4IO2A

Crystal structure of the avglur1 ligand binding domain complex with glutamate at 1.37 angstrom resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
242
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor 1
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
molecule tags Membrane protein
total genus 78
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io2A02
4G68C 1RYXA 1IIWA 1JETA 1MH4A 4IO3A 3BFTA 3N6TA 5ITOA 4P11A 4BDLA 3CI8A 2G29A 1Y9UA 1CB6A 1B51A 2XD3A 3L6GA 3CIJA 2XHDA 3G7WA 1PB8A 3LSWA 4H5FA 4R6YA 1MQDA 2F7CA 4XKPA 2H98A 4ELPA 1B7ZA 4Q0CA 3TMGA 4ISUA 4OEVA 4ZEIA 3VFJA 2F6GA 3K02A 4F29A 4NF4B 1NNPA 1MXYA 3GXAA 1NKXA 1VR5A 2UYFA 1R9LA 3V89B 2ALUA 2H4IA 3B6WA 2UVGA 4KCDA 3TQLA 4OFJA 1NNTA 2FA7A 3KBRA 4GOTA 2QMXA 3FIRA 2XX8A 4BDOA 4EQ7A 1VFEA 2DYXA 4TLMB 1S7YA 1A55A 5EYFA 3LC8A 4F1YA 5A5XB 1SD3A 4POXA 1PBPA 5L9MA 1I6BA 2RC9A 4NWDA 1OLAA 1MXUA 2HAVA 5TP9A 2HXWA 3TAJA 1DSNA 4FIMA 3KN8A 4OERA 3KEIA 4R74A 1OQHA 1P1UA 3IO6A 1D9YA 3P7IA 3CSBA 5J1DA 3LBSA 1VFDA 2HCAA 2X7PA 2I4BA 2DS9A 1PB9A 3H6WA 4HS7A 4ZEBA 1I69A 3FJ7A 4ZEKA 3U1OA 3K1NA 4ONYA 4XKQA 2Q8JA 4O3AA 3H6UA 3MP6A 5TPAB 1POY1 1LGBC 1D9VA 2XXVA 5ITPA 2O68A 1MPDA 4F19A 4GLIA 2ZNSA 1MG1A 5FHOA 1JVXA 2DQVA 3H03A 1RKMA 3DM0A 4GIZA 2I48A 1N84A 4PFWA 3VXCA 4H5GA 2LAOA 2OJTA 5CMMA 5I58A 1SYIA 1SBPA 1M5FA 3KZGA 2I49A 5DTBA 3CG3A 2I0CA 2UVIA 4KCCA 4DDDA 1GTKA 5ICQA 1UTBA 1OLCA 1YCJA 1B0HA 1NH8A 3B6TA 1SW4A 3Q27A 4H8JA 1XVYA 3QSLA 1A99A 3IOVA 2GHAA 2ZNUA 3GBBA 4I9DA 2ANJA 3OO9A 4LZ7A 4XKNA 3PPRA 3UORA 5F1QA 1US5A 3RTFB 4LUBA 4IO2A 1PBQA 4JWOA 4PETA 5AA2D 3MZ9A 4UA8A 1A8EA 4OZ9A 2P2AA 1IXCA 2RCBA 2VOZA 1F9BA 4OYVA 3N6UA 4MFIA 4YAHX 4NF6A 2NWJA 2WKYA 1URSA 5H8HB 5H8FA 5AE4A 2XXWA 1QUJA 1MY2A 2Q89A 3S9MC 4YB5A 1A7LA 1GV8A 3PUVE 3UIFA 4P0IA 3R7XA 3FASA 3V5AA 1MPCA 1NMUA 4ESWA 2XX7A 4OESA 3TTRA 1P1OA 3ZSFA 1POTA 2VHAA 4POWA 3UA8A 4ZE8A 1MY0A 3TTLA 1Y4TA 4NF5B 1FQAA 1MXVA 1MY4A 1M5BA 1QVSA 1ZBMA 4KHZE 1IZ1A 1P1WA 3SETA 1B5JA 1B46A 2P1SA 2F34A 2NXOA 2R9JA 2ONSA 2VD3A 4ZZAA 3SDFA 1OQGA 3WAFA 3PMXA 4F18A 5I2NA 4QFPA 4EF2A 3PU5A 1XVXA 4YKKA 4GWOA 3RN8A 3PUYE 4F1VA 3HPIA 3W9WA 3C31A 3G3KA 5AA4B 3IOUA 1FTMA 2Z8DA 3OEMA 1LCFA 2F35A 3KJ7A 4I62A 2V3TA 4P0GA 2AIXA 1NFTA 4ELOA 2O6AA 1Y1ZA 4QHQA 3FATA 4OENA 2O1LA 4BDRA 4JSOA 3PPNA 4G2ZA 3C34A 4R75A 2F5XA 4IO4A 1ZU0A 1YTVA 3A09A 4NF8B 4NEDA 5DVIA 4Z0IA 2THIA 5DEXA 5DVFA 4DXUA 4LVQA 3RT8A 3QXMA 3K6WA 4ECFA 2O7UA 1A40A 3KJTA 5I2KB 3RNNA 1B7HA 3H06B 4OQOA 2RF1A 3ILTB 3TCGA 3TZAA 1B0LA 2OLBA 3KN3A 5EHMA 4OMBA 4YMAA 4G8NA 4MF3A 1FQDA 3F11A 2RINA 2B65A 3O97A 2XXIA 1H43A 1Q35A 4O3CA 4R73A 3IX1A 3Q29A 4LATA 2VGQA 3PD9A 3PPQA 4IO7A 4JSDA 4TQUQ 1WDNA 2VP1A 4L17A 1JW4A 5IKBA 2M8CA 1ZIUA 3PUWE 3E13X 4PE5B 4YICA 4M1VA 2I3VA 3H6TA 4R2BA 1UIVA 5ISUA 2A5TA 2I3WA 3FV1A 1H3DA 3LUYA 3OEKA 4G68A 3SEYA 3FVGA 1GR2A 2Y7WA 1KWHA 1SW2A 3CSGA 1B3HA 3O6IA 1OVBA 3VV5A 2GFEA 2REJA 4TOZA 3UGWA 1JW1A 2F8DA 2D21A 3T96B 3QUJA 2AL4A 2HZLA 4ZDMA 1B7UA 2UYEA 1USYH 4IY5A 2I4CA 1DOTA 3IOWA 3HHFA 4JB7A 1US4A 1B52A 1VSOA 1IITA 1Y3QA 4PP0A 2YLNA 2QL3A 5L9SA 3ILUB 3K1MA 1DTGA 2O84X 3G3FA 4IO5A 4ZECA 2HZKA 3FXUA 1D4NA 4QFOA 2ZNTA 4KQPA 4RPNA 3T9VA 4XKRA 2Z23A 2PT1A 4OETA 4I1DA 1LB9A 3ZS6A 3U72A 4QSEA 2XXYA 5I59A 1B5HA 1B4HA 2QRYA 2HEUA 4OEUA 5H8NA 1QUIA 3H3GA 4MLQA 2CZLA 1SW5A 4Q5TA 3CVGA 1LCTA 4RPOA 1JEUA 1QW0A 2O69A 2XXTA 1BLFA 1ATGA 1N76A 4LQ2A 4DCYA 3T22A 4FECA 4ZE9A 1XT8A 3FGSA 4F22A 2OZZA 2FYIA 3T9UA 3HO7A 4U1OA 1M5CA 2PBWA 3ODBA 1OMPA 3KFMA 4PFYA 1ZKBA 4NTLA 2NVUB 5I57B 1BP5A 4THIA 2DE3A 3RQTA 1NNFA 1URGA 5TP9B 3O6HA 1MQHA 3DLNA 1FQFA 3N5LA 3FXQA 2AYSA 1PC3A 3BBRA 3JYRA 4M4GA 2OCUA 1LAXA 3G3HA 1CE2A 5CRYA 1QKAA 3MQ9A 4KI0E 3MVZA 4KYSA 3OOAA 4QFLA 1H76A 4GL8A 1HSJA 4JXIA 2QJEA 3IORA 2XXRA 3TFLA 5FTIA 3B7DA 3C35A 1MM7A 3FVKA 2F7AA 3KSJA 4XXUA 4IO6A 4YZZA 2RKMA 3PD8A 3EHTA 3N94A 2QS1A 4KD5A 3V83A 1JVYA 2RC8A 3MW0A 4YKIA 4OXVA 1B40A 1B05A 3MZBA 3GLBA 3QIMA 3OELA 2E0SA 4UACA 4YKJA 1TFAA 5AA3A 1USYE 4F1UA 3GZGA 2OWSA 5JTYB 5I58B 4E0XA 3FV2A 3CFLA 3MAMA 4WKMA 1FQCA 5DVJA 3M8UA 2FNCA 1LFHA 1UTBB 1FW0A 3C32A 3E9XA 4RJZA 1PDAA 4QFNA 1SDXA 3RLFE 4KYEA 3HV1A 1M5DA 1Y20A 4NMYA 4WXJA 4DXCA 3IAZA 2OK2A 1FTKA 4F31B 3TTKA 4MH5A 2O1MA 3IL1B 2Q2AA 1UQWA 2I6EA 1EZPA 1B1HA 3MJNA 2RC7A 3TCHA 4F3GA 2NOOA 4KFQA 2IA4A 4LZ5A 1IQ7A 5CMKA 1J1NA 5I56A 3IK6B 3JZJA 3BFUA 1BTJA 3M3FA 4KYDA 4X9TA 3TCFA 3HSTA 1MQJA 4F3BA 4NF6B 5CI5A 1B4ZA 3TYHA 5H8FB 4U1ZA 1DTZA 2OBGA 4FAJA 1LFIA 3IR1A 1BIYA 1I6AA 4R72A 4F2QA 3C36A 2GHBA 3C9HA 3LSXA 4NF5A 4KR5A 4DCXA 3IJXB 1MPBA 3VXBA 3ZKLA 2PMSA 3LSFB 5FTHA 2Q88A 3SEVA 4PQJA 2PVUA 4LZ8A 4GD5A 2F36A 3JV9A 3RY3A 3CRBA 1GVCA 4OFLA 3IOTA 2XXUA 3TDJA 1SI1A 5CMBA 4ZEDA 3K00A 1TT1A 1DMBA 3OSQA 1SVXB 3CG1A 5KDTB 1B32A 2ONKE 5H8SA 4YMBA 2Z22A 1YPNA 3K6XA 4LONB 5AA4A 1FTJA 4JWYA 2D3IA 4WEPA 3MP8A 4ZZEA 3SERA 1AMFA 1MRPA 2R71A 2B3FA 3FVOA 5ICTA 2HFBA 4YB7A 3MBPA 2IEEA 1MDP1 3QYTA 5I2NB 2VD2A 3UK4A 3KOTA 4FATA 3K6VA 4EDPA 1MY3A 1RYOA 3RGYA 1LFGA 2Z8EA 3U94A 3K4UA 4DLDA 1DPEA 3OMBA 4NF8A 1QJMA 1ZTYA 3THIA 3FXRA 4GQOA 5H8QB 1B5IA 4U22A 3LSLA 1O7TA 1AIVA 1ELJA 4ZEFA 3R6UA 3OO7A 5CM6A 2F78A 1UTHB 4F2OA 2Y7IA 3Q26A 1QULA 1EZ9A 2QS3A 4N13A 3TTNA 2D5WA 3L6HA 3T93B 5HPQA 4U2RA 4MBPA 1IUDA 4AQ4A 5AA2A 3PUZE 2H99A 1VE4A 1XHYA 1S9TA 3B6QA 3OSRA 1OIBA 5DEXB 1EH3A 1H45A 2QSXA 2UXAA 2YPNA 2QPQA 3MUQA 2RCAA 3G3JA 3T9HB 2O7IA 4DXBA 4IY6A 2NUVA 4WEDA 1Y4CA 2H25A 3EN3A 1N04A 4DZ1A 3VLWA 3KSXA 4GF8A 4DE8A 1IXIA 2H5YA 3A3CA 1MDQA 3G3IA 4NWCA 1R6ZA 4BDQA 2XXHA 3TEPA 3SEXA 4XIGQ 4YB6A 4EF1A 1II5A 4NE4A 1NNKA 4I8CA 4GXSB 5KCJA 2DVCA 1H44A 4R9GA 4AB5A 2QS2A 4JBZA 4G8MA 2V93A 5B7DA 1SYHA 4FEBA 2I58A 5CC2A 3FZVA 3FD3A 4RY1A 2UVJA 1XC1A 3HCQA 5ELVA 3MC2A 4R9FA 3U8QA 5EHSA 4G68B 1P1NA 3O66A 4C1TA 5CMCA 1WVJA 1T0KA 2Y7RA 4H8IA 2ZYKA 4HCWA 3PUXE 1SQYA 1LAGE 1L5TA 1R1NA 1R9QA 2ESNA 2Z8FA 3TTMA 3U92A 3MZ1A 4IGTA 3TPAA 4NF4A 5LOMA 1Z7NE 1NL5A 4H67A 1A54A 3FJGA 5CBSA 3RT6B 3D4GA 3UN6A 2XXPA 1Y3PA 4LA9A 2OWTA 4C0RA 1Y1MA 3A3UA 5A5XA 4YU0A 2V3UA 3DP4A 1SW1A 4QFKA 3OXNA 4EQ9A 3V8XB 4OTEA 4HCYA 5I84A 5I59B 3RTWB 2V84A 5F7VA 2O51A 2R6GE 3H4ZA 3C33A 1AL3A 3GBAA 2HAUA 1TWYA 3VVFA 1MXZA 5B70A 5H8NB 1N3WA 4DIGA 1AH5A 4BLAA 4R6HA 5I57A 1M5EA 3BKIB 3FVNA 4U21A 2GH9A 3VDFA 1ZMGA 3G3GA 4R2FA 3S9EA 5TU0A 3IB2A 3OO8A 5TPAA 4C1UA 2UVHA 4RXLA 2ZYNA 1NH7A 4H1XA 2GRVA 1PB7A 1JQFA 2QS4A 2ZMBA 4OFOA 4EXKA 1IXHA 3KGCA 5FHNA 3VVDA 1XS5A 2A5SA 2I0BA 3Q28A 3H6VA 3I6VA 2DP8A 3RUMA 2Q2CA 4GVOA 3PMVA 3SESA 2X26A 5HM4B 4F3PA 3PGFA 3HHGA 3VLUA 4KPTA 2Y7PA 4U4SA 4RK2A 2E1SA 2Y84A 1P99A 1TFDA 3D4CA 4XTCQ 2CMOA 3CFXA 3E3KA 1B3LA 1D3KA 4X48A 5AA1A 1JEVA 4QF9A 3IB0A 3IO4A 3MPLA 3C4MA 1ZJLA 3MVXA 5M2VA 4RYAA 3R26A 4GXAA 5JTYA 4GRKA 4N6PA 1B3FA 3VLVA 3SKPA 3VE1B 1FTOA 3OO6A 3K0VA 2DWIA 3SEUA 3WAEA 4PFTA 1MY1A 4Q30B 1LLSA 5L9OA 3UP9A 3TODA 4E0WA 1IEJA 4FE8A 4U23A 2DWJA 2AL5A 1HSLA 3ONMA 1HSEA 3Q25A 1MS7A 3O6GA 2DOJA 4X1BA 2ZYMA 4MLVA 4EUOA 2DE2A 2YJPA 2DVZA 3KOSA 3KG2A 2PX1A 3N26A 2DXRA 3ZKKA 3DP6A 4QRZA 4F39A 1AOVA 3AXFA 3MP1A 4ESXA 1N0TA 4GFRA 2F6PA 5H8HA 2XXXA 1MXWA 4RA1A 1O64A 3PPPA 1GGGA 2ZYOA 1SI0A 4LP2B 1I6QA 4H0WA 4ZS9A 1S50A 5K2YA 4YKPA 3I3VA 5K2XA 3EPEA 5IAIA 2V25A 1MXXA 3SEWA 5CBRA 3S4UA 3TKDA 3PPOA 3PMWA 3H7MA 1OVTA 1YAEA 3QK6A 3MVWA 2P0SA 3K2DA 1B9JA 5I56B 4BDNA 3E4RA 5BWJA 1PEBA 1FCKA 2Q9TA 4FORA 2PT2A 4OVJA 2XXQA 3DP8A 4BDMA 2X7QA 3EHSA 1WODA 5FHMA 5JK4A 3IJOB 1ZLQA 5KZTA 4U4XA 4FJPA 2V3QA 1QKBA 5KDTA 2G93A 1BKAA 5DT6A 2DSFA 4ELQA 3QAXA 1MM6A 1EU8A 3W15C 4FEDA 1B2HA 3K01A 3EHUA 5JEIA 1P1QA 2W7YA 1LBBA 4OWDA 1N3XA 2XX9A 3PV0E 3K6UA 3S9LC 2QMWA 1MH3A 1XOCA 4N07A 3QUFA 4ND9A 3T9XB 1DPPA 4X1DA 4HW8A 3O2AA 4IB2A 1B58A 2BJJX 3T66A 2KLFA 1N7XA 3OD7A 1EZOA 4EQBA 1LSTA 4EXLA 5H8QA 1QUKA 4JWXA 3RPWA 1FQBA 2ONRA 3TUSA 1FQEA 3TELA 1ANFA 1UTHA 3OENA 3MVYA 4GL0A 4QSCA 3W9VA 1A8FA 1JW5A 5I2KA 4JDFA 1Z7ME 4AB6A 1MQIA 4PFUA 2ZXTA 1B6HA 4RK9A 2H9BA 3USDA 2ABHA 1N7WA 3M3KA 1IXGA 1URDA 2PYYA 2DXYA 3O28A 1Q1KA 4HTGA 2XD2A 1LBCA 4TLLB 3IB1A 2B3BA 4ELRA 1TXFA 3EF7A 3ECRA 3TQWA 1UIUA 4G8HA 4LQ5A 3LR1A 4H6DA 4RNSA 3VVEA 5AA2B 1MQGA 3K1PA 3EQ1A 4F3SA 1B1XA 1LAFE 4K3FA 2REGA 3FUZA 3HN0A 3O29A 3MPKA 4Q8RA 4H65A 3CFZA 2DWAA 4R6KA 1LAHE 1O63A 1LB8A 3S2VA 4IGRA 5HBCA 1Y3NA 5DYHA 5BUUA 4G77A 4OHNA 2F7BA 4QSDA 1B3EA 2DE4A 1JNFA 4Z7EA 5L8DA 2F97A 3O9PA 3DELB 3KN7A 2HQ0A 2A5TB 3I5OA 5KCJB 2DWHA 3FJMA 2Y7KA 3S9NC 4O3BA 1B3GA 1FTLA 3M3LA 3MWBA 3CR9A 3U93A 4G4PA
chains in the Genus database with same CATH superfamily
4G68C 1FJ9A 1RYXA 4XEQA 1IIWA 1JETA 1NV1A 1QGXA 1MH4A 4IO3A 3BFTA 3N6TA 5ITOA 4P11A 4BDLA 3CI8A 2G29A 1Y9UA 1CB6A 1B51A 2XD3A 3L6GA 1K9YA 3CIJA 2XHDA 3G7WA 1PB8A 3LSWA 2WBBA 4H5FA 4R6YA 1MQDA 2F7CA 4XKPA 2H98A 4ELPA 1B7ZA 4Q0CA 3TMGA 2L5VA 4ISUA 2KQZA 4OEVA 4ZEIA 3VFJA 2F6GA 3K02A 4F29A 1LEVA 4NF4B 1NNPA 1MXYA 4MCOA 3GXAA 1NKXA 1VR5A 2UYFA 1R9LA 4NQ8A 3V89B 2ALUA 2H4IA 3B6WA 2UVGA 4KCDA 1FTAA 3TQLA 4OFJA 1NNTA 1AWBA 2FA7A 3KBRA 4GOTA 2GQ1A 2QMXA 3FIRA 2XX8A 4BDOA 4EQ7A 1VFEA 2JJKA 2DYXA 2CEXA 4TLMB 1S7YA 1FPJA 1A55A 5EYFA 3LC8A 4F1YA 4NF0A 5A5XB 1SD3A 2XA5A 1LBZA 4POXA 1PBPA 1NV7A 5L9MA 2F3BA 1I6BA 2RC9A 4NWDA 4MAGA 1OLAA 1MXUA 2HAVA 5TP9A 2HXWA 3TAJA 1DSNA 4FIMA 3KN8A 4OERA 5DW8A 1FJ6A 5EYHA 3KEIA 4NG7A 4R74A 1OQHA 1P1UA 3IO6A 1D9YA 3P7IA 3CSBA 5J1DA 3LBSA 1VFDA 2HCAA 2X7PA 2I4BA 2DS9A 1PB9A 3H6WA 4HS7A 4GWZA 4ZEBA 4PF6A 1I69A 3FJ7A 4ZEKA 3U1OA 3K1NA 4ONYA 4XKQA 2Q8JA 4O3AA 3H6UA 4DI4B 3MP6A 5TPAB 1POY1 1DBZA 1LGBC 4FBPA 1D9VA 4NHBA 2XXVA 5ITPA 2O68A 1MPDA 4F19A 4GLIA 2ZNSA 4JVCA 1MG1A 5FHOA 3U65A 4OVSA 1JVXA 4HE1A 1D9QA 2DQVA 3H03A 1RKMA 3DM0A 4GIZA 1DCUA 2I48A 1FPBA 4PFWA 1N84A 3VXCA 2F3DA 4H5GA 2LAOA 2OJTA 5CMMA 5I58A 3KC0A 1SYIA 4P1LA 1SBPA 1M5FA 3KZGA 1FBEA 2I49A 5DTBA 3PTYA 3CG3A 2I0CA 2UVIA 4KCCA 4DDDA 1GTKA 4XF5A 5ICQA 1UTBA 1OLCA 2HHMA 1YCJA 1B0HA 1NH8A 3B6TA 1SW4A 3Q27A 4H8JA 1XVYA 3QSLA 3BIGA 1A99A 3IOVA 1NV3A 2GHAA 2FBPA 2ZNUA 3GBBA 4NN3A 4I9DA 2ANJA 3OO9A 4LZ7A 4GBWA 4XKNA 3PPRA 5EQ9A 1FPEA 3UORA 5F1QA 1US5A 3RTFB 5A5LA 4N4UA 4LUBA 4IO2A 1Q9DA 1PBQA 4JWOA 4PETA 5AA2D 3MZ9A 4P47A 4UA8A 1A8EA 4OZ9A 2P2AA 1IXCA 2RCBA 2VOZA 1F9BA 3KC1A 4OYVA 3N6UA 4MFIA 2CZKA 4YAHX 4NF6A 2NWJA 2WKYA 1URSA 5H8HB 5H8FA 1FPFA 5AE4A 2XXWA 1NI9A 1QUJA 1MY2A 2Q89A 3S9MC 4YB5A 2XWIA 4X8RA 1A7LA 1GV8A 3PUVE 3UIFA 4P0IA 3R7XA 3FASA 3V5AA 4O7MA 1MPCA 1NMUA 4ESWA 2XX7A 4OESA 3TTRA 3E79A 1P1OA 3ZSFA 1KA0A 1POTA 2VHAA 4PC9A 4POWA 3UA8A 4ZE8A 4PF8A 1MY0A 3TTLA 4GWYA 1Y4TA 4GWWA 4NF5B 1FQAA 1MXVA 1MY4A 1M5BA 1SPIA 1QVSA 1ZBMA 4KHZE 1IZ1A 1P1WA 3SETA 1B5JA 1B46A 2P1SA 2F34A 2DDKA 2NXOA 2R9JA 2ONSA 2VD3A 4ZZAA 3SDFA 1OQGA 3WAFA 3PMXA 4F18A 5I2NA 5T3JA 4QFPA 4O7IA 4EF2A 3PU5A 1XVXA 1NV2A 4YKKA 4GWOA 3RN8A 3PUYE 4F1VA 3HPIA 3W9WA 3C31A 3G3KA 5AA4B 3IOUA 1FTMA 2Z8DA 3OEMA 1LCFA 2F35A 3KJ7A 4I62A 2V3TA 4P0GA 2AIXA 1NFTA 4I3EA 4ELOA 2O6AA 1Y1ZA 4QHQA 3FATA 4OENA 2O1LA 4BDRA 4JSOA 3PPNA 4G2ZA 3C34A 2OX3A 4R75A 2F5XA 4IO4A 1ZU0A 1YTVA 3A09A 4NF8B 4NEDA 5DVIA 4Z0IA 2THIA 1JP4A 4MMPA 5DEXA 5DVFA 4DXUA 4LVQA 3RT8A 3QXMA 1EYKA 3K6WA 4ECFA 2O7UA 1A40A 3KJTA 5I2KB 3RNNA 1LBVA 1B7HA 5IZ3A 3H06B 4OQOA 2RF1A 3ILTB 3TCGA 3TZAA 4PBQA 1B0LA 2OLBA 3KN3A 5EHMA 4OMBA 4YMAA 4G8NA 4MF3A 1FQDA 3F11A 4MNCA 5F24A 2RINA 2B65A 3O97A 2XXIA 1H43A 1Q35A 5ET6A 4O3CA 4R73A 3IX1A 3Q29A 3ROJA 4LATA 2VGQA 3PD9A 1NUYA 3PPQA 4IO7A 4JSDA 2CZIA 4TQUQ 1WDNA 2VP1A 4L17A 1FBHA 1JW4A 5IKBA 2M8CA 1ZIUA 3PUWE 3E13X 4PE5B 4YICA 4M1VA 2I3VA 3H6TA 4R2BA 1UIVA 5ISUA 3MSTA 2A5TA 2FVZA 2I3WA 5EQ7A 5LDZA 3FV1A 1H3DA 3LUYA 3OEKA 4G68A 1BK4A 3SEYA 3FVGA 1GR2A 2Y7WA 1FPDA 1KWHA 1SW2A 3CSGA 1B3HA 3O6IA 1OVBA 3VV5A 2GFEA 2REJA 4TOZA 3UGWA 1JW1A 2F8DA 2D21A 3T96B 3QUJA 2AL4A 2HZLA 1FPIA 4ZDMA 1B7UA 2UYEA 1USYH 4IY5A 2I4CA 1DOTA 3IOWA 3HHFA 4JB7A 1US4A 1B52A 1VSOA 1IITA 1Y3QA 4PP0A 1KZ8A 4PFBA 2YLNA 2QL3A 5L9SA 3ILUB 3D1RA 3K1MA 1DTGA 2O84X 3G3FA 4IO5A 4ZECA 2HZKA 3FXUA 1D4NA 4QFOA 2ZNTA 4I40A 4KQPA 4RPNA 3T9VA 4XKRA 4PTKA 2Z23A 2PT1A 4OETA 4I1DA 1LB9A 3ZS6A 4JVDA 3U72A 4QSEA 2XXYA 5I59A 1B5HA 2HXRA 1B4HA 2QRYA 2HEUA 4OEUA 5H8NA 1QUIA 3H3GA 4MLQA 2CZLA 1SW5A 4Q5TA 3CVGA 1LCTA 4RPOA 1JEUA 1QW0A 2O69A 2XXTA 3RPLB 1BLFA 1ATGA 4P56A 1N76A 4LQ2A 4DCYA 3T22A 4FECA 1RDXA 4ZE9A 1XT8A 3FGSA 4F22A 2OZZA 2FYIA 4MEVA 5FBPA 3T9UA 3HO7A 4U1OA 1M5CA 2PBWA 3ODBA 1OMPA 3KFMA 1FBCA 1ZKBA 4PFYA 3KBZA 4NTLA 2NVUB 5I57B 1BP5A 4THIA 2DE3A 3RQTA 1NNFA 1URGA 5TP9B 3O6HA 1MQHA 1FBFA 3DLNA 1FQFA 3N5LA 3FXQA 2AYSA 1PC3A 2BJIA 3BBRA 3JYRA 4M4GA 4PAIA 2OCUA 1LAXA 3G3HA 1CE2A 5CRYA 5ET7A 1QKAA 3MQ9A 4KI0E 3MVZA 4KYSA 3OOAA 4QFLA 1H76A 4GL8A 1HSJA 4JXIA 2QJEA 1IMEA 3IORA 2XXRA 3TFLA 4P9KA 5FTIA 3B7DA 3C35A 1MM7A 3FVKA 4GWUA 3BIHA 2F7AA 3KSJA 4XXUA 1XI6A 4IO6A 4YZZA 4PGPA 2RKMA 3PD8A 3EHTA 3N94A 2QS1A 4KD5A 3V83A 1JVYA 2RC8A 3MW0A 4YKIA 4OXVA 1B40A 1B05A 3MZBA 3GLBA 1G0HA 3LV0A 3QIMA 1EYIA 3OELA 2E0SA 1FBDA 4UACA 4YKJA 1TFAA 2Y5KA 2WYKA 5AA3A 3E78A 1USYE 4F1UA 3GZGA 2OWSA 5JTYB 5I58B 4E0XA 1IMBA 3FV2A 3CFLA 3EKIA 3MAMA 4WKMA 1FQCA 5DVJA 3M8UA 2FNCA 1LFHA 1UTBB 1FW0A 3C32A 3E9XA 4RJZA 1PDAA 4QFNA 1SDXA 3RLFE 3HFUA 4KYEA 3HV1A 1M5DA 1Y20A 4NMYA 4WXJA 4DXCA 2VPNA 3IAZA 2OK2A 3SZPA 1FTKA 2MKZA 4F31B 3TTKA 3MYUA 4MH5A 1IMFA 2O1MA 3IL1B 2Q2AA 1UQWA 2I6EA 1EZPA 1B1HA 3MJNA 4NX1A 2FHYA 2RC7A 3TCHA 4F3GA 2NOOA 4KFQA 4PGNA 2IA4A 4LZ5A 1IQ7A 5CMKA 1J1NA 5I56A 3IK6B 3JZJA 2VT5A 3BFUA 1BTJA 3M3FA 2PFZA 4KYDA 4X9TA 3TCFA 3HSTA 1MQJA 4F3BA 4PCDA 1RDZA 4O8MA 4NF6B 5CI5A 1B4ZA 4QBAA 3TYHA 5H8FB 4U1ZA 2KR0A 1DTZA 2OBGA 4PDDA 4FAJA 1LFIA 3IR1A 1BIYA 5EYGA 1I6AA 5ET5A 4R72A 4F2QA 4I3YA 3C36A 2GHBA 3C9HA 3LSXA 4NF5A 4KR5A 4DCXA 3IJXB 1MPBA 3VXBA 3ZKLA 2PMSA 3LSFB 5FTHA 2Q88A 3SEVA 5J16A 4PQJA 2PVUA 4LZ8A 4MNPA 4GD5A 2F36A 3JV9A 3RY3A 3CRBA 4PFRA 1GVCA 4OFLA 3IOTA 2XXUA 3TDJA 1SI1A 5CMBA 3CHGA 4GBVA 4ZEDA 3K00A 1TT1A 1DMBA 3OSQA 2Q8MA 1SVXB 3CG1A 5KDTB 1B32A 2ONKE 5H8SA 4YMBA 2Z22A 1YPNA 3K6XA 5EQAA 4LONB 5AA4A 1FTJA 4DI3D 2WYPA 4JWYA 4HE0A 2D3IA 5I7IA 2QVUA 4KXPA 3MP8A 4MJOA 4WEPA 4N17A 4ZZEA 3SERA 1AMFA 1LBXA 1MRPA 2R71A 2B3FA 3FVOA 3IFAA 5ICTA 4GWXA 2HFBA 4YB7A 3MBPA 4P3LA 2IEEA 1MDP1 3QYTA 5I2NB 2VD2A 3UK4A 3KOTA 4FATA 3K6VA 4EDPA 1MY3A 1IMDA 1RYOA 3RGYA 1LFGA 2Z8EA 3U94A 3K4UA 4DLDA 1DPEA 3OMBA 4NF8A 1QJMA 1ZTYA 3THIA 3FXRA 4GQOA 5H8QB 1B5IA 2OWZA 4U22A 3LSLA 1O7TA 2FIXA 1AIVA 1ELJA 4ZEFA 3R6UA 3OO7A 3QMFA 4G61A 5CM6A 2QVRA 2F78A 1UTHB 4F2OA 4H46A 2Y7IA 3Q26A 1QULA 1EZ9A 2QS3A 4N13A 3TTNA 2D5WA 3L6HA 1NUZA 1VDWA 3T93B 5HPQA 4U2RA 4MBPA 1IUDA 4AQ4A 5AA2A 3PUZE 2H99A 1VE4A 1XHYA 1S9TA 3B6QA 3OSRA 1OIBA 5DEXB 1EH3A 1H45A 2QSXA 2UXAA 2YPNA 2QPQA 3MUQA 2RCAA 3G3JA 1NV6A 3T9HB 2O7IA 4HXVA 4IY6A 2NUVA 4DXBA 4WEDA 1Y4CA 4MNIA 2H25A 3EN3A 2P3VA 1N04A 4DZ1A 3VLWA 3KSXA 4GF8A 4DE8A 1IXIA 2H5YA 3A3CA 1MDQA 3G3IA 4GX6A 2V4CA 4NWCA 1R6ZA 2XXKA 4BDQA 2XXHA 3TEPA 4OA4A 3SEXA 4XIGQ 4YB6A 5EQ8A 4EF1A 1II5A 4NE4A 1NNKA 4I8CA 4GXSB 5KCJA 2DVCA 1H44A 4R9GA 4AB5A 2QS2A 4JBZA 3FXBA 4G8MA 2V93A 5B7DA 4O94A 1SYHA 4FEBA 2I58A 5CC2A 2P3NA 3FZVA 3FD3A 4RY1A 2UVJA 1XC1A 3HCQA 2R8TA 5ELVA 3MC2A 4R9FA 3U8QA 4N6DA 5EHSA 2B4MA 3IFCA 4G68B 1P1NA 3O66A 4C1TA 5CMCA 1WVJA 1T0KA 2Y7RA 4H8IA 4JVIA 2ZYKA 4HCWA 3PUXE 1SQYA 4X04A 1LAGE 1L5TA 1R1NA 1FBGA 1R9QA 2ESNA 2Z8FA 3TTMA 3U92A 3MZ1A 4GX4A 2ZZXA 4IGTA 4AS4A 3TPAA 4NF4A 4MIJA 4UABA 5LOMA 1NL5A 1Z7NE 4OVTA 4H67A 1A54A 2CZHA 3A29A 3FJGA 5CBSA 3RT6B 3D4GA 1IMAA 3UN6A 4PBHA 2XXPA 1Y3PA 4LA9A 2OWTA 4C0RA 1Y1MA 2QVVA 3A3UA 3RPLA 5A5XA 4YU0A 2V3UA 3DP4A 1SW1A 4QFKA 3OXNA 4EQ9A 3V8XB 4OTEA 1FSAA 4HCYA 5I5PA 5I84A 5I59B 3RTWB 2V84A 2XWOA 5F7VA 2O51A 2R6GE 3H4ZA 3C33A 1AL3A 3GBAA 1KA1A 2HAUA 1TWYA 3VVFA 1MXZA 5B70A 5H8NB 1N3WA 2Y5LA 4DIGA 1AH5A 1LBYA 4BLAA 4R6HA 5I57A 1YXIA 1M5EA 3BKIB 3FVNA 4U21A 2GH9A 3VDFA 1ZMGA 3G3GA 4XFEA 4R2FA 3S9EA 5TU0A 3IB2A 4PE3A 1DK4A 3OO8A 4OVQA 5TPAA 4C1UA 2UVHA 4IR8A 4RXLA 2ZYNA 1NH7A 4H1XA 2GRVA 3GYYA 1PB7A 1JQFA 2QS4A 2ZMBA 4OFOA 4EXKA 1IXHA 2ZZWA 3KGCA 5FHNA 3VVDA 1XS5A 2PFYA 4H45A 1K9ZA 2A5SA 2I0BA 4N91A 1YYZA 3Q28A 3H6VA 3I6VA 2DP8A 2QFLA 3LUZA 2WBDA 3RUMA 2Q2CA 4GVOA 3PMVA 3SESA 2X26A 5HM4B 4F3PA 3PGFA 1NUWA 3HHGA 3VLUA 4KPTA 2Y7PA 4U4SA 4RK2A 2E1SA 2Y84A 1P99A 1TFDA 3D4CA 4XTCQ 1FRPA 2CMOA 3RYDA 3CFXA 3E3KA 1NUXA 1B3LA 1D3KA 4PAKA 4X48A 5AA1A 1JEVA 4QF9A 3IB0A 3IO4A 3MPLA 3C4MA 1ZJLA 3MVXA 5M2VA 4RYAA 3R26A 4N81A 4GXAA 2WX9A 5JTYA 4GRKA 4N6PA 1B3FA 3VLVA 3SKPA 3VE1B 1FTOA 2ZZVA 1INPA 3OO6A 3K0VA 2DWIA 3SEUA 3WAEA 4PFTA 1MY1A 4MHFA 4Q30B 4GX3A 1LLSA 5L9OA 3UP9A 3TODA 4E0WA 1IEJA 4FE8A 4U23A 2DWJA 2AL5A 1HSLA 3ONMA 1HSEA 3Q25A 1MS7A 1IMCA 3O6GA 2DOJA 4X1BA 2ZYMA 4MLVA 4EUOA 2DE2A 2YJPA 2DVZA 3KOSA 3KG2A 2PX1A 3N26A 2DXRA 3ZKKA 3DP6A 2PCRA 4QRZA 4F39A 1AOVA 3AXFA 3MP1A 4ESXA 1N0TA 4GWSA 4GFRA 2F6PA 5H8HA 2XXXA 1MXWA 4RA1A 4NGUA 1FBPA 1O64A 3PPPA 1GGGA 2ZYOA 1SI0A 5IM2A 4AS5A 4LP2B 1I6QA 4H0WA 4N6KA 4ZS9A 1S50A 5K2YA 4YKPA 3I3VA 2FIEA 5K2XA 3EPEA 5IAIA 2V25A 1MXXA 3SEWA 5CBRA 3S4UA 2Q74A 3TKDA 3PPOA 3PMWA 1LBWA 3H7MA 4MX6A 1OVTA 1YAEA 3QK6A 3MVWA 5LTCA 2P0SA 3K2DA 1B9JA 5I56B 4BDNA 3E4RA 1YZ0A 4HE2A 5BWJA 1PEBA 1FCKA 2Q9TA 4OVRA 4FORA 2PT2A 4OVJA 4PAFA 2XXQA 3DP8A 4BDMA 2X7QA 3EHSA 5IGAA 3T1BA 2B4LA 5IZ1A 1WODA 5FHMA 5JK4A 3IJOB 1ZLQA 1NV5A 5KZTA 4U4XA 4FJPA 2V3QA 1QKBA 5KDTA 2G93A 1BKAA 5DT6A 2DSFA 3NOHA 4ELQA 3QAXA 1MM6A 1EU8A 3W15C 1FPLA 4FEDA 1B2HA 3K01A 3EHUA 5JEIA 2WEFA 1P1QA 2W7YA 5ESYA 1LBBA 4OWDA 1N3XA 2XX9A 4P8BA 3PV0E 3K6UA 3S9LC 2QMWA 1MH3A 1XOCA 2CEYA 4N07A 3QUFA 4ND9A 3T9XB 1DPPA 4X1DA 4N8GA 1NV0A 4HW8A 4PFIA 3O2AA 4IB2A 1B58A 2BJJX 3T66A 2KLFA 1N7XA 3OD7A 1EZOA 4EQBA 4N15A 1LSTA 4EXLA 5H8QA 1QUKA 4JWXA 3RPWA 1CNQA 1G0IA 4OVPA 1FQBA 2ONRA 4N8YA 3TUSA 1FQEA 4NAPA 3TELA 1ANFA 1UTHA 3OENA 3MVYA 4GL0A 4QSCA 4QXDA 3T0JA 3W9VA 1A8FA 5ET8A 1JW5A 5I2KA 4JDFA 1Z7ME 4AB6A 5I3SA 1EYJA 3FBPA 1MQIA 4PFUA 2ZXTA 1B6HA 1FPGA 4RK9A 2H9BA 3USDA 2ABHA 1N7WA 2VPOA 3M3KA 1IXGA 1URDA 3B8BA 2PYYA 2DXYA 3O28A 1Q1KA 4HTGA 2XD2A 1LBCA 4TLLB 1RDYA 3IB1A 2B3BA 4ELRA 1TXFA 3EF7A 3ECRA 3TQWA 1UIUA 4G8HA 3ISPA 4LQ5A 3LR1A 4H6DA 3B50A 4RNSA 3VVEA 5AA2B 5IZ3B 1MQGA 3K1PA 3EQ1A 4F3SA 1B1XA 1LAFE 5IZZA 4K3FA 2XWVA 2REGA 3FUZA 3HN0A 3O29A 3MPKA 4Q8RA 4H65A 3CFZA 2DWAA 4R6KA 1LAHE 1O63A 1LB8A 3S2VA 1FPKA 4IGRA 5HBCA 1Y3NA 5DYHA 5BUUA 4G77A 4OHNA 2F7BA 2HPGA 4QSDA 1B3EA 2DE4A 1JNFA 4Z7EA 4PDHA 5L8DA 2F97A 3O9PA 3DELB 3KN7A 2HQ0A 2XWKA 2A5TB 3I5OA 5KCJB 2DWHA 3FJMA 2Y7KA 4LN5A 1NV4A 3S9NC 4OANA 4O3BA 1B3GA 1FTLA 3M3LA 3MWBA 3CR9A 4P1EA 3U93A 4G4PA
chains in the Genus database with same CATH topology
4G68C 1RYXA 1IIWA 1JETA 1MH4A 4IO3A 3BFTA 3N6TA 5ITOA 4P11A 4BDLA 3CI8A 2G29A 1Y9UA 1CB6A 1B51A 2XD3A 3L6GA 3CIJA 2XHDA 3G7WA 1PB8A 3LSWA 4H5FA 4R6YA 1MQDA 2F7CA 4XKPA 2H98A 4ELPA 1B7ZA 4Q0CA 3TMGA 4ISUA 4OEVA 4ZEIA 3VFJA 2F6GA 3K02A 4F29A 4NF4B 1NNPA 1MXYA 3GXAA 1NKXA 1VR5A 2UYFA 1R9LA 3V89B 2ALUA 2H4IA 3B6WA 2UVGA 4KCDA 3TQLA 4OFJA 1NNTA 2FA7A 3KBRA 4GOTA 2QMXA 3FIRA 2XX8A 4BDOA 4EQ7A 1VFEA 2DYXA 4TLMB 1S7YA 1A55A 5EYFA 3LC8A 4F1YA 5A5XB 1SD3A 4POXA 1PBPA 5L9MA 1I6BA 2RC9A 4NWDA 1OLAA 1MXUA 2HAVA 5TP9A 2HXWA 3TAJA 1DSNA 4FIMA 3KN8A 4OERA 3KEIA 4R74A 1OQHA 1P1UA 3IO6A 1D9YA 3P7IA 3CSBA 5J1DA 3LBSA 1VFDA 2HCAA 2X7PA 2I4BA 2DS9A 1PB9A 3H6WA 4HS7A 4ZEBA 1I69A 3FJ7A 4ZEKA 3U1OA 3K1NA 4ONYA 4XKQA 2Q8JA 4O3AA 3H6UA 3MP6A 5TPAB 1POY1 1LGBC 1D9VA 2XXVA 5ITPA 2O68A 1MPDA 4F19A 4GLIA 2ZNSA 1MG1A 5FHOA 1JVXA 2DQVA 3H03A 1RKMA 3DM0A 4GIZA 2I48A 1N84A 4PFWA 3VXCA 4H5GA 2LAOA 2OJTA 5CMMA 5I58A 1SYIA 1SBPA 1M5FA 3KZGA 2I49A 5DTBA 3CG3A 2I0CA 2UVIA 4KCCA 4DDDA 1GTKA 5ICQA 1UTBA 1OLCA 1YCJA 1B0HA 1NH8A 3B6TA 1SW4A 3Q27A 4H8JA 1XVYA 3QSLA 1A99A 3IOVA 2GHAA 2ZNUA 3GBBA 4I9DA 2ANJA 3OO9A 4LZ7A 4XKNA 3PPRA 3UORA 5F1QA 1US5A 3RTFB 4LUBA 4IO2A 1PBQA 4JWOA 4PETA 5AA2D 3MZ9A 4UA8A 1A8EA 4OZ9A 2P2AA 1IXCA 2RCBA 2VOZA 1F9BA 4OYVA 3N6UA 4MFIA 4YAHX 4NF6A 2NWJA 2WKYA 1URSA 5H8HB 5H8FA 5AE4A 2XXWA 1QUJA 1MY2A 2Q89A 3S9MC 4YB5A 1A7LA 1GV8A 3PUVE 3UIFA 4P0IA 3R7XA 3FASA 3V5AA 1MPCA 1NMUA 4ESWA 2XX7A 4OESA 3TTRA 1P1OA 3ZSFA 1POTA 2VHAA 4POWA 3UA8A 4ZE8A 1MY0A 3TTLA 1Y4TA 4NF5B 1FQAA 1MXVA 1MY4A 1M5BA 1QVSA 1ZBMA 4KHZE 1IZ1A 1P1WA 3SETA 1B5JA 1B46A 2P1SA 2F34A 2NXOA 2R9JA 2ONSA 2VD3A 4ZZAA 3SDFA 1OQGA 3WAFA 3PMXA 4F18A 5I2NA 4QFPA 4EF2A 3PU5A 1XVXA 4YKKA 4GWOA 3RN8A 3PUYE 4F1VA 3HPIA 3W9WA 3C31A 3G3KA 5AA4B 3IOUA 1FTMA 2Z8DA 3OEMA 1LCFA 2F35A 3KJ7A 4I62A 2V3TA 4P0GA 2AIXA 1NFTA 4ELOA 2O6AA 1Y1ZA 4QHQA 3FATA 4OENA 2O1LA 4BDRA 4JSOA 3PPNA 4G2ZA 3C34A 4R75A 2F5XA 4IO4A 1ZU0A 1YTVA 3A09A 4NF8B 4NEDA 5DVIA 4Z0IA 2THIA 5DEXA 5DVFA 4DXUA 4LVQA 3RT8A 3QXMA 3K6WA 4ECFA 2O7UA 1A40A 3KJTA 5I2KB 3RNNA 1B7HA 3H06B 4OQOA 2RF1A 3ILTB 3TCGA 3TZAA 1B0LA 2OLBA 3KN3A 5EHMA 4OMBA 4YMAA 4G8NA 4MF3A 1FQDA 3F11A 2RINA 2B65A 3O97A 2XXIA 1H43A 1Q35A 4O3CA 4R73A 3IX1A 3Q29A 4LATA 2VGQA 3PD9A 3PPQA 4IO7A 4JSDA 4TQUQ 1WDNA 2VP1A 4L17A 1JW4A 5IKBA 2M8CA 1ZIUA 3PUWE 3E13X 4PE5B 4YICA 4M1VA 2I3VA 3H6TA 4R2BA 1UIVA 5ISUA 2A5TA 2I3WA 3FV1A 1H3DA 3LUYA 3OEKA 4G68A 3SEYA 3FVGA 1GR2A 2Y7WA 1KWHA 1SW2A 3CSGA 1B3HA 3O6IA 1OVBA 3VV5A 2GFEA 2REJA 4TOZA 3UGWA 1JW1A 2F8DA 2D21A 3T96B 3QUJA 2AL4A 2HZLA 4ZDMA 1B7UA 2UYEA 1USYH 4IY5A 2I4CA 1DOTA 3IOWA 3HHFA 4JB7A 1US4A 1B52A 1VSOA 1IITA 1Y3QA 4PP0A 2YLNA 2QL3A 5L9SA 3ILUB 3K1MA 1DTGA 2O84X 3G3FA 4IO5A 4ZECA 2HZKA 3FXUA 1D4NA 4QFOA 2ZNTA 4KQPA 4RPNA 3T9VA 4XKRA 2Z23A 2PT1A 4OETA 4I1DA 1LB9A 3ZS6A 3U72A 4QSEA 2XXYA 5I59A 1B5HA 1B4HA 2QRYA 2HEUA 4OEUA 5H8NA 1QUIA 3H3GA 4MLQA 2CZLA 1SW5A 4Q5TA 3CVGA 1LCTA 4RPOA 1JEUA 1QW0A 2O69A 2XXTA 1BLFA 1ATGA 1N76A 4LQ2A 4DCYA 3T22A 4FECA 4ZE9A 1XT8A 3FGSA 4F22A 2OZZA 2FYIA 3T9UA 3HO7A 4U1OA 1M5CA 2PBWA 3ODBA 1OMPA 3KFMA 4PFYA 1ZKBA 4NTLA 2NVUB 5I57B 1BP5A 4THIA 2DE3A 3RQTA 1NNFA 1URGA 5TP9B 3O6HA 1MQHA 3DLNA 1FQFA 3N5LA 3FXQA 2AYSA 1PC3A 3BBRA 3JYRA 4M4GA 2OCUA 1LAXA 3G3HA 1CE2A 5CRYA 1QKAA 3MQ9A 4KI0E 3MVZA 4KYSA 3OOAA 4QFLA 1H76A 4GL8A 1HSJA 4JXIA 2QJEA 3IORA 2XXRA 3TFLA 5FTIA 3B7DA 3C35A 1MM7A 3FVKA 2F7AA 3KSJA 4XXUA 4IO6A 4YZZA 2RKMA 3PD8A 3EHTA 3N94A 2QS1A 4KD5A 3V83A 1JVYA 2RC8A 3MW0A 4YKIA 4OXVA 1B40A 1B05A 3MZBA 3GLBA 3QIMA 3OELA 2E0SA 4UACA 4YKJA 1TFAA 5AA3A 1USYE 4F1UA 3GZGA 2OWSA 5JTYB 5I58B 4E0XA 3FV2A 3CFLA 3MAMA 4WKMA 1FQCA 5DVJA 3M8UA 2FNCA 1LFHA 1UTBB 1FW0A 3C32A 3E9XA 4RJZA 1PDAA 4QFNA 1SDXA 3RLFE 4KYEA 3HV1A 1M5DA 1Y20A 4NMYA 4WXJA 4DXCA 3IAZA 2OK2A 1FTKA 4F31B 3TTKA 4MH5A 2O1MA 3IL1B 2Q2AA 1UQWA 2I6EA 1EZPA 1B1HA 3MJNA 2RC7A 3TCHA 4F3GA 2NOOA 4KFQA 2IA4A 4LZ5A 1IQ7A 5CMKA 1J1NA 5I56A 3IK6B 3JZJA 3BFUA 1BTJA 3M3FA 4KYDA 4X9TA 3TCFA 3HSTA 1MQJA 4F3BA 4NF6B 5CI5A 1B4ZA 3TYHA 5H8FB 4U1ZA 1DTZA 2OBGA 4FAJA 1LFIA 3IR1A 1BIYA 1I6AA 4R72A 4F2QA 3C36A 2GHBA 3C9HA 3LSXA 4NF5A 4KR5A 4DCXA 3IJXB 1MPBA 3VXBA 3ZKLA 2PMSA 3LSFB 5FTHA 2Q88A 3SEVA 4PQJA 2PVUA 4LZ8A 4GD5A 2F36A 3JV9A 3RY3A 3CRBA 1GVCA 4OFLA 3IOTA 2XXUA 3TDJA 1SI1A 5CMBA 4ZEDA 3K00A 1TT1A 1DMBA 3OSQA 1SVXB 3CG1A 5KDTB 1B32A 2ONKE 5H8SA 4YMBA 2Z22A 1YPNA 3K6XA 4LONB 5AA4A 1FTJA 4JWYA 2D3IA 4WEPA 3MP8A 4ZZEA 3SERA 1AMFA 1MRPA 2R71A 2B3FA 3FVOA 5ICTA 2HFBA 4YB7A 3MBPA 2IEEA 1MDP1 3QYTA 5I2NB 2VD2A 3UK4A 3KOTA 4FATA 3K6VA 4EDPA 1MY3A 1RYOA 3RGYA 1LFGA 2Z8EA 3U94A 3K4UA 4DLDA 1DPEA 3OMBA 4NF8A 1QJMA 1ZTYA 3THIA 3FXRA 4GQOA 5H8QB 1B5IA 4U22A 3LSLA 1O7TA 1AIVA 1ELJA 4ZEFA 3R6UA 3OO7A 5CM6A 2F78A 1UTHB 4F2OA 2Y7IA 3Q26A 1QULA 1EZ9A 2QS3A 4N13A 3TTNA 2D5WA 3L6HA 3T93B 5HPQA 4U2RA 4MBPA 1IUDA 4AQ4A 5AA2A 3PUZE 2H99A 1VE4A 1XHYA 1S9TA 3B6QA 3OSRA 1OIBA 5DEXB 1EH3A 1H45A 2QSXA 2UXAA 2YPNA 2QPQA 3MUQA 2RCAA 3G3JA 3T9HB 2O7IA 4DXBA 4IY6A 2NUVA 4WEDA 1Y4CA 2H25A 3EN3A 1N04A 4DZ1A 3VLWA 3KSXA 4GF8A 4DE8A 1IXIA 2H5YA 3A3CA 1MDQA 3G3IA 4NWCA 1R6ZA 4BDQA 2XXHA 3TEPA 3SEXA 4XIGQ 4YB6A 4EF1A 1II5A 4NE4A 1NNKA 4I8CA 4GXSB 5KCJA 2DVCA 1H44A 4R9GA 4AB5A 2QS2A 4JBZA 4G8MA 2V93A 5B7DA 1SYHA 4FEBA 2I58A 5CC2A 3FZVA 3FD3A 4RY1A 2UVJA 1XC1A 3HCQA 5ELVA 3MC2A 4R9FA 3U8QA 5EHSA 4G68B 1P1NA 3O66A 4C1TA 5CMCA 1WVJA 1T0KA 2Y7RA 4H8IA 2ZYKA 4HCWA 3PUXE 1SQYA 1LAGE 1L5TA 1R1NA 1R9QA 2ESNA 2Z8FA 3TTMA 3U92A 3MZ1A 4IGTA 3TPAA 4NF4A 5LOMA 1Z7NE 1NL5A 4H67A 1A54A 3FJGA 5CBSA 3RT6B 3D4GA 3UN6A 2XXPA 1Y3PA 4LA9A 2OWTA 4C0RA 1Y1MA 3A3UA 5A5XA 4YU0A 2V3UA 3DP4A 1SW1A 4QFKA 3OXNA 4EQ9A 3V8XB 4OTEA 4HCYA 5I84A 5I59B 3RTWB 2V84A 5F7VA 2O51A 2R6GE 3H4ZA 3C33A 1AL3A 3GBAA 2HAUA 1TWYA 3VVFA 1MXZA 5B70A 5H8NB 1N3WA 4DIGA 1AH5A 4BLAA 4R6HA 5I57A 1M5EA 3BKIB 3FVNA 4U21A 2GH9A 3VDFA 1ZMGA 3G3GA 4R2FA 3S9EA 5TU0A 3IB2A 3OO8A 5TPAA 4C1UA 2UVHA 4RXLA 2ZYNA 1NH7A 4H1XA 2GRVA 1PB7A 1JQFA 2QS4A 2ZMBA 4OFOA 4EXKA 1IXHA 3KGCA 5FHNA 3VVDA 1XS5A 2A5SA 2I0BA 3Q28A 3H6VA 3I6VA 2DP8A 3RUMA 2Q2CA 4GVOA 3PMVA 3SESA 2X26A 5HM4B 4F3PA 3PGFA 3HHGA 3VLUA 4KPTA 2Y7PA 4U4SA 4RK2A 2E1SA 2Y84A 1P99A 1TFDA 3D4CA 4XTCQ 2CMOA 3CFXA 3E3KA 1B3LA 1D3KA 4X48A 5AA1A 1JEVA 4QF9A 3IB0A 3IO4A 3MPLA 3C4MA 1ZJLA 3MVXA 5M2VA 4RYAA 3R26A 4GXAA 5JTYA 4GRKA 4N6PA 1B3FA 3VLVA 3SKPA 3VE1B 1FTOA 3OO6A 3K0VA 2DWIA 3SEUA 3WAEA 4PFTA 1MY1A 4Q30B 1LLSA 5L9OA 3UP9A 3TODA 4E0WA 1IEJA 4FE8A 4U23A 2DWJA 2AL5A 1HSLA 3ONMA 1HSEA 3Q25A 1MS7A 3O6GA 2DOJA 4X1BA 2ZYMA 4MLVA 4EUOA 2DE2A 2YJPA 2DVZA 3KOSA 3KG2A 2PX1A 3N26A 2DXRA 3ZKKA 3DP6A 4QRZA 4F39A 1AOVA 3AXFA 3MP1A 4ESXA 1N0TA 4GFRA 2F6PA 5H8HA 2XXXA 1MXWA 4RA1A 1O64A 3PPPA 1GGGA 2ZYOA 1SI0A 4LP2B 1I6QA 4H0WA 4ZS9A 1S50A 5K2YA 4YKPA 3I3VA 5K2XA 3EPEA 5IAIA 2V25A 1MXXA 3SEWA 5CBRA 3S4UA 3TKDA 3PPOA 3PMWA 3H7MA 1OVTA 1YAEA 3QK6A 3MVWA 2P0SA 3K2DA 1B9JA 5I56B 4BDNA 3E4RA 5BWJA 1PEBA 1FCKA 2Q9TA 4FORA 2PT2A 4OVJA 2XXQA 3DP8A 4BDMA 2X7QA 3EHSA 1WODA 5FHMA 5JK4A 3IJOB 1ZLQA 5KZTA 4U4XA 4FJPA 2V3QA 1QKBA 5KDTA 2G93A 1BKAA 5DT6A 2DSFA 4ELQA 3QAXA 1MM6A 1EU8A 3W15C 4FEDA 1B2HA 3K01A 3EHUA 5JEIA 1P1QA 2W7YA 1LBBA 4OWDA 1N3XA 2XX9A 3PV0E 3K6UA 3S9LC 2QMWA 1MH3A 1XOCA 4N07A 3QUFA 4ND9A 3T9XB 1DPPA 4X1DA 4HW8A 3O2AA 4IB2A 1B58A 2BJJX 3T66A 2KLFA 1N7XA 3OD7A 1EZOA 4EQBA 1LSTA 4EXLA 5H8QA 1QUKA 4JWXA 3RPWA 1FQBA 2ONRA 3TUSA 1FQEA 3TELA 1ANFA 1UTHA 3OENA 3MVYA 4GL0A 4QSCA 3W9VA 1A8FA 1JW5A 5I2KA 4JDFA 1Z7ME 4AB6A 1MQIA 4PFUA 2ZXTA 1B6HA 4RK9A 2H9BA 3USDA 2ABHA 1N7WA 3M3KA 1IXGA 1URDA 2PYYA 2DXYA 3O28A 1Q1KA 4HTGA 2XD2A 1LBCA 4TLLB 3IB1A 2B3BA 4ELRA 1TXFA 3EF7A 3ECRA 3TQWA 1UIUA 4G8HA 4LQ5A 3LR1A 4H6DA 4RNSA 3VVEA 5AA2B 1MQGA 3K1PA 3EQ1A 4F3SA 1B1XA 1LAFE 4K3FA 2REGA 3FUZA 3HN0A 3O29A 3MPKA 4Q8RA 4H65A 3CFZA 2DWAA 4R6KA 1LAHE 1O63A 1LB8A 3S2VA 4IGRA 5HBCA 1Y3NA 5DYHA 5BUUA 4G77A 4OHNA 2F7BA 4QSDA 1B3EA 2DE4A 1JNFA 4Z7EA 5L8DA 2F97A 3O9PA 3DELB 3KN7A 2HQ0A 2A5TB 3I5OA 5KCJB 2DWHA 3FJMA 2Y7KA 3S9NC 4O3BA 1B3GA 1FTLA 3M3LA 3MWBA 3CR9A 3U93A 4G4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4G68 C;  1RYX A;  1IIW A;  1JET A;  1MH4 A;  4IO3 A;  3BFT A;  3N6T A;  5ITO A;  4P11 A;  4BDL A;  3CI8 A;  2G29 A;  1Y9U A;  1CB6 A;  1B51 A;  2XD3 A;  3L6G A;  3CIJ A;  2XHD A;  3G7W A;  1PB8 A;  3LSW A;  4H5F A;  4R6Y A;  1MQD A;  2F7C A;  4XKP A;  2H98 A;  4ELP A;  1B7Z A;  4Q0C A;  3TMG A;  4ISU A;  4OEV A;  4ZEI A;  3VFJ A;  2F6G A;  3K02 A;  4F29 A;  4NF4 B;  1NNP A;  1MXY A;  3GXA A;  1NKX A;  1VR5 A;  2UYF A;  1R9L A;  3V89 B;  2ALU A;  2H4I A;  3B6W A;  2UVG A;  4KCD A;  3TQL A;  4OFJ A;  1NNT A;  2FA7 A;  3KBR A;  4GOT A;  2QMX A;  3FIR A;  2XX8 A;  4BDO A;  4EQ7 A;  1VFE A;  2DYX A;  4TLM B;  1S7Y A;  1A55 A;  5EYF A;  3LC8 A;  4F1Y A;  5A5X B;  1SD3 A;  4POX A;  1PBP A;  5L9M A;  1I6B A;  2RC9 A;  4NWD A;  1OLA A;  1MXU A;  2HAV A;  5TP9 A;  2HXW A;  3TAJ A;  1DSN A;  4FIM A;  3KN8 A;  4OER A;  3KEI A;  4R74 A;  1OQH A;  1P1U A;  3IO6 A;  1D9Y A;  3P7I A;  3CSB A;  5J1D A;  3LBS A;  1VFD A;  2HCA A;  2X7P A;  2I4B A;  2DS9 A;  1PB9 A;  3H6W A;  4HS7 A;  4ZEB A;  1I69 A;  3FJ7 A;  4ZEK A;  3U1O A;  3K1N A;  4ONY A;  4XKQ A;  2Q8J A;  4O3A A;  3H6U A;  3MP6 A;  5TPA B;  1POY 1;  1LGB C;  1D9V A;  2XXV A;  5ITP A;  2O68 A;  1MPD A;  4F19 A;  4GLI A;  2ZNS A;  1MG1 A;  5FHO A;  1JVX A;  2DQV A;  3H03 A;  1RKM A;  3DM0 A;  4GIZ A;  2I48 A;  1N84 A;  4PFW A;  3VXC A;  4H5G A;  2LAO A;  2OJT A;  5CMM A;  5I58 A;  1SYI A;  1SBP A;  1M5F A;  3KZG A;  2I49 A;  5DTB A;  3CG3 A;  2I0C A;  2UVI A;  4KCC A;  4DDD A;  1GTK A;  5ICQ A;  1UTB A;  1OLC A;  1YCJ A;  1B0H A;  1NH8 A;  3B6T A;  1SW4 A;  3Q27 A;  4H8J A;  1XVY A;  3QSL A;  1A99 A;  3IOV A;  2GHA A;  2ZNU A;  3GBB A;  4I9D A;  2ANJ A;  3OO9 A;  4LZ7 A;  4XKN A;  3PPR A;  3UOR A;  5F1Q A;  1US5 A;  3RTF B;  4LUB A;  4IO2 A;  1PBQ A;  4JWO A;  4PET A;  5AA2 D;  3MZ9 A;  4UA8 A;  1A8E A;  4OZ9 A;  2P2A A;  1IXC A;  2RCB A;  2VOZ A;  1F9B A;  4OYV A;  3N6U A;  4MFI A;  4YAH X;  4NF6 A;  2NWJ A;  2WKY A;  1URS A;  5H8H B;  5H8F A;  5AE4 A;  2XXW A;  1QUJ A;  1MY2 A;  2Q89 A;  3S9M C;  4YB5 A;  1A7L A;  1GV8 A;  3PUV E;  3UIF A;  4P0I A;  3R7X A;  3FAS A;  3V5A A;  1MPC A;  1NMU A;  4ESW A;  2XX7 A;  4OES A;  3TTR A;  1P1O A;  3ZSF A;  1POT A;  2VHA A;  4POW A;  3UA8 A;  4ZE8 A;  1MY0 A;  3TTL A;  1Y4T A;  4NF5 B;  1FQA A;  1MXV A;  1MY4 A;  1M5B A;  1QVS A;  1ZBM A;  4KHZ E;  1IZ1 A;  1P1W A;  3SET A;  1B5J A;  1B46 A;  2P1S A;  2F34 A;  2NXO A;  2R9J A;  2ONS A;  2VD3 A;  4ZZA A;  3SDF A;  1OQG A;  3WAF A;  3PMX A;  4F18 A;  5I2N A;  4QFP A;  4EF2 A;  3PU5 A;  1XVX A;  4YKK A;  4GWO A;  3RN8 A;  3PUY E;  4F1V A;  3HPI A;  3W9W A;  3C31 A;  3G3K A;  5AA4 B;  3IOU A;  1FTM A;  2Z8D A;  3OEM A;  1LCF A;  2F35 A;  3KJ7 A;  4I62 A;  2V3T A;  4P0G A;  2AIX A;  1NFT A;  4ELO A;  2O6A A;  1Y1Z A;  4QHQ A;  3FAT A;  4OEN A;  2O1L A;  4BDR A;  4JSO A;  3PPN A;  4G2Z A;  3C34 A;  4R75 A;  2F5X A;  4IO4 A;  1ZU0 A;  1YTV A;  3A09 A;  4NF8 B;  4NED A;  5DVI A;  4Z0I A;  2THI A;  5DEX A;  5DVF A;  4DXU A;  4LVQ A;  3RT8 A;  3QXM A;  3K6W A;  4ECF A;  2O7U A;  1A40 A;  3KJT A;  5I2K B;  3RNN A;  1B7H A;  3H06 B;  4OQO A;  2RF1 A;  3ILT B;  3TCG A;  3TZA A;  1B0L A;  2OLB A;  3KN3 A;  5EHM A;  4OMB A;  4YMA A;  4G8N A;  4MF3 A;  1FQD A;  3F11 A;  2RIN A;  2B65 A;  3O97 A;  2XXI A;  1H43 A;  1Q35 A;  4O3C A;  4R73 A;  3IX1 A;  3Q29 A;  4LAT A;  2VGQ A;  3PD9 A;  3PPQ A;  4IO7 A;  4JSD A;  4TQU Q;  1WDN A;  2VP1 A;  4L17 A;  1JW4 A;  5IKB A;  2M8C A;  1ZIU A;  3PUW E;  3E13 X;  4PE5 B;  4YIC A;  4M1V A;  2I3V A;  3H6T A;  4R2B A;  1UIV A;  5ISU A;  2A5T A;  2I3W A;  3FV1 A;  1H3D A;  3LUY A;  3OEK A;  4G68 A;  3SEY A;  3FVG A;  1GR2 A;  2Y7W A;  1KWH A;  1SW2 A;  3CSG A;  1B3H A;  3O6I A;  1OVB A;  3VV5 A;  2GFE A;  2REJ A;  4TOZ A;  3UGW A;  1JW1 A;  2F8D A;  2D21 A;  3T96 B;  3QUJ A;  2AL4 A;  2HZL A;  4ZDM A;  1B7U A;  2UYE A;  1USY H;  4IY5 A;  2I4C A;  1DOT A;  3IOW A;  3HHF A;  4JB7 A;  1US4 A;  1B52 A;  1VSO A;  1IIT A;  1Y3Q A;  4PP0 A;  2YLN A;  2QL3 A;  5L9S A;  3ILU B;  3K1M A;  1DTG A;  2O84 X;  3G3F A;  4IO5 A;  4ZEC A;  2HZK A;  3FXU A;  1D4N A;  4QFO A;  2ZNT A;  4KQP A;  4RPN A;  3T9V A;  4XKR A;  2Z23 A;  2PT1 A;  4OET A;  4I1D A;  1LB9 A;  3ZS6 A;  3U72 A;  4QSE A;  2XXY A;  5I59 A;  1B5H A;  1B4H A;  2QRY A;  2HEU A;  4OEU A;  5H8N A;  1QUI A;  3H3G A;  4MLQ A;  2CZL A;  1SW5 A;  4Q5T A;  3CVG A;  1LCT A;  4RPO A;  1JEU A;  1QW0 A;  2O69 A;  2XXT A;  1BLF A;  1ATG A;  1N76 A;  4LQ2 A;  4DCY A;  3T22 A;  4FEC A;  4ZE9 A;  1XT8 A;  3FGS A;  4F22 A;  2OZZ A;  2FYI A;  3T9U A;  3HO7 A;  4U1O A;  1M5C A;  2PBW A;  3ODB A;  1OMP A;  3KFM A;  4PFY A;  1ZKB A;  4NTL A;  2NVU B;  5I57 B;  1BP5 A;  4THI A;  2DE3 A;  3RQT A;  1NNF A;  1URG A;  5TP9 B;  3O6H A;  1MQH A;  3DLN A;  1FQF A;  3N5L A;  3FXQ A;  2AYS A;  1PC3 A;  3BBR A;  3JYR A;  4M4G A;  2OCU A;  1LAX A;  3G3H A;  1CE2 A;  5CRY A;  1QKA A;  3MQ9 A;  4KI0 E;  3MVZ A;  4KYS A;  3OOA A;  4QFL A;  1H76 A;  4GL8 A;  1HSJ A;  4JXI A;  2QJE A;  3IOR A;  2XXR A;  3TFL A;  5FTI A;  3B7D A;  3C35 A;  1MM7 A;  3FVK A;  2F7A A;  3KSJ A;  4XXU A;  4IO6 A;  4YZZ A;  2RKM A;  3PD8 A;  3EHT A;  3N94 A;  2QS1 A;  4KD5 A;  3V83 A;  1JVY A;  2RC8 A;  3MW0 A;  4YKI A;  4OXV A;  1B40 A;  1B05 A;  3MZB A;  3GLB A;  3QIM A;  3OEL A;  2E0S A;  4UAC A;  4YKJ A;  1TFA A;  5AA3 A;  1USY E;  4F1U A;  3GZG A;  2OWS A;  5JTY B;  5I58 B;  4E0X A;  3FV2 A;  3CFL A;  3MAM A;  4WKM A;  1FQC A;  5DVJ A;  3M8U A;  2FNC A;  1LFH A;  1UTB B;  1FW0 A;  3C32 A;  3E9X A;  4RJZ A;  1PDA A;  4QFN A;  1SDX A;  3RLF E;  4KYE A;  3HV1 A;  1M5D A;  1Y20 A;  4NMY A;  4WXJ A;  4DXC A;  3IAZ A;  2OK2 A;  1FTK A;  4F31 B;  3TTK A;  4MH5 A;  2O1M A;  3IL1 B;  2Q2A A;  1UQW A;  2I6E A;  1EZP A;  1B1H A;  3MJN A;  2RC7 A;  3TCH A;  4F3G A;  2NOO A;  4KFQ A;  2IA4 A;  4LZ5 A;  1IQ7 A;  5CMK A;  1J1N A;  5I56 A;  3IK6 B;  3JZJ A;  3BFU A;  1BTJ A;  3M3F A;  4KYD A;  4X9T A;  3TCF A;  3HST A;  1MQJ A;  4F3B A;  4NF6 B;  5CI5 A;  1B4Z A;  3TYH A;  5H8F B;  4U1Z A;  1DTZ A;  2OBG A;  4FAJ A;  1LFI A;  3IR1 A;  1BIY A;  1I6A A;  4R72 A;  4F2Q A;  3C36 A;  2GHB A;  3C9H A;  3LSX A;  4NF5 A;  4KR5 A;  4DCX A;  3IJX B;  1MPB A;  3VXB A;  3ZKL A;  2PMS A;  3LSF B;  5FTH A;  2Q88 A;  3SEV A;  4PQJ A;  2PVU A;  4LZ8 A;  4GD5 A;  2F36 A;  3JV9 A;  3RY3 A;  3CRB A;  1GVC A;  4OFL A;  3IOT A;  2XXU A;  3TDJ A;  1SI1 A;  5CMB A;  4ZED A;  3K00 A;  1TT1 A;  1DMB A;  3OSQ A;  1SVX B;  3CG1 A;  5KDT B;  1B32 A;  2ONK E;  5H8S A;  4YMB A;  2Z22 A;  1YPN A;  3K6X A;  4LON B;  5AA4 A;  1FTJ A;  4JWY A;  2D3I A;  4WEP A;  3MP8 A;  4ZZE A;  3SER A;  1AMF A;  1MRP A;  2R71 A;  2B3F A;  3FVO A;  5ICT A;  2HFB A;  4YB7 A;  3MBP A;  2IEE A;  1MDP 1;  3QYT A;  5I2N B;  2VD2 A;  3UK4 A;  3KOT A;  4FAT A;  3K6V A;  4EDP A;  1MY3 A;  1RYO A;  3RGY A;  1LFG A;  2Z8E A;  3U94 A;  3K4U A;  4DLD A;  1DPE A;  3OMB A;  4NF8 A;  1QJM A;  1ZTY A;  3THI A;  3FXR A;  4GQO A;  5H8Q B;  1B5I A;  4U22 A;  3LSL A;  1O7T A;  1AIV A;  1ELJ A;  4ZEF A;  3R6U A;  3OO7 A;  5CM6 A;  2F78 A;  1UTH B;  4F2O A;  2Y7I A;  3Q26 A;  1QUL A;  1EZ9 A;  2QS3 A;  4N13 A;  3TTN A;  2D5W A;  3L6H A;  3T93 B;  5HPQ A;  4U2R A;  4MBP A;  1IUD A;  4AQ4 A;  5AA2 A;  3PUZ E;  2H99 A;  1VE4 A;  1XHY A;  1S9T A;  3B6Q A;  3OSR A;  1OIB A;  5DEX B;  1EH3 A;  1H45 A;  2QSX A;  2UXA A;  2YPN A;  2QPQ A;  3MUQ A;  2RCA A;  3G3J A;  3T9H B;  2O7I A;  4DXB A;  4IY6 A;  2NUV A;  4WED A;  1Y4C A;  2H25 A;  3EN3 A;  1N04 A;  4DZ1 A;  3VLW A;  3KSX A;  4GF8 A;  4DE8 A;  1IXI A;  2H5Y A;  3A3C A;  1MDQ A;  3G3I A;  4NWC A;  1R6Z A;  4BDQ A;  2XXH A;  3TEP A;  3SEX A;  4XIG Q;  4YB6 A;  4EF1 A;  1II5 A;  4NE4 A;  1NNK A;  4I8C A;  4GXS B;  5KCJ A;  2DVC A;  1H44 A;  4R9G A;  4AB5 A;  2QS2 A;  4JBZ A;  4G8M A;  2V93 A;  5B7D A;  1SYH A;  4FEB A;  2I58 A;  5CC2 A;  3FZV A;  3FD3 A;  4RY1 A;  2UVJ A;  1XC1 A;  3HCQ A;  5ELV A;  3MC2 A;  4R9F A;  3U8Q A;  5EHS A;  4G68 B;  1P1N A;  3O66 A;  4C1T A;  5CMC A;  1WVJ A;  1T0K A;  2Y7R A;  4H8I A;  2ZYK A;  4HCW A;  3PUX E;  1SQY A;  1LAG E;  1L5T A;  1R1N A;  1R9Q A;  2ESN A;  2Z8F A;  3TTM A;  3U92 A;  3MZ1 A;  4IGT A;  3TPA A;  4NF4 A;  5LOM A;  1Z7N E;  1NL5 A;  4H67 A;  1A54 A;  3FJG A;  5CBS A;  3RT6 B;  3D4G A;  3UN6 A;  2XXP A;  1Y3P A;  4LA9 A;  2OWT A;  4C0R A;  1Y1M A;  3A3U A;  5A5X A;  4YU0 A;  2V3U A;  3DP4 A;  1SW1 A;  4QFK A;  3OXN A;  4EQ9 A;  3V8X B;  4OTE A;  4HCY A;  5I84 A;  5I59 B;  3RTW B;  2V84 A;  5F7V A;  2O51 A;  2R6G E;  3H4Z A;  3C33 A;  1AL3 A;  3GBA A;  2HAU A;  1TWY A;  3VVF A;  1MXZ A;  5B70 A;  5H8N B;  1N3W A;  4DIG A;  1AH5 A;  4BLA A;  4R6H A;  5I57 A;  1M5E A;  3BKI B;  3FVN A;  4U21 A;  2GH9 A;  3VDF A;  1ZMG A;  3G3G A;  4R2F A;  3S9E A;  5TU0 A;  3IB2 A;  3OO8 A;  5TPA A;  4C1U A;  2UVH A;  4RXL A;  2ZYN A;  1NH7 A;  4H1X A;  2GRV A;  1PB7 A;  1JQF A;  2QS4 A;  2ZMB A;  4OFO A;  4EXK A;  1IXH A;  3KGC A;  5FHN A;  3VVD A;  1XS5 A;  2A5S A;  2I0B A;  3Q28 A;  3H6V A;  3I6V A;  2DP8 A;  3RUM A;  2Q2C A;  4GVO A;  3PMV A;  3SES A;  2X26 A;  5HM4 B;  4F3P A;  3PGF A;  3HHG A;  3VLU A;  4KPT A;  2Y7P A;  4U4S A;  4RK2 A;  2E1S A;  2Y84 A;  1P99 A;  1TFD A;  3D4C A;  4XTC Q;  2CMO A;  3CFX A;  3E3K A;  1B3L A;  1D3K A;  4X48 A;  5AA1 A;  1JEV A;  4QF9 A;  3IB0 A;  3IO4 A;  3MPL A;  3C4M A;  1ZJL A;  3MVX A;  5M2V A;  4RYA A;  3R26 A;  4GXA A;  5JTY A;  4GRK A;  4N6P A;  1B3F A;  3VLV A;  3SKP A;  3VE1 B;  1FTO A;  3OO6 A;  3K0V A;  2DWI A;  3SEU A;  3WAE A;  4PFT A;  1MY1 A;  4Q30 B;  1LLS A;  5L9O A;  3UP9 A;  3TOD A;  4E0W A;  1IEJ A;  4FE8 A;  4U23 A;  2DWJ A;  2AL5 A;  1HSL A;  3ONM A;  1HSE A;  3Q25 A;  1MS7 A;  3O6G A;  2DOJ A;  4X1B A;  2ZYM A;  4MLV A;  4EUO A;  2DE2 A;  2YJP A;  2DVZ A;  3KOS A;  3KG2 A;  2PX1 A;  3N26 A;  2DXR A;  3ZKK A;  3DP6 A;  4QRZ A;  4F39 A;  1AOV A;  3AXF A;  3MP1 A;  4ESX A;  1N0T A;  4GFR A;  2F6P A;  5H8H A;  2XXX A;  1MXW A;  4RA1 A;  1O64 A;  3PPP A;  1GGG A;  2ZYO A;  1SI0 A;  4LP2 B;  1I6Q A;  4H0W A;  4ZS9 A;  1S50 A;  5K2Y A;  4YKP A;  3I3V A;  5K2X A;  3EPE A;  5IAI A;  2V25 A;  1MXX A;  3SEW A;  5CBR A;  3S4U A;  3TKD A;  3PPO A;  3PMW A;  3H7M A;  1OVT A;  1YAE A;  3QK6 A;  3MVW A;  2P0S A;  3K2D A;  1B9J A;  5I56 B;  4BDN A;  3E4R A;  5BWJ A;  1PEB A;  1FCK A;  2Q9T A;  4FOR A;  2PT2 A;  4OVJ A;  2XXQ A;  3DP8 A;  4BDM A;  2X7Q A;  3EHS A;  1WOD A;  5FHM A;  5JK4 A;  3IJO B;  1ZLQ A;  5KZT A;  4U4X A;  4FJP A;  2V3Q A;  1QKB A;  5KDT A;  2G93 A;  1BKA A;  5DT6 A;  2DSF A;  4ELQ A;  3QAX A;  1MM6 A;  1EU8 A;  3W15 C;  4FED A;  1B2H A;  3K01 A;  3EHU A;  5JEI A;  1P1Q A;  2W7Y A;  1LBB A;  4OWD A;  1N3X A;  2XX9 A;  3PV0 E;  3K6U A;  3S9L C;  2QMW A;  1MH3 A;  1XOC A;  4N07 A;  3QUF A;  4ND9 A;  3T9X B;  1DPP A;  4X1D A;  4HW8 A;  3O2A A;  4IB2 A;  1B58 A;  2BJJ X;  3T66 A;  2KLF A;  1N7X A;  3OD7 A;  1EZO A;  4EQB A;  1LST A;  4EXL A;  5H8Q A;  1QUK A;  4JWX A;  3RPW A;  1FQB A;  2ONR A;  3TUS A;  1FQE A;  3TEL A;  1ANF A;  1UTH A;  3OEN A;  3MVY A;  4GL0 A;  4QSC A;  3W9V A;  1A8F A;  1JW5 A;  5I2K A;  4JDF A;  1Z7M E;  4AB6 A;  1MQI A;  4PFU A;  2ZXT A;  1B6H A;  4RK9 A;  2H9B A;  3USD A;  2ABH A;  1N7W A;  3M3K A;  1IXG A;  1URD A;  2PYY A;  2DXY A;  3O28 A;  1Q1K A;  4HTG A;  2XD2 A;  1LBC A;  4TLL B;  3IB1 A;  2B3B A;  4ELR A;  1TXF A;  3EF7 A;  3ECR A;  3TQW A;  1UIU A;  4G8H A;  4LQ5 A;  3LR1 A;  4H6D A;  4RNS A;  3VVE A;  5AA2 B;  1MQG A;  3K1P A;  3EQ1 A;  4F3S A;  1B1X A;  1LAF E;  4K3F A;  2REG A;  3FUZ A;  3HN0 A;  3O29 A;  3MPK A;  4Q8R A;  4H65 A;  3CFZ A;  2DWA A;  4R6K A;  1LAH E;  1O63 A;  1LB8 A;  3S2V A;  4IGR A;  5HBC A;  1Y3N A;  5DYH A;  5BUU A;  4G77 A;  4OHN A;  2F7B A;  4QSD A;  1B3E A;  2DE4 A;  1JNF A;  4Z7E A;  5L8D A;  2F97 A;  3O9P A;  3DEL B;  3KN7 A;  2HQ0 A;  2A5T B;  3I5O A;  5KCJ B;  2DWH A;  3FJM A;  2Y7K A;  3S9N C;  4O3B A;  1B3G A;  1FTL A;  3M3L A;  3MWB A;  3CR9 A;  3U93 A;  4G4P A; 
#chains in the Genus database with same CATH topology
 4G68 C;  1FJ9 A;  1RYX A;  4XEQ A;  1IIW A;  1JET A;  1NV1 A;  1QGX A;  1MH4 A;  4IO3 A;  3BFT A;  3N6T A;  5ITO A;  4P11 A;  4BDL A;  3CI8 A;  2G29 A;  1Y9U A;  1CB6 A;  1B51 A;  2XD3 A;  3L6G A;  1K9Y A;  3CIJ A;  2XHD A;  3G7W A;  1PB8 A;  3LSW A;  2WBB A;  4H5F A;  4R6Y A;  1MQD A;  2F7C A;  4XKP A;  2H98 A;  4ELP A;  1B7Z A;  4Q0C A;  3TMG A;  2L5V A;  4ISU A;  2KQZ A;  4OEV A;  4ZEI A;  3VFJ A;  2F6G A;  3K02 A;  4F29 A;  1LEV A;  4NF4 B;  1NNP A;  1MXY A;  4MCO A;  3GXA A;  1NKX A;  1VR5 A;  2UYF A;  1R9L A;  4NQ8 A;  3V89 B;  2ALU A;  2H4I A;  3B6W A;  2UVG A;  4KCD A;  1FTA A;  3TQL A;  4OFJ A;  1NNT A;  1AWB A;  2FA7 A;  3KBR A;  4GOT A;  2GQ1 A;  2QMX A;  3FIR A;  2XX8 A;  4BDO A;  4EQ7 A;  1VFE A;  2JJK A;  2DYX A;  2CEX A;  4TLM B;  1S7Y A;  1FPJ A;  1A55 A;  5EYF A;  3LC8 A;  4F1Y A;  4NF0 A;  5A5X B;  1SD3 A;  2XA5 A;  1LBZ A;  4POX A;  1PBP A;  1NV7 A;  5L9M A;  2F3B A;  1I6B A;  2RC9 A;  4NWD A;  4MAG A;  1OLA A;  1MXU A;  2HAV A;  5TP9 A;  2HXW A;  3TAJ A;  1DSN A;  4FIM A;  3KN8 A;  4OER A;  5DW8 A;  1FJ6 A;  5EYH A;  3KEI A;  4NG7 A;  4R74 A;  1OQH A;  1P1U A;  3IO6 A;  1D9Y A;  3P7I A;  3CSB A;  5J1D A;  3LBS A;  1VFD A;  2HCA A;  2X7P A;  2I4B A;  2DS9 A;  1PB9 A;  3H6W A;  4HS7 A;  4GWZ A;  4ZEB A;  4PF6 A;  1I69 A;  3FJ7 A;  4ZEK A;  3U1O A;  3K1N A;  4ONY A;  4XKQ A;  2Q8J A;  4O3A A;  3H6U A;  4DI4 B;  3MP6 A;  5TPA B;  1POY 1;  1DBZ A;  1LGB C;  4FBP A;  1D9V A;  4NHB A;  2XXV A;  5ITP A;  2O68 A;  1MPD A;  4F19 A;  4GLI A;  2ZNS A;  4JVC A;  1MG1 A;  5FHO A;  3U65 A;  4OVS A;  1JVX A;  4HE1 A;  1D9Q A;  2DQV A;  3H03 A;  1RKM A;  3DM0 A;  4GIZ A;  1DCU A;  2I48 A;  1FPB A;  4PFW A;  1N84 A;  3VXC A;  2F3D A;  4H5G A;  2LAO A;  2OJT A;  5CMM A;  5I58 A;  3KC0 A;  1SYI A;  4P1L A;  1SBP A;  1M5F A;  3KZG A;  1FBE A;  2I49 A;  5DTB A;  3PTY A;  3CG3 A;  2I0C A;  2UVI A;  4KCC A;  4DDD A;  1GTK A;  4XF5 A;  5ICQ A;  1UTB A;  1OLC A;  2HHM A;  1YCJ A;  1B0H A;  1NH8 A;  3B6T A;  1SW4 A;  3Q27 A;  4H8J A;  1XVY A;  3QSL A;  3BIG A;  1A99 A;  3IOV A;  1NV3 A;  2GHA A;  2FBP A;  2ZNU A;  3GBB A;  4NN3 A;  4I9D A;  2ANJ A;  3OO9 A;  4LZ7 A;  4GBW A;  4XKN A;  3PPR A;  5EQ9 A;  1FPE A;  3UOR A;  5F1Q A;  1US5 A;  3RTF B;  5A5L A;  4N4U A;  4LUB A;  4IO2 A;  1Q9D A;  1PBQ A;  4JWO A;  4PET A;  5AA2 D;  3MZ9 A;  4P47 A;  4UA8 A;  1A8E A;  4OZ9 A;  2P2A A;  1IXC A;  2RCB A;  2VOZ A;  1F9B A;  3KC1 A;  4OYV A;  3N6U A;  4MFI A;  2CZK A;  4YAH X;  4NF6 A;  2NWJ A;  2WKY A;  1URS A;  5H8H B;  5H8F A;  1FPF A;  5AE4 A;  2XXW A;  1NI9 A;  1QUJ A;  1MY2 A;  2Q89 A;  3S9M C;  4YB5 A;  2XWI A;  4X8R A;  1A7L A;  1GV8 A;  3PUV E;  3UIF A;  4P0I A;  3R7X A;  3FAS A;  3V5A A;  4O7M A;  1MPC A;  1NMU A;  4ESW A;  2XX7 A;  4OES A;  3TTR A;  3E79 A;  1P1O A;  3ZSF A;  1KA0 A;  1POT A;  2VHA A;  4PC9 A;  4POW A;  3UA8 A;  4ZE8 A;  4PF8 A;  1MY0 A;  3TTL A;  4GWY A;  1Y4T A;  4GWW A;  4NF5 B;  1FQA A;  1MXV A;  1MY4 A;  1M5B A;  1SPI A;  1QVS A;  1ZBM A;  4KHZ E;  1IZ1 A;  1P1W A;  3SET A;  1B5J A;  1B46 A;  2P1S A;  2F34 A;  2DDK A;  2NXO A;  2R9J A;  2ONS A;  2VD3 A;  4ZZA A;  3SDF A;  1OQG A;  3WAF A;  3PMX A;  4F18 A;  5I2N A;  5T3J A;  4QFP A;  4O7I A;  4EF2 A;  3PU5 A;  1XVX A;  1NV2 A;  4YKK A;  4GWO A;  3RN8 A;  3PUY E;  4F1V A;  3HPI A;  3W9W A;  3C31 A;  3G3K A;  5AA4 B;  3IOU A;  1FTM A;  2Z8D A;  3OEM A;  1LCF A;  2F35 A;  3KJ7 A;  4I62 A;  2V3T A;  4P0G A;  2AIX A;  1NFT A;  4I3E A;  4ELO A;  2O6A A;  1Y1Z A;  4QHQ A;  3FAT A;  4OEN A;  2O1L A;  4BDR A;  4JSO A;  3PPN A;  4G2Z A;  3C34 A;  2OX3 A;  4R75 A;  2F5X A;  4IO4 A;  1ZU0 A;  1YTV A;  3A09 A;  4NF8 B;  4NED A;  5DVI A;  4Z0I A;  2THI A;  1JP4 A;  4MMP A;  5DEX A;  5DVF A;  4DXU A;  4LVQ A;  3RT8 A;  3QXM A;  1EYK A;  3K6W A;  4ECF A;  2O7U A;  1A40 A;  3KJT A;  5I2K B;  3RNN A;  1LBV A;  1B7H A;  5IZ3 A;  3H06 B;  4OQO A;  2RF1 A;  3ILT B;  3TCG A;  3TZA A;  4PBQ A;  1B0L A;  2OLB A;  3KN3 A;  5EHM A;  4OMB A;  4YMA A;  4G8N A;  4MF3 A;  1FQD A;  3F11 A;  4MNC A;  5F24 A;  2RIN A;  2B65 A;  3O97 A;  2XXI A;  1H43 A;  1Q35 A;  5ET6 A;  4O3C A;  4R73 A;  3IX1 A;  3Q29 A;  3ROJ A;  4LAT A;  2VGQ A;  3PD9 A;  1NUY A;  3PPQ A;  4IO7 A;  4JSD A;  2CZI A;  4TQU Q;  1WDN A;  2VP1 A;  4L17 A;  1FBH A;  1JW4 A;  5IKB A;  2M8C A;  1ZIU A;  3PUW E;  3E13 X;  4PE5 B;  4YIC A;  4M1V A;  2I3V A;  3H6T A;  4R2B A;  1UIV A;  5ISU A;  3MST A;  2A5T A;  2FVZ A;  2I3W A;  5EQ7 A;  5LDZ A;  3FV1 A;  1H3D A;  3LUY A;  3OEK A;  4G68 A;  1BK4 A;  3SEY A;  3FVG A;  1GR2 A;  2Y7W A;  1FPD A;  1KWH A;  1SW2 A;  3CSG A;  1B3H A;  3O6I A;  1OVB A;  3VV5 A;  2GFE A;  2REJ A;  4TOZ A;  3UGW A;  1JW1 A;  2F8D A;  2D21 A;  3T96 B;  3QUJ A;  2AL4 A;  2HZL A;  1FPI A;  4ZDM A;  1B7U A;  2UYE A;  1USY H;  4IY5 A;  2I4C A;  1DOT A;  3IOW A;  3HHF A;  4JB7 A;  1US4 A;  1B52 A;  1VSO A;  1IIT A;  1Y3Q A;  4PP0 A;  1KZ8 A;  4PFB A;  2YLN A;  2QL3 A;  5L9S A;  3ILU B;  3D1R A;  3K1M A;  1DTG A;  2O84 X;  3G3F A;  4IO5 A;  4ZEC A;  2HZK A;  3FXU A;  1D4N A;  4QFO A;  2ZNT A;  4I40 A;  4KQP A;  4RPN A;  3T9V A;  4XKR A;  4PTK A;  2Z23 A;  2PT1 A;  4OET A;  4I1D A;  1LB9 A;  3ZS6 A;  4JVD A;  3U72 A;  4QSE A;  2XXY A;  5I59 A;  1B5H A;  2HXR A;  1B4H A;  2QRY A;  2HEU A;  4OEU A;  5H8N A;  1QUI A;  3H3G A;  4MLQ A;  2CZL A;  1SW5 A;  4Q5T A;  3CVG A;  1LCT A;  4RPO A;  1JEU A;  1QW0 A;  2O69 A;  2XXT A;  3RPL B;  1BLF A;  1ATG A;  4P56 A;  1N76 A;  4LQ2 A;  4DCY A;  3T22 A;  4FEC A;  1RDX A;  4ZE9 A;  1XT8 A;  3FGS A;  4F22 A;  2OZZ A;  2FYI A;  4MEV A;  5FBP A;  3T9U A;  3HO7 A;  4U1O A;  1M5C A;  2PBW A;  3ODB A;  1OMP A;  3KFM A;  1FBC A;  1ZKB A;  4PFY A;  3KBZ A;  4NTL A;  2NVU B;  5I57 B;  1BP5 A;  4THI A;  2DE3 A;  3RQT A;  1NNF A;  1URG A;  5TP9 B;  3O6H A;  1MQH A;  1FBF A;  3DLN A;  1FQF A;  3N5L A;  3FXQ A;  2AYS A;  1PC3 A;  2BJI A;  3BBR A;  3JYR A;  4M4G A;  4PAI A;  2OCU A;  1LAX A;  3G3H A;  1CE2 A;  5CRY A;  5ET7 A;  1QKA A;  3MQ9 A;  4KI0 E;  3MVZ A;  4KYS A;  3OOA A;  4QFL A;  1H76 A;  4GL8 A;  1HSJ A;  4JXI A;  2QJE A;  1IME A;  3IOR A;  2XXR A;  3TFL A;  4P9K A;  5FTI A;  3B7D A;  3C35 A;  1MM7 A;  3FVK A;  4GWU A;  3BIH A;  2F7A A;  3KSJ A;  4XXU A;  1XI6 A;  4IO6 A;  4YZZ A;  4PGP A;  2RKM A;  3PD8 A;  3EHT A;  3N94 A;  2QS1 A;  4KD5 A;  3V83 A;  1JVY A;  2RC8 A;  3MW0 A;  4YKI A;  4OXV A;  1B40 A;  1B05 A;  3MZB A;  3GLB A;  1G0H A;  3LV0 A;  3QIM A;  1EYI A;  3OEL A;  2E0S A;  1FBD A;  4UAC A;  4YKJ A;  1TFA A;  2Y5K A;  2WYK A;  5AA3 A;  3E78 A;  1USY E;  4F1U A;  3GZG A;  2OWS A;  5JTY B;  5I58 B;  4E0X A;  1IMB A;  3FV2 A;  3CFL A;  3EKI A;  3MAM A;  4WKM A;  1FQC A;  5DVJ A;  3M8U A;  2FNC A;  1LFH A;  1UTB B;  1FW0 A;  3C32 A;  3E9X A;  4RJZ A;  1PDA A;  4QFN A;  1SDX A;  3RLF E;  3HFU A;  4KYE A;  3HV1 A;  1M5D A;  1Y20 A;  4NMY A;  4WXJ A;  4DXC A;  2VPN A;  3IAZ A;  2OK2 A;  3SZP A;  1FTK A;  2MKZ A;  4F31 B;  3TTK A;  3MYU A;  4MH5 A;  1IMF A;  2O1M A;  3IL1 B;  2Q2A A;  1UQW A;  2I6E A;  1EZP A;  1B1H A;  3MJN A;  4NX1 A;  2FHY A;  2RC7 A;  3TCH A;  4F3G A;  2NOO A;  4KFQ A;  4PGN A;  2IA4 A;  4LZ5 A;  1IQ7 A;  5CMK A;  1J1N A;  5I56 A;  3IK6 B;  3JZJ A;  2VT5 A;  3BFU A;  1BTJ A;  3M3F A;  2PFZ A;  4KYD A;  4X9T A;  3TCF A;  3HST A;  1MQJ A;  4F3B A;  4PCD A;  1RDZ A;  4O8M A;  4NF6 B;  5CI5 A;  1B4Z A;  4QBA A;  3TYH A;  5H8F B;  4U1Z A;  2KR0 A;  1DTZ A;  2OBG A;  4PDD A;  4FAJ A;  1LFI A;  3IR1 A;  1BIY A;  5EYG A;  1I6A A;  5ET5 A;  4R72 A;  4F2Q A;  4I3Y A;  3C36 A;  2GHB A;  3C9H A;  3LSX A;  4NF5 A;  4KR5 A;  4DCX A;  3IJX B;  1MPB A;  3VXB A;  3ZKL A;  2PMS A;  3LSF B;  5FTH A;  2Q88 A;  3SEV A;  5J16 A;  4PQJ A;  2PVU A;  4LZ8 A;  4MNP A;  4GD5 A;  2F36 A;  3JV9 A;  3RY3 A;  3CRB A;  4PFR A;  1GVC A;  4OFL A;  3IOT A;  2XXU A;  3TDJ A;  1SI1 A;  5CMB A;  3CHG A;  4GBV A;  4ZED A;  3K00 A;  1TT1 A;  1DMB A;  3OSQ A;  2Q8M A;  1SVX B;  3CG1 A;  5KDT B;  1B32 A;  2ONK E;  5H8S A;  4YMB A;  2Z22 A;  1YPN A;  3K6X A;  5EQA A;  4LON B;  5AA4 A;  1FTJ A;  4DI3 D;  2WYP A;  4JWY A;  4HE0 A;  2D3I A;  5I7I A;  2QVU A;  4KXP A;  3MP8 A;  4MJO A;  4WEP A;  4N17 A;  4ZZE A;  3SER A;  1AMF A;  1LBX A;  1MRP A;  2R71 A;  2B3F A;  3FVO A;  3IFA A;  5ICT A;  4GWX A;  2HFB A;  4YB7 A;  3MBP A;  4P3L A;  2IEE A;  1MDP 1;  3QYT A;  5I2N B;  2VD2 A;  3UK4 A;  3KOT A;  4FAT A;  3K6V A;  4EDP A;  1MY3 A;  1IMD A;  1RYO A;  3RGY A;  1LFG A;  2Z8E A;  3U94 A;  3K4U A;  4DLD A;  1DPE A;  3OMB A;  4NF8 A;  1QJM A;  1ZTY A;  3THI A;  3FXR A;  4GQO A;  5H8Q B;  1B5I A;  2OWZ A;  4U22 A;  3LSL A;  1O7T A;  2FIX A;  1AIV A;  1ELJ A;  4ZEF A;  3R6U A;  3OO7 A;  3QMF A;  4G61 A;  5CM6 A;  2QVR A;  2F78 A;  1UTH B;  4F2O A;  4H46 A;  2Y7I A;  3Q26 A;  1QUL A;  1EZ9 A;  2QS3 A;  4N13 A;  3TTN A;  2D5W A;  3L6H A;  1NUZ A;  1VDW A;  3T93 B;  5HPQ A;  4U2R A;  4MBP A;  1IUD A;  4AQ4 A;  5AA2 A;  3PUZ E;  2H99 A;  1VE4 A;  1XHY A;  1S9T A;  3B6Q A;  3OSR A;  1OIB A;  5DEX B;  1EH3 A;  1H45 A;  2QSX A;  2UXA A;  2YPN A;  2QPQ A;  3MUQ A;  2RCA A;  3G3J A;  1NV6 A;  3T9H B;  2O7I A;  4HXV A;  4IY6 A;  2NUV A;  4DXB A;  4WED A;  1Y4C A;  4MNI A;  2H25 A;  3EN3 A;  2P3V A;  1N04 A;  4DZ1 A;  3VLW A;  3KSX A;  4GF8 A;  4DE8 A;  1IXI A;  2H5Y A;  3A3C A;  1MDQ A;  3G3I A;  4GX6 A;  2V4C A;  4NWC A;  1R6Z A;  2XXK A;  4BDQ A;  2XXH A;  3TEP A;  4OA4 A;  3SEX A;  4XIG Q;  4YB6 A;  5EQ8 A;  4EF1 A;  1II5 A;  4NE4 A;  1NNK A;  4I8C A;  4GXS B;  5KCJ A;  2DVC A;  1H44 A;  4R9G A;  4AB5 A;  2QS2 A;  4JBZ A;  3FXB A;  4G8M A;  2V93 A;  5B7D A;  4O94 A;  1SYH A;  4FEB A;  2I58 A;  5CC2 A;  2P3N A;  3FZV A;  3FD3 A;  4RY1 A;  2UVJ A;  1XC1 A;  3HCQ A;  2R8T A;  5ELV A;  3MC2 A;  4R9F A;  3U8Q A;  4N6D A;  5EHS A;  2B4M A;  3IFC A;  4G68 B;  1P1N A;  3O66 A;  4C1T A;  5CMC A;  1WVJ A;  1T0K A;  2Y7R A;  4H8I A;  4JVI A;  2ZYK A;  4HCW A;  3PUX E;  1SQY A;  4X04 A;  1LAG E;  1L5T A;  1R1N A;  1FBG A;  1R9Q A;  2ESN A;  2Z8F A;  3TTM A;  3U92 A;  3MZ1 A;  4GX4 A;  2ZZX A;  4IGT A;  4AS4 A;  3TPA A;  4NF4 A;  4MIJ A;  4UAB A;  5LOM A;  1NL5 A;  1Z7N E;  4OVT A;  4H67 A;  1A54 A;  2CZH A;  3A29 A;  3FJG A;  5CBS A;  3RT6 B;  3D4G A;  1IMA A;  3UN6 A;  4PBH A;  2XXP A;  1Y3P A;  4LA9 A;  2OWT A;  4C0R A;  1Y1M A;  2QVV A;  3A3U A;  3RPL A;  5A5X A;  4YU0 A;  2V3U A;  3DP4 A;  1SW1 A;  4QFK A;  3OXN A;  4EQ9 A;  3V8X B;  4OTE A;  1FSA A;  4HCY A;  5I5P A;  5I84 A;  5I59 B;  3RTW B;  2V84 A;  2XWO A;  5F7V A;  2O51 A;  2R6G E;  3H4Z A;  3C33 A;  1AL3 A;  3GBA A;  1KA1 A;  2HAU A;  1TWY A;  3VVF A;  1MXZ A;  5B70 A;  5H8N B;  1N3W A;  2Y5L A;  4DIG A;  1AH5 A;  1LBY A;  4BLA A;  4R6H A;  5I57 A;  1YXI A;  1M5E A;  3BKI B;  3FVN A;  4U21 A;  2GH9 A;  3VDF A;  1ZMG A;  3G3G A;  4XFE A;  4R2F A;  3S9E A;  5TU0 A;  3IB2 A;  4PE3 A;  1DK4 A;  3OO8 A;  4OVQ A;  5TPA A;  4C1U A;  2UVH A;  4IR8 A;  4RXL A;  2ZYN A;  1NH7 A;  4H1X A;  2GRV A;  3GYY A;  1PB7 A;  1JQF A;  2QS4 A;  2ZMB A;  4OFO A;  4EXK A;  1IXH A;  2ZZW A;  3KGC A;  5FHN A;  3VVD A;  1XS5 A;  2PFY A;  4H45 A;  1K9Z A;  2A5S A;  2I0B A;  4N91 A;  1YYZ A;  3Q28 A;  3H6V A;  3I6V A;  2DP8 A;  2QFL A;  3LUZ A;  2WBD A;  3RUM A;  2Q2C A;  4GVO A;  3PMV A;  3SES A;  2X26 A;  5HM4 B;  4F3P A;  3PGF A;  1NUW A;  3HHG A;  3VLU A;  4KPT A;  2Y7P A;  4U4S A;  4RK2 A;  2E1S A;  2Y84 A;  1P99 A;  1TFD A;  3D4C A;  4XTC Q;  1FRP A;  2CMO A;  3RYD A;  3CFX A;  3E3K A;  1NUX A;  1B3L A;  1D3K A;  4PAK A;  4X48 A;  5AA1 A;  1JEV A;  4QF9 A;  3IB0 A;  3IO4 A;  3MPL A;  3C4M A;  1ZJL A;  3MVX A;  5M2V A;  4RYA A;  3R26 A;  4N81 A;  4GXA A;  2WX9 A;  5JTY A;  4GRK A;  4N6P A;  1B3F A;  3VLV A;  3SKP A;  3VE1 B;  1FTO A;  2ZZV A;  1INP A;  3OO6 A;  3K0V A;  2DWI A;  3SEU A;  3WAE A;  4PFT A;  1MY1 A;  4MHF A;  4Q30 B;  4GX3 A;  1LLS A;  5L9O A;  3UP9 A;  3TOD A;  4E0W A;  1IEJ A;  4FE8 A;  4U23 A;  2DWJ A;  2AL5 A;  1HSL A;  3ONM A;  1HSE A;  3Q25 A;  1MS7 A;  1IMC A;  3O6G A;  2DOJ A;  4X1B A;  2ZYM A;  4MLV A;  4EUO A;  2DE2 A;  2YJP A;  2DVZ A;  3KOS A;  3KG2 A;  2PX1 A;  3N26 A;  2DXR A;  3ZKK A;  3DP6 A;  2PCR A;  4QRZ A;  4F39 A;  1AOV A;  3AXF A;  3MP1 A;  4ESX A;  1N0T A;  4GWS A;  4GFR A;  2F6P A;  5H8H A;  2XXX A;  1MXW A;  4RA1 A;  4NGU A;  1FBP A;  1O64 A;  3PPP A;  1GGG A;  2ZYO A;  1SI0 A;  5IM2 A;  4AS5 A;  4LP2 B;  1I6Q A;  4H0W A;  4N6K A;  4ZS9 A;  1S50 A;  5K2Y A;  4YKP A;  3I3V A;  2FIE A;  5K2X A;  3EPE A;  5IAI A;  2V25 A;  1MXX A;  3SEW A;  5CBR A;  3S4U A;  2Q74 A;  3TKD A;  3PPO A;  3PMW A;  1LBW A;  3H7M A;  4MX6 A;  1OVT A;  1YAE A;  3QK6 A;  3MVW A;  5LTC A;  2P0S A;  3K2D A;  1B9J A;  5I56 B;  4BDN A;  3E4R A;  1YZ0 A;  4HE2 A;  5BWJ A;  1PEB A;  1FCK A;  2Q9T A;  4OVR A;  4FOR A;  2PT2 A;  4OVJ A;  4PAF A;  2XXQ A;  3DP8 A;  4BDM A;  2X7Q A;  3EHS A;  5IGA A;  3T1B A;  2B4L A;  5IZ1 A;  1WOD A;  5FHM A;  5JK4 A;  3IJO B;  1ZLQ A;  1NV5 A;  5KZT A;  4U4X A;  4FJP A;  2V3Q A;  1QKB A;  5KDT A;  2G93 A;  1BKA A;  5DT6 A;  2DSF A;  3NOH A;  4ELQ A;  3QAX A;  1MM6 A;  1EU8 A;  3W15 C;  1FPL A;  4FED A;  1B2H A;  3K01 A;  3EHU A;  5JEI A;  2WEF A;  1P1Q A;  2W7Y A;  5ESY A;  1LBB A;  4OWD A;  1N3X A;  2XX9 A;  4P8B A;  3PV0 E;  3K6U A;  3S9L C;  2QMW A;  1MH3 A;  1XOC A;  2CEY A;  4N07 A;  3QUF A;  4ND9 A;  3T9X B;  1DPP A;  4X1D A;  4N8G A;  1NV0 A;  4HW8 A;  4PFI A;  3O2A A;  4IB2 A;  1B58 A;  2BJJ X;  3T66 A;  2KLF A;  1N7X A;  3OD7 A;  1EZO A;  4EQB A;  4N15 A;  1LST A;  4EXL A;  5H8Q A;  1QUK A;  4JWX A;  3RPW A;  1CNQ A;  1G0I A;  4OVP A;  1FQB A;  2ONR A;  4N8Y A;  3TUS A;  1FQE A;  4NAP A;  3TEL A;  1ANF A;  1UTH A;  3OEN A;  3MVY A;  4GL0 A;  4QSC A;  4QXD A;  3T0J A;  3W9V A;  1A8F A;  5ET8 A;  1JW5 A;  5I2K A;  4JDF A;  1Z7M E;  4AB6 A;  5I3S A;  1EYJ A;  3FBP A;  1MQI A;  4PFU A;  2ZXT A;  1B6H A;  1FPG A;  4RK9 A;  2H9B A;  3USD A;  2ABH A;  1N7W A;  2VPO A;  3M3K A;  1IXG A;  1URD A;  3B8B A;  2PYY A;  2DXY A;  3O28 A;  1Q1K A;  4HTG A;  2XD2 A;  1LBC A;  4TLL B;  1RDY A;  3IB1 A;  2B3B A;  4ELR A;  1TXF A;  3EF7 A;  3ECR A;  3TQW A;  1UIU A;  4G8H A;  3ISP A;  4LQ5 A;  3LR1 A;  4H6D A;  3B50 A;  4RNS A;  3VVE A;  5AA2 B;  5IZ3 B;  1MQG A;  3K1P A;  3EQ1 A;  4F3S A;  1B1X A;  1LAF E;  5IZZ A;  4K3F A;  2XWV A;  2REG A;  3FUZ A;  3HN0 A;  3O29 A;  3MPK A;  4Q8R A;  4H65 A;  3CFZ A;  2DWA A;  4R6K A;  1LAH E;  1O63 A;  1LB8 A;  3S2V A;  1FPK A;  4IGR A;  5HBC A;  1Y3N A;  5DYH A;  5BUU A;  4G77 A;  4OHN A;  2F7B A;  2HPG A;  4QSD A;  1B3E A;  2DE4 A;  1JNF A;  4Z7E A;  4PDH A;  5L8D A;  2F97 A;  3O9P A;  3DEL B;  3KN7 A;  2HQ0 A;  2XWK A;  2A5T B;  3I5O A;  5KCJ B;  2DWH A;  3FJM A;  2Y7K A;  4LN5 A;  1NV4 A;  3S9N C;  4OAN A;  4O3B A;  1B3G A;  1FTL A;  3M3L A;  3MWB A;  3CR9 A;  4P1E A;  3U93 A;  4G4P A; 
#chains in the Genus database with same CATH homology
 4G68 C;  1RYX A;  1IIW A;  1JET A;  1MH4 A;  4IO3 A;  3BFT A;  3N6T A;  5ITO A;  4P11 A;  4BDL A;  3CI8 A;  2G29 A;  1Y9U A;  1CB6 A;  1B51 A;  2XD3 A;  3L6G A;  3CIJ A;  2XHD A;  3G7W A;  1PB8 A;  3LSW A;  4H5F A;  4R6Y A;  1MQD A;  2F7C A;  4XKP A;  2H98 A;  4ELP A;  1B7Z A;  4Q0C A;  3TMG A;  4ISU A;  4OEV A;  4ZEI A;  3VFJ A;  2F6G A;  3K02 A;  4F29 A;  4NF4 B;  1NNP A;  1MXY A;  3GXA A;  1NKX A;  1VR5 A;  2UYF A;  1R9L A;  3V89 B;  2ALU A;  2H4I A;  3B6W A;  2UVG A;  4KCD A;  3TQL A;  4OFJ A;  1NNT A;  2FA7 A;  3KBR A;  4GOT A;  2QMX A;  3FIR A;  2XX8 A;  4BDO A;  4EQ7 A;  1VFE A;  2DYX A;  4TLM B;  1S7Y A;  1A55 A;  5EYF A;  3LC8 A;  4F1Y A;  5A5X B;  1SD3 A;  4POX A;  1PBP A;  5L9M A;  1I6B A;  2RC9 A;  4NWD A;  1OLA A;  1MXU A;  2HAV A;  5TP9 A;  2HXW A;  3TAJ A;  1DSN A;  4FIM A;  3KN8 A;  4OER A;  3KEI A;  4R74 A;  1OQH A;  1P1U A;  3IO6 A;  1D9Y A;  3P7I A;  3CSB A;  5J1D A;  3LBS A;  1VFD A;  2HCA A;  2X7P A;  2I4B A;  2DS9 A;  1PB9 A;  3H6W A;  4HS7 A;  4ZEB A;  1I69 A;  3FJ7 A;  4ZEK A;  3U1O A;  3K1N A;  4ONY A;  4XKQ A;  2Q8J A;  4O3A A;  3H6U A;  3MP6 A;  5TPA B;  1POY 1;  1LGB C;  1D9V A;  2XXV A;  5ITP A;  2O68 A;  1MPD A;  4F19 A;  4GLI A;  2ZNS A;  1MG1 A;  5FHO A;  1JVX A;  2DQV A;  3H03 A;  1RKM A;  3DM0 A;  4GIZ A;  2I48 A;  1N84 A;  4PFW A;  3VXC A;  4H5G A;  2LAO A;  2OJT A;  5CMM A;  5I58 A;  1SYI A;  1SBP A;  1M5F A;  3KZG A;  2I49 A;  5DTB A;  3CG3 A;  2I0C A;  2UVI A;  4KCC A;  4DDD A;  1GTK A;  5ICQ A;  1UTB A;  1OLC A;  1YCJ A;  1B0H A;  1NH8 A;  3B6T A;  1SW4 A;  3Q27 A;  4H8J A;  1XVY A;  3QSL A;  1A99 A;  3IOV A;  2GHA A;  2ZNU A;  3GBB A;  4I9D A;  2ANJ A;  3OO9 A;  4LZ7 A;  4XKN A;  3PPR A;  3UOR A;  5F1Q A;  1US5 A;  3RTF B;  4LUB A;  4IO2 A;  1PBQ A;  4JWO A;  4PET A;  5AA2 D;  3MZ9 A;  4UA8 A;  1A8E A;  4OZ9 A;  2P2A A;  1IXC A;  2RCB A;  2VOZ A;  1F9B A;  4OYV A;  3N6U A;  4MFI A;  4YAH X;  4NF6 A;  2NWJ A;  2WKY A;  1URS A;  5H8H B;  5H8F A;  5AE4 A;  2XXW A;  1QUJ A;  1MY2 A;  2Q89 A;  3S9M C;  4YB5 A;  1A7L A;  1GV8 A;  3PUV E;  3UIF A;  4P0I A;  3R7X A;  3FAS A;  3V5A A;  1MPC A;  1NMU A;  4ESW A;  2XX7 A;  4OES A;  3TTR A;  1P1O A;  3ZSF A;  1POT A;  2VHA A;  4POW A;  3UA8 A;  4ZE8 A;  1MY0 A;  3TTL A;  1Y4T A;  4NF5 B;  1FQA A;  1MXV A;  1MY4 A;  1M5B A;  1QVS A;  1ZBM A;  4KHZ E;  1IZ1 A;  1P1W A;  3SET A;  1B5J A;  1B46 A;  2P1S A;  2F34 A;  2NXO A;  2R9J A;  2ONS A;  2VD3 A;  4ZZA A;  3SDF A;  1OQG A;  3WAF A;  3PMX A;  4F18 A;  5I2N A;  4QFP A;  4EF2 A;  3PU5 A;  1XVX A;  4YKK A;  4GWO A;  3RN8 A;  3PUY E;  4F1V A;  3HPI A;  3W9W A;  3C31 A;  3G3K A;  5AA4 B;  3IOU A;  1FTM A;  2Z8D A;  3OEM A;  1LCF A;  2F35 A;  3KJ7 A;  4I62 A;  2V3T A;  4P0G A;  2AIX A;  1NFT A;  4ELO A;  2O6A A;  1Y1Z A;  4QHQ A;  3FAT A;  4OEN A;  2O1L A;  4BDR A;  4JSO A;  3PPN A;  4G2Z A;  3C34 A;  4R75 A;  2F5X A;  4IO4 A;  1ZU0 A;  1YTV A;  3A09 A;  4NF8 B;  4NED A;  5DVI A;  4Z0I A;  2THI A;  5DEX A;  5DVF A;  4DXU A;  4LVQ A;  3RT8 A;  3QXM A;  3K6W A;  4ECF A;  2O7U A;  1A40 A;  3KJT A;  5I2K B;  3RNN A;  1B7H A;  3H06 B;  4OQO A;  2RF1 A;  3ILT B;  3TCG A;  3TZA A;  1B0L A;  2OLB A;  3KN3 A;  5EHM A;  4OMB A;  4YMA A;  4G8N A;  4MF3 A;  1FQD A;  3F11 A;  2RIN A;  2B65 A;  3O97 A;  2XXI A;  1H43 A;  1Q35 A;  4O3C A;  4R73 A;  3IX1 A;  3Q29 A;  4LAT A;  2VGQ A;  3PD9 A;  3PPQ A;  4IO7 A;  4JSD A;  4TQU Q;  1WDN A;  2VP1 A;  4L17 A;  1JW4 A;  5IKB A;  2M8C A;  1ZIU A;  3PUW E;  3E13 X;  4PE5 B;  4YIC A;  4M1V A;  2I3V A;  3H6T A;  4R2B A;  1UIV A;  5ISU A;  2A5T A;  2I3W A;  3FV1 A;  1H3D A;  3LUY A;  3OEK A;  4G68 A;  3SEY A;  3FVG A;  1GR2 A;  2Y7W A;  1KWH A;  1SW2 A;  3CSG A;  1B3H A;  3O6I A;  1OVB A;  3VV5 A;  2GFE A;  2REJ A;  4TOZ A;  3UGW A;  1JW1 A;  2F8D A;  2D21 A;  3T96 B;  3QUJ A;  2AL4 A;  2HZL A;  4ZDM A;  1B7U A;  2UYE A;  1USY H;  4IY5 A;  2I4C A;  1DOT A;  3IOW A;  3HHF A;  4JB7 A;  1US4 A;  1B52 A;  1VSO A;  1IIT A;  1Y3Q A;  4PP0 A;  2YLN A;  2QL3 A;  5L9S A;  3ILU B;  3K1M A;  1DTG A;  2O84 X;  3G3F A;  4IO5 A;  4ZEC A;  2HZK A;  3FXU A;  1D4N A;  4QFO A;  2ZNT A;  4KQP A;  4RPN A;  3T9V A;  4XKR A;  2Z23 A;  2PT1 A;  4OET A;  4I1D A;  1LB9 A;  3ZS6 A;  3U72 A;  4QSE A;  2XXY A;  5I59 A;  1B5H A;  1B4H A;  2QRY A;  2HEU A;  4OEU A;  5H8N A;  1QUI A;  3H3G A;  4MLQ A;  2CZL A;  1SW5 A;  4Q5T A;  3CVG A;  1LCT A;  4RPO A;  1JEU A;  1QW0 A;  2O69 A;  2XXT A;  1BLF A;  1ATG A;  1N76 A;  4LQ2 A;  4DCY A;  3T22 A;  4FEC A;  4ZE9 A;  1XT8 A;  3FGS A;  4F22 A;  2OZZ A;  2FYI A;  3T9U A;  3HO7 A;  4U1O A;  1M5C A;  2PBW A;  3ODB A;  1OMP A;  3KFM A;  4PFY A;  1ZKB A;  4NTL A;  2NVU B;  5I57 B;  1BP5 A;  4THI A;  2DE3 A;  3RQT A;  1NNF A;  1URG A;  5TP9 B;  3O6H A;  1MQH A;  3DLN A;  1FQF A;  3N5L A;  3FXQ A;  2AYS A;  1PC3 A;  3BBR A;  3JYR A;  4M4G A;  2OCU A;  1LAX A;  3G3H A;  1CE2 A;  5CRY A;  1QKA A;  3MQ9 A;  4KI0 E;  3MVZ A;  4KYS A;  3OOA A;  4QFL A;  1H76 A;  4GL8 A;  1HSJ A;  4JXI A;  2QJE A;  3IOR A;  2XXR A;  3TFL A;  5FTI A;  3B7D A;  3C35 A;  1MM7 A;  3FVK A;  2F7A A;  3KSJ A;  4XXU A;  4IO6 A;  4YZZ A;  2RKM A;  3PD8 A;  3EHT A;  3N94 A;  2QS1 A;  4KD5 A;  3V83 A;  1JVY A;  2RC8 A;  3MW0 A;  4YKI A;  4OXV A;  1B40 A;  1B05 A;  3MZB A;  3GLB A;  3QIM A;  3OEL A;  2E0S A;  4UAC A;  4YKJ A;  1TFA A;  5AA3 A;  1USY E;  4F1U A;  3GZG A;  2OWS A;  5JTY B;  5I58 B;  4E0X A;  3FV2 A;  3CFL A;  3MAM A;  4WKM A;  1FQC A;  5DVJ A;  3M8U A;  2FNC A;  1LFH A;  1UTB B;  1FW0 A;  3C32 A;  3E9X A;  4RJZ A;  1PDA A;  4QFN A;  1SDX A;  3RLF E;  4KYE A;  3HV1 A;  1M5D A;  1Y20 A;  4NMY A;  4WXJ A;  4DXC A;  3IAZ A;  2OK2 A;  1FTK A;  4F31 B;  3TTK A;  4MH5 A;  2O1M A;  3IL1 B;  2Q2A A;  1UQW A;  2I6E A;  1EZP A;  1B1H A;  3MJN A;  2RC7 A;  3TCH A;  4F3G A;  2NOO A;  4KFQ A;  2IA4 A;  4LZ5 A;  1IQ7 A;  5CMK A;  1J1N A;  5I56 A;  3IK6 B;  3JZJ A;  3BFU A;  1BTJ A;  3M3F A;  4KYD A;  4X9T A;  3TCF A;  3HST A;  1MQJ A;  4F3B A;  4NF6 B;  5CI5 A;  1B4Z A;  3TYH A;  5H8F B;  4U1Z A;  1DTZ A;  2OBG A;  4FAJ A;  1LFI A;  3IR1 A;  1BIY A;  1I6A A;  4R72 A;  4F2Q A;  3C36 A;  2GHB A;  3C9H A;  3LSX A;  4NF5 A;  4KR5 A;  4DCX A;  3IJX B;  1MPB A;  3VXB A;  3ZKL A;  2PMS A;  3LSF B;  5FTH A;  2Q88 A;  3SEV A;  4PQJ A;  2PVU A;  4LZ8 A;  4GD5 A;  2F36 A;  3JV9 A;  3RY3 A;  3CRB A;  1GVC A;  4OFL A;  3IOT A;  2XXU A;  3TDJ A;  1SI1 A;  5CMB A;  4ZED A;  3K00 A;  1TT1 A;  1DMB A;  3OSQ A;  1SVX B;  3CG1 A;  5KDT B;  1B32 A;  2ONK E;  5H8S A;  4YMB A;  2Z22 A;  1YPN A;  3K6X A;  4LON B;  5AA4 A;  1FTJ A;  4JWY A;  2D3I A;  4WEP A;  3MP8 A;  4ZZE A;  3SER A;  1AMF A;  1MRP A;  2R71 A;  2B3F A;  3FVO A;  5ICT A;  2HFB A;  4YB7 A;  3MBP A;  2IEE A;  1MDP 1;  3QYT A;  5I2N B;  2VD2 A;  3UK4 A;  3KOT A;  4FAT A;  3K6V A;  4EDP A;  1MY3 A;  1RYO A;  3RGY A;  1LFG A;  2Z8E A;  3U94 A;  3K4U A;  4DLD A;  1DPE A;  3OMB A;  4NF8 A;  1QJM A;  1ZTY A;  3THI A;  3FXR A;  4GQO A;  5H8Q B;  1B5I A;  4U22 A;  3LSL A;  1O7T A;  1AIV A;  1ELJ A;  4ZEF A;  3R6U A;  3OO7 A;  5CM6 A;  2F78 A;  1UTH B;  4F2O A;  2Y7I A;  3Q26 A;  1QUL A;  1EZ9 A;  2QS3 A;  4N13 A;  3TTN A;  2D5W A;  3L6H A;  3T93 B;  5HPQ A;  4U2R A;  4MBP A;  1IUD A;  4AQ4 A;  5AA2 A;  3PUZ E;  2H99 A;  1VE4 A;  1XHY A;  1S9T A;  3B6Q A;  3OSR A;  1OIB A;  5DEX B;  1EH3 A;  1H45 A;  2QSX A;  2UXA A;  2YPN A;  2QPQ A;  3MUQ A;  2RCA A;  3G3J A;  3T9H B;  2O7I A;  4DXB A;  4IY6 A;  2NUV A;  4WED A;  1Y4C A;  2H25 A;  3EN3 A;  1N04 A;  4DZ1 A;  3VLW A;  3KSX A;  4GF8 A;  4DE8 A;  1IXI A;  2H5Y A;  3A3C A;  1MDQ A;  3G3I A;  4NWC A;  1R6Z A;  4BDQ A;  2XXH A;  3TEP A;  3SEX A;  4XIG Q;  4YB6 A;  4EF1 A;  1II5 A;  4NE4 A;  1NNK A;  4I8C A;  4GXS B;  5KCJ A;  2DVC A;  1H44 A;  4R9G A;  4AB5 A;  2QS2 A;  4JBZ A;  4G8M A;  2V93 A;  5B7D A;  1SYH A;  4FEB A;  2I58 A;  5CC2 A;  3FZV A;  3FD3 A;  4RY1 A;  2UVJ A;  1XC1 A;  3HCQ A;  5ELV A;  3MC2 A;  4R9F A;  3U8Q A;  5EHS A;  4G68 B;  1P1N A;  3O66 A;  4C1T A;  5CMC A;  1WVJ A;  1T0K A;  2Y7R A;  4H8I A;  2ZYK A;  4HCW A;  3PUX E;  1SQY A;  1LAG E;  1L5T A;  1R1N A;  1R9Q A;  2ESN A;  2Z8F A;  3TTM A;  3U92 A;  3MZ1 A;  4IGT A;  3TPA A;  4NF4 A;  5LOM A;  1Z7N E;  1NL5 A;  4H67 A;  1A54 A;  3FJG A;  5CBS A;  3RT6 B;  3D4G A;  3UN6 A;  2XXP A;  1Y3P A;  4LA9 A;  2OWT A;  4C0R A;  1Y1M A;  3A3U A;  5A5X A;  4YU0 A;  2V3U A;  3DP4 A;  1SW1 A;  4QFK A;  3OXN A;  4EQ9 A;  3V8X B;  4OTE A;  4HCY A;  5I84 A;  5I59 B;  3RTW B;  2V84 A;  5F7V A;  2O51 A;  2R6G E;  3H4Z A;  3C33 A;  1AL3 A;  3GBA A;  2HAU A;  1TWY A;  3VVF A;  1MXZ A;  5B70 A;  5H8N B;  1N3W A;  4DIG A;  1AH5 A;  4BLA A;  4R6H A;  5I57 A;  1M5E A;  3BKI B;  3FVN A;  4U21 A;  2GH9 A;  3VDF A;  1ZMG A;  3G3G A;  4R2F A;  3S9E A;  5TU0 A;  3IB2 A;  3OO8 A;  5TPA A;  4C1U A;  2UVH A;  4RXL A;  2ZYN A;  1NH7 A;  4H1X A;  2GRV A;  1PB7 A;  1JQF A;  2QS4 A;  2ZMB A;  4OFO A;  4EXK A;  1IXH A;  3KGC A;  5FHN A;  3VVD A;  1XS5 A;  2A5S A;  2I0B A;  3Q28 A;  3H6V A;  3I6V A;  2DP8 A;  3RUM A;  2Q2C A;  4GVO A;  3PMV A;  3SES A;  2X26 A;  5HM4 B;  4F3P A;  3PGF A;  3HHG A;  3VLU A;  4KPT A;  2Y7P A;  4U4S A;  4RK2 A;  2E1S A;  2Y84 A;  1P99 A;  1TFD A;  3D4C A;  4XTC Q;  2CMO A;  3CFX A;  3E3K A;  1B3L A;  1D3K A;  4X48 A;  5AA1 A;  1JEV A;  4QF9 A;  3IB0 A;  3IO4 A;  3MPL A;  3C4M A;  1ZJL A;  3MVX A;  5M2V A;  4RYA A;  3R26 A;  4GXA A;  5JTY A;  4GRK A;  4N6P A;  1B3F A;  3VLV A;  3SKP A;  3VE1 B;  1FTO A;  3OO6 A;  3K0V A;  2DWI A;  3SEU A;  3WAE A;  4PFT A;  1MY1 A;  4Q30 B;  1LLS A;  5L9O A;  3UP9 A;  3TOD A;  4E0W A;  1IEJ A;  4FE8 A;  4U23 A;  2DWJ A;  2AL5 A;  1HSL A;  3ONM A;  1HSE A;  3Q25 A;  1MS7 A;  3O6G A;  2DOJ A;  4X1B A;  2ZYM A;  4MLV A;  4EUO A;  2DE2 A;  2YJP A;  2DVZ A;  3KOS A;  3KG2 A;  2PX1 A;  3N26 A;  2DXR A;  3ZKK A;  3DP6 A;  4QRZ A;  4F39 A;  1AOV A;  3AXF A;  3MP1 A;  4ESX A;  1N0T A;  4GFR A;  2F6P A;  5H8H A;  2XXX A;  1MXW A;  4RA1 A;  1O64 A;  3PPP A;  1GGG A;  2ZYO A;  1SI0 A;  4LP2 B;  1I6Q A;  4H0W A;  4ZS9 A;  1S50 A;  5K2Y A;  4YKP A;  3I3V A;  5K2X A;  3EPE A;  5IAI A;  2V25 A;  1MXX A;  3SEW A;  5CBR A;  3S4U A;  3TKD A;  3PPO A;  3PMW A;  3H7M A;  1OVT A;  1YAE A;  3QK6 A;  3MVW A;  2P0S A;  3K2D A;  1B9J A;  5I56 B;  4BDN A;  3E4R A;  5BWJ A;  1PEB A;  1FCK A;  2Q9T A;  4FOR A;  2PT2 A;  4OVJ A;  2XXQ A;  3DP8 A;  4BDM A;  2X7Q A;  3EHS A;  1WOD A;  5FHM A;  5JK4 A;  3IJO B;  1ZLQ A;  5KZT A;  4U4X A;  4FJP A;  2V3Q A;  1QKB A;  5KDT A;  2G93 A;  1BKA A;  5DT6 A;  2DSF A;  4ELQ A;  3QAX A;  1MM6 A;  1EU8 A;  3W15 C;  4FED A;  1B2H A;  3K01 A;  3EHU A;  5JEI A;  1P1Q A;  2W7Y A;  1LBB A;  4OWD A;  1N3X A;  2XX9 A;  3PV0 E;  3K6U A;  3S9L C;  2QMW A;  1MH3 A;  1XOC A;  4N07 A;  3QUF A;  4ND9 A;  3T9X B;  1DPP A;  4X1D A;  4HW8 A;  3O2A A;  4IB2 A;  1B58 A;  2BJJ X;  3T66 A;  2KLF A;  1N7X A;  3OD7 A;  1EZO A;  4EQB A;  1LST A;  4EXL A;  5H8Q A;  1QUK A;  4JWX A;  3RPW A;  1FQB A;  2ONR A;  3TUS A;  1FQE A;  3TEL A;  1ANF A;  1UTH A;  3OEN A;  3MVY A;  4GL0 A;  4QSC A;  3W9V A;  1A8F A;  1JW5 A;  5I2K A;  4JDF A;  1Z7M E;  4AB6 A;  1MQI A;  4PFU A;  2ZXT A;  1B6H A;  4RK9 A;  2H9B A;  3USD A;  2ABH A;  1N7W A;  3M3K A;  1IXG A;  1URD A;  2PYY A;  2DXY A;  3O28 A;  1Q1K A;  4HTG A;  2XD2 A;  1LBC A;  4TLL B;  3IB1 A;  2B3B A;  4ELR A;  1TXF A;  3EF7 A;  3ECR A;  3TQW A;  1UIU A;  4G8H A;  4LQ5 A;  3LR1 A;  4H6D A;  4RNS A;  3VVE A;  5AA2 B;  1MQG A;  3K1P A;  3EQ1 A;  4F3S A;  1B1X A;  1LAF E;  4K3F A;  2REG A;  3FUZ A;  3HN0 A;  3O29 A;  3MPK A;  4Q8R A;  4H65 A;  3CFZ A;  2DWA A;  4R6K A;  1LAH E;  1O63 A;  1LB8 A;  3S2V A;  4IGR A;  5HBC A;  1Y3N A;  5DYH A;  5BUU A;  4G77 A;  4OHN A;  2F7B A;  4QSD A;  1B3E A;  2DE4 A;  1JNF A;  4Z7E A;  5L8D A;  2F97 A;  3O9P A;  3DEL B;  3KN7 A;  2HQ0 A;  2A5T B;  3I5O A;  5KCJ B;  2DWH A;  3FJM A;  2Y7K A;  3S9N C;  4O3B A;  1B3G A;  1FTL A;  3M3L A;  3MWB A;  3CR9 A;  3U93 A;  4G4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...