 1XS5A 3PU5A 2X26A 4XKQA 1D9VA 2F7CA 2Q9TA 4ZEKA 4O3CA 3FVNA 3T22A 1NKXA 1MY4A 1PBQA 1QULA 1JQFA 2DS9A 2F78A 2NXOA 1IIWA 2XXHA 1Q1KA 3CVGA 3KOTA 2I49A 4NMYA 4QRZA 3TODA 3ZKLA 5A5XA 2PBWA 4GIZA 4I9DA 1B58A 4R9GA 3Q28A 5I2KB 1PB8A 1YTVA 3B7DA 4ZEIA 3H06B 1JW1A 1N3WA 3PMXA 5DEXA 2VD2A 3TTMA 4ECFA 1ZJLA 3MAMA 5I58A 1FTKA 3OOAA 2A5SA 3TEPA 2DXYA 4LQ2A 1MM7A 4QFKA 3VXCA 3T96B 1H43A 1LAGE 2VOZA 1LSTA 4DE8A 2ABHA 1MRPA 3K6XA 2HXWA 4TLMB 5BWJA 4AB6A 1EZOA 4FIMA 4ZS9A 4OMBA 5CMMA 3RLFE 1EZPA 5L9SA 2GH9A 1MPBA 3E3KA 4BDOA 3O6HA 4M1VA 2RKMA 2XD2A 2XD3A 4PP0A 5CRYA 5EHSA 3JZJA 3TPAA 3UK4A 5H8NB 1IUDA 3G3KA 3D4CA 1MXXA 4OFLA 4X9TA 3C9HA 1I6QA 2Y7PA 3AXFA 3B6QA 4XXUA 4GXAA 4ZZEA 1UTHB 3R6UA 4IO3A 2P1SA 2O1LA 1EH3A 3I3VA 1GR2A 3K02A 4OETA 4XKRA 1IXCA 1Y3NA 4BDRA 4R2BA 4M4GA 3CFXA 3MC2A 4MH5A 1R6ZA 2PT1A 4OEVA 1MDQA 3FJGA 4R6HA 5DVFA 5ITOA 2NVUB 3GLBA 3IOUA 2M8CA 4XKNA 2VP1A 3IX1A 3U8QA 2DSFA 3USDA 1XVXA 2DWIA 3QAXA 2ZYNA 4GL0A 4JBZA 4YU0A 3V5AA 3S9LC 3L6GA 3EHUA 3UP9A 1A40A 4FATA 1IXHA 2E1SA 2F8DA 1LCFA 1PDAA 1OLCA 3FGSA 1DSNA 4RYAA 3GBAA 3FJMA 4MLVA 2F5XA 3PPPA 3BFUA 1DPPA 1IITA 1POTA 1O64A 3FVOA 3O29A 4R9FA 3EHSA 1OQHA 4MFIA 2DWAA 4N07A 1M5BA 2RC8A 2XX9A 2UYEA 3RQTA 3UORA 1B7ZA 1P1OA 3LBSA 4KR5A 3RTWB 5CC2A 4U21A 3C34A 5FTIA 4PETA 2HZKA 3VXBA 4GRKA 2ONKE 3I6VA 4F1UA 1MPCA 2REGA 4F3BA 4ZE9A 1SDXA 4GWOA 3PUYE 2ZYOA 1MY1A 2FNCA 3TCHA 3TTKA 1Y3QA 3A3CA 2E0SA 3LSLA 3KZGA 2V3UA 1Q35A 1MY3A 1S9TA 4I62A 5K2XA 1B9JA 3OMBA 4N13A 5L9OA 1N84A 1YCJA 1DMBA 4Q8RA 1JW5A 3T66A 5I2NA 1B7HA 4EF2A 5L8DA 1WODA 2F97A 1B3EA 2HAVA 2O84X 5DT6A 3HSTA 3U1OA 5DVIA 3PPNA 1P1QA 3MWBA 3KOSA 3C35A 3UIFA 1MXZA 1Z7NE 3HV1A 2OJTA 3TTNA 1ZBMA 4X48A 4F2OA 3M8UA 4KHZE 1MM6A 4QFPA 3K4UA 4DZ1A 1AIVA 3SEVA 2HCAA 5AA1A 2CMOA 1AH5A 1OVTA 2O51A 2ZNTA 2Y7KA 4IO7A 4F22A 2QMXA 4Z0IA 1VSOA 3CG1A 1MQIA 5KDTA 1B40A 4WEDA 4EF1A 1Y4TA 4HS7A 3LSFB 1A7LA 2ZXTA 4P11A 4EQ7A 5IAIA 2QS2A 2HAUA 3FVGA 1FTLA 1MS7A 1BKAA 2O7IA 2ALUA 2UVGA 4JWOA 4NF6B 4YZZA 5TP9A 4LZ7A 5JK4A 1MPDA 4ZDMA 2QSXA 1H76A 4YKJA 2P2AA 3IOTA 1S7YA 3G3JA 3N6TA 4IO5A 4AB5A 2OWSA 3LSXA 1B1HA 2O69A 4F18A 3T9HB 4G68C 1Y3PA 3PD8A 3RN8A 2DXRA 1HSJA 3IO6A 4GXSB 1US5A 2ONRA 3FXQA 1POY1 3FJ7A 3PMWA 4K3FA 4GOTA 4G77A 4KCDA 3CRBA 3LR1A 3RUMA 4ZECA 4NF8B 1B46A 3FVKA 2OWTA 2CZLA 1Y20A 3W15C 5AA3A 3O9PA 3SEXA 2F7BA 3DP4A 3PUXE 4NEDA 3UGWA 4NF5A 4LA9A 4MF3A 1M5FA 5I56B 2X7QA 3P7IA 1HSEA 1WDNA 4G68B 4F29A 2XXPA 4GF8A 1I69A 2F36A 5I57B 3S9MC 4YB6A 1Y4CA 2DYXA 1SYHA 3CSGA 2O1MA 1USYH 1TFDA 3Q29A 1QJMA 3JYRA 2DE2A 3OEMA 4X1DA 2THIA 2YLNA 3N6UA 3G3FA 2DVZA 3FIRA 2QPQA 3H6WA 1AOVA 3CFLA 3IOWA 1PB9A
chains in the Genus database with same CATH superfamily
2D5WA 4YICA 5H8SA 2B3FA 3O28A 2YJPA 5EYFA 4UA8A 4U4SA 5TPAA 4N91A 5FHNA 1NV4A 4KPTA 2UVJA 2WYKA 3MZ9A 4H5GA 3T93B 4PFBA 3FBPA 4ZEFA 1UIVA 3K6VA 1MDP1 4FEBA 3G3GA 2Z22A 3FUZA 4OVTA 3LUYA 4R2FA 4N81A 1FQAA 4DIGA 2F34A 2DE3A 2Y7IA 2Q2CA 2AL4A 3PMVA 1FTOA 1SBPA 1N7XA 3PPRA 2DOJA 1B1XA 1BP5A 1TXFA 2R6GE 5KCJB 4F19A 3UA8A 1LFIA 4AQ4A 5B70A 3K01A 3QXMA 3BFTA 2CEYA 2Q8JA 3TQWA 4H1XA 1FBDA 1USYE 1NL5A 1LBWA 2REJA 1T0KA 3EHTA 1N76A 3VV5A 4N15A 4OXVA 5ET8A 1B5IA 1NNFA 4I1DA 1FW0A 4I8CA 4I40A 4DXCA 3K0VA 1DCUA 1LBVA 5KCJA 3VLWA 4JSOA 4PF6A 2PYYA 1A8FA 3TAJA 1B3LA 3TFLA 1SW4A 5EQAA 5L9MA 2R9JA 2Z8FA 1NUYA 1N3XA 1NV6A 2XX7A 4QFLA 3TCFA 3IJOB 1CE2A 2I0BA 1SI0A 3K1PA 3TTRA 1IMFA 4H6DA 4U22A 1NUWA 2V84A 4Q5TA 3HHGA 4F3SA 4F31B 1LGBC 2XX8A 3BKIB 5B7DA 3CSBA 5TPAB 1G0HA 2GFEA 4PBQA 4ZE8A 4YMAA 4XTCQ 5HBCA 3T9XB 2O6AA 2QVUA 1UTHA 1IMEA 1HSLA 1KA0A 1IMBA 3ONMA 3U93A 1IEJA 4P56A 5TU0A 1PC3A 2AL5A 2BJIA 1VFEA 1M5EA 4NF5B 1FCKA 1ATGA 2BJJX 5H8QB 2ZZWA 1UIUA 1XC1A 4OESA 4NE4A 3THIA 2GHBA 1IZ1A 4QBAA 3OO6A 1K9YA 2D3IA 4OTEA 4NWCA 4XKPA 5J1DA 3SETA 1JVYA 3BBRA 4GFRA 3VLUA 1Y1ZA 4RK2A 4GWWA 2F3DA 1FQFA 1OIBA 2YPNA 1IQ7A 4H0WA 4LZ8A 3PUVE 1GVCA 3N26A 4HE0A 3PPOA 1NNKA 3RYDA 4N4UA 1D4NA 3T1BA 1FPGA 4I3EA 3IR1A 4H5FA 1MXUA 2ESNA 4QSEA 3H6VA 4RNSA 5H8QA 5H8HA 1FPLA 4OANA 3OELA 3FV1A 1RDXA 4FBPA 1JEVA 1RKMA 2F3BA 4LN5A 1DTGA 3K1MA 1Z7ME 2Y7RA 4DXBA 2V93A 4KFQA 1DBZA 1QVSA 3Q26A 1VR5A 3MJNA 4F39A 3CFZA 4XF5A 3MZ1A 4NF4B 3CIJA 1RYOA 2XWVA 3KGCA 3U65A 5T3JA 4YKKA 4R72A 4YMBA 3IB2A 4YAHX 4PAIA 1XS5A 3PU5A 2F7CA 2DS9A 1MY4A 2NXOA 1QULA 3OOAA 3CVGA 4QRZA 2XXHA 1Q1KA 4GIZA 4R9GA 1PB8A 5DEXA 1JW1A 3S9EA 3TTMA 2XXKA 5FBPA 2WYPA 2ABHA 2HXWA 2WX9A 4TLMB 5BWJA 1EZOA 4ZS9A 4OMBA 4OVRA 4BDOA 2XD2A 3UK4A 4MNCA 3G3KA 1EYIA 1UTHB 4IO3A 2P1SA 2O1LA 1EH3A 3I3VA 4XKRA 1Y3NA 4BDRA 4M4GA 5ITOA 2PT1A 4R6HA 4GX3A 2NVUB 1NUXA 3USDA 3V5AA 2ZYNA 4JBZA 3L6GA 3UP9A 1IXHA 2E1SA 2F8DA 3FGSA 1OLCA 3GBAA 3FJMA 2F5XA 3PPPA 3BFUA 3ISPA 3EHSA 4N07A 1M5BA 2RC8A 4X8RA 3UORA 1P1OA 5I5PA 3LBSA 5CC2A 2HZKA 1MPCA 2REGA 4ZE9A 1SDXA 2ZYOA 1MY1A 2HXRA 3LSLA 2CZIA 1MY3A 3T66A 1WODA 2HAVA 5DVIA 3PPNA 3UIFA 3KOSA 1Z7NE 2OJTA 3M8UA 2O51A 4IO7A 2Y7KA 4Z0IA 4MNPA 1MQIA 4EF1A 4P11A 2ZXTA 4EQ7A 1NV5A 2HAUA 4YZZA 1BKAA 2ALUA 4NF6B 4LZ7A 4IO5A 1S7YA 2GQ1A 4K3FA 3FJ7A 3PMWA 3CRBA 3LR1A 3FVKA 4OVPA 5I7IA 4NEDA 4LA9A 1WDNA 1I69A 4YB6A 1Y4CA 1SYHA 3CSGA 1IMCA 2DE2A 4X1DA 2YLNA 3N6UA 3FIRA 1AWBA 3IOWA 1PB9A 2P0SA 1L5TA 5CMBA 4MBPA 4KYSA 4RJZA 2OK2A 3ILUB 3ZSFA 4OVSA 4YB7A 3FD3A 2OLBA 3G3IA 1IXGA 2KR0A 1B2HA 3MVYA 4GQOA 4H46A 3RT6B 1QUKA 3SEYA 1URDA 5AA4B 3S2VA 1LFGA 2FYIA 2PFYA 3LSWA 4F3GA 4FEDA 4U23A 1FQDA 4OWDA 2O7UA 3ZKKA 2NOOA 3EQ1A 2QVVA 5I2NB 3OD7A 2OCUA 3WAFA 4Q30B 2I3WA 2ONSA 5IKBA 3T0JA 1YZ0A 4IO4A 4H65A 1SI1A 4EXKA 4WEPA 2Y84A 4DLDA 1B4ZA 3UN6A 1MG1A 4KI0E 1DPEA 1KA1A 2HHMA 1FPFA 4N6PA 3ROJA 5KZTA 1FQCA 3K6WA 3KN3A 1I6AA 4OVQA 4DI4B 2AYSA 2QRYA 1DOTA 4NF6A 2A5TA 3S9NC 2HQ0A 1UTBA 4FECA 2Q8MA 5H8NA 4PQJA 3K2DA 1EYJA 5I57A 3KSXA 1AL3A 4TQUQ 1II5A 4GX4A 5M2VA 3E9XA 2I58A 4X1BA 3MUQA 3QSLA 4PCDA 4DI3D 3MPLA 3E13X 3N5LA 2OX3A 2QJEA 1IMAA 1SQYA 4H8JA 5J16A 1R9QA 2FIXA 1XVYA 3IFAA 4ESXA 1NH8A 4P9KA 1FQEA 3EPEA 4KQPA 5DTBA 4JWXA 1SW1A 2OZZA 4HTGA 1MXVA 3OO8A 4HXVA 1B5HA 5H8FA 2AIXA 4C1TA 4NGUA 3GZGA 4OHNA 4G8NA 2IEEA 5FTHA 3VLVA 3B50A 2HPGA 5LTCA 2L5VA 3M3LA 3OENA 2W7YA 3LC8A 5BUUA 4IB2A 4IO6A 4ELQA 5DVJA 4U2RA 2XA5A 1SD3A 4IGTA 4JDFA 4P8BA 1GGGA 1OQGA 1LBBA 1LBZA 1LBCA 3C31A 4IO2A 4JB7A 4NF8A 1ZIUA 1Y1MA 5CMCA 3M3FA 3KBRA 3DELB 2XXXA 1N7WA 4KYEA 5F1QA 5JTYB 4O3AA 3OO9A 3MW0A 4NF4A 3HFUA 2XXVA 2H9BA 1IXIA 3OO7A 2F6GA 3RPWA 1MH3A 3CHGA 2R71A 1BTJA 4O7MA 4QFNA 4RPOA 1NV0A 4G4PA 4KYDA 3E4RA 2UXAA 1R9LA 4OQOA 4C0RA 2P3VA 5A5XB 4QF9A 1TFAA 2B4MA 2Q2AA 1QW0A 2WKYA 3H3GA 4L17A 5AA2A 4ONYA 4EXLA 4POWA 3TCGA 5F24A 1S50A 1B51A 5H8HB 1YAEA 1LLSA 1RYXA 3M3KA 5K2YA 1MXWA 1QUIA 5AE4A 1YPNA 4F3PA 3PD9A 4ESWA 1DK4A 1FQBA 3IORA 2ZNSA 2I3VA 2H4IA 4HW8A 2IA4A 1JVXA 3MBPA 3TYHA 4ELPA 1DTZA 3IO4A 3H7MA 3MYUA 5ET6A 1G0IA 1M5DA 1XI6A 4O3CA 3FVNA 1FPBA 1IIWA 5A5XA 4GWSA 3Q28A 1YTVA 1N3WA 2VD2A 5IM2A 2DXYA 4QFKA 3VXCA 1YXIA 4AB6A 4FIMA 5L9SA 4PF8A 3E3KA 3O6HA 3TPAA 2WBDA 2Y5LA 3D4CA 1I6QA 4XXUA 3K02A 4OETA 1IXCA 4R2BA 5DVFA 3GLBA 3IOUA 2M8CA 3U8QA 2DSFA 3QAXA 4GL0A 3RPLA 3EHUA 1A40A 4RYAA 1DSNA 2JJKA 4MLVA 1DPPA 1POTA 1O64A 2XX9A 4KR5A 1YYZA 3E78A 4I62A 1B9JA 3OMBA 4N13A 4NF0A 1YCJA 1DMBA 2WBBA 3FXBA 1B7HA 4O94A 3QMFA 4F2OA 1MM6A 3K4UA 4DZ1A 1AH5A 1OVTA 4F22A 2QMXA 1VSOA 4WEDA 1Y4TA 3LSFB 2QS2A 3FVGA 2O7IA 4YKJA 4AB5A 2OWSA 3LSXA 4PFIA 3T9HB 3IO6A 2Q74A 1POY1 3FXQA 4G77A 3RUMA 1RDYA 1FBHA 2OWTA 4P1LA 3E79A 2F7BA 4X04A 5I56B 4G68B 2XXPA 5I57B 3S9MC 1USYH 3JYRA 3G3FA 3H6WA 1OQHA 4MFIA 1HSJA 3TQLA 1UTBB 5EHMA 4MHFA 2ANJA 2MKZA 4ZEDA 3VE1B 2XXIA 3O66A 4KXPA 4F1VA 1LAHE 2FBPA 2R8TA 3JV9A 1BK4A 4ZZAA 2Z23A 4GWYA 4AS4A 3SEUA 3B6WA 4MMPA 4PC9A 1LFHA 1MY0A 4GBVA 1LCTA 2QS3A 3O6IA 1B5JA 3MP1A 4QSDA 3GBBA 4R75A 2PMSA 1BIYA 5EYGA 5LDZA 4GL8A 1ZU0A 1D9QA 5ISUA 3IOVA 5IGAA 1ELJA 1B0HA 3EN3A 1P1WA 2H5YA 3VVFA 4DXUA 4O3BA 3D4GA 5ET7A 1K9ZA 1P99A 4LQ5A 3LV0A 4NHBA 4JVIA 3RY3A 5CM6A 1URGA 4NQ8A 3CG3A 1NNPA 1EZPA 3U92A 4OYVA 4DDDA 4OERA 2DP8A 1MQHA 2GHAA 5ESYA 1FBCA 2KLFA 2Z8DA 3TDJA 3K6UA 3T9VA 4BLAA 1SW2A 2FVZA 2B65A 4JXIA 5CMKA 4MX6A 3IJXB 3RPLB 4LONB 1QKBA 1JEUA 3KFMA 3SKPA 4O7IA 4E0XA 2HFBA 1JW4A 3GYYA 3T9UA 1NV7A 2O68A 5IZ3B 1P1UA 1ZLQA 3R7XA 4R6KA 4GVOA 3FV2A 4LZ5A 1NV3A 3GXAA 5I59A 1LBYA 3C32A 1ZTYA 1NV1A 3KG2A 4MNIA 3VVDA 3L6HA 3IB1A 4BDLA 4H45A 1BLFA 1B4HA 4OFOA 5KDTB 4PFTA 1RDZA 5CBRA 1B3HA 1B32A 1PBPA 3KJ7A 4EUOA 1F9BA 1LB9A 2VD3A 4P0GA 1OMPA 1B6HA 4WKMA 4JVCA 4R6YA 3ECRA 3MZBA 4QFOA 4PDHA 5I84A 1B05A 1Y9UA 3EF7A 3FXUA 4G2ZA 2ZMBA 3FASA 1LB8A 2XXWA 1LAFE 3OEKA 2VT5A 2QL3A 2UVIA 1GTKA 4MEVA 2HEUA 2GRVA 3U94A 4LUBA 4R74A 5I58B 5FHOA 1SYIA 1D9YA 3QUFA 4PE5B 2HZLA 3V8XB 5CI5A 5IZ1A 3I5OA 2DVCA 1A54A 3O97A 2QS4A 4NAPA 1JETA 1EU8A 2Q88A 1O7TA 3W9VA 1N0TA 1UQWA 3HCQA 3SDFA 3QIMA 4G8HA 3Q25A 2Y5KA 4RY1A 4YKIA 5ELVA 4JVDA 1J1NA 1PB7A 2F7AA 2V3TA 2XHDA 5ITPA 4XIGQ 2Q89A 1MQJA 5JTYA 1A55A 3VDFA 2XXUA 1NV2A 2RCBA 4THIA 1FPEA 4YB5A 4C1UA 1EZ9A 1NH7A 4YKPA 1OVBA 3W9WA 3HPIA 3PV0E 4JSDA 4U1OA 1B52A 3MP6A 2D21A 4I3YA 2I4BA 2QMWA 1CNQA 3QK6A 3FZVA 3A29A 1O63A 3CR9A 4G61A 4MLQA 3A09A 3C33A 5FHMA 2VHAA 2RF1A 4TLLB 4RK9A 1QKAA 3MSTA 1MQGA 2B3BA 4DCYA 2DWJA 1AMFA 1D3KA 1NNTA 4IY6A 3SERA 5AA2B 5ICTA 3PUWE 4FJPA 4PFUA 1IMDA 3ZS6A 1NMUA 3MVZA 1FRPA 1D9VA 2Q9TA 2XWOA 4OZ9A 5KDTA 2VPOA 4NMYA 2PBWA 4I9DA 1B58A 1FJ9A 3KC0A 5I2KB 3B7DA 4ZEIA 4ECFA 1ZJLA 5EYHA 4LQ2A 4GWZA 4GBWA 3T96B 1LAGE 1LSTA 5CMMA 2GH9A 4HE2A 1MPBA 4M1VA 2RKMA 4PP0A 5EHSA 5H8NB 1LBXA 4X9TA 3C9HA 4GXAA 1GR2A 5DW8A 3MC2A 4MH5A 1MDQA 4FATA 1PDAA 2XWIA 1IITA 4N6DA 3FVOA 4XEQA 1B7ZA 3C34A 4PETA 2ONKE 3I6VA 4F3BA 1FPIA 4GWOA 3TCHA 3A3CA 3KZGA 2V3UA 1Q35A 5K2XA 1N84A 4EF2A 2O84X 5DT6A 3HSTA 3IFCA 3C35A 3HV1A 2HCAA 1FPJA 5AA1A 3CG1A 1B40A 5IZ3A 1MS7A 2UVGA 4JWOA 5TP9A 5JK4A 1MPDA 1H76A 3N6TA 2O69A 3NOHA 1Y3PA 3PD8A 3RN8A 2DXRA 4GXSB 2ONRA 4KCDA 4XFEA 4ZECA 3O9PA 4AS5A 3PUXE 3UGWA 4MF3A 1QGXA 2KQZA 2X7QA 4GF8A 2F36A 1EYKA 2DYXA 3Q29A 4IR8A 2P3NA 2THIA 2QPQA 1AOVA 4GRKA 1FJ6A 2I4CA 5I56A 4F1YA 2DWHA 3B8BA 4N6KA 1SPIA 2XXRA 5H8FB 4GWUA 4P47A 2UYFA 2I0CA 2FIEA 1TWYA 1H45A 2V25A 3KN7A 2NWJA 1FTJA 1B3GA 2RC7A 1P1NA 3RT8A 2G93A 2NUVA 2PVUA 2V3QA 2F6PA 1B7UA 4GWXA 3ODBA 4FAJA 3KSJA 3OSQA 3HHFA 2DE4A 3WAEA 3DLNA 2Y7WA 1NFTA 3C4MA 1N04A 2G29A 2QS1A 1MQDA 4ND9A 3D1RA 2OWZA 5I3SA 3MVXA 4G8MA 3S4UA 5I59B 3IL1B 4P3LA 1SW5A 3C36A 2UVHA 3K00A 1FTMA 5HM4B 4PFYA 4N17A 4QSCA 1ZMGA 4RPNA 4EDPA 2B4LA 4G68A 3CI8A 5CBSA 1US4A 2I48A 2RC9A 5AA4A 3QYTA 2A5TB 4DCXA 1MXYA 4H8IA 1B3FA 4FORA 4UACA 4RA1A 3HO7A 3SEWA 3MP8A 1B0LA 5EQ8A 2QFLA 2CZKA 1CB6A 2H25A 3IAZA 3U72A 3G7WA 5TP9B 3TTLA 4U1ZA 3BIHA 3HN0A 2DQVA 1FTAA 2H99A 3DM0A 3VFJA 3TELA 2Z8EA 2OBGA 5DYHA 5EQ9A 5A5LA 1I6BA 4HCYA 1URSA 2CZHA 4IGRA 4KCCA 3TMGA 2XXTA 4N8YA 5JEIA 1FPDA 1LAXA 2XXYA 3OSRA 4F18A 4ELOA 1GV8A 1VDWA 3R26A 4OFJA 3H6UA 1KWHA 2PX1A 4ZEBA 3F11A 3VVEA 1MY2A 1H44A 3O6GA 2XWKA 1XHYA 3BIGA 3IB0A 3KJTA 4POXA 4HE1A 2PT2A 3N94A 4U4XA 4JWYA 2WEFA 3RNNA 1MH4A 2VPNA 4LATA 1TT1A 3MQ9A 5ICQA 2X7PA 3TUSA 3H6TA 1A8EA 3Q27A 3A3UA 1INPA 4ELRA 2LAOA 2V4CA 5AA2D 4P0IA 3V83A 3OXNA 3V89B 4OENA 1SVXB 3G3HA 4BDQA 1VE4A 4MJOA 3H03A 5I2KA 1XOCA 3DP8A 4BDNA 4OVJA 1ZKBA 5HPQA 2RCAA 1OLAA 3IK6B 4RXLA 1FBEA 4FE8A 1M5CA 3PPQA 3RTFB 4NX1A 4QXDA 2ZYMA 3K1NA 3B6TA 4GLIA 4PGNA 3O2AA 1PEBA 1ANFA 2I6EA 1R1NA 4KD5A 3MVWA 4PE3A 4E0WA 3DP6A 3QUJA 1FPKA 4OA4A 1Q9DA 4LVQA 3FATA 4Q0CA 3MPKA 2RINA 2ZYKA 5LOMA 4HCWA 2H98A 2XXQA 4PTKA 3KN8A 4PFWA 2FA7A 1A99A 3SESA 4GD5A 3TKDA 4IY5A 3KC1A 5ET5A 4NTLA 4QHQA 2ZNUA 4UABA 1JNFA 4EQ9A 4H67A 3ILTB 4ISUA 3PUZE 5IZZA 4Z7EA 1WVJA 3KEIA 4R73A 3FXRA 4MCOA 4WXJA 4PAKA 4TOZA 3PGFA 5F7VA 3TZAA 4F2QA 1H3DA 3H4ZA 2F35A 1VFDA 4OEUA 4LP2B 5DEXB 3RGYA 3LUZA 1QUJA 2VGQA 3PTYA 1XT8A 4XKQA 2X26A 4PDDA 4ZEKA 3T22A 1NKXA 2F78A 1PBQA 1JQFA 3KOTA 3TODA 3ZKLA 2I49A 3H06B 3PMXA 3TEPA 5I58A 3MAMA 1FTKA 2A5SA 2ZZVA 1MM7A 1H43A 2VOZA 4DE8A 1MRPA 3K6XA 1FBPA 3RLFE 4N8GA 3SZPA 2XD3A 5CRYA 3JZJA 1IUDA 1MXXA 4OFLA 1NI9A 2Y7PA 3AXFA 3B6QA 4ZZEA 3R6UA 2ZZXA 4EQBA 3CFXA 4OEVA 1R6ZA 4MAGA 3FJGA 2QVRA 4XKNA 5EQ7A 2VP1A 3IX1A 1XVXA 2DWIA 4YU0A 3S9LC 1LCFA 2DDKA 3O29A 4R9FA 2DWAA 2UYEA 3RQTA 3RTWB 4U21A 5FTIA 3VXBA 4F1UA 4PGPA 1NUZA 3PUYE 4NG7A 2FNCA 3TTKA 1Y3QA 2E0SA 1LEVA 1S9TA 2CEXA 4P1EA 5L9OA 4Q8RA 1JW5A 5I2NA 4O8MA 4PFRA 5L8DA 2F97A 1B3EA 3U1OA 1P1QA 1FBFA 3MWBA 1MXZA 3TTNA 1ZBMA 4X48A 4KHZE 4QFPA 1AIVA 3SEVA 1FBGA 2CMOA 2ZNTA 4PBHA 3EKIA 4HS7A 1A7LA 5IAIA 1FTLA 4MIJA 4ZDMA 2QSXA 4BDMA 2P2AA 3IOTA 3G3JA 1B1HA 2PCRA 4G68C 1JP4A 1US5A 1KZ8A 4GOTA 4NF8B 1B46A 4NN3A 2CZLA 1Y20A 3W15C 5AA3A 3SEXA 3DP4A 4NF5A 3KBZA 1M5FA 3P7IA 1HSEA 4F29A 4PAFA 2O1MA 1FSAA 1TFDA 1QJMA 3OEMA 4GX6A 2FHYA 2DVZA 2PFZA 3CFLA 4NWDA
chains in the Genus database with same CATH topology
2D5WA 2I4CA 2P0SA 4YICA 1L5TA 5I56A 3TQLA 5CMBA 5H8SA 1UTBB 5EHMA 4F1YA 2ANJA 2DWHA 4MBPA 4ZEDA 2B3FA 4KYSA 3O28A 2YJPA 2XXRA 4RJZA 5EYFA 3VE1B 5H8FB 2XXIA 2OK2A 3ILUB 3O66A 4OZ9A 4UA8A 3ZSFA 2UYFA 4F1VA 2I0CA 4U4SA 1TWYA 1H45A 1LAHE 2V25A 3KN7A 2NWJA 1FTJA 4YB7A 5TPAA 3FD3A 1B3GA 2OLBA 1P1NA 1IXGA 2RC7A 3G3IA 3JV9A 4ZZAA 2Z23A 5FHNA 3RT8A 2G93A 1B2HA 4KPTA 3SEUA 2UVJA 3B6WA 3MVYA 3MZ9A 4GQOA 4H5GA 1QUKA 2NUVA 2PVUA 1URDA 3RT6B 3SEYA 5AA4B 3S2VA 3T93B 2V3QA 1LFGA 2F6PA 2FYIA 3LSWA 1B7UA 4F3GA 4ZEFA 1LFHA 1UIVA 4FEDA 3K6VA 1MDP1 1MY0A 3ODBA 4U23A 4EQBA 4FEBA 4FAJA 3KSJA 1LCTA 1FQDA 2QS3A 3G3GA 3O6IA 1B5JA 3OSQA 2Z22A 3FUZA 3MP1A 4QSDA 3GBBA 4R2FA 3LUYA 3HHFA 2DE4A 2O7UA 1FQAA 4OWDA 4R75A 3WAEA 3ZKKA 4DIGA 2NOOA 2F34A 2PMSA 5LOMA 2DE3A 2Y7IA 1BIYA 3DLNA 2Q2CA 4GL8A 2AL4A 1ZU0A 1NFTA 2Y7WA 3C4MA 1N04A 3PMVA 3IOVA 5ISUA 2G29A 2QS1A 1ELJA 1B0HA 1FTOA 1MQDA 3EQ1A 4ND9A 3EN3A 5I2NB 3MVXA 1P1WA 2H5YA 3OD7A 1SBPA 4G8MA 3S4UA 3VVFA 5I59B 2OCUA 3WAFA 4DXUA 3IL1B 1N7XA 4NWDA 4O3BA 3PPRA 4Q30B 2I3WA 3D4GA 1P99A 2DOJA 4LQ5A 1SW5A 2ONSA 1B1XA 3C36A 2UVHA 3K00A 1FTMA 4IO4A 5HM4B 5IKBA 3RY3A 1BP5A 1TXFA 1SI1A 1URGA 2R6GE 3CG3A 1NNPA 4H65A 4PFYA 4F19A 3U92A 4OYVA 4DDDA 4QSCA 1ZMGA 4WEPA 2Y84A 3UA8A 1LFIA 4EXKA 4OERA 2DP8A 4AQ4A 5B70A 1MQHA 4RPNA 2GHAA 4DLDA 4EDPA 3K01A 1B4ZA 4G68A 2KLFA 2Z8DA 3CI8A 3UN6A 1MG1A 3BFTA 3QXMA 5CBSA 4KI0E 2Q8JA 1US4A 2I48A 3K6UA 2RC9A 3T9VA 3TDJA 5AA4A 1DPEA 3TQWA 4BLAA 3QYTA 2A5TB 1SW2A 4H1XA 1USYE 1MXYA 4DCXA 4H8IA 1B3FA 2B65A 1NL5A 4FORA 4JXIA 4N6PA 5CMKA 4UACA 4RA1A 3IJXB 5KZTA 3HO7A 3SEWA 2REJA 1FQCA 4LONB 1T0KA 3MP8A 1B0LA 3EHTA 1QKBA 3K6WA 1JEUA 3KN3A 3KFMA 1I6AA 3SKPA 1N76A 1CB6A 2H25A 2AYSA 3IAZA 2QRYA 3G7WA 3U72A 3VV5A 1DOTA 4OXVA 4NF6A 2HFBA 5TP9B 1B5IA 2A5TA 4E0XA 3S9NC 1NNFA 2HQ0A 1UTBA 1JW4A 4I1DA 3TTLA 4U1ZA 4FECA 1FW0A 4I8CA 3T9UA 2O68A 5H8NA 5CM6A 1P1UA 4DXCA 1ZLQA 4PQJA 3R7XA 3K0VA 4R6KA 5KCJA 3VLWA 4GVOA 4JSOA 3FV2A 3K2DA 4LZ5A 3HN0A 2DQVA 3KSXA 2PYYA 5I57A 1AL3A 3GXAA 2H99A 1II5A 3DM0A 1A8FA 4TQUQ 3TELA 3VFJA 2Z8EA 2OBGA 5M2VA 3TAJA 1B3LA 3TFLA 5DYHA 1SW4A 3E9XA 5L9MA 2I58A 1I6BA 2R9JA 3MUQA 2Z8FA 3QSLA 4X1BA 1N3XA 5I59A 4QFLA 2XX7A 3C32A 1ZTYA 3KG2A 4HCYA 1URSA 4IGRA 3TCFA 3L6HA 3IJOB 3VVDA 1CE2A 3IB1A 4KCCA 3MPLA 2I0BA 4BDLA 1BLFA 3TMGA 1B4HA 4OFOA 5KDTB 2XXTA 4PFTA 1SI0A 3E13X 5CBRA 5JEIA 1B3HA 3N5LA 3K1PA 1B32A 1PBPA 1LAXA 2XXYA 3KJ7A 2QJEA 3OSRA 1SQYA 1F9BA 4H6DA 4U22A 1LB9A 2VD3A 3R26A 4H8JA 4P0GA 1GV8A 4OFJA 1OMPA 1KWHA 1R9QA 3H6UA 3S9EA 1B6HA 1XVYA 2PX1A 4WKMA 4ZEBA 4R6YA 4ESXA 3F11A 2V84A 1NH8A 3ECRA 4Q5TA 3VVEA 3HHGA 3MZBA 1MY2A 1H44A 4QFOA 4F3SA 4F31B 3O6GA 1FQEA 1XHYA 3EPEA 4KQPA 5I84A 3IB0A 3KJTA 4POXA 1B05A 1Y9UA 1LGBC 3EF7A 3FXUA 4G2ZA 2XX8A 2PT2A 5DTBA 2ZMBA 3BKIB 3N94A 3CSBA 3FASA 1SW1A 2OZZA 1LB8A 4JWXA 4U4XA 5TPAB 4JWYA 4HTGA 1MXVA 3RNNA 1MH4A 2XXWA 1LAFE 2GFEA 4BDMA 3OEKA 3OO8A 1B5HA 5H8FA 4ZE8A 4YMAA 2AIXA 4C1TA 4LATA 4XTCQ 5HBCA 3GZGA 1TT1A 3MQ9A 3T9XB 5ICQA 4OHNA 4G8NA 2IEEA 5FTHA 2O6AA 3VLVA 2X7PA 2QL3A 3TUSA 2UVIA 3H6TA 1GTKA 1A8EA 1UTHA 3Q27A 3A3UA 3M3LA 3OENA 2W7YA 1HSLA 3LC8A 3ONMA 2HEUA 4ELRA 5BUUA 2LAOA 4IB2A 4IO6A 3U93A 4ELQA 1IEJA 5DVJA 5B7DA 5TU0A 2GRVA 5AA2D 4U2RA 4P0IA 3V83A 1PC3A 3OXNA 1SD3A 3U94A 3V89B 4IGTA 4JDFA 2AL5A 4LUBA 4OENA 1GGGA 1OQGA 1SVXB 1LBBA 1VFEA 3G3HA 1LBCA 1M5EA 3C31A 4NF5B 4R74A 4BDQA 1VE4A 5FHOA 1FCKA 5I58B 1ATGA 2BJJX 3H03A 5I2KA 5H8QB 1XOCA 1SYIA 4IO2A 4JB7A 1D9YA 1UIUA 1XC1A 3DP8A 4NF8A 4OESA 4BDNA 5KCJB 1ZIUA 4NE4A 3THIA 3QUFA 1Y1MA 2GHBA 1IZ1A 4OVJA 1ZKBA 3OO6A 4PE5B 5CMCA 2RCAA 5HPQA 1OLAA 2HZLA 3M3FA 3KBRA 3V8XB 3IK6B 3DELB 4RXLA 5CI5A 4ELOA 2XXXA 1N7WA 1M5CA 2D3IA 4FE8A 4OTEA 3PPQA 3RTFB 4NWCA 4KYEA 3I5OA 2DVCA 1A54A 4XKPA 5F1QA 5JTYB 4O3AA 3O97A 3OO9A 2ZYMA 3K1NA 3B6TA 5J1DA 3MW0A 4GLIA 3SETA 2QS4A 4NF4A 1JVYA 2XXVA 1JETA 2H9BA 1IXIA 3BBRA 3O2AA 3OO7A 4GFRA 2F6GA 1PEBA 1EU8A 3RPWA 1MH3A 3VLUA 2Q88A 1ANFA 2R71A 1O7TA 3W9VA 1BTJA 1Y1ZA 1N0TA 1UQWA 3HCQA 4QFNA 4RK2A 4RPOA 3SDFA 1FQFA 3QIMA 4G8HA 1OIBA 3Q25A 4RY1A 4YKIA 4G4PA 2YPNA 5ELVA 1IQ7A 1J1NA 4H0WA 2I6EA 4KYDA 1PB7A 2F7AA 2UXAA 2V3TA 1R1NA 2XHDA 3E4RA 3N26A 3PUVE 4LZ8A 1GVCA 1R9LA 4XIGQ 5ITPA 4OQOA 4KD5A 4C0RA 2Q89A 1MQJA 3MVWA 3PPOA 4E0WA 5JTYA 1A55A 3VDFA 1NNKA 2XXUA 5A5XB 3DP6A 3QUJA 1D4NA 2RCBA 4QF9A 4THIA 1TFAA 2Q2AA 4LVQA 3IR1A 3FATA 4H5FA 1MXUA 4Q0CA 2ESNA 1QW0A 2RINA 3MPKA 4YB5A 4C1UA 2ZYKA 4QSEA 1EZ9A 1NH7A 3H6VA 4RNSA 4YKPA 1OVBA 2WKYA 5H8QA 5H8HA 4HCWA 3W9WA 2H98A 3H3GA 3HPIA 3OELA 3PV0E 4JSDA 2XXQA 4L17A 4ONYA 5AA2A 4EXLA 3FV1A 3KN8A 4PFWA 4POWA 3TCGA 4U1OA 1B52A 2FA7A 1A99A 3MP6A 1JEVA 1RKMA 3SESA 1S50A 1B51A 5H8HB 1YAEA 4GD5A 3TKDA 1LLSA 1RYXA 3M3KA 2D21A 4IY5A 1DTGA 3K1MA 4NTLA 1Z7ME 4QHQA 2ZNUA 3TTRA 2I4BA 2QMWA 5K2YA 1MXWA 1JNFA 1QUIA 3QK6A 4EQ9A 3FZVA 5AE4A 4H67A 1O63A 2Y7RA 3ILTB 3PUZE 1YPNA 4ISUA 4DXBA 3CR9A 4Z7EA 4F3PA 1WVJA 2V93A 3PD9A 4MLQA 4ESWA 3KEIA 3A09A 3C33A 4R73A 1FQBA 4KFQA 3FXRA 1QVSA 2VHAA 5FHMA 4WXJA 2RF1A 3IORA 4TLLB 2ZNSA 2I3VA 4RK9A 1QKAA 2H4IA 3Q26A 4TOZA 1VR5A 3PGFA 4HW8A 1MQGA 2IA4A 5F7VA 1JVXA 3MJNA 4F39A 2B3BA 3MBPA 4DCYA 3TZAA 3CFZA 4F2QA 1H3DA 3H4ZA 2DWJA 2F35A 3TYHA 1AMFA 4ELPA 1DTZA 3IO4A 3MZ1A 1D3KA 4NF4B 1NNTA 3CIJA 4IY6A 3SERA 4EUOA 1VFDA 3H7MA 1RYOA 4OEUA 4LP2B 5AA2B 5DEXB 3KGCA 5ICTA 3PUWE 4FJPA 4YKKA 3RGYA 1QUJA 4R72A 4YMBA 2VGQA 4PFUA 3ZS6A 1M5DA 3IB2A 1NMUA 1XT8A 4YAHX 3MVZA 1XS5A 3PU5A 2X26A 4XKQA 1D9VA 2F7CA 2Q9TA 4ZEKA 4O3CA 3FVNA 3T22A 1NKXA 1MY4A 1PBQA 1QULA 1JQFA 2DS9A 2F78A 2NXOA 1IIWA 2XXHA 1Q1KA 3CVGA 3KOTA 2I49A 4NMYA 4QRZA 3TODA 3ZKLA 5A5XA 2PBWA 4GIZA 4I9DA 1B58A 4R9GA 3Q28A 5I2KB 1PB8A 1YTVA 3B7DA 4ZEIA 3H06B 1JW1A 1N3WA 3PMXA 5DEXA 2VD2A 3TTMA 4ECFA 1ZJLA 3MAMA 5I58A 1FTKA 3OOAA 2A5SA 3TEPA 2DXYA 4LQ2A 1MM7A 4QFKA 3VXCA 3T96B 1H43A 1LAGE 2VOZA 1LSTA 4DE8A 2ABHA 1MRPA 3K6XA 2HXWA 4TLMB 5BWJA 4AB6A 1EZOA 4FIMA 4ZS9A 4OMBA 5CMMA 3RLFE 1EZPA 5L9SA 2GH9A 1MPBA 3E3KA 4BDOA 3O6HA 4M1VA 2RKMA 2XD2A 2XD3A 4PP0A 5CRYA 5EHSA 3JZJA 3TPAA 3UK4A 5H8NB 1IUDA 3G3KA 3D4CA 1MXXA 4OFLA 4X9TA 3C9HA 1I6QA 2Y7PA 3AXFA 3B6QA 4XXUA 4GXAA 4ZZEA 1UTHB 3R6UA 4IO3A 2P1SA 2O1LA 1EH3A 3I3VA 1GR2A 3K02A 4OETA 4XKRA 1IXCA 1Y3NA 4BDRA 4R2BA 4M4GA 3CFXA 3MC2A 4MH5A 1R6ZA 2PT1A 4OEVA 1MDQA 3FJGA 4R6HA 5DVFA 5ITOA 2NVUB 3GLBA 3IOUA 2M8CA 4XKNA 2VP1A 3IX1A 3U8QA 2DSFA 3USDA 1XVXA 2DWIA 3QAXA 2ZYNA 4GL0A 4JBZA 4YU0A 3V5AA 3S9LC 3L6GA 3EHUA 3UP9A 1A40A 4FATA 1IXHA 2E1SA 2F8DA 1LCFA 1PDAA 1OLCA 3FGSA 1DSNA 4RYAA 3GBAA 3FJMA 4MLVA 2F5XA 3PPPA 3BFUA 1DPPA 1IITA 1POTA 1O64A 3FVOA 3O29A 4R9FA 3EHSA 1OQHA 4MFIA 2DWAA 4N07A 1M5BA 2RC8A 2XX9A 2UYEA 3RQTA 3UORA 1B7ZA 1P1OA 3LBSA 4KR5A 3RTWB 5CC2A 4U21A 3C34A 5FTIA 4PETA 2HZKA 3VXBA 4GRKA 2ONKE 3I6VA 4F1UA 1MPCA 2REGA 4F3BA 4ZE9A 1SDXA 4GWOA 3PUYE 2ZYOA 1MY1A 2FNCA 3TCHA 3TTKA 1Y3QA 3A3CA 2E0SA 3LSLA 3KZGA 2V3UA 1Q35A 1MY3A 1S9TA 4I62A 5K2XA 1B9JA 3OMBA 4N13A 5L9OA 1N84A 1YCJA 1DMBA 4Q8RA 1JW5A 3T66A 5I2NA 1B7HA 4EF2A 5L8DA 1WODA 2F97A 1B3EA 2HAVA 2O84X 5DT6A 3HSTA 3U1OA 5DVIA 3PPNA 1P1QA 3MWBA 3KOSA 3C35A 3UIFA 1MXZA 1Z7NE 3HV1A 2OJTA 3TTNA 1ZBMA 4X48A 4F2OA 3M8UA 4KHZE 1MM6A 4QFPA 3K4UA 4DZ1A 1AIVA 3SEVA 2HCAA 5AA1A 2CMOA 1AH5A 1OVTA 2O51A 2ZNTA 2Y7KA 4IO7A 4F22A 2QMXA 4Z0IA 1VSOA 3CG1A 1MQIA 5KDTA 1B40A 4WEDA 4EF1A 1Y4TA 4HS7A 3LSFB 1A7LA 2ZXTA 4P11A 4EQ7A 5IAIA 2QS2A 2HAUA 3FVGA 1FTLA 1MS7A 1BKAA 2O7IA 2ALUA 2UVGA 4JWOA 4NF6B 4YZZA 5TP9A 4LZ7A 5JK4A 1MPDA 4ZDMA 2QSXA 1H76A 4YKJA 2P2AA 3IOTA 1S7YA 3G3JA 3N6TA 4IO5A 4AB5A 2OWSA 3LSXA 1B1HA 2O69A 4F18A 3T9HB 4G68C 1Y3PA 3PD8A 3RN8A 2DXRA 1HSJA 3IO6A 4GXSB 1US5A 2ONRA 3FXQA 1POY1 3FJ7A 3PMWA 4K3FA 4GOTA 4G77A 4KCDA 3CRBA 3LR1A 3RUMA 4ZECA 4NF8B 1B46A 3FVKA 2OWTA 2CZLA 1Y20A 3W15C 5AA3A 3O9PA 3SEXA 2F7BA 3DP4A 3PUXE 4NEDA 3UGWA 4NF5A 4LA9A 4MF3A 1M5FA 5I56B 2X7QA 3P7IA 1HSEA 1WDNA 4G68B 4F29A 2XXPA 4GF8A 1I69A 2F36A 5I57B 3S9MC 4YB6A 1Y4CA 2DYXA 1SYHA 3CSGA 2O1MA 1USYH 1TFDA 3Q29A 1QJMA 3JYRA 2DE2A 3OEMA 4X1DA 2THIA 2YLNA 3N6UA 3G3FA 2DVZA 3FIRA 2QPQA 3H6WA 1AOVA 3CFLA 3IOWA 1PB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D5W A;  2I4C A;  2P0S A;  4YIC A;  1L5T A;  5I56 A;  3TQL A;  5CMB A;  5H8S A;  1UTB B;  5EHM A;  4F1Y A;  2ANJ A;  2DWH A;  4MBP A;  4ZED A;  2B3F A;  4KYS A;  3O28 A;  2YJP A;  2XXR A;  4RJZ A;  5EYF A;  3VE1 B;  5H8F B;  2XXI A;  2OK2 A;  3ILU B;  3O66 A;  4OZ9 A;  4UA8 A;  3ZSF A;  2UYF A;  4F1V A;  2I0C A;  4U4S A;  1TWY A;  1H45 A;  1LAH E;  2V25 A;  3KN7 A;  2NWJ A;  1FTJ A;  4YB7 A;  5TPA A;  3FD3 A;  1B3G A;  2OLB A;  1P1N A;  1IXG A;  2RC7 A;  3G3I A;  3JV9 A;  4ZZA A;  2Z23 A;  5FHN A;  3RT8 A;  2G93 A;  1B2H A;  4KPT A;  3SEU A;  2UVJ A;  3B6W A;  3MVY A;  3MZ9 A;  4GQO A;  4H5G A;  1QUK A;  2NUV A;  2PVU A;  1URD A;  3RT6 B;  3SEY A;  5AA4 B;  3S2V A;  3T93 B;  2V3Q A;  1LFG A;  2F6P A;  2FYI A;  3LSW A;  1B7U A;  4F3G A;  4ZEF A;  1LFH A;  1UIV A;  4FED A;  3K6V A;  1MDP 1;  1MY0 A;  3ODB A;  4U23 A;  4EQB A;  4FEB A;  4FAJ A;  3KSJ A;  1LCT A;  1FQD A;  2QS3 A;  3G3G A;  3O6I A;  1B5J A;  3OSQ A;  2Z22 A;  3FUZ A;  3MP1 A;  4QSD A;  3GBB A;  4R2F A;  3LUY A;  3HHF A;  2DE4 A;  2O7U A;  1FQA A;  4OWD A;  4R75 A;  3WAE A;  3ZKK A;  4DIG A;  2NOO A;  2F34 A;  2PMS A;  5LOM A;  2DE3 A;  2Y7I A;  1BIY A;  3DLN A;  2Q2C A;  4GL8 A;  2AL4 A;  1ZU0 A;  1NFT A;  2Y7W A;  3C4M A;  1N04 A;  3PMV A;  3IOV A;  5ISU A;  2G29 A;  2QS1 A;  1ELJ A;  1B0H A;  1FTO A;  1MQD A;  3EQ1 A;  4ND9 A;  3EN3 A;  5I2N B;  3MVX A;  1P1W A;  2H5Y A;  3OD7 A;  1SBP A;  4G8M A;  3S4U A;  3VVF A;  5I59 B;  2OCU A;  3WAF A;  4DXU A;  3IL1 B;  1N7X A;  4NWD A;  4O3B A;  3PPR A;  4Q30 B;  2I3W A;  3D4G A;  1P99 A;  2DOJ A;  4LQ5 A;  1SW5 A;  2ONS A;  1B1X A;  3C36 A;  2UVH A;  3K00 A;  1FTM A;  4IO4 A;  5HM4 B;  5IKB A;  3RY3 A;  1BP5 A;  1TXF A;  1SI1 A;  1URG A;  2R6G E;  3CG3 A;  1NNP A;  4H65 A;  4PFY A;  4F19 A;  3U92 A;  4OYV A;  4DDD A;  4QSC A;  1ZMG A;  4WEP A;  2Y84 A;  3UA8 A;  1LFI A;  4EXK A;  4OER A;  2DP8 A;  4AQ4 A;  5B70 A;  1MQH A;  4RPN A;  2GHA A;  4DLD A;  4EDP A;  3K01 A;  1B4Z A;  4G68 A;  2KLF A;  2Z8D A;  3CI8 A;  3UN6 A;  1MG1 A;  3BFT A;  3QXM A;  5CBS A;  4KI0 E;  2Q8J A;  1US4 A;  2I48 A;  3K6U A;  2RC9 A;  3T9V A;  3TDJ A;  5AA4 A;  1DPE A;  3TQW A;  4BLA A;  3QYT A;  2A5T B;  1SW2 A;  4H1X A;  1USY E;  1MXY A;  4DCX A;  4H8I A;  1B3F A;  2B65 A;  1NL5 A;  4FOR A;  4JXI A;  4N6P A;  5CMK A;  4UAC A;  4RA1 A;  3IJX B;  5KZT A;  3HO7 A;  3SEW A;  2REJ A;  1FQC A;  4LON B;  1T0K A;  3MP8 A;  1B0L A;  3EHT A;  1QKB A;  3K6W A;  1JEU A;  3KN3 A;  3KFM A;  1I6A A;  3SKP A;  1N76 A;  1CB6 A;  2H25 A;  2AYS A;  3IAZ A;  2QRY A;  3G7W A;  3U72 A;  3VV5 A;  1DOT A;  4OXV A;  4NF6 A;  2HFB A;  5TP9 B;  1B5I A;  2A5T A;  4E0X A;  3S9N C;  1NNF A;  2HQ0 A;  1UTB A;  1JW4 A;  4I1D A;  3TTL A;  4U1Z A;  4FEC A;  1FW0 A;  4I8C A;  3T9U A;  2O68 A;  5H8N A;  5CM6 A;  1P1U A;  4DXC A;  1ZLQ A;  4PQJ A;  3R7X A;  3K0V A;  4R6K A;  5KCJ A;  3VLW A;  4GVO A;  4JSO A;  3FV2 A;  3K2D A;  4LZ5 A;  3HN0 A;  2DQV A;  3KSX A;  2PYY A;  5I57 A;  1AL3 A;  3GXA A;  2H99 A;  1II5 A;  3DM0 A;  1A8F A;  4TQU Q;  3TEL A;  3VFJ A;  2Z8E A;  2OBG A;  5M2V A;  3TAJ A;  1B3L A;  3TFL A;  5DYH A;  1SW4 A;  3E9X A;  5L9M A;  2I58 A;  1I6B A;  2R9J A;  3MUQ A;  2Z8F A;  3QSL A;  4X1B A;  1N3X A;  5I59 A;  4QFL A;  2XX7 A;  3C32 A;  1ZTY A;  3KG2 A;  4HCY A;  1URS A;  4IGR A;  3TCF A;  3L6H A;  3IJO B;  3VVD A;  1CE2 A;  3IB1 A;  4KCC A;  3MPL A;  2I0B A;  4BDL A;  1BLF A;  3TMG A;  1B4H A;  4OFO A;  5KDT B;  2XXT A;  4PFT A;  1SI0 A;  3E13 X;  5CBR A;  5JEI A;  1B3H A;  3N5L A;  3K1P A;  1B32 A;  1PBP A;  1LAX A;  2XXY A;  3KJ7 A;  2QJE A;  3OSR A;  1SQY A;  1F9B A;  4H6D A;  4U22 A;  1LB9 A;  2VD3 A;  3R26 A;  4H8J A;  4P0G A;  1GV8 A;  4OFJ A;  1OMP A;  1KWH A;  1R9Q A;  3H6U A;  3S9E A;  1B6H A;  1XVY A;  2PX1 A;  4WKM A;  4ZEB A;  4R6Y A;  4ESX A;  3F11 A;  2V84 A;  1NH8 A;  3ECR A;  4Q5T A;  3VVE A;  3HHG A;  3MZB A;  1MY2 A;  1H44 A;  4QFO A;  4F3S A;  4F31 B;  3O6G A;  1FQE A;  1XHY A;  3EPE A;  4KQP A;  5I84 A;  3IB0 A;  3KJT A;  4POX A;  1B05 A;  1Y9U A;  1LGB C;  3EF7 A;  3FXU A;  4G2Z A;  2XX8 A;  2PT2 A;  5DTB A;  2ZMB A;  3BKI B;  3N94 A;  3CSB A;  3FAS A;  1SW1 A;  2OZZ A;  1LB8 A;  4JWX A;  4U4X A;  5TPA B;  4JWY A;  4HTG A;  1MXV A;  3RNN A;  1MH4 A;  2XXW A;  1LAF E;  2GFE A;  4BDM A;  3OEK A;  3OO8 A;  1B5H A;  5H8F A;  4ZE8 A;  4YMA A;  2AIX A;  4C1T A;  4LAT A;  4XTC Q;  5HBC A;  3GZG A;  1TT1 A;  3MQ9 A;  3T9X B;  5ICQ A;  4OHN A;  4G8N A;  2IEE A;  5FTH A;  2O6A A;  3VLV A;  2X7P A;  2QL3 A;  3TUS A;  2UVI A;  3H6T A;  1GTK A;  1A8E A;  1UTH A;  3Q27 A;  3A3U A;  3M3L A;  3OEN A;  2W7Y A;  1HSL A;  3LC8 A;  3ONM A;  2HEU A;  4ELR A;  5BUU A;  2LAO A;  4IB2 A;  4IO6 A;  3U93 A;  4ELQ A;  1IEJ A;  5DVJ A;  5B7D A;  5TU0 A;  2GRV A;  5AA2 D;  4U2R A;  4P0I A;  3V83 A;  1PC3 A;  3OXN A;  1SD3 A;  3U94 A;  3V89 B;  4IGT A;  4JDF A;  2AL5 A;  4LUB A;  4OEN A;  1GGG A;  1OQG A;  1SVX B;  1LBB A;  1VFE A;  3G3H A;  1LBC A;  1M5E A;  3C31 A;  4NF5 B;  4R74 A;  4BDQ A;  1VE4 A;  5FHO A;  1FCK A;  5I58 B;  1ATG A;  2BJJ X;  3H03 A;  5I2K A;  5H8Q B;  1XOC A;  1SYI A;  4IO2 A;  4JB7 A;  1D9Y A;  1UIU A;  1XC1 A;  3DP8 A;  4NF8 A;  4OES A;  4BDN A;  5KCJ B;  1ZIU A;  4NE4 A;  3THI A;  3QUF A;  1Y1M A;  2GHB A;  1IZ1 A;  4OVJ A;  1ZKB A;  3OO6 A;  4PE5 B;  5CMC A;  2RCA A;  5HPQ A;  1OLA A;  2HZL A;  3M3F A;  3KBR A;  3V8X B;  3IK6 B;  3DEL B;  4RXL A;  5CI5 A;  4ELO A;  2XXX A;  1N7W A;  1M5C A;  2D3I A;  4FE8 A;  4OTE A;  3PPQ A;  3RTF B;  4NWC A;  4KYE A;  3I5O A;  2DVC A;  1A54 A;  4XKP A;  5F1Q A;  5JTY B;  4O3A A;  3O97 A;  3OO9 A;  2ZYM A;  3K1N A;  3B6T A;  5J1D A;  3MW0 A;  4GLI A;  3SET A;  2QS4 A;  4NF4 A;  1JVY A;  2XXV A;  1JET A;  2H9B A;  1IXI A;  3BBR A;  3O2A A;  3OO7 A;  4GFR A;  2F6G A;  1PEB A;  1EU8 A;  3RPW A;  1MH3 A;  3VLU A;  2Q88 A;  1ANF A;  2R71 A;  1O7T A;  3W9V A;  1BTJ A;  1Y1Z A;  1N0T A;  1UQW A;  3HCQ A;  4QFN A;  4RK2 A;  4RPO A;  3SDF A;  1FQF A;  3QIM A;  4G8H A;  1OIB A;  3Q25 A;  4RY1 A;  4YKI A;  4G4P A;  2YPN A;  5ELV A;  1IQ7 A;  1J1N A;  4H0W A;  2I6E A;  4KYD A;  1PB7 A;  2F7A A;  2UXA A;  2V3T A;  1R1N A;  2XHD A;  3E4R A;  3N26 A;  3PUV E;  4LZ8 A;  1GVC A;  1R9L A;  4XIG Q;  5ITP A;  4OQO A;  4KD5 A;  4C0R A;  2Q89 A;  1MQJ A;  3MVW A;  3PPO A;  4E0W A;  5JTY A;  1A55 A;  3VDF A;  1NNK A;  2XXU A;  5A5X B;  3DP6 A;  3QUJ A;  1D4N A;  2RCB A;  4QF9 A;  4THI A;  1TFA A;  2Q2A A;  4LVQ A;  3IR1 A;  3FAT A;  4H5F A;  1MXU A;  4Q0C A;  2ESN A;  1QW0 A;  2RIN A;  3MPK A;  4YB5 A;  4C1U A;  2ZYK A;  4QSE A;  1EZ9 A;  1NH7 A;  3H6V A;  4RNS A;  4YKP A;  1OVB A;  2WKY A;  5H8Q A;  5H8H A;  4HCW A;  3W9W A;  2H98 A;  3H3G A;  3HPI A;  3OEL A;  3PV0 E;  4JSD A;  2XXQ A;  4L17 A;  4ONY A;  5AA2 A;  4EXL A;  3FV1 A;  3KN8 A;  4PFW A;  4POW A;  3TCG A;  4U1O A;  1B52 A;  2FA7 A;  1A99 A;  3MP6 A;  1JEV A;  1RKM A;  3SES A;  1S50 A;  1B51 A;  5H8H B;  1YAE A;  4GD5 A;  3TKD A;  1LLS A;  1RYX A;  3M3K A;  2D21 A;  4IY5 A;  1DTG A;  3K1M A;  4NTL A;  1Z7M E;  4QHQ A;  2ZNU A;  3TTR A;  2I4B A;  2QMW A;  5K2Y A;  1MXW A;  1JNF A;  1QUI A;  3QK6 A;  4EQ9 A;  3FZV A;  5AE4 A;  4H67 A;  1O63 A;  2Y7R A;  3ILT B;  3PUZ E;  1YPN A;  4ISU A;  4DXB A;  3CR9 A;  4Z7E A;  4F3P A;  1WVJ A;  2V93 A;  3PD9 A;  4MLQ A;  4ESW A;  3KEI A;  3A09 A;  3C33 A;  4R73 A;  1FQB A;  4KFQ A;  3FXR A;  1QVS A;  2VHA A;  5FHM A;  4WXJ A;  2RF1 A;  3IOR A;  4TLL B;  2ZNS A;  2I3V A;  4RK9 A;  1QKA A;  2H4I A;  3Q26 A;  4TOZ A;  1VR5 A;  3PGF A;  4HW8 A;  1MQG A;  2IA4 A;  5F7V A;  1JVX A;  3MJN A;  4F39 A;  2B3B A;  3MBP A;  4DCY A;  3TZA A;  3CFZ A;  4F2Q A;  1H3D A;  3H4Z A;  2DWJ A;  2F35 A;  3TYH A;  1AMF A;  4ELP A;  1DTZ A;  3IO4 A;  3MZ1 A;  1D3K A;  4NF4 B;  1NNT A;  3CIJ A;  4IY6 A;  3SER A;  4EUO A;  1VFD A;  3H7M A;  1RYO A;  4OEU A;  4LP2 B;  5AA2 B;  5DEX B;  3KGC A;  5ICT A;  3PUW E;  4FJP A;  4YKK A;  3RGY A;  1QUJ A;  4R72 A;  4YMB A;  2VGQ A;  4PFU A;  3ZS6 A;  1M5D A;  3IB2 A;  1NMU A;  1XT8 A;  4YAH X;  3MVZ A;  1XS5 A;  3PU5 A;  2X26 A;  4XKQ A;  1D9V A;  2F7C A;  2Q9T A;  4ZEK A;  4O3C A;  3FVN A;  3T22 A;  1NKX A;  1MY4 A;  1PBQ A;  1QUL A;  1JQF A;  2DS9 A;  2F78 A;  2NXO A;  1IIW A;  2XXH A;  1Q1K A;  3CVG A;  3KOT A;  2I49 A;  4NMY A;  4QRZ A;  3TOD A;  3ZKL A;  5A5X A;  2PBW A;  4GIZ A;  4I9D A;  1B58 A;  4R9G A;  3Q28 A;  5I2K B;  1PB8 A;  1YTV A;  3B7D A;  4ZEI A;  3H06 B;  1JW1 A;  1N3W A;  3PMX A;  5DEX A;  2VD2 A;  3TTM A;  4ECF A;  1ZJL A;  3MAM A;  5I58 A;  1FTK A;  3OOA A;  2A5S A;  3TEP A;  2DXY A;  4LQ2 A;  1MM7 A;  4QFK A;  3VXC A;  3T96 B;  1H43 A;  1LAG E;  2VOZ A;  1LST A;  4DE8 A;  2ABH A;  1MRP A;  3K6X A;  2HXW A;  4TLM B;  5BWJ A;  4AB6 A;  1EZO A;  4FIM A;  4ZS9 A;  4OMB A;  5CMM A;  3RLF E;  1EZP A;  5L9S A;  2GH9 A;  1MPB A;  3E3K A;  4BDO A;  3O6H A;  4M1V A;  2RKM A;  2XD2 A;  2XD3 A;  4PP0 A;  5CRY A;  5EHS A;  3JZJ A;  3TPA A;  3UK4 A;  5H8N B;  1IUD A;  3G3K A;  3D4C A;  1MXX A;  4OFL A;  4X9T A;  3C9H A;  1I6Q A;  2Y7P A;  3AXF A;  3B6Q A;  4XXU A;  4GXA A;  4ZZE A;  1UTH B;  3R6U A;  4IO3 A;  2P1S A;  2O1L A;  1EH3 A;  3I3V A;  1GR2 A;  3K02 A;  4OET A;  4XKR A;  1IXC A;  1Y3N A;  4BDR A;  4R2B A;  4M4G A;  3CFX A;  3MC2 A;  4MH5 A;  1R6Z A;  2PT1 A;  4OEV A;  1MDQ A;  3FJG A;  4R6H A;  5DVF A;  5ITO A;  2NVU B;  3GLB A;  3IOU A;  2M8C A;  4XKN A;  2VP1 A;  3IX1 A;  3U8Q A;  2DSF A;  3USD A;  1XVX A;  2DWI A;  3QAX A;  2ZYN A;  4GL0 A;  4JBZ A;  4YU0 A;  3V5A A;  3S9L C;  3L6G A;  3EHU A;  3UP9 A;  1A40 A;  4FAT A;  1IXH A;  2E1S A;  2F8D A;  1LCF A;  1PDA A;  1OLC A;  3FGS A;  1DSN A;  4RYA A;  3GBA A;  3FJM A;  4MLV A;  2F5X A;  3PPP A;  3BFU A;  1DPP A;  1IIT A;  1POT A;  1O64 A;  3FVO A;  3O29 A;  4R9F A;  3EHS A;  1OQH A;  4MFI A;  2DWA A;  4N07 A;  1M5B A;  2RC8 A;  2XX9 A;  2UYE A;  3RQT A;  3UOR A;  1B7Z A;  1P1O A;  3LBS A;  4KR5 A;  3RTW B;  5CC2 A;  4U21 A;  3C34 A;  5FTI A;  4PET A;  2HZK A;  3VXB A;  4GRK A;  2ONK E;  3I6V A;  4F1U A;  1MPC A;  2REG A;  4F3B A;  4ZE9 A;  1SDX A;  4GWO A;  3PUY E;  2ZYO A;  1MY1 A;  2FNC A;  3TCH A;  3TTK A;  1Y3Q A;  3A3C A;  2E0S A;  3LSL A;  3KZG A;  2V3U A;  1Q35 A;  1MY3 A;  1S9T A;  4I62 A;  5K2X A;  1B9J A;  3OMB A;  4N13 A;  5L9O A;  1N84 A;  1YCJ A;  1DMB A;  4Q8R A;  1JW5 A;  3T66 A;  5I2N A;  1B7H A;  4EF2 A;  5L8D A;  1WOD A;  2F97 A;  1B3E A;  2HAV A;  2O84 X;  5DT6 A;  3HST A;  3U1O A;  5DVI A;  3PPN A;  1P1Q A;  3MWB A;  3KOS A;  3C35 A;  3UIF A;  1MXZ A;  1Z7N E;  3HV1 A;  2OJT A;  3TTN A;  1ZBM A;  4X48 A;  4F2O A;  3M8U A;  4KHZ E;  1MM6 A;  4QFP A;  3K4U A;  4DZ1 A;  1AIV A;  3SEV A;  2HCA A;  5AA1 A;  2CMO A;  1AH5 A;  1OVT A;  2O51 A;  2ZNT A;  2Y7K A;  4IO7 A;  4F22 A;  2QMX A;  4Z0I A;  1VSO A;  3CG1 A;  1MQI A;  5KDT A;  1B40 A;  4WED A;  4EF1 A;  1Y4T A;  4HS7 A;  3LSF B;  1A7L A;  2ZXT A;  4P11 A;  4EQ7 A;  5IAI A;  2QS2 A;  2HAU A;  3FVG A;  1FTL A;  1MS7 A;  1BKA A;  2O7I A;  2ALU A;  2UVG A;  4JWO A;  4NF6 B;  4YZZ A;  5TP9 A;  4LZ7 A;  5JK4 A;  1MPD A;  4ZDM A;  2QSX A;  1H76 A;  4YKJ A;  2P2A A;  3IOT A;  1S7Y A;  3G3J A;  3N6T A;  4IO5 A;  4AB5 A;  2OWS A;  3LSX A;  1B1H A;  2O69 A;  4F18 A;  3T9H B;  4G68 C;  1Y3P A;  3PD8 A;  3RN8 A;  2DXR A;  1HSJ A;  3IO6 A;  4GXS B;  1US5 A;  2ONR A;  3FXQ A;  1POY 1;  3FJ7 A;  3PMW A;  4K3F A;  4GOT A;  4G77 A;  4KCD A;  3CRB A;  3LR1 A;  3RUM A;  4ZEC A;  4NF8 B;  1B46 A;  3FVK A;  2OWT A;  2CZL A;  1Y20 A;  3W15 C;  5AA3 A;  3O9P A;  3SEX A;  2F7B A;  3DP4 A;  3PUX E;  4NED A;  3UGW A;  4NF5 A;  4LA9 A;  4MF3 A;  1M5F A;  5I56 B;  2X7Q A;  3P7I A;  1HSE A;  1WDN A;  4G68 B;  4F29 A;  2XXP A;  4GF8 A;  1I69 A;  2F36 A;  5I57 B;  3S9M C;  4YB6 A;  1Y4C A;  2DYX A;  1SYH A;  3CSG A;  2O1M A;  1USY H;  1TFD A;  3Q29 A;  1QJM A;  3JYR A;  2DE2 A;  3OEM A;  4X1D A;  2THI A;  2YLN A;  3N6U A;  3G3F A;  2DVZ A;  3FIR A;  2QPQ A;  3H6W A;  1AOV A;  3CFL A;  3IOW A;  1PB9 A; 
#chains in the Genus database with same CATH topology
 2D5W A;  4YIC A;  5H8S A;  2B3F A;  3O28 A;  2YJP A;  5EYF A;  4UA8 A;  4U4S A;  5TPA A;  4N91 A;  5FHN A;  1NV4 A;  4KPT A;  2UVJ A;  2WYK A;  3MZ9 A;  4H5G A;  3T93 B;  4PFB A;  3FBP A;  4ZEF A;  1UIV A;  3K6V A;  1MDP 1;  4FEB A;  3G3G A;  2Z22 A;  3FUZ A;  4OVT A;  3LUY A;  4R2F A;  4N81 A;  1FQA A;  4DIG A;  2F34 A;  2DE3 A;  2Y7I A;  2Q2C A;  2AL4 A;  3PMV A;  1FTO A;  1SBP A;  1N7X A;  3PPR A;  2DOJ A;  1B1X A;  1BP5 A;  1TXF A;  2R6G E;  5KCJ B;  4F19 A;  3UA8 A;  1LFI A;  4AQ4 A;  5B70 A;  3K01 A;  3QXM A;  3BFT A;  2CEY A;  2Q8J A;  3TQW A;  4H1X A;  1FBD A;  1USY E;  1NL5 A;  1LBW A;  2REJ A;  1T0K A;  3EHT A;  1N76 A;  3VV5 A;  4N15 A;  4OXV A;  5ET8 A;  1B5I A;  1NNF A;  4I1D A;  1FW0 A;  4I8C A;  4I40 A;  4DXC A;  3K0V A;  1DCU A;  1LBV A;  5KCJ A;  3VLW A;  4JSO A;  4PF6 A;  2PYY A;  1A8F A;  3TAJ A;  1B3L A;  3TFL A;  1SW4 A;  5EQA A;  5L9M A;  2R9J A;  2Z8F A;  1NUY A;  1N3X A;  1NV6 A;  2XX7 A;  4QFL A;  3TCF A;  3IJO B;  1CE2 A;  2I0B A;  1SI0 A;  3K1P A;  3TTR A;  1IMF A;  4H6D A;  4U22 A;  1NUW A;  2V84 A;  4Q5T A;  3HHG A;  4F3S A;  4F31 B;  1LGB C;  2XX8 A;  3BKI B;  5B7D A;  3CSB A;  5TPA B;  1G0H A;  2GFE A;  4PBQ A;  4ZE8 A;  4YMA A;  4XTC Q;  5HBC A;  3T9X B;  2O6A A;  2QVU A;  1UTH A;  1IME A;  1HSL A;  1KA0 A;  1IMB A;  3ONM A;  3U93 A;  1IEJ A;  4P56 A;  5TU0 A;  1PC3 A;  2AL5 A;  2BJI A;  1VFE A;  1M5E A;  4NF5 B;  1FCK A;  1ATG A;  2BJJ X;  5H8Q B;  2ZZW A;  1UIU A;  1XC1 A;  4OES A;  4NE4 A;  3THI A;  2GHB A;  1IZ1 A;  4QBA A;  3OO6 A;  1K9Y A;  2D3I A;  4OTE A;  4NWC A;  4XKP A;  5J1D A;  3SET A;  1JVY A;  3BBR A;  4GFR A;  3VLU A;  1Y1Z A;  4RK2 A;  4GWW A;  2F3D A;  1FQF A;  1OIB A;  2YPN A;  1IQ7 A;  4H0W A;  4LZ8 A;  3PUV E;  1GVC A;  3N26 A;  4HE0 A;  3PPO A;  1NNK A;  3RYD A;  4N4U A;  1D4N A;  3T1B A;  1FPG A;  4I3E A;  3IR1 A;  4H5F A;  1MXU A;  2ESN A;  4QSE A;  3H6V A;  4RNS A;  5H8Q A;  5H8H A;  1FPL A;  4OAN A;  3OEL A;  3FV1 A;  1RDX A;  4FBP A;  1JEV A;  1RKM A;  2F3B A;  4LN5 A;  1DTG A;  3K1M A;  1Z7M E;  2Y7R A;  4DXB A;  2V93 A;  4KFQ A;  1DBZ A;  1QVS A;  3Q26 A;  1VR5 A;  3MJN A;  4F39 A;  3CFZ A;  4XF5 A;  3MZ1 A;  4NF4 B;  3CIJ A;  1RYO A;  2XWV A;  3KGC A;  3U65 A;  5T3J A;  4YKK A;  4R72 A;  4YMB A;  3IB2 A;  4YAH X;  4PAI A;  1XS5 A;  3PU5 A;  2F7C A;  2DS9 A;  1MY4 A;  2NXO A;  1QUL A;  3OOA A;  3CVG A;  4QRZ A;  2XXH A;  1Q1K A;  4GIZ A;  4R9G A;  1PB8 A;  5DEX A;  1JW1 A;  3S9E A;  3TTM A;  2XXK A;  5FBP A;  2WYP A;  2ABH A;  2HXW A;  2WX9 A;  4TLM B;  5BWJ A;  1EZO A;  4ZS9 A;  4OMB A;  4OVR A;  4BDO A;  2XD2 A;  3UK4 A;  4MNC A;  3G3K A;  1EYI A;  1UTH B;  4IO3 A;  2P1S A;  2O1L A;  1EH3 A;  3I3V A;  4XKR A;  1Y3N A;  4BDR A;  4M4G A;  5ITO A;  2PT1 A;  4R6H A;  4GX3 A;  2NVU B;  1NUX A;  3USD A;  3V5A A;  2ZYN A;  4JBZ A;  3L6G A;  3UP9 A;  1IXH A;  2E1S A;  2F8D A;  3FGS A;  1OLC A;  3GBA A;  3FJM A;  2F5X A;  3PPP A;  3BFU A;  3ISP A;  3EHS A;  4N07 A;  1M5B A;  2RC8 A;  4X8R A;  3UOR A;  1P1O A;  5I5P A;  3LBS A;  5CC2 A;  2HZK A;  1MPC A;  2REG A;  4ZE9 A;  1SDX A;  2ZYO A;  1MY1 A;  2HXR A;  3LSL A;  2CZI A;  1MY3 A;  3T66 A;  1WOD A;  2HAV A;  5DVI A;  3PPN A;  3UIF A;  3KOS A;  1Z7N E;  2OJT A;  3M8U A;  2O51 A;  4IO7 A;  2Y7K A;  4Z0I A;  4MNP A;  1MQI A;  4EF1 A;  4P11 A;  2ZXT A;  4EQ7 A;  1NV5 A;  2HAU A;  4YZZ A;  1BKA A;  2ALU A;  4NF6 B;  4LZ7 A;  4IO5 A;  1S7Y A;  2GQ1 A;  4K3F A;  3FJ7 A;  3PMW A;  3CRB A;  3LR1 A;  3FVK A;  4OVP A;  5I7I A;  4NED A;  4LA9 A;  1WDN A;  1I69 A;  4YB6 A;  1Y4C A;  1SYH A;  3CSG A;  1IMC A;  2DE2 A;  4X1D A;  2YLN A;  3N6U A;  3FIR A;  1AWB A;  3IOW A;  1PB9 A;  2P0S A;  1L5T A;  5CMB A;  4MBP A;  4KYS A;  4RJZ A;  2OK2 A;  3ILU B;  3ZSF A;  4OVS A;  4YB7 A;  3FD3 A;  2OLB A;  3G3I A;  1IXG A;  2KR0 A;  1B2H A;  3MVY A;  4GQO A;  4H46 A;  3RT6 B;  1QUK A;  3SEY A;  1URD A;  5AA4 B;  3S2V A;  1LFG A;  2FYI A;  2PFY A;  3LSW A;  4F3G A;  4FED A;  4U23 A;  1FQD A;  4OWD A;  2O7U A;  3ZKK A;  2NOO A;  3EQ1 A;  2QVV A;  5I2N B;  3OD7 A;  2OCU A;  3WAF A;  4Q30 B;  2I3W A;  2ONS A;  5IKB A;  3T0J A;  1YZ0 A;  4IO4 A;  4H65 A;  1SI1 A;  4EXK A;  4WEP A;  2Y84 A;  4DLD A;  1B4Z A;  3UN6 A;  1MG1 A;  4KI0 E;  1DPE A;  1KA1 A;  2HHM A;  1FPF A;  4N6P A;  3ROJ A;  5KZT A;  1FQC A;  3K6W A;  3KN3 A;  1I6A A;  4OVQ A;  4DI4 B;  2AYS A;  2QRY A;  1DOT A;  4NF6 A;  2A5T A;  3S9N C;  2HQ0 A;  1UTB A;  4FEC A;  2Q8M A;  5H8N A;  4PQJ A;  3K2D A;  1EYJ A;  5I57 A;  3KSX A;  1AL3 A;  4TQU Q;  1II5 A;  4GX4 A;  5M2V A;  3E9X A;  2I58 A;  4X1B A;  3MUQ A;  3QSL A;  4PCD A;  4DI3 D;  3MPL A;  3E13 X;  3N5L A;  2OX3 A;  2QJE A;  1IMA A;  1SQY A;  4H8J A;  5J16 A;  1R9Q A;  2FIX A;  1XVY A;  3IFA A;  4ESX A;  1NH8 A;  4P9K A;  1FQE A;  3EPE A;  4KQP A;  5DTB A;  4JWX A;  1SW1 A;  2OZZ A;  4HTG A;  1MXV A;  3OO8 A;  4HXV A;  1B5H A;  5H8F A;  2AIX A;  4C1T A;  4NGU A;  3GZG A;  4OHN A;  4G8N A;  2IEE A;  5FTH A;  3VLV A;  3B50 A;  2HPG A;  5LTC A;  2L5V A;  3M3L A;  3OEN A;  2W7Y A;  3LC8 A;  5BUU A;  4IB2 A;  4IO6 A;  4ELQ A;  5DVJ A;  4U2R A;  2XA5 A;  1SD3 A;  4IGT A;  4JDF A;  4P8B A;  1GGG A;  1OQG A;  1LBB A;  1LBZ A;  1LBC A;  3C31 A;  4IO2 A;  4JB7 A;  4NF8 A;  1ZIU A;  1Y1M A;  5CMC A;  3M3F A;  3KBR A;  3DEL B;  2XXX A;  1N7W A;  4KYE A;  5F1Q A;  5JTY B;  4O3A A;  3OO9 A;  3MW0 A;  4NF4 A;  3HFU A;  2XXV A;  2H9B A;  1IXI A;  3OO7 A;  2F6G A;  3RPW A;  1MH3 A;  3CHG A;  2R71 A;  1BTJ A;  4O7M A;  4QFN A;  4RPO A;  1NV0 A;  4G4P A;  4KYD A;  3E4R A;  2UXA A;  1R9L A;  4OQO A;  4C0R A;  2P3V A;  5A5X B;  4QF9 A;  1TFA A;  2B4M A;  2Q2A A;  1QW0 A;  2WKY A;  3H3G A;  4L17 A;  5AA2 A;  4ONY A;  4EXL A;  4POW A;  3TCG A;  5F24 A;  1S50 A;  1B51 A;  5H8H B;  1YAE A;  1LLS A;  1RYX A;  3M3K A;  5K2Y A;  1MXW A;  1QUI A;  5AE4 A;  1YPN A;  4F3P A;  3PD9 A;  4ESW A;  1DK4 A;  1FQB A;  3IOR A;  2ZNS A;  2I3V A;  2H4I A;  4HW8 A;  2IA4 A;  1JVX A;  3MBP A;  3TYH A;  4ELP A;  1DTZ A;  3IO4 A;  3H7M A;  3MYU A;  5ET6 A;  1G0I A;  1M5D A;  1XI6 A;  4O3C A;  3FVN A;  1FPB A;  1IIW A;  5A5X A;  4GWS A;  3Q28 A;  1YTV A;  1N3W A;  2VD2 A;  5IM2 A;  2DXY A;  4QFK A;  3VXC A;  1YXI A;  4AB6 A;  4FIM A;  5L9S A;  4PF8 A;  3E3K A;  3O6H A;  3TPA A;  2WBD A;  2Y5L A;  3D4C A;  1I6Q A;  4XXU A;  3K02 A;  4OET A;  1IXC A;  4R2B A;  5DVF A;  3GLB A;  3IOU A;  2M8C A;  3U8Q A;  2DSF A;  3QAX A;  4GL0 A;  3RPL A;  3EHU A;  1A40 A;  4RYA A;  1DSN A;  2JJK A;  4MLV A;  1DPP A;  1POT A;  1O64 A;  2XX9 A;  4KR5 A;  1YYZ A;  3E78 A;  4I62 A;  1B9J A;  3OMB A;  4N13 A;  4NF0 A;  1YCJ A;  1DMB A;  2WBB A;  3FXB A;  1B7H A;  4O94 A;  3QMF A;  4F2O A;  1MM6 A;  3K4U A;  4DZ1 A;  1AH5 A;  1OVT A;  4F22 A;  2QMX A;  1VSO A;  4WED A;  1Y4T A;  3LSF B;  2QS2 A;  3FVG A;  2O7I A;  4YKJ A;  4AB5 A;  2OWS A;  3LSX A;  4PFI A;  3T9H B;  3IO6 A;  2Q74 A;  1POY 1;  3FXQ A;  4G77 A;  3RUM A;  1RDY A;  1FBH A;  2OWT A;  4P1L A;  3E79 A;  2F7B A;  4X04 A;  5I56 B;  4G68 B;  2XXP A;  5I57 B;  3S9M C;  1USY H;  3JYR A;  3G3F A;  3H6W A;  1OQH A;  4MFI A;  1HSJ A;  3TQL A;  1UTB B;  5EHM A;  4MHF A;  2ANJ A;  2MKZ A;  4ZED A;  3VE1 B;  2XXI A;  3O66 A;  4KXP A;  4F1V A;  1LAH E;  2FBP A;  2R8T A;  3JV9 A;  1BK4 A;  4ZZA A;  2Z23 A;  4GWY A;  4AS4 A;  3SEU A;  3B6W A;  4MMP A;  4PC9 A;  1LFH A;  1MY0 A;  4GBV A;  1LCT A;  2QS3 A;  3O6I A;  1B5J A;  3MP1 A;  4QSD A;  3GBB A;  4R75 A;  2PMS A;  1BIY A;  5EYG A;  5LDZ A;  4GL8 A;  1ZU0 A;  1D9Q A;  5ISU A;  3IOV A;  5IGA A;  1ELJ A;  1B0H A;  3EN3 A;  1P1W A;  2H5Y A;  3VVF A;  4DXU A;  4O3B A;  3D4G A;  5ET7 A;  1K9Z A;  1P99 A;  4LQ5 A;  3LV0 A;  4NHB A;  4JVI A;  3RY3 A;  5CM6 A;  1URG A;  4NQ8 A;  3CG3 A;  1NNP A;  1EZP A;  3U92 A;  4OYV A;  4DDD A;  4OER A;  2DP8 A;  1MQH A;  2GHA A;  5ESY A;  1FBC A;  2KLF A;  2Z8D A;  3TDJ A;  3K6U A;  3T9V A;  4BLA A;  1SW2 A;  2FVZ A;  2B65 A;  4JXI A;  5CMK A;  4MX6 A;  3IJX B;  3RPL B;  4LON B;  1QKB A;  1JEU A;  3KFM A;  3SKP A;  4O7I A;  4E0X A;  2HFB A;  1JW4 A;  3GYY A;  3T9U A;  1NV7 A;  2O68 A;  5IZ3 B;  1P1U A;  1ZLQ A;  3R7X A;  4R6K A;  4GVO A;  3FV2 A;  4LZ5 A;  1NV3 A;  3GXA A;  5I59 A;  1LBY A;  3C32 A;  1ZTY A;  1NV1 A;  3KG2 A;  4MNI A;  3VVD A;  3L6H A;  3IB1 A;  4BDL A;  4H45 A;  1BLF A;  1B4H A;  4OFO A;  5KDT B;  4PFT A;  1RDZ A;  5CBR A;  1B3H A;  1B32 A;  1PBP A;  3KJ7 A;  4EUO A;  1F9B A;  1LB9 A;  2VD3 A;  4P0G A;  1OMP A;  1B6H A;  4WKM A;  4JVC A;  4R6Y A;  3ECR A;  3MZB A;  4QFO A;  4PDH A;  5I84 A;  1B05 A;  1Y9U A;  3EF7 A;  3FXU A;  4G2Z A;  2ZMB A;  3FAS A;  1LB8 A;  2XXW A;  1LAF E;  3OEK A;  2VT5 A;  2QL3 A;  2UVI A;  1GTK A;  4MEV A;  2HEU A;  2GRV A;  3U94 A;  4LUB A;  4R74 A;  5I58 B;  5FHO A;  1SYI A;  1D9Y A;  3QUF A;  4PE5 B;  2HZL A;  3V8X B;  5CI5 A;  5IZ1 A;  3I5O A;  2DVC A;  1A54 A;  3O97 A;  2QS4 A;  4NAP A;  1JET A;  1EU8 A;  2Q88 A;  1O7T A;  3W9V A;  1N0T A;  1UQW A;  3HCQ A;  3SDF A;  3QIM A;  4G8H A;  3Q25 A;  2Y5K A;  4RY1 A;  4YKI A;  5ELV A;  4JVD A;  1J1N A;  1PB7 A;  2F7A A;  2V3T A;  2XHD A;  5ITP A;  4XIG Q;  2Q89 A;  1MQJ A;  5JTY A;  1A55 A;  3VDF A;  2XXU A;  1NV2 A;  2RCB A;  4THI A;  1FPE A;  4YB5 A;  4C1U A;  1EZ9 A;  1NH7 A;  4YKP A;  1OVB A;  3W9W A;  3HPI A;  3PV0 E;  4JSD A;  4U1O A;  1B52 A;  3MP6 A;  2D21 A;  4I3Y A;  2I4B A;  2QMW A;  1CNQ A;  3QK6 A;  3FZV A;  3A29 A;  1O63 A;  3CR9 A;  4G61 A;  4MLQ A;  3A09 A;  3C33 A;  5FHM A;  2VHA A;  2RF1 A;  4TLL B;  4RK9 A;  1QKA A;  3MST A;  1MQG A;  2B3B A;  4DCY A;  2DWJ A;  1AMF A;  1D3K A;  1NNT A;  4IY6 A;  3SER A;  5AA2 B;  5ICT A;  3PUW E;  4FJP A;  4PFU A;  1IMD A;  3ZS6 A;  1NMU A;  3MVZ A;  1FRP A;  1D9V A;  2Q9T A;  2XWO A;  4OZ9 A;  5KDT A;  2VPO A;  4NMY A;  2PBW A;  4I9D A;  1B58 A;  1FJ9 A;  3KC0 A;  5I2K B;  3B7D A;  4ZEI A;  4ECF A;  1ZJL A;  5EYH A;  4LQ2 A;  4GWZ A;  4GBW A;  3T96 B;  1LAG E;  1LST A;  5CMM A;  2GH9 A;  4HE2 A;  1MPB A;  4M1V A;  2RKM A;  4PP0 A;  5EHS A;  5H8N B;  1LBX A;  4X9T A;  3C9H A;  4GXA A;  1GR2 A;  5DW8 A;  3MC2 A;  4MH5 A;  1MDQ A;  4FAT A;  1PDA A;  2XWI A;  1IIT A;  4N6D A;  3FVO A;  4XEQ A;  1B7Z A;  3C34 A;  4PET A;  2ONK E;  3I6V A;  4F3B A;  1FPI A;  4GWO A;  3TCH A;  3A3C A;  3KZG A;  2V3U A;  1Q35 A;  5K2X A;  1N84 A;  4EF2 A;  2O84 X;  5DT6 A;  3HST A;  3IFC A;  3C35 A;  3HV1 A;  2HCA A;  1FPJ A;  5AA1 A;  3CG1 A;  1B40 A;  5IZ3 A;  1MS7 A;  2UVG A;  4JWO A;  5TP9 A;  5JK4 A;  1MPD A;  1H76 A;  3N6T A;  2O69 A;  3NOH A;  1Y3P A;  3PD8 A;  3RN8 A;  2DXR A;  4GXS B;  2ONR A;  4KCD A;  4XFE A;  4ZEC A;  3O9P A;  4AS5 A;  3PUX E;  3UGW A;  4MF3 A;  1QGX A;  2KQZ A;  2X7Q A;  4GF8 A;  2F36 A;  1EYK A;  2DYX A;  3Q29 A;  4IR8 A;  2P3N A;  2THI A;  2QPQ A;  1AOV A;  4GRK A;  1FJ6 A;  2I4C A;  5I56 A;  4F1Y A;  2DWH A;  3B8B A;  4N6K A;  1SPI A;  2XXR A;  5H8F B;  4GWU A;  4P47 A;  2UYF A;  2I0C A;  2FIE A;  1TWY A;  1H45 A;  2V25 A;  3KN7 A;  2NWJ A;  1FTJ A;  1B3G A;  2RC7 A;  1P1N A;  3RT8 A;  2G93 A;  2NUV A;  2PVU A;  2V3Q A;  2F6P A;  1B7U A;  4GWX A;  3ODB A;  4FAJ A;  3KSJ A;  3OSQ A;  3HHF A;  2DE4 A;  3WAE A;  3DLN A;  2Y7W A;  1NFT A;  3C4M A;  1N04 A;  2G29 A;  2QS1 A;  1MQD A;  4ND9 A;  3D1R A;  2OWZ A;  5I3S A;  3MVX A;  4G8M A;  3S4U A;  5I59 B;  3IL1 B;  4P3L A;  1SW5 A;  3C36 A;  2UVH A;  3K00 A;  1FTM A;  5HM4 B;  4PFY A;  4N17 A;  4QSC A;  1ZMG A;  4RPN A;  4EDP A;  2B4L A;  4G68 A;  3CI8 A;  5CBS A;  1US4 A;  2I48 A;  2RC9 A;  5AA4 A;  3QYT A;  2A5T B;  4DCX A;  1MXY A;  4H8I A;  1B3F A;  4FOR A;  4UAC A;  4RA1 A;  3HO7 A;  3SEW A;  3MP8 A;  1B0L A;  5EQ8 A;  2QFL A;  2CZK A;  1CB6 A;  2H25 A;  3IAZ A;  3U72 A;  3G7W A;  5TP9 B;  3TTL A;  4U1Z A;  3BIH A;  3HN0 A;  2DQV A;  1FTA A;  2H99 A;  3DM0 A;  3VFJ A;  3TEL A;  2Z8E A;  2OBG A;  5DYH A;  5EQ9 A;  5A5L A;  1I6B A;  4HCY A;  1URS A;  2CZH A;  4IGR A;  4KCC A;  3TMG A;  2XXT A;  4N8Y A;  5JEI A;  1FPD A;  1LAX A;  2XXY A;  3OSR A;  4F18 A;  4ELO A;  1GV8 A;  1VDW A;  3R26 A;  4OFJ A;  3H6U A;  1KWH A;  2PX1 A;  4ZEB A;  3F11 A;  3VVE A;  1MY2 A;  1H44 A;  3O6G A;  2XWK A;  1XHY A;  3BIG A;  3IB0 A;  3KJT A;  4POX A;  4HE1 A;  2PT2 A;  3N94 A;  4U4X A;  4JWY A;  2WEF A;  3RNN A;  1MH4 A;  2VPN A;  4LAT A;  1TT1 A;  3MQ9 A;  5ICQ A;  2X7P A;  3TUS A;  3H6T A;  1A8E A;  3Q27 A;  3A3U A;  1INP A;  4ELR A;  2LAO A;  2V4C A;  5AA2 D;  4P0I A;  3V83 A;  3OXN A;  3V89 B;  4OEN A;  1SVX B;  3G3H A;  4BDQ A;  1VE4 A;  4MJO A;  3H03 A;  5I2K A;  1XOC A;  3DP8 A;  4BDN A;  4OVJ A;  1ZKB A;  5HPQ A;  2RCA A;  1OLA A;  3IK6 B;  4RXL A;  1FBE A;  4FE8 A;  1M5C A;  3PPQ A;  3RTF B;  4NX1 A;  4QXD A;  2ZYM A;  3K1N A;  3B6T A;  4GLI A;  4PGN A;  3O2A A;  1PEB A;  1ANF A;  2I6E A;  1R1N A;  4KD5 A;  3MVW A;  4PE3 A;  4E0W A;  3DP6 A;  3QUJ A;  1FPK A;  4OA4 A;  1Q9D A;  4LVQ A;  3FAT A;  4Q0C A;  3MPK A;  2RIN A;  2ZYK A;  5LOM A;  4HCW A;  2H98 A;  2XXQ A;  4PTK A;  3KN8 A;  4PFW A;  2FA7 A;  1A99 A;  3SES A;  4GD5 A;  3TKD A;  4IY5 A;  3KC1 A;  5ET5 A;  4NTL A;  4QHQ A;  2ZNU A;  4UAB A;  1JNF A;  4EQ9 A;  4H67 A;  3ILT B;  4ISU A;  3PUZ E;  5IZZ A;  4Z7E A;  1WVJ A;  3KEI A;  4R73 A;  3FXR A;  4MCO A;  4WXJ A;  4PAK A;  4TOZ A;  3PGF A;  5F7V A;  3TZA A;  4F2Q A;  1H3D A;  3H4Z A;  2F35 A;  1VFD A;  4OEU A;  4LP2 B;  5DEX B;  3RGY A;  3LUZ A;  1QUJ A;  2VGQ A;  3PTY A;  1XT8 A;  4XKQ A;  2X26 A;  4PDD A;  4ZEK A;  3T22 A;  1NKX A;  2F78 A;  1PBQ A;  1JQF A;  3KOT A;  3TOD A;  3ZKL A;  2I49 A;  3H06 B;  3PMX A;  3TEP A;  5I58 A;  3MAM A;  1FTK A;  2A5S A;  2ZZV A;  1MM7 A;  1H43 A;  2VOZ A;  4DE8 A;  1MRP A;  3K6X A;  1FBP A;  3RLF E;  4N8G A;  3SZP A;  2XD3 A;  5CRY A;  3JZJ A;  1IUD A;  1MXX A;  4OFL A;  1NI9 A;  2Y7P A;  3AXF A;  3B6Q A;  4ZZE A;  3R6U A;  2ZZX A;  4EQB A;  3CFX A;  4OEV A;  1R6Z A;  4MAG A;  3FJG A;  2QVR A;  4XKN A;  5EQ7 A;  2VP1 A;  3IX1 A;  1XVX A;  2DWI A;  4YU0 A;  3S9L C;  1LCF A;  2DDK A;  3O29 A;  4R9F A;  2DWA A;  2UYE A;  3RQT A;  3RTW B;  4U21 A;  5FTI A;  3VXB A;  4F1U A;  4PGP A;  1NUZ A;  3PUY E;  4NG7 A;  2FNC A;  3TTK A;  1Y3Q A;  2E0S A;  1LEV A;  1S9T A;  2CEX A;  4P1E A;  5L9O A;  4Q8R A;  1JW5 A;  5I2N A;  4O8M A;  4PFR A;  5L8D A;  2F97 A;  1B3E A;  3U1O A;  1P1Q A;  1FBF A;  3MWB A;  1MXZ A;  3TTN A;  1ZBM A;  4X48 A;  4KHZ E;  4QFP A;  1AIV A;  3SEV A;  1FBG A;  2CMO A;  2ZNT A;  4PBH A;  3EKI A;  4HS7 A;  1A7L A;  5IAI A;  1FTL A;  4MIJ A;  4ZDM A;  2QSX A;  4BDM A;  2P2A A;  3IOT A;  3G3J A;  1B1H A;  2PCR A;  4G68 C;  1JP4 A;  1US5 A;  1KZ8 A;  4GOT A;  4NF8 B;  1B46 A;  4NN3 A;  2CZL A;  1Y20 A;  3W15 C;  5AA3 A;  3SEX A;  3DP4 A;  4NF5 A;  3KBZ A;  1M5F A;  3P7I A;  1HSE A;  4F29 A;  4PAF A;  2O1M A;  1FSA A;  1TFD A;  1QJM A;  3OEM A;  4GX6 A;  2FHY A;  2DVZ A;  2PFZ A;  3CFL A;  4NWD A; 
#chains in the Genus database with same CATH homology
 2D5W A;  2I4C A;  2P0S A;  4YIC A;  1L5T A;  5I56 A;  3TQL A;  5CMB A;  5H8S A;  1UTB B;  5EHM A;  4F1Y A;  2ANJ A;  2DWH A;  4MBP A;  4ZED A;  2B3F A;  4KYS A;  3O28 A;  2YJP A;  2XXR A;  4RJZ A;  5EYF A;  3VE1 B;  5H8F B;  2XXI A;  2OK2 A;  3ILU B;  3O66 A;  4OZ9 A;  4UA8 A;  3ZSF A;  2UYF A;  4F1V A;  2I0C A;  4U4S A;  1TWY A;  1H45 A;  1LAH E;  2V25 A;  3KN7 A;  2NWJ A;  1FTJ A;  4YB7 A;  5TPA A;  3FD3 A;  1B3G A;  2OLB A;  1P1N A;  1IXG A;  2RC7 A;  3G3I A;  3JV9 A;  4ZZA A;  2Z23 A;  5FHN A;  3RT8 A;  2G93 A;  1B2H A;  4KPT A;  3SEU A;  2UVJ A;  3B6W A;  3MVY A;  3MZ9 A;  4GQO A;  4H5G A;  1QUK A;  2NUV A;  2PVU A;  1URD A;  3RT6 B;  3SEY A;  5AA4 B;  3S2V A;  3T93 B;  2V3Q A;  1LFG A;  2F6P A;  2FYI A;  3LSW A;  1B7U A;  4F3G A;  4ZEF A;  1LFH A;  1UIV A;  4FED A;  3K6V A;  1MDP 1;  1MY0 A;  3ODB A;  4U23 A;  4EQB A;  4FEB A;  4FAJ A;  3KSJ A;  1LCT A;  1FQD A;  2QS3 A;  3G3G A;  3O6I A;  1B5J A;  3OSQ A;  2Z22 A;  3FUZ A;  3MP1 A;  4QSD A;  3GBB A;  4R2F A;  3LUY A;  3HHF A;  2DE4 A;  2O7U A;  1FQA A;  4OWD A;  4R75 A;  3WAE A;  3ZKK A;  4DIG A;  2NOO A;  2F34 A;  2PMS A;  5LOM A;  2DE3 A;  2Y7I A;  1BIY A;  3DLN A;  2Q2C A;  4GL8 A;  2AL4 A;  1ZU0 A;  1NFT A;  2Y7W A;  3C4M A;  1N04 A;  3PMV A;  3IOV A;  5ISU A;  2G29 A;  2QS1 A;  1ELJ A;  1B0H A;  1FTO A;  1MQD A;  3EQ1 A;  4ND9 A;  3EN3 A;  5I2N B;  3MVX A;  1P1W A;  2H5Y A;  3OD7 A;  1SBP A;  4G8M A;  3S4U A;  3VVF A;  5I59 B;  2OCU A;  3WAF A;  4DXU A;  3IL1 B;  1N7X A;  4NWD A;  4O3B A;  3PPR A;  4Q30 B;  2I3W A;  3D4G A;  1P99 A;  2DOJ A;  4LQ5 A;  1SW5 A;  2ONS A;  1B1X A;  3C36 A;  2UVH A;  3K00 A;  1FTM A;  4IO4 A;  5HM4 B;  5IKB A;  3RY3 A;  1BP5 A;  1TXF A;  1SI1 A;  1URG A;  2R6G E;  3CG3 A;  1NNP A;  4H65 A;  4PFY A;  4F19 A;  3U92 A;  4OYV A;  4DDD A;  4QSC A;  1ZMG A;  4WEP A;  2Y84 A;  3UA8 A;  1LFI A;  4EXK A;  4OER A;  2DP8 A;  4AQ4 A;  5B70 A;  1MQH A;  4RPN A;  2GHA A;  4DLD A;  4EDP A;  3K01 A;  1B4Z A;  4G68 A;  2KLF A;  2Z8D A;  3CI8 A;  3UN6 A;  1MG1 A;  3BFT A;  3QXM A;  5CBS A;  4KI0 E;  2Q8J A;  1US4 A;  2I48 A;  3K6U A;  2RC9 A;  3T9V A;  3TDJ A;  5AA4 A;  1DPE A;  3TQW A;  4BLA A;  3QYT A;  2A5T B;  1SW2 A;  4H1X A;  1USY E;  1MXY A;  4DCX A;  4H8I A;  1B3F A;  2B65 A;  1NL5 A;  4FOR A;  4JXI A;  4N6P A;  5CMK A;  4UAC A;  4RA1 A;  3IJX B;  5KZT A;  3HO7 A;  3SEW A;  2REJ A;  1FQC A;  4LON B;  1T0K A;  3MP8 A;  1B0L A;  3EHT A;  1QKB A;  3K6W A;  1JEU A;  3KN3 A;  3KFM A;  1I6A A;  3SKP A;  1N76 A;  1CB6 A;  2H25 A;  2AYS A;  3IAZ A;  2QRY A;  3G7W A;  3U72 A;  3VV5 A;  1DOT A;  4OXV A;  4NF6 A;  2HFB A;  5TP9 B;  1B5I A;  2A5T A;  4E0X A;  3S9N C;  1NNF A;  2HQ0 A;  1UTB A;  1JW4 A;  4I1D A;  3TTL A;  4U1Z A;  4FEC A;  1FW0 A;  4I8C A;  3T9U A;  2O68 A;  5H8N A;  5CM6 A;  1P1U A;  4DXC A;  1ZLQ A;  4PQJ A;  3R7X A;  3K0V A;  4R6K A;  5KCJ A;  3VLW A;  4GVO A;  4JSO A;  3FV2 A;  3K2D A;  4LZ5 A;  3HN0 A;  2DQV A;  3KSX A;  2PYY A;  5I57 A;  1AL3 A;  3GXA A;  2H99 A;  1II5 A;  3DM0 A;  1A8F A;  4TQU Q;  3TEL A;  3VFJ A;  2Z8E A;  2OBG A;  5M2V A;  3TAJ A;  1B3L A;  3TFL A;  5DYH A;  1SW4 A;  3E9X A;  5L9M A;  2I58 A;  1I6B A;  2R9J A;  3MUQ A;  2Z8F A;  3QSL A;  4X1B A;  1N3X A;  5I59 A;  4QFL A;  2XX7 A;  3C32 A;  1ZTY A;  3KG2 A;  4HCY A;  1URS A;  4IGR A;  3TCF A;  3L6H A;  3IJO B;  3VVD A;  1CE2 A;  3IB1 A;  4KCC A;  3MPL A;  2I0B A;  4BDL A;  1BLF A;  3TMG A;  1B4H A;  4OFO A;  5KDT B;  2XXT A;  4PFT A;  1SI0 A;  3E13 X;  5CBR A;  5JEI A;  1B3H A;  3N5L A;  3K1P A;  1B32 A;  1PBP A;  1LAX A;  2XXY A;  3KJ7 A;  2QJE A;  3OSR A;  1SQY A;  1F9B A;  4H6D A;  4U22 A;  1LB9 A;  2VD3 A;  3R26 A;  4H8J A;  4P0G A;  1GV8 A;  4OFJ A;  1OMP A;  1KWH A;  1R9Q A;  3H6U A;  3S9E A;  1B6H A;  1XVY A;  2PX1 A;  4WKM A;  4ZEB A;  4R6Y A;  4ESX A;  3F11 A;  2V84 A;  1NH8 A;  3ECR A;  4Q5T A;  3VVE A;  3HHG A;  3MZB A;  1MY2 A;  1H44 A;  4QFO A;  4F3S A;  4F31 B;  3O6G A;  1FQE A;  1XHY A;  3EPE A;  4KQP A;  5I84 A;  3IB0 A;  3KJT A;  4POX A;  1B05 A;  1Y9U A;  1LGB C;  3EF7 A;  3FXU A;  4G2Z A;  2XX8 A;  2PT2 A;  5DTB A;  2ZMB A;  3BKI B;  3N94 A;  3CSB A;  3FAS A;  1SW1 A;  2OZZ A;  1LB8 A;  4JWX A;  4U4X A;  5TPA B;  4JWY A;  4HTG A;  1MXV A;  3RNN A;  1MH4 A;  2XXW A;  1LAF E;  2GFE A;  4BDM A;  3OEK A;  3OO8 A;  1B5H A;  5H8F A;  4ZE8 A;  4YMA A;  2AIX A;  4C1T A;  4LAT A;  4XTC Q;  5HBC A;  3GZG A;  1TT1 A;  3MQ9 A;  3T9X B;  5ICQ A;  4OHN A;  4G8N A;  2IEE A;  5FTH A;  2O6A A;  3VLV A;  2X7P A;  2QL3 A;  3TUS A;  2UVI A;  3H6T A;  1GTK A;  1A8E A;  1UTH A;  3Q27 A;  3A3U A;  3M3L A;  3OEN A;  2W7Y A;  1HSL A;  3LC8 A;  3ONM A;  2HEU A;  4ELR A;  5BUU A;  2LAO A;  4IB2 A;  4IO6 A;  3U93 A;  4ELQ A;  1IEJ A;  5DVJ A;  5B7D A;  5TU0 A;  2GRV A;  5AA2 D;  4U2R A;  4P0I A;  3V83 A;  1PC3 A;  3OXN A;  1SD3 A;  3U94 A;  3V89 B;  4IGT A;  4JDF A;  2AL5 A;  4LUB A;  4OEN A;  1GGG A;  1OQG A;  1SVX B;  1LBB A;  1VFE A;  3G3H A;  1LBC A;  1M5E A;  3C31 A;  4NF5 B;  4R74 A;  4BDQ A;  1VE4 A;  5FHO A;  1FCK A;  5I58 B;  1ATG A;  2BJJ X;  3H03 A;  5I2K A;  5H8Q B;  1XOC A;  1SYI A;  4IO2 A;  4JB7 A;  1D9Y A;  1UIU A;  1XC1 A;  3DP8 A;  4NF8 A;  4OES A;  4BDN A;  5KCJ B;  1ZIU A;  4NE4 A;  3THI A;  3QUF A;  1Y1M A;  2GHB A;  1IZ1 A;  4OVJ A;  1ZKB A;  3OO6 A;  4PE5 B;  5CMC A;  2RCA A;  5HPQ A;  1OLA A;  2HZL A;  3M3F A;  3KBR A;  3V8X B;  3IK6 B;  3DEL B;  4RXL A;  5CI5 A;  4ELO A;  2XXX A;  1N7W A;  1M5C A;  2D3I A;  4FE8 A;  4OTE A;  3PPQ A;  3RTF B;  4NWC A;  4KYE A;  3I5O A;  2DVC A;  1A54 A;  4XKP A;  5F1Q A;  5JTY B;  4O3A A;  3O97 A;  3OO9 A;  2ZYM A;  3K1N A;  3B6T A;  5J1D A;  3MW0 A;  4GLI A;  3SET A;  2QS4 A;  4NF4 A;  1JVY A;  2XXV A;  1JET A;  2H9B A;  1IXI A;  3BBR A;  3O2A A;  3OO7 A;  4GFR A;  2F6G A;  1PEB A;  1EU8 A;  3RPW A;  1MH3 A;  3VLU A;  2Q88 A;  1ANF A;  2R71 A;  1O7T A;  3W9V A;  1BTJ A;  1Y1Z A;  1N0T A;  1UQW A;  3HCQ A;  4QFN A;  4RK2 A;  4RPO A;  3SDF A;  1FQF A;  3QIM A;  4G8H A;  1OIB A;  3Q25 A;  4RY1 A;  4YKI A;  4G4P A;  2YPN A;  5ELV A;  1IQ7 A;  1J1N A;  4H0W A;  2I6E A;  4KYD A;  1PB7 A;  2F7A A;  2UXA A;  2V3T A;  1R1N A;  2XHD A;  3E4R A;  3N26 A;  3PUV E;  4LZ8 A;  1GVC A;  1R9L A;  4XIG Q;  5ITP A;  4OQO A;  4KD5 A;  4C0R A;  2Q89 A;  1MQJ A;  3MVW A;  3PPO A;  4E0W A;  5JTY A;  1A55 A;  3VDF A;  1NNK A;  2XXU A;  5A5X B;  3DP6 A;  3QUJ A;  1D4N A;  2RCB A;  4QF9 A;  4THI A;  1TFA A;  2Q2A A;  4LVQ A;  3IR1 A;  3FAT A;  4H5F A;  1MXU A;  4Q0C A;  2ESN A;  1QW0 A;  2RIN A;  3MPK A;  4YB5 A;  4C1U A;  2ZYK A;  4QSE A;  1EZ9 A;  1NH7 A;  3H6V A;  4RNS A;  4YKP A;  1OVB A;  2WKY A;  5H8Q A;  5H8H A;  4HCW A;  3W9W A;  2H98 A;  3H3G A;  3HPI A;  3OEL A;  3PV0 E;  4JSD A;  2XXQ A;  4L17 A;  4ONY A;  5AA2 A;  4EXL A;  3FV1 A;  3KN8 A;  4PFW A;  4POW A;  3TCG A;  4U1O A;  1B52 A;  2FA7 A;  1A99 A;  3MP6 A;  1JEV A;  1RKM A;  3SES A;  1S50 A;  1B51 A;  5H8H B;  1YAE A;  4GD5 A;  3TKD A;  1LLS A;  1RYX A;  3M3K A;  2D21 A;  4IY5 A;  1DTG A;  3K1M A;  4NTL A;  1Z7M E;  4QHQ A;  2ZNU A;  3TTR A;  2I4B A;  2QMW A;  5K2Y A;  1MXW A;  1JNF A;  1QUI A;  3QK6 A;  4EQ9 A;  3FZV A;  5AE4 A;  4H67 A;  1O63 A;  2Y7R A;  3ILT B;  3PUZ E;  1YPN A;  4ISU A;  4DXB A;  3CR9 A;  4Z7E A;  4F3P A;  1WVJ A;  2V93 A;  3PD9 A;  4MLQ A;  4ESW A;  3KEI A;  3A09 A;  3C33 A;  4R73 A;  1FQB A;  4KFQ A;  3FXR A;  1QVS A;  2VHA A;  5FHM A;  4WXJ A;  2RF1 A;  3IOR A;  4TLL B;  2ZNS A;  2I3V A;  4RK9 A;  1QKA A;  2H4I A;  3Q26 A;  4TOZ A;  1VR5 A;  3PGF A;  4HW8 A;  1MQG A;  2IA4 A;  5F7V A;  1JVX A;  3MJN A;  4F39 A;  2B3B A;  3MBP A;  4DCY A;  3TZA A;  3CFZ A;  4F2Q A;  1H3D A;  3H4Z A;  2DWJ A;  2F35 A;  3TYH A;  1AMF A;  4ELP A;  1DTZ A;  3IO4 A;  3MZ1 A;  1D3K A;  4NF4 B;  1NNT A;  3CIJ A;  4IY6 A;  3SER A;  4EUO A;  1VFD A;  3H7M A;  1RYO A;  4OEU A;  4LP2 B;  5AA2 B;  5DEX B;  3KGC A;  5ICT A;  3PUW E;  4FJP A;  4YKK A;  3RGY A;  1QUJ A;  4R72 A;  4YMB A;  2VGQ A;  4PFU A;  3ZS6 A;  1M5D A;  3IB2 A;  1NMU A;  1XT8 A;  4YAH X;  3MVZ A;  1XS5 A;  3PU5 A;  2X26 A;  4XKQ A;  1D9V A;  2F7C A;  2Q9T A;  4ZEK A;  4O3C A;  3FVN A;  3T22 A;  1NKX A;  1MY4 A;  1PBQ A;  1QUL A;  1JQF A;  2DS9 A;  2F78 A;  2NXO A;  1IIW A;  2XXH A;  1Q1K A;  3CVG A;  3KOT A;  2I49 A;  4NMY A;  4QRZ A;  3TOD A;  3ZKL A;  5A5X A;  2PBW A;  4GIZ A;  4I9D A;  1B58 A;  4R9G A;  3Q28 A;  5I2K B;  1PB8 A;  1YTV A;  3B7D A;  4ZEI A;  3H06 B;  1JW1 A;  1N3W A;  3PMX A;  5DEX A;  2VD2 A;  3TTM A;  4ECF A;  1ZJL A;  3MAM A;  5I58 A;  1FTK A;  3OOA A;  2A5S A;  3TEP A;  2DXY A;  4LQ2 A;  1MM7 A;  4QFK A;  3VXC A;  3T96 B;  1H43 A;  1LAG E;  2VOZ A;  1LST A;  4DE8 A;  2ABH A;  1MRP A;  3K6X A;  2HXW A;  4TLM B;  5BWJ A;  4AB6 A;  1EZO A;  4FIM A;  4ZS9 A;  4OMB A;  5CMM A;  3RLF E;  1EZP A;  5L9S A;  2GH9 A;  1MPB A;  3E3K A;  4BDO A;  3O6H A;  4M1V A;  2RKM A;  2XD2 A;  2XD3 A;  4PP0 A;  5CRY A;  5EHS A;  3JZJ A;  3TPA A;  3UK4 A;  5H8N B;  1IUD A;  3G3K A;  3D4C A;  1MXX A;  4OFL A;  4X9T A;  3C9H A;  1I6Q A;  2Y7P A;  3AXF A;  3B6Q A;  4XXU A;  4GXA A;  4ZZE A;  1UTH B;  3R6U A;  4IO3 A;  2P1S A;  2O1L A;  1EH3 A;  3I3V A;  1GR2 A;  3K02 A;  4OET A;  4XKR A;  1IXC A;  1Y3N A;  4BDR A;  4R2B A;  4M4G A;  3CFX A;  3MC2 A;  4MH5 A;  1R6Z A;  2PT1 A;  4OEV A;  1MDQ A;  3FJG A;  4R6H A;  5DVF A;  5ITO A;  2NVU B;  3GLB A;  3IOU A;  2M8C A;  4XKN A;  2VP1 A;  3IX1 A;  3U8Q A;  2DSF A;  3USD A;  1XVX A;  2DWI A;  3QAX A;  2ZYN A;  4GL0 A;  4JBZ A;  4YU0 A;  3V5A A;  3S9L C;  3L6G A;  3EHU A;  3UP9 A;  1A40 A;  4FAT A;  1IXH A;  2E1S A;  2F8D A;  1LCF A;  1PDA A;  1OLC A;  3FGS A;  1DSN A;  4RYA A;  3GBA A;  3FJM A;  4MLV A;  2F5X A;  3PPP A;  3BFU A;  1DPP A;  1IIT A;  1POT A;  1O64 A;  3FVO A;  3O29 A;  4R9F A;  3EHS A;  1OQH A;  4MFI A;  2DWA A;  4N07 A;  1M5B A;  2RC8 A;  2XX9 A;  2UYE A;  3RQT A;  3UOR A;  1B7Z A;  1P1O A;  3LBS A;  4KR5 A;  3RTW B;  5CC2 A;  4U21 A;  3C34 A;  5FTI A;  4PET A;  2HZK A;  3VXB A;  4GRK A;  2ONK E;  3I6V A;  4F1U A;  1MPC A;  2REG A;  4F3B A;  4ZE9 A;  1SDX A;  4GWO A;  3PUY E;  2ZYO A;  1MY1 A;  2FNC A;  3TCH A;  3TTK A;  1Y3Q A;  3A3C A;  2E0S A;  3LSL A;  3KZG A;  2V3U A;  1Q35 A;  1MY3 A;  1S9T A;  4I62 A;  5K2X A;  1B9J A;  3OMB A;  4N13 A;  5L9O A;  1N84 A;  1YCJ A;  1DMB A;  4Q8R A;  1JW5 A;  3T66 A;  5I2N A;  1B7H A;  4EF2 A;  5L8D A;  1WOD A;  2F97 A;  1B3E A;  2HAV A;  2O84 X;  5DT6 A;  3HST A;  3U1O A;  5DVI A;  3PPN A;  1P1Q A;  3MWB A;  3KOS A;  3C35 A;  3UIF A;  1MXZ A;  1Z7N E;  3HV1 A;  2OJT A;  3TTN A;  1ZBM A;  4X48 A;  4F2O A;  3M8U A;  4KHZ E;  1MM6 A;  4QFP A;  3K4U A;  4DZ1 A;  1AIV A;  3SEV A;  2HCA A;  5AA1 A;  2CMO A;  1AH5 A;  1OVT A;  2O51 A;  2ZNT A;  2Y7K A;  4IO7 A;  4F22 A;  2QMX A;  4Z0I A;  1VSO A;  3CG1 A;  1MQI A;  5KDT A;  1B40 A;  4WED A;  4EF1 A;  1Y4T A;  4HS7 A;  3LSF B;  1A7L A;  2ZXT A;  4P11 A;  4EQ7 A;  5IAI A;  2QS2 A;  2HAU A;  3FVG A;  1FTL A;  1MS7 A;  1BKA A;  2O7I A;  2ALU A;  2UVG A;  4JWO A;  4NF6 B;  4YZZ A;  5TP9 A;  4LZ7 A;  5JK4 A;  1MPD A;  4ZDM A;  2QSX A;  1H76 A;  4YKJ A;  2P2A A;  3IOT A;  1S7Y A;  3G3J A;  3N6T A;  4IO5 A;  4AB5 A;  2OWS A;  3LSX A;  1B1H A;  2O69 A;  4F18 A;  3T9H B;  4G68 C;  1Y3P A;  3PD8 A;  3RN8 A;  2DXR A;  1HSJ A;  3IO6 A;  4GXS B;  1US5 A;  2ONR A;  3FXQ A;  1POY 1;  3FJ7 A;  3PMW A;  4K3F A;  4GOT A;  4G77 A;  4KCD A;  3CRB A;  3LR1 A;  3RUM A;  4ZEC A;  4NF8 B;  1B46 A;  3FVK A;  2OWT A;  2CZL A;  1Y20 A;  3W15 C;  5AA3 A;  3O9P A;  3SEX A;  2F7B A;  3DP4 A;  3PUX E;  4NED A;  3UGW A;  4NF5 A;  4LA9 A;  4MF3 A;  1M5F A;  5I56 B;  2X7Q A;  3P7I A;  1HSE A;  1WDN A;  4G68 B;  4F29 A;  2XXP A;  4GF8 A;  1I69 A;  2F36 A;  5I57 B;  3S9M C;  4YB6 A;  1Y4C A;  2DYX A;  1SYH A;  3CSG A;  2O1M A;  1USY H;  1TFD A;  3Q29 A;  1QJM A;  3JYR A;  2DE2 A;  3OEM A;  4X1D A;  2THI A;  2YLN A;  3N6U A;  3G3F A;  2DVZ A;  3FIR A;  2QPQ A;  3H6W A;  1AOV A;  3CFL A;  3IOW A;  1PB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...