1II5A

Crystal structure of the glur0 ligand binding core complex with l-glutamate
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
226
structure length
221
Chain Sequence
GSAMALKVGVVGNPPFVFYGAFTGISLDVWRAVAESQKWNSEYVRQNSISAGITAVAEGELDILIGPISVTPERAAIEGITFTQPYFSSGIGLLIPGTATPLFRSVGDLKNKEVAVVRDTTAVDWANFYQADVRETNNLTAAITLLQKKQVEAVMFDRPALIYYTRQNPNLNLEVTEIRVSLEPYGFVLKENSPLQKTINVEMLNLLYSRVIAEFTERWLG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms for ligand binding to GluR0 ion channels: crystal structures of the glutamate and serine complexes and a closed apo state.
pubmed doi rcsb
source organism Synechocystis sp. pcc 6803 substr. kazusa
molecule tags Membrane protein
molecule keywords Slr1257 protein
total genus 72
structure length 221
sequence length 226
ec nomenclature
pdb deposition date 2001-04-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ii5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1ii5A02
4WKMA 1MPDA 2O6AA 3JZJA 4OFOA 3PUZE 4O3BA 4U4XA 5CM6A 2V93A 5H8QA 3QUJA 1IXCA 2DSFA 2ZYKA 4JXIA 1JEVA 5F7VA 5TP9A 4GQOA 1MXWA 4R9FA 2E1SA 1SI1A 2QSXA 4YMBA 5KCJB 4X1DA 4DXUA 4F3SA 3M3LA 1M5FA 4P0IA 1MS7A 4I62A 4IO3A 1B3GA 3V5AA 1PB8A 1QKAA 2O84X 2Z23A 3BBRA 3S2VA 1DSNA 2H98A 1H3DA 3B6TA 2DXYA 3I6VA 3K6VA 5AE4A 4U4SA 3OO8A 5IKBA 3MZ9A 4H0WA 3LUYA 2Q89A 2HFBA 3V8XB 3TTKA 2ALUA 2RCBA 3FD3A 5ITPA 2I4CA 3C34A 3DELB 1O63A 2XX7A 3FATA 1YCJA 4NF4B 4BDLA 4LQ2A 4C1TA 2XX8A 3U8QA 1A8FA 1MRPA 3IO6A 4G77A 4MLQA 1AL3A 2F36A 4RK9A 2ANJA 4KD5A 1N7XA 3MVXA 4GLIA 1B7ZA 4R2FA 2O7IA 3SETA 2NXOA 3AXFA 1OIBA 3E9XA 4FORA 3T9VA 1B3LA 2OWSA 3G3KA 1OLCA 4LP2B 4FAJA 3RT6B 2ZNSA 1B51A 4ISUA 3KGCA 3U92A 4F2OA 5J1DA 3O97A 2FA7A 5KCJA 1FQBA 1MXZA 2IEEA 4LQ5A 4XKRA 4FEBA 1KWHA 2HZKA 4ZZEA 3TTMA 2I58A 3E4RA 3IJOB 2QS4A 1USYE 3W9VA 4NF5A 2ZXTA 3F11A 3TELA 3PV0E 2DXRA 3TODA 3Q25A 5L9OA 2X26A 5CBRA 3ZS6A 2QS2A 3TZAA 4F3GA 3KJ7A 5H8HB 1FW0A 4U2RA 4THIA 1MPCA 3KZGA 5DEXA 2VD3A 3PGFA 3LR1A 4IY5A 2QMXA 3D4CA 4GF8A 4KHZE 4KPTA 1MXXA 3HCQA 1B32A 3BFUA 1MM6A 1B5IA 1SW2A 3FVKA 3LSXA 4GOTA 4JWXA 3RUMA 5IAIA 4XKQA 1N7WA 3TTRA 3MVWA 2GHAA 3VVEA 4C1UA 1Y3QA 3TEPA 1B6HA 5ISUA 4G8NA 3Q28A 4L17A 2RC9A 1DMBA 2HEUA 3CR9A 2CZLA 4GXSB 4E0WA 5HPQA 1LAGE 3PUVE 4QFPA 4FATA 2ZMBA 2PMSA 2FNCA 1B7HA 1SDXA 1LFHA 2Y7WA 3HSTA 3V83A 1UTBB 2F34A 1ZJLA 2M8CA 2ONRA 3L6GA 3VLWA 5CBSA 3S9EA 1MY4A 3U93A 3PPPA 1B05A 3K4UA 1JEUA 3OD7A 1VFDA 2G93A 5I2KA 3T9HB 2H4IA 3O6GA 5ELVA 2V3TA 4GD5A 4N13A 1RYXA 3TCHA 2Z8FA 1M5CA 5I59B 3TQLA 2UVJA 4F3PA 2Q9TA 3MC2A 4QFOA 1LAHE 3IO4A 3Q26A 1NFTA 1IUDA 1OLAA 1FQAA 3CG3A 2F35A 1EZ9A 2HCAA 2Z8EA 2O1LA 3OELA 3G3IA 4JB7A 1XVYA 2XX9A 4GRKA 4M4GA 1IQ7A 4NF4A 1ZTYA 1MY3A 2D3IA 3Q29A 2XXUA 1EZPA 1WDNA 3O2AA 4IO6A 3M3KA 1GR2A 5K2XA 2OCUA 1B1HA 3G3HA 1LBBA 3FJMA 2RINA 3QAXA 3KOSA 5FTIA 3RT8A 1NH7A 2F8DA 4G8HA 2XD2A 3UP9A 1B0LA 3K02A 5AA3A 2Y7KA 1MXUA 1PB9A 5AA2B 5B7DA 1H43A 2F78A 3FVGA 4MF3A 2XXYA 3V89B 1BP5A 3IR1A 4AQ4A 4KCDA 2B3FA 3PD9A 1NNKA 4RYAA 4F1VA 1MXYA 3EHTA 4R9GA 4EDPA 1URSA 1XC1A 3FV2A 4P0GA 1MH4A 4OTEA 3BFTA 5CMCA 5JTYB 1MQDA 1Z7ME 1B3EA 2A5TA 1FTJA 2QJEA 4ESXA 1EU8A 4DXBA 3B6WA 3FXQA 2P2AA 1N3XA 4OESA 2UVGA 3FIRA 3CFLA 4FE8A 4NF5B 1NNFA 4XKPA 4HS7A 5I58A 4X9TA 4EQ7A 3IX1A 4OWDA 5KDTA 2VHAA 1OQHA 3GBBA 2XXHA 4R6YA 4F19A 4PE5B 2LAOA 2OZZA 3EQ1A 3OENA 2XHDA 4XTCQ 1R1NA 3PUYE 3TPAA 4LUBA 3EN3A 1MY0A 5DVFA 3ILTB 3DM0A 5TU0A 4BLAA 4Q5TA 3KN3A 3L6HA 1ELJA 1SW1A 4POWA 2ONSA 5LOMA 2NOOA 3EF7A 3DP8A 2W7YA 4K3FA 1B52A 2XD3A 3OEKA 1MG1A 3B6QA 3RNNA 3G7WA 3VVFA 2PYYA 3K1PA 1XS5A 3PMWA 4ECFA 5H8FB 5EYFA 1YTVA 1D9YA 2I0CA 4IGRA 5AA1A 4OMBA 1R9QA 2Q8JA 1DOTA 2UYEA 1ZIUA 3PMXA 2B65A 2R71A 3IL1B 3CRBA 4XKNA 5HBCA 1FTLA 2HXWA 1II5A 2O1MA 1F9BA 3IOVA 4YMAA 1MQGA 1N3WA 1QVSA 4F3BA 1B3FA 3OSQA 4E0XA 1ATGA 4GWOA 2I49A 4F1YA 1Q1KA 1XOCA 3MWBA 1T0KA 3CIJA 4G2ZA 1A99A 4R73A 1S50A 3PPOA 5FHNA 4ELQA 3ZSFA 1I6BA 4IO2A 4PETA 3K1NA 3KFMA 3N5LA 3T66A 5I2NA 3RTWB 4DIGA 4MLVA 1IEJA 1LLSA 1OQGA 2QPQA 3B7DA 3IAZA 3R6UA 2DWJA 3G3JA 2DE4A 2RC8A 3GXAA 4KYSA 4AB6A 2REJA 5DVIA 1BLFA 2Z8DA 2G29A 1IXHA 3IORA 1XHYA 4H1XA 4Z0IA 3U72A 5I2NB 3T9XB 1NKXA 2V84A 1OMPA 5L9MA 5K2YA 1L5TA 5L9SA 1AOVA 1M5DA 1Y4CA 4JWOA 5I59A 4EXKA 1RKMA 1P1OA 5H8SA 1Y20A 3K6WA 3MVZA 4R75A 2GRVA 4R6KA 1VR5A 3TAJA 3TDJA 1FQFA 3VLVA 3WAFA 4F39A 3C31A 3MP6A 4ONYA 1H76A 1R9LA 5DTBA 3UA8A 4KCCA 3TTNA 4YB6A 1ZU0A 5H8NA 1FQCA 3O9PA 3EPEA 4O3AA 4R2BA 2XXRA 1AMFA 3IJXB 3CSBA 3MZBA 4FECA 4X1BA 5FTHA 2ONKE 3KOTA 1D4NA 3QXMA 3PMVA 1FCKA 4HTGA 1WODA 1POY1 3MAMA 4BDOA 4PFWA 1FTOA 1H44A 3GZGA 2F6PA 3K1MA 1M5BA 1MY2A 3C4MA 4LZ7A 4BDNA 5L8DA 4OHNA 1HSJA 1B58A 1Z7NE 3FJ7A 3ECRA 3MJNA 4ELPA 1IITA 2GHBA 1AH5A 3E3KA 3FUZA 3RGYA 3TYHA 3N6TA 1NL5A 5AA2D 4GVOA 4QFKA 3OO7A 1UQWA 5CMKA 1TXFA 2BJJX 3QK6A 5I57B 2DE2A 4N6PA 4YB7A 1JQFA 4OEUA 5A5XB 1I6QA 1LB9A 4P11A 2V25A 2ZNTA 1NH8A 2ZYMA 1B0HA 4I1DA 4Q0CA 1LAXA 4TOZA 4YKPA 1DTGA 3RN8A 3FGSA 2D5WA 4TLLB 5DVJA 1RYOA 3CI8A 3RPWA 1MQIA 1PB7A 1H45A 3G3GA 5TP9B 4ZEKA 2RF1A 2UVHA 2V3QA 2XXTA 4JSDA 4NF6A 2PT1A 4WXJA 5DEXB 1YPNA 2H9BA 3R7XA 3VDFA 2KLFA 3GBAA 4DCYA 3H03A 1OVBA 1JNFA 2IA4A 2WKYA 5ITOA 4JBZA 4EUOA 3O29A 2F6GA 2XXWA 2Z22A 1BKAA 2O68A 4Z7EA 1CB6A 3MP8A 1DTZA 1LBCA 1NNPA 2VD2A 3LBSA 1I6AA 2O69A 4I9DA 4QSCA 3PUXE 4EF2A 1SVXB 5JK4A 2XXXA 4NWCA 4OERA 5H8FA 1PDAA 2OBGA 3D4GA 4JWYA 2F7AA 3FVOA 2XXIA 4G68B 1BIYA 1USYH 2QS1A 4I8CA 1J1NA 4N07A 5KDTB 1IXGA 1N04A 1VSOA 2CMOA 2FYIA 1B40A 2I0BA 3A09A 3JYRA 2OK2A 3MW0A 3MPKA 3KJTA 5CMBA 3TTLA 3UK4A 1BTJA 3ZKKA 4KI0E 5I84A 1A40A 1LCTA 4R74A 2PBWA 2DS9A 2DQVA 3VV5A 4DZ1A 1ZMGA 1MQHA 3FXRA 1NMUA 4KQPA 4RA1A 3TUSA 4ZS9A 3IOWA 4HW8A 2XXQA 3OMBA 1ZLQA 1LSTA 2ESNA 2V3UA 3Q27A 4ZEBA 1FTMA 2RCAA 4PQJA 4YAHX 5FHOA 3SESA 1URDA 1WVJA 4RPOA 2ABHA 1JW5A 2H5YA 2X7QA 4QHQA 3IB2A 1SYIA 1B3HA 4YKJA 5ICQA 1PBPA 4M1VA 3MBPA 1ANFA 4IO5A 3MQ9A 2AL4A 5B70A 4TLMB 4RJZA 2H99A 2NUVA 3N26A 4G4PA 1UTHB 3KSXA 4BDQA 1R6ZA 3LSLA 5I58B 1P99A 1JVYA 1LB8A 4MH5A 4MFIA 3ZKLA 1LFGA 4OEVA 4PP0A 1YAEA 4UA8A 4NMYA 3K01A 3E13X 4F31B 2P1SA 3K00A 2I6EA 3LSFB 3U1OA 2B3BA 4DE8A 5ICTA 4F29A 4OZ9A 5CRYA 5A5XA 2F5XA 2AL5A 3H7MA 4OXVA 2I48A 3FASA 4OENA 4RNSA 5JEIA 1SQYA 1Y3PA 3K2DA 3O6IA 3HV1A 1B5HA 3T22A 3N94A 3S4UA 4FJPA 1Y3NA 2Q2AA 3C9HA 3DLNA 2NVUB 4ESWA 5CI5A 5KZTA 3A3UA 3PPQA 4NF8B 4XXUA 2H25A 4ZE8A 1A7LA 3TKDA 3IOUA 3KG2A 3W9WA 4Q8RA 1N0TA 4QRZA 4ZDMA 3GLBA 1TWYA 1MDP1 1UTHA 1S9TA 4R72A 3HN0A 1IXIA 1EH3A 2QS3A 1TFDA 2YPNA 3USDA 2DOJA 2Y7RA 3HPIA 4JDFA 2NWJA 3CG1A 1JW4A 4QSDA 5AA2A 2HQ0A 1XT8A 3A3CA 4U23A 4PFUA 3EHSA 1B2HA 1GV8A 2HAUA 4YICA 2Y7PA 1UTBA 1VE4A 2ZYNA 1IZ1A 4ELRA 3T93B 3C32A 1HSLA 2ZYOA 3H4ZA 2PX1A 2GFEA 1JETA 1Q35A 1MY1A 2D21A 2F97A 4GL8A 1B1XA 4ZZAA 1VFEA 3OO9A 4IO4A 1OVTA 4R6HA 2F7BA 2HAVA 3PUWE 3IB1A 3N6UA 5H8NB 3VVDA 4KFQA 4GIZA 3TFLA 1B5JA 2GH9A 2Y7IA 3CFXA 4U21A 4YB5A 3SKPA 4IB2A 1GTKA 1JVXA 3JV9A 3TQWA 2R9JA 4AB5A 1US5A 1TT1A 1B9JA 3C33A 3RTFB 3VXCA 3LSWA 4H5FA 4WEPA 1SYHA 3OOAA 4NEDA 3SERA 4OQOA 4QSEA 2YJPA 3TCFA 2DWHA 1UIUA 2A5TB 3QIMA 3UGWA 4ZECA 3S9MC 3C36A 1SI0A 5CMMA 1MPBA 1A8EA 1M5EA 2Y84A 1PC3A 1D9VA 4LVQA 2OLBA 1SBPA 3O66A 3OXNA 1QUKA 3SDFA 1S7YA 3PD8A 4RY1A 2I3VA 3PPNA 3QUFA 3H6WA 3ONMA 5I57A 3UN6A 4RXLA 3IK6B 4HCWA 3SEVA 2OWTA 5HM4B 3S9NC 1AIVA 2I3WA 2OJTA 3FV1A 1P1UA 3DP6A 2XXVA 1HSEA 2PT2A 3MVYA 5I56A 2QMWA 1ZKBA 4KR5A 3HO7A 4QFLA 1FTKA 3MZ1A 3U94A 1MM7A 3G3FA 1B4HA 2RC7A 3HHFA 3KN7A 3PPRA 2QRYA 1GVCA 4DXCA 5AA4B 1SW4A 3KEIA 3VE1B 3K6XA 1GGGA 3P7IA 2DVZA 1N76A 4RK2A 4U22A 4POXA 4BDRA 3QYTA 2REGA 1D3KA 3MP1A 4OFJA 4YZZA 3H06B 1O64A 5TPAA 1XVXA 3UORA 3VXBA 5AA4A 5M2VA 1N84A 2QL3A 5EHMA 1ZBMA 1A54A 2RKMA 4IY6A 4H8IA 1O7TA 1QJMA 1SD3A 3OO6A 1B4ZA 3EHUA 3LC8A 2DWIA 4G68A 3WAEA 5H8QB 4ZEFA 2PVUA 1DPPA 3I5OA 4ZE9A 1QKBA 1POTA 3HHGA 4LZ5A 4RPNA 4NTLA 4NE4A 3FZVA 1MQJA 3PU5A 4HCYA 4JSOA 3T9UA 5CC2A 4DDDA 4OYVA 1LAFE 1Y4TA 3BKIB 4G68C 4H8JA 5I56B 1MXVA 3OEMA 1QUJA 4YKIA 4PFYA 2UXAA 1IIWA 1SW5A 4IGTA 2DE3A 1FQEA 4LONB 3KBRA 2UVIA 3MUQA 3H6VA 5F1QA 4DLDA 2O51A 3FVNA 4GFRA 4LZ8A 1P1NA 2DWAA 2O7UA 5BUUA 4G8MA 4TQUQ 4H65A 3ODBA 1B7UA 4EQBA 4NWDA 3VFJA 1P1WA 4OVJA 1MH3A 5DYHA 2VP1A 4KYEA 5JTYA 2A5SA 3TCGA 3H6TA 4H67A 3KN8A 4ELOA 4KYDA 1TFAA 4EQ9A 1CE2A 2Q88A 3I3VA 4U1OA 4LA9A 1FQDA 5BWJA 4QF9A 1LCFA 4C0RA 4U1ZA 2ZNUA 1NNTA 3K0VA 3CVGA 3DP4A 4WEDA 3RY3A 3SEYA 3TMGA 3MPLA 3FXUA 1Y9UA 2P0SA 1QULA 4GL0A 4PFTA 5EHSA 3FJGA 3R26A 4OFLA 4YKKA 3KSJA 3M3FA 2HZLA 3RQTA 4BDMA 5I2KB 4XIGQ 4H6DA 3IB0A 1DPEA 4Q30B 2X7PA 3SEUA 1QUIA 1Y1ZA 3IOTA 3O28A 4UACA 3T96B 4OETA 2XXPA 3CSGA 2VOZA 4MBPA 3W15C 5DT6A 1P1QA 1URGA 2YLNA 2E0SA 3C35A 4NF8A 4GXAA 4EXLA 5FHMA 4O3CA 3H6UA 5TPAB 3RLFE 1LFIA 3UIFA 1MDQA 4F22A 3QSLA 4ZEDA 2DP8A 1B46A 3OSRA 3H3GA 3THIA 4EF1A 2DYXA 5H8HA 4QFNA 2I4BA 2VGQA 1Y1MA 1JW1A 1QW0A 2Q2CA 3O6HA 4ZEIA 4F1UA 2AYSA 2AIXA 1I69A 1US4A 2THIA 1LGBC 2R6GE 1PBQA 3CFZA 4FIMA 4NF6B 4IO7A 4DCXA 1PEBA 2UYFA 2DVCA 4ND9A 4YU0A 1UIVA 3SEWA 1EZOA 2F7CA 4H5GA 4LATA 3M8UA 3SEXA 4F2QA 1A55A 3K6UA 3VLUA 3S9LC 4FEDA 4F18A 4X48A 3ILUB
chains in the Genus database with same CATH superfamily
3JZJA 2V93A 5H8QA 1IXCA 2DSFA 1JEVA 4AS4A 4YMBA 4X1DA 4F3SA 3VLUA 5JEIA 1QKAA 2O84X 2Z23A 3BBRA 5HM4B 1H3DA 4U4SA 3MZ9A 4H0WA 2QVVA 4JVIA 3TTKA 3DELB 2XX7A 2Q74A 1YCJA 4LQ2A 3IO6A 4G77A 3MVXA 3SETA 1B7ZA 2O7IA 2NXOA 4LP2B 5CM6A 3RT6B 2ZNSA 4F2OA 4FEBA 4ZZEA 3Q25A 4DI4B 3ZS6A 3TZAA 4F3GA 3KJ7A 5H8HB 1MPCA 4XFEA 1FPKA 3PGFA 3VLWA 1B32A 4GOTA 3FVKA 1N7WA 3TTRA 4C1UA 1Y3QA 4L17A 1DMBA 5HPQA 3PUVE 2ZMBA 2PMSA 5IZ1A 1B7HA 2Y7WA 1ZJLA 2M8CA 3L6GA 1MY4A 3T9HB 2H4IA 3O6GA 4N13A 4QFOA 3A29A 1OLAA 5AA2B 2F35A 1IQ7A 1KA1A 4GX6A 4N8GA 1GR2A 5K2XA 2OCUA 3QAXA 1LBBA 5FTIA 2F8DA 4G8HA 1PB9A 4OA4A 3FVGA 4MJOA 2B3FA 4RYAA 1LBWA 3EHTA 4EDPA 1XC1A 4P0GA 3BFTA 5JTYB 4KXPA 3FXQA 1N3XA 4OESA 4NF5B 1NNFA 4EQ7A 3IX1A 1RDYA 2OZZA 4XTCQ 3OENA 4GWZA 4BLAA 3L6HA 3HFUA 4POWA 3DP8A 2W7YA 4K3FA 3K1PA 1D9YA 1R9QA 1DOTA 3IL1B 4PAIA 5HBCA 2HXWA 1II5A 1F9BA 3IOVA 4F3BA 1ATGA 4F1YA 1Q1KA 1XOCA 3CIJA 5FHNA 2XXKA 3ZSFA 4IO2A 4PETA 3N5LA 3R6UA 2DE4A 2RC8A 4H1XA 4Z0IA 2QVUA 5IZ3A 1Y4CA 4JWOA 1RKMA 5H8SA 1FPJA 4I3EA 3TAJA 3WAFA 3C31A 3TTNA 3O9PA 4MNIA 4R2BA 4XF5A 3CSBA 5FTHA 1D4NA 2WX9A 1FTOA 4LZ7A 1IITA 3RGYA 1NL5A 4GVOA 1FJ9A 2BJJX 2DE2A 5A5XB 1LBXA 4PAKA 4P11A 4PCDA 2ZNTA 1NH8A 4TOZA 4Q0CA 1LAXA 3RN8A 2D5WA 3RPWA 1MQIA 5TP9B 2UVHA 2XXTA 1YPNA 2VPOA 2KLFA 1NV0A 3GBAA 4DCYA 4Z7EA 3LBSA 1LBCA 1NNPA 2O69A 4NWCA 2OBGA 3D4GA 3MYUA 2F7AA 3KJTA 4R74A 2OX3A 3FXRA 4KQPA 2XXQA 2V3UA 4YAHX 4RPOA 2WEFA 4YKJA 1PBPA 4GBWA 2AL4A 5B70A 2H99A 2FBPA 1R6ZA 1JVYA 1LFGA 4OEVA 3B50A 4N81A 2P1SA 2I6EA 3LSFB 3U1OA 1NUYA 4OENA 1Y3PA 4FJPA 1YXIA 1JP4A 1N0TA 3GLBA 1TWYA 1EH3A 2WYPA 2Y7RA 4JDFA 3CG1A 5AA2A 2HQ0A 1B2HA 2VT5A 1BK4A 4ELRA 1VE4A 4OVSA 4GBVA 1JETA 1CNQA 3OO9A 1OVTA 1QGXA 3VVDA 4GX4A 3CFXA 4U21A 3SKPA 5IZZA 4IB2A 1TT1A 3C33A 3LSWA 1SYHA 3OOAA 4N4UA 2YJPA 1UIUA 2A5TB 3QIMA 3C36A 4MEVA 1K9YA 1SBPA 3O66A 3SDFA 1S7YA 4RY1A 3PPNA 3ONMA 1AIVA 3FV1A 2XXVA 1HSEA 2PT2A 2RC7A 1GVCA 2JJKA 5AA4B 1SW4A 4BDRA 4U22A 1D3KA 2F3DA 4OFJA 3H06B 3UORA 1XVXA 5M2VA 1N84A 5EHMA 3EHUA 3WAEA 4NG7A 1POTA 3HHGA 4RPNA 1NI9A 3FZVA 1Y4TA 5I56B 1NUWA 5FBPA 1FQEA 2V4CA 3KBRA 4GFRA 1P1NA 1K9ZA 2DWAA 4TQUQ 1B7UA 3QMFA 5ESYA 4KYEA 4H67A 4LA9A 1NNTA 3CVGA 3DP4A 1LEVA 4OVPA 5EQAA 1Y9UA 2P0SA 4GL0A 3R26A 4OFLA 4YKKA 3KSJA 4BDMA 5LTCA 4XIGQ 3IB0A 4Q30B 3SEUA 1QUIA 3T96B 4UACA 4OETA 3CSGA 3KC1A 4GXAA 4EXLA 5FHMA 4O3CA 3THIA 1B46A 5H8HA 2I4BA 2Q2CA 5EQ9A 4NAPA 1I69A 4NF6B 2R6GE 4FIMA 4IO7A 4DCXA 4ND9A 2F7CA 3ROJA 3M8UA 5IZ3B 3S9LC 4O7IA 4JBZA 4O3BA 4U4XA 1INPA 3QUJA 4GQOA 4OANA 5KCJB 3IFCA 5EQ7A 1FPFA 3GYYA 3M3LA 4P0IA 2P3VA 1B3GA 1PB8A 3S2VA 3K6VA 2BJIA 3IFAA 3KC0A 2QFLA 3FATA 4C1TA 2XX8A 1MRPA 4MLQA 1AL3A 4RK9A 4GLIA 3E9XA 1OIBA 3G3KA 4FAJA 1B51A 3KGCA 4GWYA 3U92A 2FA7A 1MXZA 4LQ5A 2HZKA 3TTMA 2QS4A 3PV0E 2DXRA 3TODA 5L9OA 2VD3A 2QMXA 3D4CA 1MXXA 3HCQA 3BFUA 1MM6A 3LSXA 4PFIA 3VVEA 3BIGA 1B6HA 4G8NA 3Q28A 2RC9A 4GXSB 2FNCA 3V83A 2ONRA 5CBSA 3S9EA 3U93A 1B05A 2G93A 5ELVA 3TCHA 5I59B 3TQLA 4F3PA 1LAHE 3IO4A 4GF8A 2HCAA 2Z8EA 3OELA 4NF4A 4O8MA 1FPLA 3G3IA 2XX9A 4GRKA 1MY3A 2XXUA 1EZPA 1WDNA 4IO6A 3M3KA 1EYJA 1B1HA 3G3HA 2RINA 2VPNA 3KOSA 3K02A 5AA3A 5EQ8A 1MXUA 1H43A 2F78A 3V89B 1BP5A 3IR1A 4AQ4A 1NNKA 1MH4A 4HE0A 1Z7ME 4PC9A 2A5TA 4DXBA 3FIRA 4FE8A 4HS7A 5I58A 2VHAA 1OQHA 3GBBA 3EQ1A 1R1NA 3PUYE 3EN3A 5DVFA 3DM0A 4Q5TA 1FPGA 1ELJA 3EF7A 2CEYA 3OEKA 3RNNA 1MG1A 3PMWA 4ECFA 5AA1A 1ZIUA 3CRBA 1FTLA 1MQGA 1QVSA 1B3FA 1FSAA 2WBBA 4GWOA 4PE3A 3MWBA 1A99A 1S50A 3PPOA 5I3SA 3K1NA 3KFMA 1IEJA 1OQGA 2DWJA 3G3JA 3GXAA 4KYSA 2REJA 1BLFA 1XHYA 3U72A 1NKXA 1OMPA 1GV8A 4R6KA 3VLVA 4F39A 5AA2D 4PFBA 4P8BA 4YB6A 1ZU0A 1AMFA 4FECA 5EYGA 4X1BA 2ONKE 3QXMA 3PMVA 1POY1 4BDOA 4PFWA 1H44A 3GZGA 4MNCA 5KDTB 4NN3A 1HSJA 1Z7NE 3FJ7A 2GHBA 3E3KA 1EYIA 4QFKA 3OO7A 4GWXA 5I57B 1JQFA 1LB9A 5J1DA 1B0HA 3RTWB 4TLLB 1RYOA 3G3GA 2V3QA 4JSDA 5DEXB 2PT1A 2H9BA 3H03A 1FJ6A 1OVBA 4EUOA 2PFYA 2XXWA 4HE1A 1DTZA 1SVXB 4OERA 5H8FA 1PDAA 2HPGA 2XXIA 1BIYA 4NX1A 1IXGA 3A09A 2FYIA 3MW0A 4FATA 2OK2A 3MPKA 5I84A 1A40A 1LCTA 2PBWA 2DS9A 1ZMGA 1MQHA 1NMUA 2FVZA 4ZS9A 3OMBA 1IMBA 1LSTA 3Q27A 3B8BA 3SESA 1JW5A 2H5YA 2X7QA 3IB2A 4IO5A 3MQ9A 3D1RA 3N26A 1UTHB 4MH5A 4MFIA 1YAEA 4PGNA 3K01A 4IR8A 3E79A 4DE8A 4F29A 3H7MA 1RDXA 1B5HA 3S4UA 2Q2AA 3DLNA 4UABA 5KZTA 2H25A 5LDZA 1A7LA 3IOUA 4ZDMA 1S9TA 4R72A 2QS3A 4P3LA 1XT8A 4PFUA 1NV1A 2ZYNA 1UTBA 1IZ1A 3T93B 3C32A 3RYDA 1HSLA 3H4ZA 2PX1A 4ZZAA 1SPIA 2HAVA 3PUWE 4GIZA 2GH9A 1NUXA 4AB5A 4MIJA 1B9JA 4GWWA 3SERA 4MAGA 4QSEA 4HE2A 1SI0A 5CMMA 1A8EA 2Y84A 1PC3A 1D9VA 2OLBA 1NV7A 3QUFA 3IK6B 2OWTA 1G0HA 2OJTA 3DP6A 2QMWA 4KR5A 1FTKA 3U94A 3G3FA 3HHFA 1B4HA 3KN7A 3P7IA 1G0IA 1Q9DA 4N8YA 2REGA 3MP1A 5AA4A 4YZZA 1O64A 3VXBA 4IY6A 3OO6A 5H8QB 2PVUA 3I5OA 1QKBA 4LZ5A 2XWIA 5CC2A 4NE4A 3PU5A 4JSOA 3MSTA 4HCYA 4OYVA 4OVRA 1LAFE 4YKIA 1QUJA 1SW5A 4IGTA 1NV3A 3MUQA 3H6VA 4DLDA 3FVNA 5BUUA 3ODBA 3VFJA 1MH3A 2B4LA 5JTYA 2A5SA 3H6TA 1FPEA 4KYDA 1CE2A 3K0VA 3SEYA 4P1EA 3FXUA 4PFTA 2XWOA 3RQTA 5I2KB 4H6DA 3T9VA 2X7PA 4N17A 5DT6A 1P1QA 1URGA 4DI3D 3H6UA 5TPAB 3RLFE 1LFIA 1MDQA 4AS5A 2DP8A 5DW8A 4QFNA 5ET5A 2VGQA 1Y1MA 3O6HA 2AIXA 2THIA 3CFZA 1PEBA 1UIVA 4LATA 3SEXA 2FHYA 1A55A 1LBVA 1LBYA 4FEDA 4F18A 4WKMA 1MPDA 1XI6A 3PUZE 4JXIA 4R9FA 2E1SA 2QSXA 4I62A 1DSNA 3NOHA 3B6TA 2DXYA 3I6VA 5AE4A 4OVQA 5IKBA 3OO8A 3LUYA 2HFBA 3FD3A 5ITPA 2I4CA 3C34A 4PF8A 2KR0A 3CHGA 4BDLA 3U8QA 1N7XA 1B3LA 2CZKA 3O97A 1FQBA 4FBPA 4XKRA 2I58A 3E4RA 1USYE 4NF5A 2ZXTA 3F11A 1FPIA 2X26A 4U2RA 4THIA 3FBPA 4IY5A 3LR1A 4KHZE 4KPTA 4OTEA 1B5IA 1SW2A 1FBDA 4XKQA 3MVWA 2GHAA 5IM2A 3CR9A 2CZLA 4QXDA 1SDXA 1LFHA 3HSTA 3PPPA 3OD7A 3K4UA 1JEUA 5I2KA 1VFDA 2V3TA 4GD5A 1RYXA 2Z8FA 2Y5KA 3MC2A 3Q26A 3CG3A 1EZ9A 4JB7A 4M4GA 2O1LA 1XVYA 1ZTYA 2ZZWA 3Q29A 3O2AA 3RT8A 2XD2A 5B7DA 4MF3A 3ISPA 4R9GA 5CMCA 1MQDA 1B3EA 1FTJA 2QJEA 1LBZA 2P2AA 4XKPA 4X9TA 5KDTA 4PE5B 1NV6A 2LAOA 2XHDA 4NGUA 3ILTB 5TU0A 3KN3A 1FBHA 1SW1A 2ONSA 5LOMA 2NOOA 1B52A 2XD3A 4GWUA 1YYZA 5EYFA 1YTVA 2I0CA 2Q8JA 2UYEA 2PFZA 3PMXA 2B65A 2R71A 4PDDA 4XKNA 3LUZA 1NV4A 4YMAA 1N3WA 2I49A 4JVCA 1T0KA 4G2ZA 1I6BA 3T66A 4MLVA 2QPQA 2Z8DA 2G29A 1IXHA 3IORA 3T0JA 5I2NB 1D9QA 5K2YA 3U65A 5I59A 4EXKA 2FIXA 3MVZA 2GRVA 3MP6A 1R9LA 4QBAA 3UA8A 2PCRA 1FQCA 4O3AA 2XXRA 3MZBA 3KOTA 1WODA 3K1MA 1M5BA 1MY2A 3C4MA 5L8DA 1B58A 3FUZA 1UQWA 5CMKA 1TXFA 1RDZA 3QK6A 4N6PA 4YB7A 1I6QA 2ZYMA 4YKPA 3FGSA 4WXJA 4HXVA 1JNFA 2IA4A 5EYHA 3O29A 2F6GA 2Z22A 3MP8A 2VD2A 4I9DA 1I6AA 4QSCA 4EF2A 3PUXE 5ET6A 2XXXA 4N91A 1FBGA 3FVOA 4N07A 4G68B 4I8CA 1J1NA 1N04A 2I0BA 5CMBA 3TTLA 3ZKKA 3VV5A 4RA1A 3TUSA 1ZLQA 2ESNA 4ZEBA 4PQJA 1URDA 1WVJA 4QHQA 5I5PA 1SYIA 4M1VA 1ANFA 4TLMB 3KSXA 3LSLA 1AWBA 1P99A 4PP0A 4P56A 4NMYA 4F31B 5ICTA 1EYKA 4OZ9A 5CRYA 2F5XA 2AL5A 3FASA 4RNSA 2FIEA 3HV1A 1Y3NA 2NVUB 4ESWA 3PPQA 4XXUA 3TKDA 3W9WA 4Q8RA 1UTHA 1TFDA 3USDA 5T3JA 2NWJA 1JW4A 4PBQA 2XWKA 3A3CA 4U23A 3EHSA 2HAUA 4YICA 2Y7PA 1FTAA 4G61A 2ZYOA 2WYKA 2DDKA 2GFEA 2F97A 4GL8A 1B1XA 1VFEA 1FBEA 4R6HA 2F7BA 4NHBA 3IB1A 5H8NB 4KFQA 4MNPA 2Y7IA 3JV9A 3TQWA 2R9JA 3LV0A 3RTFB 4H5FA 2Q8MA 4OQOA 4ZECA 3PD8A 2I3VA 3H6WA 4RXLA 3PTYA 4GX3A 2I3WA 4H45A 1P1UA 3MVYA 1ZKBA 4QFLA 1MM7A 2QRYA 3K6XA 1GGGA 2DVZA 3QYTA 1IMFA 2MKZA 2QL3A 1A54A 2RKMA 1O7TA 1QJMA 4H46A 3LC8A 4ZE9A 3FXBA 3T9UA 4X04A 3T1BA 4I40A 4PFYA 1IIWA 2DE3A 2ZZXA 2O51A 4LZ8A 2O7UA 4G8MA 4NWDA 1P1WA 4OVJA 2VP1A 4JVDA 1TFAA 4EQ9A 3I3VA 1KA0A 4U1OA 1LCFA 4U1ZA 2ZNUA 4WEDA 3TMGA 5EHSA 1QULA 2HZLA 3TELA 1Y1ZA 3IOTA 2XXPA 4MBPA 2VOZA 3W15C 2CZHA 3C35A 2E0SA 1NV5A 4PBHA 3UIFA 4ZEDA 4F22A 3OSRA 3H3GA 2DYXA 4ZEIA 1JW1A 1QW0A 2DVCA 4YU0A 3SEWA 4H5GA 3K6UA 4X48A 2F3BA 2O6AA 4OFOA 4PTKA 1FBFA 2ZYKA 5F7VA 5TP9A 1MXWA 1SI1A 4DXUA 1M5FA 3V5AA 1MS7A 4IO3A 2H98A 2Q89A 3V8XB 2ALUA 2RCBA 2XWVA 4N15A 1O63A 4NF4B 1A8FA 2F36A 5DTBA 2ANJA 4KD5A 4R2FA 3AXFA 4FORA 2OWSA 1OLCA 4ISUA 5KCJA 4MHFA 2IEEA 2ZZVA 1NUZA 1KWHA 4MCOA 3IJOB 3W9VA 1DBZA 4P9KA 5CBRA 2L5VA 2WBDA 2GQ1A 2R8TA 2QS2A 1FW0A 4NF0A 3KZGA 5DEXA 1FBPA 5IAIA 3RUMA 4JWXA 3TEPA 4GWSA 2HEUA 4E0WA 1LAGE 4QFPA 1UTBB 2F34A 4PAFA 4MMPA 1M5CA 1KZ8A 2UVJA 2CZIA 2Q9TA 1NFTA 1IUDA 1FQAA 2KQZA 2D3IA 3FJMA 1NH7A 4N6KA 3UP9A 1B0LA 2Y7KA 3BIHA 2XXYA 4KCDA 3PD9A 4F1VA 1MXYA 1URSA 3FV2A 4O7MA 3EKIA 4ESXA 1EU8A 3B6WA 3E78A 2UVGA 3CFLA 2B4MA 4OWDA 4R6YA 2XXHA 4F19A 3TPAA 2XA5A 4LUBA 1MY0A 3B6QA 3G7WA 3VVFA 2PYYA 1XS5A 5H8FB 4IGRA 4OMBA 2O1MA 3OSQA 4E0XA 4R73A 4ELQA 1YZ0A 3KBZA 5F24A 5I2NA 4DIGA 5ET8A 1LLSA 3B7DA 3IAZA 4AB6A 5DVIA 3T9XB 2V84A 5L9MA 1L5TA 5L9SA 1M5DA 1P1OA 1Y20A 1FPBA 3K6WA 4R75A 3TDJA 5J16A 1VR5A 1FQFA 4ONYA 1H76A 4N6DA 4KCCA 4X8RA 5H8NA 3EPEA 3IJXB 1FCKA 4HTGA 3MAMA 2F6PA 4BDNA 4OHNA 3ECRA 3MJNA 4ELPA 4O94A 1AH5A 3TYHA 3N6TA 2HHMA 2QVRA 4OEUA 1NV2A 2V25A 4I1DA 3S9NC 1DTGA 5DVJA 3CI8A 1PB7A 1H45A 2RF1A 4NF6A 1IMEA 3R7XA 3VDFA 2WKYA 5ITOA 1AOVA 1BKAA 2O68A 1CB6A 5JK4A 1FBCA 4JWYA 5I7IA 4PGPA 1USYH 2QS1A 1VSOA 3JYRA 2CMOA 1B40A 3UK4A 1BTJA 4KI0E 4DZ1A 2DQVA 3IOWA 4HW8A 1FTMA 2RCAA 5FHOA 2ABHA 1B3HA 2P3NA 5ICQA 3MBPA 4RJZA 2NUVA 4G4PA 4BDQA 5I58B 1LB8A 3ZKLA 4UA8A 3E13X 3K00A 2B3BA 5A5XA 3ILUB 4OXVA 3RPLA 2I48A 1SQYA 3K2DA 3O6IA 3T22A 3N94A 3C9HA 4P47A 5CI5A 3A3UA 2CEXA 4NF8B 4ZE8A 3KG2A 4QRZA 1MDP1 2Y5LA 4NQ8A 3HN0A 1IXIA 4PFRA 2YPNA 2DOJA 3HPIA 4XEQA 4QSDA 1Q35A 1MY1A 2D21A 4IO4A 3N6UA 1DCUA 2HXRA 1B5JA 3TFLA 2OWZA 4YB5A 1GTKA 1JVXA 1US5A 1FRPA 3VXCA 4WEPA 4NEDA 3TCFA 2DWHA 3S9MC 3UGWA 1MPBA 1M5EA 4LVQA 3OXNA 1QUKA 5I57A 3UN6A 3SEVA 4HCWA 4LN5A 3SZPA 1DK4A 1IMCA 5I56A 3HO7A 3MZ1A 4DXCA 3PPRA 3KEIA 3VE1B 4RK2A 1N76A 4POXA 5TPAA 5IGAA 1IMAA 1ZBMA 4H8IA 1SD3A 4PF6A 1B4ZA 4PDHA 2DWIA 4G68A 4ZEFA 5A5LA 1DPPA 4NTLA 1MQJA 4DDDA 3BKIB 4G68C 4H8JA 1FPDA 1MXVA 3OEMA 4OVTA 2UXAA 4LONB 2UVIA 5F1QA 4H65A 4EQBA 1IMDA 5DYHA 3RPLB 3TCGA 3KN8A 5ET7A 2Q88A 1FQDA 5BWJA 4QF9A 4C0RA 3RY3A 3MPLA 3FJGA 3M3FA 1DPEA 3O28A 5ISUA 4P1LA 2YLNA 4NF8A 4MX6A 3QSLA 4EF1A 4I3YA 4F1UA 1VDWA 2AYSA 1US4A 1LGBC 1PBQA 4ELOA 2UYFA 1EZOA 4F2QA 4ZEKA
chains in the Genus database with same CATH topology
4WKMA 1MPDA 2O6AA 3JZJA 4OFOA 3PUZE 4O3BA 4U4XA 5CM6A 2V93A 5H8QA 3QUJA 1IXCA 2DSFA 2ZYKA 4JXIA 1JEVA 5F7VA 5TP9A 4GQOA 1MXWA 4R9FA 2E1SA 1SI1A 2QSXA 4YMBA 5KCJB 4X1DA 4DXUA 4F3SA 3M3LA 1M5FA 4P0IA 1MS7A 4I62A 4IO3A 1B3GA 3V5AA 1PB8A 1QKAA 2O84X 2Z23A 3BBRA 3S2VA 1DSNA 2H98A 1H3DA 3B6TA 2DXYA 3I6VA 3K6VA 5AE4A 4U4SA 3OO8A 5IKBA 3MZ9A 4H0WA 3LUYA 2Q89A 2HFBA 3V8XB 3TTKA 2ALUA 2RCBA 3FD3A 5ITPA 2I4CA 3C34A 3DELB 1O63A 2XX7A 3FATA 1YCJA 4NF4B 4BDLA 4LQ2A 4C1TA 2XX8A 3U8QA 1A8FA 1MRPA 3IO6A 4G77A 4MLQA 1AL3A 2F36A 4RK9A 2ANJA 4KD5A 1N7XA 3MVXA 4GLIA 1B7ZA 4R2FA 2O7IA 3SETA 2NXOA 3AXFA 1OIBA 3E9XA 4FORA 3T9VA 1B3LA 2OWSA 3G3KA 1OLCA 4LP2B 4FAJA 3RT6B 2ZNSA 1B51A 4ISUA 3KGCA 3U92A 4F2OA 5J1DA 3O97A 2FA7A 5KCJA 1FQBA 1MXZA 2IEEA 4LQ5A 4XKRA 4FEBA 1KWHA 2HZKA 4ZZEA 3TTMA 2I58A 3E4RA 3IJOB 2QS4A 1USYE 3W9VA 4NF5A 2ZXTA 3F11A 3TELA 3PV0E 2DXRA 3TODA 3Q25A 5L9OA 2X26A 5CBRA 3ZS6A 2QS2A 3TZAA 4F3GA 3KJ7A 5H8HB 1FW0A 4U2RA 4THIA 1MPCA 3KZGA 5DEXA 2VD3A 3PGFA 3LR1A 4IY5A 2QMXA 3D4CA 4GF8A 4KHZE 4KPTA 1MXXA 3HCQA 1B32A 3BFUA 1MM6A 1B5IA 1SW2A 3FVKA 3LSXA 4GOTA 4JWXA 3RUMA 5IAIA 4XKQA 1N7WA 3TTRA 3MVWA 2GHAA 3VVEA 4C1UA 1Y3QA 3TEPA 1B6HA 5ISUA 4G8NA 3Q28A 4L17A 2RC9A 1DMBA 2HEUA 3CR9A 2CZLA 4GXSB 4E0WA 5HPQA 1LAGE 3PUVE 4QFPA 4FATA 2ZMBA 2PMSA 2FNCA 1B7HA 1SDXA 1LFHA 2Y7WA 3HSTA 3V83A 1UTBB 2F34A 1ZJLA 2M8CA 2ONRA 3L6GA 3VLWA 5CBSA 3S9EA 1MY4A 3U93A 3PPPA 1B05A 3K4UA 1JEUA 3OD7A 1VFDA 2G93A 5I2KA 3T9HB 2H4IA 3O6GA 5ELVA 2V3TA 4GD5A 4N13A 1RYXA 3TCHA 2Z8FA 1M5CA 5I59B 3TQLA 2UVJA 4F3PA 2Q9TA 3MC2A 4QFOA 1LAHE 3IO4A 3Q26A 1NFTA 1IUDA 1OLAA 1FQAA 3CG3A 2F35A 1EZ9A 2HCAA 2Z8EA 2O1LA 3OELA 3G3IA 4JB7A 1XVYA 2XX9A 4GRKA 4M4GA 1IQ7A 4NF4A 1ZTYA 1MY3A 2D3IA 3Q29A 2XXUA 1EZPA 1WDNA 3O2AA 4IO6A 3M3KA 1GR2A 5K2XA 2OCUA 1B1HA 3G3HA 1LBBA 3FJMA 2RINA 3QAXA 3KOSA 5FTIA 3RT8A 1NH7A 2F8DA 4G8HA 2XD2A 3UP9A 1B0LA 3K02A 5AA3A 2Y7KA 1MXUA 1PB9A 5AA2B 5B7DA 1H43A 2F78A 3FVGA 4MF3A 2XXYA 3V89B 1BP5A 3IR1A 4AQ4A 4KCDA 2B3FA 3PD9A 1NNKA 4RYAA 4F1VA 1MXYA 3EHTA 4R9GA 4EDPA 1URSA 1XC1A 3FV2A 4P0GA 1MH4A 4OTEA 3BFTA 5CMCA 5JTYB 1MQDA 1Z7ME 1B3EA 2A5TA 1FTJA 2QJEA 4ESXA 1EU8A 4DXBA 3B6WA 3FXQA 2P2AA 1N3XA 4OESA 2UVGA 3FIRA 3CFLA 4FE8A 4NF5B 1NNFA 4XKPA 4HS7A 5I58A 4X9TA 4EQ7A 3IX1A 4OWDA 5KDTA 2VHAA 1OQHA 3GBBA 2XXHA 4R6YA 4F19A 4PE5B 2LAOA 2OZZA 3EQ1A 3OENA 2XHDA 4XTCQ 1R1NA 3PUYE 3TPAA 4LUBA 3EN3A 1MY0A 5DVFA 3ILTB 3DM0A 5TU0A 4BLAA 4Q5TA 3KN3A 3L6HA 1ELJA 1SW1A 4POWA 2ONSA 5LOMA 2NOOA 3EF7A 3DP8A 2W7YA 4K3FA 1B52A 2XD3A 3OEKA 1MG1A 3B6QA 3RNNA 3G7WA 3VVFA 2PYYA 3K1PA 1XS5A 3PMWA 4ECFA 5H8FB 5EYFA 1YTVA 1D9YA 2I0CA 4IGRA 5AA1A 4OMBA 1R9QA 2Q8JA 1DOTA 2UYEA 1ZIUA 3PMXA 2B65A 2R71A 3IL1B 3CRBA 4XKNA 5HBCA 1FTLA 2HXWA 1II5A 2O1MA 1F9BA 3IOVA 4YMAA 1MQGA 1N3WA 1QVSA 4F3BA 1B3FA 3OSQA 4E0XA 1ATGA 4GWOA 2I49A 4F1YA 1Q1KA 1XOCA 3MWBA 1T0KA 3CIJA 4G2ZA 1A99A 4R73A 1S50A 3PPOA 5FHNA 4ELQA 3ZSFA 1I6BA 4IO2A 4PETA 3K1NA 3KFMA 3N5LA 3T66A 5I2NA 3RTWB 4DIGA 4MLVA 1IEJA 1LLSA 1OQGA 2QPQA 3B7DA 3IAZA 3R6UA 2DWJA 3G3JA 2DE4A 2RC8A 3GXAA 4KYSA 4AB6A 2REJA 5DVIA 1BLFA 2Z8DA 2G29A 1IXHA 3IORA 1XHYA 4H1XA 4Z0IA 3U72A 5I2NB 3T9XB 1NKXA 2V84A 1OMPA 5L9MA 5K2YA 1L5TA 5L9SA 1AOVA 1M5DA 1Y4CA 4JWOA 5I59A 4EXKA 1RKMA 1P1OA 5H8SA 1Y20A 3K6WA 3MVZA 4R75A 2GRVA 4R6KA 1VR5A 3TAJA 3TDJA 1FQFA 3VLVA 3WAFA 4F39A 3C31A 3MP6A 4ONYA 1H76A 1R9LA 5DTBA 3UA8A 4KCCA 3TTNA 4YB6A 1ZU0A 5H8NA 1FQCA 3O9PA 3EPEA 4O3AA 4R2BA 2XXRA 1AMFA 3IJXB 3CSBA 3MZBA 4FECA 4X1BA 5FTHA 2ONKE 3KOTA 1D4NA 3QXMA 3PMVA 1FCKA 4HTGA 1WODA 1POY1 3MAMA 4BDOA 4PFWA 1FTOA 1H44A 3GZGA 2F6PA 3K1MA 1M5BA 1MY2A 3C4MA 4LZ7A 4BDNA 5L8DA 4OHNA 1HSJA 1B58A 1Z7NE 3FJ7A 3ECRA 3MJNA 4ELPA 1IITA 2GHBA 1AH5A 3E3KA 3FUZA 3RGYA 3TYHA 3N6TA 1NL5A 5AA2D 4GVOA 4QFKA 3OO7A 1UQWA 5CMKA 1TXFA 2BJJX 3QK6A 5I57B 2DE2A 4N6PA 4YB7A 1JQFA 4OEUA 5A5XB 1I6QA 1LB9A 4P11A 2V25A 2ZNTA 1NH8A 2ZYMA 1B0HA 4I1DA 4Q0CA 1LAXA 4TOZA 4YKPA 1DTGA 3RN8A 3FGSA 2D5WA 4TLLB 5DVJA 1RYOA 3CI8A 3RPWA 1MQIA 1PB7A 1H45A 3G3GA 5TP9B 4ZEKA 2RF1A 2UVHA 2V3QA 2XXTA 4JSDA 4NF6A 2PT1A 4WXJA 5DEXB 1YPNA 2H9BA 3R7XA 3VDFA 2KLFA 3GBAA 4DCYA 3H03A 1OVBA 1JNFA 2IA4A 2WKYA 5ITOA 4JBZA 4EUOA 3O29A 2F6GA 2XXWA 2Z22A 1BKAA 2O68A 4Z7EA 1CB6A 3MP8A 1DTZA 1LBCA 1NNPA 2VD2A 3LBSA 1I6AA 2O69A 4I9DA 4QSCA 3PUXE 4EF2A 1SVXB 5JK4A 2XXXA 4NWCA 4OERA 5H8FA 1PDAA 2OBGA 3D4GA 4JWYA 2F7AA 3FVOA 2XXIA 4G68B 1BIYA 1USYH 2QS1A 4I8CA 1J1NA 4N07A 5KDTB 1IXGA 1N04A 1VSOA 2CMOA 2FYIA 1B40A 2I0BA 3A09A 3JYRA 2OK2A 3MW0A 3MPKA 3KJTA 5CMBA 3TTLA 3UK4A 1BTJA 3ZKKA 4KI0E 5I84A 1A40A 1LCTA 4R74A 2PBWA 2DS9A 2DQVA 3VV5A 4DZ1A 1ZMGA 1MQHA 3FXRA 1NMUA 4KQPA 4RA1A 3TUSA 4ZS9A 3IOWA 4HW8A 2XXQA 3OMBA 1ZLQA 1LSTA 2ESNA 2V3UA 3Q27A 4ZEBA 1FTMA 2RCAA 4PQJA 4YAHX 5FHOA 3SESA 1URDA 1WVJA 4RPOA 2ABHA 1JW5A 2H5YA 2X7QA 4QHQA 3IB2A 1SYIA 1B3HA 4YKJA 5ICQA 1PBPA 4M1VA 3MBPA 1ANFA 4IO5A 3MQ9A 2AL4A 5B70A 4TLMB 4RJZA 2H99A 2NUVA 3N26A 4G4PA 1UTHB 3KSXA 4BDQA 1R6ZA 3LSLA 5I58B 1P99A 1JVYA 1LB8A 4MH5A 4MFIA 3ZKLA 1LFGA 4OEVA 4PP0A 1YAEA 4UA8A 4NMYA 3K01A 3E13X 4F31B 2P1SA 3K00A 2I6EA 3LSFB 3U1OA 2B3BA 4DE8A 5ICTA 4F29A 4OZ9A 5CRYA 5A5XA 2F5XA 2AL5A 3H7MA 4OXVA 2I48A 3FASA 4OENA 4RNSA 5JEIA 1SQYA 1Y3PA 3K2DA 3O6IA 3HV1A 1B5HA 3T22A 3N94A 3S4UA 4FJPA 1Y3NA 2Q2AA 3C9HA 3DLNA 2NVUB 4ESWA 5CI5A 5KZTA 3A3UA 3PPQA 4NF8B 4XXUA 2H25A 4ZE8A 1A7LA 3TKDA 3IOUA 3KG2A 3W9WA 4Q8RA 1N0TA 4QRZA 4ZDMA 3GLBA 1TWYA 1MDP1 1UTHA 1S9TA 4R72A 3HN0A 1IXIA 1EH3A 2QS3A 1TFDA 2YPNA 3USDA 2DOJA 2Y7RA 3HPIA 4JDFA 2NWJA 3CG1A 1JW4A 4QSDA 5AA2A 2HQ0A 1XT8A 3A3CA 4U23A 4PFUA 3EHSA 1B2HA 1GV8A 2HAUA 4YICA 2Y7PA 1UTBA 1VE4A 2ZYNA 1IZ1A 4ELRA 3T93B 3C32A 1HSLA 2ZYOA 3H4ZA 2PX1A 2GFEA 1JETA 1Q35A 1MY1A 2D21A 2F97A 4GL8A 1B1XA 4ZZAA 1VFEA 3OO9A 4IO4A 1OVTA 4R6HA 2F7BA 2HAVA 3PUWE 3IB1A 3N6UA 5H8NB 3VVDA 4KFQA 4GIZA 3TFLA 1B5JA 2GH9A 2Y7IA 3CFXA 4U21A 4YB5A 3SKPA 4IB2A 1GTKA 1JVXA 3JV9A 3TQWA 2R9JA 4AB5A 1US5A 1TT1A 1B9JA 3C33A 3RTFB 3VXCA 3LSWA 4H5FA 4WEPA 1SYHA 3OOAA 4NEDA 3SERA 4OQOA 4QSEA 2YJPA 3TCFA 2DWHA 1UIUA 2A5TB 3QIMA 3UGWA 4ZECA 3S9MC 3C36A 1SI0A 5CMMA 1MPBA 1A8EA 1M5EA 2Y84A 1PC3A 1D9VA 4LVQA 2OLBA 1SBPA 3O66A 3OXNA 1QUKA 3SDFA 1S7YA 3PD8A 4RY1A 2I3VA 3PPNA 3QUFA 3H6WA 3ONMA 5I57A 3UN6A 4RXLA 3IK6B 4HCWA 3SEVA 2OWTA 5HM4B 3S9NC 1AIVA 2I3WA 2OJTA 3FV1A 1P1UA 3DP6A 2XXVA 1HSEA 2PT2A 3MVYA 5I56A 2QMWA 1ZKBA 4KR5A 3HO7A 4QFLA 1FTKA 3MZ1A 3U94A 1MM7A 3G3FA 1B4HA 2RC7A 3HHFA 3KN7A 3PPRA 2QRYA 1GVCA 4DXCA 5AA4B 1SW4A 3KEIA 3VE1B 3K6XA 1GGGA 3P7IA 2DVZA 1N76A 4RK2A 4U22A 4POXA 4BDRA 3QYTA 2REGA 1D3KA 3MP1A 4OFJA 4YZZA 3H06B 1O64A 5TPAA 1XVXA 3UORA 3VXBA 5AA4A 5M2VA 1N84A 2QL3A 5EHMA 1ZBMA 1A54A 2RKMA 4IY6A 4H8IA 1O7TA 1QJMA 1SD3A 3OO6A 1B4ZA 3EHUA 3LC8A 2DWIA 4G68A 3WAEA 5H8QB 4ZEFA 2PVUA 1DPPA 3I5OA 4ZE9A 1QKBA 1POTA 3HHGA 4LZ5A 4RPNA 4NTLA 4NE4A 3FZVA 1MQJA 3PU5A 4HCYA 4JSOA 3T9UA 5CC2A 4DDDA 4OYVA 1LAFE 1Y4TA 3BKIB 4G68C 4H8JA 5I56B 1MXVA 3OEMA 1QUJA 4YKIA 4PFYA 2UXAA 1IIWA 1SW5A 4IGTA 2DE3A 1FQEA 4LONB 3KBRA 2UVIA 3MUQA 3H6VA 5F1QA 4DLDA 2O51A 3FVNA 4GFRA 4LZ8A 1P1NA 2DWAA 2O7UA 5BUUA 4G8MA 4TQUQ 4H65A 3ODBA 1B7UA 4EQBA 4NWDA 3VFJA 1P1WA 4OVJA 1MH3A 5DYHA 2VP1A 4KYEA 5JTYA 2A5SA 3TCGA 3H6TA 4H67A 3KN8A 4ELOA 4KYDA 1TFAA 4EQ9A 1CE2A 2Q88A 3I3VA 4U1OA 4LA9A 1FQDA 5BWJA 4QF9A 1LCFA 4C0RA 4U1ZA 2ZNUA 1NNTA 3K0VA 3CVGA 3DP4A 4WEDA 3RY3A 3SEYA 3TMGA 3MPLA 3FXUA 1Y9UA 2P0SA 1QULA 4GL0A 4PFTA 5EHSA 3FJGA 3R26A 4OFLA 4YKKA 3KSJA 3M3FA 2HZLA 3RQTA 4BDMA 5I2KB 4XIGQ 4H6DA 3IB0A 1DPEA 4Q30B 2X7PA 3SEUA 1QUIA 1Y1ZA 3IOTA 3O28A 4UACA 3T96B 4OETA 2XXPA 3CSGA 2VOZA 4MBPA 3W15C 5DT6A 1P1QA 1URGA 2YLNA 2E0SA 3C35A 4NF8A 4GXAA 4EXLA 5FHMA 4O3CA 3H6UA 5TPAB 3RLFE 1LFIA 3UIFA 1MDQA 4F22A 3QSLA 4ZEDA 2DP8A 1B46A 3OSRA 3H3GA 3THIA 4EF1A 2DYXA 5H8HA 4QFNA 2I4BA 2VGQA 1Y1MA 1JW1A 1QW0A 2Q2CA 3O6HA 4ZEIA 4F1UA 2AYSA 2AIXA 1I69A 1US4A 2THIA 1LGBC 2R6GE 1PBQA 3CFZA 4FIMA 4NF6B 4IO7A 4DCXA 1PEBA 2UYFA 2DVCA 4ND9A 4YU0A 1UIVA 3SEWA 1EZOA 2F7CA 4H5GA 4LATA 3M8UA 3SEXA 4F2QA 1A55A 3K6UA 3VLUA 3S9LC 4FEDA 4F18A 4X48A 3ILUB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WKM A;  1MPD A;  2O6A A;  3JZJ A;  4OFO A;  3PUZ E;  4O3B A;  4U4X A;  5CM6 A;  2V93 A;  5H8Q A;  3QUJ A;  1IXC A;  2DSF A;  2ZYK A;  4JXI A;  1JEV A;  5F7V A;  5TP9 A;  4GQO A;  1MXW A;  4R9F A;  2E1S A;  1SI1 A;  2QSX A;  4YMB A;  5KCJ B;  4X1D A;  4DXU A;  4F3S A;  3M3L A;  1M5F A;  4P0I A;  1MS7 A;  4I62 A;  4IO3 A;  1B3G A;  3V5A A;  1PB8 A;  1QKA A;  2O84 X;  2Z23 A;  3BBR A;  3S2V A;  1DSN A;  2H98 A;  1H3D A;  3B6T A;  2DXY A;  3I6V A;  3K6V A;  5AE4 A;  4U4S A;  3OO8 A;  5IKB A;  3MZ9 A;  4H0W A;  3LUY A;  2Q89 A;  2HFB A;  3V8X B;  3TTK A;  2ALU A;  2RCB A;  3FD3 A;  5ITP A;  2I4C A;  3C34 A;  3DEL B;  1O63 A;  2XX7 A;  3FAT A;  1YCJ A;  4NF4 B;  4BDL A;  4LQ2 A;  4C1T A;  2XX8 A;  3U8Q A;  1A8F A;  1MRP A;  3IO6 A;  4G77 A;  4MLQ A;  1AL3 A;  2F36 A;  4RK9 A;  2ANJ A;  4KD5 A;  1N7X A;  3MVX A;  4GLI A;  1B7Z A;  4R2F A;  2O7I A;  3SET A;  2NXO A;  3AXF A;  1OIB A;  3E9X A;  4FOR A;  3T9V A;  1B3L A;  2OWS A;  3G3K A;  1OLC A;  4LP2 B;  4FAJ A;  3RT6 B;  2ZNS A;  1B51 A;  4ISU A;  3KGC A;  3U92 A;  4F2O A;  5J1D A;  3O97 A;  2FA7 A;  5KCJ A;  1FQB A;  1MXZ A;  2IEE A;  4LQ5 A;  4XKR A;  4FEB A;  1KWH A;  2HZK A;  4ZZE A;  3TTM A;  2I58 A;  3E4R A;  3IJO B;  2QS4 A;  1USY E;  3W9V A;  4NF5 A;  2ZXT A;  3F11 A;  3TEL A;  3PV0 E;  2DXR A;  3TOD A;  3Q25 A;  5L9O A;  2X26 A;  5CBR A;  3ZS6 A;  2QS2 A;  3TZA A;  4F3G A;  3KJ7 A;  5H8H B;  1FW0 A;  4U2R A;  4THI A;  1MPC A;  3KZG A;  5DEX A;  2VD3 A;  3PGF A;  3LR1 A;  4IY5 A;  2QMX A;  3D4C A;  4GF8 A;  4KHZ E;  4KPT A;  1MXX A;  3HCQ A;  1B32 A;  3BFU A;  1MM6 A;  1B5I A;  1SW2 A;  3FVK A;  3LSX A;  4GOT A;  4JWX A;  3RUM A;  5IAI A;  4XKQ A;  1N7W A;  3TTR A;  3MVW A;  2GHA A;  3VVE A;  4C1U A;  1Y3Q A;  3TEP A;  1B6H A;  5ISU A;  4G8N A;  3Q28 A;  4L17 A;  2RC9 A;  1DMB A;  2HEU A;  3CR9 A;  2CZL A;  4GXS B;  4E0W A;  5HPQ A;  1LAG E;  3PUV E;  4QFP A;  4FAT A;  2ZMB A;  2PMS A;  2FNC A;  1B7H A;  1SDX A;  1LFH A;  2Y7W A;  3HST A;  3V83 A;  1UTB B;  2F34 A;  1ZJL A;  2M8C A;  2ONR A;  3L6G A;  3VLW A;  5CBS A;  3S9E A;  1MY4 A;  3U93 A;  3PPP A;  1B05 A;  3K4U A;  1JEU A;  3OD7 A;  1VFD A;  2G93 A;  5I2K A;  3T9H B;  2H4I A;  3O6G A;  5ELV A;  2V3T A;  4GD5 A;  4N13 A;  1RYX A;  3TCH A;  2Z8F A;  1M5C A;  5I59 B;  3TQL A;  2UVJ A;  4F3P A;  2Q9T A;  3MC2 A;  4QFO A;  1LAH E;  3IO4 A;  3Q26 A;  1NFT A;  1IUD A;  1OLA A;  1FQA A;  3CG3 A;  2F35 A;  1EZ9 A;  2HCA A;  2Z8E A;  2O1L A;  3OEL A;  3G3I A;  4JB7 A;  1XVY A;  2XX9 A;  4GRK A;  4M4G A;  1IQ7 A;  4NF4 A;  1ZTY A;  1MY3 A;  2D3I A;  3Q29 A;  2XXU A;  1EZP A;  1WDN A;  3O2A A;  4IO6 A;  3M3K A;  1GR2 A;  5K2X A;  2OCU A;  1B1H A;  3G3H A;  1LBB A;  3FJM A;  2RIN A;  3QAX A;  3KOS A;  5FTI A;  3RT8 A;  1NH7 A;  2F8D A;  4G8H A;  2XD2 A;  3UP9 A;  1B0L A;  3K02 A;  5AA3 A;  2Y7K A;  1MXU A;  1PB9 A;  5AA2 B;  5B7D A;  1H43 A;  2F78 A;  3FVG A;  4MF3 A;  2XXY A;  3V89 B;  1BP5 A;  3IR1 A;  4AQ4 A;  4KCD A;  2B3F A;  3PD9 A;  1NNK A;  4RYA A;  4F1V A;  1MXY A;  3EHT A;  4R9G A;  4EDP A;  1URS A;  1XC1 A;  3FV2 A;  4P0G A;  1MH4 A;  4OTE A;  3BFT A;  5CMC A;  5JTY B;  1MQD A;  1Z7M E;  1B3E A;  2A5T A;  1FTJ A;  2QJE A;  4ESX A;  1EU8 A;  4DXB A;  3B6W A;  3FXQ A;  2P2A A;  1N3X A;  4OES A;  2UVG A;  3FIR A;  3CFL A;  4FE8 A;  4NF5 B;  1NNF A;  4XKP A;  4HS7 A;  5I58 A;  4X9T A;  4EQ7 A;  3IX1 A;  4OWD A;  5KDT A;  2VHA A;  1OQH A;  3GBB A;  2XXH A;  4R6Y A;  4F19 A;  4PE5 B;  2LAO A;  2OZZ A;  3EQ1 A;  3OEN A;  2XHD A;  4XTC Q;  1R1N A;  3PUY E;  3TPA A;  4LUB A;  3EN3 A;  1MY0 A;  5DVF A;  3ILT B;  3DM0 A;  5TU0 A;  4BLA A;  4Q5T A;  3KN3 A;  3L6H A;  1ELJ A;  1SW1 A;  4POW A;  2ONS A;  5LOM A;  2NOO A;  3EF7 A;  3DP8 A;  2W7Y A;  4K3F A;  1B52 A;  2XD3 A;  3OEK A;  1MG1 A;  3B6Q A;  3RNN A;  3G7W A;  3VVF A;  2PYY A;  3K1P A;  1XS5 A;  3PMW A;  4ECF A;  5H8F B;  5EYF A;  1YTV A;  1D9Y A;  2I0C A;  4IGR A;  5AA1 A;  4OMB A;  1R9Q A;  2Q8J A;  1DOT A;  2UYE A;  1ZIU A;  3PMX A;  2B65 A;  2R71 A;  3IL1 B;  3CRB A;  4XKN A;  5HBC A;  1FTL A;  2HXW A;  1II5 A;  2O1M A;  1F9B A;  3IOV A;  4YMA A;  1MQG A;  1N3W A;  1QVS A;  4F3B A;  1B3F A;  3OSQ A;  4E0X A;  1ATG A;  4GWO A;  2I49 A;  4F1Y A;  1Q1K A;  1XOC A;  3MWB A;  1T0K A;  3CIJ A;  4G2Z A;  1A99 A;  4R73 A;  1S50 A;  3PPO A;  5FHN A;  4ELQ A;  3ZSF A;  1I6B A;  4IO2 A;  4PET A;  3K1N A;  3KFM A;  3N5L A;  3T66 A;  5I2N A;  3RTW B;  4DIG A;  4MLV A;  1IEJ A;  1LLS A;  1OQG A;  2QPQ A;  3B7D A;  3IAZ A;  3R6U A;  2DWJ A;  3G3J A;  2DE4 A;  2RC8 A;  3GXA A;  4KYS A;  4AB6 A;  2REJ A;  5DVI A;  1BLF A;  2Z8D A;  2G29 A;  1IXH A;  3IOR A;  1XHY A;  4H1X A;  4Z0I A;  3U72 A;  5I2N B;  3T9X B;  1NKX A;  2V84 A;  1OMP A;  5L9M A;  5K2Y A;  1L5T A;  5L9S A;  1AOV A;  1M5D A;  1Y4C A;  4JWO A;  5I59 A;  4EXK A;  1RKM A;  1P1O A;  5H8S A;  1Y20 A;  3K6W A;  3MVZ A;  4R75 A;  2GRV A;  4R6K A;  1VR5 A;  3TAJ A;  3TDJ A;  1FQF A;  3VLV A;  3WAF A;  4F39 A;  3C31 A;  3MP6 A;  4ONY A;  1H76 A;  1R9L A;  5DTB A;  3UA8 A;  4KCC A;  3TTN A;  4YB6 A;  1ZU0 A;  5H8N A;  1FQC A;  3O9P A;  3EPE A;  4O3A A;  4R2B A;  2XXR A;  1AMF A;  3IJX B;  3CSB A;  3MZB A;  4FEC A;  4X1B A;  5FTH A;  2ONK E;  3KOT A;  1D4N A;  3QXM A;  3PMV A;  1FCK A;  4HTG A;  1WOD A;  1POY 1;  3MAM A;  4BDO A;  4PFW A;  1FTO A;  1H44 A;  3GZG A;  2F6P A;  3K1M A;  1M5B A;  1MY2 A;  3C4M A;  4LZ7 A;  4BDN A;  5L8D A;  4OHN A;  1HSJ A;  1B58 A;  1Z7N E;  3FJ7 A;  3ECR A;  3MJN A;  4ELP A;  1IIT A;  2GHB A;  1AH5 A;  3E3K A;  3FUZ A;  3RGY A;  3TYH A;  3N6T A;  1NL5 A;  5AA2 D;  4GVO A;  4QFK A;  3OO7 A;  1UQW A;  5CMK A;  1TXF A;  2BJJ X;  3QK6 A;  5I57 B;  2DE2 A;  4N6P A;  4YB7 A;  1JQF A;  4OEU A;  5A5X B;  1I6Q A;  1LB9 A;  4P11 A;  2V25 A;  2ZNT A;  1NH8 A;  2ZYM A;  1B0H A;  4I1D A;  4Q0C A;  1LAX A;  4TOZ A;  4YKP A;  1DTG A;  3RN8 A;  3FGS A;  2D5W A;  4TLL B;  5DVJ A;  1RYO A;  3CI8 A;  3RPW A;  1MQI A;  1PB7 A;  1H45 A;  3G3G A;  5TP9 B;  4ZEK A;  2RF1 A;  2UVH A;  2V3Q A;  2XXT A;  4JSD A;  4NF6 A;  2PT1 A;  4WXJ A;  5DEX B;  1YPN A;  2H9B A;  3R7X A;  3VDF A;  2KLF A;  3GBA A;  4DCY A;  3H03 A;  1OVB A;  1JNF A;  2IA4 A;  2WKY A;  5ITO A;  4JBZ A;  4EUO A;  3O29 A;  2F6G A;  2XXW A;  2Z22 A;  1BKA A;  2O68 A;  4Z7E A;  1CB6 A;  3MP8 A;  1DTZ A;  1LBC A;  1NNP A;  2VD2 A;  3LBS A;  1I6A A;  2O69 A;  4I9D A;  4QSC A;  3PUX E;  4EF2 A;  1SVX B;  5JK4 A;  2XXX A;  4NWC A;  4OER A;  5H8F A;  1PDA A;  2OBG A;  3D4G A;  4JWY A;  2F7A A;  3FVO A;  2XXI A;  4G68 B;  1BIY A;  1USY H;  2QS1 A;  4I8C A;  1J1N A;  4N07 A;  5KDT B;  1IXG A;  1N04 A;  1VSO A;  2CMO A;  2FYI A;  1B40 A;  2I0B A;  3A09 A;  3JYR A;  2OK2 A;  3MW0 A;  3MPK A;  3KJT A;  5CMB A;  3TTL A;  3UK4 A;  1BTJ A;  3ZKK A;  4KI0 E;  5I84 A;  1A40 A;  1LCT A;  4R74 A;  2PBW A;  2DS9 A;  2DQV A;  3VV5 A;  4DZ1 A;  1ZMG A;  1MQH A;  3FXR A;  1NMU A;  4KQP A;  4RA1 A;  3TUS A;  4ZS9 A;  3IOW A;  4HW8 A;  2XXQ A;  3OMB A;  1ZLQ A;  1LST A;  2ESN A;  2V3U A;  3Q27 A;  4ZEB A;  1FTM A;  2RCA A;  4PQJ A;  4YAH X;  5FHO A;  3SES A;  1URD A;  1WVJ A;  4RPO A;  2ABH A;  1JW5 A;  2H5Y A;  2X7Q A;  4QHQ A;  3IB2 A;  1SYI A;  1B3H A;  4YKJ A;  5ICQ A;  1PBP A;  4M1V A;  3MBP A;  1ANF A;  4IO5 A;  3MQ9 A;  2AL4 A;  5B70 A;  4TLM B;  4RJZ A;  2H99 A;  2NUV A;  3N26 A;  4G4P A;  1UTH B;  3KSX A;  4BDQ A;  1R6Z A;  3LSL A;  5I58 B;  1P99 A;  1JVY A;  1LB8 A;  4MH5 A;  4MFI A;  3ZKL A;  1LFG A;  4OEV A;  4PP0 A;  1YAE A;  4UA8 A;  4NMY A;  3K01 A;  3E13 X;  4F31 B;  2P1S A;  3K00 A;  2I6E A;  3LSF B;  3U1O A;  2B3B A;  4DE8 A;  5ICT A;  4F29 A;  4OZ9 A;  5CRY A;  5A5X A;  2F5X A;  2AL5 A;  3H7M A;  4OXV A;  2I48 A;  3FAS A;  4OEN A;  4RNS A;  5JEI A;  1SQY A;  1Y3P A;  3K2D A;  3O6I A;  3HV1 A;  1B5H A;  3T22 A;  3N94 A;  3S4U A;  4FJP A;  1Y3N A;  2Q2A A;  3C9H A;  3DLN A;  2NVU B;  4ESW A;  5CI5 A;  5KZT A;  3A3U A;  3PPQ A;  4NF8 B;  4XXU A;  2H25 A;  4ZE8 A;  1A7L A;  3TKD A;  3IOU A;  3KG2 A;  3W9W A;  4Q8R A;  1N0T A;  4QRZ A;  4ZDM A;  3GLB A;  1TWY A;  1MDP 1;  1UTH A;  1S9T A;  4R72 A;  3HN0 A;  1IXI A;  1EH3 A;  2QS3 A;  1TFD A;  2YPN A;  3USD A;  2DOJ A;  2Y7R A;  3HPI A;  4JDF A;  2NWJ A;  3CG1 A;  1JW4 A;  4QSD A;  5AA2 A;  2HQ0 A;  1XT8 A;  3A3C A;  4U23 A;  4PFU A;  3EHS A;  1B2H A;  1GV8 A;  2HAU A;  4YIC A;  2Y7P A;  1UTB A;  1VE4 A;  2ZYN A;  1IZ1 A;  4ELR A;  3T93 B;  3C32 A;  1HSL A;  2ZYO A;  3H4Z A;  2PX1 A;  2GFE A;  1JET A;  1Q35 A;  1MY1 A;  2D21 A;  2F97 A;  4GL8 A;  1B1X A;  4ZZA A;  1VFE A;  3OO9 A;  4IO4 A;  1OVT A;  4R6H A;  2F7B A;  2HAV A;  3PUW E;  3IB1 A;  3N6U A;  5H8N B;  3VVD A;  4KFQ A;  4GIZ A;  3TFL A;  1B5J A;  2GH9 A;  2Y7I A;  3CFX A;  4U21 A;  4YB5 A;  3SKP A;  4IB2 A;  1GTK A;  1JVX A;  3JV9 A;  3TQW A;  2R9J A;  4AB5 A;  1US5 A;  1TT1 A;  1B9J A;  3C33 A;  3RTF B;  3VXC A;  3LSW A;  4H5F A;  4WEP A;  1SYH A;  3OOA A;  4NED A;  3SER A;  4OQO A;  4QSE A;  2YJP A;  3TCF A;  2DWH A;  1UIU A;  2A5T B;  3QIM A;  3UGW A;  4ZEC A;  3S9M C;  3C36 A;  1SI0 A;  5CMM A;  1MPB A;  1A8E A;  1M5E A;  2Y84 A;  1PC3 A;  1D9V A;  4LVQ A;  2OLB A;  1SBP A;  3O66 A;  3OXN A;  1QUK A;  3SDF A;  1S7Y A;  3PD8 A;  4RY1 A;  2I3V A;  3PPN A;  3QUF A;  3H6W A;  3ONM A;  5I57 A;  3UN6 A;  4RXL A;  3IK6 B;  4HCW A;  3SEV A;  2OWT A;  5HM4 B;  3S9N C;  1AIV A;  2I3W A;  2OJT A;  3FV1 A;  1P1U A;  3DP6 A;  2XXV A;  1HSE A;  2PT2 A;  3MVY A;  5I56 A;  2QMW A;  1ZKB A;  4KR5 A;  3HO7 A;  4QFL A;  1FTK A;  3MZ1 A;  3U94 A;  1MM7 A;  3G3F A;  1B4H A;  2RC7 A;  3HHF A;  3KN7 A;  3PPR A;  2QRY A;  1GVC A;  4DXC A;  5AA4 B;  1SW4 A;  3KEI A;  3VE1 B;  3K6X A;  1GGG A;  3P7I A;  2DVZ A;  1N76 A;  4RK2 A;  4U22 A;  4POX A;  4BDR A;  3QYT A;  2REG A;  1D3K A;  3MP1 A;  4OFJ A;  4YZZ A;  3H06 B;  1O64 A;  5TPA A;  1XVX A;  3UOR A;  3VXB A;  5AA4 A;  5M2V A;  1N84 A;  2QL3 A;  5EHM A;  1ZBM A;  1A54 A;  2RKM A;  4IY6 A;  4H8I A;  1O7T A;  1QJM A;  1SD3 A;  3OO6 A;  1B4Z A;  3EHU A;  3LC8 A;  2DWI A;  4G68 A;  3WAE A;  5H8Q B;  4ZEF A;  2PVU A;  1DPP A;  3I5O A;  4ZE9 A;  1QKB A;  1POT A;  3HHG A;  4LZ5 A;  4RPN A;  4NTL A;  4NE4 A;  3FZV A;  1MQJ A;  3PU5 A;  4HCY A;  4JSO A;  3T9U A;  5CC2 A;  4DDD A;  4OYV A;  1LAF E;  1Y4T A;  3BKI B;  4G68 C;  4H8J A;  5I56 B;  1MXV A;  3OEM A;  1QUJ A;  4YKI A;  4PFY A;  2UXA A;  1IIW A;  1SW5 A;  4IGT A;  2DE3 A;  1FQE A;  4LON B;  3KBR A;  2UVI A;  3MUQ A;  3H6V A;  5F1Q A;  4DLD A;  2O51 A;  3FVN A;  4GFR A;  4LZ8 A;  1P1N A;  2DWA A;  2O7U A;  5BUU A;  4G8M A;  4TQU Q;  4H65 A;  3ODB A;  1B7U A;  4EQB A;  4NWD A;  3VFJ A;  1P1W A;  4OVJ A;  1MH3 A;  5DYH A;  2VP1 A;  4KYE A;  5JTY A;  2A5S A;  3TCG A;  3H6T A;  4H67 A;  3KN8 A;  4ELO A;  4KYD A;  1TFA A;  4EQ9 A;  1CE2 A;  2Q88 A;  3I3V A;  4U1O A;  4LA9 A;  1FQD A;  5BWJ A;  4QF9 A;  1LCF A;  4C0R A;  4U1Z A;  2ZNU A;  1NNT A;  3K0V A;  3CVG A;  3DP4 A;  4WED A;  3RY3 A;  3SEY A;  3TMG A;  3MPL A;  3FXU A;  1Y9U A;  2P0S A;  1QUL A;  4GL0 A;  4PFT A;  5EHS A;  3FJG A;  3R26 A;  4OFL A;  4YKK A;  3KSJ A;  3M3F A;  2HZL A;  3RQT A;  4BDM A;  5I2K B;  4XIG Q;  4H6D A;  3IB0 A;  1DPE A;  4Q30 B;  2X7P A;  3SEU A;  1QUI A;  1Y1Z A;  3IOT A;  3O28 A;  4UAC A;  3T96 B;  4OET A;  2XXP A;  3CSG A;  2VOZ A;  4MBP A;  3W15 C;  5DT6 A;  1P1Q A;  1URG A;  2YLN A;  2E0S A;  3C35 A;  4NF8 A;  4GXA A;  4EXL A;  5FHM A;  4O3C A;  3H6U A;  5TPA B;  3RLF E;  1LFI A;  3UIF A;  1MDQ A;  4F22 A;  3QSL A;  4ZED A;  2DP8 A;  1B46 A;  3OSR A;  3H3G A;  3THI A;  4EF1 A;  2DYX A;  5H8H A;  4QFN A;  2I4B A;  2VGQ A;  1Y1M A;  1JW1 A;  1QW0 A;  2Q2C A;  3O6H A;  4ZEI A;  4F1U A;  2AYS A;  2AIX A;  1I69 A;  1US4 A;  2THI A;  1LGB C;  2R6G E;  1PBQ A;  3CFZ A;  4FIM A;  4NF6 B;  4IO7 A;  4DCX A;  1PEB A;  2UYF A;  2DVC A;  4ND9 A;  4YU0 A;  1UIV A;  3SEW A;  1EZO A;  2F7C A;  4H5G A;  4LAT A;  3M8U A;  3SEX A;  4F2Q A;  1A55 A;  3K6U A;  3VLU A;  3S9L C;  4FED A;  4F18 A;  4X48 A;  3ILU B; 
#chains in the Genus database with same CATH topology
 3JZJ A;  2V93 A;  5H8Q A;  1IXC A;  2DSF A;  1JEV A;  4AS4 A;  4YMB A;  4X1D A;  4F3S A;  3VLU A;  5JEI A;  1QKA A;  2O84 X;  2Z23 A;  3BBR A;  5HM4 B;  1H3D A;  4U4S A;  3MZ9 A;  4H0W A;  2QVV A;  4JVI A;  3TTK A;  3DEL B;  2XX7 A;  2Q74 A;  1YCJ A;  4LQ2 A;  3IO6 A;  4G77 A;  3MVX A;  3SET A;  1B7Z A;  2O7I A;  2NXO A;  4LP2 B;  5CM6 A;  3RT6 B;  2ZNS A;  4F2O A;  4FEB A;  4ZZE A;  3Q25 A;  4DI4 B;  3ZS6 A;  3TZA A;  4F3G A;  3KJ7 A;  5H8H B;  1MPC A;  4XFE A;  1FPK A;  3PGF A;  3VLW A;  1B32 A;  4GOT A;  3FVK A;  1N7W A;  3TTR A;  4C1U A;  1Y3Q A;  4L17 A;  1DMB A;  5HPQ A;  3PUV E;  2ZMB A;  2PMS A;  5IZ1 A;  1B7H A;  2Y7W A;  1ZJL A;  2M8C A;  3L6G A;  1MY4 A;  3T9H B;  2H4I A;  3O6G A;  4N13 A;  4QFO A;  3A29 A;  1OLA A;  5AA2 B;  2F35 A;  1IQ7 A;  1KA1 A;  4GX6 A;  4N8G A;  1GR2 A;  5K2X A;  2OCU A;  3QAX A;  1LBB A;  5FTI A;  2F8D A;  4G8H A;  1PB9 A;  4OA4 A;  3FVG A;  4MJO A;  2B3F A;  4RYA A;  1LBW A;  3EHT A;  4EDP A;  1XC1 A;  4P0G A;  3BFT A;  5JTY B;  4KXP A;  3FXQ A;  1N3X A;  4OES A;  4NF5 B;  1NNF A;  4EQ7 A;  3IX1 A;  1RDY A;  2OZZ A;  4XTC Q;  3OEN A;  4GWZ A;  4BLA A;  3L6H A;  3HFU A;  4POW A;  3DP8 A;  2W7Y A;  4K3F A;  3K1P A;  1D9Y A;  1R9Q A;  1DOT A;  3IL1 B;  4PAI A;  5HBC A;  2HXW A;  1II5 A;  1F9B A;  3IOV A;  4F3B A;  1ATG A;  4F1Y A;  1Q1K A;  1XOC A;  3CIJ A;  5FHN A;  2XXK A;  3ZSF A;  4IO2 A;  4PET A;  3N5L A;  3R6U A;  2DE4 A;  2RC8 A;  4H1X A;  4Z0I A;  2QVU A;  5IZ3 A;  1Y4C A;  4JWO A;  1RKM A;  5H8S A;  1FPJ A;  4I3E A;  3TAJ A;  3WAF A;  3C31 A;  3TTN A;  3O9P A;  4MNI A;  4R2B A;  4XF5 A;  3CSB A;  5FTH A;  1D4N A;  2WX9 A;  1FTO A;  4LZ7 A;  1IIT A;  3RGY A;  1NL5 A;  4GVO A;  1FJ9 A;  2BJJ X;  2DE2 A;  5A5X B;  1LBX A;  4PAK A;  4P11 A;  4PCD A;  2ZNT A;  1NH8 A;  4TOZ A;  4Q0C A;  1LAX A;  3RN8 A;  2D5W A;  3RPW A;  1MQI A;  5TP9 B;  2UVH A;  2XXT A;  1YPN A;  2VPO A;  2KLF A;  1NV0 A;  3GBA A;  4DCY A;  4Z7E A;  3LBS A;  1LBC A;  1NNP A;  2O69 A;  4NWC A;  2OBG A;  3D4G A;  3MYU A;  2F7A A;  3KJT A;  4R74 A;  2OX3 A;  3FXR A;  4KQP A;  2XXQ A;  2V3U A;  4YAH X;  4RPO A;  2WEF A;  4YKJ A;  1PBP A;  4GBW A;  2AL4 A;  5B70 A;  2H99 A;  2FBP A;  1R6Z A;  1JVY A;  1LFG A;  4OEV A;  3B50 A;  4N81 A;  2P1S A;  2I6E A;  3LSF B;  3U1O A;  1NUY A;  4OEN A;  1Y3P A;  4FJP A;  1YXI A;  1JP4 A;  1N0T A;  3GLB A;  1TWY A;  1EH3 A;  2WYP A;  2Y7R A;  4JDF A;  3CG1 A;  5AA2 A;  2HQ0 A;  1B2H A;  2VT5 A;  1BK4 A;  4ELR A;  1VE4 A;  4OVS A;  4GBV A;  1JET A;  1CNQ A;  3OO9 A;  1OVT A;  1QGX A;  3VVD A;  4GX4 A;  3CFX A;  4U21 A;  3SKP A;  5IZZ A;  4IB2 A;  1TT1 A;  3C33 A;  3LSW A;  1SYH A;  3OOA A;  4N4U A;  2YJP A;  1UIU A;  2A5T B;  3QIM A;  3C36 A;  4MEV A;  1K9Y A;  1SBP A;  3O66 A;  3SDF A;  1S7Y A;  4RY1 A;  3PPN A;  3ONM A;  1AIV A;  3FV1 A;  2XXV A;  1HSE A;  2PT2 A;  2RC7 A;  1GVC A;  2JJK A;  5AA4 B;  1SW4 A;  4BDR A;  4U22 A;  1D3K A;  2F3D A;  4OFJ A;  3H06 B;  3UOR A;  1XVX A;  5M2V A;  1N84 A;  5EHM A;  3EHU A;  3WAE A;  4NG7 A;  1POT A;  3HHG A;  4RPN A;  1NI9 A;  3FZV A;  1Y4T A;  5I56 B;  1NUW A;  5FBP A;  1FQE A;  2V4C A;  3KBR A;  4GFR A;  1P1N A;  1K9Z A;  2DWA A;  4TQU Q;  1B7U A;  3QMF A;  5ESY A;  4KYE A;  4H67 A;  4LA9 A;  1NNT A;  3CVG A;  3DP4 A;  1LEV A;  4OVP A;  5EQA A;  1Y9U A;  2P0S A;  4GL0 A;  3R26 A;  4OFL A;  4YKK A;  3KSJ A;  4BDM A;  5LTC A;  4XIG Q;  3IB0 A;  4Q30 B;  3SEU A;  1QUI A;  3T96 B;  4UAC A;  4OET A;  3CSG A;  3KC1 A;  4GXA A;  4EXL A;  5FHM A;  4O3C A;  3THI A;  1B46 A;  5H8H A;  2I4B A;  2Q2C A;  5EQ9 A;  4NAP A;  1I69 A;  4NF6 B;  2R6G E;  4FIM A;  4IO7 A;  4DCX A;  4ND9 A;  2F7C A;  3ROJ A;  3M8U A;  5IZ3 B;  3S9L C;  4O7I A;  4JBZ A;  4O3B A;  4U4X A;  1INP A;  3QUJ A;  4GQO A;  4OAN A;  5KCJ B;  3IFC A;  5EQ7 A;  1FPF A;  3GYY A;  3M3L A;  4P0I A;  2P3V A;  1B3G A;  1PB8 A;  3S2V A;  3K6V A;  2BJI A;  3IFA A;  3KC0 A;  2QFL A;  3FAT A;  4C1T A;  2XX8 A;  1MRP A;  4MLQ A;  1AL3 A;  4RK9 A;  4GLI A;  3E9X A;  1OIB A;  3G3K A;  4FAJ A;  1B51 A;  3KGC A;  4GWY A;  3U92 A;  2FA7 A;  1MXZ A;  4LQ5 A;  2HZK A;  3TTM A;  2QS4 A;  3PV0 E;  2DXR A;  3TOD A;  5L9O A;  2VD3 A;  2QMX A;  3D4C A;  1MXX A;  3HCQ A;  3BFU A;  1MM6 A;  3LSX A;  4PFI A;  3VVE A;  3BIG A;  1B6H A;  4G8N A;  3Q28 A;  2RC9 A;  4GXS B;  2FNC A;  3V83 A;  2ONR A;  5CBS A;  3S9E A;  3U93 A;  1B05 A;  2G93 A;  5ELV A;  3TCH A;  5I59 B;  3TQL A;  4F3P A;  1LAH E;  3IO4 A;  4GF8 A;  2HCA A;  2Z8E A;  3OEL A;  4NF4 A;  4O8M A;  1FPL A;  3G3I A;  2XX9 A;  4GRK A;  1MY3 A;  2XXU A;  1EZP A;  1WDN A;  4IO6 A;  3M3K A;  1EYJ A;  1B1H A;  3G3H A;  2RIN A;  2VPN A;  3KOS A;  3K02 A;  5AA3 A;  5EQ8 A;  1MXU A;  1H43 A;  2F78 A;  3V89 B;  1BP5 A;  3IR1 A;  4AQ4 A;  1NNK A;  1MH4 A;  4HE0 A;  1Z7M E;  4PC9 A;  2A5T A;  4DXB A;  3FIR A;  4FE8 A;  4HS7 A;  5I58 A;  2VHA A;  1OQH A;  3GBB A;  3EQ1 A;  1R1N A;  3PUY E;  3EN3 A;  5DVF A;  3DM0 A;  4Q5T A;  1FPG A;  1ELJ A;  3EF7 A;  2CEY A;  3OEK A;  3RNN A;  1MG1 A;  3PMW A;  4ECF A;  5AA1 A;  1ZIU A;  3CRB A;  1FTL A;  1MQG A;  1QVS A;  1B3F A;  1FSA A;  2WBB A;  4GWO A;  4PE3 A;  3MWB A;  1A99 A;  1S50 A;  3PPO A;  5I3S A;  3K1N A;  3KFM A;  1IEJ A;  1OQG A;  2DWJ A;  3G3J A;  3GXA A;  4KYS A;  2REJ A;  1BLF A;  1XHY A;  3U72 A;  1NKX A;  1OMP A;  1GV8 A;  4R6K A;  3VLV A;  4F39 A;  5AA2 D;  4PFB A;  4P8B A;  4YB6 A;  1ZU0 A;  1AMF A;  4FEC A;  5EYG A;  4X1B A;  2ONK E;  3QXM A;  3PMV A;  1POY 1;  4BDO A;  4PFW A;  1H44 A;  3GZG A;  4MNC A;  5KDT B;  4NN3 A;  1HSJ A;  1Z7N E;  3FJ7 A;  2GHB A;  3E3K A;  1EYI A;  4QFK A;  3OO7 A;  4GWX A;  5I57 B;  1JQF A;  1LB9 A;  5J1D A;  1B0H A;  3RTW B;  4TLL B;  1RYO A;  3G3G A;  2V3Q A;  4JSD A;  5DEX B;  2PT1 A;  2H9B A;  3H03 A;  1FJ6 A;  1OVB A;  4EUO A;  2PFY A;  2XXW A;  4HE1 A;  1DTZ A;  1SVX B;  4OER A;  5H8F A;  1PDA A;  2HPG A;  2XXI A;  1BIY A;  4NX1 A;  1IXG A;  3A09 A;  2FYI A;  3MW0 A;  4FAT A;  2OK2 A;  3MPK A;  5I84 A;  1A40 A;  1LCT A;  2PBW A;  2DS9 A;  1ZMG A;  1MQH A;  1NMU A;  2FVZ A;  4ZS9 A;  3OMB A;  1IMB A;  1LST A;  3Q27 A;  3B8B A;  3SES A;  1JW5 A;  2H5Y A;  2X7Q A;  3IB2 A;  4IO5 A;  3MQ9 A;  3D1R A;  3N26 A;  1UTH B;  4MH5 A;  4MFI A;  1YAE A;  4PGN A;  3K01 A;  4IR8 A;  3E79 A;  4DE8 A;  4F29 A;  3H7M A;  1RDX A;  1B5H A;  3S4U A;  2Q2A A;  3DLN A;  4UAB A;  5KZT A;  2H25 A;  5LDZ A;  1A7L A;  3IOU A;  4ZDM A;  1S9T A;  4R72 A;  2QS3 A;  4P3L A;  1XT8 A;  4PFU A;  1NV1 A;  2ZYN A;  1UTB A;  1IZ1 A;  3T93 B;  3C32 A;  3RYD A;  1HSL A;  3H4Z A;  2PX1 A;  4ZZA A;  1SPI A;  2HAV A;  3PUW E;  4GIZ A;  2GH9 A;  1NUX A;  4AB5 A;  4MIJ A;  1B9J A;  4GWW A;  3SER A;  4MAG A;  4QSE A;  4HE2 A;  1SI0 A;  5CMM A;  1A8E A;  2Y84 A;  1PC3 A;  1D9V A;  2OLB A;  1NV7 A;  3QUF A;  3IK6 B;  2OWT A;  1G0H A;  2OJT A;  3DP6 A;  2QMW A;  4KR5 A;  1FTK A;  3U94 A;  3G3F A;  3HHF A;  1B4H A;  3KN7 A;  3P7I A;  1G0I A;  1Q9D A;  4N8Y A;  2REG A;  3MP1 A;  5AA4 A;  4YZZ A;  1O64 A;  3VXB A;  4IY6 A;  3OO6 A;  5H8Q B;  2PVU A;  3I5O A;  1QKB A;  4LZ5 A;  2XWI A;  5CC2 A;  4NE4 A;  3PU5 A;  4JSO A;  3MST A;  4HCY A;  4OYV A;  4OVR A;  1LAF E;  4YKI A;  1QUJ A;  1SW5 A;  4IGT A;  1NV3 A;  3MUQ A;  3H6V A;  4DLD A;  3FVN A;  5BUU A;  3ODB A;  3VFJ A;  1MH3 A;  2B4L A;  5JTY A;  2A5S A;  3H6T A;  1FPE A;  4KYD A;  1CE2 A;  3K0V A;  3SEY A;  4P1E A;  3FXU A;  4PFT A;  2XWO A;  3RQT A;  5I2K B;  4H6D A;  3T9V A;  2X7P A;  4N17 A;  5DT6 A;  1P1Q A;  1URG A;  4DI3 D;  3H6U A;  5TPA B;  3RLF E;  1LFI A;  1MDQ A;  4AS5 A;  2DP8 A;  5DW8 A;  4QFN A;  5ET5 A;  2VGQ A;  1Y1M A;  3O6H A;  2AIX A;  2THI A;  3CFZ A;  1PEB A;  1UIV A;  4LAT A;  3SEX A;  2FHY A;  1A55 A;  1LBV A;  1LBY A;  4FED A;  4F18 A;  4WKM A;  1MPD A;  1XI6 A;  3PUZ E;  4JXI A;  4R9F A;  2E1S A;  2QSX A;  4I62 A;  1DSN A;  3NOH A;  3B6T A;  2DXY A;  3I6V A;  5AE4 A;  4OVQ A;  5IKB A;  3OO8 A;  3LUY A;  2HFB A;  3FD3 A;  5ITP A;  2I4C A;  3C34 A;  4PF8 A;  2KR0 A;  3CHG A;  4BDL A;  3U8Q A;  1N7X A;  1B3L A;  2CZK A;  3O97 A;  1FQB A;  4FBP A;  4XKR A;  2I58 A;  3E4R A;  1USY E;  4NF5 A;  2ZXT A;  3F11 A;  1FPI A;  2X26 A;  4U2R A;  4THI A;  3FBP A;  4IY5 A;  3LR1 A;  4KHZ E;  4KPT A;  4OTE A;  1B5I A;  1SW2 A;  1FBD A;  4XKQ A;  3MVW A;  2GHA A;  5IM2 A;  3CR9 A;  2CZL A;  4QXD A;  1SDX A;  1LFH A;  3HST A;  3PPP A;  3OD7 A;  3K4U A;  1JEU A;  5I2K A;  1VFD A;  2V3T A;  4GD5 A;  1RYX A;  2Z8F A;  2Y5K A;  3MC2 A;  3Q26 A;  3CG3 A;  1EZ9 A;  4JB7 A;  4M4G A;  2O1L A;  1XVY A;  1ZTY A;  2ZZW A;  3Q29 A;  3O2A A;  3RT8 A;  2XD2 A;  5B7D A;  4MF3 A;  3ISP A;  4R9G A;  5CMC A;  1MQD A;  1B3E A;  1FTJ A;  2QJE A;  1LBZ A;  2P2A A;  4XKP A;  4X9T A;  5KDT A;  4PE5 B;  1NV6 A;  2LAO A;  2XHD A;  4NGU A;  3ILT B;  5TU0 A;  3KN3 A;  1FBH A;  1SW1 A;  2ONS A;  5LOM A;  2NOO A;  1B52 A;  2XD3 A;  4GWU A;  1YYZ A;  5EYF A;  1YTV A;  2I0C A;  2Q8J A;  2UYE A;  2PFZ A;  3PMX A;  2B65 A;  2R71 A;  4PDD A;  4XKN A;  3LUZ A;  1NV4 A;  4YMA A;  1N3W A;  2I49 A;  4JVC A;  1T0K A;  4G2Z A;  1I6B A;  3T66 A;  4MLV A;  2QPQ A;  2Z8D A;  2G29 A;  1IXH A;  3IOR A;  3T0J A;  5I2N B;  1D9Q A;  5K2Y A;  3U65 A;  5I59 A;  4EXK A;  2FIX A;  3MVZ A;  2GRV A;  3MP6 A;  1R9L A;  4QBA A;  3UA8 A;  2PCR A;  1FQC A;  4O3A A;  2XXR A;  3MZB A;  3KOT A;  1WOD A;  3K1M A;  1M5B A;  1MY2 A;  3C4M A;  5L8D A;  1B58 A;  3FUZ A;  1UQW A;  5CMK A;  1TXF A;  1RDZ A;  3QK6 A;  4N6P A;  4YB7 A;  1I6Q A;  2ZYM A;  4YKP A;  3FGS A;  4WXJ A;  4HXV A;  1JNF A;  2IA4 A;  5EYH A;  3O29 A;  2F6G A;  2Z22 A;  3MP8 A;  2VD2 A;  4I9D A;  1I6A A;  4QSC A;  4EF2 A;  3PUX E;  5ET6 A;  2XXX A;  4N91 A;  1FBG A;  3FVO A;  4N07 A;  4G68 B;  4I8C A;  1J1N A;  1N04 A;  2I0B A;  5CMB A;  3TTL A;  3ZKK A;  3VV5 A;  4RA1 A;  3TUS A;  1ZLQ A;  2ESN A;  4ZEB A;  4PQJ A;  1URD A;  1WVJ A;  4QHQ A;  5I5P A;  1SYI A;  4M1V A;  1ANF A;  4TLM B;  3KSX A;  3LSL A;  1AWB A;  1P99 A;  4PP0 A;  4P56 A;  4NMY A;  4F31 B;  5ICT A;  1EYK A;  4OZ9 A;  5CRY A;  2F5X A;  2AL5 A;  3FAS A;  4RNS A;  2FIE A;  3HV1 A;  1Y3N A;  2NVU B;  4ESW A;  3PPQ A;  4XXU A;  3TKD A;  3W9W A;  4Q8R A;  1UTH A;  1TFD A;  3USD A;  5T3J A;  2NWJ A;  1JW4 A;  4PBQ A;  2XWK A;  3A3C A;  4U23 A;  3EHS A;  2HAU A;  4YIC A;  2Y7P A;  1FTA A;  4G61 A;  2ZYO A;  2WYK A;  2DDK A;  2GFE A;  2F97 A;  4GL8 A;  1B1X A;  1VFE A;  1FBE A;  4R6H A;  2F7B A;  4NHB A;  3IB1 A;  5H8N B;  4KFQ A;  4MNP A;  2Y7I A;  3JV9 A;  3TQW A;  2R9J A;  3LV0 A;  3RTF B;  4H5F A;  2Q8M A;  4OQO A;  4ZEC A;  3PD8 A;  2I3V A;  3H6W A;  4RXL A;  3PTY A;  4GX3 A;  2I3W A;  4H45 A;  1P1U A;  3MVY A;  1ZKB A;  4QFL A;  1MM7 A;  2QRY A;  3K6X A;  1GGG A;  2DVZ A;  3QYT A;  1IMF A;  2MKZ A;  2QL3 A;  1A54 A;  2RKM A;  1O7T A;  1QJM A;  4H46 A;  3LC8 A;  4ZE9 A;  3FXB A;  3T9U A;  4X04 A;  3T1B A;  4I40 A;  4PFY A;  1IIW A;  2DE3 A;  2ZZX A;  2O51 A;  4LZ8 A;  2O7U A;  4G8M A;  4NWD A;  1P1W A;  4OVJ A;  2VP1 A;  4JVD A;  1TFA A;  4EQ9 A;  3I3V A;  1KA0 A;  4U1O A;  1LCF A;  4U1Z A;  2ZNU A;  4WED A;  3TMG A;  5EHS A;  1QUL A;  2HZL A;  3TEL A;  1Y1Z A;  3IOT A;  2XXP A;  4MBP A;  2VOZ A;  3W15 C;  2CZH A;  3C35 A;  2E0S A;  1NV5 A;  4PBH A;  3UIF A;  4ZED A;  4F22 A;  3OSR A;  3H3G A;  2DYX A;  4ZEI A;  1JW1 A;  1QW0 A;  2DVC A;  4YU0 A;  3SEW A;  4H5G A;  3K6U A;  4X48 A;  2F3B A;  2O6A A;  4OFO A;  4PTK A;  1FBF A;  2ZYK A;  5F7V A;  5TP9 A;  1MXW A;  1SI1 A;  4DXU A;  1M5F A;  3V5A A;  1MS7 A;  4IO3 A;  2H98 A;  2Q89 A;  3V8X B;  2ALU A;  2RCB A;  2XWV A;  4N15 A;  1O63 A;  4NF4 B;  1A8F A;  2F36 A;  5DTB A;  2ANJ A;  4KD5 A;  4R2F A;  3AXF A;  4FOR A;  2OWS A;  1OLC A;  4ISU A;  5KCJ A;  4MHF A;  2IEE A;  2ZZV A;  1NUZ A;  1KWH A;  4MCO A;  3IJO B;  3W9V A;  1DBZ A;  4P9K A;  5CBR A;  2L5V A;  2WBD A;  2GQ1 A;  2R8T A;  2QS2 A;  1FW0 A;  4NF0 A;  3KZG A;  5DEX A;  1FBP A;  5IAI A;  3RUM A;  4JWX A;  3TEP A;  4GWS A;  2HEU A;  4E0W A;  1LAG E;  4QFP A;  1UTB B;  2F34 A;  4PAF A;  4MMP A;  1M5C A;  1KZ8 A;  2UVJ A;  2CZI A;  2Q9T A;  1NFT A;  1IUD A;  1FQA A;  2KQZ A;  2D3I A;  3FJM A;  1NH7 A;  4N6K A;  3UP9 A;  1B0L A;  2Y7K A;  3BIH A;  2XXY A;  4KCD A;  3PD9 A;  4F1V A;  1MXY A;  1URS A;  3FV2 A;  4O7M A;  3EKI A;  4ESX A;  1EU8 A;  3B6W A;  3E78 A;  2UVG A;  3CFL A;  2B4M A;  4OWD A;  4R6Y A;  2XXH A;  4F19 A;  3TPA A;  2XA5 A;  4LUB A;  1MY0 A;  3B6Q A;  3G7W A;  3VVF A;  2PYY A;  1XS5 A;  5H8F B;  4IGR A;  4OMB A;  2O1M A;  3OSQ A;  4E0X A;  4R73 A;  4ELQ A;  1YZ0 A;  3KBZ A;  5F24 A;  5I2N A;  4DIG A;  5ET8 A;  1LLS A;  3B7D A;  3IAZ A;  4AB6 A;  5DVI A;  3T9X B;  2V84 A;  5L9M A;  1L5T A;  5L9S A;  1M5D A;  1P1O A;  1Y20 A;  1FPB A;  3K6W A;  4R75 A;  3TDJ A;  5J16 A;  1VR5 A;  1FQF A;  4ONY A;  1H76 A;  4N6D A;  4KCC A;  4X8R A;  5H8N A;  3EPE A;  3IJX B;  1FCK A;  4HTG A;  3MAM A;  2F6P A;  4BDN A;  4OHN A;  3ECR A;  3MJN A;  4ELP A;  4O94 A;  1AH5 A;  3TYH A;  3N6T A;  2HHM A;  2QVR A;  4OEU A;  1NV2 A;  2V25 A;  4I1D A;  3S9N C;  1DTG A;  5DVJ A;  3CI8 A;  1PB7 A;  1H45 A;  2RF1 A;  4NF6 A;  1IME A;  3R7X A;  3VDF A;  2WKY A;  5ITO A;  1AOV A;  1BKA A;  2O68 A;  1CB6 A;  5JK4 A;  1FBC A;  4JWY A;  5I7I A;  4PGP A;  1USY H;  2QS1 A;  1VSO A;  3JYR A;  2CMO A;  1B40 A;  3UK4 A;  1BTJ A;  4KI0 E;  4DZ1 A;  2DQV A;  3IOW A;  4HW8 A;  1FTM A;  2RCA A;  5FHO A;  2ABH A;  1B3H A;  2P3N A;  5ICQ A;  3MBP A;  4RJZ A;  2NUV A;  4G4P A;  4BDQ A;  5I58 B;  1LB8 A;  3ZKL A;  4UA8 A;  3E13 X;  3K00 A;  2B3B A;  5A5X A;  3ILU B;  4OXV A;  3RPL A;  2I48 A;  1SQY A;  3K2D A;  3O6I A;  3T22 A;  3N94 A;  3C9H A;  4P47 A;  5CI5 A;  3A3U A;  2CEX A;  4NF8 B;  4ZE8 A;  3KG2 A;  4QRZ A;  1MDP 1;  2Y5L A;  4NQ8 A;  3HN0 A;  1IXI A;  4PFR A;  2YPN A;  2DOJ A;  3HPI A;  4XEQ A;  4QSD A;  1Q35 A;  1MY1 A;  2D21 A;  4IO4 A;  3N6U A;  1DCU A;  2HXR A;  1B5J A;  3TFL A;  2OWZ A;  4YB5 A;  1GTK A;  1JVX A;  1US5 A;  1FRP A;  3VXC A;  4WEP A;  4NED A;  3TCF A;  2DWH A;  3S9M C;  3UGW A;  1MPB A;  1M5E A;  4LVQ A;  3OXN A;  1QUK A;  5I57 A;  3UN6 A;  3SEV A;  4HCW A;  4LN5 A;  3SZP A;  1DK4 A;  1IMC A;  5I56 A;  3HO7 A;  3MZ1 A;  4DXC A;  3PPR A;  3KEI A;  3VE1 B;  4RK2 A;  1N76 A;  4POX A;  5TPA A;  5IGA A;  1IMA A;  1ZBM A;  4H8I A;  1SD3 A;  4PF6 A;  1B4Z A;  4PDH A;  2DWI A;  4G68 A;  4ZEF A;  5A5L A;  1DPP A;  4NTL A;  1MQJ A;  4DDD A;  3BKI B;  4G68 C;  4H8J A;  1FPD A;  1MXV A;  3OEM A;  4OVT A;  2UXA A;  4LON B;  2UVI A;  5F1Q A;  4H65 A;  4EQB A;  1IMD A;  5DYH A;  3RPL B;  3TCG A;  3KN8 A;  5ET7 A;  2Q88 A;  1FQD A;  5BWJ A;  4QF9 A;  4C0R A;  3RY3 A;  3MPL A;  3FJG A;  3M3F A;  1DPE A;  3O28 A;  5ISU A;  4P1L A;  2YLN A;  4NF8 A;  4MX6 A;  3QSL A;  4EF1 A;  4I3Y A;  4F1U A;  1VDW A;  2AYS A;  1US4 A;  1LGB C;  1PBQ A;  4ELO A;  2UYF A;  1EZO A;  4F2Q A;  4ZEK A; 
#chains in the Genus database with same CATH homology
 4WKM A;  1MPD A;  2O6A A;  3JZJ A;  4OFO A;  3PUZ E;  4O3B A;  4U4X A;  5CM6 A;  2V93 A;  5H8Q A;  3QUJ A;  1IXC A;  2DSF A;  2ZYK A;  4JXI A;  1JEV A;  5F7V A;  5TP9 A;  4GQO A;  1MXW A;  4R9F A;  2E1S A;  1SI1 A;  2QSX A;  4YMB A;  5KCJ B;  4X1D A;  4DXU A;  4F3S A;  3M3L A;  1M5F A;  4P0I A;  1MS7 A;  4I62 A;  4IO3 A;  1B3G A;  3V5A A;  1PB8 A;  1QKA A;  2O84 X;  2Z23 A;  3BBR A;  3S2V A;  1DSN A;  2H98 A;  1H3D A;  3B6T A;  2DXY A;  3I6V A;  3K6V A;  5AE4 A;  4U4S A;  3OO8 A;  5IKB A;  3MZ9 A;  4H0W A;  3LUY A;  2Q89 A;  2HFB A;  3V8X B;  3TTK A;  2ALU A;  2RCB A;  3FD3 A;  5ITP A;  2I4C A;  3C34 A;  3DEL B;  1O63 A;  2XX7 A;  3FAT A;  1YCJ A;  4NF4 B;  4BDL A;  4LQ2 A;  4C1T A;  2XX8 A;  3U8Q A;  1A8F A;  1MRP A;  3IO6 A;  4G77 A;  4MLQ A;  1AL3 A;  2F36 A;  4RK9 A;  2ANJ A;  4KD5 A;  1N7X A;  3MVX A;  4GLI A;  1B7Z A;  4R2F A;  2O7I A;  3SET A;  2NXO A;  3AXF A;  1OIB A;  3E9X A;  4FOR A;  3T9V A;  1B3L A;  2OWS A;  3G3K A;  1OLC A;  4LP2 B;  4FAJ A;  3RT6 B;  2ZNS A;  1B51 A;  4ISU A;  3KGC A;  3U92 A;  4F2O A;  5J1D A;  3O97 A;  2FA7 A;  5KCJ A;  1FQB A;  1MXZ A;  2IEE A;  4LQ5 A;  4XKR A;  4FEB A;  1KWH A;  2HZK A;  4ZZE A;  3TTM A;  2I58 A;  3E4R A;  3IJO B;  2QS4 A;  1USY E;  3W9V A;  4NF5 A;  2ZXT A;  3F11 A;  3TEL A;  3PV0 E;  2DXR A;  3TOD A;  3Q25 A;  5L9O A;  2X26 A;  5CBR A;  3ZS6 A;  2QS2 A;  3TZA A;  4F3G A;  3KJ7 A;  5H8H B;  1FW0 A;  4U2R A;  4THI A;  1MPC A;  3KZG A;  5DEX A;  2VD3 A;  3PGF A;  3LR1 A;  4IY5 A;  2QMX A;  3D4C A;  4GF8 A;  4KHZ E;  4KPT A;  1MXX A;  3HCQ A;  1B32 A;  3BFU A;  1MM6 A;  1B5I A;  1SW2 A;  3FVK A;  3LSX A;  4GOT A;  4JWX A;  3RUM A;  5IAI A;  4XKQ A;  1N7W A;  3TTR A;  3MVW A;  2GHA A;  3VVE A;  4C1U A;  1Y3Q A;  3TEP A;  1B6H A;  5ISU A;  4G8N A;  3Q28 A;  4L17 A;  2RC9 A;  1DMB A;  2HEU A;  3CR9 A;  2CZL A;  4GXS B;  4E0W A;  5HPQ A;  1LAG E;  3PUV E;  4QFP A;  4FAT A;  2ZMB A;  2PMS A;  2FNC A;  1B7H A;  1SDX A;  1LFH A;  2Y7W A;  3HST A;  3V83 A;  1UTB B;  2F34 A;  1ZJL A;  2M8C A;  2ONR A;  3L6G A;  3VLW A;  5CBS A;  3S9E A;  1MY4 A;  3U93 A;  3PPP A;  1B05 A;  3K4U A;  1JEU A;  3OD7 A;  1VFD A;  2G93 A;  5I2K A;  3T9H B;  2H4I A;  3O6G A;  5ELV A;  2V3T A;  4GD5 A;  4N13 A;  1RYX A;  3TCH A;  2Z8F A;  1M5C A;  5I59 B;  3TQL A;  2UVJ A;  4F3P A;  2Q9T A;  3MC2 A;  4QFO A;  1LAH E;  3IO4 A;  3Q26 A;  1NFT A;  1IUD A;  1OLA A;  1FQA A;  3CG3 A;  2F35 A;  1EZ9 A;  2HCA A;  2Z8E A;  2O1L A;  3OEL A;  3G3I A;  4JB7 A;  1XVY A;  2XX9 A;  4GRK A;  4M4G A;  1IQ7 A;  4NF4 A;  1ZTY A;  1MY3 A;  2D3I A;  3Q29 A;  2XXU A;  1EZP A;  1WDN A;  3O2A A;  4IO6 A;  3M3K A;  1GR2 A;  5K2X A;  2OCU A;  1B1H A;  3G3H A;  1LBB A;  3FJM A;  2RIN A;  3QAX A;  3KOS A;  5FTI A;  3RT8 A;  1NH7 A;  2F8D A;  4G8H A;  2XD2 A;  3UP9 A;  1B0L A;  3K02 A;  5AA3 A;  2Y7K A;  1MXU A;  1PB9 A;  5AA2 B;  5B7D A;  1H43 A;  2F78 A;  3FVG A;  4MF3 A;  2XXY A;  3V89 B;  1BP5 A;  3IR1 A;  4AQ4 A;  4KCD A;  2B3F A;  3PD9 A;  1NNK A;  4RYA A;  4F1V A;  1MXY A;  3EHT A;  4R9G A;  4EDP A;  1URS A;  1XC1 A;  3FV2 A;  4P0G A;  1MH4 A;  4OTE A;  3BFT A;  5CMC A;  5JTY B;  1MQD A;  1Z7M E;  1B3E A;  2A5T A;  1FTJ A;  2QJE A;  4ESX A;  1EU8 A;  4DXB A;  3B6W A;  3FXQ A;  2P2A A;  1N3X A;  4OES A;  2UVG A;  3FIR A;  3CFL A;  4FE8 A;  4NF5 B;  1NNF A;  4XKP A;  4HS7 A;  5I58 A;  4X9T A;  4EQ7 A;  3IX1 A;  4OWD A;  5KDT A;  2VHA A;  1OQH A;  3GBB A;  2XXH A;  4R6Y A;  4F19 A;  4PE5 B;  2LAO A;  2OZZ A;  3EQ1 A;  3OEN A;  2XHD A;  4XTC Q;  1R1N A;  3PUY E;  3TPA A;  4LUB A;  3EN3 A;  1MY0 A;  5DVF A;  3ILT B;  3DM0 A;  5TU0 A;  4BLA A;  4Q5T A;  3KN3 A;  3L6H A;  1ELJ A;  1SW1 A;  4POW A;  2ONS A;  5LOM A;  2NOO A;  3EF7 A;  3DP8 A;  2W7Y A;  4K3F A;  1B52 A;  2XD3 A;  3OEK A;  1MG1 A;  3B6Q A;  3RNN A;  3G7W A;  3VVF A;  2PYY A;  3K1P A;  1XS5 A;  3PMW A;  4ECF A;  5H8F B;  5EYF A;  1YTV A;  1D9Y A;  2I0C A;  4IGR A;  5AA1 A;  4OMB A;  1R9Q A;  2Q8J A;  1DOT A;  2UYE A;  1ZIU A;  3PMX A;  2B65 A;  2R71 A;  3IL1 B;  3CRB A;  4XKN A;  5HBC A;  1FTL A;  2HXW A;  1II5 A;  2O1M A;  1F9B A;  3IOV A;  4YMA A;  1MQG A;  1N3W A;  1QVS A;  4F3B A;  1B3F A;  3OSQ A;  4E0X A;  1ATG A;  4GWO A;  2I49 A;  4F1Y A;  1Q1K A;  1XOC A;  3MWB A;  1T0K A;  3CIJ A;  4G2Z A;  1A99 A;  4R73 A;  1S50 A;  3PPO A;  5FHN A;  4ELQ A;  3ZSF A;  1I6B A;  4IO2 A;  4PET A;  3K1N A;  3KFM A;  3N5L A;  3T66 A;  5I2N A;  3RTW B;  4DIG A;  4MLV A;  1IEJ A;  1LLS A;  1OQG A;  2QPQ A;  3B7D A;  3IAZ A;  3R6U A;  2DWJ A;  3G3J A;  2DE4 A;  2RC8 A;  3GXA A;  4KYS A;  4AB6 A;  2REJ A;  5DVI A;  1BLF A;  2Z8D A;  2G29 A;  1IXH A;  3IOR A;  1XHY A;  4H1X A;  4Z0I A;  3U72 A;  5I2N B;  3T9X B;  1NKX A;  2V84 A;  1OMP A;  5L9M A;  5K2Y A;  1L5T A;  5L9S A;  1AOV A;  1M5D A;  1Y4C A;  4JWO A;  5I59 A;  4EXK A;  1RKM A;  1P1O A;  5H8S A;  1Y20 A;  3K6W A;  3MVZ A;  4R75 A;  2GRV A;  4R6K A;  1VR5 A;  3TAJ A;  3TDJ A;  1FQF A;  3VLV A;  3WAF A;  4F39 A;  3C31 A;  3MP6 A;  4ONY A;  1H76 A;  1R9L A;  5DTB A;  3UA8 A;  4KCC A;  3TTN A;  4YB6 A;  1ZU0 A;  5H8N A;  1FQC A;  3O9P A;  3EPE A;  4O3A A;  4R2B A;  2XXR A;  1AMF A;  3IJX B;  3CSB A;  3MZB A;  4FEC A;  4X1B A;  5FTH A;  2ONK E;  3KOT A;  1D4N A;  3QXM A;  3PMV A;  1FCK A;  4HTG A;  1WOD A;  1POY 1;  3MAM A;  4BDO A;  4PFW A;  1FTO A;  1H44 A;  3GZG A;  2F6P A;  3K1M A;  1M5B A;  1MY2 A;  3C4M A;  4LZ7 A;  4BDN A;  5L8D A;  4OHN A;  1HSJ A;  1B58 A;  1Z7N E;  3FJ7 A;  3ECR A;  3MJN A;  4ELP A;  1IIT A;  2GHB A;  1AH5 A;  3E3K A;  3FUZ A;  3RGY A;  3TYH A;  3N6T A;  1NL5 A;  5AA2 D;  4GVO A;  4QFK A;  3OO7 A;  1UQW A;  5CMK A;  1TXF A;  2BJJ X;  3QK6 A;  5I57 B;  2DE2 A;  4N6P A;  4YB7 A;  1JQF A;  4OEU A;  5A5X B;  1I6Q A;  1LB9 A;  4P11 A;  2V25 A;  2ZNT A;  1NH8 A;  2ZYM A;  1B0H A;  4I1D A;  4Q0C A;  1LAX A;  4TOZ A;  4YKP A;  1DTG A;  3RN8 A;  3FGS A;  2D5W A;  4TLL B;  5DVJ A;  1RYO A;  3CI8 A;  3RPW A;  1MQI A;  1PB7 A;  1H45 A;  3G3G A;  5TP9 B;  4ZEK A;  2RF1 A;  2UVH A;  2V3Q A;  2XXT A;  4JSD A;  4NF6 A;  2PT1 A;  4WXJ A;  5DEX B;  1YPN A;  2H9B A;  3R7X A;  3VDF A;  2KLF A;  3GBA A;  4DCY A;  3H03 A;  1OVB A;  1JNF A;  2IA4 A;  2WKY A;  5ITO A;  4JBZ A;  4EUO A;  3O29 A;  2F6G A;  2XXW A;  2Z22 A;  1BKA A;  2O68 A;  4Z7E A;  1CB6 A;  3MP8 A;  1DTZ A;  1LBC A;  1NNP A;  2VD2 A;  3LBS A;  1I6A A;  2O69 A;  4I9D A;  4QSC A;  3PUX E;  4EF2 A;  1SVX B;  5JK4 A;  2XXX A;  4NWC A;  4OER A;  5H8F A;  1PDA A;  2OBG A;  3D4G A;  4JWY A;  2F7A A;  3FVO A;  2XXI A;  4G68 B;  1BIY A;  1USY H;  2QS1 A;  4I8C A;  1J1N A;  4N07 A;  5KDT B;  1IXG A;  1N04 A;  1VSO A;  2CMO A;  2FYI A;  1B40 A;  2I0B A;  3A09 A;  3JYR A;  2OK2 A;  3MW0 A;  3MPK A;  3KJT A;  5CMB A;  3TTL A;  3UK4 A;  1BTJ A;  3ZKK A;  4KI0 E;  5I84 A;  1A40 A;  1LCT A;  4R74 A;  2PBW A;  2DS9 A;  2DQV A;  3VV5 A;  4DZ1 A;  1ZMG A;  1MQH A;  3FXR A;  1NMU A;  4KQP A;  4RA1 A;  3TUS A;  4ZS9 A;  3IOW A;  4HW8 A;  2XXQ A;  3OMB A;  1ZLQ A;  1LST A;  2ESN A;  2V3U A;  3Q27 A;  4ZEB A;  1FTM A;  2RCA A;  4PQJ A;  4YAH X;  5FHO A;  3SES A;  1URD A;  1WVJ A;  4RPO A;  2ABH A;  1JW5 A;  2H5Y A;  2X7Q A;  4QHQ A;  3IB2 A;  1SYI A;  1B3H A;  4YKJ A;  5ICQ A;  1PBP A;  4M1V A;  3MBP A;  1ANF A;  4IO5 A;  3MQ9 A;  2AL4 A;  5B70 A;  4TLM B;  4RJZ A;  2H99 A;  2NUV A;  3N26 A;  4G4P A;  1UTH B;  3KSX A;  4BDQ A;  1R6Z A;  3LSL A;  5I58 B;  1P99 A;  1JVY A;  1LB8 A;  4MH5 A;  4MFI A;  3ZKL A;  1LFG A;  4OEV A;  4PP0 A;  1YAE A;  4UA8 A;  4NMY A;  3K01 A;  3E13 X;  4F31 B;  2P1S A;  3K00 A;  2I6E A;  3LSF B;  3U1O A;  2B3B A;  4DE8 A;  5ICT A;  4F29 A;  4OZ9 A;  5CRY A;  5A5X A;  2F5X A;  2AL5 A;  3H7M A;  4OXV A;  2I48 A;  3FAS A;  4OEN A;  4RNS A;  5JEI A;  1SQY A;  1Y3P A;  3K2D A;  3O6I A;  3HV1 A;  1B5H A;  3T22 A;  3N94 A;  3S4U A;  4FJP A;  1Y3N A;  2Q2A A;  3C9H A;  3DLN A;  2NVU B;  4ESW A;  5CI5 A;  5KZT A;  3A3U A;  3PPQ A;  4NF8 B;  4XXU A;  2H25 A;  4ZE8 A;  1A7L A;  3TKD A;  3IOU A;  3KG2 A;  3W9W A;  4Q8R A;  1N0T A;  4QRZ A;  4ZDM A;  3GLB A;  1TWY A;  1MDP 1;  1UTH A;  1S9T A;  4R72 A;  3HN0 A;  1IXI A;  1EH3 A;  2QS3 A;  1TFD A;  2YPN A;  3USD A;  2DOJ A;  2Y7R A;  3HPI A;  4JDF A;  2NWJ A;  3CG1 A;  1JW4 A;  4QSD A;  5AA2 A;  2HQ0 A;  1XT8 A;  3A3C A;  4U23 A;  4PFU A;  3EHS A;  1B2H A;  1GV8 A;  2HAU A;  4YIC A;  2Y7P A;  1UTB A;  1VE4 A;  2ZYN A;  1IZ1 A;  4ELR A;  3T93 B;  3C32 A;  1HSL A;  2ZYO A;  3H4Z A;  2PX1 A;  2GFE A;  1JET A;  1Q35 A;  1MY1 A;  2D21 A;  2F97 A;  4GL8 A;  1B1X A;  4ZZA A;  1VFE A;  3OO9 A;  4IO4 A;  1OVT A;  4R6H A;  2F7B A;  2HAV A;  3PUW E;  3IB1 A;  3N6U A;  5H8N B;  3VVD A;  4KFQ A;  4GIZ A;  3TFL A;  1B5J A;  2GH9 A;  2Y7I A;  3CFX A;  4U21 A;  4YB5 A;  3SKP A;  4IB2 A;  1GTK A;  1JVX A;  3JV9 A;  3TQW A;  2R9J A;  4AB5 A;  1US5 A;  1TT1 A;  1B9J A;  3C33 A;  3RTF B;  3VXC A;  3LSW A;  4H5F A;  4WEP A;  1SYH A;  3OOA A;  4NED A;  3SER A;  4OQO A;  4QSE A;  2YJP A;  3TCF A;  2DWH A;  1UIU A;  2A5T B;  3QIM A;  3UGW A;  4ZEC A;  3S9M C;  3C36 A;  1SI0 A;  5CMM A;  1MPB A;  1A8E A;  1M5E A;  2Y84 A;  1PC3 A;  1D9V A;  4LVQ A;  2OLB A;  1SBP A;  3O66 A;  3OXN A;  1QUK A;  3SDF A;  1S7Y A;  3PD8 A;  4RY1 A;  2I3V A;  3PPN A;  3QUF A;  3H6W A;  3ONM A;  5I57 A;  3UN6 A;  4RXL A;  3IK6 B;  4HCW A;  3SEV A;  2OWT A;  5HM4 B;  3S9N C;  1AIV A;  2I3W A;  2OJT A;  3FV1 A;  1P1U A;  3DP6 A;  2XXV A;  1HSE A;  2PT2 A;  3MVY A;  5I56 A;  2QMW A;  1ZKB A;  4KR5 A;  3HO7 A;  4QFL A;  1FTK A;  3MZ1 A;  3U94 A;  1MM7 A;  3G3F A;  1B4H A;  2RC7 A;  3HHF A;  3KN7 A;  3PPR A;  2QRY A;  1GVC A;  4DXC A;  5AA4 B;  1SW4 A;  3KEI A;  3VE1 B;  3K6X A;  1GGG A;  3P7I A;  2DVZ A;  1N76 A;  4RK2 A;  4U22 A;  4POX A;  4BDR A;  3QYT A;  2REG A;  1D3K A;  3MP1 A;  4OFJ A;  4YZZ A;  3H06 B;  1O64 A;  5TPA A;  1XVX A;  3UOR A;  3VXB A;  5AA4 A;  5M2V A;  1N84 A;  2QL3 A;  5EHM A;  1ZBM A;  1A54 A;  2RKM A;  4IY6 A;  4H8I A;  1O7T A;  1QJM A;  1SD3 A;  3OO6 A;  1B4Z A;  3EHU A;  3LC8 A;  2DWI A;  4G68 A;  3WAE A;  5H8Q B;  4ZEF A;  2PVU A;  1DPP A;  3I5O A;  4ZE9 A;  1QKB A;  1POT A;  3HHG A;  4LZ5 A;  4RPN A;  4NTL A;  4NE4 A;  3FZV A;  1MQJ A;  3PU5 A;  4HCY A;  4JSO A;  3T9U A;  5CC2 A;  4DDD A;  4OYV A;  1LAF E;  1Y4T A;  3BKI B;  4G68 C;  4H8J A;  5I56 B;  1MXV A;  3OEM A;  1QUJ A;  4YKI A;  4PFY A;  2UXA A;  1IIW A;  1SW5 A;  4IGT A;  2DE3 A;  1FQE A;  4LON B;  3KBR A;  2UVI A;  3MUQ A;  3H6V A;  5F1Q A;  4DLD A;  2O51 A;  3FVN A;  4GFR A;  4LZ8 A;  1P1N A;  2DWA A;  2O7U A;  5BUU A;  4G8M A;  4TQU Q;  4H65 A;  3ODB A;  1B7U A;  4EQB A;  4NWD A;  3VFJ A;  1P1W A;  4OVJ A;  1MH3 A;  5DYH A;  2VP1 A;  4KYE A;  5JTY A;  2A5S A;  3TCG A;  3H6T A;  4H67 A;  3KN8 A;  4ELO A;  4KYD A;  1TFA A;  4EQ9 A;  1CE2 A;  2Q88 A;  3I3V A;  4U1O A;  4LA9 A;  1FQD A;  5BWJ A;  4QF9 A;  1LCF A;  4C0R A;  4U1Z A;  2ZNU A;  1NNT A;  3K0V A;  3CVG A;  3DP4 A;  4WED A;  3RY3 A;  3SEY A;  3TMG A;  3MPL A;  3FXU A;  1Y9U A;  2P0S A;  1QUL A;  4GL0 A;  4PFT A;  5EHS A;  3FJG A;  3R26 A;  4OFL A;  4YKK A;  3KSJ A;  3M3F A;  2HZL A;  3RQT A;  4BDM A;  5I2K B;  4XIG Q;  4H6D A;  3IB0 A;  1DPE A;  4Q30 B;  2X7P A;  3SEU A;  1QUI A;  1Y1Z A;  3IOT A;  3O28 A;  4UAC A;  3T96 B;  4OET A;  2XXP A;  3CSG A;  2VOZ A;  4MBP A;  3W15 C;  5DT6 A;  1P1Q A;  1URG A;  2YLN A;  2E0S A;  3C35 A;  4NF8 A;  4GXA A;  4EXL A;  5FHM A;  4O3C A;  3H6U A;  5TPA B;  3RLF E;  1LFI A;  3UIF A;  1MDQ A;  4F22 A;  3QSL A;  4ZED A;  2DP8 A;  1B46 A;  3OSR A;  3H3G A;  3THI A;  4EF1 A;  2DYX A;  5H8H A;  4QFN A;  2I4B A;  2VGQ A;  1Y1M A;  1JW1 A;  1QW0 A;  2Q2C A;  3O6H A;  4ZEI A;  4F1U A;  2AYS A;  2AIX A;  1I69 A;  1US4 A;  2THI A;  1LGB C;  2R6G E;  1PBQ A;  3CFZ A;  4FIM A;  4NF6 B;  4IO7 A;  4DCX A;  1PEB A;  2UYF A;  2DVC A;  4ND9 A;  4YU0 A;  1UIV A;  3SEW A;  1EZO A;  2F7C A;  4H5G A;  4LAT A;  3M8U A;  3SEX A;  4F2Q A;  1A55 A;  3K6U A;  3VLU A;  3S9L C;  4FED A;  4F18 A;  4X48 A;  3ILU B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...