1II5A

Crystal structure of the glur0 ligand binding core complex with l-glutamate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Slr1257 protein
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
total genus 72
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ii5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ii5A02
3KGCA 3CFZA 1B3HA 3FIRA 1D9YA 3U93A 4IY6A 4KYDA 4QFNA 1IQ7A 3FUZA 1NKXA 1WDNA 2GHBA 5H8FB 3C33A 2XD3A 2ONSA 3MJNA 4OFLA 1HSLA 2ZXTA 4GD5A 4PP0A 3RT6B 5HM4B 5BWJA 3MP6A 2DVZA 4DZ1A 3S4UA 2ZNTA 1N7WA 5H8NB 3TDJA 1B46A 3T9VA 4NWCA 3ECRA 1FQFA 1M5BA 4EXKA 4NEDA 4F2QA 2Y7PA 1SD3A 1QUKA 3C4MA 4RK2A 3TTRA 1USYE 1P1WA 1P99A 4LUBA 3FVNA 2DQVA 2DWHA 1WVJA 2XXHA 3H6WA 2O69A 4IGRA 1B1HA 2G29A 4L17A 2UYEA 3K1NA 5KCJA 1B0HA 5H8QB 5DYHA 4TLLB 3PMVA 3TCFA 1MG1A 3V5AA 3R6UA 4OQOA 3VXCA 5FHOA 4QSEA 4DXBA 1OQGA 1B3LA 2B65A 1DTZA 3MVZA 4EQ9A 3H6TA 3I6VA 2P1SA 4I62A 2F34A 2DXRA 4RJZA 4EXLA 1O63A 3IOTA 1B7UA 2XXTA 2AYSA 2QJEA 3UN6A 3O6HA 3O9PA 4YICA 1Y20A 4R9GA 1SW1A 1MY1A 2I3VA 1MY0A 1FCKA 5L9OA 1MY4A 1B7ZA 3KZGA 4O3AA 3ILTB 3WAEA 3U92A 3Q29A 1L5TA 1Y3NA 1M5CA 2F35A 1A7LA 4JSDA 3K4UA 3FVOA 2PX1A 3KN7A 3HO7A 4U1ZA 3TFLA 2O7UA 3DELB 5DVFA 4GXAA 1NFTA 3PU5A 3HCQA 3LC8A 1TFDA 5J1DA 2H25A 1JNFA 4PQJA 4EDPA 2ZYNA 4ONYA 3Q28A 4BDRA 4H8JA 1P1QA 1Y4TA 3FJ7A 2HAVA 1QKBA 4FEBA 3H03A 1DSNA 3JZJA 2V84A 3MP1A 4I9DA 1IZ1A 3T9UA 1Y1MA 4IO2A 3O6IA 3QK6A 4ELPA 1LCTA 4X48A 5AA3A 3PPRA 4NF5B 1URGA 4GL8A 3FJGA 1N76A 3LSLA 3FZVA 3ZSFA 3QYTA 3GBBA 4OWDA 2B3FA 1RYXA 4U22A 4NE4A 5I59A 2AL4A 1SBPA 5ICQA 3LUYA 2PT1A 4YMAA 3OO6A 4F3PA 4P0GA 4RPNA 1JVXA 3U8QA 4RYAA 4F2OA 1OQHA 1JVYA 4F3GA 5TU0A 1GVCA 3IOWA 1LB8A 4KPTA 1POTA 3MW0A 2H4IA 4AB6A 1MDQA 4R9FA 1N3XA 2RC7A 2Q2CA 1GV8A 4BDOA 5IAIA 3OENA 3MVWA 1QUJA 2F6PA 5H8FA 4I8CA 3QIMA 1PB8A 3IAZA 1JW1A 4PETA 1A54A 4EF1A 3G3IA 1SW4A 2XX7A 3CIJA 4JWYA 1HSJA 4OYVA 5I2NB 4WEPA 1D9VA 2ZYOA 5H8HA 2DXYA 4F3SA 3D4CA 5H8NA 3ILUB 4G8MA 2F8DA 3KG2A 4HW8A 4QSDA 2DSFA 2W7YA 1TFAA 5AA1A 1FQAA 4R2BA 1O7TA 4KFQA 3FD3A 3F11A 4ZEBA 4ZS9A 1XOCA 4ZECA 2Y84A 1Q35A 4EUOA 2HAUA 2WKYA 4DXCA 5FHNA 1EZPA 4FECA 4MFIA 4YU0A 4C1UA 1XVXA 3L6GA 3E4RA 3PPPA 5CMMA 1ZKBA 1SDXA 2UVHA 5AA2B 3SEYA 3GLBA 4C1TA 1AH5A 4G77A 3PUVE 3K02A 1M5FA 3PMWA 3S9NC 1LFIA 4YB6A 3TQLA 3IO6A 2O1LA 1D3KA 3UORA 3KN8A 3S9EA 3UIFA 4U23A 5EYFA 4KCDA 1FW0A 2OLBA 3FVGA 3T93B 3IX1A 5I2KB 3ZKLA 5DVJA 1SI0A 2V3TA 1I6QA 4U4SA 4RK9A 2ALUA 3TUSA 1BLFA 4LZ5A 3UGWA 4RNSA 2ONKE 4ECFA 3K0VA 1NNTA 3TKDA 4OHNA 5KDTB 3QUJA 3ONMA 2VD2A 2PT2A 4YKIA 1AL3A 3H6UA 5TPAA 4NF8B 5I57B 4R6HA 3VVEA 2VD3A 2ZNSA 4OEUA 1ANFA 1B51A 5CBRA 2FA7A 3KSJA 3CRBA 1LCFA 3OD7A 5BUUA 1MM6A 3M3LA 2XXWA 2VP1A 3PUZE 4KR5A 3KN3A 3OEMA 4KYEA 4GLIA 3IORA 3Q26A 1MXWA 3FXUA 3B6TA 4ESXA 4FATA 2O84X 3MWBA 1PB9A 2Y7RA 1KWHA 4F22A 4U21A 2QS3A 3D4GA 2P2AA 4QRZA 1AOVA 3RUMA 2QMWA 2GRVA 2PMSA 4NF5A 3C9HA 4U4XA 1ZLQA 1B0LA 4N6PA 4LA9A 4Q0CA 4YKPA 4Q30B 1MH3A 2XD2A 4IO7A 4ZEIA 2D3IA 2FNCA 3KJTA 3A3UA 2ZYMA 2F6GA 5FTIA 1QJMA 3C34A 4IB2A 5A5XA 1UTBB 1FTMA 4OERA 2GH9A 5ISUA 1OLCA 1MXXA 3W9VA 1A40A 3MUQA 4G4PA 4C0RA 1MPBA 3Q25A 2OZZA 4ZEKA 1B4ZA 4KHZE 1MM7A 2QL3A 3PUXE 1UTHB 1AMFA 1N0TA 4U1OA 2HQ0A 5HBCA 1Y3PA 4F3BA 3SESA 3O2AA 4MLVA 4DCXA 1TXFA 2OWSA 2OJTA 2OBGA 4FORA 1PC3A 1LAHE 1B5HA 2Z22A 1US4A 3G3FA 4POWA 4G8NA 1B2HA 1ZMGA 4QFLA 4MF3A 5IKBA 4GIZA 1BTJA 2QS1A 3LSXA 4Z7EA 5JTYA 4EQ7A 3W15C 2QPQA 5DT6A 4G68C 2F36A 1AIVA 3MP8A 3SEUA 4G68B 3LSFB 4LZ7A 3VE1B 2ZYKA 4XXUA 4M1VA 4KQPA 2RCBA 2Y7IA 1Y4CA 3UP9A 3CFLA 3V8XB 4H5FA 1DMBA 1NL5A 2H5YA 3S2VA 1LAXA 4HCWA 2V93A 1I69A 2A5SA 3TAJA 3VV5A 2Z8EA 2Z8FA 4HCYA 4GWOA 1LGBC 3OSQA 1FTLA 2B3BA 3FATA 3M3FA 4BDLA 5CM6A 4DDDA 1JEVA 5LOMA 2R71A 3EN3A 1P1NA 1NNKA 4NF6B 1N7XA 4EQBA 1Z7ME 3K6UA 2Y7KA 3AXFA 4OTEA 3RPWA 1MQDA 3KOSA 2GFEA 3GXAA 4MH5A 4ZE8A 4POXA 1YCJA 4ZZEA 4RPOA 1IITA 1A99A 3E9XA 5JEIA 5DEXB 3M3KA 4JBZA 2XXVA 1URDA 2XXRA 2I0CA 2A5TB 2IEEA 2ONRA 2UXAA 2Q8JA 1MY3A 2HZKA 2X7PA 3E3KA 5H8SA 3T22A 4DE8A 4NF8A 3C31A 2V25A 1S50A 5CI5A 3OELA 4R2FA 1IIWA 4TOZA 2NXOA 3IL1B 3B6QA 4NF4A 4YZZA 1B3GA 4F19A 4IO4A 2THIA 3A09A 5ITPA 1IXGA 1GR2A 4THIA 2D5WA 4NMYA 2O68A 2XX9A 1B7HA 1F9BA 4GFRA 1RYOA 2RINA 1H43A 4KI0E 4QFOA 1O64A 2RC9A 4G2ZA 5AE4A 1VFDA 1R1NA 1M5EA 4GVOA 1MY2A 1SYHA 5I56B 2HCAA 2HFBA 3IB2A 3RNNA 2DE4A 4OMBA 2UVJA 1ZJLA 1USYH 1B3EA 3W9WA 3BBRA 1POY1 3TTMA 2DYXA 3H6VA 1FTOA 4E0XA 2E1SA 1IUDA 1I6AA 4FE8A 4OEVA 1RKMA 3MPLA 4O3BA 4P0IA 3HV1A 4BDQA 1ELJA 3PUYE 3C32A 1XC1A 3V89B 2H98A 3PUWE 5TP9B 1D4NA 2QSXA 1B1XA 1M5DA 3T9HB 2QRYA 3V83A 5L8DA 1UTHA 3SEWA 3BFUA 3PPOA 4E0WA 1XS5A 1HSEA 3QUFA 3EPEA 2VOZA 1R6ZA 3C36A 1IXCA 4H6DA 3G3JA 1UIVA 3LR1A 5L9MA 1SQYA 4LQ2A 4PFTA 1LAFE 3OO7A 1LLSA 2UVGA 3HPIA 4IO3A 4IO5A 1S9TA 2DE3A 2XXUA 3EHUA 4NTLA 1DOTA 2RKMA 2O6AA 3RTWB 3RQTA 1R9QA 5KCJB 5ELVA 2V3QA 2CMOA 4G68A 5H8QA 5KZTA 1B40A 2AIXA 4OVJA 3VFJA 5AA4B 3K6VA 1B5JA 5CBSA 3G3KA 3OXNA 3HHFA 3IB1A 3IR1A 5DTBA 5F1QA 3B6WA 3IB0A 2BJJX 4PFUA 1PBPA 4ELRA 3JYRA 3H06B 2HXWA 1II5A 4F31B 3MPKA 3DP6A 4PFYA 1DPEA 4ND9A 3K00A 1IXHA 3LBSA 2XXPA 1MQHA 1SVXB 3TYHA 4ESWA 2ZNUA 3SDFA 2ANJA 2R9JA 3L6HA 4NF6A 1IEJA 1N04A 3FASA 4LQ5A 2Z8DA 1B05A 4OESA 5I58B 1YPNA 2H9BA 5DVIA 3P7IA 4BLAA 4YKJA 3TTLA 3VLVA 4N07A 1NNFA 1JW4A 3G3GA 2A5TA 1A55A 4PE5B 4ELQA 1FTJA 3I3VA 3HN0A 3FJMA 3OMBA 2NVUB 4KYSA 4GXSB 4DCYA 3CR9A 4JSOA 3PD9A 2V3UA 1BIYA 5CMKA 3MQ9A 4JDFA 1B32A 2HEUA 1IXIA 4IGTA 3O29A 3IO4A 1P1OA 5HPQA 1NH7A 1YAEA 1JW5A 1A8EA 3T9XB 1MXVA 1H45A 2R6GE 1YTVA 1B9JA 1H3DA 4GQOA 1MDP1 1US5A 5AA2D 1PBQA 1VSOA 4Q5TA 1ATGA 4R75A 4QFPA 1T0KA 4LZ8A 3OSRA 4YAHX 1MQJA 1XT8A 1FTKA 2DOJA 3PGFA 2D21A 3G7WA 5I56A 1B6HA 1OIBA 1MRPA 1VE4A 5FTHA 2Q9TA 3MBPA 2PYYA 1SYIA 2Q89A 2UVIA 3PPNA 4GL0A 5JK4A 3CVGA 2XHDA 1VFEA 3O66A 3TCHA 1N3WA 4G8HA 1JQFA 3R26A 3TODA 4H5GA 4HS7A 2DE2A 4WEDA 3TZAA 3QSLA 1DTGA 1S7YA 2I0BA 3K2DA 5TP9A 4XKQA 2I4BA 4JB7A 3N26A 3S9LC 4GOTA 2Z23A 3IK6B 5FHMA 2Y7WA 4M4GA 3T66A 4XTCQ 1DPPA 2HZLA 5I2NA 1LB9A 3KBRA 5H8HB 1OVBA 2E0SA 3FXRA 3I5OA 4U2RA 4WXJA 3QXMA 3MVXA 4HTGA 4O3CA 4F18A 2I49A 3IJOB 3VDFA 4QHQA 2I58A 4X1BA 4ZEFA 4KCCA 2REJA 5ICTA 2DS9A 1OLAA 3C35A 3RGYA 4R72A 4P11A 3VLWA 1CE2A 3PPQA 3ODBA 1XVYA 5AA4A 2F7AA 3A3CA 3U1OA 1MXZA 1CB6A 5AA2A 2F97A 4K3FA 2O1MA 1URSA 3E13X 3N5LA 5CC2A 3OO9A 3GZGA 2DWJA 3CG3A 1B4HA 1B3FA 4ELOA 3KJ7A 1MS7A 2G93A 1B58A 3TELA 4PFWA 2DWAA 3ZKKA 5ITOA 1WODA 1TWYA 4Z0IA 5I2KA 4YMBA 2RF1A 1UQWA 3EHSA 5K2YA 4ISUA 3RN8A 4DXUA 5I58A 1XHYA 1BP5A 2X7QA 1R9LA 3S9MC 2OWTA 4EF2A 3EF7A 4ZDMA 1EZ9A 3OOAA 3ZS6A 3O6GA 1Z7NE 1MXUA 5KDTA 5M2VA 2M8CA 5TPAB 5L9SA 1I6BA 1MQIA 5CRYA 4F39A 5I57A 4F1YA 1SW5A 2VGQA 3EQ1A 4OFOA 3B7DA 2I6EA 3WAFA 3FGSA 3PV0E 2I48A 3OEKA 3MC2A 3CSGA 3TMGA 3TCGA 3BKIB 4H1XA 4NWDA 1QUIA 2ESNA 2VHAA 4FEDA 4ZZAA 5EHMA 3CI8A 4YKKA 4H67A 4RY1A 2PVUA 3R7XA 2GHAA 2RC8A 4TQUQ 5EHSA 1LBBA 4OETA 2F7CA 4I1DA 4AQ4A 1GGGA 2QS4A 2UYFA 4MBPA 3MZ1A 4MLQA 1QULA 2X26A 3MAMA 4AB5A 3G3HA 1EH3A 1GTKA 2F78A 3KSXA 4OXVA 3BFTA 4OFJA 2QMXA 4RA1A 2DP8A 3LSWA 3O28A 1SI1A 2OCUA 3RLFE 1MPDA 3HHGA 3TQWA 4IO6A 1TT1A 2IA4A 1ZIUA 2P0SA 2PBWA 3SERA 3OO8A 3CSBA 2DVCA 1FQCA 4R6YA 2Q2AA 4JWXA 3MVYA 4FIMA 1EZOA 3H3GA 3RT8A 4QF9A 4R73A 4F29A 2DWIA 2XX8A 4LVQA 4BDMA 4H65A 3H4ZA 1B52A 5A5XB 1UTBA 1SW2A 3IOUA 3N6UA 3HSTA 3H7MA 1NMUA 4KD5A 1B5IA 3TTNA 4N13A 3FXQA 3UA8A 4ZEDA 4R6KA 4JXIA 1A8FA 1NNPA 1EU8A 2CZLA 2FYIA 1ZU0A 1VR5A 4DIGA 3SEVA 4XIGQ 4UA8A 3O97A 2YLNA 4LONB 1FQBA 4H8IA 4YB7A 5I84A 2YJPA 4F1VA 2XXIA 3RY3A 1OVTA 1QW0A 4WKMA 1N84A 4FJPA 4GRKA 3SETA 2F7BA 3CG1A 3Q27A 1PEBA 3U72A 2XXQA 5JTYB 1FQDA 3RTFB 4X9TA 3CFXA 3U94A 5K2XA 1LSTA 4QSCA 2QS2A 1Q1KA 3DP8A 1BKAA 3KOTA 1PDAA 2LAOA 3N94A 4R74A 5B7DA 2I4CA 1PB7A 4GF8A 3KEIA 3K6WA 3K1PA 3JV9A 3IJXB 5CMBA 1H44A 4BDNA 2YPNA 4OZ9A 3FV2A 3K1MA 2RCAA 3DLNA 3GBAA 4OENA 3K01A 1FQEA 1QKAA 3VVFA 3VXBA 1Y3QA 1MPCA 1JEUA 4F1UA 5F7VA 1LFHA 3VVDA 4XKPA 3UK4A 3T96B 2REGA 3N6TA 4JWOA 1UIUA 4XKNA 4FAJA 2ZMBA 3MZBA 1P1UA 3TTKA 1MH4A 1H76A 4IY5A 1MQGA 5DEXA 1MXYA 1QVSA 2ABHA 4UACA 4YB5A 1LAGE 1J1NA 3THIA 1OMPA 3USDA 2NOOA 1ZBMA 2O7IA 3EHTA 2XXYA 3KFMA 2OK2A 4Q8RA 3VLUA 4NF4B 2I3WA 1LFGA 1ZTYA 3IOVA 2O51A 2NWJA 3DP4A 5CMCA 3PMXA 3TEPA 2F5XA 3DM0A 3FVKA 2AL5A 4LP2B 3SEXA 1JETA 5B70A 1Y1ZA 2XXXA 2KLFA 2H99A 3PD8A 5I59B 1Y9UA 4TLMB 4DLDA 3K6XA 3MZ9A 4RXLA 2Q88A 4X1DA 4H0WA 4QFKA 3TPAA 4LATA 4ZE9A 3M8UA 1NH8A 3QAXA 4XKRA 3SKPA 1LBCA 2NUVA 3FV1A
chains in the Genus database with same CATH superfamily
3KGCA 4PAIA 3CFZA 1B3HA 3FIRA 1D9YA 3U93A 2WEFA 4IY6A 4KYDA 2FVZA 4QFNA 1IQ7A 3FUZA 1NKXA 1WDNA 2GHBA 5H8FB 1FBPA 3C33A 2XD3A 2ONSA 3MJNA 2QVVA 4OFLA 1HSLA 2ZXTA 4GD5A 4PP0A 1IMBA 3RT6B 5BWJA 5HM4B 3MP6A 2DVZA 4DZ1A 3S4UA 2ZNTA 1N7WA 1XI6A 5H8NB 3TDJA 1B46A 3T9VA 4NWCA 3ECRA 1FJ9A 1FQFA 1M5BA 4EXKA 4P9KA 4NEDA 4F2QA 2Y7PA 1SD3A 2KQZA 1QUKA 3C4MA 4RK2A 3TTRA 1USYE 1P1WA 1P99A 4LUBA 3FVNA 2DQVA 4MX6A 4LN5A 2DWHA 1WVJA 2XXHA 3H6WA 2O69A 4IGRA 1B1HA 2G29A 4L17A 2UYEA 3K1NA 5KCJA 2JJKA 1B0HA 5H8QB 5DYHA 4TLLB 3PMVA 3TCFA 1MG1A 3V5AA 3R6UA 1IMDA 4OQOA 3VXCA 5FHOA 4QSEA 4DXBA 1OQGA 1B3LA 2B65A 1DTZA 3MVZA 4EQ9A 3H6TA 2CZHA 3I6VA 2P1SA 2WBBA 4I62A 1RDYA 2F34A 2DXRA 4RJZA 4EXLA 1O63A 2B4LA 1INPA 3IOTA 1B7UA 2XXTA 2AYSA 2QJEA 3UN6A 3O6HA 3O9PA 3QMFA 4R9GA 1Y20A 4YICA 1SW1A 1MY1A 2I3VA 1MY0A 4MCOA 1FCKA 5L9OA 1MY4A 4GWWA 1B7ZA 3KZGA 4O3AA 3ILTB 3WAEA 3U92A 3Q29A 2ZZWA 1L5TA 1Y3NA 1M5CA 2F35A 1A7LA 4JSDA 3K4UA 3FVOA 2PX1A 4OA4A 4NF0A 3KN7A 3HO7A 4GWZA 4U1ZA 3DELB 2O7UA 5DVFA 3TFLA 4GXAA 1NFTA 3PU5A 3HCQA 5EQ9A 3LC8A 1TFDA 5J1DA 2H25A 1JNFA 2QFLA 4N6DA 4PQJA 4EDPA 2ZYNA 4ONYA 3Q28A 4BDRA 4H8JA 1P1QA 1Y4TA 2HPGA 3FJ7A 4GWUA 2HAVA 1QKBA 5IZ1A 4FEBA 3H03A 1DSNA 3JZJA 2V84A 3MP1A 4I9DA 4GX6A 1IZ1A 3T9UA 1Y1MA 4IO2A 4G61A 3O6IA 3QK6A 4ELPA 1LCTA 4X48A 5AA3A 3PPRA 4NF5B 1RDZA 1URGA 4GL8A 3FJGA 1N76A 1SPIA 3LSLA 3FZVA 3ZSFA 3QYTA 1IMAA 4OVQA 3GBBA 4OWDA 2B3FA 1RYXA 4U22A 4NE4A 5I59A 2AL4A 1SBPA 5ICQA 3LUYA 2PT1A 3IFAA 4YMAA 1EYJA 3OO6A 4F3PA 4N8YA 4P0GA 4RPNA 4N4UA 1JVXA 3E79A 3U8QA 4RYAA 4F2OA 1OQHA 1JVYA 4F3GA 2QVUA 5TU0A 1GVCA 3IOWA 1LB8A 4KPTA 4GBVA 1POTA 3MW0A 2H4IA 4P1LA 4OVTA 4AB6A 1MDQA 2CEXA 4R9FA 1N3XA 2RC7A 2Q2CA 1GV8A 4BDOA 1QGXA 5IAIA 3OENA 3MVWA 1QUJA 5ET5A 4HE0A 2F6PA 5H8FA 4I8CA 1K9YA 3QIMA 4GWSA 4DI4B 1PB8A 3IAZA 1JW1A 4PETA 1A54A 4EF1A 3G3IA 1SW4A 2XX7A 3CIJA 4JWYA 3T1BA 1HSJA 1G0IA 4OYVA 5I2NB 4WEPA 1D9VA 2ZYOA 5H8HA 2DXYA 4F3SA 3D4CA 5H8NA 3ILUB 4G8MA 2F8DA 3KG2A 4HW8A 4QSDA 2DSFA 2W7YA 1TFAA 5AA1A 1FQAA 3FBPA 4R2BA 1O7TA 4KFQA 3FD3A 3F11A 4ZEBA 4ZS9A 1XOCA 4ZECA 2Y84A 1Q35A 4EUOA 2HAUA 2WKYA 4DXCA 5FHNA 1EZPA 4FECA 4MFIA 4YU0A 4C1UA 1XVXA 3L6GA 3E4RA 3PPPA 5CMMA 1ZKBA 1SDXA 3PTYA 2UVHA 5AA2B 3SEYA 3GLBA 4C1TA 1NV0A 1FPJA 1AH5A 4G77A 3PUVE 3K02A 1M5FA 5IZ3A 3PMWA 3S9NC 1LFIA 4YB6A 3TQLA 3IO6A 2O1LA 3RPLB 1D3KA 3UORA 3KN8A 3S9EA 3UIFA 4U23A 5EYFA 3B50A 4KCDA 1FW0A 2OLBA 5I7IA 3FVGA 3FXBA 3T93B 3IX1A 5I2KB 1Q9DA 4HE2A 3ZKLA 5DVJA 4OVSA 2CEYA 1SI0A 1EYKA 2V3TA 1I6QA 4U4SA 4RK9A 2ALUA 3TUSA 1BLFA 4LZ5A 3UGWA 4RNSA 2ONKE 4XEQA 4ECFA 3K0VA 1NNTA 3TKDA 4H46A 1K9ZA 4OHNA 1FPLA 3QUJA 5KDTB 4N15A 3ONMA 2VD2A 2PT2A 4YKIA 1AL3A 3H6UA 5TPAA 4NF8B 5I57B 4R6HA 3VVEA 2VD3A 2ZNSA 4OEUA 1ANFA 1B51A 5CBRA 2FA7A 3KSJA 3CRBA 1LCFA 1DK4A 3OD7A 5A5LA 5BUUA 1FBGA 1MM6A 3M3LA 2XXWA 2P3NA 2VP1A 1FJ6A 3PUZE 4KR5A 3KN3A 3OEMA 4XF5A 1NUYA 4KYEA 4GLIA 3IORA 3Q26A 1MXWA 4O8MA 3FXUA 3B6TA 4ESXA 3GYYA 2HXRA 4FATA 2O84X 3MWBA 1PB9A 2Y7RA 1KWHA 4F22A 4U21A 5EQ7A 2QS3A 3D4GA 1NUWA 2P2AA 2PFZA 4QRZA 1AOVA 3RUMA 2QMWA 2GRVA 2PMSA 4NF5A 3C9HA 4U4XA 1ZLQA 4PTKA 3E78A 1B0LA 4MMPA 4N6PA 4O7IA 5ESYA 4QXDA 4LA9A 2P3VA 4Q0CA 4YKPA 4Q30B 1MH3A 5LTCA 2XD2A 4IO7A 4ZEIA 2D3IA 2FNCA 4NX1A 3KJTA 3A3UA 4N8GA 2ZYMA 2F6GA 5FTIA 1QJMA 3C34A 4IB2A 1UTBB 5A5XA 1FTMA 1RDXA 4OERA 2GH9A 5ISUA 1OLCA 1MXXA 1NV1A 3W9VA 1A40A 3MUQA 4G4PA 4C0RA 1MPBA 3BIHA 1NV6A 3Q25A 2OZZA 4ZEKA 2XWKA 1B4ZA 4KHZE 1MM7A 2QL3A 3PUXE 1UTHB 1AMFA 1N0TA 4U1OA 2HQ0A 5HBCA 1Y3PA 4F3BA 2MKZA 3SESA 3O2AA 4MLVA 4DCXA 1TXFA 2QVRA 2OWSA 4OVRA 4P1EA 2OX3A 2OJTA 2OBGA 4FORA 1PC3A 1LAHE 1B5HA 2Z22A 1US4A 3G3FA 4POWA 1FBCA 4GBWA 4PE3A 4G8NA 1B2HA 1ZMGA 4QFLA 4MF3A 5IKBA 3LV0A 4GX4A 4GIZA 1VDWA 1BTJA 4HE1A 2QS1A 3LSXA 4Z7EA 5JTYA 4EQ7A 3W15C 2QPQA 5DT6A 4G68C 2F36A 1AIVA 3MP8A 3SEUA 4G68B 3LSFB 4LZ7A 3VE1B 2ZYKA 4XXUA 4M1VA 4KQPA 2RCBA 2Y7IA 1YYZA 1Y4CA 1FBEA 3UP9A 3CFLA 3V8XB 4H5FA 1DMBA 1NL5A 2H5YA 3S2VA 1KZ8A 1LAXA 4HCWA 2V93A 1I69A 2A5SA 3TAJA 1DCUA 3VV5A 2Z8EA 2Z8FA 4HCYA 4GWOA 4P56A 1LGBC 4N91A 3OSQA 1FTLA 2B3BA 3FATA 2F3BA 3M3FA 4BDLA 5CM6A 4DDDA 1NI9A 1JEVA 5LOMA 2R71A 3EN3A 1P1NA 1NNKA 4NF6B 1N7XA 4EQBA 1Z7ME 3K6UA 2Y7KA 2B4MA 4MHFA 3NOHA 3AXFA 3KBZA 4OTEA 4HXVA 3RPWA 2PCRA 1MQDA 3KOSA 2GFEA 3GXAA 4MH5A 4ZE8A 4POXA 1YCJA 4ZZEA 5T3JA 4NGUA 4RPOA 1IITA 1A99A 1G0HA 4XFEA 3E9XA 5JEIA 5DEXB 3M3KA 4JBZA 2XXVA 1URDA 2XXRA 2I0CA 2A5TB 1FBFA 2IEEA 2ONRA 2UXAA 2Q8JA 1MY3A 2HZKA 2X7PA 3LUZA 3E3KA 5H8SA 3T22A 4DE8A 4NF8A 3C31A 2V25A 4N6KA 1S50A 5CI5A 3OELA 4R2FA 1IIWA 4TOZA 2NXOA 2Q74A 3B6QA 3IL1B 4NF4A 4YZZA 4GX3A 1LBXA 1B3GA 4F19A 4PFRA 4IO4A 2THIA 3A09A 5ITPA 1IMEA 1IXGA 1FPDA 1GR2A 4THIA 2D5WA 5I3SA 4NMYA 2O68A 2XX9A 1B7HA 1F9BA 4GFRA 1RYOA 2RINA 1H43A 4KI0E 4QFOA 1O64A 2RC9A 4G2ZA 4MAGA 5AE4A 1VFDA 1R1NA 1M5EA 4GVOA 2KR0A 1MY2A 1SYHA 5I56B 2HCAA 2HFBA 3IB2A 3RNNA 2DE4A 4OMBA 2UVJA 1ZJLA 1USYH 4AS5A 1B3EA 3W9WA 3BBRA 1DBZA 1POY1 3TTMA 5IZZA 2DYXA 5ET7A 3H6VA 4JVCA 1FTOA 4N81A 4E0XA 2E1SA 1IUDA 1I6AA 4FE8A 4OEVA 1RKMA 3MPLA 2XWVA 4O3BA 4P0IA 3HV1A 4BDQA 1ELJA 3PUYE 3C32A 4P8BA 1XC1A 3V89B 2H98A 3PUWE 1FSAA 5TP9B 1D4NA 2QSXA 1B1XA 1M5DA 3T9HB 2QRYA 4X8RA 3V83A 5L8DA 1UTHA 3SEWA 4MEVA 1FPEA 3BFUA 3PPOA 4E0WA 1XS5A 3B8BA 1HSEA 3QUFA 3IFCA 1FPKA 2WBDA 3EPEA 2VOZA 3MYUA 1R6ZA 3C36A 1IXCA 4H6DA 3G3JA 2R8TA 1UIVA 3LR1A 5L9MA 1SQYA 4LQ2A 4PFTA 1LAFE 5J16A 3OO7A 1FTAA 1LLSA 2UVGA 1D9QA 3HPIA 3KC1A 4IO3A 4IO5A 1S9TA 4O7MA 2DE3A 1LBWA 2XXUA 3EHUA 4NTLA 2FBPA 1DOTA 2RKMA 2O6AA 3RTWB 3RQTA 1R9QA 5KCJB 5ELVA 2V3QA 2CMOA 4G68A 5H8QA 5KZTA 1B40A 2AIXA 4OVJA 3VFJA 5AA4B 3K6VA 1B5JA 5CBSA 3G3KA 3OXNA 3HHFA 3IB1A 3IR1A 5DTBA 5F1QA 3B6WA 3IB0A 2BJJX 4PFUA 1PBPA 4PAFA 4ELRA 3JYRA 4PFBA 3H06B 2HXWA 2PFYA 1II5A 4F31B 3MPKA 4OVPA 3DP6A 2CZIA 4PFYA 1DPEA 4ND9A 3K00A 5EYGA 1IXHA 3LBSA 4OANA 2XXPA 1MQHA 1SVXB 5ET8A 3TYHA 4ESWA 2ZNUA 3SDFA 2ANJA 2R9JA 3L6HA 4JVIA 1IEJA 4NF6A 1N04A 3FASA 4LQ5A 2Z8DA 1B05A 4MNIA 4OESA 5I58B 1YPNA 2H9BA 4NQ8A 5DVIA 3P7IA 4BLAA 4YKJA 3TTLA 4I3YA 3VLVA 4NG7A 2VT5A 4N07A 2FIEA 1NNFA 4GWXA 1JW4A 3G3GA 4PF6A 4DI3D 2A5TA 1A55A 4PE5B 4UABA 4ELQA 4I3EA 2XXKA 1FTJA 3RYDA 3I3VA 3HN0A 3FJMA 3OMBA 2NVUB 4KYSA 4GXSB 4DCYA 3CR9A 1IMFA 4JSOA 1FPBA 3PD9A 2V3UA 1BIYA 5CMKA 3MQ9A 4JDFA 1B32A 2HEUA 2WYPA 1IXIA 4IGTA 3O29A 5IM2A 3IO4A 1P1OA 5HPQA 1NH7A 1YAEA 1JW5A 1A8EA 2WX9A 3T9XB 1MXVA 1H45A 4PDHA 4MIJA 2R6GE 1YTVA 1B9JA 1H3DA 2OWZA 1FPFA 4GQOA 1MDP1 1US5A 5AA2D 1PBQA 1VSOA 4Q5TA 1ATGA 4R75A 1BK4A 4QFPA 1T0KA 4LZ8A 3OSRA 4YAHX 3T0JA 1MQJA 1XT8A 1FTKA 2DOJA 3PGFA 2D21A 3G7WA 5I56A 1B6HA 1OIBA 1MRPA 1VE4A 5FTHA 2Q9TA 4AS4A 5DW8A 3MBPA 2PYYA 1KA1A 1SYIA 4GWYA 2Q89A 2UVIA 3PPNA 4GL0A 4NN3A 5JK4A 2FHYA 3CVGA 3ROJA 2Q8MA 2XHDA 1VFEA 3O66A 3TCHA 1N3WA 4G8HA 1JQFA 3R26A 3TODA 4X04A 4H5GA 4HS7A 2DE2A 4WEDA 3TZAA 3QSLA 1DTGA 1S7YA 2I0BA 3K2DA 5TP9A 4XKQA 2I4BA 4JB7A 3N26A 3S9LC 4GOTA 1LBYA 4PBQA 2Z23A 3IK6B 5FHMA 2Y7WA 4M4GA 1NUZA 3T66A 4XTCQ 4N17A 1DPPA 2HZLA 5I2NA 1LB9A 3KBRA 5H8HB 1OVBA 2E0SA 3FXRA 3I5OA 4U2RA 4WXJA 3QXMA 2WYKA 3MVXA 4HTGA 4O3CA 5EYHA 4F18A 2XA5A 2I49A 1YXIA 3IJOB 3VDFA 4QHQA 2I58A 4X1BA 4ZEFA 4KCCA 2REJA 5ICTA 2DS9A 3MSTA 3SZPA 1OLAA 1LBVA 1JP4A 3C35A 3RGYA 3KC0A 4R72A 4P11A 3VLWA 1CE2A 3PPQA 2XWIA 4NHBA 3ODBA 1XVYA 5AA4A 2F7AA 3A3CA 3U1OA 1MXZA 1CB6A 5AA2A 2F97A 4K3FA 2O1MA 1URSA 4PC9A 3E13X 3N5LA 4MNPA 2HHMA 5CC2A 3OO9A 3GZGA 4PDDA 1FBHA 2DWJA 3CG3A 5IZ3B 1B4HA 1B3FA 4ELOA 3KJ7A 4O94A 1MS7A 3CHGA 3RPLA 2G93A 2V4CA 1B58A 3TELA 4PFWA 2DWAA 3ZKKA 5ITOA 1WODA 1TWYA 4Z0IA 5I2KA 4YMBA 2RF1A 1UQWA 3EHSA 5K2YA 4ISUA 3RN8A 1KA0A 4DXUA 1CNQA 1XHYA 5I58A 1BP5A 1EYIA 2X7QA 1R9LA 3S9MC 2OWTA 4EF2A 3EF7A 4ZDMA 1EZ9A 3OOAA 3ZS6A 1LBZA 3O6GA 1Z7NE 1MXUA 5KDTA 2DDKA 5M2VA 3ISPA 2M8CA 5TPAB 5L9SA 1I6BA 1MQIA 5CRYA 4F39A 5I57A 4F1YA 3BIGA 1SW5A 2VGQA 3EQ1A 4OFOA 3B7DA 2I6EA 3WAFA 3FGSA 3PV0E 2I48A 3EKIA 3OEKA 3MC2A 3CSGA 3TMGA 3TCGA 3BKIB 4H1XA 1NV4A 2ZZVA 4NWDA 1QUIA 2ESNA 2VHAA 4FEDA 4ZZAA 4I40A 5EHMA 3CI8A 4YKKA 4H67A 4QBAA 4RY1A 2PVUA 3R7XA 2GHAA 2RC8A 4TQUQ 5EHSA 1LBBA 4OETA 2F7CA 4I1DA 4AQ4A 1GGGA 4PBHA 2QS4A 2UYFA 4MBPA 3MZ1A 4MLQA 1QULA 2X26A 3MAMA 4AB5A 3G3HA 1EH3A 1GTKA 4FBPA 2F78A 3KSXA 4KXPA 4OXVA 3BFTA 4OFJA 4H45A 2QMXA 4RA1A 2DP8A 3LSWA 3O28A 1SI1A 2OCUA 4IR8A 4NAPA 3RLFE 1MPDA 3HHGA 3TQWA 4IO6A 1TT1A 4JVDA 5EQ8A 2IA4A 1ZIUA 2P0SA 2PBWA 3SERA 2CZKA 3OO8A 3CSBA 2DVCA 1FQCA 4R6YA 2Q2AA 4JWXA 3MVYA 4FIMA 1EZOA 3H3GA 4PGNA 3RT8A 4QF9A 4R73A 2DWIA 4BDMA 2XX8A 4LVQA 4F29A 4H65A 3H4ZA 1B52A 1NUXA 5A5XB 1UTBA 1SW2A 3IOUA 3N6UA 3HSTA 3H7MA 2Y5LA 1NMUA 4KD5A 1B5IA 1IMCA 3TTNA 4N13A 3FXQA 3UA8A 4ZEDA 4R6KA 4JXIA 1A8FA 1NNPA 1EU8A 2VPOA 2CZLA 4PFIA 2FYIA 1ZU0A 1VR5A 4DIGA 3SEVA 4XIGQ 4UA8A 1FRPA 3O97A 2YLNA 4LONB 1FQBA 4H8IA 4YB7A 1FPIA 5I84A 2YJPA 4F1VA 2XXIA 3RY3A 2F3DA 1QW0A 1OVTA 4WKMA 1N84A 4FJPA 4GRKA 3SETA 4MJOA 2F7BA 5EQAA 2XWOA 1LEVA 3CG1A 3Q27A 1PEBA 3U72A 2XXQA 5JTYB 1FQDA 1NV7A 3RTFB 4X9TA 1YZ0A 3CFXA 4PGPA 3U94A 5I5PA 5K2XA 1LSTA 4QSCA 2QS2A 1Q1KA 3DP8A 1BKAA 3KOTA 1PDAA 5ET6A 1NV5A 2LAOA 3N94A 4PF8A 4R74A 5B7DA 2I4CA 1PB7A 4GF8A 3KEIA 3K6WA 1NV2A 3K1PA 3JV9A 3IJXB 2ZZXA 5CMBA 1H44A 4BDNA 2YPNA 4OZ9A 3FV2A 3K1MA 2RCAA 3DLNA 3GBAA 4OENA 3K01A 1FQEA 2FIXA 1QKAA 3VVFA 3VXBA 1FPGA 1Y3QA 1MPCA 1JEUA 4P3LA 4F1UA 5F7VA 1LFHA 3VVDA 4XKPA 3U65A 3UK4A 3T96B 2REGA 3N6TA 4JWOA 1UIUA 4XKNA 4FAJA 2ZMBA 3MZBA 1P1UA 3TTKA 1MH4A 2BJIA 1H76A 4IY5A 1MQGA 5DEXA 1MXYA 4MNCA 1QVSA 2ABHA 4UACA 4YB5A 1LAGE 1J1NA 5FBPA 3D1RA 3THIA 1OMPA 4P47A 3USDA 2NOOA 1ZBMA 2O7IA 3EHTA 2XXYA 2VPNA 3KFMA 1NV3A 2OK2A 3VLUA 4Q8RA 4NF4B 1FBDA 2I3WA 1LFGA 3A29A 1ZTYA 3IOVA 2O51A 2NWJA 3DP4A 5CMCA 5LDZA 3PMXA 3TEPA 2L5VA 2F5XA 3DM0A 2Y5KA 3FVKA 2AL5A 4LP2B 3SEXA 1JETA 5IGAA 5B70A 1Y1ZA 2XXXA 2KLFA 2H99A 3PD8A 4PAKA 3HFUA 2GQ1A 5I59B 1Y9UA 4TLMB 4PCDA 4DLDA 3K6XA 3MZ9A 4RXLA 2Q88A 4X1DA 5F24A 4H0WA 4QFKA 3TPAA 4LATA 4ZE9A 3M8UA 1NH8A 3QAXA 1AWBA 4XKRA 3SKPA 1LBCA 2NUVA 3FV1A
chains in the Genus database with same CATH topology
3KGCA 3CFZA 1B3HA 3FIRA 1D9YA 3U93A 4IY6A 4KYDA 4QFNA 1IQ7A 3FUZA 1NKXA 1WDNA 2GHBA 5H8FB 3C33A 2XD3A 2ONSA 3MJNA 4OFLA 1HSLA 2ZXTA 4GD5A 4PP0A 3RT6B 5HM4B 5BWJA 3MP6A 2DVZA 4DZ1A 3S4UA 2ZNTA 1N7WA 5H8NB 3TDJA 1B46A 3T9VA 4NWCA 3ECRA 1FQFA 1M5BA 4EXKA 4NEDA 4F2QA 2Y7PA 1SD3A 1QUKA 3C4MA 4RK2A 3TTRA 1USYE 1P1WA 1P99A 4LUBA 3FVNA 2DQVA 2DWHA 1WVJA 2XXHA 3H6WA 2O69A 4IGRA 1B1HA 2G29A 4L17A 2UYEA 3K1NA 5KCJA 1B0HA 5H8QB 5DYHA 4TLLB 3PMVA 3TCFA 1MG1A 3V5AA 3R6UA 4OQOA 3VXCA 5FHOA 4QSEA 4DXBA 1OQGA 1B3LA 2B65A 1DTZA 3MVZA 4EQ9A 3H6TA 3I6VA 2P1SA 4I62A 2F34A 2DXRA 4RJZA 4EXLA 1O63A 3IOTA 1B7UA 2XXTA 2AYSA 2QJEA 3UN6A 3O6HA 3O9PA 4YICA 1Y20A 4R9GA 1SW1A 1MY1A 2I3VA 1MY0A 1FCKA 5L9OA 1MY4A 1B7ZA 3KZGA 4O3AA 3ILTB 3WAEA 3U92A 3Q29A 1L5TA 1Y3NA 1M5CA 2F35A 1A7LA 4JSDA 3K4UA 3FVOA 2PX1A 3KN7A 3HO7A 4U1ZA 3TFLA 2O7UA 3DELB 5DVFA 4GXAA 1NFTA 3PU5A 3HCQA 3LC8A 1TFDA 5J1DA 2H25A 1JNFA 4PQJA 4EDPA 2ZYNA 4ONYA 3Q28A 4BDRA 4H8JA 1P1QA 1Y4TA 3FJ7A 2HAVA 1QKBA 4FEBA 3H03A 1DSNA 3JZJA 2V84A 3MP1A 4I9DA 1IZ1A 3T9UA 1Y1MA 4IO2A 3O6IA 3QK6A 4ELPA 1LCTA 4X48A 5AA3A 3PPRA 4NF5B 1URGA 4GL8A 3FJGA 1N76A 3LSLA 3FZVA 3ZSFA 3QYTA 3GBBA 4OWDA 2B3FA 1RYXA 4U22A 4NE4A 5I59A 2AL4A 1SBPA 5ICQA 3LUYA 2PT1A 4YMAA 3OO6A 4F3PA 4P0GA 4RPNA 1JVXA 3U8QA 4RYAA 4F2OA 1OQHA 1JVYA 4F3GA 5TU0A 1GVCA 3IOWA 1LB8A 4KPTA 1POTA 3MW0A 2H4IA 4AB6A 1MDQA 4R9FA 1N3XA 2RC7A 2Q2CA 1GV8A 4BDOA 5IAIA 3OENA 3MVWA 1QUJA 2F6PA 5H8FA 4I8CA 3QIMA 1PB8A 3IAZA 1JW1A 4PETA 1A54A 4EF1A 3G3IA 1SW4A 2XX7A 3CIJA 4JWYA 1HSJA 4OYVA 5I2NB 4WEPA 1D9VA 2ZYOA 5H8HA 2DXYA 4F3SA 3D4CA 5H8NA 3ILUB 4G8MA 2F8DA 3KG2A 4HW8A 4QSDA 2DSFA 2W7YA 1TFAA 5AA1A 1FQAA 4R2BA 1O7TA 4KFQA 3FD3A 3F11A 4ZEBA 4ZS9A 1XOCA 4ZECA 2Y84A 1Q35A 4EUOA 2HAUA 2WKYA 4DXCA 5FHNA 1EZPA 4FECA 4MFIA 4YU0A 4C1UA 1XVXA 3L6GA 3E4RA 3PPPA 5CMMA 1ZKBA 1SDXA 2UVHA 5AA2B 3SEYA 3GLBA 4C1TA 1AH5A 4G77A 3PUVE 3K02A 1M5FA 3PMWA 3S9NC 1LFIA 4YB6A 3TQLA 3IO6A 2O1LA 1D3KA 3UORA 3KN8A 3S9EA 3UIFA 4U23A 5EYFA 4KCDA 1FW0A 2OLBA 3FVGA 3T93B 3IX1A 5I2KB 3ZKLA 5DVJA 1SI0A 2V3TA 1I6QA 4U4SA 4RK9A 2ALUA 3TUSA 1BLFA 4LZ5A 3UGWA 4RNSA 2ONKE 4ECFA 3K0VA 1NNTA 3TKDA 4OHNA 5KDTB 3QUJA 3ONMA 2VD2A 2PT2A 4YKIA 1AL3A 3H6UA 5TPAA 4NF8B 5I57B 4R6HA 3VVEA 2VD3A 2ZNSA 4OEUA 1ANFA 1B51A 5CBRA 2FA7A 3KSJA 3CRBA 1LCFA 3OD7A 5BUUA 1MM6A 3M3LA 2XXWA 2VP1A 3PUZE 4KR5A 3KN3A 3OEMA 4KYEA 4GLIA 3IORA 3Q26A 1MXWA 3FXUA 3B6TA 4ESXA 4FATA 2O84X 3MWBA 1PB9A 2Y7RA 1KWHA 4F22A 4U21A 2QS3A 3D4GA 2P2AA 4QRZA 1AOVA 3RUMA 2QMWA 2GRVA 2PMSA 4NF5A 3C9HA 4U4XA 1ZLQA 1B0LA 4N6PA 4LA9A 4Q0CA 4YKPA 4Q30B 1MH3A 2XD2A 4IO7A 4ZEIA 2D3IA 2FNCA 3KJTA 3A3UA 2ZYMA 2F6GA 5FTIA 1QJMA 3C34A 4IB2A 5A5XA 1UTBB 1FTMA 4OERA 2GH9A 5ISUA 1OLCA 1MXXA 3W9VA 1A40A 3MUQA 4G4PA 4C0RA 1MPBA 3Q25A 2OZZA 4ZEKA 1B4ZA 4KHZE 1MM7A 2QL3A 3PUXE 1UTHB 1AMFA 1N0TA 4U1OA 2HQ0A 5HBCA 1Y3PA 4F3BA 3SESA 3O2AA 4MLVA 4DCXA 1TXFA 2OWSA 2OJTA 2OBGA 4FORA 1PC3A 1LAHE 1B5HA 2Z22A 1US4A 3G3FA 4POWA 4G8NA 1B2HA 1ZMGA 4QFLA 4MF3A 5IKBA 4GIZA 1BTJA 2QS1A 3LSXA 4Z7EA 5JTYA 4EQ7A 3W15C 2QPQA 5DT6A 4G68C 2F36A 1AIVA 3MP8A 3SEUA 4G68B 3LSFB 4LZ7A 3VE1B 2ZYKA 4XXUA 4M1VA 4KQPA 2RCBA 2Y7IA 1Y4CA 3UP9A 3CFLA 3V8XB 4H5FA 1DMBA 1NL5A 2H5YA 3S2VA 1LAXA 4HCWA 2V93A 1I69A 2A5SA 3TAJA 3VV5A 2Z8EA 2Z8FA 4HCYA 4GWOA 1LGBC 3OSQA 1FTLA 2B3BA 3FATA 3M3FA 4BDLA 5CM6A 4DDDA 1JEVA 5LOMA 2R71A 3EN3A 1P1NA 1NNKA 4NF6B 1N7XA 4EQBA 1Z7ME 3K6UA 2Y7KA 3AXFA 4OTEA 3RPWA 1MQDA 3KOSA 2GFEA 3GXAA 4MH5A 4ZE8A 4POXA 1YCJA 4ZZEA 4RPOA 1IITA 1A99A 3E9XA 5JEIA 5DEXB 3M3KA 4JBZA 2XXVA 1URDA 2XXRA 2I0CA 2A5TB 2IEEA 2ONRA 2UXAA 2Q8JA 1MY3A 2HZKA 2X7PA 3E3KA 5H8SA 3T22A 4DE8A 4NF8A 3C31A 2V25A 1S50A 5CI5A 3OELA 4R2FA 1IIWA 4TOZA 2NXOA 3IL1B 3B6QA 4NF4A 4YZZA 1B3GA 4F19A 4IO4A 2THIA 3A09A 5ITPA 1IXGA 1GR2A 4THIA 2D5WA 4NMYA 2O68A 2XX9A 1B7HA 1F9BA 4GFRA 1RYOA 2RINA 1H43A 4KI0E 4QFOA 1O64A 2RC9A 4G2ZA 5AE4A 1VFDA 1R1NA 1M5EA 4GVOA 1MY2A 1SYHA 5I56B 2HCAA 2HFBA 3IB2A 3RNNA 2DE4A 4OMBA 2UVJA 1ZJLA 1USYH 1B3EA 3W9WA 3BBRA 1POY1 3TTMA 2DYXA 3H6VA 1FTOA 4E0XA 2E1SA 1IUDA 1I6AA 4FE8A 4OEVA 1RKMA 3MPLA 4O3BA 4P0IA 3HV1A 4BDQA 1ELJA 3PUYE 3C32A 1XC1A 3V89B 2H98A 3PUWE 5TP9B 1D4NA 2QSXA 1B1XA 1M5DA 3T9HB 2QRYA 3V83A 5L8DA 1UTHA 3SEWA 3BFUA 3PPOA 4E0WA 1XS5A 1HSEA 3QUFA 3EPEA 2VOZA 1R6ZA 3C36A 1IXCA 4H6DA 3G3JA 1UIVA 3LR1A 5L9MA 1SQYA 4LQ2A 4PFTA 1LAFE 3OO7A 1LLSA 2UVGA 3HPIA 4IO3A 4IO5A 1S9TA 2DE3A 2XXUA 3EHUA 4NTLA 1DOTA 2RKMA 2O6AA 3RTWB 3RQTA 1R9QA 5KCJB 5ELVA 2V3QA 2CMOA 4G68A 5H8QA 5KZTA 1B40A 2AIXA 4OVJA 3VFJA 5AA4B 3K6VA 1B5JA 5CBSA 3G3KA 3OXNA 3HHFA 3IB1A 3IR1A 5DTBA 5F1QA 3B6WA 3IB0A 2BJJX 4PFUA 1PBPA 4ELRA 3JYRA 3H06B 2HXWA 1II5A 4F31B 3MPKA 3DP6A 4PFYA 1DPEA 4ND9A 3K00A 1IXHA 3LBSA 2XXPA 1MQHA 1SVXB 3TYHA 4ESWA 2ZNUA 3SDFA 2ANJA 2R9JA 3L6HA 4NF6A 1IEJA 1N04A 3FASA 4LQ5A 2Z8DA 1B05A 4OESA 5I58B 1YPNA 2H9BA 5DVIA 3P7IA 4BLAA 4YKJA 3TTLA 3VLVA 4N07A 1NNFA 1JW4A 3G3GA 2A5TA 1A55A 4PE5B 4ELQA 1FTJA 3I3VA 3HN0A 3FJMA 3OMBA 2NVUB 4KYSA 4GXSB 4DCYA 3CR9A 4JSOA 3PD9A 2V3UA 1BIYA 5CMKA 3MQ9A 4JDFA 1B32A 2HEUA 1IXIA 4IGTA 3O29A 3IO4A 1P1OA 5HPQA 1NH7A 1YAEA 1JW5A 1A8EA 3T9XB 1MXVA 1H45A 2R6GE 1YTVA 1B9JA 1H3DA 4GQOA 1MDP1 1US5A 5AA2D 1PBQA 1VSOA 4Q5TA 1ATGA 4R75A 4QFPA 1T0KA 4LZ8A 3OSRA 4YAHX 1MQJA 1XT8A 1FTKA 2DOJA 3PGFA 2D21A 3G7WA 5I56A 1B6HA 1OIBA 1MRPA 1VE4A 5FTHA 2Q9TA 3MBPA 2PYYA 1SYIA 2Q89A 2UVIA 3PPNA 4GL0A 5JK4A 3CVGA 2XHDA 1VFEA 3O66A 3TCHA 1N3WA 4G8HA 1JQFA 3R26A 3TODA 4H5GA 4HS7A 2DE2A 4WEDA 3TZAA 3QSLA 1DTGA 1S7YA 2I0BA 3K2DA 5TP9A 4XKQA 2I4BA 4JB7A 3N26A 3S9LC 4GOTA 2Z23A 3IK6B 5FHMA 2Y7WA 4M4GA 3T66A 4XTCQ 1DPPA 2HZLA 5I2NA 1LB9A 3KBRA 5H8HB 1OVBA 2E0SA 3FXRA 3I5OA 4U2RA 4WXJA 3QXMA 3MVXA 4HTGA 4O3CA 4F18A 2I49A 3IJOB 3VDFA 4QHQA 2I58A 4X1BA 4ZEFA 4KCCA 2REJA 5ICTA 2DS9A 1OLAA 3C35A 3RGYA 4R72A 4P11A 3VLWA 1CE2A 3PPQA 3ODBA 1XVYA 5AA4A 2F7AA 3A3CA 3U1OA 1MXZA 1CB6A 5AA2A 2F97A 4K3FA 2O1MA 1URSA 3E13X 3N5LA 5CC2A 3OO9A 3GZGA 2DWJA 3CG3A 1B4HA 1B3FA 4ELOA 3KJ7A 1MS7A 2G93A 1B58A 3TELA 4PFWA 2DWAA 3ZKKA 5ITOA 1WODA 1TWYA 4Z0IA 5I2KA 4YMBA 2RF1A 1UQWA 3EHSA 5K2YA 4ISUA 3RN8A 4DXUA 5I58A 1XHYA 1BP5A 2X7QA 1R9LA 3S9MC 2OWTA 4EF2A 3EF7A 4ZDMA 1EZ9A 3OOAA 3ZS6A 3O6GA 1Z7NE 1MXUA 5KDTA 5M2VA 2M8CA 5TPAB 5L9SA 1I6BA 1MQIA 5CRYA 4F39A 5I57A 4F1YA 1SW5A 2VGQA 3EQ1A 4OFOA 3B7DA 2I6EA 3WAFA 3FGSA 3PV0E 2I48A 3OEKA 3MC2A 3CSGA 3TMGA 3TCGA 3BKIB 4H1XA 4NWDA 1QUIA 2ESNA 2VHAA 4FEDA 4ZZAA 5EHMA 3CI8A 4YKKA 4H67A 4RY1A 2PVUA 3R7XA 2GHAA 2RC8A 4TQUQ 5EHSA 1LBBA 4OETA 2F7CA 4I1DA 4AQ4A 1GGGA 2QS4A 2UYFA 4MBPA 3MZ1A 4MLQA 1QULA 2X26A 3MAMA 4AB5A 3G3HA 1EH3A 1GTKA 2F78A 3KSXA 4OXVA 3BFTA 4OFJA 2QMXA 4RA1A 2DP8A 3LSWA 3O28A 1SI1A 2OCUA 3RLFE 1MPDA 3HHGA 3TQWA 4IO6A 1TT1A 2IA4A 1ZIUA 2P0SA 2PBWA 3SERA 3OO8A 3CSBA 2DVCA 1FQCA 4R6YA 2Q2AA 4JWXA 3MVYA 4FIMA 1EZOA 3H3GA 3RT8A 4QF9A 4R73A 4F29A 2DWIA 2XX8A 4LVQA 4BDMA 4H65A 3H4ZA 1B52A 5A5XB 1UTBA 1SW2A 3IOUA 3N6UA 3HSTA 3H7MA 1NMUA 4KD5A 1B5IA 3TTNA 4N13A 3FXQA 3UA8A 4ZEDA 4R6KA 4JXIA 1A8FA 1NNPA 1EU8A 2CZLA 2FYIA 1ZU0A 1VR5A 4DIGA 3SEVA 4XIGQ 4UA8A 3O97A 2YLNA 4LONB 1FQBA 4H8IA 4YB7A 5I84A 2YJPA 4F1VA 2XXIA 3RY3A 1OVTA 1QW0A 4WKMA 1N84A 4FJPA 4GRKA 3SETA 2F7BA 3CG1A 3Q27A 1PEBA 3U72A 2XXQA 5JTYB 1FQDA 3RTFB 4X9TA 3CFXA 3U94A 5K2XA 1LSTA 4QSCA 2QS2A 1Q1KA 3DP8A 1BKAA 3KOTA 1PDAA 2LAOA 3N94A 4R74A 5B7DA 2I4CA 1PB7A 4GF8A 3KEIA 3K6WA 3K1PA 3JV9A 3IJXB 5CMBA 1H44A 4BDNA 2YPNA 4OZ9A 3FV2A 3K1MA 2RCAA 3DLNA 3GBAA 4OENA 3K01A 1FQEA 1QKAA 3VVFA 3VXBA 1Y3QA 1MPCA 1JEUA 4F1UA 5F7VA 1LFHA 3VVDA 4XKPA 3UK4A 3T96B 2REGA 3N6TA 4JWOA 1UIUA 4XKNA 4FAJA 2ZMBA 3MZBA 1P1UA 3TTKA 1MH4A 1H76A 4IY5A 1MQGA 5DEXA 1MXYA 1QVSA 2ABHA 4UACA 4YB5A 1LAGE 1J1NA 3THIA 1OMPA 3USDA 2NOOA 1ZBMA 2O7IA 3EHTA 2XXYA 3KFMA 2OK2A 4Q8RA 3VLUA 4NF4B 2I3WA 1LFGA 1ZTYA 3IOVA 2O51A 2NWJA 3DP4A 5CMCA 3PMXA 3TEPA 2F5XA 3DM0A 3FVKA 2AL5A 4LP2B 3SEXA 1JETA 5B70A 1Y1ZA 2XXXA 2KLFA 2H99A 3PD8A 5I59B 1Y9UA 4TLMB 4DLDA 3K6XA 3MZ9A 4RXLA 2Q88A 4X1DA 4H0WA 4QFKA 3TPAA 4LATA 4ZE9A 3M8UA 1NH8A 3QAXA 4XKRA 3SKPA 1LBCA 2NUVA 3FV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KGC A;  3CFZ A;  1B3H A;  3FIR A;  1D9Y A;  3U93 A;  4IY6 A;  4KYD A;  4QFN A;  1IQ7 A;  3FUZ A;  1NKX A;  1WDN A;  2GHB A;  5H8F B;  3C33 A;  2XD3 A;  2ONS A;  3MJN A;  4OFL A;  1HSL A;  2ZXT A;  4GD5 A;  4PP0 A;  3RT6 B;  5HM4 B;  5BWJ A;  3MP6 A;  2DVZ A;  4DZ1 A;  3S4U A;  2ZNT A;  1N7W A;  5H8N B;  3TDJ A;  1B46 A;  3T9V A;  4NWC A;  3ECR A;  1FQF A;  1M5B A;  4EXK A;  4NED A;  4F2Q A;  2Y7P A;  1SD3 A;  1QUK A;  3C4M A;  4RK2 A;  3TTR A;  1USY E;  1P1W A;  1P99 A;  4LUB A;  3FVN A;  2DQV A;  2DWH A;  1WVJ A;  2XXH A;  3H6W A;  2O69 A;  4IGR A;  1B1H A;  2G29 A;  4L17 A;  2UYE A;  3K1N A;  5KCJ A;  1B0H A;  5H8Q B;  5DYH A;  4TLL B;  3PMV A;  3TCF A;  1MG1 A;  3V5A A;  3R6U A;  4OQO A;  3VXC A;  5FHO A;  4QSE A;  4DXB A;  1OQG A;  1B3L A;  2B65 A;  1DTZ A;  3MVZ A;  4EQ9 A;  3H6T A;  3I6V A;  2P1S A;  4I62 A;  2F34 A;  2DXR A;  4RJZ A;  4EXL A;  1O63 A;  3IOT A;  1B7U A;  2XXT A;  2AYS A;  2QJE A;  3UN6 A;  3O6H A;  3O9P A;  4YIC A;  1Y20 A;  4R9G A;  1SW1 A;  1MY1 A;  2I3V A;  1MY0 A;  1FCK A;  5L9O A;  1MY4 A;  1B7Z A;  3KZG A;  4O3A A;  3ILT B;  3WAE A;  3U92 A;  3Q29 A;  1L5T A;  1Y3N A;  1M5C A;  2F35 A;  1A7L A;  4JSD A;  3K4U A;  3FVO A;  2PX1 A;  3KN7 A;  3HO7 A;  4U1Z A;  3TFL A;  2O7U A;  3DEL B;  5DVF A;  4GXA A;  1NFT A;  3PU5 A;  3HCQ A;  3LC8 A;  1TFD A;  5J1D A;  2H25 A;  1JNF A;  4PQJ A;  4EDP A;  2ZYN A;  4ONY A;  3Q28 A;  4BDR A;  4H8J A;  1P1Q A;  1Y4T A;  3FJ7 A;  2HAV A;  1QKB A;  4FEB A;  3H03 A;  1DSN A;  3JZJ A;  2V84 A;  3MP1 A;  4I9D A;  1IZ1 A;  3T9U A;  1Y1M A;  4IO2 A;  3O6I A;  3QK6 A;  4ELP A;  1LCT A;  4X48 A;  5AA3 A;  3PPR A;  4NF5 B;  1URG A;  4GL8 A;  3FJG A;  1N76 A;  3LSL A;  3FZV A;  3ZSF A;  3QYT A;  3GBB A;  4OWD A;  2B3F A;  1RYX A;  4U22 A;  4NE4 A;  5I59 A;  2AL4 A;  1SBP A;  5ICQ A;  3LUY A;  2PT1 A;  4YMA A;  3OO6 A;  4F3P A;  4P0G A;  4RPN A;  1JVX A;  3U8Q A;  4RYA A;  4F2O A;  1OQH A;  1JVY A;  4F3G A;  5TU0 A;  1GVC A;  3IOW A;  1LB8 A;  4KPT A;  1POT A;  3MW0 A;  2H4I A;  4AB6 A;  1MDQ A;  4R9F A;  1N3X A;  2RC7 A;  2Q2C A;  1GV8 A;  4BDO A;  5IAI A;  3OEN A;  3MVW A;  1QUJ A;  2F6P A;  5H8F A;  4I8C A;  3QIM A;  1PB8 A;  3IAZ A;  1JW1 A;  4PET A;  1A54 A;  4EF1 A;  3G3I A;  1SW4 A;  2XX7 A;  3CIJ A;  4JWY A;  1HSJ A;  4OYV A;  5I2N B;  4WEP A;  1D9V A;  2ZYO A;  5H8H A;  2DXY A;  4F3S A;  3D4C A;  5H8N A;  3ILU B;  4G8M A;  2F8D A;  3KG2 A;  4HW8 A;  4QSD A;  2DSF A;  2W7Y A;  1TFA A;  5AA1 A;  1FQA A;  4R2B A;  1O7T A;  4KFQ A;  3FD3 A;  3F11 A;  4ZEB A;  4ZS9 A;  1XOC A;  4ZEC A;  2Y84 A;  1Q35 A;  4EUO A;  2HAU A;  2WKY A;  4DXC A;  5FHN A;  1EZP A;  4FEC A;  4MFI A;  4YU0 A;  4C1U A;  1XVX A;  3L6G A;  3E4R A;  3PPP A;  5CMM A;  1ZKB A;  1SDX A;  2UVH A;  5AA2 B;  3SEY A;  3GLB A;  4C1T A;  1AH5 A;  4G77 A;  3PUV E;  3K02 A;  1M5F A;  3PMW A;  3S9N C;  1LFI A;  4YB6 A;  3TQL A;  3IO6 A;  2O1L A;  1D3K A;  3UOR A;  3KN8 A;  3S9E A;  3UIF A;  4U23 A;  5EYF A;  4KCD A;  1FW0 A;  2OLB A;  3FVG A;  3T93 B;  3IX1 A;  5I2K B;  3ZKL A;  5DVJ A;  1SI0 A;  2V3T A;  1I6Q A;  4U4S A;  4RK9 A;  2ALU A;  3TUS A;  1BLF A;  4LZ5 A;  3UGW A;  4RNS A;  2ONK E;  4ECF A;  3K0V A;  1NNT A;  3TKD A;  4OHN A;  5KDT B;  3QUJ A;  3ONM A;  2VD2 A;  2PT2 A;  4YKI A;  1AL3 A;  3H6U A;  5TPA A;  4NF8 B;  5I57 B;  4R6H A;  3VVE A;  2VD3 A;  2ZNS A;  4OEU A;  1ANF A;  1B51 A;  5CBR A;  2FA7 A;  3KSJ A;  3CRB A;  1LCF A;  3OD7 A;  5BUU A;  1MM6 A;  3M3L A;  2XXW A;  2VP1 A;  3PUZ E;  4KR5 A;  3KN3 A;  3OEM A;  4KYE A;  4GLI A;  3IOR A;  3Q26 A;  1MXW A;  3FXU A;  3B6T A;  4ESX A;  4FAT A;  2O84 X;  3MWB A;  1PB9 A;  2Y7R A;  1KWH A;  4F22 A;  4U21 A;  2QS3 A;  3D4G A;  2P2A A;  4QRZ A;  1AOV A;  3RUM A;  2QMW A;  2GRV A;  2PMS A;  4NF5 A;  3C9H A;  4U4X A;  1ZLQ A;  1B0L A;  4N6P A;  4LA9 A;  4Q0C A;  4YKP A;  4Q30 B;  1MH3 A;  2XD2 A;  4IO7 A;  4ZEI A;  2D3I A;  2FNC A;  3KJT A;  3A3U A;  2ZYM A;  2F6G A;  5FTI A;  1QJM A;  3C34 A;  4IB2 A;  5A5X A;  1UTB B;  1FTM A;  4OER A;  2GH9 A;  5ISU A;  1OLC A;  1MXX A;  3W9V A;  1A40 A;  3MUQ A;  4G4P A;  4C0R A;  1MPB A;  3Q25 A;  2OZZ A;  4ZEK A;  1B4Z A;  4KHZ E;  1MM7 A;  2QL3 A;  3PUX E;  1UTH B;  1AMF A;  1N0T A;  4U1O A;  2HQ0 A;  5HBC A;  1Y3P A;  4F3B A;  3SES A;  3O2A A;  4MLV A;  4DCX A;  1TXF A;  2OWS A;  2OJT A;  2OBG A;  4FOR A;  1PC3 A;  1LAH E;  1B5H A;  2Z22 A;  1US4 A;  3G3F A;  4POW A;  4G8N A;  1B2H A;  1ZMG A;  4QFL A;  4MF3 A;  5IKB A;  4GIZ A;  1BTJ A;  2QS1 A;  3LSX A;  4Z7E A;  5JTY A;  4EQ7 A;  3W15 C;  2QPQ A;  5DT6 A;  4G68 C;  2F36 A;  1AIV A;  3MP8 A;  3SEU A;  4G68 B;  3LSF B;  4LZ7 A;  3VE1 B;  2ZYK A;  4XXU A;  4M1V A;  4KQP A;  2RCB A;  2Y7I A;  1Y4C A;  3UP9 A;  3CFL A;  3V8X B;  4H5F A;  1DMB A;  1NL5 A;  2H5Y A;  3S2V A;  1LAX A;  4HCW A;  2V93 A;  1I69 A;  2A5S A;  3TAJ A;  3VV5 A;  2Z8E A;  2Z8F A;  4HCY A;  4GWO A;  1LGB C;  3OSQ A;  1FTL A;  2B3B A;  3FAT A;  3M3F A;  4BDL A;  5CM6 A;  4DDD A;  1JEV A;  5LOM A;  2R71 A;  3EN3 A;  1P1N A;  1NNK A;  4NF6 B;  1N7X A;  4EQB A;  1Z7M E;  3K6U A;  2Y7K A;  3AXF A;  4OTE A;  3RPW A;  1MQD A;  3KOS A;  2GFE A;  3GXA A;  4MH5 A;  4ZE8 A;  4POX A;  1YCJ A;  4ZZE A;  4RPO A;  1IIT A;  1A99 A;  3E9X A;  5JEI A;  5DEX B;  3M3K A;  4JBZ A;  2XXV A;  1URD A;  2XXR A;  2I0C A;  2A5T B;  2IEE A;  2ONR A;  2UXA A;  2Q8J A;  1MY3 A;  2HZK A;  2X7P A;  3E3K A;  5H8S A;  3T22 A;  4DE8 A;  4NF8 A;  3C31 A;  2V25 A;  1S50 A;  5CI5 A;  3OEL A;  4R2F A;  1IIW A;  4TOZ A;  2NXO A;  3IL1 B;  3B6Q A;  4NF4 A;  4YZZ A;  1B3G A;  4F19 A;  4IO4 A;  2THI A;  3A09 A;  5ITP A;  1IXG A;  1GR2 A;  4THI A;  2D5W A;  4NMY A;  2O68 A;  2XX9 A;  1B7H A;  1F9B A;  4GFR A;  1RYO A;  2RIN A;  1H43 A;  4KI0 E;  4QFO A;  1O64 A;  2RC9 A;  4G2Z A;  5AE4 A;  1VFD A;  1R1N A;  1M5E A;  4GVO A;  1MY2 A;  1SYH A;  5I56 B;  2HCA A;  2HFB A;  3IB2 A;  3RNN A;  2DE4 A;  4OMB A;  2UVJ A;  1ZJL A;  1USY H;  1B3E A;  3W9W A;  3BBR A;  1POY 1;  3TTM A;  2DYX A;  3H6V A;  1FTO A;  4E0X A;  2E1S A;  1IUD A;  1I6A A;  4FE8 A;  4OEV A;  1RKM A;  3MPL A;  4O3B A;  4P0I A;  3HV1 A;  4BDQ A;  1ELJ A;  3PUY E;  3C32 A;  1XC1 A;  3V89 B;  2H98 A;  3PUW E;  5TP9 B;  1D4N A;  2QSX A;  1B1X A;  1M5D A;  3T9H B;  2QRY A;  3V83 A;  5L8D A;  1UTH A;  3SEW A;  3BFU A;  3PPO A;  4E0W A;  1XS5 A;  1HSE A;  3QUF A;  3EPE A;  2VOZ A;  1R6Z A;  3C36 A;  1IXC A;  4H6D A;  3G3J A;  1UIV A;  3LR1 A;  5L9M A;  1SQY A;  4LQ2 A;  4PFT A;  1LAF E;  3OO7 A;  1LLS A;  2UVG A;  3HPI A;  4IO3 A;  4IO5 A;  1S9T A;  2DE3 A;  2XXU A;  3EHU A;  4NTL A;  1DOT A;  2RKM A;  2O6A A;  3RTW B;  3RQT A;  1R9Q A;  5KCJ B;  5ELV A;  2V3Q A;  2CMO A;  4G68 A;  5H8Q A;  5KZT A;  1B40 A;  2AIX A;  4OVJ A;  3VFJ A;  5AA4 B;  3K6V A;  1B5J A;  5CBS A;  3G3K A;  3OXN A;  3HHF A;  3IB1 A;  3IR1 A;  5DTB A;  5F1Q A;  3B6W A;  3IB0 A;  2BJJ X;  4PFU A;  1PBP A;  4ELR A;  3JYR A;  3H06 B;  2HXW A;  1II5 A;  4F31 B;  3MPK A;  3DP6 A;  4PFY A;  1DPE A;  4ND9 A;  3K00 A;  1IXH A;  3LBS A;  2XXP A;  1MQH A;  1SVX B;  3TYH A;  4ESW A;  2ZNU A;  3SDF A;  2ANJ A;  2R9J A;  3L6H A;  4NF6 A;  1IEJ A;  1N04 A;  3FAS A;  4LQ5 A;  2Z8D A;  1B05 A;  4OES A;  5I58 B;  1YPN A;  2H9B A;  5DVI A;  3P7I A;  4BLA A;  4YKJ A;  3TTL A;  3VLV A;  4N07 A;  1NNF A;  1JW4 A;  3G3G A;  2A5T A;  1A55 A;  4PE5 B;  4ELQ A;  1FTJ A;  3I3V A;  3HN0 A;  3FJM A;  3OMB A;  2NVU B;  4KYS A;  4GXS B;  4DCY A;  3CR9 A;  4JSO A;  3PD9 A;  2V3U A;  1BIY A;  5CMK A;  3MQ9 A;  4JDF A;  1B32 A;  2HEU A;  1IXI A;  4IGT A;  3O29 A;  3IO4 A;  1P1O A;  5HPQ A;  1NH7 A;  1YAE A;  1JW5 A;  1A8E A;  3T9X B;  1MXV A;  1H45 A;  2R6G E;  1YTV A;  1B9J A;  1H3D A;  4GQO A;  1MDP 1;  1US5 A;  5AA2 D;  1PBQ A;  1VSO A;  4Q5T A;  1ATG A;  4R75 A;  4QFP A;  1T0K A;  4LZ8 A;  3OSR A;  4YAH X;  1MQJ A;  1XT8 A;  1FTK A;  2DOJ A;  3PGF A;  2D21 A;  3G7W A;  5I56 A;  1B6H A;  1OIB A;  1MRP A;  1VE4 A;  5FTH A;  2Q9T A;  3MBP A;  2PYY A;  1SYI A;  2Q89 A;  2UVI A;  3PPN A;  4GL0 A;  5JK4 A;  3CVG A;  2XHD A;  1VFE A;  3O66 A;  3TCH A;  1N3W A;  4G8H A;  1JQF A;  3R26 A;  3TOD A;  4H5G A;  4HS7 A;  2DE2 A;  4WED A;  3TZA A;  3QSL A;  1DTG A;  1S7Y A;  2I0B A;  3K2D A;  5TP9 A;  4XKQ A;  2I4B A;  4JB7 A;  3N26 A;  3S9L C;  4GOT A;  2Z23 A;  3IK6 B;  5FHM A;  2Y7W A;  4M4G A;  3T66 A;  4XTC Q;  1DPP A;  2HZL A;  5I2N A;  1LB9 A;  3KBR A;  5H8H B;  1OVB A;  2E0S A;  3FXR A;  3I5O A;  4U2R A;  4WXJ A;  3QXM A;  3MVX A;  4HTG A;  4O3C A;  4F18 A;  2I49 A;  3IJO B;  3VDF A;  4QHQ A;  2I58 A;  4X1B A;  4ZEF A;  4KCC A;  2REJ A;  5ICT A;  2DS9 A;  1OLA A;  3C35 A;  3RGY A;  4R72 A;  4P11 A;  3VLW A;  1CE2 A;  3PPQ A;  3ODB A;  1XVY A;  5AA4 A;  2F7A A;  3A3C A;  3U1O A;  1MXZ A;  1CB6 A;  5AA2 A;  2F97 A;  4K3F A;  2O1M A;  1URS A;  3E13 X;  3N5L A;  5CC2 A;  3OO9 A;  3GZG A;  2DWJ A;  3CG3 A;  1B4H A;  1B3F A;  4ELO A;  3KJ7 A;  1MS7 A;  2G93 A;  1B58 A;  3TEL A;  4PFW A;  2DWA A;  3ZKK A;  5ITO A;  1WOD A;  1TWY A;  4Z0I A;  5I2K A;  4YMB A;  2RF1 A;  1UQW A;  3EHS A;  5K2Y A;  4ISU A;  3RN8 A;  4DXU A;  5I58 A;  1XHY A;  1BP5 A;  2X7Q A;  1R9L A;  3S9M C;  2OWT A;  4EF2 A;  3EF7 A;  4ZDM A;  1EZ9 A;  3OOA A;  3ZS6 A;  3O6G A;  1Z7N E;  1MXU A;  5KDT A;  5M2V A;  2M8C A;  5TPA B;  5L9S A;  1I6B A;  1MQI A;  5CRY A;  4F39 A;  5I57 A;  4F1Y A;  1SW5 A;  2VGQ A;  3EQ1 A;  4OFO A;  3B7D A;  2I6E A;  3WAF A;  3FGS A;  3PV0 E;  2I48 A;  3OEK A;  3MC2 A;  3CSG A;  3TMG A;  3TCG A;  3BKI B;  4H1X A;  4NWD A;  1QUI A;  2ESN A;  2VHA A;  4FED A;  4ZZA A;  5EHM A;  3CI8 A;  4YKK A;  4H67 A;  4RY1 A;  2PVU A;  3R7X A;  2GHA A;  2RC8 A;  4TQU Q;  5EHS A;  1LBB A;  4OET A;  2F7C A;  4I1D A;  4AQ4 A;  1GGG A;  2QS4 A;  2UYF A;  4MBP A;  3MZ1 A;  4MLQ A;  1QUL A;  2X26 A;  3MAM A;  4AB5 A;  3G3H A;  1EH3 A;  1GTK A;  2F78 A;  3KSX A;  4OXV A;  3BFT A;  4OFJ A;  2QMX A;  4RA1 A;  2DP8 A;  3LSW A;  3O28 A;  1SI1 A;  2OCU A;  3RLF E;  1MPD A;  3HHG A;  3TQW A;  4IO6 A;  1TT1 A;  2IA4 A;  1ZIU A;  2P0S A;  2PBW A;  3SER A;  3OO8 A;  3CSB A;  2DVC A;  1FQC A;  4R6Y A;  2Q2A A;  4JWX A;  3MVY A;  4FIM A;  1EZO A;  3H3G A;  3RT8 A;  4QF9 A;  4R73 A;  4F29 A;  2DWI A;  2XX8 A;  4LVQ A;  4BDM A;  4H65 A;  3H4Z A;  1B52 A;  5A5X B;  1UTB A;  1SW2 A;  3IOU A;  3N6U A;  3HST A;  3H7M A;  1NMU A;  4KD5 A;  1B5I A;  3TTN A;  4N13 A;  3FXQ A;  3UA8 A;  4ZED A;  4R6K A;  4JXI A;  1A8F A;  1NNP A;  1EU8 A;  2CZL A;  2FYI A;  1ZU0 A;  1VR5 A;  4DIG A;  3SEV A;  4XIG Q;  4UA8 A;  3O97 A;  2YLN A;  4LON B;  1FQB A;  4H8I A;  4YB7 A;  5I84 A;  2YJP A;  4F1V A;  2XXI A;  3RY3 A;  1OVT A;  1QW0 A;  4WKM A;  1N84 A;  4FJP A;  4GRK A;  3SET A;  2F7B A;  3CG1 A;  3Q27 A;  1PEB A;  3U72 A;  2XXQ A;  5JTY B;  1FQD A;  3RTF B;  4X9T A;  3CFX A;  3U94 A;  5K2X A;  1LST A;  4QSC A;  2QS2 A;  1Q1K A;  3DP8 A;  1BKA A;  3KOT A;  1PDA A;  2LAO A;  3N94 A;  4R74 A;  5B7D A;  2I4C A;  1PB7 A;  4GF8 A;  3KEI A;  3K6W A;  3K1P A;  3JV9 A;  3IJX B;  5CMB A;  1H44 A;  4BDN A;  2YPN A;  4OZ9 A;  3FV2 A;  3K1M A;  2RCA A;  3DLN A;  3GBA A;  4OEN A;  3K01 A;  1FQE A;  1QKA A;  3VVF A;  3VXB A;  1Y3Q A;  1MPC A;  1JEU A;  4F1U A;  5F7V A;  1LFH A;  3VVD A;  4XKP A;  3UK4 A;  3T96 B;  2REG A;  3N6T A;  4JWO A;  1UIU A;  4XKN A;  4FAJ A;  2ZMB A;  3MZB A;  1P1U A;  3TTK A;  1MH4 A;  1H76 A;  4IY5 A;  1MQG A;  5DEX A;  1MXY A;  1QVS A;  2ABH A;  4UAC A;  4YB5 A;  1LAG E;  1J1N A;  3THI A;  1OMP A;  3USD A;  2NOO A;  1ZBM A;  2O7I A;  3EHT A;  2XXY A;  3KFM A;  2OK2 A;  4Q8R A;  3VLU A;  4NF4 B;  2I3W A;  1LFG A;  1ZTY A;  3IOV A;  2O51 A;  2NWJ A;  3DP4 A;  5CMC A;  3PMX A;  3TEP A;  2F5X A;  3DM0 A;  3FVK A;  2AL5 A;  4LP2 B;  3SEX A;  1JET A;  5B70 A;  1Y1Z A;  2XXX A;  2KLF A;  2H99 A;  3PD8 A;  5I59 B;  1Y9U A;  4TLM B;  4DLD A;  3K6X A;  3MZ9 A;  4RXL A;  2Q88 A;  4X1D A;  4H0W A;  4QFK A;  3TPA A;  4LAT A;  4ZE9 A;  3M8U A;  1NH8 A;  3QAX A;  4XKR A;  3SKP A;  1LBC A;  2NUV A;  3FV1 A; 
#chains in the Genus database with same CATH topology
 3KGC A;  4PAI A;  3CFZ A;  1B3H A;  3FIR A;  1D9Y A;  3U93 A;  2WEF A;  4IY6 A;  4KYD A;  2FVZ A;  4QFN A;  1IQ7 A;  3FUZ A;  1NKX A;  1WDN A;  2GHB A;  5H8F B;  1FBP A;  3C33 A;  2XD3 A;  2ONS A;  3MJN A;  2QVV A;  4OFL A;  1HSL A;  2ZXT A;  4GD5 A;  4PP0 A;  1IMB A;  3RT6 B;  5BWJ A;  5HM4 B;  3MP6 A;  2DVZ A;  4DZ1 A;  3S4U A;  2ZNT A;  1N7W A;  1XI6 A;  5H8N B;  3TDJ A;  1B46 A;  3T9V A;  4NWC A;  3ECR A;  1FJ9 A;  1FQF A;  1M5B A;  4EXK A;  4P9K A;  4NED A;  4F2Q A;  2Y7P A;  1SD3 A;  2KQZ A;  1QUK A;  3C4M A;  4RK2 A;  3TTR A;  1USY E;  1P1W A;  1P99 A;  4LUB A;  3FVN A;  2DQV A;  4MX6 A;  4LN5 A;  2DWH A;  1WVJ A;  2XXH A;  3H6W A;  2O69 A;  4IGR A;  1B1H A;  2G29 A;  4L17 A;  2UYE A;  3K1N A;  5KCJ A;  2JJK A;  1B0H A;  5H8Q B;  5DYH A;  4TLL B;  3PMV A;  3TCF A;  1MG1 A;  3V5A A;  3R6U A;  1IMD A;  4OQO A;  3VXC A;  5FHO A;  4QSE A;  4DXB A;  1OQG A;  1B3L A;  2B65 A;  1DTZ A;  3MVZ A;  4EQ9 A;  3H6T A;  2CZH A;  3I6V A;  2P1S A;  2WBB A;  4I62 A;  1RDY A;  2F34 A;  2DXR A;  4RJZ A;  4EXL A;  1O63 A;  2B4L A;  1INP A;  3IOT A;  1B7U A;  2XXT A;  2AYS A;  2QJE A;  3UN6 A;  3O6H A;  3O9P A;  3QMF A;  4R9G A;  1Y20 A;  4YIC A;  1SW1 A;  1MY1 A;  2I3V A;  1MY0 A;  4MCO A;  1FCK A;  5L9O A;  1MY4 A;  4GWW A;  1B7Z A;  3KZG A;  4O3A A;  3ILT B;  3WAE A;  3U92 A;  3Q29 A;  2ZZW A;  1L5T A;  1Y3N A;  1M5C A;  2F35 A;  1A7L A;  4JSD A;  3K4U A;  3FVO A;  2PX1 A;  4OA4 A;  4NF0 A;  3KN7 A;  3HO7 A;  4GWZ A;  4U1Z A;  3DEL B;  2O7U A;  5DVF A;  3TFL A;  4GXA A;  1NFT A;  3PU5 A;  3HCQ A;  5EQ9 A;  3LC8 A;  1TFD A;  5J1D A;  2H25 A;  1JNF A;  2QFL A;  4N6D A;  4PQJ A;  4EDP A;  2ZYN A;  4ONY A;  3Q28 A;  4BDR A;  4H8J A;  1P1Q A;  1Y4T A;  2HPG A;  3FJ7 A;  4GWU A;  2HAV A;  1QKB A;  5IZ1 A;  4FEB A;  3H03 A;  1DSN A;  3JZJ A;  2V84 A;  3MP1 A;  4I9D A;  4GX6 A;  1IZ1 A;  3T9U A;  1Y1M A;  4IO2 A;  4G61 A;  3O6I A;  3QK6 A;  4ELP A;  1LCT A;  4X48 A;  5AA3 A;  3PPR A;  4NF5 B;  1RDZ A;  1URG A;  4GL8 A;  3FJG A;  1N76 A;  1SPI A;  3LSL A;  3FZV A;  3ZSF A;  3QYT A;  1IMA A;  4OVQ A;  3GBB A;  4OWD A;  2B3F A;  1RYX A;  4U22 A;  4NE4 A;  5I59 A;  2AL4 A;  1SBP A;  5ICQ A;  3LUY A;  2PT1 A;  3IFA A;  4YMA A;  1EYJ A;  3OO6 A;  4F3P A;  4N8Y A;  4P0G A;  4RPN A;  4N4U A;  1JVX A;  3E79 A;  3U8Q A;  4RYA A;  4F2O A;  1OQH A;  1JVY A;  4F3G A;  2QVU A;  5TU0 A;  1GVC A;  3IOW A;  1LB8 A;  4KPT A;  4GBV A;  1POT A;  3MW0 A;  2H4I A;  4P1L A;  4OVT A;  4AB6 A;  1MDQ A;  2CEX A;  4R9F A;  1N3X A;  2RC7 A;  2Q2C A;  1GV8 A;  4BDO A;  1QGX A;  5IAI A;  3OEN A;  3MVW A;  1QUJ A;  5ET5 A;  4HE0 A;  2F6P A;  5H8F A;  4I8C A;  1K9Y A;  3QIM A;  4GWS A;  4DI4 B;  1PB8 A;  3IAZ A;  1JW1 A;  4PET A;  1A54 A;  4EF1 A;  3G3I A;  1SW4 A;  2XX7 A;  3CIJ A;  4JWY A;  3T1B A;  1HSJ A;  1G0I A;  4OYV A;  5I2N B;  4WEP A;  1D9V A;  2ZYO A;  5H8H A;  2DXY A;  4F3S A;  3D4C A;  5H8N A;  3ILU B;  4G8M A;  2F8D A;  3KG2 A;  4HW8 A;  4QSD A;  2DSF A;  2W7Y A;  1TFA A;  5AA1 A;  1FQA A;  3FBP A;  4R2B A;  1O7T A;  4KFQ A;  3FD3 A;  3F11 A;  4ZEB A;  4ZS9 A;  1XOC A;  4ZEC A;  2Y84 A;  1Q35 A;  4EUO A;  2HAU A;  2WKY A;  4DXC A;  5FHN A;  1EZP A;  4FEC A;  4MFI A;  4YU0 A;  4C1U A;  1XVX A;  3L6G A;  3E4R A;  3PPP A;  5CMM A;  1ZKB A;  1SDX A;  3PTY A;  2UVH A;  5AA2 B;  3SEY A;  3GLB A;  4C1T A;  1NV0 A;  1FPJ A;  1AH5 A;  4G77 A;  3PUV E;  3K02 A;  1M5F A;  5IZ3 A;  3PMW A;  3S9N C;  1LFI A;  4YB6 A;  3TQL A;  3IO6 A;  2O1L A;  3RPL B;  1D3K A;  3UOR A;  3KN8 A;  3S9E A;  3UIF A;  4U23 A;  5EYF A;  3B50 A;  4KCD A;  1FW0 A;  2OLB A;  5I7I A;  3FVG A;  3FXB A;  3T93 B;  3IX1 A;  5I2K B;  1Q9D A;  4HE2 A;  3ZKL A;  5DVJ A;  4OVS A;  2CEY A;  1SI0 A;  1EYK A;  2V3T A;  1I6Q A;  4U4S A;  4RK9 A;  2ALU A;  3TUS A;  1BLF A;  4LZ5 A;  3UGW A;  4RNS A;  2ONK E;  4XEQ A;  4ECF A;  3K0V A;  1NNT A;  3TKD A;  4H46 A;  1K9Z A;  4OHN A;  1FPL A;  3QUJ A;  5KDT B;  4N15 A;  3ONM A;  2VD2 A;  2PT2 A;  4YKI A;  1AL3 A;  3H6U A;  5TPA A;  4NF8 B;  5I57 B;  4R6H A;  3VVE A;  2VD3 A;  2ZNS A;  4OEU A;  1ANF A;  1B51 A;  5CBR A;  2FA7 A;  3KSJ A;  3CRB A;  1LCF A;  1DK4 A;  3OD7 A;  5A5L A;  5BUU A;  1FBG A;  1MM6 A;  3M3L A;  2XXW A;  2P3N A;  2VP1 A;  1FJ6 A;  3PUZ E;  4KR5 A;  3KN3 A;  3OEM A;  4XF5 A;  1NUY A;  4KYE A;  4GLI A;  3IOR A;  3Q26 A;  1MXW A;  4O8M A;  3FXU A;  3B6T A;  4ESX A;  3GYY A;  2HXR A;  4FAT A;  2O84 X;  3MWB A;  1PB9 A;  2Y7R A;  1KWH A;  4F22 A;  4U21 A;  5EQ7 A;  2QS3 A;  3D4G A;  1NUW A;  2P2A A;  2PFZ A;  4QRZ A;  1AOV A;  3RUM A;  2QMW A;  2GRV A;  2PMS A;  4NF5 A;  3C9H A;  4U4X A;  1ZLQ A;  4PTK A;  3E78 A;  1B0L A;  4MMP A;  4N6P A;  4O7I A;  5ESY A;  4QXD A;  4LA9 A;  2P3V A;  4Q0C A;  4YKP A;  4Q30 B;  1MH3 A;  5LTC A;  2XD2 A;  4IO7 A;  4ZEI A;  2D3I A;  2FNC A;  4NX1 A;  3KJT A;  3A3U A;  4N8G A;  2ZYM A;  2F6G A;  5FTI A;  1QJM A;  3C34 A;  4IB2 A;  1UTB B;  5A5X A;  1FTM A;  1RDX A;  4OER A;  2GH9 A;  5ISU A;  1OLC A;  1MXX A;  1NV1 A;  3W9V A;  1A40 A;  3MUQ A;  4G4P A;  4C0R A;  1MPB A;  3BIH A;  1NV6 A;  3Q25 A;  2OZZ A;  4ZEK A;  2XWK A;  1B4Z A;  4KHZ E;  1MM7 A;  2QL3 A;  3PUX E;  1UTH B;  1AMF A;  1N0T A;  4U1O A;  2HQ0 A;  5HBC A;  1Y3P A;  4F3B A;  2MKZ A;  3SES A;  3O2A A;  4MLV A;  4DCX A;  1TXF A;  2QVR A;  2OWS A;  4OVR A;  4P1E A;  2OX3 A;  2OJT A;  2OBG A;  4FOR A;  1PC3 A;  1LAH E;  1B5H A;  2Z22 A;  1US4 A;  3G3F A;  4POW A;  1FBC A;  4GBW A;  4PE3 A;  4G8N A;  1B2H A;  1ZMG A;  4QFL A;  4MF3 A;  5IKB A;  3LV0 A;  4GX4 A;  4GIZ A;  1VDW A;  1BTJ A;  4HE1 A;  2QS1 A;  3LSX A;  4Z7E A;  5JTY A;  4EQ7 A;  3W15 C;  2QPQ A;  5DT6 A;  4G68 C;  2F36 A;  1AIV A;  3MP8 A;  3SEU A;  4G68 B;  3LSF B;  4LZ7 A;  3VE1 B;  2ZYK A;  4XXU A;  4M1V A;  4KQP A;  2RCB A;  2Y7I A;  1YYZ A;  1Y4C A;  1FBE A;  3UP9 A;  3CFL A;  3V8X B;  4H5F A;  1DMB A;  1NL5 A;  2H5Y A;  3S2V A;  1KZ8 A;  1LAX A;  4HCW A;  2V93 A;  1I69 A;  2A5S A;  3TAJ A;  1DCU A;  3VV5 A;  2Z8E A;  2Z8F A;  4HCY A;  4GWO A;  4P56 A;  1LGB C;  4N91 A;  3OSQ A;  1FTL A;  2B3B A;  3FAT A;  2F3B A;  3M3F A;  4BDL A;  5CM6 A;  4DDD A;  1NI9 A;  1JEV A;  5LOM A;  2R71 A;  3EN3 A;  1P1N A;  1NNK A;  4NF6 B;  1N7X A;  4EQB A;  1Z7M E;  3K6U A;  2Y7K A;  2B4M A;  4MHF A;  3NOH A;  3AXF A;  3KBZ A;  4OTE A;  4HXV A;  3RPW A;  2PCR A;  1MQD A;  3KOS A;  2GFE A;  3GXA A;  4MH5 A;  4ZE8 A;  4POX A;  1YCJ A;  4ZZE A;  5T3J A;  4NGU A;  4RPO A;  1IIT A;  1A99 A;  1G0H A;  4XFE A;  3E9X A;  5JEI A;  5DEX B;  3M3K A;  4JBZ A;  2XXV A;  1URD A;  2XXR A;  2I0C A;  2A5T B;  1FBF A;  2IEE A;  2ONR A;  2UXA A;  2Q8J A;  1MY3 A;  2HZK A;  2X7P A;  3LUZ A;  3E3K A;  5H8S A;  3T22 A;  4DE8 A;  4NF8 A;  3C31 A;  2V25 A;  4N6K A;  1S50 A;  5CI5 A;  3OEL A;  4R2F A;  1IIW A;  4TOZ A;  2NXO A;  2Q74 A;  3B6Q A;  3IL1 B;  4NF4 A;  4YZZ A;  4GX3 A;  1LBX A;  1B3G A;  4F19 A;  4PFR A;  4IO4 A;  2THI A;  3A09 A;  5ITP A;  1IME A;  1IXG A;  1FPD A;  1GR2 A;  4THI A;  2D5W A;  5I3S A;  4NMY A;  2O68 A;  2XX9 A;  1B7H A;  1F9B A;  4GFR A;  1RYO A;  2RIN A;  1H43 A;  4KI0 E;  4QFO A;  1O64 A;  2RC9 A;  4G2Z A;  4MAG A;  5AE4 A;  1VFD A;  1R1N A;  1M5E A;  4GVO A;  2KR0 A;  1MY2 A;  1SYH A;  5I56 B;  2HCA A;  2HFB A;  3IB2 A;  3RNN A;  2DE4 A;  4OMB A;  2UVJ A;  1ZJL A;  1USY H;  4AS5 A;  1B3E A;  3W9W A;  3BBR A;  1DBZ A;  1POY 1;  3TTM A;  5IZZ A;  2DYX A;  5ET7 A;  3H6V A;  4JVC A;  1FTO A;  4N81 A;  4E0X A;  2E1S A;  1IUD A;  1I6A A;  4FE8 A;  4OEV A;  1RKM A;  3MPL A;  2XWV A;  4O3B A;  4P0I A;  3HV1 A;  4BDQ A;  1ELJ A;  3PUY E;  3C32 A;  4P8B A;  1XC1 A;  3V89 B;  2H98 A;  3PUW E;  1FSA A;  5TP9 B;  1D4N A;  2QSX A;  1B1X A;  1M5D A;  3T9H B;  2QRY A;  4X8R A;  3V83 A;  5L8D A;  1UTH A;  3SEW A;  4MEV A;  1FPE A;  3BFU A;  3PPO A;  4E0W A;  1XS5 A;  3B8B A;  1HSE A;  3QUF A;  3IFC A;  1FPK A;  2WBD A;  3EPE A;  2VOZ A;  3MYU A;  1R6Z A;  3C36 A;  1IXC A;  4H6D A;  3G3J A;  2R8T A;  1UIV A;  3LR1 A;  5L9M A;  1SQY A;  4LQ2 A;  4PFT A;  1LAF E;  5J16 A;  3OO7 A;  1FTA A;  1LLS A;  2UVG A;  1D9Q A;  3HPI A;  3KC1 A;  4IO3 A;  4IO5 A;  1S9T A;  4O7M A;  2DE3 A;  1LBW A;  2XXU A;  3EHU A;  4NTL A;  2FBP A;  1DOT A;  2RKM A;  2O6A A;  3RTW B;  3RQT A;  1R9Q A;  5KCJ B;  5ELV A;  2V3Q A;  2CMO A;  4G68 A;  5H8Q A;  5KZT A;  1B40 A;  2AIX A;  4OVJ A;  3VFJ A;  5AA4 B;  3K6V A;  1B5J A;  5CBS A;  3G3K A;  3OXN A;  3HHF A;  3IB1 A;  3IR1 A;  5DTB A;  5F1Q A;  3B6W A;  3IB0 A;  2BJJ X;  4PFU A;  1PBP A;  4PAF A;  4ELR A;  3JYR A;  4PFB A;  3H06 B;  2HXW A;  2PFY A;  1II5 A;  4F31 B;  3MPK A;  4OVP A;  3DP6 A;  2CZI A;  4PFY A;  1DPE A;  4ND9 A;  3K00 A;  5EYG A;  1IXH A;  3LBS A;  4OAN A;  2XXP A;  1MQH A;  1SVX B;  5ET8 A;  3TYH A;  4ESW A;  2ZNU A;  3SDF A;  2ANJ A;  2R9J A;  3L6H A;  4JVI A;  1IEJ A;  4NF6 A;  1N04 A;  3FAS A;  4LQ5 A;  2Z8D A;  1B05 A;  4MNI A;  4OES A;  5I58 B;  1YPN A;  2H9B A;  4NQ8 A;  5DVI A;  3P7I A;  4BLA A;  4YKJ A;  3TTL A;  4I3Y A;  3VLV A;  4NG7 A;  2VT5 A;  4N07 A;  2FIE A;  1NNF A;  4GWX A;  1JW4 A;  3G3G A;  4PF6 A;  4DI3 D;  2A5T A;  1A55 A;  4PE5 B;  4UAB A;  4ELQ A;  4I3E A;  2XXK A;  1FTJ A;  3RYD A;  3I3V A;  3HN0 A;  3FJM A;  3OMB A;  2NVU B;  4KYS A;  4GXS B;  4DCY A;  3CR9 A;  1IMF A;  4JSO A;  1FPB A;  3PD9 A;  2V3U A;  1BIY A;  5CMK A;  3MQ9 A;  4JDF A;  1B32 A;  2HEU A;  2WYP A;  1IXI A;  4IGT A;  3O29 A;  5IM2 A;  3IO4 A;  1P1O A;  5HPQ A;  1NH7 A;  1YAE A;  1JW5 A;  1A8E A;  2WX9 A;  3T9X B;  1MXV A;  1H45 A;  4PDH A;  4MIJ A;  2R6G E;  1YTV A;  1B9J A;  1H3D A;  2OWZ A;  1FPF A;  4GQO A;  1MDP 1;  1US5 A;  5AA2 D;  1PBQ A;  1VSO A;  4Q5T A;  1ATG A;  4R75 A;  1BK4 A;  4QFP A;  1T0K A;  4LZ8 A;  3OSR A;  4YAH X;  3T0J A;  1MQJ A;  1XT8 A;  1FTK A;  2DOJ A;  3PGF A;  2D21 A;  3G7W A;  5I56 A;  1B6H A;  1OIB A;  1MRP A;  1VE4 A;  5FTH A;  2Q9T A;  4AS4 A;  5DW8 A;  3MBP A;  2PYY A;  1KA1 A;  1SYI A;  4GWY A;  2Q89 A;  2UVI A;  3PPN A;  4GL0 A;  4NN3 A;  5JK4 A;  2FHY A;  3CVG A;  3ROJ A;  2Q8M A;  2XHD A;  1VFE A;  3O66 A;  3TCH A;  1N3W A;  4G8H A;  1JQF A;  3R26 A;  3TOD A;  4X04 A;  4H5G A;  4HS7 A;  2DE2 A;  4WED A;  3TZA A;  3QSL A;  1DTG A;  1S7Y A;  2I0B A;  3K2D A;  5TP9 A;  4XKQ A;  2I4B A;  4JB7 A;  3N26 A;  3S9L C;  4GOT A;  1LBY A;  4PBQ A;  2Z23 A;  3IK6 B;  5FHM A;  2Y7W A;  4M4G A;  1NUZ A;  3T66 A;  4XTC Q;  4N17 A;  1DPP A;  2HZL A;  5I2N A;  1LB9 A;  3KBR A;  5H8H B;  1OVB A;  2E0S A;  3FXR A;  3I5O A;  4U2R A;  4WXJ A;  3QXM A;  2WYK A;  3MVX A;  4HTG A;  4O3C A;  5EYH A;  4F18 A;  2XA5 A;  2I49 A;  1YXI A;  3IJO B;  3VDF A;  4QHQ A;  2I58 A;  4X1B A;  4ZEF A;  4KCC A;  2REJ A;  5ICT A;  2DS9 A;  3MST A;  3SZP A;  1OLA A;  1LBV A;  1JP4 A;  3C35 A;  3RGY A;  3KC0 A;  4R72 A;  4P11 A;  3VLW A;  1CE2 A;  3PPQ A;  2XWI A;  4NHB A;  3ODB A;  1XVY A;  5AA4 A;  2F7A A;  3A3C A;  3U1O A;  1MXZ A;  1CB6 A;  5AA2 A;  2F97 A;  4K3F A;  2O1M A;  1URS A;  4PC9 A;  3E13 X;  3N5L A;  4MNP A;  2HHM A;  5CC2 A;  3OO9 A;  3GZG A;  4PDD A;  1FBH A;  2DWJ A;  3CG3 A;  5IZ3 B;  1B4H A;  1B3F A;  4ELO A;  3KJ7 A;  4O94 A;  1MS7 A;  3CHG A;  3RPL A;  2G93 A;  2V4C A;  1B58 A;  3TEL A;  4PFW A;  2DWA A;  3ZKK A;  5ITO A;  1WOD A;  1TWY A;  4Z0I A;  5I2K A;  4YMB A;  2RF1 A;  1UQW A;  3EHS A;  5K2Y A;  4ISU A;  3RN8 A;  1KA0 A;  4DXU A;  1CNQ A;  1XHY A;  5I58 A;  1BP5 A;  1EYI A;  2X7Q A;  1R9L A;  3S9M C;  2OWT A;  4EF2 A;  3EF7 A;  4ZDM A;  1EZ9 A;  3OOA A;  3ZS6 A;  1LBZ A;  3O6G A;  1Z7N E;  1MXU A;  5KDT A;  2DDK A;  5M2V A;  3ISP A;  2M8C A;  5TPA B;  5L9S A;  1I6B A;  1MQI A;  5CRY A;  4F39 A;  5I57 A;  4F1Y A;  3BIG A;  1SW5 A;  2VGQ A;  3EQ1 A;  4OFO A;  3B7D A;  2I6E A;  3WAF A;  3FGS A;  3PV0 E;  2I48 A;  3EKI A;  3OEK A;  3MC2 A;  3CSG A;  3TMG A;  3TCG A;  3BKI B;  4H1X A;  1NV4 A;  2ZZV A;  4NWD A;  1QUI A;  2ESN A;  2VHA A;  4FED A;  4ZZA A;  4I40 A;  5EHM A;  3CI8 A;  4YKK A;  4H67 A;  4QBA A;  4RY1 A;  2PVU A;  3R7X A;  2GHA A;  2RC8 A;  4TQU Q;  5EHS A;  1LBB A;  4OET A;  2F7C A;  4I1D A;  4AQ4 A;  1GGG A;  4PBH A;  2QS4 A;  2UYF A;  4MBP A;  3MZ1 A;  4MLQ A;  1QUL A;  2X26 A;  3MAM A;  4AB5 A;  3G3H A;  1EH3 A;  1GTK A;  4FBP A;  2F78 A;  3KSX A;  4KXP A;  4OXV A;  3BFT A;  4OFJ A;  4H45 A;  2QMX A;  4RA1 A;  2DP8 A;  3LSW A;  3O28 A;  1SI1 A;  2OCU A;  4IR8 A;  4NAP A;  3RLF E;  1MPD A;  3HHG A;  3TQW A;  4IO6 A;  1TT1 A;  4JVD A;  5EQ8 A;  2IA4 A;  1ZIU A;  2P0S A;  2PBW A;  3SER A;  2CZK A;  3OO8 A;  3CSB A;  2DVC A;  1FQC A;  4R6Y A;  2Q2A A;  4JWX A;  3MVY A;  4FIM A;  1EZO A;  3H3G A;  4PGN A;  3RT8 A;  4QF9 A;  4R73 A;  2DWI A;  4BDM A;  2XX8 A;  4LVQ A;  4F29 A;  4H65 A;  3H4Z A;  1B52 A;  1NUX A;  5A5X B;  1UTB A;  1SW2 A;  3IOU A;  3N6U A;  3HST A;  3H7M A;  2Y5L A;  1NMU A;  4KD5 A;  1B5I A;  1IMC A;  3TTN A;  4N13 A;  3FXQ A;  3UA8 A;  4ZED A;  4R6K A;  4JXI A;  1A8F A;  1NNP A;  1EU8 A;  2VPO A;  2CZL A;  4PFI A;  2FYI A;  1ZU0 A;  1VR5 A;  4DIG A;  3SEV A;  4XIG Q;  4UA8 A;  1FRP A;  3O97 A;  2YLN A;  4LON B;  1FQB A;  4H8I A;  4YB7 A;  1FPI A;  5I84 A;  2YJP A;  4F1V A;  2XXI A;  3RY3 A;  2F3D A;  1QW0 A;  1OVT A;  4WKM A;  1N84 A;  4FJP A;  4GRK A;  3SET A;  4MJO A;  2F7B A;  5EQA A;  2XWO A;  1LEV A;  3CG1 A;  3Q27 A;  1PEB A;  3U72 A;  2XXQ A;  5JTY B;  1FQD A;  1NV7 A;  3RTF B;  4X9T A;  1YZ0 A;  3CFX A;  4PGP A;  3U94 A;  5I5P A;  5K2X A;  1LST A;  4QSC A;  2QS2 A;  1Q1K A;  3DP8 A;  1BKA A;  3KOT A;  1PDA A;  5ET6 A;  1NV5 A;  2LAO A;  3N94 A;  4PF8 A;  4R74 A;  5B7D A;  2I4C A;  1PB7 A;  4GF8 A;  3KEI A;  3K6W A;  1NV2 A;  3K1P A;  3JV9 A;  3IJX B;  2ZZX A;  5CMB A;  1H44 A;  4BDN A;  2YPN A;  4OZ9 A;  3FV2 A;  3K1M A;  2RCA A;  3DLN A;  3GBA A;  4OEN A;  3K01 A;  1FQE A;  2FIX A;  1QKA A;  3VVF A;  3VXB A;  1FPG A;  1Y3Q A;  1MPC A;  1JEU A;  4P3L A;  4F1U A;  5F7V A;  1LFH A;  3VVD A;  4XKP A;  3U65 A;  3UK4 A;  3T96 B;  2REG A;  3N6T A;  4JWO A;  1UIU A;  4XKN A;  4FAJ A;  2ZMB A;  3MZB A;  1P1U A;  3TTK A;  1MH4 A;  2BJI A;  1H76 A;  4IY5 A;  1MQG A;  5DEX A;  1MXY A;  4MNC A;  1QVS A;  2ABH A;  4UAC A;  4YB5 A;  1LAG E;  1J1N A;  5FBP A;  3D1R A;  3THI A;  1OMP A;  4P47 A;  3USD A;  2NOO A;  1ZBM A;  2O7I A;  3EHT A;  2XXY A;  2VPN A;  3KFM A;  1NV3 A;  2OK2 A;  3VLU A;  4Q8R A;  4NF4 B;  1FBD A;  2I3W A;  1LFG A;  3A29 A;  1ZTY A;  3IOV A;  2O51 A;  2NWJ A;  3DP4 A;  5CMC A;  5LDZ A;  3PMX A;  3TEP A;  2L5V A;  2F5X A;  3DM0 A;  2Y5K A;  3FVK A;  2AL5 A;  4LP2 B;  3SEX A;  1JET A;  5IGA A;  5B70 A;  1Y1Z A;  2XXX A;  2KLF A;  2H99 A;  3PD8 A;  4PAK A;  3HFU A;  2GQ1 A;  5I59 B;  1Y9U A;  4TLM B;  4PCD A;  4DLD A;  3K6X A;  3MZ9 A;  4RXL A;  2Q88 A;  4X1D A;  5F24 A;  4H0W A;  4QFK A;  3TPA A;  4LAT A;  4ZE9 A;  3M8U A;  1NH8 A;  3QAX A;  1AWB A;  4XKR A;  3SKP A;  1LBC A;  2NUV A;  3FV1 A; 
#chains in the Genus database with same CATH homology
 3KGC A;  3CFZ A;  1B3H A;  3FIR A;  1D9Y A;  3U93 A;  4IY6 A;  4KYD A;  4QFN A;  1IQ7 A;  3FUZ A;  1NKX A;  1WDN A;  2GHB A;  5H8F B;  3C33 A;  2XD3 A;  2ONS A;  3MJN A;  4OFL A;  1HSL A;  2ZXT A;  4GD5 A;  4PP0 A;  3RT6 B;  5HM4 B;  5BWJ A;  3MP6 A;  2DVZ A;  4DZ1 A;  3S4U A;  2ZNT A;  1N7W A;  5H8N B;  3TDJ A;  1B46 A;  3T9V A;  4NWC A;  3ECR A;  1FQF A;  1M5B A;  4EXK A;  4NED A;  4F2Q A;  2Y7P A;  1SD3 A;  1QUK A;  3C4M A;  4RK2 A;  3TTR A;  1USY E;  1P1W A;  1P99 A;  4LUB A;  3FVN A;  2DQV A;  2DWH A;  1WVJ A;  2XXH A;  3H6W A;  2O69 A;  4IGR A;  1B1H A;  2G29 A;  4L17 A;  2UYE A;  3K1N A;  5KCJ A;  1B0H A;  5H8Q B;  5DYH A;  4TLL B;  3PMV A;  3TCF A;  1MG1 A;  3V5A A;  3R6U A;  4OQO A;  3VXC A;  5FHO A;  4QSE A;  4DXB A;  1OQG A;  1B3L A;  2B65 A;  1DTZ A;  3MVZ A;  4EQ9 A;  3H6T A;  3I6V A;  2P1S A;  4I62 A;  2F34 A;  2DXR A;  4RJZ A;  4EXL A;  1O63 A;  3IOT A;  1B7U A;  2XXT A;  2AYS A;  2QJE A;  3UN6 A;  3O6H A;  3O9P A;  4YIC A;  1Y20 A;  4R9G A;  1SW1 A;  1MY1 A;  2I3V A;  1MY0 A;  1FCK A;  5L9O A;  1MY4 A;  1B7Z A;  3KZG A;  4O3A A;  3ILT B;  3WAE A;  3U92 A;  3Q29 A;  1L5T A;  1Y3N A;  1M5C A;  2F35 A;  1A7L A;  4JSD A;  3K4U A;  3FVO A;  2PX1 A;  3KN7 A;  3HO7 A;  4U1Z A;  3TFL A;  2O7U A;  3DEL B;  5DVF A;  4GXA A;  1NFT A;  3PU5 A;  3HCQ A;  3LC8 A;  1TFD A;  5J1D A;  2H25 A;  1JNF A;  4PQJ A;  4EDP A;  2ZYN A;  4ONY A;  3Q28 A;  4BDR A;  4H8J A;  1P1Q A;  1Y4T A;  3FJ7 A;  2HAV A;  1QKB A;  4FEB A;  3H03 A;  1DSN A;  3JZJ A;  2V84 A;  3MP1 A;  4I9D A;  1IZ1 A;  3T9U A;  1Y1M A;  4IO2 A;  3O6I A;  3QK6 A;  4ELP A;  1LCT A;  4X48 A;  5AA3 A;  3PPR A;  4NF5 B;  1URG A;  4GL8 A;  3FJG A;  1N76 A;  3LSL A;  3FZV A;  3ZSF A;  3QYT A;  3GBB A;  4OWD A;  2B3F A;  1RYX A;  4U22 A;  4NE4 A;  5I59 A;  2AL4 A;  1SBP A;  5ICQ A;  3LUY A;  2PT1 A;  4YMA A;  3OO6 A;  4F3P A;  4P0G A;  4RPN A;  1JVX A;  3U8Q A;  4RYA A;  4F2O A;  1OQH A;  1JVY A;  4F3G A;  5TU0 A;  1GVC A;  3IOW A;  1LB8 A;  4KPT A;  1POT A;  3MW0 A;  2H4I A;  4AB6 A;  1MDQ A;  4R9F A;  1N3X A;  2RC7 A;  2Q2C A;  1GV8 A;  4BDO A;  5IAI A;  3OEN A;  3MVW A;  1QUJ A;  2F6P A;  5H8F A;  4I8C A;  3QIM A;  1PB8 A;  3IAZ A;  1JW1 A;  4PET A;  1A54 A;  4EF1 A;  3G3I A;  1SW4 A;  2XX7 A;  3CIJ A;  4JWY A;  1HSJ A;  4OYV A;  5I2N B;  4WEP A;  1D9V A;  2ZYO A;  5H8H A;  2DXY A;  4F3S A;  3D4C A;  5H8N A;  3ILU B;  4G8M A;  2F8D A;  3KG2 A;  4HW8 A;  4QSD A;  2DSF A;  2W7Y A;  1TFA A;  5AA1 A;  1FQA A;  4R2B A;  1O7T A;  4KFQ A;  3FD3 A;  3F11 A;  4ZEB A;  4ZS9 A;  1XOC A;  4ZEC A;  2Y84 A;  1Q35 A;  4EUO A;  2HAU A;  2WKY A;  4DXC A;  5FHN A;  1EZP A;  4FEC A;  4MFI A;  4YU0 A;  4C1U A;  1XVX A;  3L6G A;  3E4R A;  3PPP A;  5CMM A;  1ZKB A;  1SDX A;  2UVH A;  5AA2 B;  3SEY A;  3GLB A;  4C1T A;  1AH5 A;  4G77 A;  3PUV E;  3K02 A;  1M5F A;  3PMW A;  3S9N C;  1LFI A;  4YB6 A;  3TQL A;  3IO6 A;  2O1L A;  1D3K A;  3UOR A;  3KN8 A;  3S9E A;  3UIF A;  4U23 A;  5EYF A;  4KCD A;  1FW0 A;  2OLB A;  3FVG A;  3T93 B;  3IX1 A;  5I2K B;  3ZKL A;  5DVJ A;  1SI0 A;  2V3T A;  1I6Q A;  4U4S A;  4RK9 A;  2ALU A;  3TUS A;  1BLF A;  4LZ5 A;  3UGW A;  4RNS A;  2ONK E;  4ECF A;  3K0V A;  1NNT A;  3TKD A;  4OHN A;  5KDT B;  3QUJ A;  3ONM A;  2VD2 A;  2PT2 A;  4YKI A;  1AL3 A;  3H6U A;  5TPA A;  4NF8 B;  5I57 B;  4R6H A;  3VVE A;  2VD3 A;  2ZNS A;  4OEU A;  1ANF A;  1B51 A;  5CBR A;  2FA7 A;  3KSJ A;  3CRB A;  1LCF A;  3OD7 A;  5BUU A;  1MM6 A;  3M3L A;  2XXW A;  2VP1 A;  3PUZ E;  4KR5 A;  3KN3 A;  3OEM A;  4KYE A;  4GLI A;  3IOR A;  3Q26 A;  1MXW A;  3FXU A;  3B6T A;  4ESX A;  4FAT A;  2O84 X;  3MWB A;  1PB9 A;  2Y7R A;  1KWH A;  4F22 A;  4U21 A;  2QS3 A;  3D4G A;  2P2A A;  4QRZ A;  1AOV A;  3RUM A;  2QMW A;  2GRV A;  2PMS A;  4NF5 A;  3C9H A;  4U4X A;  1ZLQ A;  1B0L A;  4N6P A;  4LA9 A;  4Q0C A;  4YKP A;  4Q30 B;  1MH3 A;  2XD2 A;  4IO7 A;  4ZEI A;  2D3I A;  2FNC A;  3KJT A;  3A3U A;  2ZYM A;  2F6G A;  5FTI A;  1QJM A;  3C34 A;  4IB2 A;  5A5X A;  1UTB B;  1FTM A;  4OER A;  2GH9 A;  5ISU A;  1OLC A;  1MXX A;  3W9V A;  1A40 A;  3MUQ A;  4G4P A;  4C0R A;  1MPB A;  3Q25 A;  2OZZ A;  4ZEK A;  1B4Z A;  4KHZ E;  1MM7 A;  2QL3 A;  3PUX E;  1UTH B;  1AMF A;  1N0T A;  4U1O A;  2HQ0 A;  5HBC A;  1Y3P A;  4F3B A;  3SES A;  3O2A A;  4MLV A;  4DCX A;  1TXF A;  2OWS A;  2OJT A;  2OBG A;  4FOR A;  1PC3 A;  1LAH E;  1B5H A;  2Z22 A;  1US4 A;  3G3F A;  4POW A;  4G8N A;  1B2H A;  1ZMG A;  4QFL A;  4MF3 A;  5IKB A;  4GIZ A;  1BTJ A;  2QS1 A;  3LSX A;  4Z7E A;  5JTY A;  4EQ7 A;  3W15 C;  2QPQ A;  5DT6 A;  4G68 C;  2F36 A;  1AIV A;  3MP8 A;  3SEU A;  4G68 B;  3LSF B;  4LZ7 A;  3VE1 B;  2ZYK A;  4XXU A;  4M1V A;  4KQP A;  2RCB A;  2Y7I A;  1Y4C A;  3UP9 A;  3CFL A;  3V8X B;  4H5F A;  1DMB A;  1NL5 A;  2H5Y A;  3S2V A;  1LAX A;  4HCW A;  2V93 A;  1I69 A;  2A5S A;  3TAJ A;  3VV5 A;  2Z8E A;  2Z8F A;  4HCY A;  4GWO A;  1LGB C;  3OSQ A;  1FTL A;  2B3B A;  3FAT A;  3M3F A;  4BDL A;  5CM6 A;  4DDD A;  1JEV A;  5LOM A;  2R71 A;  3EN3 A;  1P1N A;  1NNK A;  4NF6 B;  1N7X A;  4EQB A;  1Z7M E;  3K6U A;  2Y7K A;  3AXF A;  4OTE A;  3RPW A;  1MQD A;  3KOS A;  2GFE A;  3GXA A;  4MH5 A;  4ZE8 A;  4POX A;  1YCJ A;  4ZZE A;  4RPO A;  1IIT A;  1A99 A;  3E9X A;  5JEI A;  5DEX B;  3M3K A;  4JBZ A;  2XXV A;  1URD A;  2XXR A;  2I0C A;  2A5T B;  2IEE A;  2ONR A;  2UXA A;  2Q8J A;  1MY3 A;  2HZK A;  2X7P A;  3E3K A;  5H8S A;  3T22 A;  4DE8 A;  4NF8 A;  3C31 A;  2V25 A;  1S50 A;  5CI5 A;  3OEL A;  4R2F A;  1IIW A;  4TOZ A;  2NXO A;  3IL1 B;  3B6Q A;  4NF4 A;  4YZZ A;  1B3G A;  4F19 A;  4IO4 A;  2THI A;  3A09 A;  5ITP A;  1IXG A;  1GR2 A;  4THI A;  2D5W A;  4NMY A;  2O68 A;  2XX9 A;  1B7H A;  1F9B A;  4GFR A;  1RYO A;  2RIN A;  1H43 A;  4KI0 E;  4QFO A;  1O64 A;  2RC9 A;  4G2Z A;  5AE4 A;  1VFD A;  1R1N A;  1M5E A;  4GVO A;  1MY2 A;  1SYH A;  5I56 B;  2HCA A;  2HFB A;  3IB2 A;  3RNN A;  2DE4 A;  4OMB A;  2UVJ A;  1ZJL A;  1USY H;  1B3E A;  3W9W A;  3BBR A;  1POY 1;  3TTM A;  2DYX A;  3H6V A;  1FTO A;  4E0X A;  2E1S A;  1IUD A;  1I6A A;  4FE8 A;  4OEV A;  1RKM A;  3MPL A;  4O3B A;  4P0I A;  3HV1 A;  4BDQ A;  1ELJ A;  3PUY E;  3C32 A;  1XC1 A;  3V89 B;  2H98 A;  3PUW E;  5TP9 B;  1D4N A;  2QSX A;  1B1X A;  1M5D A;  3T9H B;  2QRY A;  3V83 A;  5L8D A;  1UTH A;  3SEW A;  3BFU A;  3PPO A;  4E0W A;  1XS5 A;  1HSE A;  3QUF A;  3EPE A;  2VOZ A;  1R6Z A;  3C36 A;  1IXC A;  4H6D A;  3G3J A;  1UIV A;  3LR1 A;  5L9M A;  1SQY A;  4LQ2 A;  4PFT A;  1LAF E;  3OO7 A;  1LLS A;  2UVG A;  3HPI A;  4IO3 A;  4IO5 A;  1S9T A;  2DE3 A;  2XXU A;  3EHU A;  4NTL A;  1DOT A;  2RKM A;  2O6A A;  3RTW B;  3RQT A;  1R9Q A;  5KCJ B;  5ELV A;  2V3Q A;  2CMO A;  4G68 A;  5H8Q A;  5KZT A;  1B40 A;  2AIX A;  4OVJ A;  3VFJ A;  5AA4 B;  3K6V A;  1B5J A;  5CBS A;  3G3K A;  3OXN A;  3HHF A;  3IB1 A;  3IR1 A;  5DTB A;  5F1Q A;  3B6W A;  3IB0 A;  2BJJ X;  4PFU A;  1PBP A;  4ELR A;  3JYR A;  3H06 B;  2HXW A;  1II5 A;  4F31 B;  3MPK A;  3DP6 A;  4PFY A;  1DPE A;  4ND9 A;  3K00 A;  1IXH A;  3LBS A;  2XXP A;  1MQH A;  1SVX B;  3TYH A;  4ESW A;  2ZNU A;  3SDF A;  2ANJ A;  2R9J A;  3L6H A;  4NF6 A;  1IEJ A;  1N04 A;  3FAS A;  4LQ5 A;  2Z8D A;  1B05 A;  4OES A;  5I58 B;  1YPN A;  2H9B A;  5DVI A;  3P7I A;  4BLA A;  4YKJ A;  3TTL A;  3VLV A;  4N07 A;  1NNF A;  1JW4 A;  3G3G A;  2A5T A;  1A55 A;  4PE5 B;  4ELQ A;  1FTJ A;  3I3V A;  3HN0 A;  3FJM A;  3OMB A;  2NVU B;  4KYS A;  4GXS B;  4DCY A;  3CR9 A;  4JSO A;  3PD9 A;  2V3U A;  1BIY A;  5CMK A;  3MQ9 A;  4JDF A;  1B32 A;  2HEU A;  1IXI A;  4IGT A;  3O29 A;  3IO4 A;  1P1O A;  5HPQ A;  1NH7 A;  1YAE A;  1JW5 A;  1A8E A;  3T9X B;  1MXV A;  1H45 A;  2R6G E;  1YTV A;  1B9J A;  1H3D A;  4GQO A;  1MDP 1;  1US5 A;  5AA2 D;  1PBQ A;  1VSO A;  4Q5T A;  1ATG A;  4R75 A;  4QFP A;  1T0K A;  4LZ8 A;  3OSR A;  4YAH X;  1MQJ A;  1XT8 A;  1FTK A;  2DOJ A;  3PGF A;  2D21 A;  3G7W A;  5I56 A;  1B6H A;  1OIB A;  1MRP A;  1VE4 A;  5FTH A;  2Q9T A;  3MBP A;  2PYY A;  1SYI A;  2Q89 A;  2UVI A;  3PPN A;  4GL0 A;  5JK4 A;  3CVG A;  2XHD A;  1VFE A;  3O66 A;  3TCH A;  1N3W A;  4G8H A;  1JQF A;  3R26 A;  3TOD A;  4H5G A;  4HS7 A;  2DE2 A;  4WED A;  3TZA A;  3QSL A;  1DTG A;  1S7Y A;  2I0B A;  3K2D A;  5TP9 A;  4XKQ A;  2I4B A;  4JB7 A;  3N26 A;  3S9L C;  4GOT A;  2Z23 A;  3IK6 B;  5FHM A;  2Y7W A;  4M4G A;  3T66 A;  4XTC Q;  1DPP A;  2HZL A;  5I2N A;  1LB9 A;  3KBR A;  5H8H B;  1OVB A;  2E0S A;  3FXR A;  3I5O A;  4U2R A;  4WXJ A;  3QXM A;  3MVX A;  4HTG A;  4O3C A;  4F18 A;  2I49 A;  3IJO B;  3VDF A;  4QHQ A;  2I58 A;  4X1B A;  4ZEF A;  4KCC A;  2REJ A;  5ICT A;  2DS9 A;  1OLA A;  3C35 A;  3RGY A;  4R72 A;  4P11 A;  3VLW A;  1CE2 A;  3PPQ A;  3ODB A;  1XVY A;  5AA4 A;  2F7A A;  3A3C A;  3U1O A;  1MXZ A;  1CB6 A;  5AA2 A;  2F97 A;  4K3F A;  2O1M A;  1URS A;  3E13 X;  3N5L A;  5CC2 A;  3OO9 A;  3GZG A;  2DWJ A;  3CG3 A;  1B4H A;  1B3F A;  4ELO A;  3KJ7 A;  1MS7 A;  2G93 A;  1B58 A;  3TEL A;  4PFW A;  2DWA A;  3ZKK A;  5ITO A;  1WOD A;  1TWY A;  4Z0I A;  5I2K A;  4YMB A;  2RF1 A;  1UQW A;  3EHS A;  5K2Y A;  4ISU A;  3RN8 A;  4DXU A;  5I58 A;  1XHY A;  1BP5 A;  2X7Q A;  1R9L A;  3S9M C;  2OWT A;  4EF2 A;  3EF7 A;  4ZDM A;  1EZ9 A;  3OOA A;  3ZS6 A;  3O6G A;  1Z7N E;  1MXU A;  5KDT A;  5M2V A;  2M8C A;  5TPA B;  5L9S A;  1I6B A;  1MQI A;  5CRY A;  4F39 A;  5I57 A;  4F1Y A;  1SW5 A;  2VGQ A;  3EQ1 A;  4OFO A;  3B7D A;  2I6E A;  3WAF A;  3FGS A;  3PV0 E;  2I48 A;  3OEK A;  3MC2 A;  3CSG A;  3TMG A;  3TCG A;  3BKI B;  4H1X A;  4NWD A;  1QUI A;  2ESN A;  2VHA A;  4FED A;  4ZZA A;  5EHM A;  3CI8 A;  4YKK A;  4H67 A;  4RY1 A;  2PVU A;  3R7X A;  2GHA A;  2RC8 A;  4TQU Q;  5EHS A;  1LBB A;  4OET A;  2F7C A;  4I1D A;  4AQ4 A;  1GGG A;  2QS4 A;  2UYF A;  4MBP A;  3MZ1 A;  4MLQ A;  1QUL A;  2X26 A;  3MAM A;  4AB5 A;  3G3H A;  1EH3 A;  1GTK A;  2F78 A;  3KSX A;  4OXV A;  3BFT A;  4OFJ A;  2QMX A;  4RA1 A;  2DP8 A;  3LSW A;  3O28 A;  1SI1 A;  2OCU A;  3RLF E;  1MPD A;  3HHG A;  3TQW A;  4IO6 A;  1TT1 A;  2IA4 A;  1ZIU A;  2P0S A;  2PBW A;  3SER A;  3OO8 A;  3CSB A;  2DVC A;  1FQC A;  4R6Y A;  2Q2A A;  4JWX A;  3MVY A;  4FIM A;  1EZO A;  3H3G A;  3RT8 A;  4QF9 A;  4R73 A;  4F29 A;  2DWI A;  2XX8 A;  4LVQ A;  4BDM A;  4H65 A;  3H4Z A;  1B52 A;  5A5X B;  1UTB A;  1SW2 A;  3IOU A;  3N6U A;  3HST A;  3H7M A;  1NMU A;  4KD5 A;  1B5I A;  3TTN A;  4N13 A;  3FXQ A;  3UA8 A;  4ZED A;  4R6K A;  4JXI A;  1A8F A;  1NNP A;  1EU8 A;  2CZL A;  2FYI A;  1ZU0 A;  1VR5 A;  4DIG A;  3SEV A;  4XIG Q;  4UA8 A;  3O97 A;  2YLN A;  4LON B;  1FQB A;  4H8I A;  4YB7 A;  5I84 A;  2YJP A;  4F1V A;  2XXI A;  3RY3 A;  1OVT A;  1QW0 A;  4WKM A;  1N84 A;  4FJP A;  4GRK A;  3SET A;  2F7B A;  3CG1 A;  3Q27 A;  1PEB A;  3U72 A;  2XXQ A;  5JTY B;  1FQD A;  3RTF B;  4X9T A;  3CFX A;  3U94 A;  5K2X A;  1LST A;  4QSC A;  2QS2 A;  1Q1K A;  3DP8 A;  1BKA A;  3KOT A;  1PDA A;  2LAO A;  3N94 A;  4R74 A;  5B7D A;  2I4C A;  1PB7 A;  4GF8 A;  3KEI A;  3K6W A;  3K1P A;  3JV9 A;  3IJX B;  5CMB A;  1H44 A;  4BDN A;  2YPN A;  4OZ9 A;  3FV2 A;  3K1M A;  2RCA A;  3DLN A;  3GBA A;  4OEN A;  3K01 A;  1FQE A;  1QKA A;  3VVF A;  3VXB A;  1Y3Q A;  1MPC A;  1JEU A;  4F1U A;  5F7V A;  1LFH A;  3VVD A;  4XKP A;  3UK4 A;  3T96 B;  2REG A;  3N6T A;  4JWO A;  1UIU A;  4XKN A;  4FAJ A;  2ZMB A;  3MZB A;  1P1U A;  3TTK A;  1MH4 A;  1H76 A;  4IY5 A;  1MQG A;  5DEX A;  1MXY A;  1QVS A;  2ABH A;  4UAC A;  4YB5 A;  1LAG E;  1J1N A;  3THI A;  1OMP A;  3USD A;  2NOO A;  1ZBM A;  2O7I A;  3EHT A;  2XXY A;  3KFM A;  2OK2 A;  4Q8R A;  3VLU A;  4NF4 B;  2I3W A;  1LFG A;  1ZTY A;  3IOV A;  2O51 A;  2NWJ A;  3DP4 A;  5CMC A;  3PMX A;  3TEP A;  2F5X A;  3DM0 A;  3FVK A;  2AL5 A;  4LP2 B;  3SEX A;  1JET A;  5B70 A;  1Y1Z A;  2XXX A;  2KLF A;  2H99 A;  3PD8 A;  5I59 B;  1Y9U A;  4TLM B;  4DLD A;  3K6X A;  3MZ9 A;  4RXL A;  2Q88 A;  4X1D A;  4H0W A;  4QFK A;  3TPA A;  4LAT A;  4ZE9 A;  3M8U A;  1NH8 A;  3QAX A;  4XKR A;  3SKP A;  1LBC A;  2NUV A;  3FV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...