4P0GA

Crystal structure of mltf from pseudomonas aeruginosa complexed with bulgecin and muropeptide
Total Genus 152
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
152
sequence length
429
structure length
429
Chain Sequence
b'APTALERVQKEGVLRVITRNSPATYFQDRNGETGFEYELAKRFAERLGVELKIETADNLDDLYAQLSREGGPALAAAGLTPGREDDASVRYSHTYLDVTPQIIYRNGQQRPTRPEDLVGKRIMVLKGSSHAEQLAELKKQYPELKYEESDAVEVVDLLRMVDVGDIDLTLVDSNELAMNQVYFPNVRVAFDFGEARGLAWALPGGDDDSLMNEVNAFLDQAKKEGLLQRLKDRYYGHVDVLGYVGAYTFAQHLQQRLPRYESHFKQSGKQLDTDWRLLAAIGYQESLWQPGATSKTGVRGLMMLTNRTAQAMGVSNRLDPKQSIQGGSKYFVQIRSELPESIKEPDRSWFALAAYNIGGAHLEDARKMAEKEGLNPNKWLDVKKMLPRLAQKQWYAKTRYGYARGGETVHFVQNVRRYYDILTWVTQPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Membrane-bound lytic murein transglycosylase F
publication title Crystal structure of MltF from Pseudomonas aeruginosa complexed with bulgecin and muropeptide
rcsb
source organism Pseudomonas aeruginosa
molecule tags Lyase
total genus 152
structure length 429
sequence length 429
ec nomenclature ec 4.2.2.n1: Peptidoglycan lytic exotransglycosylase.
pdb deposition date 2014-02-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
A PF01464 SLT Transglycosylase SLT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4p0gA02
4R9GA 4LZ7A 4GRKA 1II5A 4GF8A 4Q0CA 3B6TA 4XKQA 2OZZA 4YB5A 2QL3A 2DE2A 2DSFA 4KPTA 4Q30B 4X9TA 4G68C 4IO3A 1NNFA 3E3KA 5HM4B 2OLBA 3IB2A 5I56A 3RLFE 4F2QA 2OBGA 3ZS6A 1RYXA 1EZ9A 1MG1A 1JVXA 4GXSB 4RXLA 3SEVA 3L6HA 1MQIA 2Q88A 5H8FA 2D21A 3OSQA 4QSEA 1B1HA 2HEUA 2I0CA 1BLFA 1M5CA 4L17A 4LVQA 4NE4A 4H8JA 1A8FA 3WAFA 2A5SA 5AA2B 4EQ9A 5BWJA 2VGQA 4YAHX 3TUSA 3H4ZA 4ZEIA 2NVUB 1H3DA 5KDTA 1SW2A 2XXUA 1WODA 2XXIA 3MQ9A 1NKXA 1AMFA 2H9BA 1TFAA 3DP4A 1Y4TA 4M4GA 2DVCA 3FJMA 1O7TA 2VHAA 2FYIA 4OQOA 3F11A 4F3PA 2QSXA 4U4XA 5AA3A 4ELPA 5A5XB 3CR9A 1B3LA 5FTIA 1QULA 3H03A 2H99A 2I4CA 2XXTA 5CMMA 1P1OA 3KG2A 1MM7A 4XXUA 4N13A 2I0BA 1Y3NA 4KQPA 4GXAA 1UQWA 3U8QA 4YU0A 4X1DA 1LFGA 4LUBA 3ILUB 3SEUA 2GRVA 3KBRA 5FHNA 2RC8A 2E1SA 1FTKA 3G3JA 3PPPA 3QXMA 2QMXA 4KYDA 3HPIA 1Z7ME 4EQ7A 2ZMBA 4ESWA 4DE8A 4XIGQ 3TAJA 5L9SA 4PFWA 3K6WA 1IIWA 4F1UA 1SYHA 3CVGA 1ZLQA 1DMBA 2DE4A 4EDPA 1VFDA 3C32A 2GFEA 2HQ0A 4GL0A 1IXHA 5B7DA 4IGRA 1GGGA 3FV1A 2I58A 4EUOA 1MH4A 4C1UA 1AL3A 1N7WA 5KCJA 2W7YA 5B70A 1UTBA 4U22A 4OHNA 4G68A 3VVEA 1ZTYA 2PT1A 1M5EA 4ZS9A 1H76A 3MVZA 4IO2A 2HFBA 2YLNA 3BBRA 1SYIA 2F35A 2ESNA 4FECA 3S9LC 4XKRA 4LQ5A 5HBCA 3KOSA 1UTHB 1B7HA 1FCKA 2XXYA 4R6KA 1BIYA 2DWAA 4GOTA 1URSA 1FQBA 1QW0A 3UORA 3OELA 5FHOA 2HCAA 5DEXA 4EQBA 2Q89A 4NWCA 1CE2A 3OMBA 1LCTA 3D4GA 3T96B 4ELRA 2PT2A 3PPQA 5H8NB 1H44A 4IB2A 1MY4A 4OMBA 2NUVA 1D3KA 3MBPA 4JXIA 3IK6B 3V8XB 3O9PA 2PX1A 2UYEA 5K2XA 1MM6A 4O3CA 4YKJA 2Z8EA 1P1UA 3Q25A 2Y7KA 4O3AA 4JDFA 4JWOA 3M3KA 1BP5A 3SESA 2UYFA 3KJ7A 3EPEA 4LA9A 2DP8A 4R2BA 4QFOA 2PYYA 4XKPA 3LSXA 2ABHA 3RGYA 1QKAA 2KLFA 1MXZA 4YMAA 3PD9A 1NMUA 4RJZA 1B3EA 3TTRA 3IORA 5CC2A 3S2VA 3PPRA 3M3LA 1A54A 1DPPA 4PFUA 5M2VA 4G8MA 1FQDA 2Q9TA 3CFLA 2I48A 2DQVA 1NNKA 1GR2A 1FTOA 1B52A 3IO6A 2DXYA 5AA2D 3KSXA 5L9MA 4EXKA 4H5FA 1FQCA 3T9HB 3IOTA 4HTGA 4OFOA 4KYSA 1NH8A 2H98A 1XOCA 2Y7PA 1LGBC 3TEPA 2O69A 1XVYA 1MRPA 3H6VA 1Y3QA 4OFJA 3LSFB 3EHSA 1TWYA 3T9XB 4Q8RA 2F7BA 1XS5A 4OERA 3TPAA 1DTZA 1SI1A 1AH5A 1SD3A 2DWHA 4U1ZA 1SDXA 4GD5A 3D4CA 5DVJA 3KSJA 4X48A 3O28A 1B3HA 3EN3A 4R6HA 1NNPA 2QMWA 3V5AA 3VLVA 1PB7A 3HHFA 3DLNA 5H8NA 1ZJLA 1LFIA 3H7MA 3C9HA 3KN8A 1NL5A 1P1QA 4H67A 2O84X 2Z23A 5EHMA 1DOTA 5EHSA 2F78A 4JWYA 4ZEBA 4N07A 4KFQA 1Y1ZA 2XHDA 4HCWA 1JQFA 2F7CA 3RT6B 3CFXA 3T9VA 4Q5TA 4ZEFA 3KFMA 4MH5A 5LOMA 4GFRA 3HN0A 5AA1A 1O63A 4OFLA 3VVFA 3C33A 1F9BA 4H65A 1QUKA 4JWXA 1XT8A 2V84A 1ATGA 1IEJA 3RN8A 3SERA 4C1TA 1OLAA 5I57B 1N7XA 1RKMA 4IY6A 2O68A 4ZECA 3UK4A 5ICQA 5DVIA 1MY2A 2GH9A 5F1QA 4G8NA 1M5DA 3MVYA 2ZYOA 3EHUA 3H6TA 3FXQA 1B46A 3CFZA 3OD7A 4LZ5A 3B7DA 3LR1A 4R74A 4OENA 2XXXA 2Z22A 3M3FA 5JTYB 3T9UA 1MXVA 1A55A 3MPKA 1PB9A 2XX7A 3FGSA 1Y3PA 1VFEA 1Y1MA 3FVNA 4I8CA 3TYHA 4C0RA 2CZLA 2RCAA 2QJEA 4N6PA 3HHGA 4PFYA 3BFUA 4PFTA 1IXIA 1JEUA 4DDDA 2ANJA 4BDQA 3UP9A 3I3VA 1A7LA 2FA7A 1JEVA 1EZPA 4P11A 3MW0A 2G93A 1USYE 1B1XA 3IR1A 3K02A 3S9MC 1N3WA 4H6DA 4OTEA 4BDMA 1TFDA 3I6VA 3IAZA 2F6GA 5H8HB 2XXPA 2OK2A 3R6UA 1N04A 1MDP1 3ZKKA 3VDFA 3LBSA 3O6IA 1US4A 1MPDA 2XD3A 2GHAA 1URGA 3C31A 4JSDA 2HAUA 3IX1A 4NF5A 4PETA 3OO6A 1MQHA 5I57A 3EHTA 4YICA 4KYEA 3IOWA 1LB8A 4H8IA 1LAFE 3TCHA 2OCUA 1US5A 3N6TA 1SQYA 3HSTA 5TPAA 1FQFA 2V3UA 3DP8A 3HO7A 1AOVA 2O7UA 4OEUA 3L6GA 4QFNA 4ECFA 1A8EA 3FV2A 1SW1A 3K1MA 5I2KB 5EYFA 2I4BA 3S9EA 4NF6B 3E9XA 2X26A 3K2DA 4U4SA 3QSLA 2Q2CA 4ZDMA 4R2FA 5ELVA 3N26A 4MF3A 4F29A 3G3HA 4FE8A 5F7VA 1B51A 3OENA 1B5IA 4DIGA 2DVZA 4U2RA 4GIZA 2O1MA 4I62A 4ESXA 1HSLA 5CMKA 3RUMA 3S9NC 4ZEKA 1B7UA 3TTLA 3MZ1A 3PUYE 2Y84A 3PPOA 4R73A 1UIVA 1B3FA 4DCYA 3TFLA 4KCDA 1JETA 2O1LA 5AA2A 2QRYA 3H06B 4LQ2A 3PMVA 4FAJA 1YAEA 3RQTA 1Y4CA 1S50A 2FNCA 3LSLA 3PMWA 4DXBA 4NF4B 4HW8A 2PVUA 1LLSA 4P0GA 5TU0A 2NOOA 5I2NB 4RPOA 2F34A 1FQEA 5I59B 5AA4B 4MLVA 3GXAA 5CMBA 2ZNTA 3Q26A 2HZLA 3K6XA 3UN6A 2VOZA 1B4ZA 4YZZA 4FATA 2H4IA 5A5XA 3KZGA 3PGFA 5L8DA 4NF8B 2QS1A 3THIA 2V3QA 1SW5A 4XKNA 2HZKA 1EH3A 4NF6A 3E13X 3TQLA 1I6QA 3AXFA 3UGWA 1ZMGA 2NWJA 3MP6A 2IA4A 1SI0A 1MY1A 3OOAA 4NTLA 3H6UA 4PP0A 1MPCA 3G3IA 3U94A 1PEBA 4O3BA 3SEYA 1MXWA 2GHBA 4R6YA 1PDAA 5HPQA 2F5XA 1MQGA 1B7ZA 4WKMA 3WAEA 4POXA 2XXVA 4WXJA 3ONMA 1SW4A 3GBAA 3TODA 5I58B 5CBSA 4R75A 3N6UA 3RY3A 5CI5A 3EF7A 1FTLA 3UIFA 3K01A 4E0XA 2O7IA 5I2NA 1POY1 3OO9A 3VXCA 2H25A 1Q35A 4I1DA 4MBPA 5K2YA 1ZU0A 2F36A 1FTMA 5AA4A 4EF1A 4P0IA 4FEBA 2O51A 1HSEA 2Q2AA 5TP9B 2RKMA 3V83A 2RCBA 3TTMA 2QS2A 3TELA 2HAVA 1XHYA 3JV9A 3MVXA 3QUJA 1JVYA 1LB9A 1UTHA 3C35A 2ZYNA 4G4PA 3IO4A 2I6EA 3TCGA 5ITPA 2F8DA 1I69A 2WKYA 4AB6A 2Z8FA 1AIVA 1Y9UA 1P99A 2LAOA 4IY5A 2H5YA 4IO4A 4RYAA 4KR5A 4IO5A 2ZNUA 1N0TA 1NH7A 4BLAA 3DP6A 4RY1A 4G8HA 3HV1A 2OWSA 3FJ7A 4IO6A 2VD2A 3RT8A 2XXQA 4F2OA 2AL4A 1R9LA 4IO7A 1IITA 3S4UA 2I49A 3BFTA 2DOJA 3RTFB 5KZTA 4RNSA 2AIXA 3LSWA 1D9YA 2F97A 4QRZA 3VVDA 4WEPA 4KHZE 1GVCA 1I6BA 3G7WA 3MC2A 2E0SA 4UA8A 3MPLA 4NEDA 1B0LA 2B3FA 2V25A 4ND9A 4BDLA 1ANFA 2RINA 1LBBA 4DCXA 2DS9A 4DXUA 2XX9A 2XXHA 3C36A 3R26A 5I58A 1XC1A 1WVJA 1MXYA 4ZZEA 5DVFA 3HCQA 2D3IA 1N76A 1ZKBA 3QK6A 1IUDA 1B32A 1H43A 1FTJA 1B4HA 4LP2B 2REGA 3O6HA 3Q29A 2AYSA 3QIMA 3FATA 4FORA 1LSTA 5KDTB 1B40A 2X7PA 1OIBA 1DTGA 3B6WA 3K00A 3U1OA 3ILTB 1FW0A 3PV0E 2I3VA 2THIA 3B6QA 3VXBA 1B2HA 4JSOA 3OO7A 3O66A 5ITOA 1DPEA 1N84A 3CSBA 1OQHA 1M5FA 2ONSA 3VFJA 2F7AA 4YKIA 2ZYMA 3P7IA 2UVHA 4TQUQ 3K1PA 1VE4A 4OZ9A 4G2ZA 3TKDA 1J1NA 4F31B 2ONRA 3FVGA 2DWJA 2PMSA 3PMXA 3TQWA 2IEEA 3GLBA 4F19A 2ZNSA 4QFLA 4OEVA 1R6ZA 2XXWA 1MXUA 4BDOA 2DE3A 4YKPA 3A3CA 1JW5A 3TTKA 1D9VA 4GWOA 4ELQA 2VP1A 2A5TB 2B3BA 1R1NA 4G77A 3LUYA 1MPBA 4OESA 1MQDA 2M8CA 2X7QA 3U92A 4HS7A 4QFPA 3PUZE 4JB7A 3T66A 4I9DA 3QAXA 3SKPA 3GZGA 4YB6A 5KCJB 1YTVA 2DYXA 2QPQA 1UTBB 4G68B 3H3GA 2AL5A 3N5LA 4H5GA 1IQ7A 3T22A 4U23A 2I3WA 3Q28A 3MP1A 5JEIA 1BTJA 3OSRA 2Y7IA 2OJTA 4AB5A 4OWDA 4FEDA 4JBZA 1RYOA 5JTYA 1WDNA 5DYHA 2F6PA 1LCFA 4DXCA 3ODBA 2XD2A 3PD8A 1QKBA 4ZEDA 3KJTA 3FXRA 4RA1A 3A09A 1OVTA 2P0SA 3G3FA 1B05A 2UVJA 2YPNA 4ZE8A 4QSDA 3IL1B 4LATA 1QUIA 3ECRA 1Q1KA 4XTCQ 1QVSA 3FVKA 5DEXB 2R6GE 4R72A 1IXGA 3KEIA 3MUQA 4DZ1A 4R9FA 1ZIUA 4KCCA 1D4NA 3PUVE 2ONKE 2CMOA 3MP8A 1N3XA 4F1VA 5H8HA 5FHMA 1Z7NE 3PUXE 2A5TA 1PB8A 3K6UA 4OVJA 3M8UA 5H8QB 3TMGA 1SBPA 3FUZA 5DT6A 3SEXA 4PQJA 2Z8DA 1B58A 4E0WA 3TCFA 3C34A 4F22A 1B3GA 1XVXA 2REJA 2DWIA 4BDNA 3SDFA 3MZBA 5BUUA 1MY0A 1ZBMA 3K4UA 3IOUA 2XXRA 2Q8JA 1MXXA 3U93A 3JZJA 5CBRA 3O2AA 1MY3A 4KI0E 1B5HA 3FJGA 1GV8A 1JW4A 3FD3A 2O6AA 3UA8A 1JNFA 4BDRA 3CG3A 4ONYA 1OQGA 4M1VA 1DSNA 1POTA 3IOVA 1MH3A 4ZE9A 4HCYA 1EZOA 5JK4A 2R71A 5I2KA 3U72A 1OLCA 3MAMA 3DM0A 3DELB 1USYH 3FASA 3R7XA 2HXWA 4YMBA 3CI8A 3IJOB 1LAHE 4H0WA 4OETA 3KN7A 4WEDA 1P1WA 3K0VA 2Y7RA 1CB6A 3EQ1A 1R9QA 3KOTA 3QUFA 1TXFA 2V3TA 1YPNA 5L9OA 3MWBA 1IXCA 4IGTA 3MZ9A 3IB0A 4FIMA 3IB1A 3JYRA 3TTNA 4EXLA 3OEKA 4ISUA 4MFIA 5CMCA 1VSOA 3RNNA 5H8QA 2RF1A 3C4MA 5FTHA 1JW1A 3GBBA 5AE4A 4KD5A 4QSCA 3CG1A 1TT1A 4F39A 1M5BA 4F18A 4QF9A 1IZ1A 4LZ8A 1PBQA 4QFKA 3ZSFA 4QHQA 2P2AA 3W9WA 4NF4A 3O97A 3VLUA 1B0HA 1L5TA 4TLMB 1URDA 3TDJA 2Y7WA 1NNTA 3MVWA 3KN3A 3CRBA 4RK2A 5I59A 1QUJA 1B6HA 4NWDA 2RC7A 1S7YA 1VR5A 4GLIA 4ZZAA 4Z7EA 1PC3A 3TZAA 2ZYKA 2UXAA 2YJPA 4AQ4A 3OEMA 4NF8A 3VV5A 3W15C 3SETA 5J1DA 2RC9A 3V89B 4DLDA 1S9TA 3Q27A 1LAXA 1OMPA 5DTBA 3PPNA 4F3SA 1I6AA 5IKBA 3CSGA 4U21A 4RPNA 1KWHA 3A3UA 4GL8A 4Z0IA 3K6VA 1ELJA 3FXUA 2ALUA 2PBWA 4F3BA 5CM6A 5CRYA 1O64A 4NMYA 3OXNA 3G3KA 4TLLB 1MDQA 5IAIA 1A40A 1OVBA 4OYVA 2VD3A 4YKKA 3PU5A 4F3GA 2UVIA 3K1NA 4EF2A 2G29A 3ZKLA 1T0KA 3IJXB 1P1NA 1PBPA 4MLQA 5I56B 4ELOA 1Y20A 5I84A 1B9JA 4THIA 4X1BA 5H8SA 4RK9A 3OO8A 3VLWA 4LONB 1EU8A 2ZXTA 4UACA 5H8FB 3PUWE 2XX8A 3BKIB 3RPWA 2V93A 3USDA 1A99A 3FVOA 4OXVA 1MQJA 4U1OA 3SEWA 1YCJA 1SVXB 3LC8A 2R9JA 3O29A 2P1SA 1H45A 5ISUA 3FZVA 3I5OA 3QYTA 2UVGA 4NF5B 2B65A 1HSJA 3RTWB 3T93B 3FIRA 5ICTA 3KGCA 2D5WA 2BJJX 1UIUA 2DXRA 3MJNA 1B5JA 4F1YA 2NXOA 5TP9A 1LAGE 1FQAA 4H1XA 1QJMA 1BKAA 3N94A 3G3GA 4K3FA 4FJPA 1GTKA 4TOZA 2QS4A 3W9VA 3H6WA 4YB7A 2OWTA 1LFHA 5TPAB 4GQOA 1MS7A 4PE5B 2QS3A 4POWA 3CIJA 4GVOA 1LBCA 3O6GA 1NFTA 3VE1B 3E4RA
chains in the Genus database with same CATH superfamily
1DCUA 4R9GA 4LZ7A 4MIJA 4GRKA 1II5A 4GF8A 4Q0CA 3B6TA 4XKQA 2OZZA 4YB5A 1NV3A 2QL3A 2DE2A 2DSFA 3T0JA 4KPTA 4Q30B 4X9TA 4G68C 2HXRA 4GBVA 4IO3A 1NNFA 3E3KA 5HM4B 2OLBA 3IB2A 2FIXA 5I56A 3RLFE 4F2QA 2OBGA 3ZS6A 2OX3A 1RYXA 1EZ9A 1MG1A 1JVXA 4GXSB 4RXLA 3SEVA 3L6HA 1MQIA 5ET8A 2Q88A 5H8FA 2D21A 3OSQA 4QSEA 1B1HA 2HEUA 2I0CA 1BLFA 4GWYA 1M5CA 3RYDA 4L17A 4LVQA 4NE4A 4H8JA 1A8FA 3WAFA 2JJKA 2A5SA 1LBXA 5AA2B 4EQ9A 5BWJA 2VGQA 4YAHX 3TUSA 3H4ZA 4ZEIA 5EQ9A 2NVUB 1H3DA 5KDTA 1SW2A 2XXUA 1WODA 2XXIA 3MQ9A 4HE2A 1NKXA 3BIGA 1AMFA 2H9BA 1TFAA 3DP4A 1Y4TA 4M4GA 2DVCA 4MNIA 3FJMA 1O7TA 2CZHA 2VHAA 2FYIA 4OQOA 3F11A 4F3PA 2QSXA 4U4XA 5AA3A 4ELPA 5A5XB 5EYHA 3CR9A 1B3LA 4X04A 5FTIA 1QULA 3H03A 2H99A 2I4CA 2XXTA 5CMMA 1FPDA 1P1OA 3KG2A 1MM7A 4XXUA 4N13A 2I0BA 1Y3NA 2XWVA 5IZZA 4KQPA 4GXAA 2XWOA 1UQWA 3U8QA 4YU0A 5ESYA 4X1DA 1LFGA 4LUBA 3ILUB 3SEUA 2GRVA 3KBRA 5FHNA 2RC8A 2E1SA 1FTKA 3G3JA 3PPPA 3QXMA 2QMXA 4KYDA 3HPIA 1Z7ME 4EQ7A 3EKIA 2ZMBA 2QVVA 4ESWA 4DE8A 4XIGQ 3TAJA 5L9SA 4OVPA 4PFWA 2CZKA 3K6WA 4PAIA 1IIWA 4F1UA 1SYHA 3CVGA 1ZLQA 1DMBA 2DE4A 2VT5A 4EDPA 1VFDA 3C32A 2GFEA 4IR8A 2HQ0A 4GL0A 1IXHA 2KR0A 5B7DA 4IGRA 1GGGA 3FV1A 2I58A 4EUOA 4GWSA 1MH4A 4C1UA 1AL3A 1FBFA 1N7WA 5KCJA 2W7YA 4G61A 5B70A 3KC0A 1UTBA 4U22A 4OHNA 4G68A 4OANA 3VVEA 1ZTYA 2PT1A 1M5EA 4ZS9A 1H76A 5I7IA 4O94A 1NUZA 3D1RA 3MVZA 4IO2A 2HFBA 4MX6A 2YLNA 3BBRA 1SYIA 2F35A 2ESNA 4FECA 4DI3D 3S9LC 4XKRA 4LQ5A 5HBCA 3KOSA 1UTHB 1B7HA 1FCKA 2XXYA 4R6KA 1FPIA 5LDZA 1BIYA 2DWAA 4GOTA 4PCDA 1URSA 1FQBA 1QW0A 3UORA 3OELA 5FHOA 2HCAA 5DEXA 3IFCA 4EQBA 2Q89A 4NWCA 1CE2A 3OMBA 4XF5A 1LCTA 3D4GA 3T96B 4ELRA 1FRPA 2PT2A 3PPQA 4N6KA 5H8NB 1H44A 2PFZA 4IB2A 1MY4A 4OMBA 2NUVA 1D3KA 3MBPA 4JXIA 5T3JA 3IK6B 2R8TA 3V8XB 3O9PA 2PX1A 2UYEA 5K2XA 1MM6A 2ZZVA 4O3CA 4YKJA 1NV1A 2Z8EA 1P1UA 3Q25A 1XI6A 2Y7KA 4O3AA 4MNPA 4JDFA 4JWOA 3M3KA 1BP5A 3SESA 2UYFA 3KJ7A 3EPEA 4H45A 4LA9A 1FBPA 2DP8A 4R2BA 1FBCA 4QFOA 2PYYA 3A29A 4XKPA 3LSXA 2ABHA 3RGYA 1QKAA 2KLFA 1MXZA 4YMAA 3PD9A 2Y5KA 1NMUA 4RJZA 1B3EA 3TTRA 3IORA 5CC2A 3S2VA 3PPRA 3M3LA 1A54A 1DPPA 4PFUA 5M2VA 4G8MA 1K9ZA 1FQDA 2Q9TA 3CFLA 2I48A 2DQVA 1NNKA 1GR2A 1FTOA 1B52A 3IO6A 2DXYA 4MMPA 5AA2D 5LTCA 3KSXA 1DBZA 5L9MA 4EXKA 4H5FA 1FQCA 3T9HB 3IOTA 4HTGA 4OFOA 4N8YA 4KYSA 1NH8A 2H98A 1XOCA 4O7MA 2Y7PA 1LGBC 3TEPA 1NV2A 2O69A 1XVYA 1MRPA 3H6VA 1Y3QA 4OFJA 3LSFB 3EHSA 2PCRA 1TWYA 3T9XB 4Q8RA 2F7BA 1XS5A 4OERA 3TPAA 1DTZA 1SI1A 1AH5A 1SD3A 2DWHA 4U1ZA 4PC9A 1SDXA 4GD5A 3D4CA 5DVJA 3KSJA 4X48A 4DI4B 3O28A 1B3HA 3EN3A 4XFEA 2QFLA 4I40A 4R6HA 1NNPA 2QMWA 3V5AA 3VLVA 1PB7A 3HHFA 3DLNA 5H8NA 1ZJLA 1LFIA 3H7MA 3C9HA 3KN8A 1RDZA 1NL5A 1P1QA 4H67A 2O84X 2V4CA 2Z23A 5EHMA 1DOTA 5EHSA 2F78A 4JWYA 4ZEBA 4N07A 4KFQA 1Y1ZA 2XHDA 4HCWA 1JQFA 2F7CA 3RT6B 2OWZA 3CFXA 3T9VA 4Q5TA 4ZEFA 3KFMA 4MH5A 5LOMA 4GFRA 3HN0A 4N15A 5AA1A 3MSTA 1O63A 4OFLA 3NOHA 2P3VA 1FJ9A 3VVFA 3C33A 3E78A 1F9BA 4H65A 1QUKA 4JWXA 1XT8A 2FHYA 2V84A 1ATGA 4MJOA 1IEJA 3RN8A 3SERA 4C1TA 1OLAA 2Q74A 5I57B 1N7XA 1RKMA 4IY6A 2O68A 4ZECA 3UK4A 5ICQA 5DVIA 1MY2A 4OVSA 2GH9A 5F1QA 4G8NA 1M5DA 3MVYA 1IMBA 2ZYOA 3E79A 3EHUA 3H6TA 3FXQA 1QGXA 1B46A 3CFZA 3OD7A 4LZ5A 3B7DA 3LR1A 4R74A 4OENA 2QVUA 2XXXA 2Z22A 3M3FA 5JTYB 3T9UA 1MXVA 1A55A 3MPKA 1PB9A 2XX7A 3FGSA 1Y3PA 1Q9DA 1VFEA 1Y1MA 3FVNA 4I8CA 3TYHA 2WEFA 2CZLA 4C0RA 2RCAA 2QJEA 4N6PA 3HHGA 1EYJA 4PFYA 3BFUA 5FBPA 4PFTA 1IXIA 4MEVA 4X8RA 2GQ1A 1JEUA 4DDDA 4HE1A 2ANJA 2XWIA 4BDQA 1EYKA 3UP9A 5I5PA 5IZ3B 3I3VA 1A7LA 2FA7A 1JEVA 1EZPA 4P11A 3MW0A 2G93A 1USYE 1B1XA 3IR1A 3K02A 3S9MC 1N3WA 4JVDA 4H6DA 1FPEA 4OTEA 4BDMA 1TFDA 3I6VA 3IAZA 2F6GA 5H8HB 2XXPA 2OK2A 3R6UA 4LN5A 1N04A 1MDP1 3ZKKA 3VDFA 3LBSA 3O6IA 1MPDA 1US4A 2XD3A 2GHAA 1URGA 3C31A 4JSDA 2HAUA 3IX1A 4NF5A 4PETA 3OO6A 1MQHA 3GYYA 1FPGA 5I57A 3EHTA 4FBPA 4YICA 4KYEA 3IOWA 1LB8A 4H8IA 1LAFE 3FBPA 3TCHA 2OCUA 4PDHA 1US5A 3N6TA 1RDYA 1SQYA 3HSTA 5TPAA 1FQFA 2V3UA 3DP8A 3HO7A 1AOVA 1FBDA 1NUYA 2O7UA 4OEUA 3L6GA 4QFNA 4PFIA 4ECFA 1A8EA 3FV2A 1SW1A 3K1MA 4NG7A 5I2KB 5EYFA 2I4BA 3S9EA 4NF6B 1NV4A 3E9XA 2X26A 3K2DA 4U4SA 3QSLA 2Q2CA 4ZDMA 4R2FA 5ELVA 3N26A 4MF3A 4F29A 2HPGA 3G3HA 4FE8A 4GWXA 5F7VA 4PTKA 1B51A 3OENA 1B5IA 1NUWA 1YYZA 4DIGA 2DVZA 4U2RA 4GIZA 2O1MA 4I62A 4ESXA 1HSLA 5CMKA 3RUMA 3S9NC 4ZEKA 1B7UA 3TTLA 2MKZA 1NUXA 5ET5A 3MZ1A 3PUYE 2Y84A 3PPOA 4R73A 1UIVA 1B3FA 4DCYA 3TFLA 4KCDA 1JETA 2O1LA 2QRYA 3H06B 5AA2A 4LQ2A 3PMVA 4FAJA 1YAEA 3RQTA 1Y4CA 1S50A 2FNCA 3LSLA 1FBHA 3PMWA 4DXBA 4NF4B 4HW8A 2PVUA 1LLSA 4P0GA 4P1LA 1VDWA 1LBVA 5TU0A 2NOOA 5I2NB 4RPOA 2F34A 1FQEA 5I59B 5AA4B 4MLVA 3GXAA 5CMBA 4PFBA 2ZNTA 3Q26A 2HZLA 3K6XA 3UN6A 1FPLA 2VOZA 1B4ZA 1NV0A 4YZZA 4N8GA 4FATA 4NQ8A 2H4IA 5A5XA 3KZGA 3PGFA 5L8DA 4PE3A 4NF8B 2QS1A 3THIA 2V3QA 1SW5A 2F3DA 4XKNA 2HZKA 1EH3A 2VPNA 4NF6A 3E13X 3TQLA 1I6QA 3AXFA 3UGWA 1ZMGA 2NWJA 3MP6A 2XWKA 2IA4A 1SI0A 1MY1A 5EQAA 3OOAA 4NTLA 3H6UA 4PP0A 1MPCA 3G3IA 3U94A 1PEBA 4O3BA 3SEYA 1MXWA 2GHBA 3IFAA 4R6YA 1PDAA 5HPQA 2F5XA 1MQGA 5ET7A 1B7ZA 4WKMA 3WAEA 4POXA 2XXVA 4WXJA 3ONMA 1SW4A 3GBAA 3TODA 5I58B 5CBSA 4R75A 3N6UA 3RY3A 5CI5A 2ZZWA 3EF7A 1FTLA 4NAPA 3UIFA 3K01A 4E0XA 2O7IA 5I2NA 1POY1 3OO9A 3VXCA 2H25A 1Q35A 4I1DA 4MBPA 5K2YA 1ZU0A 2F36A 1FTMA 5AA4A 4EF1A 4P0IA 4FEBA 2O51A 1HSEA 2Q2AA 4PGNA 4P1EA 1CNQA 3ISPA 5TP9B 2RKMA 3V83A 2RCBA 3TTMA 2QS2A 3TELA 2HAVA 4AS5A 1XHYA 3JV9A 3MVXA 3QUJA 1JVYA 1LB9A 1UTHA 3C35A 2FVZA 2BJIA 2ZYNA 4G4PA 3IO4A 2I6EA 3TCGA 5ITPA 2F8DA 1I69A 2WKYA 4AB6A 2HHMA 2Z8FA 1AIVA 1Y9UA 1P99A 2LAOA 4IY5A 3B50A 2H5YA 4IO4A 4RYAA 4KR5A 1DK4A 4IO5A 2ZNUA 1N0TA 1NH7A 4BLAA 3DP6A 4RY1A 4G8HA 3HV1A 2OWSA 3FJ7A 4IO6A 2VD2A 3RT8A 2XXQA 4F2OA 2AL4A 1R9LA 4IO7A 1IITA 3S4UA 2I49A 3BFTA 2Q8MA 2DOJA 3RTFB 5KZTA 5F24A 2FIEA 4RNSA 4N4UA 2AIXA 3LSWA 1D9YA 2F97A 4QRZA 3VVDA 4WEPA 5DW8A 2PFYA 4KHZE 1GVCA 1I6BA 3G7WA 3BIHA 3MC2A 2E0SA 4OA4A 4UA8A 3MPLA 4NEDA 2VPOA 3T1BA 1B0LA 2B3FA 2V25A 4ND9A 4BDLA 1ANFA 2RINA 1LBBA 4GBWA 4DCXA 2DS9A 4DXUA 2XX9A 4O7IA 4MNCA 2XXHA 3C36A 3R26A 1IMFA 3QMFA 5I58A 1XC1A 4PAKA 4PAFA 1WVJA 4I3EA 2CEYA 1MXYA 4ZZEA 5DVFA 1NV6A 3HCQA 2D3IA 1N76A 1ZKBA 3QK6A 1IUDA 1B32A 1H43A 1FTJA 1B4HA 2WYPA 4LP2B 2REGA 3O6HA 4HE0A 3Q29A 3KC1A 2AYSA 3QIMA 3FATA 4FORA 1LSTA 5KDTB 1B40A 2X7PA 1OIBA 1DTGA 3B6WA 3K00A 3U1OA 3ILTB 1FW0A 3PV0E 2P3NA 2I3VA 2THIA 3B6QA 3VXBA 1B2HA 4JSOA 3OO7A 3O66A 4P3LA 5ITOA 1DPEA 4GWWA 3SZPA 1N84A 3CSBA 5ET6A 1OQHA 1M5FA 1NV7A 2ONSA 3LV0A 3VFJA 2F7AA 4YKIA 2ZYMA 3P7IA 2UVHA 4TQUQ 3K1PA 3CHGA 1VE4A 4OZ9A 4G2ZA 3TKDA 1J1NA 4F31B 2ONRA 3FVGA 1G0IA 2DWJA 1G0HA 2PMSA 3PMXA 4N91A 2IEEA 3TQWA 2L5VA 2CZIA 3HFUA 3GLBA 4AS4A 4F19A 2ZNSA 4QFLA 4MCOA 4OEVA 1R6ZA 2XXWA 4NN3A 1MXUA 3KBZA 4QBAA 4BDOA 2DE3A 4HXVA 4YKPA 3A3CA 1JW5A 3TTKA 1D9VA 4GWOA 4ELQA 2VP1A 2A5TB 2B3BA 1R1NA 4G77A 3LUYA 1MPBA 4OESA 4UABA 1BK4A 1MQDA 2M8CA 2X7QA 3U92A 4HS7A 1FPJA 4QFPA 3PUZE 4JB7A 3T66A 4I9DA 3QAXA 3SKPA 3GZGA 5EQ8A 4YB6A 1YZ0A 5KCJB 1YTVA 2DYXA 2QPQA 2WBBA 1UTBB 4G68B 2Y5LA 3H3GA 2AL5A 3RPLB 2DDKA 3N5LA 5A5LA 4H5GA 4P56A 1IQ7A 3T22A 4U23A 2I3WA 3Q28A 5EYGA 3MP1A 5JEIA 1AWBA 1BTJA 3OSRA 1LBYA 4MAGA 2Y7IA 2OJTA 4AB5A 4OWDA 4FEDA 4JBZA 1RYOA 5JTYA 1WDNA 5DYHA 1FPKA 2F6PA 1LCFA 4DXCA 3ODBA 2XD2A 3PD8A 1QKBA 3KJTA 3FXRA 4RA1A 3A09A 4OVTA 1OVTA 4ZEDA 2P0SA 3G3FA 1B05A 2UVJA 2YPNA 4ZE8A 4QSDA 3IL1B 4N17A 4LATA 1QUIA 3ECRA 1Q1KA 4XTCQ 1QVSA 3FVKA 5DEXB 1IMCA 1LBZA 2R6GE 5IZ3A 4R72A 1IXGA 3KEIA 3MUQA 4DZ1A 4R9FA 1ZIUA 4KCCA 1D4NA 3PUVE 4PDDA 2ONKE 5EQ7A 1SPIA 2CMOA 3MP8A 1N3XA 1KA1A 2KQZA 4F1VA 5H8HA 5FHMA 1Z7NE 3PUXE 2A5TA 1PB8A 2ZZXA 3K6UA 4OVJA 3M8UA 5H8QB 3TMGA 1SBPA 3FUZA 5DT6A 3SEXA 4PQJA 2Z8DA 1B58A 4E0WA 4OVRA 3TCFA 3C34A 1IMDA 4F22A 4I3YA 1B3GA 1XVXA 2REJA 4PF6A 4N81A 1LEVA 2DWIA 4BDNA 3SDFA 3MZBA 5BUUA 1MY0A 1ZBMA 3K4UA 3IOUA 2XXRA 2Q8JA 1MXXA 3U93A 3JZJA 5CBRA 3O2AA 1IMEA 1MY3A 3RPLA 5IM2A 4KI0E 1B5HA 4NGUA 3FJGA 2F3BA 1GV8A 1JW4A 3FD3A 1FBGA 2O6AA 1RDXA 3UA8A 1JNFA 4BDRA 3CG3A 4ONYA 1OQGA 4M1VA 1EYIA 1LBWA 1DSNA 1POTA 3IOVA 4GX4A 1MH3A 4ZE9A 4HCYA 1EZOA 5JK4A 2R71A 5I2KA 1KZ8A 2B4LA 3U72A 4GWZA 2FBPA 1OLCA 3MAMA 3DM0A 1JP4A 3DELB 1USYH 3FASA 3R7XA 2HXWA 4YMBA 3CI8A 3IJOB 1LAHE 4H0WA 4PBHA 4OETA 3KN7A 4WEDA 1P1WA 3K0VA 2QVRA 2Y7RA 1FJ6A 1CB6A 2XXKA 3EQ1A 1R9QA 3KOTA 3QUFA 1TXFA 2V3TA 1YPNA 5L9OA 3MWBA 1IXCA 1NV5A 4IGTA 3MZ9A 3IB0A 4N6DA 4FIMA 4PBQA 3IB1A 4PFRA 3JYRA 4PF8A 3TTNA 4H46A 4EXLA 3OEKA 4ISUA 4MFIA 5CMCA 1VSOA 3RNNA 5H8QA 2RF1A 3C4MA 5FTHA 1JW1A 3GBBA 5AE4A 4KD5A 4QSCA 3CG1A 1TT1A 4F39A 1M5BA 4NF0A 3FXBA 4QF9A 4F18A 1IZ1A 4LZ8A 4P8BA 2CEXA 1PBQA 2B4MA 2WBDA 4QFKA 1INPA 3ZSFA 4QHQA 2P2AA 3W9WA 4NF4A 4XEQA 3PTYA 3O97A 3VLUA 1B0HA 1YXIA 1L5TA 4TLMB 4JVIA 1URDA 3TDJA 2Y7WA 1NNTA 4JVCA 3MVWA 3KN3A 3CRBA 4RK2A 4O8MA 5I59A 1QUJA 1B6HA 4NWDA 2RC7A 1S7YA 1K9YA 1VR5A 4GLIA 4ZZAA 3MYUA 4Z7EA 1PC3A 3TZAA 2ZYKA 2UXAA 2YJPA 4AQ4A 1FPFA 4NX1A 3OEMA 4NF8A 3VV5A 3W15C 3SETA 5J1DA 2RC9A 3V89B 4DLDA 1S9TA 3Q27A 1LAXA 1OMPA 4NHBA 5DTBA 3PPNA 4F3SA 1I6AA 5IKBA 3CSGA 4U21A 4RPNA 1KWHA 3A3UA 4GL8A 4Z0IA 3K6VA 1ELJA 3FXUA 2ALUA 2PBWA 4F3BA 5CM6A 5CRYA 1O64A 4NMYA 3OXNA 3G3KA 4TLLB 1MDQA 5IAIA 1A40A 1OVBA 5IGAA 2XA5A 3B8BA 5I3SA 4OYVA 2VD3A 4YKKA 3PU5A 1NI9A 4F3GA 2UVIA 3K1NA 4EF2A 2G29A 3ZKLA 1T0KA 3IJXB 1P1NA 1PBPA 4MLQA 5I56B 4ELOA 1Y20A 5I84A 1B9JA 4THIA 4P47A 4X1BA 1FPBA 5H8SA 4RK9A 3OO8A 3VLWA 1FBEA 4LONB 1EU8A 2ZXTA 4UACA 4KXPA 5H8FB 1FSAA 3PUWE 2XX8A 3BKIB 4OVQA 5IZ1A 4GX3A 3RPWA 2V93A 3USDA 1KA0A 1A99A 3FVOA 4GX6A 1MQJA 4OXVA 4U1OA 3SEWA 1YCJA 4P9KA 1SVXB 1D9QA 3LC8A 2WYKA 2R9JA 3O29A 2P1SA 1H45A 5ISUA 3FZVA 1FTAA 3I5OA 4MHFA 3QYTA 2UVGA 4NF5B 2B65A 1HSJA 3RTWB 3T93B 3FIRA 5ICTA 3KGCA 2D5WA 2BJJX 1UIUA 2DXRA 3MJNA 1B5JA 4F1YA 2NXOA 5TP9A 1LAGE 1FQAA 4H1XA 1QJMA 5J16A 1BKAA 3N94A 3G3GA 4K3FA 4FJPA 4PGPA 3U65A 1GTKA 4TOZA 4GWUA 3ROJA 2QS4A 3W9VA 3H6WA 4YB7A 2OWTA 1LFHA 1IMAA 5TPAB 4GQOA 1MS7A 3LUZA 4PE5B 2QS3A 4POWA 3CIJA 4GVOA 2WX9A 1LBCA 4QXDA 3O6GA 1NFTA 3VE1B 3E4RA
chains in the Genus database with same CATH topology
4R9GA 4LZ7A 4GRKA 1II5A 4GF8A 4Q0CA 3B6TA 4XKQA 2OZZA 4YB5A 2QL3A 2DE2A 2DSFA 4KPTA 4Q30B 4X9TA 4G68C 4IO3A 1NNFA 3E3KA 5HM4B 2OLBA 3IB2A 5I56A 3RLFE 4F2QA 2OBGA 3ZS6A 1RYXA 1EZ9A 1MG1A 1JVXA 4GXSB 4RXLA 3SEVA 3L6HA 1MQIA 2Q88A 5H8FA 2D21A 3OSQA 4QSEA 1B1HA 2HEUA 2I0CA 1BLFA 1M5CA 4L17A 4LVQA 4NE4A 4H8JA 1A8FA 3WAFA 2A5SA 5AA2B 4EQ9A 5BWJA 2VGQA 4YAHX 3TUSA 3H4ZA 4ZEIA 2NVUB 1H3DA 5KDTA 1SW2A 2XXUA 1WODA 2XXIA 3MQ9A 1NKXA 1AMFA 2H9BA 1TFAA 3DP4A 1Y4TA 4M4GA 2DVCA 3FJMA 1O7TA 2VHAA 2FYIA 4OQOA 3F11A 4F3PA 2QSXA 4U4XA 5AA3A 4ELPA 5A5XB 3CR9A 1B3LA 5FTIA 1QULA 3H03A 2H99A 2I4CA 2XXTA 5CMMA 1P1OA 3KG2A 1MM7A 4XXUA 4N13A 2I0BA 1Y3NA 4KQPA 4GXAA 1UQWA 3U8QA 4YU0A 4X1DA 1LFGA 4LUBA 3ILUB 3SEUA 2GRVA 3KBRA 5FHNA 2RC8A 2E1SA 1FTKA 3G3JA 3PPPA 3QXMA 2QMXA 4KYDA 3HPIA 1Z7ME 4EQ7A 2ZMBA 4ESWA 4DE8A 4XIGQ 3TAJA 5L9SA 4PFWA 3K6WA 1IIWA 4F1UA 1SYHA 3CVGA 1ZLQA 1DMBA 2DE4A 4EDPA 1VFDA 3C32A 2GFEA 2HQ0A 4GL0A 1IXHA 5B7DA 4IGRA 1GGGA 3FV1A 2I58A 4EUOA 1MH4A 4C1UA 1AL3A 1N7WA 5KCJA 2W7YA 5B70A 1UTBA 4U22A 4OHNA 4G68A 3VVEA 1ZTYA 2PT1A 1M5EA 4ZS9A 1H76A 3MVZA 4IO2A 2HFBA 2YLNA 3BBRA 1SYIA 2F35A 2ESNA 4FECA 3S9LC 4XKRA 4LQ5A 5HBCA 3KOSA 1UTHB 1B7HA 1FCKA 2XXYA 4R6KA 1BIYA 2DWAA 4GOTA 1URSA 1FQBA 1QW0A 3UORA 3OELA 5FHOA 2HCAA 5DEXA 4EQBA 2Q89A 4NWCA 1CE2A 3OMBA 1LCTA 3D4GA 3T96B 4ELRA 2PT2A 3PPQA 5H8NB 1H44A 4IB2A 1MY4A 4OMBA 2NUVA 1D3KA 3MBPA 4JXIA 3IK6B 3V8XB 3O9PA 2PX1A 2UYEA 5K2XA 1MM6A 4O3CA 4YKJA 2Z8EA 1P1UA 3Q25A 2Y7KA 4O3AA 4JDFA 4JWOA 3M3KA 1BP5A 3SESA 2UYFA 3KJ7A 3EPEA 4LA9A 2DP8A 4R2BA 4QFOA 2PYYA 4XKPA 3LSXA 2ABHA 3RGYA 1QKAA 2KLFA 1MXZA 4YMAA 3PD9A 1NMUA 4RJZA 1B3EA 3TTRA 3IORA 5CC2A 3S2VA 3PPRA 3M3LA 1A54A 1DPPA 4PFUA 5M2VA 4G8MA 1FQDA 2Q9TA 3CFLA 2I48A 2DQVA 1NNKA 1GR2A 1FTOA 1B52A 3IO6A 2DXYA 5AA2D 3KSXA 5L9MA 4EXKA 4H5FA 1FQCA 3T9HB 3IOTA 4HTGA 4OFOA 4KYSA 1NH8A 2H98A 1XOCA 2Y7PA 1LGBC 3TEPA 2O69A 1XVYA 1MRPA 3H6VA 1Y3QA 4OFJA 3LSFB 3EHSA 1TWYA 3T9XB 4Q8RA 2F7BA 1XS5A 4OERA 3TPAA 1DTZA 1SI1A 1AH5A 1SD3A 2DWHA 4U1ZA 1SDXA 4GD5A 3D4CA 5DVJA 3KSJA 4X48A 3O28A 1B3HA 3EN3A 4R6HA 1NNPA 2QMWA 3V5AA 3VLVA 1PB7A 3HHFA 3DLNA 5H8NA 1ZJLA 1LFIA 3H7MA 3C9HA 3KN8A 1NL5A 1P1QA 4H67A 2O84X 2Z23A 5EHMA 1DOTA 5EHSA 2F78A 4JWYA 4ZEBA 4N07A 4KFQA 1Y1ZA 2XHDA 4HCWA 1JQFA 2F7CA 3RT6B 3CFXA 3T9VA 4Q5TA 4ZEFA 3KFMA 4MH5A 5LOMA 4GFRA 3HN0A 5AA1A 1O63A 4OFLA 3VVFA 3C33A 1F9BA 4H65A 1QUKA 4JWXA 1XT8A 2V84A 1ATGA 1IEJA 3RN8A 3SERA 4C1TA 1OLAA 5I57B 1N7XA 1RKMA 4IY6A 2O68A 4ZECA 3UK4A 5ICQA 5DVIA 1MY2A 2GH9A 5F1QA 4G8NA 1M5DA 3MVYA 2ZYOA 3EHUA 3H6TA 3FXQA 1B46A 3CFZA 3OD7A 4LZ5A 3B7DA 3LR1A 4R74A 4OENA 2XXXA 2Z22A 3M3FA 5JTYB 3T9UA 1MXVA 1A55A 3MPKA 1PB9A 2XX7A 3FGSA 1Y3PA 1VFEA 1Y1MA 3FVNA 4I8CA 3TYHA 4C0RA 2CZLA 2RCAA 2QJEA 4N6PA 3HHGA 4PFYA 3BFUA 4PFTA 1IXIA 1JEUA 4DDDA 2ANJA 4BDQA 3UP9A 3I3VA 1A7LA 2FA7A 1JEVA 1EZPA 4P11A 3MW0A 2G93A 1USYE 1B1XA 3IR1A 3K02A 3S9MC 1N3WA 4H6DA 4OTEA 4BDMA 1TFDA 3I6VA 3IAZA 2F6GA 5H8HB 2XXPA 2OK2A 3R6UA 1N04A 1MDP1 3ZKKA 3VDFA 3LBSA 3O6IA 1US4A 1MPDA 2XD3A 2GHAA 1URGA 3C31A 4JSDA 2HAUA 3IX1A 4NF5A 4PETA 3OO6A 1MQHA 5I57A 3EHTA 4YICA 4KYEA 3IOWA 1LB8A 4H8IA 1LAFE 3TCHA 2OCUA 1US5A 3N6TA 1SQYA 3HSTA 5TPAA 1FQFA 2V3UA 3DP8A 3HO7A 1AOVA 2O7UA 4OEUA 3L6GA 4QFNA 4ECFA 1A8EA 3FV2A 1SW1A 3K1MA 5I2KB 5EYFA 2I4BA 3S9EA 4NF6B 3E9XA 2X26A 3K2DA 4U4SA 3QSLA 2Q2CA 4ZDMA 4R2FA 5ELVA 3N26A 4MF3A 4F29A 3G3HA 4FE8A 5F7VA 1B51A 3OENA 1B5IA 4DIGA 2DVZA 4U2RA 4GIZA 2O1MA 4I62A 4ESXA 1HSLA 5CMKA 3RUMA 3S9NC 4ZEKA 1B7UA 3TTLA 3MZ1A 3PUYE 2Y84A 3PPOA 4R73A 1UIVA 1B3FA 4DCYA 3TFLA 4KCDA 1JETA 2O1LA 5AA2A 2QRYA 3H06B 4LQ2A 3PMVA 4FAJA 1YAEA 3RQTA 1Y4CA 1S50A 2FNCA 3LSLA 3PMWA 4DXBA 4NF4B 4HW8A 2PVUA 1LLSA 4P0GA 5TU0A 2NOOA 5I2NB 4RPOA 2F34A 1FQEA 5I59B 5AA4B 4MLVA 3GXAA 5CMBA 2ZNTA 3Q26A 2HZLA 3K6XA 3UN6A 2VOZA 1B4ZA 4YZZA 4FATA 2H4IA 5A5XA 3KZGA 3PGFA 5L8DA 4NF8B 2QS1A 3THIA 2V3QA 1SW5A 4XKNA 2HZKA 1EH3A 4NF6A 3E13X 3TQLA 1I6QA 3AXFA 3UGWA 1ZMGA 2NWJA 3MP6A 2IA4A 1SI0A 1MY1A 3OOAA 4NTLA 3H6UA 4PP0A 1MPCA 3G3IA 3U94A 1PEBA 4O3BA 3SEYA 1MXWA 2GHBA 4R6YA 1PDAA 5HPQA 2F5XA 1MQGA 1B7ZA 4WKMA 3WAEA 4POXA 2XXVA 4WXJA 3ONMA 1SW4A 3GBAA 3TODA 5I58B 5CBSA 4R75A 3N6UA 3RY3A 5CI5A 3EF7A 1FTLA 3UIFA 3K01A 4E0XA 2O7IA 5I2NA 1POY1 3OO9A 3VXCA 2H25A 1Q35A 4I1DA 4MBPA 5K2YA 1ZU0A 2F36A 1FTMA 5AA4A 4EF1A 4P0IA 4FEBA 2O51A 1HSEA 2Q2AA 5TP9B 2RKMA 3V83A 2RCBA 3TTMA 2QS2A 3TELA 2HAVA 1XHYA 3JV9A 3MVXA 3QUJA 1JVYA 1LB9A 1UTHA 3C35A 2ZYNA 4G4PA 3IO4A 2I6EA 3TCGA 5ITPA 2F8DA 1I69A 2WKYA 4AB6A 2Z8FA 1AIVA 1Y9UA 1P99A 2LAOA 4IY5A 2H5YA 4IO4A 4RYAA 4KR5A 4IO5A 2ZNUA 1N0TA 1NH7A 4BLAA 3DP6A 4RY1A 4G8HA 3HV1A 2OWSA 3FJ7A 4IO6A 2VD2A 3RT8A 2XXQA 4F2OA 2AL4A 1R9LA 4IO7A 1IITA 3S4UA 2I49A 3BFTA 2DOJA 3RTFB 5KZTA 4RNSA 2AIXA 3LSWA 1D9YA 2F97A 4QRZA 3VVDA 4WEPA 4KHZE 1GVCA 1I6BA 3G7WA 3MC2A 2E0SA 4UA8A 3MPLA 4NEDA 1B0LA 2B3FA 2V25A 4ND9A 4BDLA 1ANFA 2RINA 1LBBA 4DCXA 2DS9A 4DXUA 2XX9A 2XXHA 3C36A 3R26A 5I58A 1XC1A 1WVJA 1MXYA 4ZZEA 5DVFA 3HCQA 2D3IA 1N76A 1ZKBA 3QK6A 1IUDA 1B32A 1H43A 1FTJA 1B4HA 4LP2B 2REGA 3O6HA 3Q29A 2AYSA 3QIMA 3FATA 4FORA 1LSTA 5KDTB 1B40A 2X7PA 1OIBA 1DTGA 3B6WA 3K00A 3U1OA 3ILTB 1FW0A 3PV0E 2I3VA 2THIA 3B6QA 3VXBA 1B2HA 4JSOA 3OO7A 3O66A 5ITOA 1DPEA 1N84A 3CSBA 1OQHA 1M5FA 2ONSA 3VFJA 2F7AA 4YKIA 2ZYMA 3P7IA 2UVHA 4TQUQ 3K1PA 1VE4A 4OZ9A 4G2ZA 3TKDA 1J1NA 4F31B 2ONRA 3FVGA 2DWJA 2PMSA 3PMXA 3TQWA 2IEEA 3GLBA 4F19A 2ZNSA 4QFLA 4OEVA 1R6ZA 2XXWA 1MXUA 4BDOA 2DE3A 4YKPA 3A3CA 1JW5A 3TTKA 1D9VA 4GWOA 4ELQA 2VP1A 2A5TB 2B3BA 1R1NA 4G77A 3LUYA 1MPBA 4OESA 1MQDA 2M8CA 2X7QA 3U92A 4HS7A 4QFPA 3PUZE 4JB7A 3T66A 4I9DA 3QAXA 3SKPA 3GZGA 4YB6A 5KCJB 1YTVA 2DYXA 2QPQA 1UTBB 4G68B 3H3GA 2AL5A 3N5LA 4H5GA 1IQ7A 3T22A 4U23A 2I3WA 3Q28A 3MP1A 5JEIA 1BTJA 3OSRA 2Y7IA 2OJTA 4AB5A 4OWDA 4FEDA 4JBZA 1RYOA 5JTYA 1WDNA 5DYHA 2F6PA 1LCFA 4DXCA 3ODBA 2XD2A 3PD8A 1QKBA 4ZEDA 3KJTA 3FXRA 4RA1A 3A09A 1OVTA 2P0SA 3G3FA 1B05A 2UVJA 2YPNA 4ZE8A 4QSDA 3IL1B 4LATA 1QUIA 3ECRA 1Q1KA 4XTCQ 1QVSA 3FVKA 5DEXB 2R6GE 4R72A 1IXGA 3KEIA 3MUQA 4DZ1A 4R9FA 1ZIUA 4KCCA 1D4NA 3PUVE 2ONKE 2CMOA 3MP8A 1N3XA 4F1VA 5H8HA 5FHMA 1Z7NE 3PUXE 2A5TA 1PB8A 3K6UA 4OVJA 3M8UA 5H8QB 3TMGA 1SBPA 3FUZA 5DT6A 3SEXA 4PQJA 2Z8DA 1B58A 4E0WA 3TCFA 3C34A 4F22A 1B3GA 1XVXA 2REJA 2DWIA 4BDNA 3SDFA 3MZBA 5BUUA 1MY0A 1ZBMA 3K4UA 3IOUA 2XXRA 2Q8JA 1MXXA 3U93A 3JZJA 5CBRA 3O2AA 1MY3A 4KI0E 1B5HA 3FJGA 1GV8A 1JW4A 3FD3A 2O6AA 3UA8A 1JNFA 4BDRA 3CG3A 4ONYA 1OQGA 4M1VA 1DSNA 1POTA 3IOVA 1MH3A 4ZE9A 4HCYA 1EZOA 5JK4A 2R71A 5I2KA 3U72A 1OLCA 3MAMA 3DM0A 3DELB 1USYH 3FASA 3R7XA 2HXWA 4YMBA 3CI8A 3IJOB 1LAHE 4H0WA 4OETA 3KN7A 4WEDA 1P1WA 3K0VA 2Y7RA 1CB6A 3EQ1A 1R9QA 3KOTA 3QUFA 1TXFA 2V3TA 1YPNA 5L9OA 3MWBA 1IXCA 4IGTA 3MZ9A 3IB0A 4FIMA 3IB1A 3JYRA 3TTNA 4EXLA 3OEKA 4ISUA 4MFIA 5CMCA 1VSOA 3RNNA 5H8QA 2RF1A 3C4MA 5FTHA 1JW1A 3GBBA 5AE4A 4KD5A 4QSCA 3CG1A 1TT1A 4F39A 1M5BA 4F18A 4QF9A 1IZ1A 4LZ8A 1PBQA 4QFKA 3ZSFA 4QHQA 2P2AA 3W9WA 4NF4A 3O97A 3VLUA 1B0HA 1L5TA 4TLMB 1URDA 3TDJA 2Y7WA 1NNTA 3MVWA 3KN3A 3CRBA 4RK2A 5I59A 1QUJA 1B6HA 4NWDA 2RC7A 1S7YA 1VR5A 4GLIA 4ZZAA 4Z7EA 1PC3A 3TZAA 2ZYKA 2UXAA 2YJPA 4AQ4A 3OEMA 4NF8A 3VV5A 3W15C 3SETA 5J1DA 2RC9A 3V89B 4DLDA 1S9TA 3Q27A 1LAXA 1OMPA 5DTBA 3PPNA 4F3SA 1I6AA 5IKBA 3CSGA 4U21A 4RPNA 1KWHA 3A3UA 4GL8A 4Z0IA 3K6VA 1ELJA 3FXUA 2ALUA 2PBWA 4F3BA 5CM6A 5CRYA 1O64A 4NMYA 3OXNA 3G3KA 4TLLB 1MDQA 5IAIA 1A40A 1OVBA 4OYVA 2VD3A 4YKKA 3PU5A 4F3GA 2UVIA 3K1NA 4EF2A 2G29A 3ZKLA 1T0KA 3IJXB 1P1NA 1PBPA 4MLQA 5I56B 4ELOA 1Y20A 5I84A 1B9JA 4THIA 4X1BA 5H8SA 4RK9A 3OO8A 3VLWA 4LONB 1EU8A 2ZXTA 4UACA 5H8FB 3PUWE 2XX8A 3BKIB 3RPWA 2V93A 3USDA 1A99A 3FVOA 4OXVA 1MQJA 4U1OA 3SEWA 1YCJA 1SVXB 3LC8A 2R9JA 3O29A 2P1SA 1H45A 5ISUA 3FZVA 3I5OA 3QYTA 2UVGA 4NF5B 2B65A 1HSJA 3RTWB 3T93B 3FIRA 5ICTA 3KGCA 2D5WA 2BJJX 1UIUA 2DXRA 3MJNA 1B5JA 4F1YA 2NXOA 5TP9A 1LAGE 1FQAA 4H1XA 1QJMA 1BKAA 3N94A 3G3GA 4K3FA 4FJPA 1GTKA 4TOZA 2QS4A 3W9VA 3H6WA 4YB7A 2OWTA 1LFHA 5TPAB 4GQOA 1MS7A 4PE5B 2QS3A 4POWA 3CIJA 4GVOA 1LBCA 3O6GA 1NFTA 3VE1B 3E4RA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R9G A;  4LZ7 A;  4GRK A;  1II5 A;  4GF8 A;  4Q0C A;  3B6T A;  4XKQ A;  2OZZ A;  4YB5 A;  2QL3 A;  2DE2 A;  2DSF A;  4KPT A;  4Q30 B;  4X9T A;  4G68 C;  4IO3 A;  1NNF A;  3E3K A;  5HM4 B;  2OLB A;  3IB2 A;  5I56 A;  3RLF E;  4F2Q A;  2OBG A;  3ZS6 A;  1RYX A;  1EZ9 A;  1MG1 A;  1JVX A;  4GXS B;  4RXL A;  3SEV A;  3L6H A;  1MQI A;  2Q88 A;  5H8F A;  2D21 A;  3OSQ A;  4QSE A;  1B1H A;  2HEU A;  2I0C A;  1BLF A;  1M5C A;  4L17 A;  4LVQ A;  4NE4 A;  4H8J A;  1A8F A;  3WAF A;  2A5S A;  5AA2 B;  4EQ9 A;  5BWJ A;  2VGQ A;  4YAH X;  3TUS A;  3H4Z A;  4ZEI A;  2NVU B;  1H3D A;  5KDT A;  1SW2 A;  2XXU A;  1WOD A;  2XXI A;  3MQ9 A;  1NKX A;  1AMF A;  2H9B A;  1TFA A;  3DP4 A;  1Y4T A;  4M4G A;  2DVC A;  3FJM A;  1O7T A;  2VHA A;  2FYI A;  4OQO A;  3F11 A;  4F3P A;  2QSX A;  4U4X A;  5AA3 A;  4ELP A;  5A5X B;  3CR9 A;  1B3L A;  5FTI A;  1QUL A;  3H03 A;  2H99 A;  2I4C A;  2XXT A;  5CMM A;  1P1O A;  3KG2 A;  1MM7 A;  4XXU A;  4N13 A;  2I0B A;  1Y3N A;  4KQP A;  4GXA A;  1UQW A;  3U8Q A;  4YU0 A;  4X1D A;  1LFG A;  4LUB A;  3ILU B;  3SEU A;  2GRV A;  3KBR A;  5FHN A;  2RC8 A;  2E1S A;  1FTK A;  3G3J A;  3PPP A;  3QXM A;  2QMX A;  4KYD A;  3HPI A;  1Z7M E;  4EQ7 A;  2ZMB A;  4ESW A;  4DE8 A;  4XIG Q;  3TAJ A;  5L9S A;  4PFW A;  3K6W A;  1IIW A;  4F1U A;  1SYH A;  3CVG A;  1ZLQ A;  1DMB A;  2DE4 A;  4EDP A;  1VFD A;  3C32 A;  2GFE A;  2HQ0 A;  4GL0 A;  1IXH A;  5B7D A;  4IGR A;  1GGG A;  3FV1 A;  2I58 A;  4EUO A;  1MH4 A;  4C1U A;  1AL3 A;  1N7W A;  5KCJ A;  2W7Y A;  5B70 A;  1UTB A;  4U22 A;  4OHN A;  4G68 A;  3VVE A;  1ZTY A;  2PT1 A;  1M5E A;  4ZS9 A;  1H76 A;  3MVZ A;  4IO2 A;  2HFB A;  2YLN A;  3BBR A;  1SYI A;  2F35 A;  2ESN A;  4FEC A;  3S9L C;  4XKR A;  4LQ5 A;  5HBC A;  3KOS A;  1UTH B;  1B7H A;  1FCK A;  2XXY A;  4R6K A;  1BIY A;  2DWA A;  4GOT A;  1URS A;  1FQB A;  1QW0 A;  3UOR A;  3OEL A;  5FHO A;  2HCA A;  5DEX A;  4EQB A;  2Q89 A;  4NWC A;  1CE2 A;  3OMB A;  1LCT A;  3D4G A;  3T96 B;  4ELR A;  2PT2 A;  3PPQ A;  5H8N B;  1H44 A;  4IB2 A;  1MY4 A;  4OMB A;  2NUV A;  1D3K A;  3MBP A;  4JXI A;  3IK6 B;  3V8X B;  3O9P A;  2PX1 A;  2UYE A;  5K2X A;  1MM6 A;  4O3C A;  4YKJ A;  2Z8E A;  1P1U A;  3Q25 A;  2Y7K A;  4O3A A;  4JDF A;  4JWO A;  3M3K A;  1BP5 A;  3SES A;  2UYF A;  3KJ7 A;  3EPE A;  4LA9 A;  2DP8 A;  4R2B A;  4QFO A;  2PYY A;  4XKP A;  3LSX A;  2ABH A;  3RGY A;  1QKA A;  2KLF A;  1MXZ A;  4YMA A;  3PD9 A;  1NMU A;  4RJZ A;  1B3E A;  3TTR A;  3IOR A;  5CC2 A;  3S2V A;  3PPR A;  3M3L A;  1A54 A;  1DPP A;  4PFU A;  5M2V A;  4G8M A;  1FQD A;  2Q9T A;  3CFL A;  2I48 A;  2DQV A;  1NNK A;  1GR2 A;  1FTO A;  1B52 A;  3IO6 A;  2DXY A;  5AA2 D;  3KSX A;  5L9M A;  4EXK A;  4H5F A;  1FQC A;  3T9H B;  3IOT A;  4HTG A;  4OFO A;  4KYS A;  1NH8 A;  2H98 A;  1XOC A;  2Y7P A;  1LGB C;  3TEP A;  2O69 A;  1XVY A;  1MRP A;  3H6V A;  1Y3Q A;  4OFJ A;  3LSF B;  3EHS A;  1TWY A;  3T9X B;  4Q8R A;  2F7B A;  1XS5 A;  4OER A;  3TPA A;  1DTZ A;  1SI1 A;  1AH5 A;  1SD3 A;  2DWH A;  4U1Z A;  1SDX A;  4GD5 A;  3D4C A;  5DVJ A;  3KSJ A;  4X48 A;  3O28 A;  1B3H A;  3EN3 A;  4R6H A;  1NNP A;  2QMW A;  3V5A A;  3VLV A;  1PB7 A;  3HHF A;  3DLN A;  5H8N A;  1ZJL A;  1LFI A;  3H7M A;  3C9H A;  3KN8 A;  1NL5 A;  1P1Q A;  4H67 A;  2O84 X;  2Z23 A;  5EHM A;  1DOT A;  5EHS A;  2F78 A;  4JWY A;  4ZEB A;  4N07 A;  4KFQ A;  1Y1Z A;  2XHD A;  4HCW A;  1JQF A;  2F7C A;  3RT6 B;  3CFX A;  3T9V A;  4Q5T A;  4ZEF A;  3KFM A;  4MH5 A;  5LOM A;  4GFR A;  3HN0 A;  5AA1 A;  1O63 A;  4OFL A;  3VVF A;  3C33 A;  1F9B A;  4H65 A;  1QUK A;  4JWX A;  1XT8 A;  2V84 A;  1ATG A;  1IEJ A;  3RN8 A;  3SER A;  4C1T A;  1OLA A;  5I57 B;  1N7X A;  1RKM A;  4IY6 A;  2O68 A;  4ZEC A;  3UK4 A;  5ICQ A;  5DVI A;  1MY2 A;  2GH9 A;  5F1Q A;  4G8N A;  1M5D A;  3MVY A;  2ZYO A;  3EHU A;  3H6T A;  3FXQ A;  1B46 A;  3CFZ A;  3OD7 A;  4LZ5 A;  3B7D A;  3LR1 A;  4R74 A;  4OEN A;  2XXX A;  2Z22 A;  3M3F A;  5JTY B;  3T9U A;  1MXV A;  1A55 A;  3MPK A;  1PB9 A;  2XX7 A;  3FGS A;  1Y3P A;  1VFE A;  1Y1M A;  3FVN A;  4I8C A;  3TYH A;  4C0R A;  2CZL A;  2RCA A;  2QJE A;  4N6P A;  3HHG A;  4PFY A;  3BFU A;  4PFT A;  1IXI A;  1JEU A;  4DDD A;  2ANJ A;  4BDQ A;  3UP9 A;  3I3V A;  1A7L A;  2FA7 A;  1JEV A;  1EZP A;  4P11 A;  3MW0 A;  2G93 A;  1USY E;  1B1X A;  3IR1 A;  3K02 A;  3S9M C;  1N3W A;  4H6D A;  4OTE A;  4BDM A;  1TFD A;  3I6V A;  3IAZ A;  2F6G A;  5H8H B;  2XXP A;  2OK2 A;  3R6U A;  1N04 A;  1MDP 1;  3ZKK A;  3VDF A;  3LBS A;  3O6I A;  1US4 A;  1MPD A;  2XD3 A;  2GHA A;  1URG A;  3C31 A;  4JSD A;  2HAU A;  3IX1 A;  4NF5 A;  4PET A;  3OO6 A;  1MQH A;  5I57 A;  3EHT A;  4YIC A;  4KYE A;  3IOW A;  1LB8 A;  4H8I A;  1LAF E;  3TCH A;  2OCU A;  1US5 A;  3N6T A;  1SQY A;  3HST A;  5TPA A;  1FQF A;  2V3U A;  3DP8 A;  3HO7 A;  1AOV A;  2O7U A;  4OEU A;  3L6G A;  4QFN A;  4ECF A;  1A8E A;  3FV2 A;  1SW1 A;  3K1M A;  5I2K B;  5EYF A;  2I4B A;  3S9E A;  4NF6 B;  3E9X A;  2X26 A;  3K2D A;  4U4S A;  3QSL A;  2Q2C A;  4ZDM A;  4R2F A;  5ELV A;  3N26 A;  4MF3 A;  4F29 A;  3G3H A;  4FE8 A;  5F7V A;  1B51 A;  3OEN A;  1B5I A;  4DIG A;  2DVZ A;  4U2R A;  4GIZ A;  2O1M A;  4I62 A;  4ESX A;  1HSL A;  5CMK A;  3RUM A;  3S9N C;  4ZEK A;  1B7U A;  3TTL A;  3MZ1 A;  3PUY E;  2Y84 A;  3PPO A;  4R73 A;  1UIV A;  1B3F A;  4DCY A;  3TFL A;  4KCD A;  1JET A;  2O1L A;  5AA2 A;  2QRY A;  3H06 B;  4LQ2 A;  3PMV A;  4FAJ A;  1YAE A;  3RQT A;  1Y4C A;  1S50 A;  2FNC A;  3LSL A;  3PMW A;  4DXB A;  4NF4 B;  4HW8 A;  2PVU A;  1LLS A;  4P0G A;  5TU0 A;  2NOO A;  5I2N B;  4RPO A;  2F34 A;  1FQE A;  5I59 B;  5AA4 B;  4MLV A;  3GXA A;  5CMB A;  2ZNT A;  3Q26 A;  2HZL A;  3K6X A;  3UN6 A;  2VOZ A;  1B4Z A;  4YZZ A;  4FAT A;  2H4I A;  5A5X A;  3KZG A;  3PGF A;  5L8D A;  4NF8 B;  2QS1 A;  3THI A;  2V3Q A;  1SW5 A;  4XKN A;  2HZK A;  1EH3 A;  4NF6 A;  3E13 X;  3TQL A;  1I6Q A;  3AXF A;  3UGW A;  1ZMG A;  2NWJ A;  3MP6 A;  2IA4 A;  1SI0 A;  1MY1 A;  3OOA A;  4NTL A;  3H6U A;  4PP0 A;  1MPC A;  3G3I A;  3U94 A;  1PEB A;  4O3B A;  3SEY A;  1MXW A;  2GHB A;  4R6Y A;  1PDA A;  5HPQ A;  2F5X A;  1MQG A;  1B7Z A;  4WKM A;  3WAE A;  4POX A;  2XXV A;  4WXJ A;  3ONM A;  1SW4 A;  3GBA A;  3TOD A;  5I58 B;  5CBS A;  4R75 A;  3N6U A;  3RY3 A;  5CI5 A;  3EF7 A;  1FTL A;  3UIF A;  3K01 A;  4E0X A;  2O7I A;  5I2N A;  1POY 1;  3OO9 A;  3VXC A;  2H25 A;  1Q35 A;  4I1D A;  4MBP A;  5K2Y A;  1ZU0 A;  2F36 A;  1FTM A;  5AA4 A;  4EF1 A;  4P0I A;  4FEB A;  2O51 A;  1HSE A;  2Q2A A;  5TP9 B;  2RKM A;  3V83 A;  2RCB A;  3TTM A;  2QS2 A;  3TEL A;  2HAV A;  1XHY A;  3JV9 A;  3MVX A;  3QUJ A;  1JVY A;  1LB9 A;  1UTH A;  3C35 A;  2ZYN A;  4G4P A;  3IO4 A;  2I6E A;  3TCG A;  5ITP A;  2F8D A;  1I69 A;  2WKY A;  4AB6 A;  2Z8F A;  1AIV A;  1Y9U A;  1P99 A;  2LAO A;  4IY5 A;  2H5Y A;  4IO4 A;  4RYA A;  4KR5 A;  4IO5 A;  2ZNU A;  1N0T A;  1NH7 A;  4BLA A;  3DP6 A;  4RY1 A;  4G8H A;  3HV1 A;  2OWS A;  3FJ7 A;  4IO6 A;  2VD2 A;  3RT8 A;  2XXQ A;  4F2O A;  2AL4 A;  1R9L A;  4IO7 A;  1IIT A;  3S4U A;  2I49 A;  3BFT A;  2DOJ A;  3RTF B;  5KZT A;  4RNS A;  2AIX A;  3LSW A;  1D9Y A;  2F97 A;  4QRZ A;  3VVD A;  4WEP A;  4KHZ E;  1GVC A;  1I6B A;  3G7W A;  3MC2 A;  2E0S A;  4UA8 A;  3MPL A;  4NED A;  1B0L A;  2B3F A;  2V25 A;  4ND9 A;  4BDL A;  1ANF A;  2RIN A;  1LBB A;  4DCX A;  2DS9 A;  4DXU A;  2XX9 A;  2XXH A;  3C36 A;  3R26 A;  5I58 A;  1XC1 A;  1WVJ A;  1MXY A;  4ZZE A;  5DVF A;  3HCQ A;  2D3I A;  1N76 A;  1ZKB A;  3QK6 A;  1IUD A;  1B32 A;  1H43 A;  1FTJ A;  1B4H A;  4LP2 B;  2REG A;  3O6H A;  3Q29 A;  2AYS A;  3QIM A;  3FAT A;  4FOR A;  1LST A;  5KDT B;  1B40 A;  2X7P A;  1OIB A;  1DTG A;  3B6W A;  3K00 A;  3U1O A;  3ILT B;  1FW0 A;  3PV0 E;  2I3V A;  2THI A;  3B6Q A;  3VXB A;  1B2H A;  4JSO A;  3OO7 A;  3O66 A;  5ITO A;  1DPE A;  1N84 A;  3CSB A;  1OQH A;  1M5F A;  2ONS A;  3VFJ A;  2F7A A;  4YKI A;  2ZYM A;  3P7I A;  2UVH A;  4TQU Q;  3K1P A;  1VE4 A;  4OZ9 A;  4G2Z A;  3TKD A;  1J1N A;  4F31 B;  2ONR A;  3FVG A;  2DWJ A;  2PMS A;  3PMX A;  3TQW A;  2IEE A;  3GLB A;  4F19 A;  2ZNS A;  4QFL A;  4OEV A;  1R6Z A;  2XXW A;  1MXU A;  4BDO A;  2DE3 A;  4YKP A;  3A3C A;  1JW5 A;  3TTK A;  1D9V A;  4GWO A;  4ELQ A;  2VP1 A;  2A5T B;  2B3B A;  1R1N A;  4G77 A;  3LUY A;  1MPB A;  4OES A;  1MQD A;  2M8C A;  2X7Q A;  3U92 A;  4HS7 A;  4QFP A;  3PUZ E;  4JB7 A;  3T66 A;  4I9D A;  3QAX A;  3SKP A;  3GZG A;  4YB6 A;  5KCJ B;  1YTV A;  2DYX A;  2QPQ A;  1UTB B;  4G68 B;  3H3G A;  2AL5 A;  3N5L A;  4H5G A;  1IQ7 A;  3T22 A;  4U23 A;  2I3W A;  3Q28 A;  3MP1 A;  5JEI A;  1BTJ A;  3OSR A;  2Y7I A;  2OJT A;  4AB5 A;  4OWD A;  4FED A;  4JBZ A;  1RYO A;  5JTY A;  1WDN A;  5DYH A;  2F6P A;  1LCF A;  4DXC A;  3ODB A;  2XD2 A;  3PD8 A;  1QKB A;  4ZED A;  3KJT A;  3FXR A;  4RA1 A;  3A09 A;  1OVT A;  2P0S A;  3G3F A;  1B05 A;  2UVJ A;  2YPN A;  4ZE8 A;  4QSD A;  3IL1 B;  4LAT A;  1QUI A;  3ECR A;  1Q1K A;  4XTC Q;  1QVS A;  3FVK A;  5DEX B;  2R6G E;  4R72 A;  1IXG A;  3KEI A;  3MUQ A;  4DZ1 A;  4R9F A;  1ZIU A;  4KCC A;  1D4N A;  3PUV E;  2ONK E;  2CMO A;  3MP8 A;  1N3X A;  4F1V A;  5H8H A;  5FHM A;  1Z7N E;  3PUX E;  2A5T A;  1PB8 A;  3K6U A;  4OVJ A;  3M8U A;  5H8Q B;  3TMG A;  1SBP A;  3FUZ A;  5DT6 A;  3SEX A;  4PQJ A;  2Z8D A;  1B58 A;  4E0W A;  3TCF A;  3C34 A;  4F22 A;  1B3G A;  1XVX A;  2REJ A;  2DWI A;  4BDN A;  3SDF A;  3MZB A;  5BUU A;  1MY0 A;  1ZBM A;  3K4U A;  3IOU A;  2XXR A;  2Q8J A;  1MXX A;  3U93 A;  3JZJ A;  5CBR A;  3O2A A;  1MY3 A;  4KI0 E;  1B5H A;  3FJG A;  1GV8 A;  1JW4 A;  3FD3 A;  2O6A A;  3UA8 A;  1JNF A;  4BDR A;  3CG3 A;  4ONY A;  1OQG A;  4M1V A;  1DSN A;  1POT A;  3IOV A;  1MH3 A;  4ZE9 A;  4HCY A;  1EZO A;  5JK4 A;  2R71 A;  5I2K A;  3U72 A;  1OLC A;  3MAM A;  3DM0 A;  3DEL B;  1USY H;  3FAS A;  3R7X A;  2HXW A;  4YMB A;  3CI8 A;  3IJO B;  1LAH E;  4H0W A;  4OET A;  3KN7 A;  4WED A;  1P1W A;  3K0V A;  2Y7R A;  1CB6 A;  3EQ1 A;  1R9Q A;  3KOT A;  3QUF A;  1TXF A;  2V3T A;  1YPN A;  5L9O A;  3MWB A;  1IXC A;  4IGT A;  3MZ9 A;  3IB0 A;  4FIM A;  3IB1 A;  3JYR A;  3TTN A;  4EXL A;  3OEK A;  4ISU A;  4MFI A;  5CMC A;  1VSO A;  3RNN A;  5H8Q A;  2RF1 A;  3C4M A;  5FTH A;  1JW1 A;  3GBB A;  5AE4 A;  4KD5 A;  4QSC A;  3CG1 A;  1TT1 A;  4F39 A;  1M5B A;  4F18 A;  4QF9 A;  1IZ1 A;  4LZ8 A;  1PBQ A;  4QFK A;  3ZSF A;  4QHQ A;  2P2A A;  3W9W A;  4NF4 A;  3O97 A;  3VLU A;  1B0H A;  1L5T A;  4TLM B;  1URD A;  3TDJ A;  2Y7W A;  1NNT A;  3MVW A;  3KN3 A;  3CRB A;  4RK2 A;  5I59 A;  1QUJ A;  1B6H A;  4NWD A;  2RC7 A;  1S7Y A;  1VR5 A;  4GLI A;  4ZZA A;  4Z7E A;  1PC3 A;  3TZA A;  2ZYK A;  2UXA A;  2YJP A;  4AQ4 A;  3OEM A;  4NF8 A;  3VV5 A;  3W15 C;  3SET A;  5J1D A;  2RC9 A;  3V89 B;  4DLD A;  1S9T A;  3Q27 A;  1LAX A;  1OMP A;  5DTB A;  3PPN A;  4F3S A;  1I6A A;  5IKB A;  3CSG A;  4U21 A;  4RPN A;  1KWH A;  3A3U A;  4GL8 A;  4Z0I A;  3K6V A;  1ELJ A;  3FXU A;  2ALU A;  2PBW A;  4F3B A;  5CM6 A;  5CRY A;  1O64 A;  4NMY A;  3OXN A;  3G3K A;  4TLL B;  1MDQ A;  5IAI A;  1A40 A;  1OVB A;  4OYV A;  2VD3 A;  4YKK A;  3PU5 A;  4F3G A;  2UVI A;  3K1N A;  4EF2 A;  2G29 A;  3ZKL A;  1T0K A;  3IJX B;  1P1N A;  1PBP A;  4MLQ A;  5I56 B;  4ELO A;  1Y20 A;  5I84 A;  1B9J A;  4THI A;  4X1B A;  5H8S A;  4RK9 A;  3OO8 A;  3VLW A;  4LON B;  1EU8 A;  2ZXT A;  4UAC A;  5H8F B;  3PUW E;  2XX8 A;  3BKI B;  3RPW A;  2V93 A;  3USD A;  1A99 A;  3FVO A;  4OXV A;  1MQJ A;  4U1O A;  3SEW A;  1YCJ A;  1SVX B;  3LC8 A;  2R9J A;  3O29 A;  2P1S A;  1H45 A;  5ISU A;  3FZV A;  3I5O A;  3QYT A;  2UVG A;  4NF5 B;  2B65 A;  1HSJ A;  3RTW B;  3T93 B;  3FIR A;  5ICT A;  3KGC A;  2D5W A;  2BJJ X;  1UIU A;  2DXR A;  3MJN A;  1B5J A;  4F1Y A;  2NXO A;  5TP9 A;  1LAG E;  1FQA A;  4H1X A;  1QJM A;  1BKA A;  3N94 A;  3G3G A;  4K3F A;  4FJP A;  1GTK A;  4TOZ A;  2QS4 A;  3W9V A;  3H6W A;  4YB7 A;  2OWT A;  1LFH A;  5TPA B;  4GQO A;  1MS7 A;  4PE5 B;  2QS3 A;  4POW A;  3CIJ A;  4GVO A;  1LBC A;  3O6G A;  1NFT A;  3VE1 B;  3E4R A; 
#chains in the Genus database with same CATH topology
 1DCU A;  4R9G A;  4LZ7 A;  4MIJ A;  4GRK A;  1II5 A;  4GF8 A;  4Q0C A;  3B6T A;  4XKQ A;  2OZZ A;  4YB5 A;  1NV3 A;  2QL3 A;  2DE2 A;  2DSF A;  3T0J A;  4KPT A;  4Q30 B;  4X9T A;  4G68 C;  2HXR A;  4GBV A;  4IO3 A;  1NNF A;  3E3K A;  5HM4 B;  2OLB A;  3IB2 A;  2FIX A;  5I56 A;  3RLF E;  4F2Q A;  2OBG A;  3ZS6 A;  2OX3 A;  1RYX A;  1EZ9 A;  1MG1 A;  1JVX A;  4GXS B;  4RXL A;  3SEV A;  3L6H A;  1MQI A;  5ET8 A;  2Q88 A;  5H8F A;  2D21 A;  3OSQ A;  4QSE A;  1B1H A;  2HEU A;  2I0C A;  1BLF A;  4GWY A;  1M5C A;  3RYD A;  4L17 A;  4LVQ A;  4NE4 A;  4H8J A;  1A8F A;  3WAF A;  2JJK A;  2A5S A;  1LBX A;  5AA2 B;  4EQ9 A;  5BWJ A;  2VGQ A;  4YAH X;  3TUS A;  3H4Z A;  4ZEI A;  5EQ9 A;  2NVU B;  1H3D A;  5KDT A;  1SW2 A;  2XXU A;  1WOD A;  2XXI A;  3MQ9 A;  4HE2 A;  1NKX A;  3BIG A;  1AMF A;  2H9B A;  1TFA A;  3DP4 A;  1Y4T A;  4M4G A;  2DVC A;  4MNI A;  3FJM A;  1O7T A;  2CZH A;  2VHA A;  2FYI A;  4OQO A;  3F11 A;  4F3P A;  2QSX A;  4U4X A;  5AA3 A;  4ELP A;  5A5X B;  5EYH A;  3CR9 A;  1B3L A;  4X04 A;  5FTI A;  1QUL A;  3H03 A;  2H99 A;  2I4C A;  2XXT A;  5CMM A;  1FPD A;  1P1O A;  3KG2 A;  1MM7 A;  4XXU A;  4N13 A;  2I0B A;  1Y3N A;  2XWV A;  5IZZ A;  4KQP A;  4GXA A;  2XWO A;  1UQW A;  3U8Q A;  4YU0 A;  5ESY A;  4X1D A;  1LFG A;  4LUB A;  3ILU B;  3SEU A;  2GRV A;  3KBR A;  5FHN A;  2RC8 A;  2E1S A;  1FTK A;  3G3J A;  3PPP A;  3QXM A;  2QMX A;  4KYD A;  3HPI A;  1Z7M E;  4EQ7 A;  3EKI A;  2ZMB A;  2QVV A;  4ESW A;  4DE8 A;  4XIG Q;  3TAJ A;  5L9S A;  4OVP A;  4PFW A;  2CZK A;  3K6W A;  4PAI A;  1IIW A;  4F1U A;  1SYH A;  3CVG A;  1ZLQ A;  1DMB A;  2DE4 A;  2VT5 A;  4EDP A;  1VFD A;  3C32 A;  2GFE A;  4IR8 A;  2HQ0 A;  4GL0 A;  1IXH A;  2KR0 A;  5B7D A;  4IGR A;  1GGG A;  3FV1 A;  2I58 A;  4EUO A;  4GWS A;  1MH4 A;  4C1U A;  1AL3 A;  1FBF A;  1N7W A;  5KCJ A;  2W7Y A;  4G61 A;  5B70 A;  3KC0 A;  1UTB A;  4U22 A;  4OHN A;  4G68 A;  4OAN A;  3VVE A;  1ZTY A;  2PT1 A;  1M5E A;  4ZS9 A;  1H76 A;  5I7I A;  4O94 A;  1NUZ A;  3D1R A;  3MVZ A;  4IO2 A;  2HFB A;  4MX6 A;  2YLN A;  3BBR A;  1SYI A;  2F35 A;  2ESN A;  4FEC A;  4DI3 D;  3S9L C;  4XKR A;  4LQ5 A;  5HBC A;  3KOS A;  1UTH B;  1B7H A;  1FCK A;  2XXY A;  4R6K A;  1FPI A;  5LDZ A;  1BIY A;  2DWA A;  4GOT A;  4PCD A;  1URS A;  1FQB A;  1QW0 A;  3UOR A;  3OEL A;  5FHO A;  2HCA A;  5DEX A;  3IFC A;  4EQB A;  2Q89 A;  4NWC A;  1CE2 A;  3OMB A;  4XF5 A;  1LCT A;  3D4G A;  3T96 B;  4ELR A;  1FRP A;  2PT2 A;  3PPQ A;  4N6K A;  5H8N B;  1H44 A;  2PFZ A;  4IB2 A;  1MY4 A;  4OMB A;  2NUV A;  1D3K A;  3MBP A;  4JXI A;  5T3J A;  3IK6 B;  2R8T A;  3V8X B;  3O9P A;  2PX1 A;  2UYE A;  5K2X A;  1MM6 A;  2ZZV A;  4O3C A;  4YKJ A;  1NV1 A;  2Z8E A;  1P1U A;  3Q25 A;  1XI6 A;  2Y7K A;  4O3A A;  4MNP A;  4JDF A;  4JWO A;  3M3K A;  1BP5 A;  3SES A;  2UYF A;  3KJ7 A;  3EPE A;  4H45 A;  4LA9 A;  1FBP A;  2DP8 A;  4R2B A;  1FBC A;  4QFO A;  2PYY A;  3A29 A;  4XKP A;  3LSX A;  2ABH A;  3RGY A;  1QKA A;  2KLF A;  1MXZ A;  4YMA A;  3PD9 A;  2Y5K A;  1NMU A;  4RJZ A;  1B3E A;  3TTR A;  3IOR A;  5CC2 A;  3S2V A;  3PPR A;  3M3L A;  1A54 A;  1DPP A;  4PFU A;  5M2V A;  4G8M A;  1K9Z A;  1FQD A;  2Q9T A;  3CFL A;  2I48 A;  2DQV A;  1NNK A;  1GR2 A;  1FTO A;  1B52 A;  3IO6 A;  2DXY A;  4MMP A;  5AA2 D;  5LTC A;  3KSX A;  1DBZ A;  5L9M A;  4EXK A;  4H5F A;  1FQC A;  3T9H B;  3IOT A;  4HTG A;  4OFO A;  4N8Y A;  4KYS A;  1NH8 A;  2H98 A;  1XOC A;  4O7M A;  2Y7P A;  1LGB C;  3TEP A;  1NV2 A;  2O69 A;  1XVY A;  1MRP A;  3H6V A;  1Y3Q A;  4OFJ A;  3LSF B;  3EHS A;  2PCR A;  1TWY A;  3T9X B;  4Q8R A;  2F7B A;  1XS5 A;  4OER A;  3TPA A;  1DTZ A;  1SI1 A;  1AH5 A;  1SD3 A;  2DWH A;  4U1Z A;  4PC9 A;  1SDX A;  4GD5 A;  3D4C A;  5DVJ A;  3KSJ A;  4X48 A;  4DI4 B;  3O28 A;  1B3H A;  3EN3 A;  4XFE A;  2QFL A;  4I40 A;  4R6H A;  1NNP A;  2QMW A;  3V5A A;  3VLV A;  1PB7 A;  3HHF A;  3DLN A;  5H8N A;  1ZJL A;  1LFI A;  3H7M A;  3C9H A;  3KN8 A;  1RDZ A;  1NL5 A;  1P1Q A;  4H67 A;  2O84 X;  2V4C A;  2Z23 A;  5EHM A;  1DOT A;  5EHS A;  2F78 A;  4JWY A;  4ZEB A;  4N07 A;  4KFQ A;  1Y1Z A;  2XHD A;  4HCW A;  1JQF A;  2F7C A;  3RT6 B;  2OWZ A;  3CFX A;  3T9V A;  4Q5T A;  4ZEF A;  3KFM A;  4MH5 A;  5LOM A;  4GFR A;  3HN0 A;  4N15 A;  5AA1 A;  3MST A;  1O63 A;  4OFL A;  3NOH A;  2P3V A;  1FJ9 A;  3VVF A;  3C33 A;  3E78 A;  1F9B A;  4H65 A;  1QUK A;  4JWX A;  1XT8 A;  2FHY A;  2V84 A;  1ATG A;  4MJO A;  1IEJ A;  3RN8 A;  3SER A;  4C1T A;  1OLA A;  2Q74 A;  5I57 B;  1N7X A;  1RKM A;  4IY6 A;  2O68 A;  4ZEC A;  3UK4 A;  5ICQ A;  5DVI A;  1MY2 A;  4OVS A;  2GH9 A;  5F1Q A;  4G8N A;  1M5D A;  3MVY A;  1IMB A;  2ZYO A;  3E79 A;  3EHU A;  3H6T A;  3FXQ A;  1QGX A;  1B46 A;  3CFZ A;  3OD7 A;  4LZ5 A;  3B7D A;  3LR1 A;  4R74 A;  4OEN A;  2QVU A;  2XXX A;  2Z22 A;  3M3F A;  5JTY B;  3T9U A;  1MXV A;  1A55 A;  3MPK A;  1PB9 A;  2XX7 A;  3FGS A;  1Y3P A;  1Q9D A;  1VFE A;  1Y1M A;  3FVN A;  4I8C A;  3TYH A;  2WEF A;  2CZL A;  4C0R A;  2RCA A;  2QJE A;  4N6P A;  3HHG A;  1EYJ A;  4PFY A;  3BFU A;  5FBP A;  4PFT A;  1IXI A;  4MEV A;  4X8R A;  2GQ1 A;  1JEU A;  4DDD A;  4HE1 A;  2ANJ A;  2XWI A;  4BDQ A;  1EYK A;  3UP9 A;  5I5P A;  5IZ3 B;  3I3V A;  1A7L A;  2FA7 A;  1JEV A;  1EZP A;  4P11 A;  3MW0 A;  2G93 A;  1USY E;  1B1X A;  3IR1 A;  3K02 A;  3S9M C;  1N3W A;  4JVD A;  4H6D A;  1FPE A;  4OTE A;  4BDM A;  1TFD A;  3I6V A;  3IAZ A;  2F6G A;  5H8H B;  2XXP A;  2OK2 A;  3R6U A;  4LN5 A;  1N04 A;  1MDP 1;  3ZKK A;  3VDF A;  3LBS A;  3O6I A;  1MPD A;  1US4 A;  2XD3 A;  2GHA A;  1URG A;  3C31 A;  4JSD A;  2HAU A;  3IX1 A;  4NF5 A;  4PET A;  3OO6 A;  1MQH A;  3GYY A;  1FPG A;  5I57 A;  3EHT A;  4FBP A;  4YIC A;  4KYE A;  3IOW A;  1LB8 A;  4H8I A;  1LAF E;  3FBP A;  3TCH A;  2OCU A;  4PDH A;  1US5 A;  3N6T A;  1RDY A;  1SQY A;  3HST A;  5TPA A;  1FQF A;  2V3U A;  3DP8 A;  3HO7 A;  1AOV A;  1FBD A;  1NUY A;  2O7U A;  4OEU A;  3L6G A;  4QFN A;  4PFI A;  4ECF A;  1A8E A;  3FV2 A;  1SW1 A;  3K1M A;  4NG7 A;  5I2K B;  5EYF A;  2I4B A;  3S9E A;  4NF6 B;  1NV4 A;  3E9X A;  2X26 A;  3K2D A;  4U4S A;  3QSL A;  2Q2C A;  4ZDM A;  4R2F A;  5ELV A;  3N26 A;  4MF3 A;  4F29 A;  2HPG A;  3G3H A;  4FE8 A;  4GWX A;  5F7V A;  4PTK A;  1B51 A;  3OEN A;  1B5I A;  1NUW A;  1YYZ A;  4DIG A;  2DVZ A;  4U2R A;  4GIZ A;  2O1M A;  4I62 A;  4ESX A;  1HSL A;  5CMK A;  3RUM A;  3S9N C;  4ZEK A;  1B7U A;  3TTL A;  2MKZ A;  1NUX A;  5ET5 A;  3MZ1 A;  3PUY E;  2Y84 A;  3PPO A;  4R73 A;  1UIV A;  1B3F A;  4DCY A;  3TFL A;  4KCD A;  1JET A;  2O1L A;  2QRY A;  3H06 B;  5AA2 A;  4LQ2 A;  3PMV A;  4FAJ A;  1YAE A;  3RQT A;  1Y4C A;  1S50 A;  2FNC A;  3LSL A;  1FBH A;  3PMW A;  4DXB A;  4NF4 B;  4HW8 A;  2PVU A;  1LLS A;  4P0G A;  4P1L A;  1VDW A;  1LBV A;  5TU0 A;  2NOO A;  5I2N B;  4RPO A;  2F34 A;  1FQE A;  5I59 B;  5AA4 B;  4MLV A;  3GXA A;  5CMB A;  4PFB A;  2ZNT A;  3Q26 A;  2HZL A;  3K6X A;  3UN6 A;  1FPL A;  2VOZ A;  1B4Z A;  1NV0 A;  4YZZ A;  4N8G A;  4FAT A;  4NQ8 A;  2H4I A;  5A5X A;  3KZG A;  3PGF A;  5L8D A;  4PE3 A;  4NF8 B;  2QS1 A;  3THI A;  2V3Q A;  1SW5 A;  2F3D A;  4XKN A;  2HZK A;  1EH3 A;  2VPN A;  4NF6 A;  3E13 X;  3TQL A;  1I6Q A;  3AXF A;  3UGW A;  1ZMG A;  2NWJ A;  3MP6 A;  2XWK A;  2IA4 A;  1SI0 A;  1MY1 A;  5EQA A;  3OOA A;  4NTL A;  3H6U A;  4PP0 A;  1MPC A;  3G3I A;  3U94 A;  1PEB A;  4O3B A;  3SEY A;  1MXW A;  2GHB A;  3IFA A;  4R6Y A;  1PDA A;  5HPQ A;  2F5X A;  1MQG A;  5ET7 A;  1B7Z A;  4WKM A;  3WAE A;  4POX A;  2XXV A;  4WXJ A;  3ONM A;  1SW4 A;  3GBA A;  3TOD A;  5I58 B;  5CBS A;  4R75 A;  3N6U A;  3RY3 A;  5CI5 A;  2ZZW A;  3EF7 A;  1FTL A;  4NAP A;  3UIF A;  3K01 A;  4E0X A;  2O7I A;  5I2N A;  1POY 1;  3OO9 A;  3VXC A;  2H25 A;  1Q35 A;  4I1D A;  4MBP A;  5K2Y A;  1ZU0 A;  2F36 A;  1FTM A;  5AA4 A;  4EF1 A;  4P0I A;  4FEB A;  2O51 A;  1HSE A;  2Q2A A;  4PGN A;  4P1E A;  1CNQ A;  3ISP A;  5TP9 B;  2RKM A;  3V83 A;  2RCB A;  3TTM A;  2QS2 A;  3TEL A;  2HAV A;  4AS5 A;  1XHY A;  3JV9 A;  3MVX A;  3QUJ A;  1JVY A;  1LB9 A;  1UTH A;  3C35 A;  2FVZ A;  2BJI A;  2ZYN A;  4G4P A;  3IO4 A;  2I6E A;  3TCG A;  5ITP A;  2F8D A;  1I69 A;  2WKY A;  4AB6 A;  2HHM A;  2Z8F A;  1AIV A;  1Y9U A;  1P99 A;  2LAO A;  4IY5 A;  3B50 A;  2H5Y A;  4IO4 A;  4RYA A;  4KR5 A;  1DK4 A;  4IO5 A;  2ZNU A;  1N0T A;  1NH7 A;  4BLA A;  3DP6 A;  4RY1 A;  4G8H A;  3HV1 A;  2OWS A;  3FJ7 A;  4IO6 A;  2VD2 A;  3RT8 A;  2XXQ A;  4F2O A;  2AL4 A;  1R9L A;  4IO7 A;  1IIT A;  3S4U A;  2I49 A;  3BFT A;  2Q8M A;  2DOJ A;  3RTF B;  5KZT A;  5F24 A;  2FIE A;  4RNS A;  4N4U A;  2AIX A;  3LSW A;  1D9Y A;  2F97 A;  4QRZ A;  3VVD A;  4WEP A;  5DW8 A;  2PFY A;  4KHZ E;  1GVC A;  1I6B A;  3G7W A;  3BIH A;  3MC2 A;  2E0S A;  4OA4 A;  4UA8 A;  3MPL A;  4NED A;  2VPO A;  3T1B A;  1B0L A;  2B3F A;  2V25 A;  4ND9 A;  4BDL A;  1ANF A;  2RIN A;  1LBB A;  4GBW A;  4DCX A;  2DS9 A;  4DXU A;  2XX9 A;  4O7I A;  4MNC A;  2XXH A;  3C36 A;  3R26 A;  1IMF A;  3QMF A;  5I58 A;  1XC1 A;  4PAK A;  4PAF A;  1WVJ A;  4I3E A;  2CEY A;  1MXY A;  4ZZE A;  5DVF A;  1NV6 A;  3HCQ A;  2D3I A;  1N76 A;  1ZKB A;  3QK6 A;  1IUD A;  1B32 A;  1H43 A;  1FTJ A;  1B4H A;  2WYP A;  4LP2 B;  2REG A;  3O6H A;  4HE0 A;  3Q29 A;  3KC1 A;  2AYS A;  3QIM A;  3FAT A;  4FOR A;  1LST A;  5KDT B;  1B40 A;  2X7P A;  1OIB A;  1DTG A;  3B6W A;  3K00 A;  3U1O A;  3ILT B;  1FW0 A;  3PV0 E;  2P3N A;  2I3V A;  2THI A;  3B6Q A;  3VXB A;  1B2H A;  4JSO A;  3OO7 A;  3O66 A;  4P3L A;  5ITO A;  1DPE A;  4GWW A;  3SZP A;  1N84 A;  3CSB A;  5ET6 A;  1OQH A;  1M5F A;  1NV7 A;  2ONS A;  3LV0 A;  3VFJ A;  2F7A A;  4YKI A;  2ZYM A;  3P7I A;  2UVH A;  4TQU Q;  3K1P A;  3CHG A;  1VE4 A;  4OZ9 A;  4G2Z A;  3TKD A;  1J1N A;  4F31 B;  2ONR A;  3FVG A;  1G0I A;  2DWJ A;  1G0H A;  2PMS A;  3PMX A;  4N91 A;  2IEE A;  3TQW A;  2L5V A;  2CZI A;  3HFU A;  3GLB A;  4AS4 A;  4F19 A;  2ZNS A;  4QFL A;  4MCO A;  4OEV A;  1R6Z A;  2XXW A;  4NN3 A;  1MXU A;  3KBZ A;  4QBA A;  4BDO A;  2DE3 A;  4HXV A;  4YKP A;  3A3C A;  1JW5 A;  3TTK A;  1D9V A;  4GWO A;  4ELQ A;  2VP1 A;  2A5T B;  2B3B A;  1R1N A;  4G77 A;  3LUY A;  1MPB A;  4OES A;  4UAB A;  1BK4 A;  1MQD A;  2M8C A;  2X7Q A;  3U92 A;  4HS7 A;  1FPJ A;  4QFP A;  3PUZ E;  4JB7 A;  3T66 A;  4I9D A;  3QAX A;  3SKP A;  3GZG A;  5EQ8 A;  4YB6 A;  1YZ0 A;  5KCJ B;  1YTV A;  2DYX A;  2QPQ A;  2WBB A;  1UTB B;  4G68 B;  2Y5L A;  3H3G A;  2AL5 A;  3RPL B;  2DDK A;  3N5L A;  5A5L A;  4H5G A;  4P56 A;  1IQ7 A;  3T22 A;  4U23 A;  2I3W A;  3Q28 A;  5EYG A;  3MP1 A;  5JEI A;  1AWB A;  1BTJ A;  3OSR A;  1LBY A;  4MAG A;  2Y7I A;  2OJT A;  4AB5 A;  4OWD A;  4FED A;  4JBZ A;  1RYO A;  5JTY A;  1WDN A;  5DYH A;  1FPK A;  2F6P A;  1LCF A;  4DXC A;  3ODB A;  2XD2 A;  3PD8 A;  1QKB A;  3KJT A;  3FXR A;  4RA1 A;  3A09 A;  4OVT A;  1OVT A;  4ZED A;  2P0S A;  3G3F A;  1B05 A;  2UVJ A;  2YPN A;  4ZE8 A;  4QSD A;  3IL1 B;  4N17 A;  4LAT A;  1QUI A;  3ECR A;  1Q1K A;  4XTC Q;  1QVS A;  3FVK A;  5DEX B;  1IMC A;  1LBZ A;  2R6G E;  5IZ3 A;  4R72 A;  1IXG A;  3KEI A;  3MUQ A;  4DZ1 A;  4R9F A;  1ZIU A;  4KCC A;  1D4N A;  3PUV E;  4PDD A;  2ONK E;  5EQ7 A;  1SPI A;  2CMO A;  3MP8 A;  1N3X A;  1KA1 A;  2KQZ A;  4F1V A;  5H8H A;  5FHM A;  1Z7N E;  3PUX E;  2A5T A;  1PB8 A;  2ZZX A;  3K6U A;  4OVJ A;  3M8U A;  5H8Q B;  3TMG A;  1SBP A;  3FUZ A;  5DT6 A;  3SEX A;  4PQJ A;  2Z8D A;  1B58 A;  4E0W A;  4OVR A;  3TCF A;  3C34 A;  1IMD A;  4F22 A;  4I3Y A;  1B3G A;  1XVX A;  2REJ A;  4PF6 A;  4N81 A;  1LEV A;  2DWI A;  4BDN A;  3SDF A;  3MZB A;  5BUU A;  1MY0 A;  1ZBM A;  3K4U A;  3IOU A;  2XXR A;  2Q8J A;  1MXX A;  3U93 A;  3JZJ A;  5CBR A;  3O2A A;  1IME A;  1MY3 A;  3RPL A;  5IM2 A;  4KI0 E;  1B5H A;  4NGU A;  3FJG A;  2F3B A;  1GV8 A;  1JW4 A;  3FD3 A;  1FBG A;  2O6A A;  1RDX A;  3UA8 A;  1JNF A;  4BDR A;  3CG3 A;  4ONY A;  1OQG A;  4M1V A;  1EYI A;  1LBW A;  1DSN A;  1POT A;  3IOV A;  4GX4 A;  1MH3 A;  4ZE9 A;  4HCY A;  1EZO A;  5JK4 A;  2R71 A;  5I2K A;  1KZ8 A;  2B4L A;  3U72 A;  4GWZ A;  2FBP A;  1OLC A;  3MAM A;  3DM0 A;  1JP4 A;  3DEL B;  1USY H;  3FAS A;  3R7X A;  2HXW A;  4YMB A;  3CI8 A;  3IJO B;  1LAH E;  4H0W A;  4PBH A;  4OET A;  3KN7 A;  4WED A;  1P1W A;  3K0V A;  2QVR A;  2Y7R A;  1FJ6 A;  1CB6 A;  2XXK A;  3EQ1 A;  1R9Q A;  3KOT A;  3QUF A;  1TXF A;  2V3T A;  1YPN A;  5L9O A;  3MWB A;  1IXC A;  1NV5 A;  4IGT A;  3MZ9 A;  3IB0 A;  4N6D A;  4FIM A;  4PBQ A;  3IB1 A;  4PFR A;  3JYR A;  4PF8 A;  3TTN A;  4H46 A;  4EXL A;  3OEK A;  4ISU A;  4MFI A;  5CMC A;  1VSO A;  3RNN A;  5H8Q A;  2RF1 A;  3C4M A;  5FTH A;  1JW1 A;  3GBB A;  5AE4 A;  4KD5 A;  4QSC A;  3CG1 A;  1TT1 A;  4F39 A;  1M5B A;  4NF0 A;  3FXB A;  4QF9 A;  4F18 A;  1IZ1 A;  4LZ8 A;  4P8B A;  2CEX A;  1PBQ A;  2B4M A;  2WBD A;  4QFK A;  1INP A;  3ZSF A;  4QHQ A;  2P2A A;  3W9W A;  4NF4 A;  4XEQ A;  3PTY A;  3O97 A;  3VLU A;  1B0H A;  1YXI A;  1L5T A;  4TLM B;  4JVI A;  1URD A;  3TDJ A;  2Y7W A;  1NNT A;  4JVC A;  3MVW A;  3KN3 A;  3CRB A;  4RK2 A;  4O8M A;  5I59 A;  1QUJ A;  1B6H A;  4NWD A;  2RC7 A;  1S7Y A;  1K9Y A;  1VR5 A;  4GLI A;  4ZZA A;  3MYU A;  4Z7E A;  1PC3 A;  3TZA A;  2ZYK A;  2UXA A;  2YJP A;  4AQ4 A;  1FPF A;  4NX1 A;  3OEM A;  4NF8 A;  3VV5 A;  3W15 C;  3SET A;  5J1D A;  2RC9 A;  3V89 B;  4DLD A;  1S9T A;  3Q27 A;  1LAX A;  1OMP A;  4NHB A;  5DTB A;  3PPN A;  4F3S A;  1I6A A;  5IKB A;  3CSG A;  4U21 A;  4RPN A;  1KWH A;  3A3U A;  4GL8 A;  4Z0I A;  3K6V A;  1ELJ A;  3FXU A;  2ALU A;  2PBW A;  4F3B A;  5CM6 A;  5CRY A;  1O64 A;  4NMY A;  3OXN A;  3G3K A;  4TLL B;  1MDQ A;  5IAI A;  1A40 A;  1OVB A;  5IGA A;  2XA5 A;  3B8B A;  5I3S A;  4OYV A;  2VD3 A;  4YKK A;  3PU5 A;  1NI9 A;  4F3G A;  2UVI A;  3K1N A;  4EF2 A;  2G29 A;  3ZKL A;  1T0K A;  3IJX B;  1P1N A;  1PBP A;  4MLQ A;  5I56 B;  4ELO A;  1Y20 A;  5I84 A;  1B9J A;  4THI A;  4P47 A;  4X1B A;  1FPB A;  5H8S A;  4RK9 A;  3OO8 A;  3VLW A;  1FBE A;  4LON B;  1EU8 A;  2ZXT A;  4UAC A;  4KXP A;  5H8F B;  1FSA A;  3PUW E;  2XX8 A;  3BKI B;  4OVQ A;  5IZ1 A;  4GX3 A;  3RPW A;  2V93 A;  3USD A;  1KA0 A;  1A99 A;  3FVO A;  4GX6 A;  1MQJ A;  4OXV A;  4U1O A;  3SEW A;  1YCJ A;  4P9K A;  1SVX B;  1D9Q A;  3LC8 A;  2WYK A;  2R9J A;  3O29 A;  2P1S A;  1H45 A;  5ISU A;  3FZV A;  1FTA A;  3I5O A;  4MHF A;  3QYT A;  2UVG A;  4NF5 B;  2B65 A;  1HSJ A;  3RTW B;  3T93 B;  3FIR A;  5ICT A;  3KGC A;  2D5W A;  2BJJ X;  1UIU A;  2DXR A;  3MJN A;  1B5J A;  4F1Y A;  2NXO A;  5TP9 A;  1LAG E;  1FQA A;  4H1X A;  1QJM A;  5J16 A;  1BKA A;  3N94 A;  3G3G A;  4K3F A;  4FJP A;  4PGP A;  3U65 A;  1GTK A;  4TOZ A;  4GWU A;  3ROJ A;  2QS4 A;  3W9V A;  3H6W A;  4YB7 A;  2OWT A;  1LFH A;  1IMA A;  5TPA B;  4GQO A;  1MS7 A;  3LUZ A;  4PE5 B;  2QS3 A;  4POW A;  3CIJ A;  4GVO A;  2WX9 A;  1LBC A;  4QXD A;  3O6G A;  1NFT A;  3VE1 B;  3E4R A; 
#chains in the Genus database with same CATH homology
 4R9G A;  4LZ7 A;  4GRK A;  1II5 A;  4GF8 A;  4Q0C A;  3B6T A;  4XKQ A;  2OZZ A;  4YB5 A;  2QL3 A;  2DE2 A;  2DSF A;  4KPT A;  4Q30 B;  4X9T A;  4G68 C;  4IO3 A;  1NNF A;  3E3K A;  5HM4 B;  2OLB A;  3IB2 A;  5I56 A;  3RLF E;  4F2Q A;  2OBG A;  3ZS6 A;  1RYX A;  1EZ9 A;  1MG1 A;  1JVX A;  4GXS B;  4RXL A;  3SEV A;  3L6H A;  1MQI A;  2Q88 A;  5H8F A;  2D21 A;  3OSQ A;  4QSE A;  1B1H A;  2HEU A;  2I0C A;  1BLF A;  1M5C A;  4L17 A;  4LVQ A;  4NE4 A;  4H8J A;  1A8F A;  3WAF A;  2A5S A;  5AA2 B;  4EQ9 A;  5BWJ A;  2VGQ A;  4YAH X;  3TUS A;  3H4Z A;  4ZEI A;  2NVU B;  1H3D A;  5KDT A;  1SW2 A;  2XXU A;  1WOD A;  2XXI A;  3MQ9 A;  1NKX A;  1AMF A;  2H9B A;  1TFA A;  3DP4 A;  1Y4T A;  4M4G A;  2DVC A;  3FJM A;  1O7T A;  2VHA A;  2FYI A;  4OQO A;  3F11 A;  4F3P A;  2QSX A;  4U4X A;  5AA3 A;  4ELP A;  5A5X B;  3CR9 A;  1B3L A;  5FTI A;  1QUL A;  3H03 A;  2H99 A;  2I4C A;  2XXT A;  5CMM A;  1P1O A;  3KG2 A;  1MM7 A;  4XXU A;  4N13 A;  2I0B A;  1Y3N A;  4KQP A;  4GXA A;  1UQW A;  3U8Q A;  4YU0 A;  4X1D A;  1LFG A;  4LUB A;  3ILU B;  3SEU A;  2GRV A;  3KBR A;  5FHN A;  2RC8 A;  2E1S A;  1FTK A;  3G3J A;  3PPP A;  3QXM A;  2QMX A;  4KYD A;  3HPI A;  1Z7M E;  4EQ7 A;  2ZMB A;  4ESW A;  4DE8 A;  4XIG Q;  3TAJ A;  5L9S A;  4PFW A;  3K6W A;  1IIW A;  4F1U A;  1SYH A;  3CVG A;  1ZLQ A;  1DMB A;  2DE4 A;  4EDP A;  1VFD A;  3C32 A;  2GFE A;  2HQ0 A;  4GL0 A;  1IXH A;  5B7D A;  4IGR A;  1GGG A;  3FV1 A;  2I58 A;  4EUO A;  1MH4 A;  4C1U A;  1AL3 A;  1N7W A;  5KCJ A;  2W7Y A;  5B70 A;  1UTB A;  4U22 A;  4OHN A;  4G68 A;  3VVE A;  1ZTY A;  2PT1 A;  1M5E A;  4ZS9 A;  1H76 A;  3MVZ A;  4IO2 A;  2HFB A;  2YLN A;  3BBR A;  1SYI A;  2F35 A;  2ESN A;  4FEC A;  3S9L C;  4XKR A;  4LQ5 A;  5HBC A;  3KOS A;  1UTH B;  1B7H A;  1FCK A;  2XXY A;  4R6K A;  1BIY A;  2DWA A;  4GOT A;  1URS A;  1FQB A;  1QW0 A;  3UOR A;  3OEL A;  5FHO A;  2HCA A;  5DEX A;  4EQB A;  2Q89 A;  4NWC A;  1CE2 A;  3OMB A;  1LCT A;  3D4G A;  3T96 B;  4ELR A;  2PT2 A;  3PPQ A;  5H8N B;  1H44 A;  4IB2 A;  1MY4 A;  4OMB A;  2NUV A;  1D3K A;  3MBP A;  4JXI A;  3IK6 B;  3V8X B;  3O9P A;  2PX1 A;  2UYE A;  5K2X A;  1MM6 A;  4O3C A;  4YKJ A;  2Z8E A;  1P1U A;  3Q25 A;  2Y7K A;  4O3A A;  4JDF A;  4JWO A;  3M3K A;  1BP5 A;  3SES A;  2UYF A;  3KJ7 A;  3EPE A;  4LA9 A;  2DP8 A;  4R2B A;  4QFO A;  2PYY A;  4XKP A;  3LSX A;  2ABH A;  3RGY A;  1QKA A;  2KLF A;  1MXZ A;  4YMA A;  3PD9 A;  1NMU A;  4RJZ A;  1B3E A;  3TTR A;  3IOR A;  5CC2 A;  3S2V A;  3PPR A;  3M3L A;  1A54 A;  1DPP A;  4PFU A;  5M2V A;  4G8M A;  1FQD A;  2Q9T A;  3CFL A;  2I48 A;  2DQV A;  1NNK A;  1GR2 A;  1FTO A;  1B52 A;  3IO6 A;  2DXY A;  5AA2 D;  3KSX A;  5L9M A;  4EXK A;  4H5F A;  1FQC A;  3T9H B;  3IOT A;  4HTG A;  4OFO A;  4KYS A;  1NH8 A;  2H98 A;  1XOC A;  2Y7P A;  1LGB C;  3TEP A;  2O69 A;  1XVY A;  1MRP A;  3H6V A;  1Y3Q A;  4OFJ A;  3LSF B;  3EHS A;  1TWY A;  3T9X B;  4Q8R A;  2F7B A;  1XS5 A;  4OER A;  3TPA A;  1DTZ A;  1SI1 A;  1AH5 A;  1SD3 A;  2DWH A;  4U1Z A;  1SDX A;  4GD5 A;  3D4C A;  5DVJ A;  3KSJ A;  4X48 A;  3O28 A;  1B3H A;  3EN3 A;  4R6H A;  1NNP A;  2QMW A;  3V5A A;  3VLV A;  1PB7 A;  3HHF A;  3DLN A;  5H8N A;  1ZJL A;  1LFI A;  3H7M A;  3C9H A;  3KN8 A;  1NL5 A;  1P1Q A;  4H67 A;  2O84 X;  2Z23 A;  5EHM A;  1DOT A;  5EHS A;  2F78 A;  4JWY A;  4ZEB A;  4N07 A;  4KFQ A;  1Y1Z A;  2XHD A;  4HCW A;  1JQF A;  2F7C A;  3RT6 B;  3CFX A;  3T9V A;  4Q5T A;  4ZEF A;  3KFM A;  4MH5 A;  5LOM A;  4GFR A;  3HN0 A;  5AA1 A;  1O63 A;  4OFL A;  3VVF A;  3C33 A;  1F9B A;  4H65 A;  1QUK A;  4JWX A;  1XT8 A;  2V84 A;  1ATG A;  1IEJ A;  3RN8 A;  3SER A;  4C1T A;  1OLA A;  5I57 B;  1N7X A;  1RKM A;  4IY6 A;  2O68 A;  4ZEC A;  3UK4 A;  5ICQ A;  5DVI A;  1MY2 A;  2GH9 A;  5F1Q A;  4G8N A;  1M5D A;  3MVY A;  2ZYO A;  3EHU A;  3H6T A;  3FXQ A;  1B46 A;  3CFZ A;  3OD7 A;  4LZ5 A;  3B7D A;  3LR1 A;  4R74 A;  4OEN A;  2XXX A;  2Z22 A;  3M3F A;  5JTY B;  3T9U A;  1MXV A;  1A55 A;  3MPK A;  1PB9 A;  2XX7 A;  3FGS A;  1Y3P A;  1VFE A;  1Y1M A;  3FVN A;  4I8C A;  3TYH A;  4C0R A;  2CZL A;  2RCA A;  2QJE A;  4N6P A;  3HHG A;  4PFY A;  3BFU A;  4PFT A;  1IXI A;  1JEU A;  4DDD A;  2ANJ A;  4BDQ A;  3UP9 A;  3I3V A;  1A7L A;  2FA7 A;  1JEV A;  1EZP A;  4P11 A;  3MW0 A;  2G93 A;  1USY E;  1B1X A;  3IR1 A;  3K02 A;  3S9M C;  1N3W A;  4H6D A;  4OTE A;  4BDM A;  1TFD A;  3I6V A;  3IAZ A;  2F6G A;  5H8H B;  2XXP A;  2OK2 A;  3R6U A;  1N04 A;  1MDP 1;  3ZKK A;  3VDF A;  3LBS A;  3O6I A;  1US4 A;  1MPD A;  2XD3 A;  2GHA A;  1URG A;  3C31 A;  4JSD A;  2HAU A;  3IX1 A;  4NF5 A;  4PET A;  3OO6 A;  1MQH A;  5I57 A;  3EHT A;  4YIC A;  4KYE A;  3IOW A;  1LB8 A;  4H8I A;  1LAF E;  3TCH A;  2OCU A;  1US5 A;  3N6T A;  1SQY A;  3HST A;  5TPA A;  1FQF A;  2V3U A;  3DP8 A;  3HO7 A;  1AOV A;  2O7U A;  4OEU A;  3L6G A;  4QFN A;  4ECF A;  1A8E A;  3FV2 A;  1SW1 A;  3K1M A;  5I2K B;  5EYF A;  2I4B A;  3S9E A;  4NF6 B;  3E9X A;  2X26 A;  3K2D A;  4U4S A;  3QSL A;  2Q2C A;  4ZDM A;  4R2F A;  5ELV A;  3N26 A;  4MF3 A;  4F29 A;  3G3H A;  4FE8 A;  5F7V A;  1B51 A;  3OEN A;  1B5I A;  4DIG A;  2DVZ A;  4U2R A;  4GIZ A;  2O1M A;  4I62 A;  4ESX A;  1HSL A;  5CMK A;  3RUM A;  3S9N C;  4ZEK A;  1B7U A;  3TTL A;  3MZ1 A;  3PUY E;  2Y84 A;  3PPO A;  4R73 A;  1UIV A;  1B3F A;  4DCY A;  3TFL A;  4KCD A;  1JET A;  2O1L A;  5AA2 A;  2QRY A;  3H06 B;  4LQ2 A;  3PMV A;  4FAJ A;  1YAE A;  3RQT A;  1Y4C A;  1S50 A;  2FNC A;  3LSL A;  3PMW A;  4DXB A;  4NF4 B;  4HW8 A;  2PVU A;  1LLS A;  4P0G A;  5TU0 A;  2NOO A;  5I2N B;  4RPO A;  2F34 A;  1FQE A;  5I59 B;  5AA4 B;  4MLV A;  3GXA A;  5CMB A;  2ZNT A;  3Q26 A;  2HZL A;  3K6X A;  3UN6 A;  2VOZ A;  1B4Z A;  4YZZ A;  4FAT A;  2H4I A;  5A5X A;  3KZG A;  3PGF A;  5L8D A;  4NF8 B;  2QS1 A;  3THI A;  2V3Q A;  1SW5 A;  4XKN A;  2HZK A;  1EH3 A;  4NF6 A;  3E13 X;  3TQL A;  1I6Q A;  3AXF A;  3UGW A;  1ZMG A;  2NWJ A;  3MP6 A;  2IA4 A;  1SI0 A;  1MY1 A;  3OOA A;  4NTL A;  3H6U A;  4PP0 A;  1MPC A;  3G3I A;  3U94 A;  1PEB A;  4O3B A;  3SEY A;  1MXW A;  2GHB A;  4R6Y A;  1PDA A;  5HPQ A;  2F5X A;  1MQG A;  1B7Z A;  4WKM A;  3WAE A;  4POX A;  2XXV A;  4WXJ A;  3ONM A;  1SW4 A;  3GBA A;  3TOD A;  5I58 B;  5CBS A;  4R75 A;  3N6U A;  3RY3 A;  5CI5 A;  3EF7 A;  1FTL A;  3UIF A;  3K01 A;  4E0X A;  2O7I A;  5I2N A;  1POY 1;  3OO9 A;  3VXC A;  2H25 A;  1Q35 A;  4I1D A;  4MBP A;  5K2Y A;  1ZU0 A;  2F36 A;  1FTM A;  5AA4 A;  4EF1 A;  4P0I A;  4FEB A;  2O51 A;  1HSE A;  2Q2A A;  5TP9 B;  2RKM A;  3V83 A;  2RCB A;  3TTM A;  2QS2 A;  3TEL A;  2HAV A;  1XHY A;  3JV9 A;  3MVX A;  3QUJ A;  1JVY A;  1LB9 A;  1UTH A;  3C35 A;  2ZYN A;  4G4P A;  3IO4 A;  2I6E A;  3TCG A;  5ITP A;  2F8D A;  1I69 A;  2WKY A;  4AB6 A;  2Z8F A;  1AIV A;  1Y9U A;  1P99 A;  2LAO A;  4IY5 A;  2H5Y A;  4IO4 A;  4RYA A;  4KR5 A;  4IO5 A;  2ZNU A;  1N0T A;  1NH7 A;  4BLA A;  3DP6 A;  4RY1 A;  4G8H A;  3HV1 A;  2OWS A;  3FJ7 A;  4IO6 A;  2VD2 A;  3RT8 A;  2XXQ A;  4F2O A;  2AL4 A;  1R9L A;  4IO7 A;  1IIT A;  3S4U A;  2I49 A;  3BFT A;  2DOJ A;  3RTF B;  5KZT A;  4RNS A;  2AIX A;  3LSW A;  1D9Y A;  2F97 A;  4QRZ A;  3VVD A;  4WEP A;  4KHZ E;  1GVC A;  1I6B A;  3G7W A;  3MC2 A;  2E0S A;  4UA8 A;  3MPL A;  4NED A;  1B0L A;  2B3F A;  2V25 A;  4ND9 A;  4BDL A;  1ANF A;  2RIN A;  1LBB A;  4DCX A;  2DS9 A;  4DXU A;  2XX9 A;  2XXH A;  3C36 A;  3R26 A;  5I58 A;  1XC1 A;  1WVJ A;  1MXY A;  4ZZE A;  5DVF A;  3HCQ A;  2D3I A;  1N76 A;  1ZKB A;  3QK6 A;  1IUD A;  1B32 A;  1H43 A;  1FTJ A;  1B4H A;  4LP2 B;  2REG A;  3O6H A;  3Q29 A;  2AYS A;  3QIM A;  3FAT A;  4FOR A;  1LST A;  5KDT B;  1B40 A;  2X7P A;  1OIB A;  1DTG A;  3B6W A;  3K00 A;  3U1O A;  3ILT B;  1FW0 A;  3PV0 E;  2I3V A;  2THI A;  3B6Q A;  3VXB A;  1B2H A;  4JSO A;  3OO7 A;  3O66 A;  5ITO A;  1DPE A;  1N84 A;  3CSB A;  1OQH A;  1M5F A;  2ONS A;  3VFJ A;  2F7A A;  4YKI A;  2ZYM A;  3P7I A;  2UVH A;  4TQU Q;  3K1P A;  1VE4 A;  4OZ9 A;  4G2Z A;  3TKD A;  1J1N A;  4F31 B;  2ONR A;  3FVG A;  2DWJ A;  2PMS A;  3PMX A;  3TQW A;  2IEE A;  3GLB A;  4F19 A;  2ZNS A;  4QFL A;  4OEV A;  1R6Z A;  2XXW A;  1MXU A;  4BDO A;  2DE3 A;  4YKP A;  3A3C A;  1JW5 A;  3TTK A;  1D9V A;  4GWO A;  4ELQ A;  2VP1 A;  2A5T B;  2B3B A;  1R1N A;  4G77 A;  3LUY A;  1MPB A;  4OES A;  1MQD A;  2M8C A;  2X7Q A;  3U92 A;  4HS7 A;  4QFP A;  3PUZ E;  4JB7 A;  3T66 A;  4I9D A;  3QAX A;  3SKP A;  3GZG A;  4YB6 A;  5KCJ B;  1YTV A;  2DYX A;  2QPQ A;  1UTB B;  4G68 B;  3H3G A;  2AL5 A;  3N5L A;  4H5G A;  1IQ7 A;  3T22 A;  4U23 A;  2I3W A;  3Q28 A;  3MP1 A;  5JEI A;  1BTJ A;  3OSR A;  2Y7I A;  2OJT A;  4AB5 A;  4OWD A;  4FED A;  4JBZ A;  1RYO A;  5JTY A;  1WDN A;  5DYH A;  2F6P A;  1LCF A;  4DXC A;  3ODB A;  2XD2 A;  3PD8 A;  1QKB A;  4ZED A;  3KJT A;  3FXR A;  4RA1 A;  3A09 A;  1OVT A;  2P0S A;  3G3F A;  1B05 A;  2UVJ A;  2YPN A;  4ZE8 A;  4QSD A;  3IL1 B;  4LAT A;  1QUI A;  3ECR A;  1Q1K A;  4XTC Q;  1QVS A;  3FVK A;  5DEX B;  2R6G E;  4R72 A;  1IXG A;  3KEI A;  3MUQ A;  4DZ1 A;  4R9F A;  1ZIU A;  4KCC A;  1D4N A;  3PUV E;  2ONK E;  2CMO A;  3MP8 A;  1N3X A;  4F1V A;  5H8H A;  5FHM A;  1Z7N E;  3PUX E;  2A5T A;  1PB8 A;  3K6U A;  4OVJ A;  3M8U A;  5H8Q B;  3TMG A;  1SBP A;  3FUZ A;  5DT6 A;  3SEX A;  4PQJ A;  2Z8D A;  1B58 A;  4E0W A;  3TCF A;  3C34 A;  4F22 A;  1B3G A;  1XVX A;  2REJ A;  2DWI A;  4BDN A;  3SDF A;  3MZB A;  5BUU A;  1MY0 A;  1ZBM A;  3K4U A;  3IOU A;  2XXR A;  2Q8J A;  1MXX A;  3U93 A;  3JZJ A;  5CBR A;  3O2A A;  1MY3 A;  4KI0 E;  1B5H A;  3FJG A;  1GV8 A;  1JW4 A;  3FD3 A;  2O6A A;  3UA8 A;  1JNF A;  4BDR A;  3CG3 A;  4ONY A;  1OQG A;  4M1V A;  1DSN A;  1POT A;  3IOV A;  1MH3 A;  4ZE9 A;  4HCY A;  1EZO A;  5JK4 A;  2R71 A;  5I2K A;  3U72 A;  1OLC A;  3MAM A;  3DM0 A;  3DEL B;  1USY H;  3FAS A;  3R7X A;  2HXW A;  4YMB A;  3CI8 A;  3IJO B;  1LAH E;  4H0W A;  4OET A;  3KN7 A;  4WED A;  1P1W A;  3K0V A;  2Y7R A;  1CB6 A;  3EQ1 A;  1R9Q A;  3KOT A;  3QUF A;  1TXF A;  2V3T A;  1YPN A;  5L9O A;  3MWB A;  1IXC A;  4IGT A;  3MZ9 A;  3IB0 A;  4FIM A;  3IB1 A;  3JYR A;  3TTN A;  4EXL A;  3OEK A;  4ISU A;  4MFI A;  5CMC A;  1VSO A;  3RNN A;  5H8Q A;  2RF1 A;  3C4M A;  5FTH A;  1JW1 A;  3GBB A;  5AE4 A;  4KD5 A;  4QSC A;  3CG1 A;  1TT1 A;  4F39 A;  1M5B A;  4F18 A;  4QF9 A;  1IZ1 A;  4LZ8 A;  1PBQ A;  4QFK A;  3ZSF A;  4QHQ A;  2P2A A;  3W9W A;  4NF4 A;  3O97 A;  3VLU A;  1B0H A;  1L5T A;  4TLM B;  1URD A;  3TDJ A;  2Y7W A;  1NNT A;  3MVW A;  3KN3 A;  3CRB A;  4RK2 A;  5I59 A;  1QUJ A;  1B6H A;  4NWD A;  2RC7 A;  1S7Y A;  1VR5 A;  4GLI A;  4ZZA A;  4Z7E A;  1PC3 A;  3TZA A;  2ZYK A;  2UXA A;  2YJP A;  4AQ4 A;  3OEM A;  4NF8 A;  3VV5 A;  3W15 C;  3SET A;  5J1D A;  2RC9 A;  3V89 B;  4DLD A;  1S9T A;  3Q27 A;  1LAX A;  1OMP A;  5DTB A;  3PPN A;  4F3S A;  1I6A A;  5IKB A;  3CSG A;  4U21 A;  4RPN A;  1KWH A;  3A3U A;  4GL8 A;  4Z0I A;  3K6V A;  1ELJ A;  3FXU A;  2ALU A;  2PBW A;  4F3B A;  5CM6 A;  5CRY A;  1O64 A;  4NMY A;  3OXN A;  3G3K A;  4TLL B;  1MDQ A;  5IAI A;  1A40 A;  1OVB A;  4OYV A;  2VD3 A;  4YKK A;  3PU5 A;  4F3G A;  2UVI A;  3K1N A;  4EF2 A;  2G29 A;  3ZKL A;  1T0K A;  3IJX B;  1P1N A;  1PBP A;  4MLQ A;  5I56 B;  4ELO A;  1Y20 A;  5I84 A;  1B9J A;  4THI A;  4X1B A;  5H8S A;  4RK9 A;  3OO8 A;  3VLW A;  4LON B;  1EU8 A;  2ZXT A;  4UAC A;  5H8F B;  3PUW E;  2XX8 A;  3BKI B;  3RPW A;  2V93 A;  3USD A;  1A99 A;  3FVO A;  4OXV A;  1MQJ A;  4U1O A;  3SEW A;  1YCJ A;  1SVX B;  3LC8 A;  2R9J A;  3O29 A;  2P1S A;  1H45 A;  5ISU A;  3FZV A;  3I5O A;  3QYT A;  2UVG A;  4NF5 B;  2B65 A;  1HSJ A;  3RTW B;  3T93 B;  3FIR A;  5ICT A;  3KGC A;  2D5W A;  2BJJ X;  1UIU A;  2DXR A;  3MJN A;  1B5J A;  4F1Y A;  2NXO A;  5TP9 A;  1LAG E;  1FQA A;  4H1X A;  1QJM A;  1BKA A;  3N94 A;  3G3G A;  4K3F A;  4FJP A;  1GTK A;  4TOZ A;  2QS4 A;  3W9V A;  3H6W A;  4YB7 A;  2OWT A;  1LFH A;  5TPA B;  4GQO A;  1MS7 A;  4PE5 B;  2QS3 A;  4POW A;  3CIJ A;  4GVO A;  1LBC A;  3O6G A;  1NFT A;  3VE1 B;  3E4R A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...