2P0SA

Structural genomics, the crystal structure of a putative abc transporter domain from porphyromonas gingivalis w83
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
136
structure length
130
Chain Sequence
DMKTIAIADRTGEYEQLFKENDEFRFVHAEKTAEEYRKMGADKSGIDAVLEIRQDLLEDPNAVAIYGYKQLPASVSNHISRILSDYLSDKKIASYNIPDIKQILADSKIELSVHTYKWSETSGELASGIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords ABC transporter, permease protein, putative
publication title The crystal structure of a putative ABC transporter domain from Porphyromonas gingivalis W83
rcsb
source organism Porphyromonas gingivalis
total genus 31
structure length 130
sequence length 136
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-03-01
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2p0sA01
1GGGA 1QW0A 4F2QA 4ZS9A 4KYEA 3OENA 1MH3A 2ONKE 1B3EA 3GBBA 2F97A 2OWTA 3EHTA 2DE4A 2UVGA 5H8FA 1TT1A 3EHSA 4OERA 1H44A 4ZE9A 4NWCA 3EF7A 3IX1A 4TLLB 2PBWA 3PPOA 3OO9A 1FCKA 4EXKA 3MC2A 5A5XA 4XKQA 2DVZA 4G68B 2H4IA 4AB6A 3TKDA 1LSTA 4KD5A 1B5IA 4OXVA 2ALUA 4H8JA 4JWXA 4TQUQ 2Y7RA 2Q2AA 1GV8A 3FJ7A 1B32A 3OEKA 4O3CA 5JTYB 5K2YA 3S9LC 3UGWA 3FXUA 3ZKLA 5L9OA 3G7WA 1Q1KA 3VVFA 3N6UA 4JDFA 1FW0A 3WAEA 1B58A 1SYHA 1NH8A 3V8XB 2Y7IA 3RTWB 4E0WA 4GD5A 3K1NA 2GRVA 4OEUA 1ELJA 1QVSA 1NMUA 1MQDA 3K2DA 2QPQA 3IB0A 3K02A 1MDQA 3LSXA 4NF5B 3P7IA 1NKXA 1Y1MA 4WKMA 4DDDA 1XS5A 3V89B 4NEDA 3CFXA 3O66A 5H8HA 2H98A 2FA7A 1Y20A 2YJPA 3CSGA 5CRYA 4POXA 2NWJA 5ICTA 3TEPA 1USYH 4ZZAA 2D21A 4MLQA 2F78A 3CI8A 4IGTA 1TXFA 1MPCA 1MQJA 1SW2A 3VXBA 4F1YA 4NF8A 2PT1A 5KCJB 1H3DA 5AA3A 3MZ1A 5TU0A 1B1XA 3E4RA 2Q89A 3MAMA 1VFEA 4IO7A 3MVYA 3BBRA 1VSOA 1LBBA 3Q29A 5F7VA 2Q8JA 1D9VA 2QSXA 3OELA 2I0CA 4YKJA 2ZYOA 3U1OA 2REGA 4IO4A 2FNCA 3CG1A 2ZYMA 1BLFA 1GVCA 1MXZA 3H06B 2DWAA 4MLVA 4WEPA 1UTBB 2DYXA 3EPEA 1DSNA 4AB5A 4QHQA 3TTNA 3USDA 2NVUB 1Y9UA 3C34A 4EQ9A 1MXVA 3UK4A 5BWJA 2O6AA 2F6PA 1JW1A 3OD7A 5CMKA 4QFKA 4HS7A 1B3LA 1WDNA 2HQ0A 2GHAA 3QAXA 1WVJA 5ITPA 4Q5TA 4LZ5A 4GXAA 2B3BA 4YU0A 5J1DA 3PMWA 3IK6B 5I57A 3FZVA 5KDTB 4LUBA 3KEIA 1PB8A 2QJEA 3RUMA 1AOVA 1HSLA 1WODA 2I4BA 2O51A 2DOJA 2O69A 3AXFA 5DVFA 3BFTA 3PUXE 2OWSA 3C31A 1JQFA 1QJMA 5I56A 2AYSA 2IEEA 2I3VA 5AA2D 4H0WA 1LGBC 1FQEA 3T9UA 1BP5A 4ISUA 5FTIA 2Q2CA 1B9JA 2I49A 1M5EA 4RY1A 2XXXA 4MBPA 4F18A 3PGFA 1L5TA 2H99A 5H8NA 1F9BA 4GF8A 3PD9A 1P1WA 1MM6A 4EQBA 4RJZA 1QUKA 5ICQA 3OMBA 1N84A 2F35A 2DSFA 4PFYA 5B70A 5I58B 2G93A 4KFQA 2ZXTA 1I6BA 2HXWA 2I58A 2R9JA 5TPAB 3SESA 1O63A 1B5HA 3THIA 1B1HA 2OJTA 2F7BA 2QRYA 3IB2A 1URSA 3KG2A 3IOWA 3PMVA 3FXQA 4PETA 1B5JA 3TPAA 2FYIA 4F3GA 2GHBA 1LCFA 1BTJA 4GRKA 4U4XA 4LP2B 1JW5A 3TCFA 3PU5A 1JW4A 2H5YA 3O9PA 1Q35A 1NNKA 4Q0CA 3SERA 3FXRA 3K1MA 2AL4A 3KGCA 1NH7A 3K6UA 1J1NA 5DT6A 4NF6A 1QULA 2XXIA 3TTMA 1H43A 4KPTA 2QS3A 4FJPA 2XX7A 4R2BA 1UIUA 4BLAA 2I0BA 2B3FA 1FQDA 4LATA 4GFRA 4LQ2A 4FIMA 2ZYKA 5DTBA 1POTA 4H5GA 1A8EA 2I48A 5AA2B 1FTOA 1USYE 4QFNA 3W15C 2RCAA 1XT8A 1FQAA 3TDJA 2HZLA 4LA9A 4BDOA 4EXLA 1SW1A 2XX9A 4R9FA 3DP6A 3EN3A 2A5TA 1CE2A 4DCYA 1ZBMA 5CBSA 2R71A 4GVOA 4F39A 1JVXA 4IY6A 3S9EA 2X7PA 3WAFA 1QKBA 2H9BA 1XOCA 1FQBA 5I2KA 2PMSA 1B6HA 1I6AA 4DXUA 1UTHA 4NWDA 2O7IA 4DIGA 3U92A 2I3WA 2NOOA 2ZNTA 1VR5A 1Y3PA 3FV2A 3SKPA 1Z7ME 2F5XA 3HN0A 3RT8A 4R6YA 1B2HA 1I6QA 1URGA 3BFUA 3CVGA 3MVWA 4IO3A 3O28A 5FHMA 3FATA 3PD8A 3CR9A 3RY3A 3MVZA 2XD3A 4XKNA 1FTJA 1OQGA 2Z8DA 3DP8A 3DP4A 4O3AA 2WKYA 1B4ZA 3RLFE 3SEYA 3IAZA 2HFBA 2F7AA 3K6XA 5I59B 1LFHA 3IJXB 5EHMA 1SD3A 3IL1B 3I3VA 4MF3A 3TTRA 4DXCA 3UN6A 4JXIA 3K1PA 3R6UA 4M4GA 1A8FA 3T93B 4QSDA 3IJOB 1S7YA 5AA1A 4UACA 3GXAA 4DCXA 2VD2A 2P2AA 4JB7A 1SQYA 3IOUA 4BDNA 3E9XA 2XXPA 4RNSA 4H67A 4HCWA 3N26A 4XKPA 1N76A 1B7ZA 1JEVA 3RNNA 1XVXA 3H6UA 1ZKBA 1SI1A 3IO4A 1UIVA 3KJ7A 3Q26A 3K00A 4KQPA 1DOTA 1EZ9A 2RF1A 5L8DA 1LAGE 4PFTA 4Z0IA 5FHNA 1MXWA 3CRBA 4LQ5A 4OFOA 2VHAA 2X7QA 3R26A 2V93A 4GL0A 1D4NA 2F34A 4U1OA 4GXSB 1IZ1A 1SVXB 3LSWA 3GZGA 1B3FA 1IEJA 5HPQA 1O64A 1VE4A 2VP1A 4ZDMA 3QXMA 1MXYA 4EUOA 3GLBA 2OZZA 5JK4A 2Z8EA 3QYTA 1NL5A 1SYIA 3ODBA 3OO7A 5AE4A 3R7XA 4BDRA 2NXOA 4QF9A 1HSJA 3VLVA 3PUVE 2KLFA 5BUUA 1IQ7A 5EYFA 4OYVA 1MY3A 2R6GE 1B3GA 4N13A 4JWYA 1US4A 3D4GA 3B6WA 4P0IA 4YKPA 5ELVA 3S9MC 1NNFA 3FD3A 4O3BA 3O6HA 3M8UA 4BDQA 2Q88A 2D3IA 4EQ7A 3M3LA 3O6GA 3TCGA 1ZJLA 4G68A 4LVQA 3K4UA 4MFIA 3RN8A 2F7CA 3VVEA 3E13X 4I9DA 4Z7EA 1PDAA 1B7HA 2DWJA 2O84X 4QSEA 1ZU0A 2O1MA 4ZECA 4ZEIA 4YB5A 4TOZA 2OK2A 3MVXA 2IA4A 3T22A 2XXQA 4F3BA 3HCQA 2DP8A 1OIBA 3O97A 1HSEA 2DE2A 4LONB 1N3XA 3K6WA 3MP6A 3RGYA 4F19A 3TCHA 4C1UA 3SEUA 3TFLA 3IOTA 3PUZE 3I5OA 2F6GA 3EHUA 4RPOA 1KWHA 1LAXA 3G3GA 4XTCQ 3TUSA 1MG1A 1LAHE 3B6QA 1XVYA 3N5LA 4NF5A 1LB8A 3FASA 1ZMGA 4HTGA 3PPPA 4ESXA 1N0TA 2X26A 1IITA 3DLNA 3H4ZA 2DXYA 2V3UA 2PX1A 5H8QB 1D9YA 1LCTA 3GBAA 2QMXA 3EQ1A 4KYSA 5M2VA 3HPIA 2VD3A 4OQOA 3HO7A 5F1QA 3LBSA 1B3HA 2I4CA 4TLMB 4Q30B 4ELQA 1AH5A 4QFPA 3CSBA 3TZAA 5DYHA 5AA4B 1P99A 5TP9A 3S2VA 3PMXA 2A5TB 5KCJA 3OEMA 2HAUA 4XKRA 1P1OA 5DEXA 3MQ9A 3QIMA 5I2NB 2RC8A 4F1VA 2DWHA 5DVIA 4GOTA 4ZE8A 1YTVA 4G8MA 4FEDA 4Q8RA 3FJMA 1B4HA 5B7DA 3PPRA 3T9HB 1UTHB 4JWOA 4IO5A 3G3HA 1VFDA 3V5AA 4NF4B 1MRPA 2M8CA 3ECRA 1UTBA 5EHSA 4KCDA 3MZ9A 1CB6A 3G3KA 2Z23A 3RTFB 2GH9A 4OMBA 4IGRA 1Y4CA 1LFIA 4YKKA 5CBRA 3LC8A 1SW5A 2D5WA 1N3WA 1P1NA 4G77A 1MPBA 3C35A 1JETA 5JEIA 4R74A 3M3KA 5KDTA 3JV9A 2REJA 4YZZA 5H8FB 4N6PA 4P0GA 4G2ZA 2Y7PA 4RPNA 3VLWA 4R75A 4H5FA 1BIYA 1N7WA 1PC3A 3O2AA 3C32A 1LLSA 4EF1A 1AIVA 1MXXA 3C9HA 3QSLA 4P11A 4H65A 3LUYA 2V3QA 5A5XB 2RKMA 1MY2A 1N04A 4C1TA 1OMPA 2O68A 4OTEA 5CMMA 1QUIA 3TMGA 3KBRA 4FE8A 4GIZA 3UIFA 2CZLA 3A09A 2O1LA 4G4PA 3H7MA 3SEXA 5I84A 1AMFA 3MWBA 4R73A 3G3JA 1I69A 4YAHX 5ISUA 4PFWA 2Y84A 3IR1A 3PV0E 2AL5A 4F22A 3TODA 1S9TA 3U72A 2OLBA 1OVBA 3CIJA 3W9VA 1FQFA 2XXYA 4OENA 3OOAA 2UXAA 2PT2A 1Z7NE 4U23A 3IOVA 1IXGA 5KZTA 3ZS6A 2RCBA 5TPAA 3H6TA 1MY1A 3VLUA 1M5CA 4IO2A 4F2OA 3ONMA 3ZKKA 1B46A 1ZLQA 2XXTA 1R1NA 2GFEA 1A54A 1MQGA 4YICA 3H3GA 5H8HB 4OETA 1EZPA 1R9QA 4KHZE 4YB7A 4ELPA 3V83A 3ILTB 1MY4A 1RKMA 1PBPA 3FVNA 1B0LA 3T9VA 4RK9A 3B7DA 4OVJA 1PB9A 2V25A 5IAIA 1FTLA 2DQVA 3OO8A 4ELRA 2UVIA 3FVKA 4NF8B 3CG3A 1OLAA 5DVJA 1B51A 3LSLA 4GQOA 1P1UA 3LSFB 1PB7A 4IB2A 1IXHA 4R6KA 3SEVA 2E1SA 1LBCA 5AA2A 4EDPA 3HHFA 5IKBA 3Q28A 3KSJA 2B65A 2O7UA 3D4CA 4YMAA 4GLIA 3H6VA 3U93A 2XXWA 3KFMA 4RA1A 1M5BA 1SBPA 1LAFE 1A99A 4YMBA 2VOZA 2DE3A 3OSQA 1FTKA 4JSDA 3PPNA 3JYRA 1MM7A 4GL8A 1Y4TA 3KJTA 4ELOA 1URDA 4NMYA 3JZJA 4X9TA 4F1UA 3A3CA 4DE8A 3PUWE 4G8HA 1QKAA 4THIA 1S50A 3KOTA 3N94A 3A3UA 3FVGA 4K3FA 2Z8FA 3MZBA 3FIRA 2Q9TA 4QRZA 3B6TA 5I57B 3T9XB 2UYEA 3SEWA 4IO6A 4NTLA 1OQHA 1N7XA 4KCCA 1B40A 1EZOA 2A5SA 4C0RA 4ECFA 4PE5B 2V3TA 4U1ZA 4F3PA 4WEDA 2YLNA 4RYAA 1NNTA 1MQHA 1SW4A 4FEBA 2QS2A 2DXRA 1SDXA 2LAOA 5I59A 3H03A 4QSCA 3FVOA 2OCUA 2AIXA 5LOMA 4XIGQ 4PP0A 3W9WA 5I56B 3K6VA 4OHNA 3C4MA 4FAJA 2RC9A 3KN3A 5CM6A 3Q25A 1XC1A 2ABHA 4HW8A 4OWDA 2ANJA 2E0SA 5TP9B 5H8NB 3HV1A 2XXRA 4AQ4A 1RYXA 3PUYE 2ZNUA 5FTHA 3VFJA 5FHOA 5HBCA 1B7UA 5DEXB 4MH5A 3PPQA 2H25A 3VE1B 1H76A 3KSXA 4I62A 2HAVA 3U8QA 2QS1A 4X48A 1JEUA 3T96B 1ATGA 5JTYA 3MPLA 4KR5A 1BKAA 4H8IA 1AL3A 3ZSFA 2Y7KA 2DVCA 2XXVA 3RPWA 1IXIA 1A55A 4DZ1A 1D3KA 3T66A 1H45A 1DPPA 3TTKA 3G3FA 3Q27A 1ANFA 1Y1ZA 3KN7A 3RT6B 1MY0A 4OZ9A 4FORA 4UA8A 3L6GA 4GWOA 3FUZA 4JSOA 1MH4A 1MXUA 1PEBA 1II5A 2XX8A 1LB9A 3IB1A 2UYFA 2QMWA 1SI0A 1DTZA 3MW0A 2OBGA 2ZNSA 3OXNA 4IY5A 3VDFA 4ND9A 2XHDA 1YCJA 2RINA 3F11A 3MBPA 2HCAA 1YAEA 3CFLA 4NF6B 4ESWA 4M1VA 2Y7WA 4X1DA 2VGQA 4I8CA 4LZ7A 1MQIA 4X1BA 4F29A 4DXBA 4R72A 1TFDA 4BDLA 3MPKA 4QFLA 3FJGA 3SDFA 5CC2A 5L9SA 1FTMA 1R9LA 4F3SA 4OFLA 2F36A 1OLCA 4QFOA 1RYOA 4L17A 3HSTA 3TAJA 2QL3A 5HM4B 1MDP1 3MP8A 1DTGA 1IUDA 1ZIUA 1JNFA 1Y3NA 2ONSA 1DPEA 4RXLA 1GTKA 1DMBA 4ZEDA 1T0KA 2PYYA 5I2KB 4OFJA 3LR1A 4ZEKA 4LZ8A 1XHYA 4FATA 3CFZA 3UA8A 1R6ZA 1JVYA 1NNPA 2I6EA 2UVHA 3O6IA 1ZTYA 3C33A 1IIWA 3M3FA 1EH3A 1QUJA 3TYHA 1PBQA 2DWIA 2UVJA 3FV1A 2P0SA 3N6TA 4KI0E 2RC7A 1B0HA 4OEVA 4RK2A 2NUVA 4G68C 4OESA 1EU8A 3TQWA 1POY1 3MJNA 3FGSA 3MP1A 3S4UA 4WXJA 1FQCA 3O29A 3TELA 1A40A 3VVDA 1MS7A 4U21A 5K2XA 2V84A 3RQTA 2XXHA 1UQWA 3OSRA 2ONRA 2W7YA 4U4SA 4FECA 4R9GA 4G8NA 4KYDA 4JBZA 3S9NC 4U22A 2PVUA 4EF2A 1Y3QA 3DM0A 3IO6A 4YKIA 1TWYA 3VXCA 4R6HA 4F31B 5CI5A 2YPNA 5H8QA 4DLDA 4N07A 3QUJA 3QUFA 3K01A 4H6DA 2DS9A 1O7TA 4XXUA 1YPNA 2Z22A 1US5A 4PFUA 3C36A 1TFAA 3KZGA 2BJJX 3MUQA 4HCYA 4E0XA 5L9MA 1GR2A 5AA4A 3TTLA 3QK6A 4POWA 1B05A 2ESNA 3OO6A 3TQLA 1IXCA 3U94A 2XXUA 4U2RA 4R2FA 2ZMBA 3BKIB 3K0VA 4BDMA 3VV5A 3KN8A 3SETA 3L6HA 3I6VA 3DELB 5I2NA 5I58A 2G29A 5CMBA 4ZZEA 3H6WA 5ITOA 2THIA 4H1XA 1NFTA 1A7LA 1P1QA 4NE4A 4NF4A 4PQJA 4YB6A 3G3IA 2QS4A 3ILUB 5CMCA 2CMOA 1B52A 1LFGA 3UORA 2F8DA 2HEUA 3UP9A 2HZKA 1MPDA 2XD2A 4ONYA 3E3KA 4ZEFA 1M5FA 4I1DA 5H8SA 3HHGA 3KOSA 1OVTA 4ZEBA 2ZYNA 1M5DA 2P1SA 3IORA
chains in the Genus database with same CATH superfamily
1GGGA 1QW0A 4F2QA 1LBXA 4ZS9A 4KYEA 3OENA 1MH3A 2ONKE 1B3EA 3GBBA 2F97A 2OWTA 3EHTA 2DE4A 2UVGA 5H8FA 1TT1A 3EHSA 1FBPA 1AWBA 4OERA 4JVIA 1H44A 4ZE9A 4NWCA 3EF7A 3IX1A 4TLLB 2PBWA 3PPOA 3OO9A 1FCKA 4GWXA 4GWZA 4EXKA 3MC2A 5A5XA 4XKQA 2DVZA 4G68B 2H4IA 4AB6A 3TKDA 2V4CA 1LSTA 4HE0A 4KD5A 1B5IA 4OXVA 2ALUA 2WYPA 4H8JA 1DBZA 4JWXA 4TQUQ 2WBDA 2Y7RA 4P1LA 2Q2AA 1GV8A 3FJ7A 1B32A 3OEKA 4O3CA 4MCOA 5JTYB 5K2YA 3S9LC 3UGWA 3FXUA 3ZKLA 5L9OA 3RPLA 3G7WA 1Q1KA 3VVFA 3N6UA 4JDFA 1FW0A 3WAEA 1B58A 2PFZA 1SYHA 1NH8A 3V8XB 2Y7IA 3RTWB 4E0WA 4GD5A 5IZZA 3K1NA 2GRVA 4OEUA 1ELJA 1QVSA 3BIHA 1NMUA 1YYZA 1MQDA 3K2DA 2QPQA 3IB0A 3K02A 1MDQA 1FJ6A 3LSXA 4NF5B 3P7IA 1NKXA 1Y1MA 4NHBA 4WKMA 4DDDA 1XS5A 1FPIA 3V89B 4NEDA 3CFXA 3O66A 5H8HA 2H98A 2FA7A 1Y20A 3IFCA 2YJPA 3CSGA 2FIEA 5CRYA 4POXA 2NWJA 5ICTA 1RDZA 3TEPA 1USYH 1KZ8A 4ZZAA 2D21A 4MLQA 2F78A 3CI8A 4IGTA 1TXFA 5IM2A 1MPCA 4GWUA 1MQJA 4N8YA 1SW2A 3VXBA 4F1YA 4DI4B 4NF8A 2PT1A 5KCJB 1H3DA 5AA3A 1FPDA 3MZ1A 5TU0A 1B1XA 3E4RA 2Q89A 3MAMA 1VFEA 4IO7A 3MVYA 3BBRA 1VSOA 1LBBA 3Q29A 5F7VA 3NOHA 2Q8JA 1D9VA 2QSXA 3OELA 4I3EA 2I0CA 4YKJA 2ZYOA 3U1OA 5EQ7A 2REGA 1FSAA 4IO4A 2FNCA 3CG1A 2ZYMA 4HXVA 1BLFA 1GVCA 1MXZA 3H06B 2DWAA 4MLVA 4WEPA 1UTBB 2DYXA 3EPEA 1DSNA 2JJKA 4AB5A 4QHQA 3TTNA 3USDA 2NVUB 1Y9UA 3C34A 4EQ9A 1MXVA 3UK4A 5BWJA 2O6AA 2F6PA 5IZ3B 1JW1A 3OD7A 5CMKA 4QFKA 5IGAA 4HS7A 1B3LA 1WDNA 2HQ0A 2GHAA 3QAXA 1WVJA 5ITPA 4Q5TA 4LZ5A 4GXAA 2B3BA 4YU0A 5J1DA 3PMWA 3IK6B 5I57A 2VPOA 3FZVA 5KDTB 1EYIA 4LUBA 3KEIA 1PB8A 2QJEA 4IR8A 4PFRA 3RUMA 4N8GA 1LBVA 1AOVA 1HSLA 1WODA 2I4BA 2O51A 4I40A 2DOJA 2O69A 3AXFA 5DVFA 3BFTA 3PUXE 2OWSA 3C31A 5LDZA 1JQFA 4FBPA 1QJMA 5I56A 2AYSA 2IEEA 2I3VA 5AA2D 4H0WA 1LGBC 1FQEA 3T9UA 1BP5A 4ISUA 5FTIA 5EQ9A 2Q2CA 3ISPA 1B9JA 2I49A 1M5EA 4RY1A 2XXXA 4MBPA 4F18A 3PGFA 1L5TA 2H99A 5H8NA 4PFIA 4GF8A 1F9BA 3PD9A 1P1WA 1MM6A 4EQBA 4RJZA 4PTKA 1QUKA 5ICQA 3OMBA 1N84A 2F35A 2DSFA 4PFYA 1K9YA 5B70A 5I58B 2G93A 4KFQA 1NUXA 2ZXTA 1I6BA 2HXWA 2I58A 2R9JA 4X8RA 5TPAB 3SESA 1O63A 1B5HA 1B1HA 3THIA 2OJTA 2F7BA 2QRYA 1NV7A 4N81A 3IB2A 1URSA 3KG2A 1NUYA 3IOWA 3PMVA 3FXQA 4PETA 3FXBA 1B5JA 3TPAA 2FYIA 4F3GA 2GHBA 1LCFA 1BTJA 1FPJA 4GRKA 4U4XA 4LP2B 1JW5A 1XI6A 3TCFA 4MX6A 3PU5A 1JW4A 2H5YA 3O9PA 3RYDA 1Q35A 1NNKA 4Q0CA 3SERA 3FXRA 3K1MA 2AL4A 4NG7A 3KGCA 1NH7A 3K6UA 1J1NA 5DT6A 4NF6A 1QULA 2XXIA 3TTMA 1H43A 4KPTA 2QS3A 4FJPA 2XX7A 4R2BA 1UIUA 4BLAA 4P3LA 2I0BA 2B3FA 3E78A 1FQDA 4LATA 3U65A 4GFRA 2WEFA 4LQ2A 4FIMA 2ZYKA 4O7MA 5DTBA 1POTA 4H5GA 1A8EA 2I48A 5AA2B 1FTOA 1USYE 4PBQA 4QFNA 3W15C 2RCAA 4PE3A 1XT8A 1FQAA 3TDJA 2HZLA 4PDDA 4LA9A 4BDOA 4EXLA 1SW1A 2XX9A 4R9FA 3DP6A 2B4MA 3EN3A 2A5TA 1CE2A 4DCYA 1ZBMA 1NV2A 3HFUA 5CBSA 2R71A 4GVOA 4F39A 1JVXA 4IY6A 3S9EA 2X7PA 3WAFA 1QKBA 2H9BA 1XOCA 1FQBA 5I2KA 2PMSA 1B6HA 1FPKA 1I6AA 4P56A 2OX3A 4UABA 1UTHA 4NWDA 4DXUA 2O7IA 4DIGA 3U92A 2I3WA 2NOOA 2ZNTA 1VR5A 1Y3PA 3FV2A 3SKPA 4N4UA 4OVPA 1Z7ME 2F5XA 3KBZA 3HN0A 3RT8A 4R6YA 1B2HA 1I6QA 1URGA 3BFUA 3CVGA 3MVWA 4IO3A 3O28A 5FHMA 3FATA 3PD8A 2QVVA 2FHYA 3CR9A 3RY3A 3MVZA 2XD3A 4PAKA 4XKNA 1FTJA 1OQGA 2Z8DA 3DP8A 3DP4A 4O3AA 2WKYA 3EKIA 1B4ZA 3RLFE 3SEYA 3IAZA 2HFBA 2F7AA 3K6XA 5I59B 1LFHA 3IJXB 4PGPA 5EHMA 1SD3A 3IL1B 3I3VA 4MF3A 1IMCA 2HHMA 3TTRA 4DXCA 3UN6A 4JXIA 3MYUA 1LEVA 3K1PA 3R6UA 4M4GA 1A8FA 3T93B 4QSDA 3IJOB 1S7YA 2HXRA 1FBGA 5AA1A 4UACA 3GXAA 4DCXA 2VD2A 2P2AA 4G61A 4JB7A 1SQYA 3IOUA 5EYHA 4BDNA 3E9XA 2XXPA 4N17A 4RNSA 4H67A 4HCWA 3N26A 4XKPA 1N76A 1B7ZA 1JEVA 5I7IA 3RNNA 1XVXA 3H6UA 1ZKBA 1SI1A 3IO4A 2XWVA 1UIVA 4PFBA 3KJ7A 3Q26A 3K00A 4KQPA 1DOTA 1EZ9A 2RF1A 5L8DA 2VPNA 1LAGE 4PFTA 4Z0IA 5FHNA 5EYGA 4KXPA 4GBWA 1MXWA 4O7IA 3CRBA 4LQ5A 4OFOA 2VHAA 2X7QA 4AS4A 3R26A 2V93A 4GL0A 1D4NA 2F34A 1YXIA 3KC0A 4U1OA 4GXSB 1IZ1A 1SVXB 3LSWA 3GZGA 1B3FA 1IEJA 1VDWA 5HPQA 1O64A 1VE4A 2L5VA 2VP1A 4ZDMA 3QXMA 1MXYA 4PGNA 4EUOA 3GLBA 4NN3A 2OZZA 4P9KA 5JK4A 2Z8EA 3QYTA 1NL5A 1G0HA 1SYIA 3ODBA 3OO7A 5AE4A 3R7XA 4BDRA 2NXOA 4QF9A 1HSJA 3VLVA 3PUVE 2KLFA 1EYKA 5BUUA 1IQ7A 1FBCA 3E79A 5EYFA 4OYVA 1MY3A 2R6GE 1B3GA 4N13A 4JWYA 1US4A 3D4GA 3B6WA 4P0IA 4YKPA 5ELVA 3S9MC 1NNFA 3FD3A 4O3BA 3O6HA 1IMAA 3M8UA 4BDQA 2Q88A 2D3IA 1KA0A 4EQ7A 3M3LA 3O6GA 3TCGA 1ZJLA 4G68A 4LVQA 3K4UA 4MFIA 3RN8A 2F7CA 3VVEA 1FPFA 2FIXA 3E13X 4I9DA 4Z7EA 1PDAA 1B7HA 2DWJA 2O84X 4QSEA 1ZU0A 2O1MA 4ZECA 4ZEIA 4YB5A 4TOZA 2OK2A 3MVXA 2IA4A 3T22A 2XXQA 4F3BA 3HCQA 2DP8A 1OIBA 3O97A 1HSEA 4GWWA 2DE2A 4LONB 4MHFA 1N3XA 4MJOA 3K6WA 3MP6A 3RGYA 2F3DA 4F19A 3TCHA 4C1UA 3SEUA 3TFLA 1FBEA 3IOTA 3PUZE 3B50A 4OVRA 2KQZA 2QVRA 3I5OA 2F6GA 3EHUA 4RPOA 1KWHA 1LAXA 3G3GA 4XTCQ 3TUSA 1MG1A 1LAHE 3B6QA 1XVYA 3N5LA 1G0IA 4NF5A 1LB8A 4P1EA 3FASA 2XXKA 1ZMGA 4HTGA 3LV0A 2ZZXA 3PPPA 4ESXA 1N0TA 2X26A 1IITA 3DLNA 3H4ZA 2DXYA 2V3UA 4HE1A 2PX1A 4OVTA 4P8BA 5H8QB 1D9YA 1LCTA 3GBAA 2QMXA 3EQ1A 4KYSA 5M2VA 3HPIA 2VD3A 4OQOA 3HO7A 5F1QA 4O94A 3LBSA 1B3HA 2I4CA 4TLMB 4Q30B 3BIGA 4ELQA 1AH5A 4QFPA 3CSBA 3TZAA 5DYHA 4XF5A 5AA4B 1P99A 4N6KA 5TP9A 2Q8MA 3S2VA 3PMXA 2A5TB 5KCJA 3OEMA 2HAUA 4XKRA 1P1OA 5DEXA 3MQ9A 4I3YA 3QIMA 5I2NB 2RC8A 4F1VA 1NV5A 2DWHA 3B8BA 4XEQA 5DVIA 2CZIA 1NUWA 4GOTA 2Q74A 4ZE8A 1YTVA 4G8MA 4FEDA 4Q8RA 3FJMA 1B4HA 5B7DA 3D1RA 3PPRA 3T9HB 1UTHB 4JWOA 4IO5A 3G3HA 1CNQA 1VFDA 3V5AA 4NF4B 2CEYA 1MRPA 2M8CA 1NV1A 3ECRA 1UTBA 5EHSA 4KCDA 3MZ9A 1CB6A 3G3KA 4PBHA 2Z23A 3RTFB 5IZ3A 2GH9A 2VT5A 4OMBA 4IGRA 1Y4CA 1LFIA 4YKKA 4JVCA 5CBRA 1IMBA 3LC8A 1SW5A 2D5WA 1N3WA 1P1NA 4G77A 1MPBA 3C35A 1JETA 5JEIA 4R74A 3M3KA 5KDTA 3JV9A 2REJA 4YZZA 1DCUA 5H8FB 4N6PA 4P0GA 4G2ZA 2Y7PA 4RPNA 3VLWA 4R75A 4H5FA 1BIYA 1N7WA 1PC3A 3O2AA 3C32A 3SZPA 1LLSA 4EF1A 1AIVA 1MXXA 3C9HA 3QSLA 4P11A 4H65A 3LUYA 2V3QA 5EQAA 5A5XB 2RKMA 1IMDA 1FRPA 1MY2A 1N04A 1FBDA 4C1TA 1OMPA 2O68A 4OTEA 5CMMA 1QUIA 3TMGA 3KBRA 4FE8A 4GIZA 3UIFA 2CZLA 3A09A 4GWSA 2O1LA 4G4PA 1FBHA 3H7MA 3SEXA 5I84A 1AMFA 3MWBA 4R73A 3G3JA 1I69A 2CZKA 3RPLB 4YAHX 5ISUA 4PFWA 4NGUA 1NV0A 4MMPA 2Y84A 3IR1A 4P47A 3PV0E 2AL5A 4NX1A 2F3BA 4F22A 3TODA 1S9TA 3U72A 2OLBA 1OVBA 3CIJA 3W9VA 1FQFA 2XXYA 4OENA 3OOAA 2UXAA 2WBBA 2PT2A 1Z7NE 4U23A 3IOVA 2ZZWA 1IXGA 2ZZVA 5KZTA 3T0JA 3ZS6A 2RCBA 5TPAA 3H6TA 1MY1A 3VLUA 1M5CA 4PC9A 4IO2A 4F2OA 3ONMA 3ZKKA 1B46A 1ZLQA 2XXTA 1R1NA 2GFEA 1A54A 1MQGA 4YICA 4DI3D 3H3GA 2XA5A 5H8HB 4OETA 1EZPA 1R9QA 3FBPA 4KHZE 4YB7A 4ELPA 4GX4A 5J16A 2B4LA 3V83A 3ILTB 1MY4A 2Y5KA 1RKMA 1PBPA 3FVNA 1B0LA 3T9VA 1RDXA 4RK9A 1EYJA 3B7DA 4OVJA 1PB9A 1YZ0A 2V25A 5IAIA 2P3VA 1FTLA 2DQVA 4N6DA 5FBPA 3OO8A 4ELRA 2UVIA 3FVKA 4NF8B 3PTYA 3CG3A 1OLAA 5DVJA 1B51A 3LSLA 4GQOA 1P1UA 3LSFB 1PB7A 4IB2A 4X04A 1IXHA 4R6KA 3SEVA 2E1SA 4MNIA 1LBCA 5ET7A 2FVZA 5AA2A 4EDPA 3HHFA 5IKBA 3Q28A 3KSJA 3QMFA 2B65A 2O7UA 3D4CA 4YMAA 4GLIA 2Y5LA 3H6VA 3U93A 2XXWA 3KFMA 4RA1A 4OVSA 1M5BA 1SBPA 1LAFE 1LBZA 1A99A 2XWIA 4YMBA 1D9QA 2VOZA 1SPIA 2DE3A 3OSQA 1FTKA 1QGXA 4JSDA 3PPNA 4MNPA 2FBPA 3JYRA 1MM7A 4GL8A 1Y4TA 3KJTA 4ELOA 1URDA 4NMYA 3JZJA 4PF8A 4X9TA 4PDHA 3A3CA 4F1UA 4PAIA 4DE8A 3PUWE 4G8HA 1QKAA 4THIA 4MNCA 5EQ8A 1S50A 3KOTA 3N94A 3A3UA 3FVGA 4K3FA 2Z8FA 3MZBA 3FIRA 2Q9TA 4QRZA 3B6TA 5I57B 3T9XB 2UYEA 3SEWA 4IO6A 4NTLA 1OQHA 1N7XA 4KCCA 1B40A 1EZOA 2A5SA 4NF0A 4C0RA 1RDYA 4ECFA 1FPLA 4PE5B 2V3TA 4U1ZA 4F3PA 1IMFA 4WEDA 2YLNA 4RYAA 1NNTA 1MQHA 1SW4A 4FEBA 2QS2A 2DXRA 1SDXA 2LAOA 5I59A 1IMEA 3H03A 4QSCA 3FVOA 2OCUA 4GWYA 2AIXA 5LOMA 4XIGQ 4PP0A 3W9WA 5I56B 3K6VA 4OHNA 3C4MA 4FAJA 2RC9A 1LBYA 3KC1A 3KN3A 4NAPA 5CM6A 2MKZA 4PAFA 3Q25A 1XC1A 2ABHA 4HW8A 4OWDA 2QFLA 2ANJA 2E0SA 2OWZA 5TP9B 5H8NB 3HV1A 2XXRA 4AQ4A 1LBWA 3MSTA 5ET6A 1RYXA 3PUYE 2ZNUA 5FTHA 3VFJA 5FHOA 5HBCA 1B7UA 5DEXB 4MH5A 3PPQA 1JP4A 2H25A 4MAGA 3VE1B 1H76A 3KSXA 4I62A 2HAVA 3U8QA 2QS1A 4X48A 2XWKA 1JEUA 3T96B 2WYKA 1ATGA 5JTYA 3MPLA 4HE2A 4KR5A 2CEXA 1BKAA 4H8IA 1AL3A 3ZSFA 2Y7KA 2DVCA 2XXVA 5IZ1A 2P3NA 3RPWA 1FBFA 1IXIA 1A55A 5ET5A 4DZ1A 2QVUA 1D3KA 3T66A 1H45A 1DPPA 3TTKA 3G3FA 1BK4A 3Q27A 1ANFA 1Y1ZA 3KN7A 3RT6B 1MY0A 4GX3A 4FORA 4OZ9A 1INPA 5T3JA 4UA8A 3L6GA 4GWOA 3FUZA 2WX9A 4JSOA 1MH4A 1MXUA 1PEBA 1II5A 2XX8A 1LB9A 3IB1A 2UYFA 2QMWA 1SI0A 1DTZA 3MW0A 2OBGA 2ZNSA 3OXNA 4IY5A 3VDFA 4ND9A 4N91A 2XHDA 1YCJA 2RINA 3F11A 3MBPA 2HCAA 1FTAA 1YAEA 2CZHA 3CFLA 4NF6B 4ESWA 4M1VA 2Y7WA 4X1DA 2VGQA 4I8CA 4LZ7A 4MEVA 1FPBA 1MQIA 4X1BA 4F29A 4DXBA 2KR0A 4R72A 4GBVA 1TFDA 5A5LA 4BDLA 1FPGA 3MPKA 4H46A 4QFLA 3FJGA 3SDFA 5CC2A 5DW8A 2XWOA 5L9SA 1FTMA 1R9LA 4F3SA 4OFLA 2F36A 1OLCA 4QFOA 1RYOA 4L17A 3HSTA 3TAJA 2QL3A 5HM4B 1MDP1 3MP8A 1DTGA 1IUDA 1ZIUA 1JNFA 1KA1A 1Y3NA 2ONSA 1DPEA 4RXLA 1GTKA 1DMBA 4ZEDA 1T0KA 2PYYA 5I2KB 5ET8A 4OFJA 3LR1A 4ZEKA 4LZ8A 1XHYA 4FATA 3CFZA 3UA8A 1R6ZA 1Q9DA 1JVYA 1NNPA 2I6EA 2UVHA 3O6IA 4OA4A 1FJ9A 1ZTYA 3C33A 1IIWA 3M3FA 1EH3A 1QUJA 3TYHA 1PBQA 2DWIA 4JVDA 2UVJA 3FV1A 2P0SA 3N6TA 4KI0E 2RC7A 1B0HA 4OEVA 4RK2A 2NUVA 4G68C 4O8MA 4OESA 4H45A 1EU8A 3TQWA 1POY1 4PCDA 3MJNA 3FGSA 3MP1A 3S4UA 4WXJA 1FQCA 3O29A 3TELA 1A40A 3VVDA 1MS7A 4U21A 5K2XA 2V84A 3RQTA 2PCRA 2XXHA 1FPEA 1UQWA 3OSRA 2ONRA 2W7YA 4U4SA 4FECA 4GX6A 4R9GA 4G8NA 4KYDA 4JBZA 3S9NC 4OVQA 4NQ8A 4U22A 2PVUA 1NV6A 5I5PA 4EF2A 1Y3QA 3DM0A 2R8TA 3IO6A 4YKIA 1TWYA 3VXCA 4R6HA 2DDKA 5LTCA 4F31B 5CI5A 4N15A 2YPNA 5H8QA 4DLDA 5F24A 4N07A 3QUJA 3QUFA 3K01A 4H6DA 2DS9A 1O7TA 4XXUA 3A29A 3LUZA 1YPNA 2PFYA 4QXDA 2Z22A 3GYYA 1US5A 1NV3A 4PFUA 3C36A 1TFAA 3KZGA 2BJJX 3MUQA 4HCYA 4E0XA 5L9MA 1GR2A 1K9ZA 5AA4A 3TTLA 3QK6A 4POWA 4MIJA 1B05A 2ESNA 3OO6A 3TQLA 1IXCA 3ROJA 3U94A 2XXUA 4U2RA 4R2FA 2ZMBA 4PF6A 2BJIA 3BKIB 3K0VA 4BDMA 3VV5A 3KN8A 3SETA 3L6HA 3I6VA 3DELB 5I2NA 5I58A 2G29A 3T1BA 5CMBA 2HPGA 4ZZEA 3H6WA 2THIA 5ITOA 4LN5A 4H1XA 1DK4A 4QBAA 1NFTA 1A7LA 1P1QA 4NE4A 5I3SA 4PQJA 4NF4A 4XFEA 4AS5A 4YB6A 3G3IA 2QS4A 3ILUB 5CMCA 2CMOA 2GQ1A 3IFAA 1B52A 1NUZA 1LFGA 3UORA 4OANA 2F8DA 2HEUA 3UP9A 2HZKA 5ESYA 1NV4A 1MPDA 2XD2A 4ONYA 3E3KA 4ZEFA 1M5FA 1NI9A 4I1DA 5H8SA 3HHGA 3KOSA 1OVTA 4ZEBA 2ZYNA 1M5DA 2P1SA 3CHGA 3IORA
chains in the Genus database with same CATH topology
1GGGA 1QW0A 4F2QA 4ZS9A 4KYEA 3OENA 1MH3A 2ONKE 1B3EA 3GBBA 2F97A 2OWTA 3EHTA 2DE4A 2UVGA 5H8FA 1TT1A 3EHSA 4OERA 1H44A 4ZE9A 4NWCA 3EF7A 3IX1A 4TLLB 2PBWA 3PPOA 3OO9A 1FCKA 4EXKA 3MC2A 5A5XA 4XKQA 2DVZA 4G68B 2H4IA 4AB6A 3TKDA 1LSTA 4KD5A 1B5IA 4OXVA 2ALUA 4H8JA 4JWXA 4TQUQ 2Y7RA 2Q2AA 1GV8A 3FJ7A 1B32A 3OEKA 4O3CA 5JTYB 5K2YA 3S9LC 3UGWA 3FXUA 3ZKLA 5L9OA 3G7WA 1Q1KA 3VVFA 3N6UA 4JDFA 1FW0A 3WAEA 1B58A 1SYHA 1NH8A 3V8XB 2Y7IA 3RTWB 4E0WA 4GD5A 3K1NA 2GRVA 4OEUA 1ELJA 1QVSA 1NMUA 1MQDA 3K2DA 2QPQA 3IB0A 3K02A 1MDQA 3LSXA 4NF5B 3P7IA 1NKXA 1Y1MA 4WKMA 4DDDA 1XS5A 3V89B 4NEDA 3CFXA 3O66A 5H8HA 2H98A 2FA7A 1Y20A 2YJPA 3CSGA 5CRYA 4POXA 2NWJA 5ICTA 3TEPA 1USYH 4ZZAA 2D21A 4MLQA 2F78A 3CI8A 4IGTA 1TXFA 1MPCA 1MQJA 1SW2A 3VXBA 4F1YA 4NF8A 2PT1A 5KCJB 1H3DA 5AA3A 3MZ1A 5TU0A 1B1XA 3E4RA 2Q89A 3MAMA 1VFEA 4IO7A 3MVYA 3BBRA 1VSOA 1LBBA 3Q29A 5F7VA 2Q8JA 1D9VA 2QSXA 3OELA 2I0CA 4YKJA 2ZYOA 3U1OA 2REGA 4IO4A 2FNCA 3CG1A 2ZYMA 1BLFA 1GVCA 1MXZA 3H06B 2DWAA 4MLVA 4WEPA 1UTBB 2DYXA 3EPEA 1DSNA 4AB5A 4QHQA 3TTNA 3USDA 2NVUB 1Y9UA 3C34A 4EQ9A 1MXVA 3UK4A 5BWJA 2O6AA 2F6PA 1JW1A 3OD7A 5CMKA 4QFKA 4HS7A 1B3LA 1WDNA 2HQ0A 2GHAA 3QAXA 1WVJA 5ITPA 4Q5TA 4LZ5A 4GXAA 2B3BA 4YU0A 5J1DA 3PMWA 3IK6B 5I57A 3FZVA 5KDTB 4LUBA 3KEIA 1PB8A 2QJEA 3RUMA 1AOVA 1HSLA 1WODA 2I4BA 2O51A 2DOJA 2O69A 3AXFA 5DVFA 3BFTA 3PUXE 2OWSA 3C31A 1JQFA 1QJMA 5I56A 2AYSA 2IEEA 2I3VA 5AA2D 4H0WA 1LGBC 1FQEA 3T9UA 1BP5A 4ISUA 5FTIA 2Q2CA 1B9JA 2I49A 1M5EA 4RY1A 2XXXA 4MBPA 4F18A 3PGFA 1L5TA 2H99A 5H8NA 1F9BA 4GF8A 3PD9A 1P1WA 1MM6A 4EQBA 4RJZA 1QUKA 5ICQA 3OMBA 1N84A 2F35A 2DSFA 4PFYA 5B70A 5I58B 2G93A 4KFQA 2ZXTA 1I6BA 2HXWA 2I58A 2R9JA 5TPAB 3SESA 1O63A 1B5HA 3THIA 1B1HA 2OJTA 2F7BA 2QRYA 3IB2A 1URSA 3KG2A 3IOWA 3PMVA 3FXQA 4PETA 1B5JA 3TPAA 2FYIA 4F3GA 2GHBA 1LCFA 1BTJA 4GRKA 4U4XA 4LP2B 1JW5A 3TCFA 3PU5A 1JW4A 2H5YA 3O9PA 1Q35A 1NNKA 4Q0CA 3SERA 3FXRA 3K1MA 2AL4A 3KGCA 1NH7A 3K6UA 1J1NA 5DT6A 4NF6A 1QULA 2XXIA 3TTMA 1H43A 4KPTA 2QS3A 4FJPA 2XX7A 4R2BA 1UIUA 4BLAA 2I0BA 2B3FA 1FQDA 4LATA 4GFRA 4LQ2A 4FIMA 2ZYKA 5DTBA 1POTA 4H5GA 1A8EA 2I48A 5AA2B 1FTOA 1USYE 4QFNA 3W15C 2RCAA 1XT8A 1FQAA 3TDJA 2HZLA 4LA9A 4BDOA 4EXLA 1SW1A 2XX9A 4R9FA 3DP6A 3EN3A 2A5TA 1CE2A 4DCYA 1ZBMA 5CBSA 2R71A 4GVOA 4F39A 1JVXA 4IY6A 3S9EA 2X7PA 3WAFA 1QKBA 2H9BA 1XOCA 1FQBA 5I2KA 2PMSA 1B6HA 1I6AA 4DXUA 1UTHA 4NWDA 2O7IA 4DIGA 3U92A 2I3WA 2NOOA 2ZNTA 1VR5A 1Y3PA 3FV2A 3SKPA 1Z7ME 2F5XA 3HN0A 3RT8A 4R6YA 1B2HA 1I6QA 1URGA 3BFUA 3CVGA 3MVWA 4IO3A 3O28A 5FHMA 3FATA 3PD8A 3CR9A 3RY3A 3MVZA 2XD3A 4XKNA 1FTJA 1OQGA 2Z8DA 3DP8A 3DP4A 4O3AA 2WKYA 1B4ZA 3RLFE 3SEYA 3IAZA 2HFBA 2F7AA 3K6XA 5I59B 1LFHA 3IJXB 5EHMA 1SD3A 3IL1B 3I3VA 4MF3A 3TTRA 4DXCA 3UN6A 4JXIA 3K1PA 3R6UA 4M4GA 1A8FA 3T93B 4QSDA 3IJOB 1S7YA 5AA1A 4UACA 3GXAA 4DCXA 2VD2A 2P2AA 4JB7A 1SQYA 3IOUA 4BDNA 3E9XA 2XXPA 4RNSA 4H67A 4HCWA 3N26A 4XKPA 1N76A 1B7ZA 1JEVA 3RNNA 1XVXA 3H6UA 1ZKBA 1SI1A 3IO4A 1UIVA 3KJ7A 3Q26A 3K00A 4KQPA 1DOTA 1EZ9A 2RF1A 5L8DA 1LAGE 4PFTA 4Z0IA 5FHNA 1MXWA 3CRBA 4LQ5A 4OFOA 2VHAA 2X7QA 3R26A 2V93A 4GL0A 1D4NA 2F34A 4U1OA 4GXSB 1IZ1A 1SVXB 3LSWA 3GZGA 1B3FA 1IEJA 5HPQA 1O64A 1VE4A 2VP1A 4ZDMA 3QXMA 1MXYA 4EUOA 3GLBA 2OZZA 5JK4A 2Z8EA 3QYTA 1NL5A 1SYIA 3ODBA 3OO7A 5AE4A 3R7XA 4BDRA 2NXOA 4QF9A 1HSJA 3VLVA 3PUVE 2KLFA 5BUUA 1IQ7A 5EYFA 4OYVA 1MY3A 2R6GE 1B3GA 4N13A 4JWYA 1US4A 3D4GA 3B6WA 4P0IA 4YKPA 5ELVA 3S9MC 1NNFA 3FD3A 4O3BA 3O6HA 3M8UA 4BDQA 2Q88A 2D3IA 4EQ7A 3M3LA 3O6GA 3TCGA 1ZJLA 4G68A 4LVQA 3K4UA 4MFIA 3RN8A 2F7CA 3VVEA 3E13X 4I9DA 4Z7EA 1PDAA 1B7HA 2DWJA 2O84X 4QSEA 1ZU0A 2O1MA 4ZECA 4ZEIA 4YB5A 4TOZA 2OK2A 3MVXA 2IA4A 3T22A 2XXQA 4F3BA 3HCQA 2DP8A 1OIBA 3O97A 1HSEA 2DE2A 4LONB 1N3XA 3K6WA 3MP6A 3RGYA 4F19A 3TCHA 4C1UA 3SEUA 3TFLA 3IOTA 3PUZE 3I5OA 2F6GA 3EHUA 4RPOA 1KWHA 1LAXA 3G3GA 4XTCQ 3TUSA 1MG1A 1LAHE 3B6QA 1XVYA 3N5LA 4NF5A 1LB8A 3FASA 1ZMGA 4HTGA 3PPPA 4ESXA 1N0TA 2X26A 1IITA 3DLNA 3H4ZA 2DXYA 2V3UA 2PX1A 5H8QB 1D9YA 1LCTA 3GBAA 2QMXA 3EQ1A 4KYSA 5M2VA 3HPIA 2VD3A 4OQOA 3HO7A 5F1QA 3LBSA 1B3HA 2I4CA 4TLMB 4Q30B 4ELQA 1AH5A 4QFPA 3CSBA 3TZAA 5DYHA 5AA4B 1P99A 5TP9A 3S2VA 3PMXA 2A5TB 5KCJA 3OEMA 2HAUA 4XKRA 1P1OA 5DEXA 3MQ9A 3QIMA 5I2NB 2RC8A 4F1VA 2DWHA 5DVIA 4GOTA 4ZE8A 1YTVA 4G8MA 4FEDA 4Q8RA 3FJMA 1B4HA 5B7DA 3PPRA 3T9HB 1UTHB 4JWOA 4IO5A 3G3HA 1VFDA 3V5AA 4NF4B 1MRPA 2M8CA 3ECRA 1UTBA 5EHSA 4KCDA 3MZ9A 1CB6A 3G3KA 2Z23A 3RTFB 2GH9A 4OMBA 4IGRA 1Y4CA 1LFIA 4YKKA 5CBRA 3LC8A 1SW5A 2D5WA 1N3WA 1P1NA 4G77A 1MPBA 3C35A 1JETA 5JEIA 4R74A 3M3KA 5KDTA 3JV9A 2REJA 4YZZA 5H8FB 4N6PA 4P0GA 4G2ZA 2Y7PA 4RPNA 3VLWA 4R75A 4H5FA 1BIYA 1N7WA 1PC3A 3O2AA 3C32A 1LLSA 4EF1A 1AIVA 1MXXA 3C9HA 3QSLA 4P11A 4H65A 3LUYA 2V3QA 5A5XB 2RKMA 1MY2A 1N04A 4C1TA 1OMPA 2O68A 4OTEA 5CMMA 1QUIA 3TMGA 3KBRA 4FE8A 4GIZA 3UIFA 2CZLA 3A09A 2O1LA 4G4PA 3H7MA 3SEXA 5I84A 1AMFA 3MWBA 4R73A 3G3JA 1I69A 4YAHX 5ISUA 4PFWA 2Y84A 3IR1A 3PV0E 2AL5A 4F22A 3TODA 1S9TA 3U72A 2OLBA 1OVBA 3CIJA 3W9VA 1FQFA 2XXYA 4OENA 3OOAA 2UXAA 2PT2A 1Z7NE 4U23A 3IOVA 1IXGA 5KZTA 3ZS6A 2RCBA 5TPAA 3H6TA 1MY1A 3VLUA 1M5CA 4IO2A 4F2OA 3ONMA 3ZKKA 1B46A 1ZLQA 2XXTA 1R1NA 2GFEA 1A54A 1MQGA 4YICA 3H3GA 5H8HB 4OETA 1EZPA 1R9QA 4KHZE 4YB7A 4ELPA 3V83A 3ILTB 1MY4A 1RKMA 1PBPA 3FVNA 1B0LA 3T9VA 4RK9A 3B7DA 4OVJA 1PB9A 2V25A 5IAIA 1FTLA 2DQVA 3OO8A 4ELRA 2UVIA 3FVKA 4NF8B 3CG3A 1OLAA 5DVJA 1B51A 3LSLA 4GQOA 1P1UA 3LSFB 1PB7A 4IB2A 1IXHA 4R6KA 3SEVA 2E1SA 1LBCA 5AA2A 4EDPA 3HHFA 5IKBA 3Q28A 3KSJA 2B65A 2O7UA 3D4CA 4YMAA 4GLIA 3H6VA 3U93A 2XXWA 3KFMA 4RA1A 1M5BA 1SBPA 1LAFE 1A99A 4YMBA 2VOZA 2DE3A 3OSQA 1FTKA 4JSDA 3PPNA 3JYRA 1MM7A 4GL8A 1Y4TA 3KJTA 4ELOA 1URDA 4NMYA 3JZJA 4X9TA 4F1UA 3A3CA 4DE8A 3PUWE 4G8HA 1QKAA 4THIA 1S50A 3KOTA 3N94A 3A3UA 3FVGA 4K3FA 2Z8FA 3MZBA 3FIRA 2Q9TA 4QRZA 3B6TA 5I57B 3T9XB 2UYEA 3SEWA 4IO6A 4NTLA 1OQHA 1N7XA 4KCCA 1B40A 1EZOA 2A5SA 4C0RA 4ECFA 4PE5B 2V3TA 4U1ZA 4F3PA 4WEDA 2YLNA 4RYAA 1NNTA 1MQHA 1SW4A 4FEBA 2QS2A 2DXRA 1SDXA 2LAOA 5I59A 3H03A 4QSCA 3FVOA 2OCUA 2AIXA 5LOMA 4XIGQ 4PP0A 3W9WA 5I56B 3K6VA 4OHNA 3C4MA 4FAJA 2RC9A 3KN3A 5CM6A 3Q25A 1XC1A 2ABHA 4HW8A 4OWDA 2ANJA 2E0SA 5TP9B 5H8NB 3HV1A 2XXRA 4AQ4A 1RYXA 3PUYE 2ZNUA 5FTHA 3VFJA 5FHOA 5HBCA 1B7UA 5DEXB 4MH5A 3PPQA 2H25A 3VE1B 1H76A 3KSXA 4I62A 2HAVA 3U8QA 2QS1A 4X48A 1JEUA 3T96B 1ATGA 5JTYA 3MPLA 4KR5A 1BKAA 4H8IA 1AL3A 3ZSFA 2Y7KA 2DVCA 2XXVA 3RPWA 1IXIA 1A55A 4DZ1A 1D3KA 3T66A 1H45A 1DPPA 3TTKA 3G3FA 3Q27A 1ANFA 1Y1ZA 3KN7A 3RT6B 1MY0A 4OZ9A 4FORA 4UA8A 3L6GA 4GWOA 3FUZA 4JSOA 1MH4A 1MXUA 1PEBA 1II5A 2XX8A 1LB9A 3IB1A 2UYFA 2QMWA 1SI0A 1DTZA 3MW0A 2OBGA 2ZNSA 3OXNA 4IY5A 3VDFA 4ND9A 2XHDA 1YCJA 2RINA 3F11A 3MBPA 2HCAA 1YAEA 3CFLA 4NF6B 4ESWA 4M1VA 2Y7WA 4X1DA 2VGQA 4I8CA 4LZ7A 1MQIA 4X1BA 4F29A 4DXBA 4R72A 1TFDA 4BDLA 3MPKA 4QFLA 3FJGA 3SDFA 5CC2A 5L9SA 1FTMA 1R9LA 4F3SA 4OFLA 2F36A 1OLCA 4QFOA 1RYOA 4L17A 3HSTA 3TAJA 2QL3A 5HM4B 1MDP1 3MP8A 1DTGA 1IUDA 1ZIUA 1JNFA 1Y3NA 2ONSA 1DPEA 4RXLA 1GTKA 1DMBA 4ZEDA 1T0KA 2PYYA 5I2KB 4OFJA 3LR1A 4ZEKA 4LZ8A 1XHYA 4FATA 3CFZA 3UA8A 1R6ZA 1JVYA 1NNPA 2I6EA 2UVHA 3O6IA 1ZTYA 3C33A 1IIWA 3M3FA 1EH3A 1QUJA 3TYHA 1PBQA 2DWIA 2UVJA 3FV1A 2P0SA 3N6TA 4KI0E 2RC7A 1B0HA 4OEVA 4RK2A 2NUVA 4G68C 4OESA 1EU8A 3TQWA 1POY1 3MJNA 3FGSA 3MP1A 3S4UA 4WXJA 1FQCA 3O29A 3TELA 1A40A 3VVDA 1MS7A 4U21A 5K2XA 2V84A 3RQTA 2XXHA 1UQWA 3OSRA 2ONRA 2W7YA 4U4SA 4FECA 4R9GA 4G8NA 4KYDA 4JBZA 3S9NC 4U22A 2PVUA 4EF2A 1Y3QA 3DM0A 3IO6A 4YKIA 1TWYA 3VXCA 4R6HA 4F31B 5CI5A 2YPNA 5H8QA 4DLDA 4N07A 3QUJA 3QUFA 3K01A 4H6DA 2DS9A 1O7TA 4XXUA 1YPNA 2Z22A 1US5A 4PFUA 3C36A 1TFAA 3KZGA 2BJJX 3MUQA 4HCYA 4E0XA 5L9MA 1GR2A 5AA4A 3TTLA 3QK6A 4POWA 1B05A 2ESNA 3OO6A 3TQLA 1IXCA 3U94A 2XXUA 4U2RA 4R2FA 2ZMBA 3BKIB 3K0VA 4BDMA 3VV5A 3KN8A 3SETA 3L6HA 3I6VA 3DELB 5I2NA 5I58A 2G29A 5CMBA 4ZZEA 3H6WA 5ITOA 2THIA 4H1XA 1NFTA 1A7LA 1P1QA 4NE4A 4NF4A 4PQJA 4YB6A 3G3IA 2QS4A 3ILUB 5CMCA 2CMOA 1B52A 1LFGA 3UORA 2F8DA 2HEUA 3UP9A 2HZKA 1MPDA 2XD2A 4ONYA 3E3KA 4ZEFA 1M5FA 4I1DA 5H8SA 3HHGA 3KOSA 1OVTA 4ZEBA 2ZYNA 1M5DA 2P1SA 3IORA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GGG A;  1QW0 A;  4F2Q A;  4ZS9 A;  4KYE A;  3OEN A;  1MH3 A;  2ONK E;  1B3E A;  3GBB A;  2F97 A;  2OWT A;  3EHT A;  2DE4 A;  2UVG A;  5H8F A;  1TT1 A;  3EHS A;  4OER A;  1H44 A;  4ZE9 A;  4NWC A;  3EF7 A;  3IX1 A;  4TLL B;  2PBW A;  3PPO A;  3OO9 A;  1FCK A;  4EXK A;  3MC2 A;  5A5X A;  4XKQ A;  2DVZ A;  4G68 B;  2H4I A;  4AB6 A;  3TKD A;  1LST A;  4KD5 A;  1B5I A;  4OXV A;  2ALU A;  4H8J A;  4JWX A;  4TQU Q;  2Y7R A;  2Q2A A;  1GV8 A;  3FJ7 A;  1B32 A;  3OEK A;  4O3C A;  5JTY B;  5K2Y A;  3S9L C;  3UGW A;  3FXU A;  3ZKL A;  5L9O A;  3G7W A;  1Q1K A;  3VVF A;  3N6U A;  4JDF A;  1FW0 A;  3WAE A;  1B58 A;  1SYH A;  1NH8 A;  3V8X B;  2Y7I A;  3RTW B;  4E0W A;  4GD5 A;  3K1N A;  2GRV A;  4OEU A;  1ELJ A;  1QVS A;  1NMU A;  1MQD A;  3K2D A;  2QPQ A;  3IB0 A;  3K02 A;  1MDQ A;  3LSX A;  4NF5 B;  3P7I A;  1NKX A;  1Y1M A;  4WKM A;  4DDD A;  1XS5 A;  3V89 B;  4NED A;  3CFX A;  3O66 A;  5H8H A;  2H98 A;  2FA7 A;  1Y20 A;  2YJP A;  3CSG A;  5CRY A;  4POX A;  2NWJ A;  5ICT A;  3TEP A;  1USY H;  4ZZA A;  2D21 A;  4MLQ A;  2F78 A;  3CI8 A;  4IGT A;  1TXF A;  1MPC A;  1MQJ A;  1SW2 A;  3VXB A;  4F1Y A;  4NF8 A;  2PT1 A;  5KCJ B;  1H3D A;  5AA3 A;  3MZ1 A;  5TU0 A;  1B1X A;  3E4R A;  2Q89 A;  3MAM A;  1VFE A;  4IO7 A;  3MVY A;  3BBR A;  1VSO A;  1LBB A;  3Q29 A;  5F7V A;  2Q8J A;  1D9V A;  2QSX A;  3OEL A;  2I0C A;  4YKJ A;  2ZYO A;  3U1O A;  2REG A;  4IO4 A;  2FNC A;  3CG1 A;  2ZYM A;  1BLF A;  1GVC A;  1MXZ A;  3H06 B;  2DWA A;  4MLV A;  4WEP A;  1UTB B;  2DYX A;  3EPE A;  1DSN A;  4AB5 A;  4QHQ A;  3TTN A;  3USD A;  2NVU B;  1Y9U A;  3C34 A;  4EQ9 A;  1MXV A;  3UK4 A;  5BWJ A;  2O6A A;  2F6P A;  1JW1 A;  3OD7 A;  5CMK A;  4QFK A;  4HS7 A;  1B3L A;  1WDN A;  2HQ0 A;  2GHA A;  3QAX A;  1WVJ A;  5ITP A;  4Q5T A;  4LZ5 A;  4GXA A;  2B3B A;  4YU0 A;  5J1D A;  3PMW A;  3IK6 B;  5I57 A;  3FZV A;  5KDT B;  4LUB A;  3KEI A;  1PB8 A;  2QJE A;  3RUM A;  1AOV A;  1HSL A;  1WOD A;  2I4B A;  2O51 A;  2DOJ A;  2O69 A;  3AXF A;  5DVF A;  3BFT A;  3PUX E;  2OWS A;  3C31 A;  1JQF A;  1QJM A;  5I56 A;  2AYS A;  2IEE A;  2I3V A;  5AA2 D;  4H0W A;  1LGB C;  1FQE A;  3T9U A;  1BP5 A;  4ISU A;  5FTI A;  2Q2C A;  1B9J A;  2I49 A;  1M5E A;  4RY1 A;  2XXX A;  4MBP A;  4F18 A;  3PGF A;  1L5T A;  2H99 A;  5H8N A;  1F9B A;  4GF8 A;  3PD9 A;  1P1W A;  1MM6 A;  4EQB A;  4RJZ A;  1QUK A;  5ICQ A;  3OMB A;  1N84 A;  2F35 A;  2DSF A;  4PFY A;  5B70 A;  5I58 B;  2G93 A;  4KFQ A;  2ZXT A;  1I6B A;  2HXW A;  2I58 A;  2R9J A;  5TPA B;  3SES A;  1O63 A;  1B5H A;  3THI A;  1B1H A;  2OJT A;  2F7B A;  2QRY A;  3IB2 A;  1URS A;  3KG2 A;  3IOW A;  3PMV A;  3FXQ A;  4PET A;  1B5J A;  3TPA A;  2FYI A;  4F3G A;  2GHB A;  1LCF A;  1BTJ A;  4GRK A;  4U4X A;  4LP2 B;  1JW5 A;  3TCF A;  3PU5 A;  1JW4 A;  2H5Y A;  3O9P A;  1Q35 A;  1NNK A;  4Q0C A;  3SER A;  3FXR A;  3K1M A;  2AL4 A;  3KGC A;  1NH7 A;  3K6U A;  1J1N A;  5DT6 A;  4NF6 A;  1QUL A;  2XXI A;  3TTM A;  1H43 A;  4KPT A;  2QS3 A;  4FJP A;  2XX7 A;  4R2B A;  1UIU A;  4BLA A;  2I0B A;  2B3F A;  1FQD A;  4LAT A;  4GFR A;  4LQ2 A;  4FIM A;  2ZYK A;  5DTB A;  1POT A;  4H5G A;  1A8E A;  2I48 A;  5AA2 B;  1FTO A;  1USY E;  4QFN A;  3W15 C;  2RCA A;  1XT8 A;  1FQA A;  3TDJ A;  2HZL A;  4LA9 A;  4BDO A;  4EXL A;  1SW1 A;  2XX9 A;  4R9F A;  3DP6 A;  3EN3 A;  2A5T A;  1CE2 A;  4DCY A;  1ZBM A;  5CBS A;  2R71 A;  4GVO A;  4F39 A;  1JVX A;  4IY6 A;  3S9E A;  2X7P A;  3WAF A;  1QKB A;  2H9B A;  1XOC A;  1FQB A;  5I2K A;  2PMS A;  1B6H A;  1I6A A;  4DXU A;  1UTH A;  4NWD A;  2O7I A;  4DIG A;  3U92 A;  2I3W A;  2NOO A;  2ZNT A;  1VR5 A;  1Y3P A;  3FV2 A;  3SKP A;  1Z7M E;  2F5X A;  3HN0 A;  3RT8 A;  4R6Y A;  1B2H A;  1I6Q A;  1URG A;  3BFU A;  3CVG A;  3MVW A;  4IO3 A;  3O28 A;  5FHM A;  3FAT A;  3PD8 A;  3CR9 A;  3RY3 A;  3MVZ A;  2XD3 A;  4XKN A;  1FTJ A;  1OQG A;  2Z8D A;  3DP8 A;  3DP4 A;  4O3A A;  2WKY A;  1B4Z A;  3RLF E;  3SEY A;  3IAZ A;  2HFB A;  2F7A A;  3K6X A;  5I59 B;  1LFH A;  3IJX B;  5EHM A;  1SD3 A;  3IL1 B;  3I3V A;  4MF3 A;  3TTR A;  4DXC A;  3UN6 A;  4JXI A;  3K1P A;  3R6U A;  4M4G A;  1A8F A;  3T93 B;  4QSD A;  3IJO B;  1S7Y A;  5AA1 A;  4UAC A;  3GXA A;  4DCX A;  2VD2 A;  2P2A A;  4JB7 A;  1SQY A;  3IOU A;  4BDN A;  3E9X A;  2XXP A;  4RNS A;  4H67 A;  4HCW A;  3N26 A;  4XKP A;  1N76 A;  1B7Z A;  1JEV A;  3RNN A;  1XVX A;  3H6U A;  1ZKB A;  1SI1 A;  3IO4 A;  1UIV A;  3KJ7 A;  3Q26 A;  3K00 A;  4KQP A;  1DOT A;  1EZ9 A;  2RF1 A;  5L8D A;  1LAG E;  4PFT A;  4Z0I A;  5FHN A;  1MXW A;  3CRB A;  4LQ5 A;  4OFO A;  2VHA A;  2X7Q A;  3R26 A;  2V93 A;  4GL0 A;  1D4N A;  2F34 A;  4U1O A;  4GXS B;  1IZ1 A;  1SVX B;  3LSW A;  3GZG A;  1B3F A;  1IEJ A;  5HPQ A;  1O64 A;  1VE4 A;  2VP1 A;  4ZDM A;  3QXM A;  1MXY A;  4EUO A;  3GLB A;  2OZZ A;  5JK4 A;  2Z8E A;  3QYT A;  1NL5 A;  1SYI A;  3ODB A;  3OO7 A;  5AE4 A;  3R7X A;  4BDR A;  2NXO A;  4QF9 A;  1HSJ A;  3VLV A;  3PUV E;  2KLF A;  5BUU A;  1IQ7 A;  5EYF A;  4OYV A;  1MY3 A;  2R6G E;  1B3G A;  4N13 A;  4JWY A;  1US4 A;  3D4G A;  3B6W A;  4P0I A;  4YKP A;  5ELV A;  3S9M C;  1NNF A;  3FD3 A;  4O3B A;  3O6H A;  3M8U A;  4BDQ A;  2Q88 A;  2D3I A;  4EQ7 A;  3M3L A;  3O6G A;  3TCG A;  1ZJL A;  4G68 A;  4LVQ A;  3K4U A;  4MFI A;  3RN8 A;  2F7C A;  3VVE A;  3E13 X;  4I9D A;  4Z7E A;  1PDA A;  1B7H A;  2DWJ A;  2O84 X;  4QSE A;  1ZU0 A;  2O1M A;  4ZEC A;  4ZEI A;  4YB5 A;  4TOZ A;  2OK2 A;  3MVX A;  2IA4 A;  3T22 A;  2XXQ A;  4F3B A;  3HCQ A;  2DP8 A;  1OIB A;  3O97 A;  1HSE A;  2DE2 A;  4LON B;  1N3X A;  3K6W A;  3MP6 A;  3RGY A;  4F19 A;  3TCH A;  4C1U A;  3SEU A;  3TFL A;  3IOT A;  3PUZ E;  3I5O A;  2F6G A;  3EHU A;  4RPO A;  1KWH A;  1LAX A;  3G3G A;  4XTC Q;  3TUS A;  1MG1 A;  1LAH E;  3B6Q A;  1XVY A;  3N5L A;  4NF5 A;  1LB8 A;  3FAS A;  1ZMG A;  4HTG A;  3PPP A;  4ESX A;  1N0T A;  2X26 A;  1IIT A;  3DLN A;  3H4Z A;  2DXY A;  2V3U A;  2PX1 A;  5H8Q B;  1D9Y A;  1LCT A;  3GBA A;  2QMX A;  3EQ1 A;  4KYS A;  5M2V A;  3HPI A;  2VD3 A;  4OQO A;  3HO7 A;  5F1Q A;  3LBS A;  1B3H A;  2I4C A;  4TLM B;  4Q30 B;  4ELQ A;  1AH5 A;  4QFP A;  3CSB A;  3TZA A;  5DYH A;  5AA4 B;  1P99 A;  5TP9 A;  3S2V A;  3PMX A;  2A5T B;  5KCJ A;  3OEM A;  2HAU A;  4XKR A;  1P1O A;  5DEX A;  3MQ9 A;  3QIM A;  5I2N B;  2RC8 A;  4F1V A;  2DWH A;  5DVI A;  4GOT A;  4ZE8 A;  1YTV A;  4G8M A;  4FED A;  4Q8R A;  3FJM A;  1B4H A;  5B7D A;  3PPR A;  3T9H B;  1UTH B;  4JWO A;  4IO5 A;  3G3H A;  1VFD A;  3V5A A;  4NF4 B;  1MRP A;  2M8C A;  3ECR A;  1UTB A;  5EHS A;  4KCD A;  3MZ9 A;  1CB6 A;  3G3K A;  2Z23 A;  3RTF B;  2GH9 A;  4OMB A;  4IGR A;  1Y4C A;  1LFI A;  4YKK A;  5CBR A;  3LC8 A;  1SW5 A;  2D5W A;  1N3W A;  1P1N A;  4G77 A;  1MPB A;  3C35 A;  1JET A;  5JEI A;  4R74 A;  3M3K A;  5KDT A;  3JV9 A;  2REJ A;  4YZZ A;  5H8F B;  4N6P A;  4P0G A;  4G2Z A;  2Y7P A;  4RPN A;  3VLW A;  4R75 A;  4H5F A;  1BIY A;  1N7W A;  1PC3 A;  3O2A A;  3C32 A;  1LLS A;  4EF1 A;  1AIV A;  1MXX A;  3C9H A;  3QSL A;  4P11 A;  4H65 A;  3LUY A;  2V3Q A;  5A5X B;  2RKM A;  1MY2 A;  1N04 A;  4C1T A;  1OMP A;  2O68 A;  4OTE A;  5CMM A;  1QUI A;  3TMG A;  3KBR A;  4FE8 A;  4GIZ A;  3UIF A;  2CZL A;  3A09 A;  2O1L A;  4G4P A;  3H7M A;  3SEX A;  5I84 A;  1AMF A;  3MWB A;  4R73 A;  3G3J A;  1I69 A;  4YAH X;  5ISU A;  4PFW A;  2Y84 A;  3IR1 A;  3PV0 E;  2AL5 A;  4F22 A;  3TOD A;  1S9T A;  3U72 A;  2OLB A;  1OVB A;  3CIJ A;  3W9V A;  1FQF A;  2XXY A;  4OEN A;  3OOA A;  2UXA A;  2PT2 A;  1Z7N E;  4U23 A;  3IOV A;  1IXG A;  5KZT A;  3ZS6 A;  2RCB A;  5TPA A;  3H6T A;  1MY1 A;  3VLU A;  1M5C A;  4IO2 A;  4F2O A;  3ONM A;  3ZKK A;  1B46 A;  1ZLQ A;  2XXT A;  1R1N A;  2GFE A;  1A54 A;  1MQG A;  4YIC A;  3H3G A;  5H8H B;  4OET A;  1EZP A;  1R9Q A;  4KHZ E;  4YB7 A;  4ELP A;  3V83 A;  3ILT B;  1MY4 A;  1RKM A;  1PBP A;  3FVN A;  1B0L A;  3T9V A;  4RK9 A;  3B7D A;  4OVJ A;  1PB9 A;  2V25 A;  5IAI A;  1FTL A;  2DQV A;  3OO8 A;  4ELR A;  2UVI A;  3FVK A;  4NF8 B;  3CG3 A;  1OLA A;  5DVJ A;  1B51 A;  3LSL A;  4GQO A;  1P1U A;  3LSF B;  1PB7 A;  4IB2 A;  1IXH A;  4R6K A;  3SEV A;  2E1S A;  1LBC A;  5AA2 A;  4EDP A;  3HHF A;  5IKB A;  3Q28 A;  3KSJ A;  2B65 A;  2O7U A;  3D4C A;  4YMA A;  4GLI A;  3H6V A;  3U93 A;  2XXW A;  3KFM A;  4RA1 A;  1M5B A;  1SBP A;  1LAF E;  1A99 A;  4YMB A;  2VOZ A;  2DE3 A;  3OSQ A;  1FTK A;  4JSD A;  3PPN A;  3JYR A;  1MM7 A;  4GL8 A;  1Y4T A;  3KJT A;  4ELO A;  1URD A;  4NMY A;  3JZJ A;  4X9T A;  4F1U A;  3A3C A;  4DE8 A;  3PUW E;  4G8H A;  1QKA A;  4THI A;  1S50 A;  3KOT A;  3N94 A;  3A3U A;  3FVG A;  4K3F A;  2Z8F A;  3MZB A;  3FIR A;  2Q9T A;  4QRZ A;  3B6T A;  5I57 B;  3T9X B;  2UYE A;  3SEW A;  4IO6 A;  4NTL A;  1OQH A;  1N7X A;  4KCC A;  1B40 A;  1EZO A;  2A5S A;  4C0R A;  4ECF A;  4PE5 B;  2V3T A;  4U1Z A;  4F3P A;  4WED A;  2YLN A;  4RYA A;  1NNT A;  1MQH A;  1SW4 A;  4FEB A;  2QS2 A;  2DXR A;  1SDX A;  2LAO A;  5I59 A;  3H03 A;  4QSC A;  3FVO A;  2OCU A;  2AIX A;  5LOM A;  4XIG Q;  4PP0 A;  3W9W A;  5I56 B;  3K6V A;  4OHN A;  3C4M A;  4FAJ A;  2RC9 A;  3KN3 A;  5CM6 A;  3Q25 A;  1XC1 A;  2ABH A;  4HW8 A;  4OWD A;  2ANJ A;  2E0S A;  5TP9 B;  5H8N B;  3HV1 A;  2XXR A;  4AQ4 A;  1RYX A;  3PUY E;  2ZNU A;  5FTH A;  3VFJ A;  5FHO A;  5HBC A;  1B7U A;  5DEX B;  4MH5 A;  3PPQ A;  2H25 A;  3VE1 B;  1H76 A;  3KSX A;  4I62 A;  2HAV A;  3U8Q A;  2QS1 A;  4X48 A;  1JEU A;  3T96 B;  1ATG A;  5JTY A;  3MPL A;  4KR5 A;  1BKA A;  4H8I A;  1AL3 A;  3ZSF A;  2Y7K A;  2DVC A;  2XXV A;  3RPW A;  1IXI A;  1A55 A;  4DZ1 A;  1D3K A;  3T66 A;  1H45 A;  1DPP A;  3TTK A;  3G3F A;  3Q27 A;  1ANF A;  1Y1Z A;  3KN7 A;  3RT6 B;  1MY0 A;  4OZ9 A;  4FOR A;  4UA8 A;  3L6G A;  4GWO A;  3FUZ A;  4JSO A;  1MH4 A;  1MXU A;  1PEB A;  1II5 A;  2XX8 A;  1LB9 A;  3IB1 A;  2UYF A;  2QMW A;  1SI0 A;  1DTZ A;  3MW0 A;  2OBG A;  2ZNS A;  3OXN A;  4IY5 A;  3VDF A;  4ND9 A;  2XHD A;  1YCJ A;  2RIN A;  3F11 A;  3MBP A;  2HCA A;  1YAE A;  3CFL A;  4NF6 B;  4ESW A;  4M1V A;  2Y7W A;  4X1D A;  2VGQ A;  4I8C A;  4LZ7 A;  1MQI A;  4X1B A;  4F29 A;  4DXB A;  4R72 A;  1TFD A;  4BDL A;  3MPK A;  4QFL A;  3FJG A;  3SDF A;  5CC2 A;  5L9S A;  1FTM A;  1R9L A;  4F3S A;  4OFL A;  2F36 A;  1OLC A;  4QFO A;  1RYO A;  4L17 A;  3HST A;  3TAJ A;  2QL3 A;  5HM4 B;  1MDP 1;  3MP8 A;  1DTG A;  1IUD A;  1ZIU A;  1JNF A;  1Y3N A;  2ONS A;  1DPE A;  4RXL A;  1GTK A;  1DMB A;  4ZED A;  1T0K A;  2PYY A;  5I2K B;  4OFJ A;  3LR1 A;  4ZEK A;  4LZ8 A;  1XHY A;  4FAT A;  3CFZ A;  3UA8 A;  1R6Z A;  1JVY A;  1NNP A;  2I6E A;  2UVH A;  3O6I A;  1ZTY A;  3C33 A;  1IIW A;  3M3F A;  1EH3 A;  1QUJ A;  3TYH A;  1PBQ A;  2DWI A;  2UVJ A;  3FV1 A;  2P0S A;  3N6T A;  4KI0 E;  2RC7 A;  1B0H A;  4OEV A;  4RK2 A;  2NUV A;  4G68 C;  4OES A;  1EU8 A;  3TQW A;  1POY 1;  3MJN A;  3FGS A;  3MP1 A;  3S4U A;  4WXJ A;  1FQC A;  3O29 A;  3TEL A;  1A40 A;  3VVD A;  1MS7 A;  4U21 A;  5K2X A;  2V84 A;  3RQT A;  2XXH A;  1UQW A;  3OSR A;  2ONR A;  2W7Y A;  4U4S A;  4FEC A;  4R9G A;  4G8N A;  4KYD A;  4JBZ A;  3S9N C;  4U22 A;  2PVU A;  4EF2 A;  1Y3Q A;  3DM0 A;  3IO6 A;  4YKI A;  1TWY A;  3VXC A;  4R6H A;  4F31 B;  5CI5 A;  2YPN A;  5H8Q A;  4DLD A;  4N07 A;  3QUJ A;  3QUF A;  3K01 A;  4H6D A;  2DS9 A;  1O7T A;  4XXU A;  1YPN A;  2Z22 A;  1US5 A;  4PFU A;  3C36 A;  1TFA A;  3KZG A;  2BJJ X;  3MUQ A;  4HCY A;  4E0X A;  5L9M A;  1GR2 A;  5AA4 A;  3TTL A;  3QK6 A;  4POW A;  1B05 A;  2ESN A;  3OO6 A;  3TQL A;  1IXC A;  3U94 A;  2XXU A;  4U2R A;  4R2F A;  2ZMB A;  3BKI B;  3K0V A;  4BDM A;  3VV5 A;  3KN8 A;  3SET A;  3L6H A;  3I6V A;  3DEL B;  5I2N A;  5I58 A;  2G29 A;  5CMB A;  4ZZE A;  3H6W A;  5ITO A;  2THI A;  4H1X A;  1NFT A;  1A7L A;  1P1Q A;  4NE4 A;  4NF4 A;  4PQJ A;  4YB6 A;  3G3I A;  2QS4 A;  3ILU B;  5CMC A;  2CMO A;  1B52 A;  1LFG A;  3UOR A;  2F8D A;  2HEU A;  3UP9 A;  2HZK A;  1MPD A;  2XD2 A;  4ONY A;  3E3K A;  4ZEF A;  1M5F A;  4I1D A;  5H8S A;  3HHG A;  3KOS A;  1OVT A;  4ZEB A;  2ZYN A;  1M5D A;  2P1S A;  3IOR A; 
#chains in the Genus database with same CATH topology
 1GGG A;  1QW0 A;  4F2Q A;  1LBX A;  4ZS9 A;  4KYE A;  3OEN A;  1MH3 A;  2ONK E;  1B3E A;  3GBB A;  2F97 A;  2OWT A;  3EHT A;  2DE4 A;  2UVG A;  5H8F A;  1TT1 A;  3EHS A;  1FBP A;  1AWB A;  4OER A;  4JVI A;  1H44 A;  4ZE9 A;  4NWC A;  3EF7 A;  3IX1 A;  4TLL B;  2PBW A;  3PPO A;  3OO9 A;  1FCK A;  4GWX A;  4GWZ A;  4EXK A;  3MC2 A;  5A5X A;  4XKQ A;  2DVZ A;  4G68 B;  2H4I A;  4AB6 A;  3TKD A;  2V4C A;  1LST A;  4HE0 A;  4KD5 A;  1B5I A;  4OXV A;  2ALU A;  2WYP A;  4H8J A;  1DBZ A;  4JWX A;  4TQU Q;  2WBD A;  2Y7R A;  4P1L A;  2Q2A A;  1GV8 A;  3FJ7 A;  1B32 A;  3OEK A;  4O3C A;  4MCO A;  5JTY B;  5K2Y A;  3S9L C;  3UGW A;  3FXU A;  3ZKL A;  5L9O A;  3RPL A;  3G7W A;  1Q1K A;  3VVF A;  3N6U A;  4JDF A;  1FW0 A;  3WAE A;  1B58 A;  2PFZ A;  1SYH A;  1NH8 A;  3V8X B;  2Y7I A;  3RTW B;  4E0W A;  4GD5 A;  5IZZ A;  3K1N A;  2GRV A;  4OEU A;  1ELJ A;  1QVS A;  3BIH A;  1NMU A;  1YYZ A;  1MQD A;  3K2D A;  2QPQ A;  3IB0 A;  3K02 A;  1MDQ A;  1FJ6 A;  3LSX A;  4NF5 B;  3P7I A;  1NKX A;  1Y1M A;  4NHB A;  4WKM A;  4DDD A;  1XS5 A;  1FPI A;  3V89 B;  4NED A;  3CFX A;  3O66 A;  5H8H A;  2H98 A;  2FA7 A;  1Y20 A;  3IFC A;  2YJP A;  3CSG A;  2FIE A;  5CRY A;  4POX A;  2NWJ A;  5ICT A;  1RDZ A;  3TEP A;  1USY H;  1KZ8 A;  4ZZA A;  2D21 A;  4MLQ A;  2F78 A;  3CI8 A;  4IGT A;  1TXF A;  5IM2 A;  1MPC A;  4GWU A;  1MQJ A;  4N8Y A;  1SW2 A;  3VXB A;  4F1Y A;  4DI4 B;  4NF8 A;  2PT1 A;  5KCJ B;  1H3D A;  5AA3 A;  1FPD A;  3MZ1 A;  5TU0 A;  1B1X A;  3E4R A;  2Q89 A;  3MAM A;  1VFE A;  4IO7 A;  3MVY A;  3BBR A;  1VSO A;  1LBB A;  3Q29 A;  5F7V A;  3NOH A;  2Q8J A;  1D9V A;  2QSX A;  3OEL A;  4I3E A;  2I0C A;  4YKJ A;  2ZYO A;  3U1O A;  5EQ7 A;  2REG A;  1FSA A;  4IO4 A;  2FNC A;  3CG1 A;  2ZYM A;  4HXV A;  1BLF A;  1GVC A;  1MXZ A;  3H06 B;  2DWA A;  4MLV A;  4WEP A;  1UTB B;  2DYX A;  3EPE A;  1DSN A;  2JJK A;  4AB5 A;  4QHQ A;  3TTN A;  3USD A;  2NVU B;  1Y9U A;  3C34 A;  4EQ9 A;  1MXV A;  3UK4 A;  5BWJ A;  2O6A A;  2F6P A;  5IZ3 B;  1JW1 A;  3OD7 A;  5CMK A;  4QFK A;  5IGA A;  4HS7 A;  1B3L A;  1WDN A;  2HQ0 A;  2GHA A;  3QAX A;  1WVJ A;  5ITP A;  4Q5T A;  4LZ5 A;  4GXA A;  2B3B A;  4YU0 A;  5J1D A;  3PMW A;  3IK6 B;  5I57 A;  2VPO A;  3FZV A;  5KDT B;  1EYI A;  4LUB A;  3KEI A;  1PB8 A;  2QJE A;  4IR8 A;  4PFR A;  3RUM A;  4N8G A;  1LBV A;  1AOV A;  1HSL A;  1WOD A;  2I4B A;  2O51 A;  4I40 A;  2DOJ A;  2O69 A;  3AXF A;  5DVF A;  3BFT A;  3PUX E;  2OWS A;  3C31 A;  5LDZ A;  1JQF A;  4FBP A;  1QJM A;  5I56 A;  2AYS A;  2IEE A;  2I3V A;  5AA2 D;  4H0W A;  1LGB C;  1FQE A;  3T9U A;  1BP5 A;  4ISU A;  5FTI A;  5EQ9 A;  2Q2C A;  3ISP A;  1B9J A;  2I49 A;  1M5E A;  4RY1 A;  2XXX A;  4MBP A;  4F18 A;  3PGF A;  1L5T A;  2H99 A;  5H8N A;  4PFI A;  4GF8 A;  1F9B A;  3PD9 A;  1P1W A;  1MM6 A;  4EQB A;  4RJZ A;  4PTK A;  1QUK A;  5ICQ A;  3OMB A;  1N84 A;  2F35 A;  2DSF A;  4PFY A;  1K9Y A;  5B70 A;  5I58 B;  2G93 A;  4KFQ A;  1NUX A;  2ZXT A;  1I6B A;  2HXW A;  2I58 A;  2R9J A;  4X8R A;  5TPA B;  3SES A;  1O63 A;  1B5H A;  1B1H A;  3THI A;  2OJT A;  2F7B A;  2QRY A;  1NV7 A;  4N81 A;  3IB2 A;  1URS A;  3KG2 A;  1NUY A;  3IOW A;  3PMV A;  3FXQ A;  4PET A;  3FXB A;  1B5J A;  3TPA A;  2FYI A;  4F3G A;  2GHB A;  1LCF A;  1BTJ A;  1FPJ A;  4GRK A;  4U4X A;  4LP2 B;  1JW5 A;  1XI6 A;  3TCF A;  4MX6 A;  3PU5 A;  1JW4 A;  2H5Y A;  3O9P A;  3RYD A;  1Q35 A;  1NNK A;  4Q0C A;  3SER A;  3FXR A;  3K1M A;  2AL4 A;  4NG7 A;  3KGC A;  1NH7 A;  3K6U A;  1J1N A;  5DT6 A;  4NF6 A;  1QUL A;  2XXI A;  3TTM A;  1H43 A;  4KPT A;  2QS3 A;  4FJP A;  2XX7 A;  4R2B A;  1UIU A;  4BLA A;  4P3L A;  2I0B A;  2B3F A;  3E78 A;  1FQD A;  4LAT A;  3U65 A;  4GFR A;  2WEF A;  4LQ2 A;  4FIM A;  2ZYK A;  4O7M A;  5DTB A;  1POT A;  4H5G A;  1A8E A;  2I48 A;  5AA2 B;  1FTO A;  1USY E;  4PBQ A;  4QFN A;  3W15 C;  2RCA A;  4PE3 A;  1XT8 A;  1FQA A;  3TDJ A;  2HZL A;  4PDD A;  4LA9 A;  4BDO A;  4EXL A;  1SW1 A;  2XX9 A;  4R9F A;  3DP6 A;  2B4M A;  3EN3 A;  2A5T A;  1CE2 A;  4DCY A;  1ZBM A;  1NV2 A;  3HFU A;  5CBS A;  2R71 A;  4GVO A;  4F39 A;  1JVX A;  4IY6 A;  3S9E A;  2X7P A;  3WAF A;  1QKB A;  2H9B A;  1XOC A;  1FQB A;  5I2K A;  2PMS A;  1B6H A;  1FPK A;  1I6A A;  4P56 A;  2OX3 A;  4UAB A;  1UTH A;  4NWD A;  4DXU A;  2O7I A;  4DIG A;  3U92 A;  2I3W A;  2NOO A;  2ZNT A;  1VR5 A;  1Y3P A;  3FV2 A;  3SKP A;  4N4U A;  4OVP A;  1Z7M E;  2F5X A;  3KBZ A;  3HN0 A;  3RT8 A;  4R6Y A;  1B2H A;  1I6Q A;  1URG A;  3BFU A;  3CVG A;  3MVW A;  4IO3 A;  3O28 A;  5FHM A;  3FAT A;  3PD8 A;  2QVV A;  2FHY A;  3CR9 A;  3RY3 A;  3MVZ A;  2XD3 A;  4PAK A;  4XKN A;  1FTJ A;  1OQG A;  2Z8D A;  3DP8 A;  3DP4 A;  4O3A A;  2WKY A;  3EKI A;  1B4Z A;  3RLF E;  3SEY A;  3IAZ A;  2HFB A;  2F7A A;  3K6X A;  5I59 B;  1LFH A;  3IJX B;  4PGP A;  5EHM A;  1SD3 A;  3IL1 B;  3I3V A;  4MF3 A;  1IMC A;  2HHM A;  3TTR A;  4DXC A;  3UN6 A;  4JXI A;  3MYU A;  1LEV A;  3K1P A;  3R6U A;  4M4G A;  1A8F A;  3T93 B;  4QSD A;  3IJO B;  1S7Y A;  2HXR A;  1FBG A;  5AA1 A;  4UAC A;  3GXA A;  4DCX A;  2VD2 A;  2P2A A;  4G61 A;  4JB7 A;  1SQY A;  3IOU A;  5EYH A;  4BDN A;  3E9X A;  2XXP A;  4N17 A;  4RNS A;  4H67 A;  4HCW A;  3N26 A;  4XKP A;  1N76 A;  1B7Z A;  1JEV A;  5I7I A;  3RNN A;  1XVX A;  3H6U A;  1ZKB A;  1SI1 A;  3IO4 A;  2XWV A;  1UIV A;  4PFB A;  3KJ7 A;  3Q26 A;  3K00 A;  4KQP A;  1DOT A;  1EZ9 A;  2RF1 A;  5L8D A;  2VPN A;  1LAG E;  4PFT A;  4Z0I A;  5FHN A;  5EYG A;  4KXP A;  4GBW A;  1MXW A;  4O7I A;  3CRB A;  4LQ5 A;  4OFO A;  2VHA A;  2X7Q A;  4AS4 A;  3R26 A;  2V93 A;  4GL0 A;  1D4N A;  2F34 A;  1YXI A;  3KC0 A;  4U1O A;  4GXS B;  1IZ1 A;  1SVX B;  3LSW A;  3GZG A;  1B3F A;  1IEJ A;  1VDW A;  5HPQ A;  1O64 A;  1VE4 A;  2L5V A;  2VP1 A;  4ZDM A;  3QXM A;  1MXY A;  4PGN A;  4EUO A;  3GLB A;  4NN3 A;  2OZZ A;  4P9K A;  5JK4 A;  2Z8E A;  3QYT A;  1NL5 A;  1G0H A;  1SYI A;  3ODB A;  3OO7 A;  5AE4 A;  3R7X A;  4BDR A;  2NXO A;  4QF9 A;  1HSJ A;  3VLV A;  3PUV E;  2KLF A;  1EYK A;  5BUU A;  1IQ7 A;  1FBC A;  3E79 A;  5EYF A;  4OYV A;  1MY3 A;  2R6G E;  1B3G A;  4N13 A;  4JWY A;  1US4 A;  3D4G A;  3B6W A;  4P0I A;  4YKP A;  5ELV A;  3S9M C;  1NNF A;  3FD3 A;  4O3B A;  3O6H A;  1IMA A;  3M8U A;  4BDQ A;  2Q88 A;  2D3I A;  1KA0 A;  4EQ7 A;  3M3L A;  3O6G A;  3TCG A;  1ZJL A;  4G68 A;  4LVQ A;  3K4U A;  4MFI A;  3RN8 A;  2F7C A;  3VVE A;  1FPF A;  2FIX A;  3E13 X;  4I9D A;  4Z7E A;  1PDA A;  1B7H A;  2DWJ A;  2O84 X;  4QSE A;  1ZU0 A;  2O1M A;  4ZEC A;  4ZEI A;  4YB5 A;  4TOZ A;  2OK2 A;  3MVX A;  2IA4 A;  3T22 A;  2XXQ A;  4F3B A;  3HCQ A;  2DP8 A;  1OIB A;  3O97 A;  1HSE A;  4GWW A;  2DE2 A;  4LON B;  4MHF A;  1N3X A;  4MJO A;  3K6W A;  3MP6 A;  3RGY A;  2F3D A;  4F19 A;  3TCH A;  4C1U A;  3SEU A;  3TFL A;  1FBE A;  3IOT A;  3PUZ E;  3B50 A;  4OVR A;  2KQZ A;  2QVR A;  3I5O A;  2F6G A;  3EHU A;  4RPO A;  1KWH A;  1LAX A;  3G3G A;  4XTC Q;  3TUS A;  1MG1 A;  1LAH E;  3B6Q A;  1XVY A;  3N5L A;  1G0I A;  4NF5 A;  1LB8 A;  4P1E A;  3FAS A;  2XXK A;  1ZMG A;  4HTG A;  3LV0 A;  2ZZX A;  3PPP A;  4ESX A;  1N0T A;  2X26 A;  1IIT A;  3DLN A;  3H4Z A;  2DXY A;  2V3U A;  4HE1 A;  2PX1 A;  4OVT A;  4P8B A;  5H8Q B;  1D9Y A;  1LCT A;  3GBA A;  2QMX A;  3EQ1 A;  4KYS A;  5M2V A;  3HPI A;  2VD3 A;  4OQO A;  3HO7 A;  5F1Q A;  4O94 A;  3LBS A;  1B3H A;  2I4C A;  4TLM B;  4Q30 B;  3BIG A;  4ELQ A;  1AH5 A;  4QFP A;  3CSB A;  3TZA A;  5DYH A;  4XF5 A;  5AA4 B;  1P99 A;  4N6K A;  5TP9 A;  2Q8M A;  3S2V A;  3PMX A;  2A5T B;  5KCJ A;  3OEM A;  2HAU A;  4XKR A;  1P1O A;  5DEX A;  3MQ9 A;  4I3Y A;  3QIM A;  5I2N B;  2RC8 A;  4F1V A;  1NV5 A;  2DWH A;  3B8B A;  4XEQ A;  5DVI A;  2CZI A;  1NUW A;  4GOT A;  2Q74 A;  4ZE8 A;  1YTV A;  4G8M A;  4FED A;  4Q8R A;  3FJM A;  1B4H A;  5B7D A;  3D1R A;  3PPR A;  3T9H B;  1UTH B;  4JWO A;  4IO5 A;  3G3H A;  1CNQ A;  1VFD A;  3V5A A;  4NF4 B;  2CEY A;  1MRP A;  2M8C A;  1NV1 A;  3ECR A;  1UTB A;  5EHS A;  4KCD A;  3MZ9 A;  1CB6 A;  3G3K A;  4PBH A;  2Z23 A;  3RTF B;  5IZ3 A;  2GH9 A;  2VT5 A;  4OMB A;  4IGR A;  1Y4C A;  1LFI A;  4YKK A;  4JVC A;  5CBR A;  1IMB A;  3LC8 A;  1SW5 A;  2D5W A;  1N3W A;  1P1N A;  4G77 A;  1MPB A;  3C35 A;  1JET A;  5JEI A;  4R74 A;  3M3K A;  5KDT A;  3JV9 A;  2REJ A;  4YZZ A;  1DCU A;  5H8F B;  4N6P A;  4P0G A;  4G2Z A;  2Y7P A;  4RPN A;  3VLW A;  4R75 A;  4H5F A;  1BIY A;  1N7W A;  1PC3 A;  3O2A A;  3C32 A;  3SZP A;  1LLS A;  4EF1 A;  1AIV A;  1MXX A;  3C9H A;  3QSL A;  4P11 A;  4H65 A;  3LUY A;  2V3Q A;  5EQA A;  5A5X B;  2RKM A;  1IMD A;  1FRP A;  1MY2 A;  1N04 A;  1FBD A;  4C1T A;  1OMP A;  2O68 A;  4OTE A;  5CMM A;  1QUI A;  3TMG A;  3KBR A;  4FE8 A;  4GIZ A;  3UIF A;  2CZL A;  3A09 A;  4GWS A;  2O1L A;  4G4P A;  1FBH A;  3H7M A;  3SEX A;  5I84 A;  1AMF A;  3MWB A;  4R73 A;  3G3J A;  1I69 A;  2CZK A;  3RPL B;  4YAH X;  5ISU A;  4PFW A;  4NGU A;  1NV0 A;  4MMP A;  2Y84 A;  3IR1 A;  4P47 A;  3PV0 E;  2AL5 A;  4NX1 A;  2F3B A;  4F22 A;  3TOD A;  1S9T A;  3U72 A;  2OLB A;  1OVB A;  3CIJ A;  3W9V A;  1FQF A;  2XXY A;  4OEN A;  3OOA A;  2UXA A;  2WBB A;  2PT2 A;  1Z7N E;  4U23 A;  3IOV A;  2ZZW A;  1IXG A;  2ZZV A;  5KZT A;  3T0J A;  3ZS6 A;  2RCB A;  5TPA A;  3H6T A;  1MY1 A;  3VLU A;  1M5C A;  4PC9 A;  4IO2 A;  4F2O A;  3ONM A;  3ZKK A;  1B46 A;  1ZLQ A;  2XXT A;  1R1N A;  2GFE A;  1A54 A;  1MQG A;  4YIC A;  4DI3 D;  3H3G A;  2XA5 A;  5H8H B;  4OET A;  1EZP A;  1R9Q A;  3FBP A;  4KHZ E;  4YB7 A;  4ELP A;  4GX4 A;  5J16 A;  2B4L A;  3V83 A;  3ILT B;  1MY4 A;  2Y5K A;  1RKM A;  1PBP A;  3FVN A;  1B0L A;  3T9V A;  1RDX A;  4RK9 A;  1EYJ A;  3B7D A;  4OVJ A;  1PB9 A;  1YZ0 A;  2V25 A;  5IAI A;  2P3V A;  1FTL A;  2DQV A;  4N6D A;  5FBP A;  3OO8 A;  4ELR A;  2UVI A;  3FVK A;  4NF8 B;  3PTY A;  3CG3 A;  1OLA A;  5DVJ A;  1B51 A;  3LSL A;  4GQO A;  1P1U A;  3LSF B;  1PB7 A;  4IB2 A;  4X04 A;  1IXH A;  4R6K A;  3SEV A;  2E1S A;  4MNI A;  1LBC A;  5ET7 A;  2FVZ A;  5AA2 A;  4EDP A;  3HHF A;  5IKB A;  3Q28 A;  3KSJ A;  3QMF A;  2B65 A;  2O7U A;  3D4C A;  4YMA A;  4GLI A;  2Y5L A;  3H6V A;  3U93 A;  2XXW A;  3KFM A;  4RA1 A;  4OVS A;  1M5B A;  1SBP A;  1LAF E;  1LBZ A;  1A99 A;  2XWI A;  4YMB A;  1D9Q A;  2VOZ A;  1SPI A;  2DE3 A;  3OSQ A;  1FTK A;  1QGX A;  4JSD A;  3PPN A;  4MNP A;  2FBP A;  3JYR A;  1MM7 A;  4GL8 A;  1Y4T A;  3KJT A;  4ELO A;  1URD A;  4NMY A;  3JZJ A;  4PF8 A;  4X9T A;  4PDH A;  3A3C A;  4F1U A;  4PAI A;  4DE8 A;  3PUW E;  4G8H A;  1QKA A;  4THI A;  4MNC A;  5EQ8 A;  1S50 A;  3KOT A;  3N94 A;  3A3U A;  3FVG A;  4K3F A;  2Z8F A;  3MZB A;  3FIR A;  2Q9T A;  4QRZ A;  3B6T A;  5I57 B;  3T9X B;  2UYE A;  3SEW A;  4IO6 A;  4NTL A;  1OQH A;  1N7X A;  4KCC A;  1B40 A;  1EZO A;  2A5S A;  4NF0 A;  4C0R A;  1RDY A;  4ECF A;  1FPL A;  4PE5 B;  2V3T A;  4U1Z A;  4F3P A;  1IMF A;  4WED A;  2YLN A;  4RYA A;  1NNT A;  1MQH A;  1SW4 A;  4FEB A;  2QS2 A;  2DXR A;  1SDX A;  2LAO A;  5I59 A;  1IME A;  3H03 A;  4QSC A;  3FVO A;  2OCU A;  4GWY A;  2AIX A;  5LOM A;  4XIG Q;  4PP0 A;  3W9W A;  5I56 B;  3K6V A;  4OHN A;  3C4M A;  4FAJ A;  2RC9 A;  1LBY A;  3KC1 A;  3KN3 A;  4NAP A;  5CM6 A;  2MKZ A;  4PAF A;  3Q25 A;  1XC1 A;  2ABH A;  4HW8 A;  4OWD A;  2QFL A;  2ANJ A;  2E0S A;  2OWZ A;  5TP9 B;  5H8N B;  3HV1 A;  2XXR A;  4AQ4 A;  1LBW A;  3MST A;  5ET6 A;  1RYX A;  3PUY E;  2ZNU A;  5FTH A;  3VFJ A;  5FHO A;  5HBC A;  1B7U A;  5DEX B;  4MH5 A;  3PPQ A;  1JP4 A;  2H25 A;  4MAG A;  3VE1 B;  1H76 A;  3KSX A;  4I62 A;  2HAV A;  3U8Q A;  2QS1 A;  4X48 A;  2XWK A;  1JEU A;  3T96 B;  2WYK A;  1ATG A;  5JTY A;  3MPL A;  4HE2 A;  4KR5 A;  2CEX A;  1BKA A;  4H8I A;  1AL3 A;  3ZSF A;  2Y7K A;  2DVC A;  2XXV A;  5IZ1 A;  2P3N A;  3RPW A;  1FBF A;  1IXI A;  1A55 A;  5ET5 A;  4DZ1 A;  2QVU A;  1D3K A;  3T66 A;  1H45 A;  1DPP A;  3TTK A;  3G3F A;  1BK4 A;  3Q27 A;  1ANF A;  1Y1Z A;  3KN7 A;  3RT6 B;  1MY0 A;  4GX3 A;  4FOR A;  4OZ9 A;  1INP A;  5T3J A;  4UA8 A;  3L6G A;  4GWO A;  3FUZ A;  2WX9 A;  4JSO A;  1MH4 A;  1MXU A;  1PEB A;  1II5 A;  2XX8 A;  1LB9 A;  3IB1 A;  2UYF A;  2QMW A;  1SI0 A;  1DTZ A;  3MW0 A;  2OBG A;  2ZNS A;  3OXN A;  4IY5 A;  3VDF A;  4ND9 A;  4N91 A;  2XHD A;  1YCJ A;  2RIN A;  3F11 A;  3MBP A;  2HCA A;  1FTA A;  1YAE A;  2CZH A;  3CFL A;  4NF6 B;  4ESW A;  4M1V A;  2Y7W A;  4X1D A;  2VGQ A;  4I8C A;  4LZ7 A;  4MEV A;  1FPB A;  1MQI A;  4X1B A;  4F29 A;  4DXB A;  2KR0 A;  4R72 A;  4GBV A;  1TFD A;  5A5L A;  4BDL A;  1FPG A;  3MPK A;  4H46 A;  4QFL A;  3FJG A;  3SDF A;  5CC2 A;  5DW8 A;  2XWO A;  5L9S A;  1FTM A;  1R9L A;  4F3S A;  4OFL A;  2F36 A;  1OLC A;  4QFO A;  1RYO A;  4L17 A;  3HST A;  3TAJ A;  2QL3 A;  5HM4 B;  1MDP 1;  3MP8 A;  1DTG A;  1IUD A;  1ZIU A;  1JNF A;  1KA1 A;  1Y3N A;  2ONS A;  1DPE A;  4RXL A;  1GTK A;  1DMB A;  4ZED A;  1T0K A;  2PYY A;  5I2K B;  5ET8 A;  4OFJ A;  3LR1 A;  4ZEK A;  4LZ8 A;  1XHY A;  4FAT A;  3CFZ A;  3UA8 A;  1R6Z A;  1Q9D A;  1JVY A;  1NNP A;  2I6E A;  2UVH A;  3O6I A;  4OA4 A;  1FJ9 A;  1ZTY A;  3C33 A;  1IIW A;  3M3F A;  1EH3 A;  1QUJ A;  3TYH A;  1PBQ A;  2DWI A;  4JVD A;  2UVJ A;  3FV1 A;  2P0S A;  3N6T A;  4KI0 E;  2RC7 A;  1B0H A;  4OEV A;  4RK2 A;  2NUV A;  4G68 C;  4O8M A;  4OES A;  4H45 A;  1EU8 A;  3TQW A;  1POY 1;  4PCD A;  3MJN A;  3FGS A;  3MP1 A;  3S4U A;  4WXJ A;  1FQC A;  3O29 A;  3TEL A;  1A40 A;  3VVD A;  1MS7 A;  4U21 A;  5K2X A;  2V84 A;  3RQT A;  2PCR A;  2XXH A;  1FPE A;  1UQW A;  3OSR A;  2ONR A;  2W7Y A;  4U4S A;  4FEC A;  4GX6 A;  4R9G A;  4G8N A;  4KYD A;  4JBZ A;  3S9N C;  4OVQ A;  4NQ8 A;  4U22 A;  2PVU A;  1NV6 A;  5I5P A;  4EF2 A;  1Y3Q A;  3DM0 A;  2R8T A;  3IO6 A;  4YKI A;  1TWY A;  3VXC A;  4R6H A;  2DDK A;  5LTC A;  4F31 B;  5CI5 A;  4N15 A;  2YPN A;  5H8Q A;  4DLD A;  5F24 A;  4N07 A;  3QUJ A;  3QUF A;  3K01 A;  4H6D A;  2DS9 A;  1O7T A;  4XXU A;  3A29 A;  3LUZ A;  1YPN A;  2PFY A;  4QXD A;  2Z22 A;  3GYY A;  1US5 A;  1NV3 A;  4PFU A;  3C36 A;  1TFA A;  3KZG A;  2BJJ X;  3MUQ A;  4HCY A;  4E0X A;  5L9M A;  1GR2 A;  1K9Z A;  5AA4 A;  3TTL A;  3QK6 A;  4POW A;  4MIJ A;  1B05 A;  2ESN A;  3OO6 A;  3TQL A;  1IXC A;  3ROJ A;  3U94 A;  2XXU A;  4U2R A;  4R2F A;  2ZMB A;  4PF6 A;  2BJI A;  3BKI B;  3K0V A;  4BDM A;  3VV5 A;  3KN8 A;  3SET A;  3L6H A;  3I6V A;  3DEL B;  5I2N A;  5I58 A;  2G29 A;  3T1B A;  5CMB A;  2HPG A;  4ZZE A;  3H6W A;  2THI A;  5ITO A;  4LN5 A;  4H1X A;  1DK4 A;  4QBA A;  1NFT A;  1A7L A;  1P1Q A;  4NE4 A;  5I3S A;  4PQJ A;  4NF4 A;  4XFE A;  4AS5 A;  4YB6 A;  3G3I A;  2QS4 A;  3ILU B;  5CMC A;  2CMO A;  2GQ1 A;  3IFA A;  1B52 A;  1NUZ A;  1LFG A;  3UOR A;  4OAN A;  2F8D A;  2HEU A;  3UP9 A;  2HZK A;  5ESY A;  1NV4 A;  1MPD A;  2XD2 A;  4ONY A;  3E3K A;  4ZEF A;  1M5F A;  1NI9 A;  4I1D A;  5H8S A;  3HHG A;  3KOS A;  1OVT A;  4ZEB A;  2ZYN A;  1M5D A;  2P1S A;  3CHG A;  3IOR A; 
#chains in the Genus database with same CATH homology
 1GGG A;  1QW0 A;  4F2Q A;  4ZS9 A;  4KYE A;  3OEN A;  1MH3 A;  2ONK E;  1B3E A;  3GBB A;  2F97 A;  2OWT A;  3EHT A;  2DE4 A;  2UVG A;  5H8F A;  1TT1 A;  3EHS A;  4OER A;  1H44 A;  4ZE9 A;  4NWC A;  3EF7 A;  3IX1 A;  4TLL B;  2PBW A;  3PPO A;  3OO9 A;  1FCK A;  4EXK A;  3MC2 A;  5A5X A;  4XKQ A;  2DVZ A;  4G68 B;  2H4I A;  4AB6 A;  3TKD A;  1LST A;  4KD5 A;  1B5I A;  4OXV A;  2ALU A;  4H8J A;  4JWX A;  4TQU Q;  2Y7R A;  2Q2A A;  1GV8 A;  3FJ7 A;  1B32 A;  3OEK A;  4O3C A;  5JTY B;  5K2Y A;  3S9L C;  3UGW A;  3FXU A;  3ZKL A;  5L9O A;  3G7W A;  1Q1K A;  3VVF A;  3N6U A;  4JDF A;  1FW0 A;  3WAE A;  1B58 A;  1SYH A;  1NH8 A;  3V8X B;  2Y7I A;  3RTW B;  4E0W A;  4GD5 A;  3K1N A;  2GRV A;  4OEU A;  1ELJ A;  1QVS A;  1NMU A;  1MQD A;  3K2D A;  2QPQ A;  3IB0 A;  3K02 A;  1MDQ A;  3LSX A;  4NF5 B;  3P7I A;  1NKX A;  1Y1M A;  4WKM A;  4DDD A;  1XS5 A;  3V89 B;  4NED A;  3CFX A;  3O66 A;  5H8H A;  2H98 A;  2FA7 A;  1Y20 A;  2YJP A;  3CSG A;  5CRY A;  4POX A;  2NWJ A;  5ICT A;  3TEP A;  1USY H;  4ZZA A;  2D21 A;  4MLQ A;  2F78 A;  3CI8 A;  4IGT A;  1TXF A;  1MPC A;  1MQJ A;  1SW2 A;  3VXB A;  4F1Y A;  4NF8 A;  2PT1 A;  5KCJ B;  1H3D A;  5AA3 A;  3MZ1 A;  5TU0 A;  1B1X A;  3E4R A;  2Q89 A;  3MAM A;  1VFE A;  4IO7 A;  3MVY A;  3BBR A;  1VSO A;  1LBB A;  3Q29 A;  5F7V A;  2Q8J A;  1D9V A;  2QSX A;  3OEL A;  2I0C A;  4YKJ A;  2ZYO A;  3U1O A;  2REG A;  4IO4 A;  2FNC A;  3CG1 A;  2ZYM A;  1BLF A;  1GVC A;  1MXZ A;  3H06 B;  2DWA A;  4MLV A;  4WEP A;  1UTB B;  2DYX A;  3EPE A;  1DSN A;  4AB5 A;  4QHQ A;  3TTN A;  3USD A;  2NVU B;  1Y9U A;  3C34 A;  4EQ9 A;  1MXV A;  3UK4 A;  5BWJ A;  2O6A A;  2F6P A;  1JW1 A;  3OD7 A;  5CMK A;  4QFK A;  4HS7 A;  1B3L A;  1WDN A;  2HQ0 A;  2GHA A;  3QAX A;  1WVJ A;  5ITP A;  4Q5T A;  4LZ5 A;  4GXA A;  2B3B A;  4YU0 A;  5J1D A;  3PMW A;  3IK6 B;  5I57 A;  3FZV A;  5KDT B;  4LUB A;  3KEI A;  1PB8 A;  2QJE A;  3RUM A;  1AOV A;  1HSL A;  1WOD A;  2I4B A;  2O51 A;  2DOJ A;  2O69 A;  3AXF A;  5DVF A;  3BFT A;  3PUX E;  2OWS A;  3C31 A;  1JQF A;  1QJM A;  5I56 A;  2AYS A;  2IEE A;  2I3V A;  5AA2 D;  4H0W A;  1LGB C;  1FQE A;  3T9U A;  1BP5 A;  4ISU A;  5FTI A;  2Q2C A;  1B9J A;  2I49 A;  1M5E A;  4RY1 A;  2XXX A;  4MBP A;  4F18 A;  3PGF A;  1L5T A;  2H99 A;  5H8N A;  1F9B A;  4GF8 A;  3PD9 A;  1P1W A;  1MM6 A;  4EQB A;  4RJZ A;  1QUK A;  5ICQ A;  3OMB A;  1N84 A;  2F35 A;  2DSF A;  4PFY A;  5B70 A;  5I58 B;  2G93 A;  4KFQ A;  2ZXT A;  1I6B A;  2HXW A;  2I58 A;  2R9J A;  5TPA B;  3SES A;  1O63 A;  1B5H A;  3THI A;  1B1H A;  2OJT A;  2F7B A;  2QRY A;  3IB2 A;  1URS A;  3KG2 A;  3IOW A;  3PMV A;  3FXQ A;  4PET A;  1B5J A;  3TPA A;  2FYI A;  4F3G A;  2GHB A;  1LCF A;  1BTJ A;  4GRK A;  4U4X A;  4LP2 B;  1JW5 A;  3TCF A;  3PU5 A;  1JW4 A;  2H5Y A;  3O9P A;  1Q35 A;  1NNK A;  4Q0C A;  3SER A;  3FXR A;  3K1M A;  2AL4 A;  3KGC A;  1NH7 A;  3K6U A;  1J1N A;  5DT6 A;  4NF6 A;  1QUL A;  2XXI A;  3TTM A;  1H43 A;  4KPT A;  2QS3 A;  4FJP A;  2XX7 A;  4R2B A;  1UIU A;  4BLA A;  2I0B A;  2B3F A;  1FQD A;  4LAT A;  4GFR A;  4LQ2 A;  4FIM A;  2ZYK A;  5DTB A;  1POT A;  4H5G A;  1A8E A;  2I48 A;  5AA2 B;  1FTO A;  1USY E;  4QFN A;  3W15 C;  2RCA A;  1XT8 A;  1FQA A;  3TDJ A;  2HZL A;  4LA9 A;  4BDO A;  4EXL A;  1SW1 A;  2XX9 A;  4R9F A;  3DP6 A;  3EN3 A;  2A5T A;  1CE2 A;  4DCY A;  1ZBM A;  5CBS A;  2R71 A;  4GVO A;  4F39 A;  1JVX A;  4IY6 A;  3S9E A;  2X7P A;  3WAF A;  1QKB A;  2H9B A;  1XOC A;  1FQB A;  5I2K A;  2PMS A;  1B6H A;  1I6A A;  4DXU A;  1UTH A;  4NWD A;  2O7I A;  4DIG A;  3U92 A;  2I3W A;  2NOO A;  2ZNT A;  1VR5 A;  1Y3P A;  3FV2 A;  3SKP A;  1Z7M E;  2F5X A;  3HN0 A;  3RT8 A;  4R6Y A;  1B2H A;  1I6Q A;  1URG A;  3BFU A;  3CVG A;  3MVW A;  4IO3 A;  3O28 A;  5FHM A;  3FAT A;  3PD8 A;  3CR9 A;  3RY3 A;  3MVZ A;  2XD3 A;  4XKN A;  1FTJ A;  1OQG A;  2Z8D A;  3DP8 A;  3DP4 A;  4O3A A;  2WKY A;  1B4Z A;  3RLF E;  3SEY A;  3IAZ A;  2HFB A;  2F7A A;  3K6X A;  5I59 B;  1LFH A;  3IJX B;  5EHM A;  1SD3 A;  3IL1 B;  3I3V A;  4MF3 A;  3TTR A;  4DXC A;  3UN6 A;  4JXI A;  3K1P A;  3R6U A;  4M4G A;  1A8F A;  3T93 B;  4QSD A;  3IJO B;  1S7Y A;  5AA1 A;  4UAC A;  3GXA A;  4DCX A;  2VD2 A;  2P2A A;  4JB7 A;  1SQY A;  3IOU A;  4BDN A;  3E9X A;  2XXP A;  4RNS A;  4H67 A;  4HCW A;  3N26 A;  4XKP A;  1N76 A;  1B7Z A;  1JEV A;  3RNN A;  1XVX A;  3H6U A;  1ZKB A;  1SI1 A;  3IO4 A;  1UIV A;  3KJ7 A;  3Q26 A;  3K00 A;  4KQP A;  1DOT A;  1EZ9 A;  2RF1 A;  5L8D A;  1LAG E;  4PFT A;  4Z0I A;  5FHN A;  1MXW A;  3CRB A;  4LQ5 A;  4OFO A;  2VHA A;  2X7Q A;  3R26 A;  2V93 A;  4GL0 A;  1D4N A;  2F34 A;  4U1O A;  4GXS B;  1IZ1 A;  1SVX B;  3LSW A;  3GZG A;  1B3F A;  1IEJ A;  5HPQ A;  1O64 A;  1VE4 A;  2VP1 A;  4ZDM A;  3QXM A;  1MXY A;  4EUO A;  3GLB A;  2OZZ A;  5JK4 A;  2Z8E A;  3QYT A;  1NL5 A;  1SYI A;  3ODB A;  3OO7 A;  5AE4 A;  3R7X A;  4BDR A;  2NXO A;  4QF9 A;  1HSJ A;  3VLV A;  3PUV E;  2KLF A;  5BUU A;  1IQ7 A;  5EYF A;  4OYV A;  1MY3 A;  2R6G E;  1B3G A;  4N13 A;  4JWY A;  1US4 A;  3D4G A;  3B6W A;  4P0I A;  4YKP A;  5ELV A;  3S9M C;  1NNF A;  3FD3 A;  4O3B A;  3O6H A;  3M8U A;  4BDQ A;  2Q88 A;  2D3I A;  4EQ7 A;  3M3L A;  3O6G A;  3TCG A;  1ZJL A;  4G68 A;  4LVQ A;  3K4U A;  4MFI A;  3RN8 A;  2F7C A;  3VVE A;  3E13 X;  4I9D A;  4Z7E A;  1PDA A;  1B7H A;  2DWJ A;  2O84 X;  4QSE A;  1ZU0 A;  2O1M A;  4ZEC A;  4ZEI A;  4YB5 A;  4TOZ A;  2OK2 A;  3MVX A;  2IA4 A;  3T22 A;  2XXQ A;  4F3B A;  3HCQ A;  2DP8 A;  1OIB A;  3O97 A;  1HSE A;  2DE2 A;  4LON B;  1N3X A;  3K6W A;  3MP6 A;  3RGY A;  4F19 A;  3TCH A;  4C1U A;  3SEU A;  3TFL A;  3IOT A;  3PUZ E;  3I5O A;  2F6G A;  3EHU A;  4RPO A;  1KWH A;  1LAX A;  3G3G A;  4XTC Q;  3TUS A;  1MG1 A;  1LAH E;  3B6Q A;  1XVY A;  3N5L A;  4NF5 A;  1LB8 A;  3FAS A;  1ZMG A;  4HTG A;  3PPP A;  4ESX A;  1N0T A;  2X26 A;  1IIT A;  3DLN A;  3H4Z A;  2DXY A;  2V3U A;  2PX1 A;  5H8Q B;  1D9Y A;  1LCT A;  3GBA A;  2QMX A;  3EQ1 A;  4KYS A;  5M2V A;  3HPI A;  2VD3 A;  4OQO A;  3HO7 A;  5F1Q A;  3LBS A;  1B3H A;  2I4C A;  4TLM B;  4Q30 B;  4ELQ A;  1AH5 A;  4QFP A;  3CSB A;  3TZA A;  5DYH A;  5AA4 B;  1P99 A;  5TP9 A;  3S2V A;  3PMX A;  2A5T B;  5KCJ A;  3OEM A;  2HAU A;  4XKR A;  1P1O A;  5DEX A;  3MQ9 A;  3QIM A;  5I2N B;  2RC8 A;  4F1V A;  2DWH A;  5DVI A;  4GOT A;  4ZE8 A;  1YTV A;  4G8M A;  4FED A;  4Q8R A;  3FJM A;  1B4H A;  5B7D A;  3PPR A;  3T9H B;  1UTH B;  4JWO A;  4IO5 A;  3G3H A;  1VFD A;  3V5A A;  4NF4 B;  1MRP A;  2M8C A;  3ECR A;  1UTB A;  5EHS A;  4KCD A;  3MZ9 A;  1CB6 A;  3G3K A;  2Z23 A;  3RTF B;  2GH9 A;  4OMB A;  4IGR A;  1Y4C A;  1LFI A;  4YKK A;  5CBR A;  3LC8 A;  1SW5 A;  2D5W A;  1N3W A;  1P1N A;  4G77 A;  1MPB A;  3C35 A;  1JET A;  5JEI A;  4R74 A;  3M3K A;  5KDT A;  3JV9 A;  2REJ A;  4YZZ A;  5H8F B;  4N6P A;  4P0G A;  4G2Z A;  2Y7P A;  4RPN A;  3VLW A;  4R75 A;  4H5F A;  1BIY A;  1N7W A;  1PC3 A;  3O2A A;  3C32 A;  1LLS A;  4EF1 A;  1AIV A;  1MXX A;  3C9H A;  3QSL A;  4P11 A;  4H65 A;  3LUY A;  2V3Q A;  5A5X B;  2RKM A;  1MY2 A;  1N04 A;  4C1T A;  1OMP A;  2O68 A;  4OTE A;  5CMM A;  1QUI A;  3TMG A;  3KBR A;  4FE8 A;  4GIZ A;  3UIF A;  2CZL A;  3A09 A;  2O1L A;  4G4P A;  3H7M A;  3SEX A;  5I84 A;  1AMF A;  3MWB A;  4R73 A;  3G3J A;  1I69 A;  4YAH X;  5ISU A;  4PFW A;  2Y84 A;  3IR1 A;  3PV0 E;  2AL5 A;  4F22 A;  3TOD A;  1S9T A;  3U72 A;  2OLB A;  1OVB A;  3CIJ A;  3W9V A;  1FQF A;  2XXY A;  4OEN A;  3OOA A;  2UXA A;  2PT2 A;  1Z7N E;  4U23 A;  3IOV A;  1IXG A;  5KZT A;  3ZS6 A;  2RCB A;  5TPA A;  3H6T A;  1MY1 A;  3VLU A;  1M5C A;  4IO2 A;  4F2O A;  3ONM A;  3ZKK A;  1B46 A;  1ZLQ A;  2XXT A;  1R1N A;  2GFE A;  1A54 A;  1MQG A;  4YIC A;  3H3G A;  5H8H B;  4OET A;  1EZP A;  1R9Q A;  4KHZ E;  4YB7 A;  4ELP A;  3V83 A;  3ILT B;  1MY4 A;  1RKM A;  1PBP A;  3FVN A;  1B0L A;  3T9V A;  4RK9 A;  3B7D A;  4OVJ A;  1PB9 A;  2V25 A;  5IAI A;  1FTL A;  2DQV A;  3OO8 A;  4ELR A;  2UVI A;  3FVK A;  4NF8 B;  3CG3 A;  1OLA A;  5DVJ A;  1B51 A;  3LSL A;  4GQO A;  1P1U A;  3LSF B;  1PB7 A;  4IB2 A;  1IXH A;  4R6K A;  3SEV A;  2E1S A;  1LBC A;  5AA2 A;  4EDP A;  3HHF A;  5IKB A;  3Q28 A;  3KSJ A;  2B65 A;  2O7U A;  3D4C A;  4YMA A;  4GLI A;  3H6V A;  3U93 A;  2XXW A;  3KFM A;  4RA1 A;  1M5B A;  1SBP A;  1LAF E;  1A99 A;  4YMB A;  2VOZ A;  2DE3 A;  3OSQ A;  1FTK A;  4JSD A;  3PPN A;  3JYR A;  1MM7 A;  4GL8 A;  1Y4T A;  3KJT A;  4ELO A;  1URD A;  4NMY A;  3JZJ A;  4X9T A;  4F1U A;  3A3C A;  4DE8 A;  3PUW E;  4G8H A;  1QKA A;  4THI A;  1S50 A;  3KOT A;  3N94 A;  3A3U A;  3FVG A;  4K3F A;  2Z8F A;  3MZB A;  3FIR A;  2Q9T A;  4QRZ A;  3B6T A;  5I57 B;  3T9X B;  2UYE A;  3SEW A;  4IO6 A;  4NTL A;  1OQH A;  1N7X A;  4KCC A;  1B40 A;  1EZO A;  2A5S A;  4C0R A;  4ECF A;  4PE5 B;  2V3T A;  4U1Z A;  4F3P A;  4WED A;  2YLN A;  4RYA A;  1NNT A;  1MQH A;  1SW4 A;  4FEB A;  2QS2 A;  2DXR A;  1SDX A;  2LAO A;  5I59 A;  3H03 A;  4QSC A;  3FVO A;  2OCU A;  2AIX A;  5LOM A;  4XIG Q;  4PP0 A;  3W9W A;  5I56 B;  3K6V A;  4OHN A;  3C4M A;  4FAJ A;  2RC9 A;  3KN3 A;  5CM6 A;  3Q25 A;  1XC1 A;  2ABH A;  4HW8 A;  4OWD A;  2ANJ A;  2E0S A;  5TP9 B;  5H8N B;  3HV1 A;  2XXR A;  4AQ4 A;  1RYX A;  3PUY E;  2ZNU A;  5FTH A;  3VFJ A;  5FHO A;  5HBC A;  1B7U A;  5DEX B;  4MH5 A;  3PPQ A;  2H25 A;  3VE1 B;  1H76 A;  3KSX A;  4I62 A;  2HAV A;  3U8Q A;  2QS1 A;  4X48 A;  1JEU A;  3T96 B;  1ATG A;  5JTY A;  3MPL A;  4KR5 A;  1BKA A;  4H8I A;  1AL3 A;  3ZSF A;  2Y7K A;  2DVC A;  2XXV A;  3RPW A;  1IXI A;  1A55 A;  4DZ1 A;  1D3K A;  3T66 A;  1H45 A;  1DPP A;  3TTK A;  3G3F A;  3Q27 A;  1ANF A;  1Y1Z A;  3KN7 A;  3RT6 B;  1MY0 A;  4OZ9 A;  4FOR A;  4UA8 A;  3L6G A;  4GWO A;  3FUZ A;  4JSO A;  1MH4 A;  1MXU A;  1PEB A;  1II5 A;  2XX8 A;  1LB9 A;  3IB1 A;  2UYF A;  2QMW A;  1SI0 A;  1DTZ A;  3MW0 A;  2OBG A;  2ZNS A;  3OXN A;  4IY5 A;  3VDF A;  4ND9 A;  2XHD A;  1YCJ A;  2RIN A;  3F11 A;  3MBP A;  2HCA A;  1YAE A;  3CFL A;  4NF6 B;  4ESW A;  4M1V A;  2Y7W A;  4X1D A;  2VGQ A;  4I8C A;  4LZ7 A;  1MQI A;  4X1B A;  4F29 A;  4DXB A;  4R72 A;  1TFD A;  4BDL A;  3MPK A;  4QFL A;  3FJG A;  3SDF A;  5CC2 A;  5L9S A;  1FTM A;  1R9L A;  4F3S A;  4OFL A;  2F36 A;  1OLC A;  4QFO A;  1RYO A;  4L17 A;  3HST A;  3TAJ A;  2QL3 A;  5HM4 B;  1MDP 1;  3MP8 A;  1DTG A;  1IUD A;  1ZIU A;  1JNF A;  1Y3N A;  2ONS A;  1DPE A;  4RXL A;  1GTK A;  1DMB A;  4ZED A;  1T0K A;  2PYY A;  5I2K B;  4OFJ A;  3LR1 A;  4ZEK A;  4LZ8 A;  1XHY A;  4FAT A;  3CFZ A;  3UA8 A;  1R6Z A;  1JVY A;  1NNP A;  2I6E A;  2UVH A;  3O6I A;  1ZTY A;  3C33 A;  1IIW A;  3M3F A;  1EH3 A;  1QUJ A;  3TYH A;  1PBQ A;  2DWI A;  2UVJ A;  3FV1 A;  2P0S A;  3N6T A;  4KI0 E;  2RC7 A;  1B0H A;  4OEV A;  4RK2 A;  2NUV A;  4G68 C;  4OES A;  1EU8 A;  3TQW A;  1POY 1;  3MJN A;  3FGS A;  3MP1 A;  3S4U A;  4WXJ A;  1FQC A;  3O29 A;  3TEL A;  1A40 A;  3VVD A;  1MS7 A;  4U21 A;  5K2X A;  2V84 A;  3RQT A;  2XXH A;  1UQW A;  3OSR A;  2ONR A;  2W7Y A;  4U4S A;  4FEC A;  4R9G A;  4G8N A;  4KYD A;  4JBZ A;  3S9N C;  4U22 A;  2PVU A;  4EF2 A;  1Y3Q A;  3DM0 A;  3IO6 A;  4YKI A;  1TWY A;  3VXC A;  4R6H A;  4F31 B;  5CI5 A;  2YPN A;  5H8Q A;  4DLD A;  4N07 A;  3QUJ A;  3QUF A;  3K01 A;  4H6D A;  2DS9 A;  1O7T A;  4XXU A;  1YPN A;  2Z22 A;  1US5 A;  4PFU A;  3C36 A;  1TFA A;  3KZG A;  2BJJ X;  3MUQ A;  4HCY A;  4E0X A;  5L9M A;  1GR2 A;  5AA4 A;  3TTL A;  3QK6 A;  4POW A;  1B05 A;  2ESN A;  3OO6 A;  3TQL A;  1IXC A;  3U94 A;  2XXU A;  4U2R A;  4R2F A;  2ZMB A;  3BKI B;  3K0V A;  4BDM A;  3VV5 A;  3KN8 A;  3SET A;  3L6H A;  3I6V A;  3DEL B;  5I2N A;  5I58 A;  2G29 A;  5CMB A;  4ZZE A;  3H6W A;  5ITO A;  2THI A;  4H1X A;  1NFT A;  1A7L A;  1P1Q A;  4NE4 A;  4NF4 A;  4PQJ A;  4YB6 A;  3G3I A;  2QS4 A;  3ILU B;  5CMC A;  2CMO A;  1B52 A;  1LFG A;  3UOR A;  2F8D A;  2HEU A;  3UP9 A;  2HZK A;  1MPD A;  2XD2 A;  4ONY A;  3E3K A;  4ZEF A;  1M5F A;  4I1D A;  5H8S A;  3HHG A;  3KOS A;  1OVT A;  4ZEB A;  2ZYN A;  1M5D A;  2P1S A;  3IOR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...