1II5A

Crystal structure of the glur0 ligand binding core complex with l-glutamate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Slr1257 protein
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Membrane protein
total genus 72
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ii5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ii5A02
3G7WA 3FJMA 3TQLA 1SQYA 2E1SA 2ZYKA 3FGSA 5FHOA 4XKNA 2THIA 4QFOA 3K6UA 5J1DA 4IB2A 1CB6A 3PUYE 3FVKA 2GRVA 5CRYA 4H5GA 1N84A 4JWYA 1EU8A 2QSXA 3C4MA 1TXFA 1DOTA 2O84X 3IK6B 3LUYA 5I2NA 4G68A 4KYEA 4ZECA 3TCGA 3S4UA 2VGQA 3QUFA 2XXXA 5H8HB 4U4SA 1LBBA 4XXUA 2XXYA 3O9PA 2HFBA 5FHNA 1MH3A 4R2FA 5BWJA 5I58A 3W9VA 3W15C 5AE4A 3EHTA 2O68A 4YB7A 1YCJA 2DWIA 5EHMA 1FQFA 3PUVE 3SEYA 3EQ1A 3T9UA 1LAXA 2RC7A 2DE4A 2LAOA 3RTFB 4C1UA 3WAFA 3C33A 1YPNA 3T22A 3VLWA 3KG2A 3P7IA 2DWJA 3MVWA 3QUJA 3FVOA 4ZE9A 2G93A 3B6WA 1SYHA 4YAHX 4N07A 3OO9A 1B5JA 4NF8A 3UIFA 2HCAA 3E4RA 3IOUA 3SEVA 1TWYA 4JSDA 4XKQA 1BLFA 4HCYA 2OJTA 2I3VA 5FHMA 1NKXA 3OELA 3PMVA 1IUDA 4OFOA 3PU5A 2Y7KA 4U23A 3PPQA 1MRPA 1SBPA 4KHZE 1ZIUA 5KCJB 3K02A 2H4IA 3SESA 3DP8A 1NNPA 2Z8EA 3U8QA 2IA4A 1NNKA 2NXOA 4THIA 3SEWA 5H8QB 4IGRA 3QAXA 1FTOA 2NVUB 1LCTA 4MBPA 4NF6B 5IAIA 4YMAA 3M3KA 3IOTA 4DCYA 5TPAA 1O63A 1OLCA 3N6TA 3CG3A 3MBPA 2F34A 4P0IA 4F2OA 5HPQA 4F1VA 4U1OA 3OSRA 1VSOA 3IOWA 4H67A 4ZZAA 3MZ9A 3THIA 4Q5TA 1YTVA 2F35A 3HV1A 4JXIA 1PB8A 3V8XB 4G77A 2A5TA 1NH8A 1PB7A 3BFTA 3S9LC 4FEBA 1UQWA 2UVIA 5I59A 5A5XA 1POTA 3QIMA 1S7YA 5F7VA 4IY6A 4JWXA 4QFLA 1OQHA 1ZTYA 3RQTA 3ZKLA 2I0BA 2Y7RA 3C36A 3C34A 3T9XB 3K4UA 1B32A 1A8FA 4OZ9A 4WEPA 3H06B 4ESXA 3V5AA 5ISUA 5EYFA 3G3IA 4DE8A 1IXHA 4KPTA 3N26A 4NF4B 2RCBA 4ZE8A 5H8FA 2BJJX 2H9BA 4RA1A 1UIUA 2Q89A 1LB8A 3M3LA 1FTJA 3B6QA 2F36A 1F9BA 3LSWA 4JSOA 4NF5B 3CFXA 3OO8A 1I6BA 2PX1A 5IKBA 3FJ7A 4QSEA 1PC3A 1TFDA 1AL3A 4DCXA 3UK4A 4FJPA 3V89B 4YKPA 1B3EA 4C0RA 3PPRA 1R6ZA 5JEIA 3H6VA 4R73A 1LCFA 2V25A 3O6GA 1P1UA 5KDTB 5ITOA 3HHFA 3FUZA 3RT6B 4LQ5A 3T93B 1XC1A 1H3DA 3KZGA 4BDNA 1MH4A 3R7XA 3U92A 1A7LA 4OEUA 4PFUA 1B2HA 3AXFA 2UXAA 1ZJLA 1EZ9A 1MY2A 4AB6A 3BKIB 1QUKA 1O64A 4GL8A 1ZMGA 2ONKE 4O3BA 1Q1KA 4OETA 3IAZA 4OERA 2P0SA 4OENA 3S9MC 1H44A 2UYEA 3KN3A 3C9HA 3MC2A 1UTBB 1IXCA 2NUVA 2HXWA 1URDA 1B58A 1S50A 4POXA 4XKPA 1MY4A 3KSXA 1FQBA 3G3HA 2I3WA 1ANFA 2XXVA 2CMOA 4E0WA 1I6AA 4M4GA 3TTRA 1GVCA 3S9NC 1SI0A 3G3FA 4TLLB 1MG1A 4H1XA 3KJTA 1Y4CA 4IO2A 1NNTA 3FVNA 3C31A 4RJZA 2D5WA 2HAUA 1OLAA 1Y3NA 3TZAA 1FQAA 1ZBMA 1Y4TA 2V3QA 3V83A 1HSEA 2V3TA 3LSXA 5DEXA 3GXAA 3O66A 4U22A 2OWSA 2VD2A 3HCQA 3OO6A 3PMWA 2HAVA 2QJEA 2IEEA 2I49A 5ICTA 4QSCA 1MXYA 3TMGA 4OTEA 4GD5A 3K6XA 4QFPA 2XXWA 4FATA 5AA2B 2I6EA 1P1WA 2Y84A 3DP6A 2QS4A 5CMKA 2O7UA 5H8NA 3L6GA 1NL5A 3VLVA 5TP9A 3I6VA 4MFIA 2QPQA 2F5XA 1P1OA 1Z7ME 2Q9TA 2OCUA 4ISUA 2F7CA 3RGYA 4F22A 3TUSA 1B6HA 4F1UA 2F8DA 1UTHB 4MLVA 4OESA 3TPAA 1LFIA 4LQ2A 1LAGE 1WVJA 5I56A 4PFTA 3VLUA 1MDP1 1MXUA 3MVXA 4R2BA 3JZJA 1N3WA 4ZEKA 3RNNA 1FW0A 2H25A 1MQJA 3EF7A 2HZLA 3FV1A 1FQEA 5H8NB 3Q28A 1JVYA 3FXQA 3G3GA 4XIGQ 3KOSA 4F3PA 1JW4A 1S9TA 1B52A 3C35A 4KD5A 5JK4A 2UYFA 3T66A 3E3KA 2P2AA 1VFDA 1HSLA 1R9LA 3DELB 2O69A 3SEUA 2OWTA 1B1HA 1PBQA 3U72A 4YB6A 4I8CA 1Y9UA 1PDAA 1SW1A 3K01A 1CE2A 3OD7A 2KLFA 4P11A 4YU0A 2R6GE 1VR5A 1P99A 3FXRA 1MS7A 4GXSB 3ONMA 3K6WA 4BDLA 2WKYA 4GWOA 1SDXA 4RK9A 3N5LA 3S9EA 5I2NB 4JB7A 4G68B 3IORA 3EHSA 1D4NA 3TQWA 1MQHA 3OMBA 4G8MA 3PPOA 5BUUA 4Z7EA 3CSBA 3ECRA 3KN8A 3TTMA 4F31B 2DWAA 1OQGA 4IO7A 3U1OA 4KFQA 4JDFA 3PMXA 5DT6A 3MVZA 4G2ZA 2G29A 5I58B 3TTLA 3MPLA 4F19A 3UN6A 1B0HA 1B0LA 1TT1A 3VDFA 4ESWA 3RLFE 2O1LA 1AIVA 3FVGA 1N3XA 1XS5A 3MQ9A 3VFJA 2DWHA 5L9SA 1BIYA 1BP5A 2Q8JA 4YICA 1GTKA 1QKAA 2F7AA 4LUBA 1Y3QA 5KZTA 3C32A 4FEDA 2I58A 3B7DA 3GBAA 3OSQA 1DPEA 3GBBA 4G8NA 1J1NA 3F11A 2OLBA 1D3KA 4GRKA 4NF8B 1B40A 4FIMA 4GXAA 3ODBA 4KCDA 4NEDA 5DVFA 5ITPA 3CRBA 4EF2A 3QYTA 4ELQA 3KJ7A 2YJPA 1QULA 3CIJA 3TCFA 1Y3PA 3O6HA 2XXIA 1ATGA 2UVHA 1B5HA 1HSJA 4IY5A 4ZEIA 2XHDA 3VV5A 1L5TA 1SD3A 3KOTA 1FTMA 1UIVA 4R6YA 1LLSA 4BDRA 4TOZA 4EQBA 4BDOA 1SW2A 4OHNA 3BBRA 5TPAB 2O1MA 2ZYMA 3TAJA 3BFUA 2PT2A 3LBSA 1LFGA 3PGFA 3CI8A 1P1NA 3A3CA 4E0XA 1POY1 5I2KA 4YZZA 4YKJA 1MXVA 4F2QA 2ESNA 5AA3A 3PUZE 4OMBA 1D9YA 4IO4A 4I62A 3K2DA 2RF1A 2A5TB 4HS7A 1LBCA 5I57A 1R1NA 3R26A 1H43A 5FTHA 3VE1B 3PUWE 1NNFA 4H5FA 2REGA 3MUQA 3RY3A 4N13A 4GIZA 1USYE 5CI5A 2R71A 5I59B 3FZVA 2I4CA 1Y1ZA 4UACA 4LA9A 1MQGA 4X1BA 5A5XB 4RYAA 2Y7WA 3CG1A 1RYXA 2Q2CA 4U21A 4F3GA 4KYSA 3IJOB 3MP1A 4NWDA 3E13X 3T9VA 2O6AA 2O7IA 4RY1A 3QXMA 1M5CA 1QVSA 4PQJA 5H8FB 5LOMA 2FNCA 1LAFE 1XVYA 1B5IA 2XD2A 2XX7A 3TTKA 3W9WA 4YKIA 4XKRA 3E9XA 2ANJA 4BDQA 1EH3A 4JBZA 5FTIA 2DSFA 1Z7NE 4IGTA 2VD3A 2QMWA 4KR5A 2XXUA 1M5BA 5AA1A 3MZ1A 3FJGA 3UGWA 5CC2A 4QRZA 3JYRA 4ELOA 1OVTA 3RTWB 1A55A 3G3KA 1N0TA 3PUXE 1WODA 2XXPA 2Y7IA 5K2XA 1JNFA 3MVYA 4IO6A 1A99A 2QMXA 4LZ5A 3FIRA 4G8HA 4BLAA 3FXUA 4RXLA 5CBSA 1I69A 2RC9A 4GQOA 4MLQA 1MPBA 2VHAA 1USYH 2GH9A 4R75A 1FCKA 3IO6A 2B65A 1TFAA 4OXVA 2GHBA 2NOOA 3H6UA 4DXCA 1H76A 2ALUA 4F3SA 5HBCA 1MPDA 1JQFA 1MDQA 1ZU0A 2F78A 3IJXB 3RN8A 4R9GA 2B3BA 2QL3A 4Q30B 1LSTA 4OEVA 2RINA 2DVCA 3S2VA 4HCWA 3GLBA 3O29A 3LC8A 1IQ7A 4TLMB 5EHSA 1A40A 3PPPA 1MXWA 4GF8A 4EDPA 3M3FA 4AQ4A 3H6TA 3LSLA 1IIWA 2YLNA 1SYIA 4RPOA 4C1TA 1AMFA 5CM6A 1B4HA 2ZYNA 1KWHA 4R6KA 2M8CA 4R74A 2GFEA 2I48A 1JEVA 1P1QA 4O3CA 4XTCQ 1GR2A 3MP8A 4ELPA 2Z8DA 4EUOA 1JETA 1QW0A 5F1QA 4QFKA 1MY0A 1XVXA 5AA4A 3ZS6A 4EXKA 1O7TA 3KSJA 4NE4A 2RC8A 4QFNA 2Z22A 1US5A 3MZBA 3O97A 5TU0A 3OENA 3VVDA 2OZZA 5I84A 2AL4A 4KCCA 5JTYA 1T0KA 2PYYA 3K6VA 1A54A 2AIXA 3KN7A 1B3FA 3I3VA 4F39A 1M5FA 1VE4A 3CVGA 3IX1A 3ILUB 3U94A 5CMBA 3IOVA 3RPWA 1XT8A 1A8EA 3MP6A 4U4XA 5DEXB 1GGGA 4UA8A 2O51A 1DSNA 4G4PA 2DVZA 3Q25A 4L17A 4PFYA 4GFRA 2V84A 3IB1A 2UVGA 1GV8A 4FAJA 1B9JA 1MXXA 4RPNA 2QS1A 4PE5B 2F7BA 1B7HA 3O2AA 3SETA 4ELRA 3D4CA 5B70A 3IR1A 4LVQA 2H98A 4TQUQ 1N04A 1M5DA 3RUMA 4KYDA 4NTLA 5CMMA 5CMCA 5H8HA 3OOAA 3T9HB 1DMBA 4ZZEA 2Q88A 5TP9B 2DYXA 4K3FA 3SEXA 4QF9A 2PVUA 4GLIA 3H4ZA 4LZ7A 3ZSFA 4LP2B 4X1DA 5DYHA 1PB9A 4GOTA 4KQPA 3USDA 5HM4B 5I56B 1N7WA 3DP4A 4H65A 1IXGA 3DM0A 3HN0A 5B7DA 3EN3A 3Q26A 1FTLA 1YAEA 3SKPA 1EZPA 2XXTA 3TCHA 4LATA 3A3UA 4RNSA 3FATA 2ONSA 4DLDA 3MW0A 3O6IA 1B3LA 3TKDA 1IEJA 1BTJA 3KGCA 1FQCA 2HEUA 2XXHA 4DXBA 2QS3A 1URSA 2ONRA 4F1YA 2OBGA 4DIGA 5L8DA 4FECA 3RT8A 1QUJA 2ZXTA 5KCJA 1QKBA 2F97A 4H6DA 4H8JA 3JV9A 1JEUA 1SI1A 4H8IA 3H7MA 4YB5A 4U2RA 3SERA 3WAEA 3R6UA 3TYHA 1B51A 3K1NA 5H8QA 4ND9A 3ILTB 2R9JA 2F6PA 4NF6A 2PBWA 4N6PA 4ECFA 3TEPA 4EQ7A 4AB5A 4ZEBA 4EQ9A 3TDJA 4X48A 3TFLA 4WEDA 1H45A 4OYVA 2AL5A 3Q27A 3PPNA 2I0CA 1B3HA 3UA8A 4I1DA 2E0SA 2P1SA 4IO3A 3CFLA 3KEIA 3IB0A 3OEMA 1B1XA 2ABHA 3OO7A 3TODA 1URGA 4Z0IA 3H3GA 1MM6A 1OMPA 2W7YA 1JW1A 2REJA 5DVIA 3Q29A 3PV0E 1QJMA 5DVJA 2ZNTA 2V93A 1MY1A 2I4BA 3TTNA 2H5YA 2Q2AA 1IZ1A 3GZGA 2UVJA 2DS9A 4YMBA 3CSGA 4PETA 3L6HA 4OFJA 1XOCA 4BDMA 1ELJA 4NF4A 3A09A 4R72A 1MPCA 2HQ0A 3VXBA 2VOZA 2Y7PA 5H8SA 3D4GA 2PT1A 2B3FA 3MAMA 4FE8A 1B05A 5M2VA 3N6UA 3PD9A 3K00A 4NF5A 1AOVA 5AA2D 2HZKA 3UP9A 3HHGA 5ELVA 2NWJA 1DTGA 1PEBA 1MXZA 2DE3A 4DZ1A 3DLNA 4Q0CA 1IXIA 1FQDA 2Z8FA 2OK2A 5I2KB 4R6HA 3LSFB 3K1PA 2ZNSA 4RK2A 4MH5A 5KDTA 3EHUA 2GHAA 1Y20A 1XHYA 5I57B 3KBRA 2DP8A 3MWBA 2ZNUA 1SVXB 2QS2A 4NWCA 1MM7A 2CZLA 4LONB 4OFLA 4LZ8A 1PBPA 1LGBC 3G3JA 3TELA 2ZMBA 3FASA 4F29A 1B4ZA 4DDDA 4F3BA 4P0GA 4ZS9A 3ZKKA 1BKAA 4G68C 2DOJA 4H0WA 1EZOA 3QSLA 1SW5A 5CBRA 2FYIA 4R9FA 4PP0A 3FD3A 2D21A 3VXCA 1FTKA 4IO5A 3UORA 2D3IA 3EPEA 4DXUA 4QSDA 4ZEFA 5L9OA 3K0VA 2Z23A 3IO4A 4MF3A 1OVBA 1IITA 4O3AA 3PD8A 3IB2A 2RCAA 4ONYA 1OIBA 1SW4A 1DTZA 1UTBA 5L9MA 1RYOA 2YPNA 2FA7A 1WDNA 3CR9A 4EF1A 1RKMA 4NMYA 2X7QA 2RKMA 3QK6A 3MPKA 4ZEDA 1JW5A 4FORA 1Q35A 4HTGA 3OEKA 2X26A 2DQVA 1LAHE 3O28A 1VFEA 4POWA 2DXYA 1NFTA 1M5EA 2A5SA 2H99A 1B7UA 1B3GA 3I5OA 3T96B 3H6WA 3H03A 1ZLQA 1R9QA 2V3UA 5DTBA 2XXQA 1MY3A 1I6QA 4OVJA 2X7PA 2PMSA 4I9DA 4WKMA 1NMUA 4EXLA 4ZDMA 2AYSA 1N7XA 1B46A 1US4A 5AA2A 1QUIA 4GVOA 5K2YA 1Y1MA 3VVEA 3FV2A 2XX8A 1DPPA 3IL1B 1ZKBA 1JVXA 3LR1A 3VVFA 3KFMA 4OQOA 4KI0E 2XD3A 4X9TA 1B7ZA 1LFHA 1MQIA 4YKKA 1II5A 4M1VA 3HPIA 1N76A 1MQDA 3N94A 3U93A 1UTHA 4Q8RA 4GL0A 1NH7A 3HO7A 4PFWA 5AA4B 2XX9A 3MJNA 4HW8A 2QRYA 3CFZA 3HSTA 5ICQA 2VP1A 4WXJA 3OXNA 2DE2A 1AH5A 3K1MA 2F6GA 4QHQA 4OWDA 3SDFA 4F18A 3B6TA 5JTYB 3M8UA 2ZYOA 4U1ZA 2XXRA 1D9VA 2DXRA 4JWOA 1LB9A
chains in the Genus database with same CATH superfamily
3G7WA 3FJMA 1FPLA 3TQLA 5EQ8A 1SQYA 2E1SA 2ZYKA 3FGSA 5FHOA 4XKNA 2THIA 3T0JA 4QFOA 4PDDA 3K6UA 5J1DA 4IB2A 1CB6A 3PUYE 3FVKA 2GRVA 5CRYA 4H5GA 1N84A 4JWYA 1EU8A 1KA1A 2QSXA 3C4MA 1FPKA 1TXFA 1DOTA 2O84X 3IK6B 3LUYA 5I2NA 4G68A 5IZ3A 2B4LA 4KYEA 4ZECA 4JVCA 3TCGA 3S4UA 2VGQA 3QUFA 2XXXA 5H8HB 4U4SA 1LBBA 2FBPA 4XF5A 4OVTA 4XXUA 1EYJA 2XXYA 3O9PA 4PDHA 2HFBA 5FHNA 1MH3A 4R2FA 5BWJA 1BK4A 5I58A 3W9VA 3W15C 5AE4A 3EHTA 2O68A 4YB7A 1YCJA 5F24A 2DWIA 4PBQA 5EHMA 1FQFA 3PUVE 4PBHA 3SEYA 3EQ1A 3T9UA 1LAXA 2RC7A 2DE4A 2LAOA 3RTFB 4C1UA 1FSAA 3WAFA 3C33A 1YPNA 3T22A 3VLWA 3KG2A 3P7IA 2DWJA 3MVWA 3QUJA 3FVOA 4ZE9A 2R8TA 3HFUA 2G93A 3B6WA 1SYHA 4YAHX 4H46A 1FPJA 1KA0A 4N07A 3OO9A 1B5JA 4NF8A 3UIFA 2HCAA 3E4RA 3IOUA 3SEVA 1TWYA 4JSDA 4XKQA 1BLFA 4HCYA 2OJTA 2I3VA 5FHMA 1NKXA 2FIXA 3OELA 3PMVA 1IUDA 4OFOA 3PU5A 2Y7KA 4U23A 3PPQA 3ROJA 1MRPA 1SBPA 4MMPA 4KHZE 1ZIUA 2XXKA 5KCJB 3K02A 4P9KA 2H4IA 3SESA 3DP8A 1NNPA 2Z8EA 3U8QA 2IA4A 2QVVA 4MIJA 1NNKA 2NXOA 4THIA 4N6KA 3SEWA 5H8QB 4IGRA 3QAXA 1FTOA 2NVUB 1LCTA 4MBPA 4NF6B 5IAIA 4YMAA 3M3KA 3IOTA 4DCYA 5EQAA 5TPAA 1O63A 1OLCA 3N6TA 3CG3A 3LV0A 5EYGA 3MBPA 2F34A 4P0IA 4O94A 2P3VA 4F2OA 5HPQA 3CHGA 4PAIA 4F1VA 4U1OA 3OSRA 1VSOA 3IOWA 1NUWA 4H67A 4ZZAA 3MZ9A 3THIA 4Q5TA 2BJIA 1YTVA 2F35A 2Q74A 4NGUA 3HV1A 2PFYA 4JXIA 1PB8A 4G77A 3V8XB 2A5TA 4NQ8A 1NH8A 1PB7A 3BFTA 3S9LC 4FEBA 1UQWA 1YYZA 2FVZA 3RYDA 2UVIA 5I59A 4NF0A 4G61A 5A5XA 1POTA 4I40A 3MSTA 3QIMA 1S7YA 5F7VA 2CEXA 4IY6A 1FJ6A 4JWXA 4QFLA 1OQHA 1ZTYA 3RQTA 3ZKLA 2I0BA 2Y7RA 2F3DA 3C36A 3C34A 4N91A 3T9XB 3K4UA 1B32A 1A8FA 4OZ9A 4WEPA 3H06B 4ESXA 3V5AA 5ISUA 5EYFA 2WYKA 3G3IA 4DE8A 2Y5LA 1IXHA 4KPTA 2FIEA 3N26A 4NF4B 2RCBA 4ZE8A 3RPLB 5H8FA 2BJJX 4PF6A 2H9BA 1EYIA 4RA1A 1UIUA 2Q89A 2QFLA 1LB8A 3M3LA 2L5VA 1FTJA 4PC9A 3B6QA 2F36A 1F9BA 3NOHA 3LSWA 4JSOA 4NF5B 3CFXA 3OO8A 2WX9A 1I6BA 2PX1A 5IKBA 3FJ7A 4QSEA 1PC3A 1TFDA 1AL3A 4DCXA 3UK4A 4FJPA 3V89B 3GYYA 4HE1A 1LBYA 4PGPA 4YKPA 1B3EA 4NN3A 4C0RA 3PPRA 1R6ZA 5JEIA 3H6VA 5LTCA 4R73A 1LCFA 2V25A 3O6GA 1P1UA 5KDTB 5DW8A 5ITOA 3HHFA 3FUZA 3RT6B 4LQ5A 1RDZA 3T93B 1XC1A 1H3DA 3KZGA 4BDNA 1MH4A 3R7XA 2XWIA 3U92A 1A7LA 4OEUA 4PFUA 1B2HA 3AXFA 2UXAA 1ZJLA 1EZ9A 1MY2A 4AB6A 3BKIB 1QUKA 1O64A 3A29A 4GL8A 1ZMGA 2ONKE 4O3BA 1Q1KA 4OETA 3IAZA 1SPIA 4IR8A 4OERA 2P0SA 5EYHA 4OENA 4OVRA 1H44A 3S9MC 4QXDA 2UYEA 3KN3A 3C9HA 3MC2A 1UTBB 4PFBA 1DK4A 1IXCA 2NUVA 2HXWA 1URDA 1B58A 1S50A 4POXA 4XKPA 1MY4A 3KSXA 1FQBA 3G3HA 2I3WA 1LEVA 1ANFA 2XXVA 2CMOA 4E0WA 1I6AA 4M4GA 2XWVA 4GWYA 3TTRA 1GVCA 5FBPA 3S9NC 1SI0A 3G3FA 4TLLB 1MG1A 4H1XA 3KJTA 1Y4CA 4IO2A 1NNTA 3FVNA 3C31A 4RJZA 2D5WA 2HAUA 1OLAA 1Y3NA 3TZAA 1FQAA 1ZBMA 1Y4TA 2V3QA 1YXIA 1DCUA 3V83A 2ZZWA 1HSEA 2V3TA 3LSXA 5DEXA 3GXAA 3O66A 4U22A 2OWSA 4PTKA 2VD2A 3HCQA 3OO6A 4MHFA 3PMWA 2HAVA 2QJEA 4JVDA 1JP4A 2IEEA 2I49A 5ICTA 1FPEA 4QSCA 1MXYA 3TMGA 4OTEA 4GD5A 3K6XA 4QFPA 2XXWA 4FATA 5AA2B 2I6EA 1P1WA 2Y84A 1FPDA 3DP6A 2OWZA 2QS4A 5CMKA 2O7UA 5H8NA 4JVIA 4OANA 3L6GA 1NL5A 3VLVA 5TP9A 3I6VA 4MFIA 2QPQA 5IZZA 2F5XA 1P1OA 4PAKA 1Z7ME 2CEYA 2Q9TA 2OCUA 4ISUA 2F7CA 3RGYA 4F22A 4PGNA 1B6HA 3TUSA 4F1UA 2F8DA 1QGXA 1UTHB 4MLVA 4OESA 3TPAA 1LFIA 4LQ2A 1LAGE 1WVJA 5I56A 4PFTA 3VLUA 1MDP1 3IFCA 1MXUA 1LBVA 3MVXA 4R2BA 2PFZA 3JZJA 1N3WA 4ZEKA 3RNNA 3B50A 1FW0A 2H25A 1MQJA 3EF7A 2HZLA 3FV1A 1FQEA 5H8NB 3Q28A 2OX3A 1JVYA 3FXQA 3G3GA 4XIGQ 3KOSA 4F3PA 1JW4A 1FPFA 1B52A 1S9TA 3C35A 4KD5A 5JK4A 2UYFA 5ET5A 3T66A 3E3KA 1LBZA 2P2AA 1AWBA 3KC1A 1VFDA 1HSLA 1R9LA 3DELB 3MYUA 1CNQA 2O69A 3SEUA 2OWTA 1B1HA 1PBQA 3U72A 4YB6A 4DI3D 1D9QA 4I8CA 1Y9UA 1PDAA 1SW1A 3K01A 1CE2A 3OD7A 2KLFA 4P11A 4YU0A 1NV2A 2R6GE 1VR5A 4GX3A 1P99A 3FXRA 1MS7A 1XI6A 4GXSB 2Y5KA 3ONMA 1FPGA 3K6WA 4BDLA 2WKYA 4GWOA 1SDXA 4RK9A 3N5LA 3S9EA 1LBXA 5I2NB 4JB7A 4G68B 5IZ3B 3IORA 3EHSA 1D4NA 3TQWA 1MQHA 3OMBA 4G8MA 1NUYA 3PPOA 5BUUA 3D1RA 4Z7EA 3LUZA 3CSBA 3ECRA 4O8MA 3KN8A 3TTMA 4F31B 2DWAA 1OQGA 4IO7A 3U1OA 4KFQA 4JDFA 3PMXA 5DT6A 3MVZA 1G0HA 4G2ZA 2G29A 5I58B 3TTLA 2QVUA 3MPLA 4F19A 5I3SA 3UN6A 1B0HA 1NI9A 4GWZA 1B0LA 4P1LA 1TT1A 3VDFA 4ESWA 3RLFE 2O1LA 1AIVA 3FVGA 1N3XA 1XS5A 3MQ9A 3VFJA 2DWHA 5L9SA 1BIYA 1BP5A 2XWKA 2Q8JA 4YICA 1NV5A 2VPOA 4P56A 1GTKA 1QKAA 1YZ0A 1INPA 4N81A 3SZPA 1VDWA 2F7AA 4LUBA 1FPBA 1Y3QA 5KZTA 3C32A 4FEDA 2I58A 2WYPA 3B7DA 3GBAA 3OSQA 1DPEA 3GBBA 4G8NA 1NV4A 1J1NA 3F11A 2OLBA 1D3KA 4GRKA 4NF8B 1B40A 4FIMA 4GXAA 3ODBA 2XA5A 4KCDA 1NV6A 4NEDA 5DVFA 5ITPA 3CRBA 4EF2A 3QYTA 4ELQA 3KJ7A 2YJPA 4PF8A 1QULA 1NV0A 4GX6A 3CIJA 4NG7A 3TCFA 1Y3PA 3O6HA 2XXIA 1ATGA 2UVHA 1B5HA 4AS5A 2P3NA 1FBFA 1HSJA 4IY5A 4ZEIA 2XHDA 3VV5A 1L5TA 1SD3A 3KOTA 1FTMA 4NAPA 1UIVA 4R6YA 1LLSA 4N15A 4BDRA 2KR0A 4TOZA 4EQBA 4BDOA 2MKZA 1SW2A 4OHNA 3BBRA 5TPAB 2O1MA 2ZYMA 3TAJA 3BFUA 2PT2A 4P8BA 3LBSA 1LFGA 3PGFA 3CI8A 1P1NA 5A5LA 3A3CA 4E0XA 1POY1 5I2KA 4YZZA 4YKJA 1MXVA 4F2QA 2ESNA 5AA3A 3PUZE 2CZIA 4H45A 4OMBA 1D9YA 4IO4A 4I62A 3K2DA 2RF1A 2A5TB 4HS7A 1LBCA 5I57A 1R1NA 3R26A 1H43A 5FTHA 3VE1B 3PUWE 1NNFA 2DDKA 4H5FA 2REGA 3MUQA 3T1BA 3RY3A 4N13A 4HXVA 4GIZA 1USYE 5CI5A 2R71A 5I59B 3FZVA 5J16A 2I4CA 1Y1ZA 4UACA 4LA9A 1MQGA 4X1BA 5A5XB 4O7IA 4RYAA 2Y7WA 3CG1A 1RYXA 2Q2CA 3KBZA 4U21A 3B8BA 4F3GA 4PE3A 4KYSA 3IJOB 3MP1A 4NWDA 2F3BA 3E13X 3T9VA 2O6AA 2O7IA 4RY1A 1IMDA 3QXMA 1M5CA 1QVSA 4PQJA 5H8FB 5LOMA 2FNCA 1LAFE 1XVYA 1B5IA 2XD2A 2XX7A 3TTKA 3W9WA 4YKIA 4XKRA 3E9XA 2ANJA 4BDQA 1EH3A 4JBZA 5FTIA 2DSFA 2GQ1A 1Z7NE 4IGTA 5IZ1A 2VD3A 2QMWA 4KR5A 4X04A 2XXUA 1M5BA 5AA1A 3MZ1A 3FJGA 3UGWA 5CC2A 4QRZA 3JYRA 4OVSA 4ELOA 1OVTA 1IMFA 1A55A 3RTWB 3G3KA 1N0TA 3PUXE 2Q8MA 1WODA 2XXPA 2Y7IA 5K2XA 1JNFA 3MVYA 4IO6A 1A99A 2QMXA 4LZ5A 3FIRA 4G8HA 4BLAA 3FXUA 4RXLA 1Q9DA 5ET7A 5T3JA 5CBSA 1I69A 2RC9A 4GQOA 4MLQA 1MPBA 2VHAA 5I5PA 1USYH 2VPNA 2GH9A 4I3EA 4R75A 1FCKA 3IO6A 2B65A 1TFAA 4OXVA 2GHBA 4GBVA 4OA4A 2NOOA 3H6UA 4DXCA 1H76A 2HHMA 4GWSA 4O7MA 2ALUA 4F3SA 5HBCA 1MPDA 1JQFA 1MDQA 1ZU0A 2F78A 4PFIA 3IJXB 3RN8A 4R9GA 2B3BA 2QL3A 4Q30B 4GX4A 1LSTA 4OEVA 2RINA 2DVCA 3S2VA 1FTAA 4HCWA 3GLBA 1NV7A 3O29A 3LC8A 1IQ7A 1NUZA 4TLMB 2PCRA 1A40A 5EHSA 3PPPA 1MXWA 4GF8A 4EDPA 3M3FA 4MNIA 4AQ4A 3H6TA 1IMAA 3LSLA 3PTYA 1IIWA 2YLNA 1SYIA 1NV1A 1FBDA 4RPOA 4C1TA 1AMFA 5CM6A 1B4HA 2ZYNA 1KWHA 2CZKA 4R6KA 2M8CA 4R74A 2GFEA 2I48A 1JEVA 1P1QA 4O3CA 4XTCQ 1GR2A 3MP8A 4ELPA 2Z8DA 4EUOA 1K9YA 1JETA 1QW0A 5F1QA 4QFKA 1MY0A 1XVXA 5AA4A 3ZS6A 4EXKA 4QBAA 2WBDA 1O7TA 3KSJA 4NE4A 2RC8A 4QFNA 2Z22A 1US5A 3MZBA 3O97A 5TU0A 4PFRA 3OENA 3VVDA 2OZZA 5ET6A 5I84A 2AL4A 4KCCA 4MEVA 5JTYA 1T0KA 2PYYA 3K6VA 1A54A 2AIXA 3KN7A 1B3FA 3I3VA 4F39A 1M5FA 1VE4A 3CVGA 3IX1A 3ILUB 3U94A 2KQZA 5CMBA 4NX1A 4MNPA 3IOVA 3RPWA 1XT8A 4MAGA 1A8EA 3MP6A 1FRPA 4U4XA 5DEXB 1GGGA 4UA8A 2O51A 1DSNA 4G4PA 2DVZA 2HXRA 3Q25A 4L17A 4PFYA 4GFRA 2V84A 3IB1A 3ISPA 5EQ9A 3BIGA 2UVGA 1GV8A 4FAJA 1B9JA 1MXXA 4RPNA 2QS1A 3E79A 4PE5B 2F7BA 1B7HA 3O2AA 3SETA 4ELRA 3D4CA 5B70A 3IR1A 5ESYA 4LVQA 2H98A 4NHBA 4TQUQ 1N04A 1M5DA 3RUMA 4KYDA 2V4CA 4NTLA 5CMMA 5CMCA 5H8HA 3OOAA 3T9HB 4AS4A 1DMBA 4ZZEA 2Q88A 5TP9B 2DYXA 4K3FA 3SEXA 4QF9A 2PVUA 4GLIA 3H4ZA 4LZ7A 3ZSFA 4LP2B 4X1DA 5DYHA 1PB9A 4GOTA 4KQPA 3USDA 5HM4B 5I56B 1N7WA 3DP4A 4H65A 1IXGA 3DM0A 3HN0A 5B7DA 3EN3A 4N4UA 3Q26A 4FBPA 1FBCA 1FTLA 1YAEA 3SKPA 1EZPA 1FBHA 2XXTA 3TCHA 4LATA 3A3UA 4RNSA 3FATA 2ONSA 4P47A 1IMCA 4DLDA 3MW0A 3O6IA 1B3LA 3TKDA 1IEJA 1BTJA 3KGCA 1FQCA 2HEUA 4N8YA 4LN5A 2XXHA 4MJOA 4DXBA 2QS3A 1URSA 2ONRA 4F1YA 2OBGA 4DIGA 1NUXA 5L8DA 4FECA 3RT8A 1QUJA 2ZXTA 5KCJA 4UABA 4OVPA 1QKBA 2F97A 4H6DA 4H8JA 3JV9A 1JEUA 1SI1A 4H8IA 3H7MA 4YB5A 4U2RA 3SERA 3EKIA 3WAEA 3R6UA 3TYHA 1G0IA 1B51A 3K1NA 1FBGA 5H8QA 4ND9A 4GWUA 3ILTB 3E78A 2R9JA 2F6PA 4NF6A 1NV3A 2PBWA 4N6PA 4ECFA 3TEPA 4XFEA 4GWXA 3QMFA 4EQ7A 4AB5A 4ZEBA 4EQ9A 3TDJA 4X48A 3TFLA 4WEDA 1H45A 4OYVA 2AL5A 3Q27A 1FJ9A 3PPNA 2I0CA 1B3HA 3UA8A 4I1DA 2E0SA 2P1SA 4IO3A 3CFLA 3KEIA 3IB0A 3OEMA 1B1XA 2ABHA 3OO7A 3TODA 1URGA 4Z0IA 5EQ7A 3H3GA 1MM6A 1OMPA 2B4MA 2W7YA 1JW1A 2REJA 2FHYA 5DVIA 3Q29A 4HE2A 3PV0E 1QJMA 4N17A 5DVJA 2ZNTA 2V93A 1MY1A 2I4BA 3TTNA 2H5YA 2Q2AA 2QVRA 1IZ1A 3GZGA 2UVJA 2DS9A 4YMBA 2ZZXA 3CSGA 4HE0A 4PETA 3L6HA 2ZZVA 4OFJA 2WBBA 1XOCA 4BDMA 1ELJA 4XEQA 4NF4A 3A09A 4R72A 1RDXA 1MPCA 3RPLA 2HQ0A 3VXBA 2VOZA 2Y7PA 5H8SA 3D4GA 2PT1A 2B3FA 3MAMA 4FE8A 1B05A 5M2VA 4MNCA 3N6UA 3PD9A 3K00A 4NF5A 1AOVA 5AA2D 2HZKA 3UP9A 3HHGA 5ELVA 2NWJA 1DTGA 1PEBA 1MXZA 5IM2A 2DE3A 3BIHA 4DZ1A 3DLNA 1LBWA 4Q0CA 1IXIA 1FQDA 2Z8FA 4I3YA 2OK2A 5I2KB 4R6HA 3LSFB 3IFAA 3K1PA 2ZNSA 1IMEA 4RK2A 1K9ZA 4MH5A 5KDTA 5I7IA 3EHUA 5IGAA 2GHAA 1Y20A 1XHYA 5I57B 3KBRA 4DI4B 2DP8A 3MWBA 2ZNUA 1SVXB 2QS2A 4NWCA 1MM7A 2CZLA 4LONB 4OFLA 4LZ8A 1PBPA 1LGBC 3G3JA 3TELA 2ZMBA 3FASA 4F29A 1B4ZA 4DDDA 4F3BA 4P0GA 4ZS9A 3ZKKA 1BKAA 4G68C 2DOJA 4H0WA 1EZOA 3QSLA 1SW5A 5CBRA 2FYIA 2WEFA 4R9FA 4PP0A 3FD3A 2D21A 1RDYA 3VXCA 1FTKA 4IO5A 3UORA 2D3IA 3EPEA 4DXUA 4QSDA 4ZEFA 5L9OA 3K0VA 2Z23A 3IO4A 4MF3A 1OVBA 1IITA 2VT5A 4O3AA 3PD8A 5ET8A 3IB2A 5LDZA 2RCAA 4ONYA 1OIBA 3KC0A 2JJKA 1SW4A 1DTZA 1UTBA 5L9MA 1FBPA 1RYOA 2YPNA 2FA7A 1WDNA 3CR9A 4MX6A 4EF1A 1RKMA 4NMYA 2X7QA 2CZHA 2RKMA 3QK6A 3MPKA 4ZEDA 1JW5A 4FORA 1Q35A 4HTGA 4KXPA 3OEKA 4MCOA 2X26A 2DQVA 1LAHE 3O28A 1VFEA 4POWA 2DXYA 1NFTA 1M5EA 3FBPA 3FXBA 2A5SA 2H99A 1B7UA 1B3GA 4X8RA 3I5OA 3T96B 3H6WA 3H03A 1ZLQA 1R9QA 2V3UA 5DTBA 1DBZA 2XXQA 1MY3A 1I6QA 4PCDA 4OVJA 2X7PA 1EYKA 1IMBA 2PMSA 4I9DA 4N8GA 4WKMA 1NMUA 4EXLA 4ZDMA 2AYSA 1N7XA 1B46A 4N6DA 1US4A 5AA2A 1QUIA 4GVOA 4GWWA 5K2YA 1Y1MA 3VVEA 3FV2A 2XX8A 1DPPA 3IL1B 2HPGA 1ZKBA 1JVXA 3LR1A 3VVFA 3KFMA 4OQOA 1KZ8A 1FPIA 4KI0E 2XD3A 4X9TA 1B7ZA 1LFHA 1MQIA 4YKKA 1II5A 4M1VA 3HPIA 1N76A 1MQDA 3N94A 3U93A 1UTHA 4Q8RA 4GBWA 4GL0A 1NH7A 3HO7A 4OVQA 4P1EA 2XWOA 4PFWA 5AA4B 2XX9A 3MJNA 3U65A 4HW8A 2QRYA 3CFZA 3HSTA 5ICQA 2VP1A 4WXJA 3OXNA 2DE2A 1AH5A 3K1MA 2F6GA 4QHQA 4PAFA 4OWDA 3SDFA 1FBEA 4F18A 3B6TA 5JTYB 3M8UA 2ZYOA 4U1ZA 2XXRA 4P3LA 1D9VA 2DXRA 4JWOA 1LB9A
chains in the Genus database with same CATH topology
3G7WA 3FJMA 3TQLA 1SQYA 2E1SA 2ZYKA 3FGSA 5FHOA 4XKNA 2THIA 4QFOA 3K6UA 5J1DA 4IB2A 1CB6A 3PUYE 3FVKA 2GRVA 5CRYA 4H5GA 1N84A 4JWYA 1EU8A 2QSXA 3C4MA 1TXFA 1DOTA 2O84X 3IK6B 3LUYA 5I2NA 4G68A 4KYEA 4ZECA 3TCGA 3S4UA 2VGQA 3QUFA 2XXXA 5H8HB 4U4SA 1LBBA 4XXUA 2XXYA 3O9PA 2HFBA 5FHNA 1MH3A 4R2FA 5BWJA 5I58A 3W9VA 3W15C 5AE4A 3EHTA 2O68A 4YB7A 1YCJA 2DWIA 5EHMA 1FQFA 3PUVE 3SEYA 3EQ1A 3T9UA 1LAXA 2RC7A 2DE4A 2LAOA 3RTFB 4C1UA 3WAFA 3C33A 1YPNA 3T22A 3VLWA 3KG2A 3P7IA 2DWJA 3MVWA 3QUJA 3FVOA 4ZE9A 2G93A 3B6WA 1SYHA 4YAHX 4N07A 3OO9A 1B5JA 4NF8A 3UIFA 2HCAA 3E4RA 3IOUA 3SEVA 1TWYA 4JSDA 4XKQA 1BLFA 4HCYA 2OJTA 2I3VA 5FHMA 1NKXA 3OELA 3PMVA 1IUDA 4OFOA 3PU5A 2Y7KA 4U23A 3PPQA 1MRPA 1SBPA 4KHZE 1ZIUA 5KCJB 3K02A 2H4IA 3SESA 3DP8A 1NNPA 2Z8EA 3U8QA 2IA4A 1NNKA 2NXOA 4THIA 3SEWA 5H8QB 4IGRA 3QAXA 1FTOA 2NVUB 1LCTA 4MBPA 4NF6B 5IAIA 4YMAA 3M3KA 3IOTA 4DCYA 5TPAA 1O63A 1OLCA 3N6TA 3CG3A 3MBPA 2F34A 4P0IA 4F2OA 5HPQA 4F1VA 4U1OA 3OSRA 1VSOA 3IOWA 4H67A 4ZZAA 3MZ9A 3THIA 4Q5TA 1YTVA 2F35A 3HV1A 4JXIA 1PB8A 3V8XB 4G77A 2A5TA 1NH8A 1PB7A 3BFTA 3S9LC 4FEBA 1UQWA 2UVIA 5I59A 5A5XA 1POTA 3QIMA 1S7YA 5F7VA 4IY6A 4JWXA 4QFLA 1OQHA 1ZTYA 3RQTA 3ZKLA 2I0BA 2Y7RA 3C36A 3C34A 3T9XB 3K4UA 1B32A 1A8FA 4OZ9A 4WEPA 3H06B 4ESXA 3V5AA 5ISUA 5EYFA 3G3IA 4DE8A 1IXHA 4KPTA 3N26A 4NF4B 2RCBA 4ZE8A 5H8FA 2BJJX 2H9BA 4RA1A 1UIUA 2Q89A 1LB8A 3M3LA 1FTJA 3B6QA 2F36A 1F9BA 3LSWA 4JSOA 4NF5B 3CFXA 3OO8A 1I6BA 2PX1A 5IKBA 3FJ7A 4QSEA 1PC3A 1TFDA 1AL3A 4DCXA 3UK4A 4FJPA 3V89B 4YKPA 1B3EA 4C0RA 3PPRA 1R6ZA 5JEIA 3H6VA 4R73A 1LCFA 2V25A 3O6GA 1P1UA 5KDTB 5ITOA 3HHFA 3FUZA 3RT6B 4LQ5A 3T93B 1XC1A 1H3DA 3KZGA 4BDNA 1MH4A 3R7XA 3U92A 1A7LA 4OEUA 4PFUA 1B2HA 3AXFA 2UXAA 1ZJLA 1EZ9A 1MY2A 4AB6A 3BKIB 1QUKA 1O64A 4GL8A 1ZMGA 2ONKE 4O3BA 1Q1KA 4OETA 3IAZA 4OERA 2P0SA 4OENA 3S9MC 1H44A 2UYEA 3KN3A 3C9HA 3MC2A 1UTBB 1IXCA 2NUVA 2HXWA 1URDA 1B58A 1S50A 4POXA 4XKPA 1MY4A 3KSXA 1FQBA 3G3HA 2I3WA 1ANFA 2XXVA 2CMOA 4E0WA 1I6AA 4M4GA 3TTRA 1GVCA 3S9NC 1SI0A 3G3FA 4TLLB 1MG1A 4H1XA 3KJTA 1Y4CA 4IO2A 1NNTA 3FVNA 3C31A 4RJZA 2D5WA 2HAUA 1OLAA 1Y3NA 3TZAA 1FQAA 1ZBMA 1Y4TA 2V3QA 3V83A 1HSEA 2V3TA 3LSXA 5DEXA 3GXAA 3O66A 4U22A 2OWSA 2VD2A 3HCQA 3OO6A 3PMWA 2HAVA 2QJEA 2IEEA 2I49A 5ICTA 4QSCA 1MXYA 3TMGA 4OTEA 4GD5A 3K6XA 4QFPA 2XXWA 4FATA 5AA2B 2I6EA 1P1WA 2Y84A 3DP6A 2QS4A 5CMKA 2O7UA 5H8NA 3L6GA 1NL5A 3VLVA 5TP9A 3I6VA 4MFIA 2QPQA 2F5XA 1P1OA 1Z7ME 2Q9TA 2OCUA 4ISUA 2F7CA 3RGYA 4F22A 3TUSA 1B6HA 4F1UA 2F8DA 1UTHB 4MLVA 4OESA 3TPAA 1LFIA 4LQ2A 1LAGE 1WVJA 5I56A 4PFTA 3VLUA 1MDP1 1MXUA 3MVXA 4R2BA 3JZJA 1N3WA 4ZEKA 3RNNA 1FW0A 2H25A 1MQJA 3EF7A 2HZLA 3FV1A 1FQEA 5H8NB 3Q28A 1JVYA 3FXQA 3G3GA 4XIGQ 3KOSA 4F3PA 1JW4A 1S9TA 1B52A 3C35A 4KD5A 5JK4A 2UYFA 3T66A 3E3KA 2P2AA 1VFDA 1HSLA 1R9LA 3DELB 2O69A 3SEUA 2OWTA 1B1HA 1PBQA 3U72A 4YB6A 4I8CA 1Y9UA 1PDAA 1SW1A 3K01A 1CE2A 3OD7A 2KLFA 4P11A 4YU0A 2R6GE 1VR5A 1P99A 3FXRA 1MS7A 4GXSB 3ONMA 3K6WA 4BDLA 2WKYA 4GWOA 1SDXA 4RK9A 3N5LA 3S9EA 5I2NB 4JB7A 4G68B 3IORA 3EHSA 1D4NA 3TQWA 1MQHA 3OMBA 4G8MA 3PPOA 5BUUA 4Z7EA 3CSBA 3ECRA 3KN8A 3TTMA 4F31B 2DWAA 1OQGA 4IO7A 3U1OA 4KFQA 4JDFA 3PMXA 5DT6A 3MVZA 4G2ZA 2G29A 5I58B 3TTLA 3MPLA 4F19A 3UN6A 1B0HA 1B0LA 1TT1A 3VDFA 4ESWA 3RLFE 2O1LA 1AIVA 3FVGA 1N3XA 1XS5A 3MQ9A 3VFJA 2DWHA 5L9SA 1BIYA 1BP5A 2Q8JA 4YICA 1GTKA 1QKAA 2F7AA 4LUBA 1Y3QA 5KZTA 3C32A 4FEDA 2I58A 3B7DA 3GBAA 3OSQA 1DPEA 3GBBA 4G8NA 1J1NA 3F11A 2OLBA 1D3KA 4GRKA 4NF8B 1B40A 4FIMA 4GXAA 3ODBA 4KCDA 4NEDA 5DVFA 5ITPA 3CRBA 4EF2A 3QYTA 4ELQA 3KJ7A 2YJPA 1QULA 3CIJA 3TCFA 1Y3PA 3O6HA 2XXIA 1ATGA 2UVHA 1B5HA 1HSJA 4IY5A 4ZEIA 2XHDA 3VV5A 1L5TA 1SD3A 3KOTA 1FTMA 1UIVA 4R6YA 1LLSA 4BDRA 4TOZA 4EQBA 4BDOA 1SW2A 4OHNA 3BBRA 5TPAB 2O1MA 2ZYMA 3TAJA 3BFUA 2PT2A 3LBSA 1LFGA 3PGFA 3CI8A 1P1NA 3A3CA 4E0XA 1POY1 5I2KA 4YZZA 4YKJA 1MXVA 4F2QA 2ESNA 5AA3A 3PUZE 4OMBA 1D9YA 4IO4A 4I62A 3K2DA 2RF1A 2A5TB 4HS7A 1LBCA 5I57A 1R1NA 3R26A 1H43A 5FTHA 3VE1B 3PUWE 1NNFA 4H5FA 2REGA 3MUQA 3RY3A 4N13A 4GIZA 1USYE 5CI5A 2R71A 5I59B 3FZVA 2I4CA 1Y1ZA 4UACA 4LA9A 1MQGA 4X1BA 5A5XB 4RYAA 2Y7WA 3CG1A 1RYXA 2Q2CA 4U21A 4F3GA 4KYSA 3IJOB 3MP1A 4NWDA 3E13X 3T9VA 2O6AA 2O7IA 4RY1A 3QXMA 1M5CA 1QVSA 4PQJA 5H8FB 5LOMA 2FNCA 1LAFE 1XVYA 1B5IA 2XD2A 2XX7A 3TTKA 3W9WA 4YKIA 4XKRA 3E9XA 2ANJA 4BDQA 1EH3A 4JBZA 5FTIA 2DSFA 1Z7NE 4IGTA 2VD3A 2QMWA 4KR5A 2XXUA 1M5BA 5AA1A 3MZ1A 3FJGA 3UGWA 5CC2A 4QRZA 3JYRA 4ELOA 1OVTA 3RTWB 1A55A 3G3KA 1N0TA 3PUXE 1WODA 2XXPA 2Y7IA 5K2XA 1JNFA 3MVYA 4IO6A 1A99A 2QMXA 4LZ5A 3FIRA 4G8HA 4BLAA 3FXUA 4RXLA 5CBSA 1I69A 2RC9A 4GQOA 4MLQA 1MPBA 2VHAA 1USYH 2GH9A 4R75A 1FCKA 3IO6A 2B65A 1TFAA 4OXVA 2GHBA 2NOOA 3H6UA 4DXCA 1H76A 2ALUA 4F3SA 5HBCA 1MPDA 1JQFA 1MDQA 1ZU0A 2F78A 3IJXB 3RN8A 4R9GA 2B3BA 2QL3A 4Q30B 1LSTA 4OEVA 2RINA 2DVCA 3S2VA 4HCWA 3GLBA 3O29A 3LC8A 1IQ7A 4TLMB 5EHSA 1A40A 3PPPA 1MXWA 4GF8A 4EDPA 3M3FA 4AQ4A 3H6TA 3LSLA 1IIWA 2YLNA 1SYIA 4RPOA 4C1TA 1AMFA 5CM6A 1B4HA 2ZYNA 1KWHA 4R6KA 2M8CA 4R74A 2GFEA 2I48A 1JEVA 1P1QA 4O3CA 4XTCQ 1GR2A 3MP8A 4ELPA 2Z8DA 4EUOA 1JETA 1QW0A 5F1QA 4QFKA 1MY0A 1XVXA 5AA4A 3ZS6A 4EXKA 1O7TA 3KSJA 4NE4A 2RC8A 4QFNA 2Z22A 1US5A 3MZBA 3O97A 5TU0A 3OENA 3VVDA 2OZZA 5I84A 2AL4A 4KCCA 5JTYA 1T0KA 2PYYA 3K6VA 1A54A 2AIXA 3KN7A 1B3FA 3I3VA 4F39A 1M5FA 1VE4A 3CVGA 3IX1A 3ILUB 3U94A 5CMBA 3IOVA 3RPWA 1XT8A 1A8EA 3MP6A 4U4XA 5DEXB 1GGGA 4UA8A 2O51A 1DSNA 4G4PA 2DVZA 3Q25A 4L17A 4PFYA 4GFRA 2V84A 3IB1A 2UVGA 1GV8A 4FAJA 1B9JA 1MXXA 4RPNA 2QS1A 4PE5B 2F7BA 1B7HA 3O2AA 3SETA 4ELRA 3D4CA 5B70A 3IR1A 4LVQA 2H98A 4TQUQ 1N04A 1M5DA 3RUMA 4KYDA 4NTLA 5CMMA 5CMCA 5H8HA 3OOAA 3T9HB 1DMBA 4ZZEA 2Q88A 5TP9B 2DYXA 4K3FA 3SEXA 4QF9A 2PVUA 4GLIA 3H4ZA 4LZ7A 3ZSFA 4LP2B 4X1DA 5DYHA 1PB9A 4GOTA 4KQPA 3USDA 5HM4B 5I56B 1N7WA 3DP4A 4H65A 1IXGA 3DM0A 3HN0A 5B7DA 3EN3A 3Q26A 1FTLA 1YAEA 3SKPA 1EZPA 2XXTA 3TCHA 4LATA 3A3UA 4RNSA 3FATA 2ONSA 4DLDA 3MW0A 3O6IA 1B3LA 3TKDA 1IEJA 1BTJA 3KGCA 1FQCA 2HEUA 2XXHA 4DXBA 2QS3A 1URSA 2ONRA 4F1YA 2OBGA 4DIGA 5L8DA 4FECA 3RT8A 1QUJA 2ZXTA 5KCJA 1QKBA 2F97A 4H6DA 4H8JA 3JV9A 1JEUA 1SI1A 4H8IA 3H7MA 4YB5A 4U2RA 3SERA 3WAEA 3R6UA 3TYHA 1B51A 3K1NA 5H8QA 4ND9A 3ILTB 2R9JA 2F6PA 4NF6A 2PBWA 4N6PA 4ECFA 3TEPA 4EQ7A 4AB5A 4ZEBA 4EQ9A 3TDJA 4X48A 3TFLA 4WEDA 1H45A 4OYVA 2AL5A 3Q27A 3PPNA 2I0CA 1B3HA 3UA8A 4I1DA 2E0SA 2P1SA 4IO3A 3CFLA 3KEIA 3IB0A 3OEMA 1B1XA 2ABHA 3OO7A 3TODA 1URGA 4Z0IA 3H3GA 1MM6A 1OMPA 2W7YA 1JW1A 2REJA 5DVIA 3Q29A 3PV0E 1QJMA 5DVJA 2ZNTA 2V93A 1MY1A 2I4BA 3TTNA 2H5YA 2Q2AA 1IZ1A 3GZGA 2UVJA 2DS9A 4YMBA 3CSGA 4PETA 3L6HA 4OFJA 1XOCA 4BDMA 1ELJA 4NF4A 3A09A 4R72A 1MPCA 2HQ0A 3VXBA 2VOZA 2Y7PA 5H8SA 3D4GA 2PT1A 2B3FA 3MAMA 4FE8A 1B05A 5M2VA 3N6UA 3PD9A 3K00A 4NF5A 1AOVA 5AA2D 2HZKA 3UP9A 3HHGA 5ELVA 2NWJA 1DTGA 1PEBA 1MXZA 2DE3A 4DZ1A 3DLNA 4Q0CA 1IXIA 1FQDA 2Z8FA 2OK2A 5I2KB 4R6HA 3LSFB 3K1PA 2ZNSA 4RK2A 4MH5A 5KDTA 3EHUA 2GHAA 1Y20A 1XHYA 5I57B 3KBRA 2DP8A 3MWBA 2ZNUA 1SVXB 2QS2A 4NWCA 1MM7A 2CZLA 4LONB 4OFLA 4LZ8A 1PBPA 1LGBC 3G3JA 3TELA 2ZMBA 3FASA 4F29A 1B4ZA 4DDDA 4F3BA 4P0GA 4ZS9A 3ZKKA 1BKAA 4G68C 2DOJA 4H0WA 1EZOA 3QSLA 1SW5A 5CBRA 2FYIA 4R9FA 4PP0A 3FD3A 2D21A 3VXCA 1FTKA 4IO5A 3UORA 2D3IA 3EPEA 4DXUA 4QSDA 4ZEFA 5L9OA 3K0VA 2Z23A 3IO4A 4MF3A 1OVBA 1IITA 4O3AA 3PD8A 3IB2A 2RCAA 4ONYA 1OIBA 1SW4A 1DTZA 1UTBA 5L9MA 1RYOA 2YPNA 2FA7A 1WDNA 3CR9A 4EF1A 1RKMA 4NMYA 2X7QA 2RKMA 3QK6A 3MPKA 4ZEDA 1JW5A 4FORA 1Q35A 4HTGA 3OEKA 2X26A 2DQVA 1LAHE 3O28A 1VFEA 4POWA 2DXYA 1NFTA 1M5EA 2A5SA 2H99A 1B7UA 1B3GA 3I5OA 3T96B 3H6WA 3H03A 1ZLQA 1R9QA 2V3UA 5DTBA 2XXQA 1MY3A 1I6QA 4OVJA 2X7PA 2PMSA 4I9DA 4WKMA 1NMUA 4EXLA 4ZDMA 2AYSA 1N7XA 1B46A 1US4A 5AA2A 1QUIA 4GVOA 5K2YA 1Y1MA 3VVEA 3FV2A 2XX8A 1DPPA 3IL1B 1ZKBA 1JVXA 3LR1A 3VVFA 3KFMA 4OQOA 4KI0E 2XD3A 4X9TA 1B7ZA 1LFHA 1MQIA 4YKKA 1II5A 4M1VA 3HPIA 1N76A 1MQDA 3N94A 3U93A 1UTHA 4Q8RA 4GL0A 1NH7A 3HO7A 4PFWA 5AA4B 2XX9A 3MJNA 4HW8A 2QRYA 3CFZA 3HSTA 5ICQA 2VP1A 4WXJA 3OXNA 2DE2A 1AH5A 3K1MA 2F6GA 4QHQA 4OWDA 3SDFA 4F18A 3B6TA 5JTYB 3M8UA 2ZYOA 4U1ZA 2XXRA 1D9VA 2DXRA 4JWOA 1LB9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G7W A;  3FJM A;  3TQL A;  1SQY A;  2E1S A;  2ZYK A;  3FGS A;  5FHO A;  4XKN A;  2THI A;  4QFO A;  3K6U A;  5J1D A;  4IB2 A;  1CB6 A;  3PUY E;  3FVK A;  2GRV A;  5CRY A;  4H5G A;  1N84 A;  4JWY A;  1EU8 A;  2QSX A;  3C4M A;  1TXF A;  1DOT A;  2O84 X;  3IK6 B;  3LUY A;  5I2N A;  4G68 A;  4KYE A;  4ZEC A;  3TCG A;  3S4U A;  2VGQ A;  3QUF A;  2XXX A;  5H8H B;  4U4S A;  1LBB A;  4XXU A;  2XXY A;  3O9P A;  2HFB A;  5FHN A;  1MH3 A;  4R2F A;  5BWJ A;  5I58 A;  3W9V A;  3W15 C;  5AE4 A;  3EHT A;  2O68 A;  4YB7 A;  1YCJ A;  2DWI A;  5EHM A;  1FQF A;  3PUV E;  3SEY A;  3EQ1 A;  3T9U A;  1LAX A;  2RC7 A;  2DE4 A;  2LAO A;  3RTF B;  4C1U A;  3WAF A;  3C33 A;  1YPN A;  3T22 A;  3VLW A;  3KG2 A;  3P7I A;  2DWJ A;  3MVW A;  3QUJ A;  3FVO A;  4ZE9 A;  2G93 A;  3B6W A;  1SYH A;  4YAH X;  4N07 A;  3OO9 A;  1B5J A;  4NF8 A;  3UIF A;  2HCA A;  3E4R A;  3IOU A;  3SEV A;  1TWY A;  4JSD A;  4XKQ A;  1BLF A;  4HCY A;  2OJT A;  2I3V A;  5FHM A;  1NKX A;  3OEL A;  3PMV A;  1IUD A;  4OFO A;  3PU5 A;  2Y7K A;  4U23 A;  3PPQ A;  1MRP A;  1SBP A;  4KHZ E;  1ZIU A;  5KCJ B;  3K02 A;  2H4I A;  3SES A;  3DP8 A;  1NNP A;  2Z8E A;  3U8Q A;  2IA4 A;  1NNK A;  2NXO A;  4THI A;  3SEW A;  5H8Q B;  4IGR A;  3QAX A;  1FTO A;  2NVU B;  1LCT A;  4MBP A;  4NF6 B;  5IAI A;  4YMA A;  3M3K A;  3IOT A;  4DCY A;  5TPA A;  1O63 A;  1OLC A;  3N6T A;  3CG3 A;  3MBP A;  2F34 A;  4P0I A;  4F2O A;  5HPQ A;  4F1V A;  4U1O A;  3OSR A;  1VSO A;  3IOW A;  4H67 A;  4ZZA A;  3MZ9 A;  3THI A;  4Q5T A;  1YTV A;  2F35 A;  3HV1 A;  4JXI A;  1PB8 A;  3V8X B;  4G77 A;  2A5T A;  1NH8 A;  1PB7 A;  3BFT A;  3S9L C;  4FEB A;  1UQW A;  2UVI A;  5I59 A;  5A5X A;  1POT A;  3QIM A;  1S7Y A;  5F7V A;  4IY6 A;  4JWX A;  4QFL A;  1OQH A;  1ZTY A;  3RQT A;  3ZKL A;  2I0B A;  2Y7R A;  3C36 A;  3C34 A;  3T9X B;  3K4U A;  1B32 A;  1A8F A;  4OZ9 A;  4WEP A;  3H06 B;  4ESX A;  3V5A A;  5ISU A;  5EYF A;  3G3I A;  4DE8 A;  1IXH A;  4KPT A;  3N26 A;  4NF4 B;  2RCB A;  4ZE8 A;  5H8F A;  2BJJ X;  2H9B A;  4RA1 A;  1UIU A;  2Q89 A;  1LB8 A;  3M3L A;  1FTJ A;  3B6Q A;  2F36 A;  1F9B A;  3LSW A;  4JSO A;  4NF5 B;  3CFX A;  3OO8 A;  1I6B A;  2PX1 A;  5IKB A;  3FJ7 A;  4QSE A;  1PC3 A;  1TFD A;  1AL3 A;  4DCX A;  3UK4 A;  4FJP A;  3V89 B;  4YKP A;  1B3E A;  4C0R A;  3PPR A;  1R6Z A;  5JEI A;  3H6V A;  4R73 A;  1LCF A;  2V25 A;  3O6G A;  1P1U A;  5KDT B;  5ITO A;  3HHF A;  3FUZ A;  3RT6 B;  4LQ5 A;  3T93 B;  1XC1 A;  1H3D A;  3KZG A;  4BDN A;  1MH4 A;  3R7X A;  3U92 A;  1A7L A;  4OEU A;  4PFU A;  1B2H A;  3AXF A;  2UXA A;  1ZJL A;  1EZ9 A;  1MY2 A;  4AB6 A;  3BKI B;  1QUK A;  1O64 A;  4GL8 A;  1ZMG A;  2ONK E;  4O3B A;  1Q1K A;  4OET A;  3IAZ A;  4OER A;  2P0S A;  4OEN A;  3S9M C;  1H44 A;  2UYE A;  3KN3 A;  3C9H A;  3MC2 A;  1UTB B;  1IXC A;  2NUV A;  2HXW A;  1URD A;  1B58 A;  1S50 A;  4POX A;  4XKP A;  1MY4 A;  3KSX A;  1FQB A;  3G3H A;  2I3W A;  1ANF A;  2XXV A;  2CMO A;  4E0W A;  1I6A A;  4M4G A;  3TTR A;  1GVC A;  3S9N C;  1SI0 A;  3G3F A;  4TLL B;  1MG1 A;  4H1X A;  3KJT A;  1Y4C A;  4IO2 A;  1NNT A;  3FVN A;  3C31 A;  4RJZ A;  2D5W A;  2HAU A;  1OLA A;  1Y3N A;  3TZA A;  1FQA A;  1ZBM A;  1Y4T A;  2V3Q A;  3V83 A;  1HSE A;  2V3T A;  3LSX A;  5DEX A;  3GXA A;  3O66 A;  4U22 A;  2OWS A;  2VD2 A;  3HCQ A;  3OO6 A;  3PMW A;  2HAV A;  2QJE A;  2IEE A;  2I49 A;  5ICT A;  4QSC A;  1MXY A;  3TMG A;  4OTE A;  4GD5 A;  3K6X A;  4QFP A;  2XXW A;  4FAT A;  5AA2 B;  2I6E A;  1P1W A;  2Y84 A;  3DP6 A;  2QS4 A;  5CMK A;  2O7U A;  5H8N A;  3L6G A;  1NL5 A;  3VLV A;  5TP9 A;  3I6V A;  4MFI A;  2QPQ A;  2F5X A;  1P1O A;  1Z7M E;  2Q9T A;  2OCU A;  4ISU A;  2F7C A;  3RGY A;  4F22 A;  3TUS A;  1B6H A;  4F1U A;  2F8D A;  1UTH B;  4MLV A;  4OES A;  3TPA A;  1LFI A;  4LQ2 A;  1LAG E;  1WVJ A;  5I56 A;  4PFT A;  3VLU A;  1MDP 1;  1MXU A;  3MVX A;  4R2B A;  3JZJ A;  1N3W A;  4ZEK A;  3RNN A;  1FW0 A;  2H25 A;  1MQJ A;  3EF7 A;  2HZL A;  3FV1 A;  1FQE A;  5H8N B;  3Q28 A;  1JVY A;  3FXQ A;  3G3G A;  4XIG Q;  3KOS A;  4F3P A;  1JW4 A;  1S9T A;  1B52 A;  3C35 A;  4KD5 A;  5JK4 A;  2UYF A;  3T66 A;  3E3K A;  2P2A A;  1VFD A;  1HSL A;  1R9L A;  3DEL B;  2O69 A;  3SEU A;  2OWT A;  1B1H A;  1PBQ A;  3U72 A;  4YB6 A;  4I8C A;  1Y9U A;  1PDA A;  1SW1 A;  3K01 A;  1CE2 A;  3OD7 A;  2KLF A;  4P11 A;  4YU0 A;  2R6G E;  1VR5 A;  1P99 A;  3FXR A;  1MS7 A;  4GXS B;  3ONM A;  3K6W A;  4BDL A;  2WKY A;  4GWO A;  1SDX A;  4RK9 A;  3N5L A;  3S9E A;  5I2N B;  4JB7 A;  4G68 B;  3IOR A;  3EHS A;  1D4N A;  3TQW A;  1MQH A;  3OMB A;  4G8M A;  3PPO A;  5BUU A;  4Z7E A;  3CSB A;  3ECR A;  3KN8 A;  3TTM A;  4F31 B;  2DWA A;  1OQG A;  4IO7 A;  3U1O A;  4KFQ A;  4JDF A;  3PMX A;  5DT6 A;  3MVZ A;  4G2Z A;  2G29 A;  5I58 B;  3TTL A;  3MPL A;  4F19 A;  3UN6 A;  1B0H A;  1B0L A;  1TT1 A;  3VDF A;  4ESW A;  3RLF E;  2O1L A;  1AIV A;  3FVG A;  1N3X A;  1XS5 A;  3MQ9 A;  3VFJ A;  2DWH A;  5L9S A;  1BIY A;  1BP5 A;  2Q8J A;  4YIC A;  1GTK A;  1QKA A;  2F7A A;  4LUB A;  1Y3Q A;  5KZT A;  3C32 A;  4FED A;  2I58 A;  3B7D A;  3GBA A;  3OSQ A;  1DPE A;  3GBB A;  4G8N A;  1J1N A;  3F11 A;  2OLB A;  1D3K A;  4GRK A;  4NF8 B;  1B40 A;  4FIM A;  4GXA A;  3ODB A;  4KCD A;  4NED A;  5DVF A;  5ITP A;  3CRB A;  4EF2 A;  3QYT A;  4ELQ A;  3KJ7 A;  2YJP A;  1QUL A;  3CIJ A;  3TCF A;  1Y3P A;  3O6H A;  2XXI A;  1ATG A;  2UVH A;  1B5H A;  1HSJ A;  4IY5 A;  4ZEI A;  2XHD A;  3VV5 A;  1L5T A;  1SD3 A;  3KOT A;  1FTM A;  1UIV A;  4R6Y A;  1LLS A;  4BDR A;  4TOZ A;  4EQB A;  4BDO A;  1SW2 A;  4OHN A;  3BBR A;  5TPA B;  2O1M A;  2ZYM A;  3TAJ A;  3BFU A;  2PT2 A;  3LBS A;  1LFG A;  3PGF A;  3CI8 A;  1P1N A;  3A3C A;  4E0X A;  1POY 1;  5I2K A;  4YZZ A;  4YKJ A;  1MXV A;  4F2Q A;  2ESN A;  5AA3 A;  3PUZ E;  4OMB A;  1D9Y A;  4IO4 A;  4I62 A;  3K2D A;  2RF1 A;  2A5T B;  4HS7 A;  1LBC A;  5I57 A;  1R1N A;  3R26 A;  1H43 A;  5FTH A;  3VE1 B;  3PUW E;  1NNF A;  4H5F A;  2REG A;  3MUQ A;  3RY3 A;  4N13 A;  4GIZ A;  1USY E;  5CI5 A;  2R71 A;  5I59 B;  3FZV A;  2I4C A;  1Y1Z A;  4UAC A;  4LA9 A;  1MQG A;  4X1B A;  5A5X B;  4RYA A;  2Y7W A;  3CG1 A;  1RYX A;  2Q2C A;  4U21 A;  4F3G A;  4KYS A;  3IJO B;  3MP1 A;  4NWD A;  3E13 X;  3T9V A;  2O6A A;  2O7I A;  4RY1 A;  3QXM A;  1M5C A;  1QVS A;  4PQJ A;  5H8F B;  5LOM A;  2FNC A;  1LAF E;  1XVY A;  1B5I A;  2XD2 A;  2XX7 A;  3TTK A;  3W9W A;  4YKI A;  4XKR A;  3E9X A;  2ANJ A;  4BDQ A;  1EH3 A;  4JBZ A;  5FTI A;  2DSF A;  1Z7N E;  4IGT A;  2VD3 A;  2QMW A;  4KR5 A;  2XXU A;  1M5B A;  5AA1 A;  3MZ1 A;  3FJG A;  3UGW A;  5CC2 A;  4QRZ A;  3JYR A;  4ELO A;  1OVT A;  3RTW B;  1A55 A;  3G3K A;  1N0T A;  3PUX E;  1WOD A;  2XXP A;  2Y7I A;  5K2X A;  1JNF A;  3MVY A;  4IO6 A;  1A99 A;  2QMX A;  4LZ5 A;  3FIR A;  4G8H A;  4BLA A;  3FXU A;  4RXL A;  5CBS A;  1I69 A;  2RC9 A;  4GQO A;  4MLQ A;  1MPB A;  2VHA A;  1USY H;  2GH9 A;  4R75 A;  1FCK A;  3IO6 A;  2B65 A;  1TFA A;  4OXV A;  2GHB A;  2NOO A;  3H6U A;  4DXC A;  1H76 A;  2ALU A;  4F3S A;  5HBC A;  1MPD A;  1JQF A;  1MDQ A;  1ZU0 A;  2F78 A;  3IJX B;  3RN8 A;  4R9G A;  2B3B A;  2QL3 A;  4Q30 B;  1LST A;  4OEV A;  2RIN A;  2DVC A;  3S2V A;  4HCW A;  3GLB A;  3O29 A;  3LC8 A;  1IQ7 A;  4TLM B;  5EHS A;  1A40 A;  3PPP A;  1MXW A;  4GF8 A;  4EDP A;  3M3F A;  4AQ4 A;  3H6T A;  3LSL A;  1IIW A;  2YLN A;  1SYI A;  4RPO A;  4C1T A;  1AMF A;  5CM6 A;  1B4H A;  2ZYN A;  1KWH A;  4R6K A;  2M8C A;  4R74 A;  2GFE A;  2I48 A;  1JEV A;  1P1Q A;  4O3C A;  4XTC Q;  1GR2 A;  3MP8 A;  4ELP A;  2Z8D A;  4EUO A;  1JET A;  1QW0 A;  5F1Q A;  4QFK A;  1MY0 A;  1XVX A;  5AA4 A;  3ZS6 A;  4EXK A;  1O7T A;  3KSJ A;  4NE4 A;  2RC8 A;  4QFN A;  2Z22 A;  1US5 A;  3MZB A;  3O97 A;  5TU0 A;  3OEN A;  3VVD A;  2OZZ A;  5I84 A;  2AL4 A;  4KCC A;  5JTY A;  1T0K A;  2PYY A;  3K6V A;  1A54 A;  2AIX A;  3KN7 A;  1B3F A;  3I3V A;  4F39 A;  1M5F A;  1VE4 A;  3CVG A;  3IX1 A;  3ILU B;  3U94 A;  5CMB A;  3IOV A;  3RPW A;  1XT8 A;  1A8E A;  3MP6 A;  4U4X A;  5DEX B;  1GGG A;  4UA8 A;  2O51 A;  1DSN A;  4G4P A;  2DVZ A;  3Q25 A;  4L17 A;  4PFY A;  4GFR A;  2V84 A;  3IB1 A;  2UVG A;  1GV8 A;  4FAJ A;  1B9J A;  1MXX A;  4RPN A;  2QS1 A;  4PE5 B;  2F7B A;  1B7H A;  3O2A A;  3SET A;  4ELR A;  3D4C A;  5B70 A;  3IR1 A;  4LVQ A;  2H98 A;  4TQU Q;  1N04 A;  1M5D A;  3RUM A;  4KYD A;  4NTL A;  5CMM A;  5CMC A;  5H8H A;  3OOA A;  3T9H B;  1DMB A;  4ZZE A;  2Q88 A;  5TP9 B;  2DYX A;  4K3F A;  3SEX A;  4QF9 A;  2PVU A;  4GLI A;  3H4Z A;  4LZ7 A;  3ZSF A;  4LP2 B;  4X1D A;  5DYH A;  1PB9 A;  4GOT A;  4KQP A;  3USD A;  5HM4 B;  5I56 B;  1N7W A;  3DP4 A;  4H65 A;  1IXG A;  3DM0 A;  3HN0 A;  5B7D A;  3EN3 A;  3Q26 A;  1FTL A;  1YAE A;  3SKP A;  1EZP A;  2XXT A;  3TCH A;  4LAT A;  3A3U A;  4RNS A;  3FAT A;  2ONS A;  4DLD A;  3MW0 A;  3O6I A;  1B3L A;  3TKD A;  1IEJ A;  1BTJ A;  3KGC A;  1FQC A;  2HEU A;  2XXH A;  4DXB A;  2QS3 A;  1URS A;  2ONR A;  4F1Y A;  2OBG A;  4DIG A;  5L8D A;  4FEC A;  3RT8 A;  1QUJ A;  2ZXT A;  5KCJ A;  1QKB A;  2F97 A;  4H6D A;  4H8J A;  3JV9 A;  1JEU A;  1SI1 A;  4H8I A;  3H7M A;  4YB5 A;  4U2R A;  3SER A;  3WAE A;  3R6U A;  3TYH A;  1B51 A;  3K1N A;  5H8Q A;  4ND9 A;  3ILT B;  2R9J A;  2F6P A;  4NF6 A;  2PBW A;  4N6P A;  4ECF A;  3TEP A;  4EQ7 A;  4AB5 A;  4ZEB A;  4EQ9 A;  3TDJ A;  4X48 A;  3TFL A;  4WED A;  1H45 A;  4OYV A;  2AL5 A;  3Q27 A;  3PPN A;  2I0C A;  1B3H A;  3UA8 A;  4I1D A;  2E0S A;  2P1S A;  4IO3 A;  3CFL A;  3KEI A;  3IB0 A;  3OEM A;  1B1X A;  2ABH A;  3OO7 A;  3TOD A;  1URG A;  4Z0I A;  3H3G A;  1MM6 A;  1OMP A;  2W7Y A;  1JW1 A;  2REJ A;  5DVI A;  3Q29 A;  3PV0 E;  1QJM A;  5DVJ A;  2ZNT A;  2V93 A;  1MY1 A;  2I4B A;  3TTN A;  2H5Y A;  2Q2A A;  1IZ1 A;  3GZG A;  2UVJ A;  2DS9 A;  4YMB A;  3CSG A;  4PET A;  3L6H A;  4OFJ A;  1XOC A;  4BDM A;  1ELJ A;  4NF4 A;  3A09 A;  4R72 A;  1MPC A;  2HQ0 A;  3VXB A;  2VOZ A;  2Y7P A;  5H8S A;  3D4G A;  2PT1 A;  2B3F A;  3MAM A;  4FE8 A;  1B05 A;  5M2V A;  3N6U A;  3PD9 A;  3K00 A;  4NF5 A;  1AOV A;  5AA2 D;  2HZK A;  3UP9 A;  3HHG A;  5ELV A;  2NWJ A;  1DTG A;  1PEB A;  1MXZ A;  2DE3 A;  4DZ1 A;  3DLN A;  4Q0C A;  1IXI A;  1FQD A;  2Z8F A;  2OK2 A;  5I2K B;  4R6H A;  3LSF B;  3K1P A;  2ZNS A;  4RK2 A;  4MH5 A;  5KDT A;  3EHU A;  2GHA A;  1Y20 A;  1XHY A;  5I57 B;  3KBR A;  2DP8 A;  3MWB A;  2ZNU A;  1SVX B;  2QS2 A;  4NWC A;  1MM7 A;  2CZL A;  4LON B;  4OFL A;  4LZ8 A;  1PBP A;  1LGB C;  3G3J A;  3TEL A;  2ZMB A;  3FAS A;  4F29 A;  1B4Z A;  4DDD A;  4F3B A;  4P0G A;  4ZS9 A;  3ZKK A;  1BKA A;  4G68 C;  2DOJ A;  4H0W A;  1EZO A;  3QSL A;  1SW5 A;  5CBR A;  2FYI A;  4R9F A;  4PP0 A;  3FD3 A;  2D21 A;  3VXC A;  1FTK A;  4IO5 A;  3UOR A;  2D3I A;  3EPE A;  4DXU A;  4QSD A;  4ZEF A;  5L9O A;  3K0V A;  2Z23 A;  3IO4 A;  4MF3 A;  1OVB A;  1IIT A;  4O3A A;  3PD8 A;  3IB2 A;  2RCA A;  4ONY A;  1OIB A;  1SW4 A;  1DTZ A;  1UTB A;  5L9M A;  1RYO A;  2YPN A;  2FA7 A;  1WDN A;  3CR9 A;  4EF1 A;  1RKM A;  4NMY A;  2X7Q A;  2RKM A;  3QK6 A;  3MPK A;  4ZED A;  1JW5 A;  4FOR A;  1Q35 A;  4HTG A;  3OEK A;  2X26 A;  2DQV A;  1LAH E;  3O28 A;  1VFE A;  4POW A;  2DXY A;  1NFT A;  1M5E A;  2A5S A;  2H99 A;  1B7U A;  1B3G A;  3I5O A;  3T96 B;  3H6W A;  3H03 A;  1ZLQ A;  1R9Q A;  2V3U A;  5DTB A;  2XXQ A;  1MY3 A;  1I6Q A;  4OVJ A;  2X7P A;  2PMS A;  4I9D A;  4WKM A;  1NMU A;  4EXL A;  4ZDM A;  2AYS A;  1N7X A;  1B46 A;  1US4 A;  5AA2 A;  1QUI A;  4GVO A;  5K2Y A;  1Y1M A;  3VVE A;  3FV2 A;  2XX8 A;  1DPP A;  3IL1 B;  1ZKB A;  1JVX A;  3LR1 A;  3VVF A;  3KFM A;  4OQO A;  4KI0 E;  2XD3 A;  4X9T A;  1B7Z A;  1LFH A;  1MQI A;  4YKK A;  1II5 A;  4M1V A;  3HPI A;  1N76 A;  1MQD A;  3N94 A;  3U93 A;  1UTH A;  4Q8R A;  4GL0 A;  1NH7 A;  3HO7 A;  4PFW A;  5AA4 B;  2XX9 A;  3MJN A;  4HW8 A;  2QRY A;  3CFZ A;  3HST A;  5ICQ A;  2VP1 A;  4WXJ A;  3OXN A;  2DE2 A;  1AH5 A;  3K1M A;  2F6G A;  4QHQ A;  4OWD A;  3SDF A;  4F18 A;  3B6T A;  5JTY B;  3M8U A;  2ZYO A;  4U1Z A;  2XXR A;  1D9V A;  2DXR A;  4JWO A;  1LB9 A; 
#chains in the Genus database with same CATH topology
 3G7W A;  3FJM A;  1FPL A;  3TQL A;  5EQ8 A;  1SQY A;  2E1S A;  2ZYK A;  3FGS A;  5FHO A;  4XKN A;  2THI A;  3T0J A;  4QFO A;  4PDD A;  3K6U A;  5J1D A;  4IB2 A;  1CB6 A;  3PUY E;  3FVK A;  2GRV A;  5CRY A;  4H5G A;  1N84 A;  4JWY A;  1EU8 A;  1KA1 A;  2QSX A;  3C4M A;  1FPK A;  1TXF A;  1DOT A;  2O84 X;  3IK6 B;  3LUY A;  5I2N A;  4G68 A;  5IZ3 A;  2B4L A;  4KYE A;  4ZEC A;  4JVC A;  3TCG A;  3S4U A;  2VGQ A;  3QUF A;  2XXX A;  5H8H B;  4U4S A;  1LBB A;  2FBP A;  4XF5 A;  4OVT A;  4XXU A;  1EYJ A;  2XXY A;  3O9P A;  4PDH A;  2HFB A;  5FHN A;  1MH3 A;  4R2F A;  5BWJ A;  1BK4 A;  5I58 A;  3W9V A;  3W15 C;  5AE4 A;  3EHT A;  2O68 A;  4YB7 A;  1YCJ A;  5F24 A;  2DWI A;  4PBQ A;  5EHM A;  1FQF A;  3PUV E;  4PBH A;  3SEY A;  3EQ1 A;  3T9U A;  1LAX A;  2RC7 A;  2DE4 A;  2LAO A;  3RTF B;  4C1U A;  1FSA A;  3WAF A;  3C33 A;  1YPN A;  3T22 A;  3VLW A;  3KG2 A;  3P7I A;  2DWJ A;  3MVW A;  3QUJ A;  3FVO A;  4ZE9 A;  2R8T A;  3HFU A;  2G93 A;  3B6W A;  1SYH A;  4YAH X;  4H46 A;  1FPJ A;  1KA0 A;  4N07 A;  3OO9 A;  1B5J A;  4NF8 A;  3UIF A;  2HCA A;  3E4R A;  3IOU A;  3SEV A;  1TWY A;  4JSD A;  4XKQ A;  1BLF A;  4HCY A;  2OJT A;  2I3V A;  5FHM A;  1NKX A;  2FIX A;  3OEL A;  3PMV A;  1IUD A;  4OFO A;  3PU5 A;  2Y7K A;  4U23 A;  3PPQ A;  3ROJ A;  1MRP A;  1SBP A;  4MMP A;  4KHZ E;  1ZIU A;  2XXK A;  5KCJ B;  3K02 A;  4P9K A;  2H4I A;  3SES A;  3DP8 A;  1NNP A;  2Z8E A;  3U8Q A;  2IA4 A;  2QVV A;  4MIJ A;  1NNK A;  2NXO A;  4THI A;  4N6K A;  3SEW A;  5H8Q B;  4IGR A;  3QAX A;  1FTO A;  2NVU B;  1LCT A;  4MBP A;  4NF6 B;  5IAI A;  4YMA A;  3M3K A;  3IOT A;  4DCY A;  5EQA A;  5TPA A;  1O63 A;  1OLC A;  3N6T A;  3CG3 A;  3LV0 A;  5EYG A;  3MBP A;  2F34 A;  4P0I A;  4O94 A;  2P3V A;  4F2O A;  5HPQ A;  3CHG A;  4PAI A;  4F1V A;  4U1O A;  3OSR A;  1VSO A;  3IOW A;  1NUW A;  4H67 A;  4ZZA A;  3MZ9 A;  3THI A;  4Q5T A;  2BJI A;  1YTV A;  2F35 A;  2Q74 A;  4NGU A;  3HV1 A;  2PFY A;  4JXI A;  1PB8 A;  4G77 A;  3V8X B;  2A5T A;  4NQ8 A;  1NH8 A;  1PB7 A;  3BFT A;  3S9L C;  4FEB A;  1UQW A;  1YYZ A;  2FVZ A;  3RYD A;  2UVI A;  5I59 A;  4NF0 A;  4G61 A;  5A5X A;  1POT A;  4I40 A;  3MST A;  3QIM A;  1S7Y A;  5F7V A;  2CEX A;  4IY6 A;  1FJ6 A;  4JWX A;  4QFL A;  1OQH A;  1ZTY A;  3RQT A;  3ZKL A;  2I0B A;  2Y7R A;  2F3D A;  3C36 A;  3C34 A;  4N91 A;  3T9X B;  3K4U A;  1B32 A;  1A8F A;  4OZ9 A;  4WEP A;  3H06 B;  4ESX A;  3V5A A;  5ISU A;  5EYF A;  2WYK A;  3G3I A;  4DE8 A;  2Y5L A;  1IXH A;  4KPT A;  2FIE A;  3N26 A;  4NF4 B;  2RCB A;  4ZE8 A;  3RPL B;  5H8F A;  2BJJ X;  4PF6 A;  2H9B A;  1EYI A;  4RA1 A;  1UIU A;  2Q89 A;  2QFL A;  1LB8 A;  3M3L A;  2L5V A;  1FTJ A;  4PC9 A;  3B6Q A;  2F36 A;  1F9B A;  3NOH A;  3LSW A;  4JSO A;  4NF5 B;  3CFX A;  3OO8 A;  2WX9 A;  1I6B A;  2PX1 A;  5IKB A;  3FJ7 A;  4QSE A;  1PC3 A;  1TFD A;  1AL3 A;  4DCX A;  3UK4 A;  4FJP A;  3V89 B;  3GYY A;  4HE1 A;  1LBY A;  4PGP A;  4YKP A;  1B3E A;  4NN3 A;  4C0R A;  3PPR A;  1R6Z A;  5JEI A;  3H6V A;  5LTC A;  4R73 A;  1LCF A;  2V25 A;  3O6G A;  1P1U A;  5KDT B;  5DW8 A;  5ITO A;  3HHF A;  3FUZ A;  3RT6 B;  4LQ5 A;  1RDZ A;  3T93 B;  1XC1 A;  1H3D A;  3KZG A;  4BDN A;  1MH4 A;  3R7X A;  2XWI A;  3U92 A;  1A7L A;  4OEU A;  4PFU A;  1B2H A;  3AXF A;  2UXA A;  1ZJL A;  1EZ9 A;  1MY2 A;  4AB6 A;  3BKI B;  1QUK A;  1O64 A;  3A29 A;  4GL8 A;  1ZMG A;  2ONK E;  4O3B A;  1Q1K A;  4OET A;  3IAZ A;  1SPI A;  4IR8 A;  4OER A;  2P0S A;  5EYH A;  4OEN A;  4OVR A;  1H44 A;  3S9M C;  4QXD A;  2UYE A;  3KN3 A;  3C9H A;  3MC2 A;  1UTB B;  4PFB A;  1DK4 A;  1IXC A;  2NUV A;  2HXW A;  1URD A;  1B58 A;  1S50 A;  4POX A;  4XKP A;  1MY4 A;  3KSX A;  1FQB A;  3G3H A;  2I3W A;  1LEV A;  1ANF A;  2XXV A;  2CMO A;  4E0W A;  1I6A A;  4M4G A;  2XWV A;  4GWY A;  3TTR A;  1GVC A;  5FBP A;  3S9N C;  1SI0 A;  3G3F A;  4TLL B;  1MG1 A;  4H1X A;  3KJT A;  1Y4C A;  4IO2 A;  1NNT A;  3FVN A;  3C31 A;  4RJZ A;  2D5W A;  2HAU A;  1OLA A;  1Y3N A;  3TZA A;  1FQA A;  1ZBM A;  1Y4T A;  2V3Q A;  1YXI A;  1DCU A;  3V83 A;  2ZZW A;  1HSE A;  2V3T A;  3LSX A;  5DEX A;  3GXA A;  3O66 A;  4U22 A;  2OWS A;  4PTK A;  2VD2 A;  3HCQ A;  3OO6 A;  4MHF A;  3PMW A;  2HAV A;  2QJE A;  4JVD A;  1JP4 A;  2IEE A;  2I49 A;  5ICT A;  1FPE A;  4QSC A;  1MXY A;  3TMG A;  4OTE A;  4GD5 A;  3K6X A;  4QFP A;  2XXW A;  4FAT A;  5AA2 B;  2I6E A;  1P1W A;  2Y84 A;  1FPD A;  3DP6 A;  2OWZ A;  2QS4 A;  5CMK A;  2O7U A;  5H8N A;  4JVI A;  4OAN A;  3L6G A;  1NL5 A;  3VLV A;  5TP9 A;  3I6V A;  4MFI A;  2QPQ A;  5IZZ A;  2F5X A;  1P1O A;  4PAK A;  1Z7M E;  2CEY A;  2Q9T A;  2OCU A;  4ISU A;  2F7C A;  3RGY A;  4F22 A;  4PGN A;  1B6H A;  3TUS A;  4F1U A;  2F8D A;  1QGX A;  1UTH B;  4MLV A;  4OES A;  3TPA A;  1LFI A;  4LQ2 A;  1LAG E;  1WVJ A;  5I56 A;  4PFT A;  3VLU A;  1MDP 1;  3IFC A;  1MXU A;  1LBV A;  3MVX A;  4R2B A;  2PFZ A;  3JZJ A;  1N3W A;  4ZEK A;  3RNN A;  3B50 A;  1FW0 A;  2H25 A;  1MQJ A;  3EF7 A;  2HZL A;  3FV1 A;  1FQE A;  5H8N B;  3Q28 A;  2OX3 A;  1JVY A;  3FXQ A;  3G3G A;  4XIG Q;  3KOS A;  4F3P A;  1JW4 A;  1FPF A;  1B52 A;  1S9T A;  3C35 A;  4KD5 A;  5JK4 A;  2UYF A;  5ET5 A;  3T66 A;  3E3K A;  1LBZ A;  2P2A A;  1AWB A;  3KC1 A;  1VFD A;  1HSL A;  1R9L A;  3DEL B;  3MYU A;  1CNQ A;  2O69 A;  3SEU A;  2OWT A;  1B1H A;  1PBQ A;  3U72 A;  4YB6 A;  4DI3 D;  1D9Q A;  4I8C A;  1Y9U A;  1PDA A;  1SW1 A;  3K01 A;  1CE2 A;  3OD7 A;  2KLF A;  4P11 A;  4YU0 A;  1NV2 A;  2R6G E;  1VR5 A;  4GX3 A;  1P99 A;  3FXR A;  1MS7 A;  1XI6 A;  4GXS B;  2Y5K A;  3ONM A;  1FPG A;  3K6W A;  4BDL A;  2WKY A;  4GWO A;  1SDX A;  4RK9 A;  3N5L A;  3S9E A;  1LBX A;  5I2N B;  4JB7 A;  4G68 B;  5IZ3 B;  3IOR A;  3EHS A;  1D4N A;  3TQW A;  1MQH A;  3OMB A;  4G8M A;  1NUY A;  3PPO A;  5BUU A;  3D1R A;  4Z7E A;  3LUZ A;  3CSB A;  3ECR A;  4O8M A;  3KN8 A;  3TTM A;  4F31 B;  2DWA A;  1OQG A;  4IO7 A;  3U1O A;  4KFQ A;  4JDF A;  3PMX A;  5DT6 A;  3MVZ A;  1G0H A;  4G2Z A;  2G29 A;  5I58 B;  3TTL A;  2QVU A;  3MPL A;  4F19 A;  5I3S A;  3UN6 A;  1B0H A;  1NI9 A;  4GWZ A;  1B0L A;  4P1L A;  1TT1 A;  3VDF A;  4ESW A;  3RLF E;  2O1L A;  1AIV A;  3FVG A;  1N3X A;  1XS5 A;  3MQ9 A;  3VFJ A;  2DWH A;  5L9S A;  1BIY A;  1BP5 A;  2XWK A;  2Q8J A;  4YIC A;  1NV5 A;  2VPO A;  4P56 A;  1GTK A;  1QKA A;  1YZ0 A;  1INP A;  4N81 A;  3SZP A;  1VDW A;  2F7A A;  4LUB A;  1FPB A;  1Y3Q A;  5KZT A;  3C32 A;  4FED A;  2I58 A;  2WYP A;  3B7D A;  3GBA A;  3OSQ A;  1DPE A;  3GBB A;  4G8N A;  1NV4 A;  1J1N A;  3F11 A;  2OLB A;  1D3K A;  4GRK A;  4NF8 B;  1B40 A;  4FIM A;  4GXA A;  3ODB A;  2XA5 A;  4KCD A;  1NV6 A;  4NED A;  5DVF A;  5ITP A;  3CRB A;  4EF2 A;  3QYT A;  4ELQ A;  3KJ7 A;  2YJP A;  4PF8 A;  1QUL A;  1NV0 A;  4GX6 A;  3CIJ A;  4NG7 A;  3TCF A;  1Y3P A;  3O6H A;  2XXI A;  1ATG A;  2UVH A;  1B5H A;  4AS5 A;  2P3N A;  1FBF A;  1HSJ A;  4IY5 A;  4ZEI A;  2XHD A;  3VV5 A;  1L5T A;  1SD3 A;  3KOT A;  1FTM A;  4NAP A;  1UIV A;  4R6Y A;  1LLS A;  4N15 A;  4BDR A;  2KR0 A;  4TOZ A;  4EQB A;  4BDO A;  2MKZ A;  1SW2 A;  4OHN A;  3BBR A;  5TPA B;  2O1M A;  2ZYM A;  3TAJ A;  3BFU A;  2PT2 A;  4P8B A;  3LBS A;  1LFG A;  3PGF A;  3CI8 A;  1P1N A;  5A5L A;  3A3C A;  4E0X A;  1POY 1;  5I2K A;  4YZZ A;  4YKJ A;  1MXV A;  4F2Q A;  2ESN A;  5AA3 A;  3PUZ E;  2CZI A;  4H45 A;  4OMB A;  1D9Y A;  4IO4 A;  4I62 A;  3K2D A;  2RF1 A;  2A5T B;  4HS7 A;  1LBC A;  5I57 A;  1R1N A;  3R26 A;  1H43 A;  5FTH A;  3VE1 B;  3PUW E;  1NNF A;  2DDK A;  4H5F A;  2REG A;  3MUQ A;  3T1B A;  3RY3 A;  4N13 A;  4HXV A;  4GIZ A;  1USY E;  5CI5 A;  2R71 A;  5I59 B;  3FZV A;  5J16 A;  2I4C A;  1Y1Z A;  4UAC A;  4LA9 A;  1MQG A;  4X1B A;  5A5X B;  4O7I A;  4RYA A;  2Y7W A;  3CG1 A;  1RYX A;  2Q2C A;  3KBZ A;  4U21 A;  3B8B A;  4F3G A;  4PE3 A;  4KYS A;  3IJO B;  3MP1 A;  4NWD A;  2F3B A;  3E13 X;  3T9V A;  2O6A A;  2O7I A;  4RY1 A;  1IMD A;  3QXM A;  1M5C A;  1QVS A;  4PQJ A;  5H8F B;  5LOM A;  2FNC A;  1LAF E;  1XVY A;  1B5I A;  2XD2 A;  2XX7 A;  3TTK A;  3W9W A;  4YKI A;  4XKR A;  3E9X A;  2ANJ A;  4BDQ A;  1EH3 A;  4JBZ A;  5FTI A;  2DSF A;  2GQ1 A;  1Z7N E;  4IGT A;  5IZ1 A;  2VD3 A;  2QMW A;  4KR5 A;  4X04 A;  2XXU A;  1M5B A;  5AA1 A;  3MZ1 A;  3FJG A;  3UGW A;  5CC2 A;  4QRZ A;  3JYR A;  4OVS A;  4ELO A;  1OVT A;  1IMF A;  1A55 A;  3RTW B;  3G3K A;  1N0T A;  3PUX E;  2Q8M A;  1WOD A;  2XXP A;  2Y7I A;  5K2X A;  1JNF A;  3MVY A;  4IO6 A;  1A99 A;  2QMX A;  4LZ5 A;  3FIR A;  4G8H A;  4BLA A;  3FXU A;  4RXL A;  1Q9D A;  5ET7 A;  5T3J A;  5CBS A;  1I69 A;  2RC9 A;  4GQO A;  4MLQ A;  1MPB A;  2VHA A;  5I5P A;  1USY H;  2VPN A;  2GH9 A;  4I3E A;  4R75 A;  1FCK A;  3IO6 A;  2B65 A;  1TFA A;  4OXV A;  2GHB A;  4GBV A;  4OA4 A;  2NOO A;  3H6U A;  4DXC A;  1H76 A;  2HHM A;  4GWS A;  4O7M A;  2ALU A;  4F3S A;  5HBC A;  1MPD A;  1JQF A;  1MDQ A;  1ZU0 A;  2F78 A;  4PFI A;  3IJX B;  3RN8 A;  4R9G A;  2B3B A;  2QL3 A;  4Q30 B;  4GX4 A;  1LST A;  4OEV A;  2RIN A;  2DVC A;  3S2V A;  1FTA A;  4HCW A;  3GLB A;  1NV7 A;  3O29 A;  3LC8 A;  1IQ7 A;  1NUZ A;  4TLM B;  2PCR A;  1A40 A;  5EHS A;  3PPP A;  1MXW A;  4GF8 A;  4EDP A;  3M3F A;  4MNI A;  4AQ4 A;  3H6T A;  1IMA A;  3LSL A;  3PTY A;  1IIW A;  2YLN A;  1SYI A;  1NV1 A;  1FBD A;  4RPO A;  4C1T A;  1AMF A;  5CM6 A;  1B4H A;  2ZYN A;  1KWH A;  2CZK A;  4R6K A;  2M8C A;  4R74 A;  2GFE A;  2I48 A;  1JEV A;  1P1Q A;  4O3C A;  4XTC Q;  1GR2 A;  3MP8 A;  4ELP A;  2Z8D A;  4EUO A;  1K9Y A;  1JET A;  1QW0 A;  5F1Q A;  4QFK A;  1MY0 A;  1XVX A;  5AA4 A;  3ZS6 A;  4EXK A;  4QBA A;  2WBD A;  1O7T A;  3KSJ A;  4NE4 A;  2RC8 A;  4QFN A;  2Z22 A;  1US5 A;  3MZB A;  3O97 A;  5TU0 A;  4PFR A;  3OEN A;  3VVD A;  2OZZ A;  5ET6 A;  5I84 A;  2AL4 A;  4KCC A;  4MEV A;  5JTY A;  1T0K A;  2PYY A;  3K6V A;  1A54 A;  2AIX A;  3KN7 A;  1B3F A;  3I3V A;  4F39 A;  1M5F A;  1VE4 A;  3CVG A;  3IX1 A;  3ILU B;  3U94 A;  2KQZ A;  5CMB A;  4NX1 A;  4MNP A;  3IOV A;  3RPW A;  1XT8 A;  4MAG A;  1A8E A;  3MP6 A;  1FRP A;  4U4X A;  5DEX B;  1GGG A;  4UA8 A;  2O51 A;  1DSN A;  4G4P A;  2DVZ A;  2HXR A;  3Q25 A;  4L17 A;  4PFY A;  4GFR A;  2V84 A;  3IB1 A;  3ISP A;  5EQ9 A;  3BIG A;  2UVG A;  1GV8 A;  4FAJ A;  1B9J A;  1MXX A;  4RPN A;  2QS1 A;  3E79 A;  4PE5 B;  2F7B A;  1B7H A;  3O2A A;  3SET A;  4ELR A;  3D4C A;  5B70 A;  3IR1 A;  5ESY A;  4LVQ A;  2H98 A;  4NHB A;  4TQU Q;  1N04 A;  1M5D A;  3RUM A;  4KYD A;  2V4C A;  4NTL A;  5CMM A;  5CMC A;  5H8H A;  3OOA A;  3T9H B;  4AS4 A;  1DMB A;  4ZZE A;  2Q88 A;  5TP9 B;  2DYX A;  4K3F A;  3SEX A;  4QF9 A;  2PVU A;  4GLI A;  3H4Z A;  4LZ7 A;  3ZSF A;  4LP2 B;  4X1D A;  5DYH A;  1PB9 A;  4GOT A;  4KQP A;  3USD A;  5HM4 B;  5I56 B;  1N7W A;  3DP4 A;  4H65 A;  1IXG A;  3DM0 A;  3HN0 A;  5B7D A;  3EN3 A;  4N4U A;  3Q26 A;  4FBP A;  1FBC A;  1FTL A;  1YAE A;  3SKP A;  1EZP A;  1FBH A;  2XXT A;  3TCH A;  4LAT A;  3A3U A;  4RNS A;  3FAT A;  2ONS A;  4P47 A;  1IMC A;  4DLD A;  3MW0 A;  3O6I A;  1B3L A;  3TKD A;  1IEJ A;  1BTJ A;  3KGC A;  1FQC A;  2HEU A;  4N8Y A;  4LN5 A;  2XXH A;  4MJO A;  4DXB A;  2QS3 A;  1URS A;  2ONR A;  4F1Y A;  2OBG A;  4DIG A;  1NUX A;  5L8D A;  4FEC A;  3RT8 A;  1QUJ A;  2ZXT A;  5KCJ A;  4UAB A;  4OVP A;  1QKB A;  2F97 A;  4H6D A;  4H8J A;  3JV9 A;  1JEU A;  1SI1 A;  4H8I A;  3H7M A;  4YB5 A;  4U2R A;  3SER A;  3EKI A;  3WAE A;  3R6U A;  3TYH A;  1G0I A;  1B51 A;  3K1N A;  1FBG A;  5H8Q A;  4ND9 A;  4GWU A;  3ILT B;  3E78 A;  2R9J A;  2F6P A;  4NF6 A;  1NV3 A;  2PBW A;  4N6P A;  4ECF A;  3TEP A;  4XFE A;  4GWX A;  3QMF A;  4EQ7 A;  4AB5 A;  4ZEB A;  4EQ9 A;  3TDJ A;  4X48 A;  3TFL A;  4WED A;  1H45 A;  4OYV A;  2AL5 A;  3Q27 A;  1FJ9 A;  3PPN A;  2I0C A;  1B3H A;  3UA8 A;  4I1D A;  2E0S A;  2P1S A;  4IO3 A;  3CFL A;  3KEI A;  3IB0 A;  3OEM A;  1B1X A;  2ABH A;  3OO7 A;  3TOD A;  1URG A;  4Z0I A;  5EQ7 A;  3H3G A;  1MM6 A;  1OMP A;  2B4M A;  2W7Y A;  1JW1 A;  2REJ A;  2FHY A;  5DVI A;  3Q29 A;  4HE2 A;  3PV0 E;  1QJM A;  4N17 A;  5DVJ A;  2ZNT A;  2V93 A;  1MY1 A;  2I4B A;  3TTN A;  2H5Y A;  2Q2A A;  2QVR A;  1IZ1 A;  3GZG A;  2UVJ A;  2DS9 A;  4YMB A;  2ZZX A;  3CSG A;  4HE0 A;  4PET A;  3L6H A;  2ZZV A;  4OFJ A;  2WBB A;  1XOC A;  4BDM A;  1ELJ A;  4XEQ A;  4NF4 A;  3A09 A;  4R72 A;  1RDX A;  1MPC A;  3RPL A;  2HQ0 A;  3VXB A;  2VOZ A;  2Y7P A;  5H8S A;  3D4G A;  2PT1 A;  2B3F A;  3MAM A;  4FE8 A;  1B05 A;  5M2V A;  4MNC A;  3N6U A;  3PD9 A;  3K00 A;  4NF5 A;  1AOV A;  5AA2 D;  2HZK A;  3UP9 A;  3HHG A;  5ELV A;  2NWJ A;  1DTG A;  1PEB A;  1MXZ A;  5IM2 A;  2DE3 A;  3BIH A;  4DZ1 A;  3DLN A;  1LBW A;  4Q0C A;  1IXI A;  1FQD A;  2Z8F A;  4I3Y A;  2OK2 A;  5I2K B;  4R6H A;  3LSF B;  3IFA A;  3K1P A;  2ZNS A;  1IME A;  4RK2 A;  1K9Z A;  4MH5 A;  5KDT A;  5I7I A;  3EHU A;  5IGA A;  2GHA A;  1Y20 A;  1XHY A;  5I57 B;  3KBR A;  4DI4 B;  2DP8 A;  3MWB A;  2ZNU A;  1SVX B;  2QS2 A;  4NWC A;  1MM7 A;  2CZL A;  4LON B;  4OFL A;  4LZ8 A;  1PBP A;  1LGB C;  3G3J A;  3TEL A;  2ZMB A;  3FAS A;  4F29 A;  1B4Z A;  4DDD A;  4F3B A;  4P0G A;  4ZS9 A;  3ZKK A;  1BKA A;  4G68 C;  2DOJ A;  4H0W A;  1EZO A;  3QSL A;  1SW5 A;  5CBR A;  2FYI A;  2WEF A;  4R9F A;  4PP0 A;  3FD3 A;  2D21 A;  1RDY A;  3VXC A;  1FTK A;  4IO5 A;  3UOR A;  2D3I A;  3EPE A;  4DXU A;  4QSD A;  4ZEF A;  5L9O A;  3K0V A;  2Z23 A;  3IO4 A;  4MF3 A;  1OVB A;  1IIT A;  2VT5 A;  4O3A A;  3PD8 A;  5ET8 A;  3IB2 A;  5LDZ A;  2RCA A;  4ONY A;  1OIB A;  3KC0 A;  2JJK A;  1SW4 A;  1DTZ A;  1UTB A;  5L9M A;  1FBP A;  1RYO A;  2YPN A;  2FA7 A;  1WDN A;  3CR9 A;  4MX6 A;  4EF1 A;  1RKM A;  4NMY A;  2X7Q A;  2CZH A;  2RKM A;  3QK6 A;  3MPK A;  4ZED A;  1JW5 A;  4FOR A;  1Q35 A;  4HTG A;  4KXP A;  3OEK A;  4MCO A;  2X26 A;  2DQV A;  1LAH E;  3O28 A;  1VFE A;  4POW A;  2DXY A;  1NFT A;  1M5E A;  3FBP A;  3FXB A;  2A5S A;  2H99 A;  1B7U A;  1B3G A;  4X8R A;  3I5O A;  3T96 B;  3H6W A;  3H03 A;  1ZLQ A;  1R9Q A;  2V3U A;  5DTB A;  1DBZ A;  2XXQ A;  1MY3 A;  1I6Q A;  4PCD A;  4OVJ A;  2X7P A;  1EYK A;  1IMB A;  2PMS A;  4I9D A;  4N8G A;  4WKM A;  1NMU A;  4EXL A;  4ZDM A;  2AYS A;  1N7X A;  1B46 A;  4N6D A;  1US4 A;  5AA2 A;  1QUI A;  4GVO A;  4GWW A;  5K2Y A;  1Y1M A;  3VVE A;  3FV2 A;  2XX8 A;  1DPP A;  3IL1 B;  2HPG A;  1ZKB A;  1JVX A;  3LR1 A;  3VVF A;  3KFM A;  4OQO A;  1KZ8 A;  1FPI A;  4KI0 E;  2XD3 A;  4X9T A;  1B7Z A;  1LFH A;  1MQI A;  4YKK A;  1II5 A;  4M1V A;  3HPI A;  1N76 A;  1MQD A;  3N94 A;  3U93 A;  1UTH A;  4Q8R A;  4GBW A;  4GL0 A;  1NH7 A;  3HO7 A;  4OVQ A;  4P1E A;  2XWO A;  4PFW A;  5AA4 B;  2XX9 A;  3MJN A;  3U65 A;  4HW8 A;  2QRY A;  3CFZ A;  3HST A;  5ICQ A;  2VP1 A;  4WXJ A;  3OXN A;  2DE2 A;  1AH5 A;  3K1M A;  2F6G A;  4QHQ A;  4PAF A;  4OWD A;  3SDF A;  1FBE A;  4F18 A;  3B6T A;  5JTY B;  3M8U A;  2ZYO A;  4U1Z A;  2XXR A;  4P3L A;  1D9V A;  2DXR A;  4JWO A;  1LB9 A; 
#chains in the Genus database with same CATH homology
 3G7W A;  3FJM A;  3TQL A;  1SQY A;  2E1S A;  2ZYK A;  3FGS A;  5FHO A;  4XKN A;  2THI A;  4QFO A;  3K6U A;  5J1D A;  4IB2 A;  1CB6 A;  3PUY E;  3FVK A;  2GRV A;  5CRY A;  4H5G A;  1N84 A;  4JWY A;  1EU8 A;  2QSX A;  3C4M A;  1TXF A;  1DOT A;  2O84 X;  3IK6 B;  3LUY A;  5I2N A;  4G68 A;  4KYE A;  4ZEC A;  3TCG A;  3S4U A;  2VGQ A;  3QUF A;  2XXX A;  5H8H B;  4U4S A;  1LBB A;  4XXU A;  2XXY A;  3O9P A;  2HFB A;  5FHN A;  1MH3 A;  4R2F A;  5BWJ A;  5I58 A;  3W9V A;  3W15 C;  5AE4 A;  3EHT A;  2O68 A;  4YB7 A;  1YCJ A;  2DWI A;  5EHM A;  1FQF A;  3PUV E;  3SEY A;  3EQ1 A;  3T9U A;  1LAX A;  2RC7 A;  2DE4 A;  2LAO A;  3RTF B;  4C1U A;  3WAF A;  3C33 A;  1YPN A;  3T22 A;  3VLW A;  3KG2 A;  3P7I A;  2DWJ A;  3MVW A;  3QUJ A;  3FVO A;  4ZE9 A;  2G93 A;  3B6W A;  1SYH A;  4YAH X;  4N07 A;  3OO9 A;  1B5J A;  4NF8 A;  3UIF A;  2HCA A;  3E4R A;  3IOU A;  3SEV A;  1TWY A;  4JSD A;  4XKQ A;  1BLF A;  4HCY A;  2OJT A;  2I3V A;  5FHM A;  1NKX A;  3OEL A;  3PMV A;  1IUD A;  4OFO A;  3PU5 A;  2Y7K A;  4U23 A;  3PPQ A;  1MRP A;  1SBP A;  4KHZ E;  1ZIU A;  5KCJ B;  3K02 A;  2H4I A;  3SES A;  3DP8 A;  1NNP A;  2Z8E A;  3U8Q A;  2IA4 A;  1NNK A;  2NXO A;  4THI A;  3SEW A;  5H8Q B;  4IGR A;  3QAX A;  1FTO A;  2NVU B;  1LCT A;  4MBP A;  4NF6 B;  5IAI A;  4YMA A;  3M3K A;  3IOT A;  4DCY A;  5TPA A;  1O63 A;  1OLC A;  3N6T A;  3CG3 A;  3MBP A;  2F34 A;  4P0I A;  4F2O A;  5HPQ A;  4F1V A;  4U1O A;  3OSR A;  1VSO A;  3IOW A;  4H67 A;  4ZZA A;  3MZ9 A;  3THI A;  4Q5T A;  1YTV A;  2F35 A;  3HV1 A;  4JXI A;  1PB8 A;  3V8X B;  4G77 A;  2A5T A;  1NH8 A;  1PB7 A;  3BFT A;  3S9L C;  4FEB A;  1UQW A;  2UVI A;  5I59 A;  5A5X A;  1POT A;  3QIM A;  1S7Y A;  5F7V A;  4IY6 A;  4JWX A;  4QFL A;  1OQH A;  1ZTY A;  3RQT A;  3ZKL A;  2I0B A;  2Y7R A;  3C36 A;  3C34 A;  3T9X B;  3K4U A;  1B32 A;  1A8F A;  4OZ9 A;  4WEP A;  3H06 B;  4ESX A;  3V5A A;  5ISU A;  5EYF A;  3G3I A;  4DE8 A;  1IXH A;  4KPT A;  3N26 A;  4NF4 B;  2RCB A;  4ZE8 A;  5H8F A;  2BJJ X;  2H9B A;  4RA1 A;  1UIU A;  2Q89 A;  1LB8 A;  3M3L A;  1FTJ A;  3B6Q A;  2F36 A;  1F9B A;  3LSW A;  4JSO A;  4NF5 B;  3CFX A;  3OO8 A;  1I6B A;  2PX1 A;  5IKB A;  3FJ7 A;  4QSE A;  1PC3 A;  1TFD A;  1AL3 A;  4DCX A;  3UK4 A;  4FJP A;  3V89 B;  4YKP A;  1B3E A;  4C0R A;  3PPR A;  1R6Z A;  5JEI A;  3H6V A;  4R73 A;  1LCF A;  2V25 A;  3O6G A;  1P1U A;  5KDT B;  5ITO A;  3HHF A;  3FUZ A;  3RT6 B;  4LQ5 A;  3T93 B;  1XC1 A;  1H3D A;  3KZG A;  4BDN A;  1MH4 A;  3R7X A;  3U92 A;  1A7L A;  4OEU A;  4PFU A;  1B2H A;  3AXF A;  2UXA A;  1ZJL A;  1EZ9 A;  1MY2 A;  4AB6 A;  3BKI B;  1QUK A;  1O64 A;  4GL8 A;  1ZMG A;  2ONK E;  4O3B A;  1Q1K A;  4OET A;  3IAZ A;  4OER A;  2P0S A;  4OEN A;  3S9M C;  1H44 A;  2UYE A;  3KN3 A;  3C9H A;  3MC2 A;  1UTB B;  1IXC A;  2NUV A;  2HXW A;  1URD A;  1B58 A;  1S50 A;  4POX A;  4XKP A;  1MY4 A;  3KSX A;  1FQB A;  3G3H A;  2I3W A;  1ANF A;  2XXV A;  2CMO A;  4E0W A;  1I6A A;  4M4G A;  3TTR A;  1GVC A;  3S9N C;  1SI0 A;  3G3F A;  4TLL B;  1MG1 A;  4H1X A;  3KJT A;  1Y4C A;  4IO2 A;  1NNT A;  3FVN A;  3C31 A;  4RJZ A;  2D5W A;  2HAU A;  1OLA A;  1Y3N A;  3TZA A;  1FQA A;  1ZBM A;  1Y4T A;  2V3Q A;  3V83 A;  1HSE A;  2V3T A;  3LSX A;  5DEX A;  3GXA A;  3O66 A;  4U22 A;  2OWS A;  2VD2 A;  3HCQ A;  3OO6 A;  3PMW A;  2HAV A;  2QJE A;  2IEE A;  2I49 A;  5ICT A;  4QSC A;  1MXY A;  3TMG A;  4OTE A;  4GD5 A;  3K6X A;  4QFP A;  2XXW A;  4FAT A;  5AA2 B;  2I6E A;  1P1W A;  2Y84 A;  3DP6 A;  2QS4 A;  5CMK A;  2O7U A;  5H8N A;  3L6G A;  1NL5 A;  3VLV A;  5TP9 A;  3I6V A;  4MFI A;  2QPQ A;  2F5X A;  1P1O A;  1Z7M E;  2Q9T A;  2OCU A;  4ISU A;  2F7C A;  3RGY A;  4F22 A;  3TUS A;  1B6H A;  4F1U A;  2F8D A;  1UTH B;  4MLV A;  4OES A;  3TPA A;  1LFI A;  4LQ2 A;  1LAG E;  1WVJ A;  5I56 A;  4PFT A;  3VLU A;  1MDP 1;  1MXU A;  3MVX A;  4R2B A;  3JZJ A;  1N3W A;  4ZEK A;  3RNN A;  1FW0 A;  2H25 A;  1MQJ A;  3EF7 A;  2HZL A;  3FV1 A;  1FQE A;  5H8N B;  3Q28 A;  1JVY A;  3FXQ A;  3G3G A;  4XIG Q;  3KOS A;  4F3P A;  1JW4 A;  1S9T A;  1B52 A;  3C35 A;  4KD5 A;  5JK4 A;  2UYF A;  3T66 A;  3E3K A;  2P2A A;  1VFD A;  1HSL A;  1R9L A;  3DEL B;  2O69 A;  3SEU A;  2OWT A;  1B1H A;  1PBQ A;  3U72 A;  4YB6 A;  4I8C A;  1Y9U A;  1PDA A;  1SW1 A;  3K01 A;  1CE2 A;  3OD7 A;  2KLF A;  4P11 A;  4YU0 A;  2R6G E;  1VR5 A;  1P99 A;  3FXR A;  1MS7 A;  4GXS B;  3ONM A;  3K6W A;  4BDL A;  2WKY A;  4GWO A;  1SDX A;  4RK9 A;  3N5L A;  3S9E A;  5I2N B;  4JB7 A;  4G68 B;  3IOR A;  3EHS A;  1D4N A;  3TQW A;  1MQH A;  3OMB A;  4G8M A;  3PPO A;  5BUU A;  4Z7E A;  3CSB A;  3ECR A;  3KN8 A;  3TTM A;  4F31 B;  2DWA A;  1OQG A;  4IO7 A;  3U1O A;  4KFQ A;  4JDF A;  3PMX A;  5DT6 A;  3MVZ A;  4G2Z A;  2G29 A;  5I58 B;  3TTL A;  3MPL A;  4F19 A;  3UN6 A;  1B0H A;  1B0L A;  1TT1 A;  3VDF A;  4ESW A;  3RLF E;  2O1L A;  1AIV A;  3FVG A;  1N3X A;  1XS5 A;  3MQ9 A;  3VFJ A;  2DWH A;  5L9S A;  1BIY A;  1BP5 A;  2Q8J A;  4YIC A;  1GTK A;  1QKA A;  2F7A A;  4LUB A;  1Y3Q A;  5KZT A;  3C32 A;  4FED A;  2I58 A;  3B7D A;  3GBA A;  3OSQ A;  1DPE A;  3GBB A;  4G8N A;  1J1N A;  3F11 A;  2OLB A;  1D3K A;  4GRK A;  4NF8 B;  1B40 A;  4FIM A;  4GXA A;  3ODB A;  4KCD A;  4NED A;  5DVF A;  5ITP A;  3CRB A;  4EF2 A;  3QYT A;  4ELQ A;  3KJ7 A;  2YJP A;  1QUL A;  3CIJ A;  3TCF A;  1Y3P A;  3O6H A;  2XXI A;  1ATG A;  2UVH A;  1B5H A;  1HSJ A;  4IY5 A;  4ZEI A;  2XHD A;  3VV5 A;  1L5T A;  1SD3 A;  3KOT A;  1FTM A;  1UIV A;  4R6Y A;  1LLS A;  4BDR A;  4TOZ A;  4EQB A;  4BDO A;  1SW2 A;  4OHN A;  3BBR A;  5TPA B;  2O1M A;  2ZYM A;  3TAJ A;  3BFU A;  2PT2 A;  3LBS A;  1LFG A;  3PGF A;  3CI8 A;  1P1N A;  3A3C A;  4E0X A;  1POY 1;  5I2K A;  4YZZ A;  4YKJ A;  1MXV A;  4F2Q A;  2ESN A;  5AA3 A;  3PUZ E;  4OMB A;  1D9Y A;  4IO4 A;  4I62 A;  3K2D A;  2RF1 A;  2A5T B;  4HS7 A;  1LBC A;  5I57 A;  1R1N A;  3R26 A;  1H43 A;  5FTH A;  3VE1 B;  3PUW E;  1NNF A;  4H5F A;  2REG A;  3MUQ A;  3RY3 A;  4N13 A;  4GIZ A;  1USY E;  5CI5 A;  2R71 A;  5I59 B;  3FZV A;  2I4C A;  1Y1Z A;  4UAC A;  4LA9 A;  1MQG A;  4X1B A;  5A5X B;  4RYA A;  2Y7W A;  3CG1 A;  1RYX A;  2Q2C A;  4U21 A;  4F3G A;  4KYS A;  3IJO B;  3MP1 A;  4NWD A;  3E13 X;  3T9V A;  2O6A A;  2O7I A;  4RY1 A;  3QXM A;  1M5C A;  1QVS A;  4PQJ A;  5H8F B;  5LOM A;  2FNC A;  1LAF E;  1XVY A;  1B5I A;  2XD2 A;  2XX7 A;  3TTK A;  3W9W A;  4YKI A;  4XKR A;  3E9X A;  2ANJ A;  4BDQ A;  1EH3 A;  4JBZ A;  5FTI A;  2DSF A;  1Z7N E;  4IGT A;  2VD3 A;  2QMW A;  4KR5 A;  2XXU A;  1M5B A;  5AA1 A;  3MZ1 A;  3FJG A;  3UGW A;  5CC2 A;  4QRZ A;  3JYR A;  4ELO A;  1OVT A;  3RTW B;  1A55 A;  3G3K A;  1N0T A;  3PUX E;  1WOD A;  2XXP A;  2Y7I A;  5K2X A;  1JNF A;  3MVY A;  4IO6 A;  1A99 A;  2QMX A;  4LZ5 A;  3FIR A;  4G8H A;  4BLA A;  3FXU A;  4RXL A;  5CBS A;  1I69 A;  2RC9 A;  4GQO A;  4MLQ A;  1MPB A;  2VHA A;  1USY H;  2GH9 A;  4R75 A;  1FCK A;  3IO6 A;  2B65 A;  1TFA A;  4OXV A;  2GHB A;  2NOO A;  3H6U A;  4DXC A;  1H76 A;  2ALU A;  4F3S A;  5HBC A;  1MPD A;  1JQF A;  1MDQ A;  1ZU0 A;  2F78 A;  3IJX B;  3RN8 A;  4R9G A;  2B3B A;  2QL3 A;  4Q30 B;  1LST A;  4OEV A;  2RIN A;  2DVC A;  3S2V A;  4HCW A;  3GLB A;  3O29 A;  3LC8 A;  1IQ7 A;  4TLM B;  5EHS A;  1A40 A;  3PPP A;  1MXW A;  4GF8 A;  4EDP A;  3M3F A;  4AQ4 A;  3H6T A;  3LSL A;  1IIW A;  2YLN A;  1SYI A;  4RPO A;  4C1T A;  1AMF A;  5CM6 A;  1B4H A;  2ZYN A;  1KWH A;  4R6K A;  2M8C A;  4R74 A;  2GFE A;  2I48 A;  1JEV A;  1P1Q A;  4O3C A;  4XTC Q;  1GR2 A;  3MP8 A;  4ELP A;  2Z8D A;  4EUO A;  1JET A;  1QW0 A;  5F1Q A;  4QFK A;  1MY0 A;  1XVX A;  5AA4 A;  3ZS6 A;  4EXK A;  1O7T A;  3KSJ A;  4NE4 A;  2RC8 A;  4QFN A;  2Z22 A;  1US5 A;  3MZB A;  3O97 A;  5TU0 A;  3OEN A;  3VVD A;  2OZZ A;  5I84 A;  2AL4 A;  4KCC A;  5JTY A;  1T0K A;  2PYY A;  3K6V A;  1A54 A;  2AIX A;  3KN7 A;  1B3F A;  3I3V A;  4F39 A;  1M5F A;  1VE4 A;  3CVG A;  3IX1 A;  3ILU B;  3U94 A;  5CMB A;  3IOV A;  3RPW A;  1XT8 A;  1A8E A;  3MP6 A;  4U4X A;  5DEX B;  1GGG A;  4UA8 A;  2O51 A;  1DSN A;  4G4P A;  2DVZ A;  3Q25 A;  4L17 A;  4PFY A;  4GFR A;  2V84 A;  3IB1 A;  2UVG A;  1GV8 A;  4FAJ A;  1B9J A;  1MXX A;  4RPN A;  2QS1 A;  4PE5 B;  2F7B A;  1B7H A;  3O2A A;  3SET A;  4ELR A;  3D4C A;  5B70 A;  3IR1 A;  4LVQ A;  2H98 A;  4TQU Q;  1N04 A;  1M5D A;  3RUM A;  4KYD A;  4NTL A;  5CMM A;  5CMC A;  5H8H A;  3OOA A;  3T9H B;  1DMB A;  4ZZE A;  2Q88 A;  5TP9 B;  2DYX A;  4K3F A;  3SEX A;  4QF9 A;  2PVU A;  4GLI A;  3H4Z A;  4LZ7 A;  3ZSF A;  4LP2 B;  4X1D A;  5DYH A;  1PB9 A;  4GOT A;  4KQP A;  3USD A;  5HM4 B;  5I56 B;  1N7W A;  3DP4 A;  4H65 A;  1IXG A;  3DM0 A;  3HN0 A;  5B7D A;  3EN3 A;  3Q26 A;  1FTL A;  1YAE A;  3SKP A;  1EZP A;  2XXT A;  3TCH A;  4LAT A;  3A3U A;  4RNS A;  3FAT A;  2ONS A;  4DLD A;  3MW0 A;  3O6I A;  1B3L A;  3TKD A;  1IEJ A;  1BTJ A;  3KGC A;  1FQC A;  2HEU A;  2XXH A;  4DXB A;  2QS3 A;  1URS A;  2ONR A;  4F1Y A;  2OBG A;  4DIG A;  5L8D A;  4FEC A;  3RT8 A;  1QUJ A;  2ZXT A;  5KCJ A;  1QKB A;  2F97 A;  4H6D A;  4H8J A;  3JV9 A;  1JEU A;  1SI1 A;  4H8I A;  3H7M A;  4YB5 A;  4U2R A;  3SER A;  3WAE A;  3R6U A;  3TYH A;  1B51 A;  3K1N A;  5H8Q A;  4ND9 A;  3ILT B;  2R9J A;  2F6P A;  4NF6 A;  2PBW A;  4N6P A;  4ECF A;  3TEP A;  4EQ7 A;  4AB5 A;  4ZEB A;  4EQ9 A;  3TDJ A;  4X48 A;  3TFL A;  4WED A;  1H45 A;  4OYV A;  2AL5 A;  3Q27 A;  3PPN A;  2I0C A;  1B3H A;  3UA8 A;  4I1D A;  2E0S A;  2P1S A;  4IO3 A;  3CFL A;  3KEI A;  3IB0 A;  3OEM A;  1B1X A;  2ABH A;  3OO7 A;  3TOD A;  1URG A;  4Z0I A;  3H3G A;  1MM6 A;  1OMP A;  2W7Y A;  1JW1 A;  2REJ A;  5DVI A;  3Q29 A;  3PV0 E;  1QJM A;  5DVJ A;  2ZNT A;  2V93 A;  1MY1 A;  2I4B A;  3TTN A;  2H5Y A;  2Q2A A;  1IZ1 A;  3GZG A;  2UVJ A;  2DS9 A;  4YMB A;  3CSG A;  4PET A;  3L6H A;  4OFJ A;  1XOC A;  4BDM A;  1ELJ A;  4NF4 A;  3A09 A;  4R72 A;  1MPC A;  2HQ0 A;  3VXB A;  2VOZ A;  2Y7P A;  5H8S A;  3D4G A;  2PT1 A;  2B3F A;  3MAM A;  4FE8 A;  1B05 A;  5M2V A;  3N6U A;  3PD9 A;  3K00 A;  4NF5 A;  1AOV A;  5AA2 D;  2HZK A;  3UP9 A;  3HHG A;  5ELV A;  2NWJ A;  1DTG A;  1PEB A;  1MXZ A;  2DE3 A;  4DZ1 A;  3DLN A;  4Q0C A;  1IXI A;  1FQD A;  2Z8F A;  2OK2 A;  5I2K B;  4R6H A;  3LSF B;  3K1P A;  2ZNS A;  4RK2 A;  4MH5 A;  5KDT A;  3EHU A;  2GHA A;  1Y20 A;  1XHY A;  5I57 B;  3KBR A;  2DP8 A;  3MWB A;  2ZNU A;  1SVX B;  2QS2 A;  4NWC A;  1MM7 A;  2CZL A;  4LON B;  4OFL A;  4LZ8 A;  1PBP A;  1LGB C;  3G3J A;  3TEL A;  2ZMB A;  3FAS A;  4F29 A;  1B4Z A;  4DDD A;  4F3B A;  4P0G A;  4ZS9 A;  3ZKK A;  1BKA A;  4G68 C;  2DOJ A;  4H0W A;  1EZO A;  3QSL A;  1SW5 A;  5CBR A;  2FYI A;  4R9F A;  4PP0 A;  3FD3 A;  2D21 A;  3VXC A;  1FTK A;  4IO5 A;  3UOR A;  2D3I A;  3EPE A;  4DXU A;  4QSD A;  4ZEF A;  5L9O A;  3K0V A;  2Z23 A;  3IO4 A;  4MF3 A;  1OVB A;  1IIT A;  4O3A A;  3PD8 A;  3IB2 A;  2RCA A;  4ONY A;  1OIB A;  1SW4 A;  1DTZ A;  1UTB A;  5L9M A;  1RYO A;  2YPN A;  2FA7 A;  1WDN A;  3CR9 A;  4EF1 A;  1RKM A;  4NMY A;  2X7Q A;  2RKM A;  3QK6 A;  3MPK A;  4ZED A;  1JW5 A;  4FOR A;  1Q35 A;  4HTG A;  3OEK A;  2X26 A;  2DQV A;  1LAH E;  3O28 A;  1VFE A;  4POW A;  2DXY A;  1NFT A;  1M5E A;  2A5S A;  2H99 A;  1B7U A;  1B3G A;  3I5O A;  3T96 B;  3H6W A;  3H03 A;  1ZLQ A;  1R9Q A;  2V3U A;  5DTB A;  2XXQ A;  1MY3 A;  1I6Q A;  4OVJ A;  2X7P A;  2PMS A;  4I9D A;  4WKM A;  1NMU A;  4EXL A;  4ZDM A;  2AYS A;  1N7X A;  1B46 A;  1US4 A;  5AA2 A;  1QUI A;  4GVO A;  5K2Y A;  1Y1M A;  3VVE A;  3FV2 A;  2XX8 A;  1DPP A;  3IL1 B;  1ZKB A;  1JVX A;  3LR1 A;  3VVF A;  3KFM A;  4OQO A;  4KI0 E;  2XD3 A;  4X9T A;  1B7Z A;  1LFH A;  1MQI A;  4YKK A;  1II5 A;  4M1V A;  3HPI A;  1N76 A;  1MQD A;  3N94 A;  3U93 A;  1UTH A;  4Q8R A;  4GL0 A;  1NH7 A;  3HO7 A;  4PFW A;  5AA4 B;  2XX9 A;  3MJN A;  4HW8 A;  2QRY A;  3CFZ A;  3HST A;  5ICQ A;  2VP1 A;  4WXJ A;  3OXN A;  2DE2 A;  1AH5 A;  3K1M A;  2F6G A;  4QHQ A;  4OWD A;  3SDF A;  4F18 A;  3B6T A;  5JTY B;  3M8U A;  2ZYO A;  4U1Z A;  2XXR A;  1D9V A;  2DXR A;  4JWO A;  1LB9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...