4IO2A

Crystal structure of the avglur1 ligand binding domain complex with glutamate at 1.37 angstrom resolution
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
248
structure length
242
Chain Sequence
GSARLKGITLRIGVIESVPFTIVANVNTTKLTGYVLDLIEYLRDKMGFVADVQLAPPNTSYTGLVLALANGDYDIAIGDITVTSARREIVAFSNSISDNSMRILMRKGTLIDGMDDLKNGKIPYNRIGIRIGTAGEDYYLREISGGSRNFYPLKSRQEMYDSLLAGIIDVSFMDIGTAEYVTNNIYCNLTLVGEDFDKSTFGIVTPKEWLYAKDLDVNILSLRETGILDNLKKKWFQTKACP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Glutamate receptor 1
publication title Anions Mediate Ligand Binding in Adineta vaga Glutamate Receptor Ion Channels.
pubmed doi rcsb
source organism Adineta vaga
total genus 78
structure length 242
sequence length 248
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io2A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4io2A02
3C32A 2Q89A 3F11A 1MRPA 2H4IA 1UTBA 4FIMA 3IL1B 1Y4TA 1Y1ZA 1MXVA 1IITA 3BKIB 4RYAA 3S9LC 1EZPA 3FJMA 3TTNA 3VLWA 3DP8A 2HEUA 5ITOA 1B7UA 3TELA 4TLLB 5K2XA 1DPEA 3M8UA 4QSEA 5I59B 3TQWA 3KN3A 2ZXTA 4BDMA 1TT1A 4FE8A 4XKPA 4P0GA 2ZYOA 1LFGA 3GXAA 4IO4A 2VD3A 3FUZA 3ZKLA 3IR1A 3O66A 3B7DA 2I4CA 2KLFA 3SERA 3PU5A 1B05A 4F1YA 2F7CA 1MQIA 5DVIA 3RY3A 5DT6A 1B52A 1D9YA 1FQBA 3KFMA 1MDP1 1ELJA 1N76A 3U8QA 4OWDA 4RPNA 3MUQA 4NF5B 3UA8A 1A8FA 4KR5A 3CG1A 1D3KA 4H5GA 3THIA 4IY6A 3WAFA 3O2AA 2ONRA 3B6QA 1EZOA 1IXCA 5J1DA 3HHFA 3G3KA 3QIMA 3OSQA 1I6AA 4JWYA 4MLQA 4WXJA 1PB7A 1P1QA 3RPWA 3FVOA 3G3IA 5CI5A 1SW4A 3ONMA 2DE3A 2PVUA 4QFKA 4GLIA 3TEPA 2G29A 3IB0A 1QW0A 1GR2A 3FASA 1IXHA 2PT2A 1OVTA 3OENA 5I57B 1Z7ME 1I6QA 3A3UA 2D3IA 1BIYA 4NF8B 1Z7NE 4YB7A 2I0BA 4G68C 1TFDA 4DXBA 3H3GA 5F7VA 1MXUA 2QL3A 1Y3NA 2Q9TA 2W7YA 4ZZEA 5HPQA 2X7PA 3V83A 4OFOA 1XT8A 4DIGA 5LOMA 2H98A 5AA4A 1IXIA 4PFTA 4ZEKA 5KDTA 2XXQA 3E3KA 2F35A 4F3PA 3T9UA 3IJOB 3T22A 2F6PA 2DXRA 4ND9A 4JSDA 1US4A 2DE2A 4WEDA 3K00A 3EHSA 2F5XA 3OO9A 3H6TA 5HM4B 3PMXA 4ESXA 1A8EA 3ZKKA 2RINA 4JDFA 4Z7EA 2ZNTA 5KCJA 2ONKE 4RA1A 3A3CA 4G8MA 3K02A 5DVJA 3G3JA 3KGCA 1UIVA 1XOCA 4XXUA 1A54A 4O3BA 4ZEBA 1B7ZA 1LCFA 1JNFA 4POWA 3TTKA 2D5WA 2VD2A 4U4SA 5I2NB 2ZMBA 1GTKA 2QPQA 1Q1KA 2X26A 4X1DA 1J1NA 2D21A 3IJXB 4LQ5A 3U92A 1LLSA 1A55A 5DEXA 3SEWA 1B7HA 1MH3A 2VP1A 4EQ7A 1P1OA 1SQYA 2DP8A 3Q25A 1ZJLA 1DMBA 3MZBA 2XX8A 4H8JA 4IO2A 3KSJA 2O69A 1BTJA 3QUJA 3PMWA 5TPAB 3PPOA 1MY2A 3PUYE 2O68A 4U22A 3DELB 4O3CA 2X7QA 1M5BA 2RCAA 3IX1A 4H1XA 4FATA 4QRZA 3QYTA 5L9OA 4QSDA 5AA1A 5FHNA 3W9VA 3OEKA 1N0TA 2F34A 1DTGA 4THIA 3IK6B 3MVXA 2XHDA 3K4UA 2E1SA 4Q30B 4G8HA 4LUBA 1MY1A 4U4XA 2I58A 3ZS6A 2Q2AA 4QSCA 1Y9UA 1H44A 1IEJA 4F19A 3K1NA 4KCCA 5M2VA 4BDLA 1FTJA 3EF7A 4R6HA 1D9VA 4GWOA 5DEXB 2M8CA 4M4GA 3UK4A 1JW4A 5ISUA 2DQVA 2XXUA 3SKPA 3EN3A 4R75A 4JWXA 1QUJA 2OLBA 2XX9A 3MQ9A 3N6TA 2PYYA 3CRBA 2Y7KA 3MZ9A 4BDQA 3MPLA 3TTMA 4R2BA 5H8NB 2E0SA 1JW1A 2YJPA 3H03A 1MG1A 5BUUA 2NXOA 3SDFA 2I4BA 2XXPA 5AA2A 5L9SA 1ZBMA 2V3TA 3FJGA 1EU8A 3TFLA 4LQ2A 3ODBA 4BDNA 1B1HA 1FQFA 3TZAA 4MF3A 1QUKA 3PV0E 1IQ7A 2V25A 1MDQA 1GVCA 4ZDMA 1SI1A 4F2OA 1NH7A 4KYEA 1MM6A 1SI0A 3C4MA 1ZMGA 3PMVA 1AOVA 4FAJA 1OQHA 4PP0A 3EPEA 2F78A 3T66A 4EXKA 3O6HA 3OSRA 4NF6A 1N3XA 2XXHA 4KFQA 4ZECA 1B4ZA 3ECRA 1Y3PA 4QF9A 3RUMA 2FNCA 5JTYA 2QMXA 4R2FA 1II5A 1DTZA 5ICTA 3KG2A 3C35A 1FTKA 1LFIA 2A5SA 2Y7IA 4YB6A 5H8HA 2F6GA 5A5XA 4OESA 2I6EA 2DWIA 1MY4A 3LSXA 1PC3A 3CR9A 1FQAA 4Z0IA 1YPNA 3N26A 3FZVA 2H9BA 3MW0A 4F3BA 1M5DA 2ONSA 1NNKA 3VLVA 3Q27A 3IOTA 3CSBA 4H5FA 1SBPA 4OFJA 1PBQA 4HCYA 3VVEA 1EZ9A 3H7MA 3HCQA 1PBPA 1HSLA 1B3LA 4NE4A 4QFLA 2DXYA 1LGBC 3GBBA 3T9HB 3K6UA 3KOTA 4EQBA 4OEUA 4OHNA 2Z8EA 1M5FA 2Q2CA 3EHTA 4C1TA 3FXQA 1B9JA 1TXFA 4IO5A 1UTHA 1L5TA 1FQCA 4ELRA 4QFOA 2H99A 3BFUA 3IAZA 3A09A 3QXMA 2R71A 1MXWA 2XXTA 5IKBA 1ZTYA 1OLCA 2O84X 1RYXA 3K01A 1US5A 5JTYB 3S4UA 4AB5A 2HCAA 4OVJA 4FEDA 4TOZA 3TAJA 4PFWA 3FJ7A 1MXYA 3LSFB 3MP6A 4MBPA 1B6HA 4PQJA 2QS3A 2XXWA 4KQPA 4GL8A 4F22A 3FV2A 2B3FA 4F1UA 4ZEDA 3Q26A 5CBRA 1JVYA 2OZZA 3CG3A 3G3GA 1UTBB 3SESA 1SW1A 4G77A 4G8NA 4X48A 4FECA 1POTA 4OTEA 2HAUA 4GFRA 2UVIA 1XC1A 2F97A 3W9WA 1FW0A 2XD2A 3O6IA 1LBBA 2V3UA 2Z8DA 3RLFE 4AQ4A 2Z23A 1ZLQA 2ESNA 2DSFA 5B7DA 3I3VA 1JEUA 4HW8A 1VFDA 3H6WA 4U23A 4YB5A 2ZYMA 4R73A 1F9BA 3KOSA 1P1WA 4K3FA 1VSOA 3S9EA 4LZ8A 2O1LA 3K6VA 4YKPA 3CSGA 2I3WA 1Y1MA 1FTMA 4ZEIA 1AH5A 4R9FA 3QUFA 2DE4A 5I58A 4XKRA 2NOOA 4EQ9A 4PFYA 1MQHA 2XXVA 3K1PA 4YAHX 4EDPA 1SD3A 4I1DA 1B4HA 3TCHA 3ILTB 5JEIA 5HBCA 3SEXA 2UYFA 4NEDA 4JSOA 4JXIA 3CIJA 3C9HA 3IORA 3FVKA 3OOAA 4I9DA 3FXUA 4ISUA 2IEEA 1AIVA 1FCKA 3L6HA 3MZ1A 1Y20A 1XVXA 3MP1A 3MPKA 3SEYA 4QFPA 4ELQA 1OVBA 3MAMA 1P1NA 4RK2A 1USYH 2UYEA 1S7YA 3AXFA 1SYIA 2WKYA 3KZGA 2YPNA 2DVCA 2FA7A 3O29A 2HFBA 2ZNSA 1HSEA 1QULA 4ZEFA 4YKKA 1SDXA 4ESWA 1SYHA 1DSNA 5AA4B 2O6AA 5AE4A 5KDTB 2F7BA 4DDDA 3CFXA 5EHMA 3K6WA 2NVUB 2QS4A 5I56A 3OO7A 1H45A 3HN0A 3QK6A 3RGYA 3KJ7A 1MPBA 3HSTA 1OMPA 1VFEA 3PUVE 3VXBA 2Y7PA 4UA8A 4X1BA 3K6XA 4DE8A 1PEBA 2Z8FA 2G93A 5KCJB 3IO6A 1JW5A 5CM6A 4R6YA 4F1VA 1N7WA 1QUIA 1TWYA 3HPIA 1ZU0A 3PD9A 4G68A 2ZYNA 1A99A 2I0CA 3D4GA 4IY5A 5B70A 2R9JA 3VXCA 1B5HA 2DS9A 4GRKA 4NF4A 4ZS9A 4GXSB 2XD3A 3JZJA 1UIUA 3KEIA 1YAEA 1B2HA 2XXIA 4ZE8A 5H8FA 4OENA 1Y3QA 3DP4A 1B51A 3C33A 5DTBA 1MPCA 3H4ZA 2REJA 1NMUA 4C0RA 4RK9A 4JB7A 4R9GA 3RT8A 3FVNA 5H8QA 3TODA 3MVYA 4WEPA 2F7AA 1PDAA 1XHYA 3L6GA 4GIZA 4E0WA 3FVGA 3PPQA 1LAFE 2QSXA 1POY1 4L17A 3GLBA 3PUXE 3CVGA 1OQGA 2OBGA 1S50A 2PBWA 4EF1A 3GZGA 4BLAA 2O7IA 3C31A 2A5TA 1NFTA 1WODA 1UQWA 2YLNA 3UP9A 4GL0A 5IAIA 2ANJA 1NKXA 2OWSA 3VLUA 2I49A 1BLFA 1H3DA 2RC7A 3TUSA 1O63A 2B3BA 2BJJX 1PB9A 3R26A 4WKMA 3S2VA 1LAHE 4F31B 3TTRA 5L8DA 3V5AA 1DOTA 3H6VA 2GFEA 4IGRA 4Q5TA 1A40A 3E4RA 2OWTA 1LCTA 3RTFB 3O9PA 2FYIA 5H8FB 1URSA 4PETA 1Y4CA 4YICA 4OFLA 3IO4A 4N6PA 2PMSA 5H8SA 4KCDA 2QRYA 5I59A 1VE4A 3Q29A 1B5IA 4OZ9A 2XXYA 3PPPA 4QHQA 4Q8RA 3QAXA 4GVOA 3RN8A 2DWJA 4FJPA 4U1OA 3WAEA 1URDA 3CFLA 2OCUA 3KBRA 3M3KA 1QJMA 1H43A 4ECFA 4GF8A 5ELVA 4N13A 2ALUA 1RKMA 1NNPA 1FQDA 1N3WA 1N7XA 4NWCA 5AA2B 3B6WA 1B3GA 3K0VA 3PPRA 2XXRA 5DYHA 1MY3A 4NF5A 3T9XB 3LBSA 3MVZA 5I2KA 5KZTA 3TCGA 1JETA 3T9VA 3UN6A 3TDJA 3Q28A 3ILUB 5CMMA 1ZKBA 1B3HA 5AA2D 3USDA 1LSTA 4JWOA 3RQTA 3S9MC 2NWJA 1ATGA 2CZLA 5CC2A 1FQEA 3LUYA 3MBPA 4H0WA 4OERA 3ZSFA 4R74A 5CMCA 2QS2A 3MJNA 3T93B 4ELOA 1LFHA 3PGFA 3U1OA 2R6GE 4OETA 3HHGA 4NF6B 4DXUA 3QSLA 5TP9A 3TPAA 4F18A 3BFTA 5I57A 3LR1A 4DCYA 4MH5A 4NF8A 2Y84A 1O7TA 3PUWE 2PX1A 3IOVA 4GXAA 1N84A 2O7UA 5H8HB 5A5XB 2P2AA 4LA9A 2ABHA 4IO7A 3FD3A 1GGGA 3V8XB 4IGTA 1AMFA 4G2ZA 2DWAA 1IXGA 4ELPA 4G4PA 2GRVA 1QKAA 5I2KB 3K2DA 2GHAA 3KN7A 1R9QA 2DYXA 4P0IA 2AYSA 3TKDA 1GV8A 4RXLA 4LVQA 4YMAA 2NUVA 4NMYA 2V84A 1LBCA 3R6UA 2QS1A 4F2QA 3VDFA 5BWJA 1LB8A 5K2YA 2Z22A 1B0LA 4YMBA 3E13X 1OLAA 2RKMA 1B32A 3VVDA 2F36A 5DVFA 4RPOA 5FTHA 2B65A 1MS7A 1UTHB 3OD7A 2UVHA 1FTLA 1R9LA 4TQUQ 3OXNA 3K1MA 2HZKA 3FIRA 5TP9B 5I2NA 1PB8A 1MPDA 3MWBA 4KHZE 4X9TA 4TLMB 4YZZA 1P1UA 4EUOA 2DOJA 4EF2A 4ZZAA 4YKJA 3DP6A 2QMWA 4E0XA 1RYOA 3OO8A 2V3QA 1S9TA 4O3AA 1VR5A 2F8DA 2GH9A 3H06B 1H76A 1SW2A 1USYE 1LB9A 2H25A 3W15C 4F3SA 3T96B 3PD8A 5TPAA 1EH3A 1YCJA 3G7WA 4BDOA 3PUZE 4U1ZA 4DCXA 1N04A 4ZE9A 3IB1A 2UVJA 1WVJA 3U94A 5L9MA 3FV1A 4R72A 3N5LA 3N6UA 3OMBA 3IOWA 4KYDA 1MY0A 1URGA 2H5YA 4P11A 4F39A 5ICQA 3EHUA 3I5OA 1JEVA 1T0KA 1YTVA 3HV1A 1HSJA 1TFAA 4UACA 5EYFA 1M5EA 4OXVA 4BDRA 1QVSA 1FTOA 1MH4A 4M1VA 1SW5A 3JV9A 3RNNA 5ITPA 2AIXA 4RNSA 3MVWA 1ZIUA 4YKIA 2Q88A 5EHSA 3LSWA 4OMBA 4HTGA 3G3HA 4H67A 3SETA 3TCFA 1KWHA 1MM7A 5CMBA 1B1XA 1P99A 1B58A 2UVGA 4IB2A 4I8CA 1JVXA 3C34A 2DVZA 1B3EA 3CFZA 3U72A 2ZNUA 3M3FA 5I84A 5I58B 2XX7A 3C36A 4YU0A 3TQLA 3M3LA 2DWHA 3O97A 2QJEA 3RT6B 3VE1B 1B0HA 3FGSA 3U93A 4OEVA 3OEMA 2Q8JA 5AA3A 4Q0CA 2OJTA 4OYVA 1OIBA 3B6TA 3I6VA 4F3GA 2REGA 3D4CA 2HXWA 3RTWB 4PFUA 2Y7RA 5H8NA 3VFJA 4POXA 3UORA 3UGWA 1BP5A 1I69A 4FORA 3UIFA 5FHMA 3O6GA 4I62A 4GQOA 5FHOA 4XKQA 2THIA 1MQJA 4U21A 3SEUA 4JBZA 5FTIA 4LATA 3VVFA 4RY1A 5CMKA 2HZLA 2HAVA 5JK4A 3MC2A 1MQDA 4ONYA 2I3VA 4NWDA 2CMOA 1MXXA 4IO3A 3KSXA 4GD5A 4R6KA 2RC9A 3KJTA 3OELA 4XIGQ 5I56B 2XXXA 3G3FA 3LC8A 1O64A 3JYRA 4LP2B 4HS7A 1BKAA 4LZ5A 4AB6A 3KN8A 2I48A 3PPNA 1D4NA 2O51A 3DM0A 2RF1A 1R6ZA 3IOUA 5F1QA 3GBAA 1A7LA 1MXZA 4H8IA 5CBSA 4DZ1A 4OQOA 2AL4A 1XS5A 1M5CA 1IZ1A 4H6DA 4G68B 1IIWA 1B5JA 3VV5A 4MLVA 1I6BA 3IB2A 4KI0E 2P0SA 4KD5A 2VGQA 4EXLA 4PE5B 4QFNA 4HCWA 4NF4B 2AL5A 2LAOA 4GOTA 4F29A 2PT1A 1CB6A 4U2RA 1R1NA 1QKBA 1NL5A 2VOZA 1WDNA 3LSLA 4N07A 3MP8A 2UXAA 4DXCA 3P7IA 2OK2A 4LONB 3FXRA 4DLDA 1MQGA 3N94A 4C1UA 5CRYA 2P1SA 4NTLA 3TTLA 3FATA 3DLNA 4KYSA 5H8QB 3H6UA 2RCBA 1ANFA 1B3FA 1LAGE 1Q35A 3CI8A 3HO7A 3EQ1A 5TU0A 1XVYA 4IO6A 1DPPA 2VHAA 1NNTA 2ZYKA 4FEBA 4H65A 3V89B 1SVXB 1B40A 4RJZA 3R7XA 2GHBA 3TYHA 4MFIA 3TMGA 3O28A 4XKNA 2HQ0A 3BBRA 1NH8A 3S9NC 3OO6A 1LAXA 2V93A 1AL3A 2O1MA 2A5TB 4XTCQ 1IUDA 2Y7WA 1NNFA 3SEVA 2IA4A 1JQFA 4LZ7A 1B46A 2RC8A 3E9XA 4KPTA 1CE2A
chains in the Genus database with same CATH superfamily
3C32A 2Q89A 3F11A 2HXRA 1LBXA 1MRPA 2H4IA 1UTBA 4FIMA 3IL1B 4PTKA 5IZ3A 1Y4TA 1Y1ZA 4N15A 1MXVA 1IITA 3BKIB 4RYAA 4MMPA 3S9LC 1EZPA 3FJMA 3TTNA 3VLWA 3DP8A 1FPFA 2HEUA 1LBVA 3BIGA 2F3DA 5ITOA 1B7UA 3TELA 4TLLB 5K2XA 4PFIA 1DPEA 3M8UA 4QSEA 5I59B 3TQWA 3KN3A 4PAIA 2ZXTA 4GWYA 4BDMA 1TT1A 4FE8A 4XKPA 4P0GA 2ZYOA 1LFGA 4KXPA 3GXAA 4IO4A 2VD3A 2Y5LA 3FUZA 3ZKLA 4PC9A 3IR1A 3O66A 4IR8A 3B7DA 2I4CA 2KLFA 3SERA 3PU5A 1B05A 4F1YA 2F7CA 1MQIA 5DVIA 3RY3A 5DT6A 1B52A 1D9YA 1FQBA 3KFMA 1MDP1 1ELJA 1N76A 3U8QA 4OWDA 4RPNA 3MUQA 4NF5B 3UA8A 1A8FA 4KR5A 3CG1A 1D3KA 3U65A 4H5GA 3THIA 4IY6A 3WAFA 3O2AA 2ONRA 3B6QA 1EZOA 5EYGA 1IXCA 5J1DA 3KBZA 3HHFA 3G3KA 1FPIA 3QIMA 3OSQA 1I6AA 4JWYA 4MLQA 4WXJA 1PB7A 1P1QA 4PFBA 3RPWA 1D9QA 3FVOA 3G3IA 5CI5A 1SW4A 4GWWA 3ONMA 2DE3A 2PVUA 4QFKA 1NV3A 4GLIA 3TEPA 2G29A 3IB0A 1QW0A 1GR2A 4HE0A 3FASA 1IXHA 1FSAA 2PT2A 1OVTA 1FBPA 3OENA 5I57B 1Z7ME 1I6QA 3A3UA 2D3IA 4NF8B 1BIYA 1FBEA 1Z7NE 4YB7A 2I0BA 4G68C 1TFDA 5FBPA 4DXBA 3H3GA 5F7VA 1MXUA 2QL3A 1Y3NA 2Q9TA 2W7YA 4ZZEA 5HPQA 2X7PA 3V83A 4OFOA 1XT8A 4DIGA 5LOMA 2H98A 5EQ7A 1FBHA 5AA4A 1IXIA 4PFTA 4ZEKA 5KDTA 2XXQA 3E3KA 2F35A 4F3PA 3T9UA 3IJOB 3T22A 2F6PA 2DXRA 4ND9A 4JSDA 1US4A 2DE2A 4WEDA 3K00A 3EHSA 2F5XA 3OO9A 3H6TA 1KA0A 5HM4B 3PMXA 4XEQA 4ESXA 1A8EA 3ZKKA 4PDDA 2RINA 4JDFA 4Z7EA 2ZNTA 5KCJA 2ONKE 2CEYA 4RA1A 3A3CA 4G8MA 3RPLB 4I3YA 3K02A 5DVJA 3G3JA 3KGCA 1UIVA 1XOCA 3MSTA 4XXUA 1A54A 4O3BA 4ZEBA 1B7ZA 1LCFA 1FPBA 1JNFA 4POWA 3TTKA 4FBPA 2D5WA 2VD2A 1FJ6A 4U4SA 5I2NB 1IMEA 2ZMBA 1GTKA 2QPQA 1Q1KA 2QVRA 2X26A 4MAGA 4X1DA 1J1NA 2D21A 3IJXB 4QXDA 4LQ5A 3U92A 1LLSA 1A55A 5DEXA 3SEWA 4N6KA 1B7HA 1MH3A 4P47A 2VP1A 4EQ7A 1P1OA 1SQYA 2DP8A 3Q25A 1ZJLA 1DMBA 3MZBA 2XX8A 4H8JA 4IO2A 3KSJA 2O69A 1BTJA 3QUJA 3PMWA 5TPAB 3PPOA 1MY2A 3PUYE 2O68A 4U22A 3DELB 3A29A 4O3CA 2X7QA 1M5BA 4QBAA 2RCAA 3IX1A 4H1XA 4FATA 4QRZA 3QYTA 5L9OA 3NOHA 4QSDA 1RDZA 5AA1A 5FHNA 3W9VA 3GYYA 3OEKA 1N0TA 2F34A 1DTGA 4THIA 3IK6B 3MVXA 2XHDA 3K4UA 2B4MA 2E1SA 4Q30B 2FIEA 4G8HA 4AS4A 4PF8A 4LUBA 1MY1A 3E79A 4U4XA 2I58A 3ZS6A 2Q2AA 4QSCA 4NX1A 1Y9UA 1H44A 1IEJA 4F19A 3K1NA 4KCCA 5M2VA 4BDLA 1FTJA 3EF7A 4R6HA 1D9VA 4I40A 4GWOA 4XFEA 5DEXB 2M8CA 2QVVA 4M4GA 4PF6A 1JW4A 3UK4A 5ISUA 2DQVA 2XXUA 3SKPA 1QGXA 3EN3A 4R75A 4JWXA 1QUJA 2OLBA 2XX9A 3MQ9A 3N6TA 5DW8A 2PYYA 3CRBA 2Y7KA 3MYUA 3MZ9A 4BDQA 3MPLA 3TTMA 3FBPA 4G61A 4R2BA 2Q74A 4NAPA 5H8NB 2E0SA 1JW1A 2YJPA 3H03A 1MG1A 5BUUA 2NXOA 3SDFA 2I4BA 2XXPA 4O94A 5AA2A 5L9SA 1ZBMA 2V3TA 3FJGA 1EU8A 3TFLA 3BIHA 4LQ2A 3ODBA 4BDNA 1B1HA 1FQFA 3TZAA 4MF3A 1QUKA 3LUZA 3T0JA 3PV0E 1IQ7A 2V25A 1MDQA 1GVCA 4ZDMA 1SI1A 4F2OA 1NH7A 4KYEA 1MM6A 4N81A 1SI0A 3C4MA 1ZMGA 3PMVA 1AOVA 4FAJA 4X04A 1OQHA 4PP0A 2XWOA 3EPEA 2F78A 3T66A 2PFZA 4EXKA 3O6HA 4NHBA 2PFYA 3OSRA 4NF6A 1N3XA 2XXHA 4KFQA 1YYZA 4ZECA 1B4ZA 3IFCA 3ECRA 1Y3PA 2VPNA 4QF9A 3RUMA 5ESYA 2FNCA 5JTYA 2QMXA 2VPOA 2XXKA 4R2FA 1II5A 1DTZA 5ICTA 3KG2A 3C35A 1FTKA 1LFIA 2GQ1A 3IFAA 4X8RA 1NV7A 2A5SA 2Y7IA 4YB6A 4N91A 1NUYA 5H8HA 2F6GA 5A5XA 4OESA 2I6EA 2DWIA 4MNPA 1YXIA 1MY4A 3LSXA 1PC3A 3CR9A 1FPKA 1FQAA 4Z0IA 2WBDA 1YPNA 2PCRA 3N26A 3FZVA 2H9BA 3MW0A 4F3BA 1M5DA 4OVSA 2ONSA 1NNKA 3VLVA 1DBZA 3Q27A 3IOTA 3CSBA 4H5FA 1RDXA 2CZHA 1SBPA 4OFJA 1PBQA 4HCYA 3VVEA 1EZ9A 3H7MA 3HCQA 1PBPA 1HSLA 1B3LA 4QFLA 4NE4A 2DXYA 1LGBC 2WX9A 3GBBA 3T9HB 4HE2A 3K6UA 3KOTA 4EQBA 4OEUA 4OHNA 1K9YA 2Z8EA 1M5FA 2Q2CA 3EHTA 4C1TA 3FXQA 1B9JA 1TXFA 2VT5A 4IO5A 1UTHA 1L5TA 1FQCA 4ELRA 4QFOA 2H99A 3BFUA 3IAZA 3A09A 3QXMA 2R71A 1MXWA 2XXTA 2FVZA 3T1BA 1INPA 5IKBA 1IMCA 1ZTYA 1OLCA 2O84X 1RYXA 3K01A 1US5A 5JTYB 3S4UA 4AB5A 4OVRA 2HCAA 4OVJA 1EYIA 4FEDA 4TOZA 3TAJA 4PFWA 3CHGA 3FJ7A 1MXYA 3LSFB 3MP6A 1IMFA 4MBPA 1B6HA 4PQJA 2QS3A 2XXWA 4KQPA 4GL8A 4F22A 3FV2A 2B3FA 5LDZA 4F1UA 4ZEDA 4MJOA 3Q26A 5CBRA 1JVYA 2OZZA 3CG3A 3G3GA 1UTBB 3SESA 5F24A 1SW1A 4G77A 5IZ3B 4G8NA 1FBDA 4X48A 4FECA 1POTA 1XI6A 4OTEA 2HAUA 2MKZA 4GFRA 2UVIA 1XC1A 2F97A 3W9WA 1FW0A 2XD2A 3O6IA 1LBBA 3E78A 2V3UA 2Z8DA 3RLFE 4AQ4A 2Z23A 1ZLQA 2ESNA 2DSFA 5B7DA 3I3VA 1JEUA 4HW8A 1Q9DA 4MX6A 1VFDA 3H6WA 4U23A 4YB5A 2ZYMA 4R73A 1F9BA 3KOSA 1LEVA 1P1WA 4K3FA 1VSOA 3S9EA 4LZ8A 2L5VA 2O1LA 3K6VA 4P1EA 2WBBA 4YKPA 3CSGA 4P9KA 2I3WA 1Y1MA 1FTMA 4ZEIA 1AH5A 4R9FA 3QUFA 2DE4A 5I58A 4XKRA 2NOOA 4EQ9A 4PFYA 1MQHA 3KC0A 2XXVA 3K1PA 4YAHX 4EDPA 1SD3A 4I1DA 1B4HA 4GX3A 3TCHA 1NV2A 3ILTB 5JEIA 5HBCA 3SEXA 2UYFA 4NEDA 4JSOA 4JXIA 3CIJA 3C9HA 3IORA 3FVKA 3OOAA 4PCDA 4I9DA 5EYHA 3FXUA 4ISUA 4DI4B 2IEEA 1AIVA 1FCKA 3L6HA 3MZ1A 1Y20A 1XVXA 3MP1A 3MPKA 3SEYA 4NG7A 4QFPA 4ELQA 1OVBA 3MAMA 1P1NA 4RK2A 1USYH 2UYEA 1S7YA 3AXFA 3B50A 1SYIA 2WKYA 3KZGA 2YPNA 5IM2A 5ET7A 2F3BA 4N6DA 2DVCA 2FA7A 3O29A 2HFBA 2ZNSA 1HSEA 1QULA 4ZEFA 4GWZA 4YKKA 1SDXA 4AS5A 4ESWA 1SYHA 3LV0A 1DSNA 2OWZA 5AA4B 2O6AA 5AE4A 5KDTB 2F7BA 4DDDA 3CFXA 5EHMA 3K6WA 2NVUB 2QS4A 5I56A 3OO7A 3SZPA 4OANA 1H45A 1EYKA 3HN0A 3QK6A 3RGYA 3KJ7A 4NGUA 1MPBA 3HSTA 1OMPA 1VFEA 3PUVE 3VXBA 2Y7PA 2BJIA 4UA8A 4X1BA 3K6XA 4DE8A 1PEBA 2Z8FA 2G93A 4PBHA 5KCJB 3IO6A 1JW5A 2WYKA 5CM6A 4R6YA 4F1VA 1N7WA 4JVCA 1QUIA 1TWYA 3HPIA 1ZU0A 3PD9A 4G68A 2ZYNA 1A99A 2I0CA 3D4GA 4IY5A 5B70A 2R9JA 3VXCA 2WEFA 1B5HA 2DS9A 4GRKA 4NF4A 4ZS9A 4GXSB 2QFLA 2XD3A 3JZJA 4P3LA 1UIUA 1FBCA 3KEIA 1YAEA 1B2HA 1FTAA 2XXIA 1NV0A 5ET5A 4ZE8A 5H8FA 4OENA 1Y3QA 3DP4A 1KZ8A 1B51A 3C33A 5DTBA 1MPCA 3H4ZA 2Q8MA 2REJA 1NMUA 4C0RA 2FIXA 4RK9A 4JB7A 4R9GA 3RT8A 3FVNA 5H8QA 3TODA 3MVYA 4JVDA 4WEPA 2F7AA 1PDAA 2XWIA 1XHYA 3L6GA 4GIZA 1IMAA 1FRPA 4E0WA 3FVGA 3PPQA 4MHFA 1LAFE 2QSXA 1POY1 4L17A 3GLBA 3PUXE 3CVGA 1OQGA 4NQ8A 2OBGA 1S50A 2ZZXA 2PBWA 4EF1A 3GZGA 4BLAA 2O7IA 3C31A 2A5TA 1NFTA 1WODA 1UQWA 2DDKA 2YLNA 4GL0A 3UP9A 5IAIA 2ANJA 1NKXA 1FPEA 2OWSA 3VLUA 2I49A 1BLFA 1H3DA 2RC7A 4JVIA 3TUSA 4N4UA 1O63A 2B3BA 1G0HA 1FPJA 4P1LA 2BJJX 1PB9A 3R26A 4WKMA 3S2VA 1LAHE 2ZZWA 4F31B 3TTRA 5L8DA 3V5AA 1DOTA 3H6VA 2GFEA 4IGRA 4Q5TA 1A40A 3E4RA 2OWTA 1LCTA 3RTFB 1FPDA 3O9PA 2FYIA 5H8FB 1URSA 3B8BA 4PETA 1Y4CA 4YICA 4OFLA 4P8BA 3IO4A 4N6PA 2PMSA 1NV4A 5H8SA 1FJ9A 4KCDA 4GWXA 2QRYA 5I59A 1VE4A 3Q29A 1B5IA 4OZ9A 2XXYA 3PPPA 4QHQA 4Q8RA 3QAXA 4GVOA 3RN8A 2DWJA 1DCUA 4FJPA 2XWVA 4U1OA 3WAEA 1URDA 3CFLA 1DK4A 2OCUA 4MNCA 3KBRA 3M3KA 1QJMA 1H43A 4ECFA 4GF8A 5ELVA 4N13A 2ALUA 1RKMA 1NNPA 1FQDA 1N3WA 1N7XA 4NWCA 5AA2B 3B6WA 1NUWA 1B3GA 3K0VA 3PPRA 2XXRA 4N8GA 2KQZA 2CEXA 5DYHA 1MY3A 4NF5A 5ET6A 3T9XB 5IZZA 3LBSA 3MVZA 5I2KA 1AWBA 5KZTA 5I3SA 3TCGA 1JETA 1K9ZA 3T9VA 3TDJA 3UN6A 3Q28A 3ILUB 5CMMA 5LTCA 4OVPA 4O7MA 1ZKBA 1B3HA 5AA2D 4GBWA 3USDA 1LSTA 4JWOA 3RQTA 3S9MC 2NWJA 1ATGA 2CZLA 4O8MA 5CC2A 1FQEA 3LUYA 3PTYA 3MBPA 1IMBA 4H0WA 4OERA 3ZSFA 1FBFA 4R74A 4H45A 2QS2A 3MJNA 5CMCA 3T93B 4ELOA 1LFHA 3PGFA 4GX6A 3U1OA 3FXBA 2R6GE 4PGNA 4OETA 3HHGA 4NF6B 4DXUA 3QSLA 5TP9A 3TPAA 4F18A 4DI3D 1FBGA 3BFTA 5I57A 3LR1A 4DCYA 4HXVA 4MH5A 4NF8A 2Y84A 1LBYA 1RDYA 1O7TA 3PUWE 2PX1A 1NI9A 3IOVA 4GXAA 1N84A 4H46A 2O7UA 5H8HB 5A5XB 2P2AA 4LA9A 2ABHA 4IO7A 3FD3A 1GGGA 3V8XB 4IGTA 1AMFA 4G2ZA 2DWAA 1IXGA 4MNIA 1G0IA 1NV1A 4ELPA 1FPGA 4G4PA 2GRVA 1QKAA 4MIJA 5I2KB 3K2DA 2GHAA 4NF0A 3KN7A 1R9QA 2DYXA 4P0IA 2AYSA 3TKDA 1GV8A 4RXLA 4PAKA 4LVQA 4YMAA 5IZ1A 2NUVA 4NMYA 1VDWA 1KA1A 2V84A 1LBCA 3R6UA 1LBZA 2QS1A 4F2QA 3VDFA 5BWJA 1LB8A 5K2YA 2Z22A 3RPLA 3ISPA 1B0LA 4YMBA 3E13X 1OLAA 2RKMA 1B32A 4P56A 4GWSA 4O7IA 3VVDA 2F36A 1CNQA 5DVFA 4RPOA 5ET8A 5FTHA 2B65A 1MS7A 1UTHB 3OD7A 2UVHA 1FTLA 1R9LA 4TQUQ 3OXNA 3K1MA 2HZKA 1IMDA 4XF5A 3FIRA 5TP9B 5I2NA 1PB8A 1MPDA 3MWBA 4KHZE 4X9TA 4TLMB 4YZZA 1P1UA 4EUOA 2DOJA 4EF2A 4ZZAA 4GWUA 4YKJA 3DP6A 2QMWA 4E0XA 1RYOA 3OO8A 2V3QA 1S9TA 4O3AA 1VR5A 2F8DA 2GH9A 3H06B 1H76A 1SW2A 1USYE 1LB9A 2H25A 3W15C 4F3SA 1NV5A 3T96B 5I5PA 3PD8A 5TPAA 1EH3A 1YCJA 3G7WA 4BDOA 3PUZE 4U1ZA 4PFRA 4DCXA 1N04A 1SPIA 4ZE9A 3IB1A 2UVJA 1WVJA 3U94A 5L9MA 2OX3A 3FV1A 4R72A 3N5LA 3N6UA 2CZIA 3OMBA 3IOWA 1FPLA 4KYDA 1MY0A 1JP4A 1URGA 2H5YA 4P11A 4F39A 5ICQA 3EHUA 3I5OA 1JEVA 4N8YA 1T0KA 1YTVA 3HV1A 1HSJA 1TFAA 4UACA 5EYFA 1M5EA 4OXVA 4BDRA 1QVSA 1FTOA 1MH4A 4M1VA 3HFUA 1SW5A 5IGAA 3JV9A 3RNNA 5ITPA 2AIXA 4RNSA 3MVWA 1ZIUA 4YKIA 2Q88A 5EHSA 3LSWA 4OMBA 2V4CA 4HTGA 3G3HA 4H67A 3SETA 3TCFA 1NV6A 1KWHA 2FHYA 1MM7A 5CMBA 1B1XA 1P99A 1B58A 2UVGA 3QMFA 4IB2A 4I8CA 2JJKA 1JVXA 3C34A 2DVZA 4MEVA 4NN3A 1B3EA 3CFZA 3U72A 2P3NA 2ZNUA 3M3FA 5I84A 5I58B 5I7IA 3ROJA 4N17A 2XX7A 3C36A 4YU0A 5EQ9A 3TQLA 3M3LA 2DWHA 2B4LA 3O97A 2HPGA 2QJEA 3RT6B 1NUXA 3VE1B 1B0HA 3FGSA 3U93A 4OEVA 3OEMA 2Q8JA 5AA3A 4Q0CA 2OJTA 4OYVA 1OIBA 3B6TA 3I6VA 5A5LA 4F3GA 2REGA 3D4CA 5EQ8A 2FBPA 2HXWA 3RTWB 2HHMA 4PFUA 2Y7RA 5H8NA 3VFJA 4POXA 4PDHA 3UORA 3UGWA 1BP5A 1I69A 4FORA 4MCOA 3UIFA 1NUZA 5FHMA 3O6GA 4I62A 4GBVA 4GQOA 4GX4A 5FHOA 4XKQA 2THIA 1MQJA 2ZZVA 1LBWA 4U21A 5J16A 2R8TA 3SEUA 4JBZA 5FTIA 4LATA 3VVFA 4RY1A 5CMKA 2HZLA 2HAVA 5JK4A 3MC2A 1MQDA 4ONYA 2I3VA 4NWDA 2CMOA 1MXXA 4IO3A 3KSXA 4LN5A 4GD5A 4R6KA 2RC9A 3KJTA 3OELA 4XIGQ 5I56B 2XXXA 3G3FA 3LC8A 2P3VA 1O64A 3JYRA 4LP2B 4HS7A 1BKAA 4LZ5A 4AB6A 3KN8A 2I48A 3PPNA 1D4NA 2O51A 2CZKA 3DM0A 2RF1A 1R6ZA 3IOUA 5F1QA 3GBAA 1A7LA 1MXZA 4H8IA 3RYDA 1YZ0A 5CBSA 4DZ1A 4OQOA 2AL4A 1XS5A 1M5CA 1IZ1A 4H6DA 4G68B 4UABA 1IIWA 1B5JA 3VV5A 4MLVA 1I6BA 2WYPA 2XA5A 3IB2A 4KI0E 4PE3A 2P0SA 5T3JA 4KD5A 2VGQA 4I3EA 2QVUA 4PE5B 4EXLA 4QFNA 4HCWA 4NF4B 5EQAA 2AL5A 2LAOA 4GOTA 4HE1A 2PT1A 1CB6A 4F29A 4U2RA 3EKIA 2KR0A 1R1NA 1QKBA 1NL5A 2VOZA 1WDNA 3LSLA 4N07A 3MP8A 2XWKA 2UXAA 4DXCA 3P7IA 2OK2A 4LONB 3FXRA 1MQGA 4DLDA 3N94A 4C1UA 5CRYA 2P1SA 2Y5KA 4NTLA 3TTLA 4PAFA 3FATA 3DLNA 4KYSA 5H8QB 4PBQA 3H6UA 2RCBA 1ANFA 1B3FA 1LAGE 4OA4A 1Q35A 3CI8A 3HO7A 3EQ1A 5TU0A 1XVYA 4IO6A 1DPPA 2VHAA 1NNTA 2ZYKA 4FEBA 4H65A 3V89B 1SVXB 1EYJA 1B40A 4RJZA 3R7XA 2GHBA 3D1RA 3TYHA 4MFIA 3TMGA 3O28A 4XKNA 2HQ0A 3KC1A 1BK4A 3BBRA 4OVTA 4PGPA 1NH8A 3S9NC 4OVQA 3OO6A 1LAXA 2V93A 1AL3A 2O1MA 2A5TB 4XTCQ 1IUDA 2Y7WA 1NNFA 3SEVA 2IA4A 1JQFA 4LZ7A 1B46A 2RC8A 3E9XA 4KPTA 1CE2A
chains in the Genus database with same CATH topology
3C32A 2Q89A 3F11A 1MRPA 2H4IA 1UTBA 4FIMA 3IL1B 1Y4TA 1Y1ZA 1MXVA 1IITA 3BKIB 4RYAA 3S9LC 1EZPA 3FJMA 3TTNA 3VLWA 3DP8A 2HEUA 5ITOA 1B7UA 3TELA 4TLLB 5K2XA 1DPEA 3M8UA 4QSEA 5I59B 3TQWA 3KN3A 2ZXTA 4BDMA 1TT1A 4FE8A 4XKPA 4P0GA 2ZYOA 1LFGA 3GXAA 4IO4A 2VD3A 3FUZA 3ZKLA 3IR1A 3O66A 3B7DA 2I4CA 2KLFA 3SERA 3PU5A 1B05A 4F1YA 2F7CA 1MQIA 5DVIA 3RY3A 5DT6A 1B52A 1D9YA 1FQBA 3KFMA 1MDP1 1ELJA 1N76A 3U8QA 4OWDA 4RPNA 3MUQA 4NF5B 3UA8A 1A8FA 4KR5A 3CG1A 1D3KA 4H5GA 3THIA 4IY6A 3WAFA 3O2AA 2ONRA 3B6QA 1EZOA 1IXCA 5J1DA 3HHFA 3G3KA 3QIMA 3OSQA 1I6AA 4JWYA 4MLQA 4WXJA 1PB7A 1P1QA 3RPWA 3FVOA 3G3IA 5CI5A 1SW4A 3ONMA 2DE3A 2PVUA 4QFKA 4GLIA 3TEPA 2G29A 3IB0A 1QW0A 1GR2A 3FASA 1IXHA 2PT2A 1OVTA 3OENA 5I57B 1Z7ME 1I6QA 3A3UA 2D3IA 1BIYA 4NF8B 1Z7NE 4YB7A 2I0BA 4G68C 1TFDA 4DXBA 3H3GA 5F7VA 1MXUA 2QL3A 1Y3NA 2Q9TA 2W7YA 4ZZEA 5HPQA 2X7PA 3V83A 4OFOA 1XT8A 4DIGA 5LOMA 2H98A 5AA4A 1IXIA 4PFTA 4ZEKA 5KDTA 2XXQA 3E3KA 2F35A 4F3PA 3T9UA 3IJOB 3T22A 2F6PA 2DXRA 4ND9A 4JSDA 1US4A 2DE2A 4WEDA 3K00A 3EHSA 2F5XA 3OO9A 3H6TA 5HM4B 3PMXA 4ESXA 1A8EA 3ZKKA 2RINA 4JDFA 4Z7EA 2ZNTA 5KCJA 2ONKE 4RA1A 3A3CA 4G8MA 3K02A 5DVJA 3G3JA 3KGCA 1UIVA 1XOCA 4XXUA 1A54A 4O3BA 4ZEBA 1B7ZA 1LCFA 1JNFA 4POWA 3TTKA 2D5WA 2VD2A 4U4SA 5I2NB 2ZMBA 1GTKA 2QPQA 1Q1KA 2X26A 4X1DA 1J1NA 2D21A 3IJXB 4LQ5A 3U92A 1LLSA 1A55A 5DEXA 3SEWA 1B7HA 1MH3A 2VP1A 4EQ7A 1P1OA 1SQYA 2DP8A 3Q25A 1ZJLA 1DMBA 3MZBA 2XX8A 4H8JA 4IO2A 3KSJA 2O69A 1BTJA 3QUJA 3PMWA 5TPAB 3PPOA 1MY2A 3PUYE 2O68A 4U22A 3DELB 4O3CA 2X7QA 1M5BA 2RCAA 3IX1A 4H1XA 4FATA 4QRZA 3QYTA 5L9OA 4QSDA 5AA1A 5FHNA 3W9VA 3OEKA 1N0TA 2F34A 1DTGA 4THIA 3IK6B 3MVXA 2XHDA 3K4UA 2E1SA 4Q30B 4G8HA 4LUBA 1MY1A 4U4XA 2I58A 3ZS6A 2Q2AA 4QSCA 1Y9UA 1H44A 1IEJA 4F19A 3K1NA 4KCCA 5M2VA 4BDLA 1FTJA 3EF7A 4R6HA 1D9VA 4GWOA 5DEXB 2M8CA 4M4GA 3UK4A 1JW4A 5ISUA 2DQVA 2XXUA 3SKPA 3EN3A 4R75A 4JWXA 1QUJA 2OLBA 2XX9A 3MQ9A 3N6TA 2PYYA 3CRBA 2Y7KA 3MZ9A 4BDQA 3MPLA 3TTMA 4R2BA 5H8NB 2E0SA 1JW1A 2YJPA 3H03A 1MG1A 5BUUA 2NXOA 3SDFA 2I4BA 2XXPA 5AA2A 5L9SA 1ZBMA 2V3TA 3FJGA 1EU8A 3TFLA 4LQ2A 3ODBA 4BDNA 1B1HA 1FQFA 3TZAA 4MF3A 1QUKA 3PV0E 1IQ7A 2V25A 1MDQA 1GVCA 4ZDMA 1SI1A 4F2OA 1NH7A 4KYEA 1MM6A 1SI0A 3C4MA 1ZMGA 3PMVA 1AOVA 4FAJA 1OQHA 4PP0A 3EPEA 2F78A 3T66A 4EXKA 3O6HA 3OSRA 4NF6A 1N3XA 2XXHA 4KFQA 4ZECA 1B4ZA 3ECRA 1Y3PA 4QF9A 3RUMA 2FNCA 5JTYA 2QMXA 4R2FA 1II5A 1DTZA 5ICTA 3KG2A 3C35A 1FTKA 1LFIA 2A5SA 2Y7IA 4YB6A 5H8HA 2F6GA 5A5XA 4OESA 2I6EA 2DWIA 1MY4A 3LSXA 1PC3A 3CR9A 1FQAA 4Z0IA 1YPNA 3N26A 3FZVA 2H9BA 3MW0A 4F3BA 1M5DA 2ONSA 1NNKA 3VLVA 3Q27A 3IOTA 3CSBA 4H5FA 1SBPA 4OFJA 1PBQA 4HCYA 3VVEA 1EZ9A 3H7MA 3HCQA 1PBPA 1HSLA 1B3LA 4NE4A 4QFLA 2DXYA 1LGBC 3GBBA 3T9HB 3K6UA 3KOTA 4EQBA 4OEUA 4OHNA 2Z8EA 1M5FA 2Q2CA 3EHTA 4C1TA 3FXQA 1B9JA 1TXFA 4IO5A 1UTHA 1L5TA 1FQCA 4ELRA 4QFOA 2H99A 3BFUA 3IAZA 3A09A 3QXMA 2R71A 1MXWA 2XXTA 5IKBA 1ZTYA 1OLCA 2O84X 1RYXA 3K01A 1US5A 5JTYB 3S4UA 4AB5A 2HCAA 4OVJA 4FEDA 4TOZA 3TAJA 4PFWA 3FJ7A 1MXYA 3LSFB 3MP6A 4MBPA 1B6HA 4PQJA 2QS3A 2XXWA 4KQPA 4GL8A 4F22A 3FV2A 2B3FA 4F1UA 4ZEDA 3Q26A 5CBRA 1JVYA 2OZZA 3CG3A 3G3GA 1UTBB 3SESA 1SW1A 4G77A 4G8NA 4X48A 4FECA 1POTA 4OTEA 2HAUA 4GFRA 2UVIA 1XC1A 2F97A 3W9WA 1FW0A 2XD2A 3O6IA 1LBBA 2V3UA 2Z8DA 3RLFE 4AQ4A 2Z23A 1ZLQA 2ESNA 2DSFA 5B7DA 3I3VA 1JEUA 4HW8A 1VFDA 3H6WA 4U23A 4YB5A 2ZYMA 4R73A 1F9BA 3KOSA 1P1WA 4K3FA 1VSOA 3S9EA 4LZ8A 2O1LA 3K6VA 4YKPA 3CSGA 2I3WA 1Y1MA 1FTMA 4ZEIA 1AH5A 4R9FA 3QUFA 2DE4A 5I58A 4XKRA 2NOOA 4EQ9A 4PFYA 1MQHA 2XXVA 3K1PA 4YAHX 4EDPA 1SD3A 4I1DA 1B4HA 3TCHA 3ILTB 5JEIA 5HBCA 3SEXA 2UYFA 4NEDA 4JSOA 4JXIA 3CIJA 3C9HA 3IORA 3FVKA 3OOAA 4I9DA 3FXUA 4ISUA 2IEEA 1AIVA 1FCKA 3L6HA 3MZ1A 1Y20A 1XVXA 3MP1A 3MPKA 3SEYA 4QFPA 4ELQA 1OVBA 3MAMA 1P1NA 4RK2A 1USYH 2UYEA 1S7YA 3AXFA 1SYIA 2WKYA 3KZGA 2YPNA 2DVCA 2FA7A 3O29A 2HFBA 2ZNSA 1HSEA 1QULA 4ZEFA 4YKKA 1SDXA 4ESWA 1SYHA 1DSNA 5AA4B 2O6AA 5AE4A 5KDTB 2F7BA 4DDDA 3CFXA 5EHMA 3K6WA 2NVUB 2QS4A 5I56A 3OO7A 1H45A 3HN0A 3QK6A 3RGYA 3KJ7A 1MPBA 3HSTA 1OMPA 1VFEA 3PUVE 3VXBA 2Y7PA 4UA8A 4X1BA 3K6XA 4DE8A 1PEBA 2Z8FA 2G93A 5KCJB 3IO6A 1JW5A 5CM6A 4R6YA 4F1VA 1N7WA 1QUIA 1TWYA 3HPIA 1ZU0A 3PD9A 4G68A 2ZYNA 1A99A 2I0CA 3D4GA 4IY5A 5B70A 2R9JA 3VXCA 1B5HA 2DS9A 4GRKA 4NF4A 4ZS9A 4GXSB 2XD3A 3JZJA 1UIUA 3KEIA 1YAEA 1B2HA 2XXIA 4ZE8A 5H8FA 4OENA 1Y3QA 3DP4A 1B51A 3C33A 5DTBA 1MPCA 3H4ZA 2REJA 1NMUA 4C0RA 4RK9A 4JB7A 4R9GA 3RT8A 3FVNA 5H8QA 3TODA 3MVYA 4WEPA 2F7AA 1PDAA 1XHYA 3L6GA 4GIZA 4E0WA 3FVGA 3PPQA 1LAFE 2QSXA 1POY1 4L17A 3GLBA 3PUXE 3CVGA 1OQGA 2OBGA 1S50A 2PBWA 4EF1A 3GZGA 4BLAA 2O7IA 3C31A 2A5TA 1NFTA 1WODA 1UQWA 2YLNA 3UP9A 4GL0A 5IAIA 2ANJA 1NKXA 2OWSA 3VLUA 2I49A 1BLFA 1H3DA 2RC7A 3TUSA 1O63A 2B3BA 2BJJX 1PB9A 3R26A 4WKMA 3S2VA 1LAHE 4F31B 3TTRA 5L8DA 3V5AA 1DOTA 3H6VA 2GFEA 4IGRA 4Q5TA 1A40A 3E4RA 2OWTA 1LCTA 3RTFB 3O9PA 2FYIA 5H8FB 1URSA 4PETA 1Y4CA 4YICA 4OFLA 3IO4A 4N6PA 2PMSA 5H8SA 4KCDA 2QRYA 5I59A 1VE4A 3Q29A 1B5IA 4OZ9A 2XXYA 3PPPA 4QHQA 4Q8RA 3QAXA 4GVOA 3RN8A 2DWJA 4FJPA 4U1OA 3WAEA 1URDA 3CFLA 2OCUA 3KBRA 3M3KA 1QJMA 1H43A 4ECFA 4GF8A 5ELVA 4N13A 2ALUA 1RKMA 1NNPA 1FQDA 1N3WA 1N7XA 4NWCA 5AA2B 3B6WA 1B3GA 3K0VA 3PPRA 2XXRA 5DYHA 1MY3A 4NF5A 3T9XB 3LBSA 3MVZA 5I2KA 5KZTA 3TCGA 1JETA 3T9VA 3UN6A 3TDJA 3Q28A 3ILUB 5CMMA 1ZKBA 1B3HA 5AA2D 3USDA 1LSTA 4JWOA 3RQTA 3S9MC 2NWJA 1ATGA 2CZLA 5CC2A 1FQEA 3LUYA 3MBPA 4H0WA 4OERA 3ZSFA 4R74A 5CMCA 2QS2A 3MJNA 3T93B 4ELOA 1LFHA 3PGFA 3U1OA 2R6GE 4OETA 3HHGA 4NF6B 4DXUA 3QSLA 5TP9A 3TPAA 4F18A 3BFTA 5I57A 3LR1A 4DCYA 4MH5A 4NF8A 2Y84A 1O7TA 3PUWE 2PX1A 3IOVA 4GXAA 1N84A 2O7UA 5H8HB 5A5XB 2P2AA 4LA9A 2ABHA 4IO7A 3FD3A 1GGGA 3V8XB 4IGTA 1AMFA 4G2ZA 2DWAA 1IXGA 4ELPA 4G4PA 2GRVA 1QKAA 5I2KB 3K2DA 2GHAA 3KN7A 1R9QA 2DYXA 4P0IA 2AYSA 3TKDA 1GV8A 4RXLA 4LVQA 4YMAA 2NUVA 4NMYA 2V84A 1LBCA 3R6UA 2QS1A 4F2QA 3VDFA 5BWJA 1LB8A 5K2YA 2Z22A 1B0LA 4YMBA 3E13X 1OLAA 2RKMA 1B32A 3VVDA 2F36A 5DVFA 4RPOA 5FTHA 2B65A 1MS7A 1UTHB 3OD7A 2UVHA 1FTLA 1R9LA 4TQUQ 3OXNA 3K1MA 2HZKA 3FIRA 5TP9B 5I2NA 1PB8A 1MPDA 3MWBA 4KHZE 4X9TA 4TLMB 4YZZA 1P1UA 4EUOA 2DOJA 4EF2A 4ZZAA 4YKJA 3DP6A 2QMWA 4E0XA 1RYOA 3OO8A 2V3QA 1S9TA 4O3AA 1VR5A 2F8DA 2GH9A 3H06B 1H76A 1SW2A 1USYE 1LB9A 2H25A 3W15C 4F3SA 3T96B 3PD8A 5TPAA 1EH3A 1YCJA 3G7WA 4BDOA 3PUZE 4U1ZA 4DCXA 1N04A 4ZE9A 3IB1A 2UVJA 1WVJA 3U94A 5L9MA 3FV1A 4R72A 3N5LA 3N6UA 3OMBA 3IOWA 4KYDA 1MY0A 1URGA 2H5YA 4P11A 4F39A 5ICQA 3EHUA 3I5OA 1JEVA 1T0KA 1YTVA 3HV1A 1HSJA 1TFAA 4UACA 5EYFA 1M5EA 4OXVA 4BDRA 1QVSA 1FTOA 1MH4A 4M1VA 1SW5A 3JV9A 3RNNA 5ITPA 2AIXA 4RNSA 3MVWA 1ZIUA 4YKIA 2Q88A 5EHSA 3LSWA 4OMBA 4HTGA 3G3HA 4H67A 3SETA 3TCFA 1KWHA 1MM7A 5CMBA 1B1XA 1P99A 1B58A 2UVGA 4IB2A 4I8CA 1JVXA 3C34A 2DVZA 1B3EA 3CFZA 3U72A 2ZNUA 3M3FA 5I84A 5I58B 2XX7A 3C36A 4YU0A 3TQLA 3M3LA 2DWHA 3O97A 2QJEA 3RT6B 3VE1B 1B0HA 3FGSA 3U93A 4OEVA 3OEMA 2Q8JA 5AA3A 4Q0CA 2OJTA 4OYVA 1OIBA 3B6TA 3I6VA 4F3GA 2REGA 3D4CA 2HXWA 3RTWB 4PFUA 2Y7RA 5H8NA 3VFJA 4POXA 3UORA 3UGWA 1BP5A 1I69A 4FORA 3UIFA 5FHMA 3O6GA 4I62A 4GQOA 5FHOA 4XKQA 2THIA 1MQJA 4U21A 3SEUA 4JBZA 5FTIA 4LATA 3VVFA 4RY1A 5CMKA 2HZLA 2HAVA 5JK4A 3MC2A 1MQDA 4ONYA 2I3VA 4NWDA 2CMOA 1MXXA 4IO3A 3KSXA 4GD5A 4R6KA 2RC9A 3KJTA 3OELA 4XIGQ 5I56B 2XXXA 3G3FA 3LC8A 1O64A 3JYRA 4LP2B 4HS7A 1BKAA 4LZ5A 4AB6A 3KN8A 2I48A 3PPNA 1D4NA 2O51A 3DM0A 2RF1A 1R6ZA 3IOUA 5F1QA 3GBAA 1A7LA 1MXZA 4H8IA 5CBSA 4DZ1A 4OQOA 2AL4A 1XS5A 1M5CA 1IZ1A 4H6DA 4G68B 1IIWA 1B5JA 3VV5A 4MLVA 1I6BA 3IB2A 4KI0E 2P0SA 4KD5A 2VGQA 4EXLA 4PE5B 4QFNA 4HCWA 4NF4B 2AL5A 2LAOA 4GOTA 4F29A 2PT1A 1CB6A 4U2RA 1R1NA 1QKBA 1NL5A 2VOZA 1WDNA 3LSLA 4N07A 3MP8A 2UXAA 4DXCA 3P7IA 2OK2A 4LONB 3FXRA 4DLDA 1MQGA 3N94A 4C1UA 5CRYA 2P1SA 4NTLA 3TTLA 3FATA 3DLNA 4KYSA 5H8QB 3H6UA 2RCBA 1ANFA 1B3FA 1LAGE 1Q35A 3CI8A 3HO7A 3EQ1A 5TU0A 1XVYA 4IO6A 1DPPA 2VHAA 1NNTA 2ZYKA 4FEBA 4H65A 3V89B 1SVXB 1B40A 4RJZA 3R7XA 2GHBA 3TYHA 4MFIA 3TMGA 3O28A 4XKNA 2HQ0A 3BBRA 1NH8A 3S9NC 3OO6A 1LAXA 2V93A 1AL3A 2O1MA 2A5TB 4XTCQ 1IUDA 2Y7WA 1NNFA 3SEVA 2IA4A 1JQFA 4LZ7A 1B46A 2RC8A 3E9XA 4KPTA 1CE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C32 A;  2Q89 A;  3F11 A;  1MRP A;  2H4I A;  1UTB A;  4FIM A;  3IL1 B;  1Y4T A;  1Y1Z A;  1MXV A;  1IIT A;  3BKI B;  4RYA A;  3S9L C;  1EZP A;  3FJM A;  3TTN A;  3VLW A;  3DP8 A;  2HEU A;  5ITO A;  1B7U A;  3TEL A;  4TLL B;  5K2X A;  1DPE A;  3M8U A;  4QSE A;  5I59 B;  3TQW A;  3KN3 A;  2ZXT A;  4BDM A;  1TT1 A;  4FE8 A;  4XKP A;  4P0G A;  2ZYO A;  1LFG A;  3GXA A;  4IO4 A;  2VD3 A;  3FUZ A;  3ZKL A;  3IR1 A;  3O66 A;  3B7D A;  2I4C A;  2KLF A;  3SER A;  3PU5 A;  1B05 A;  4F1Y A;  2F7C A;  1MQI A;  5DVI A;  3RY3 A;  5DT6 A;  1B52 A;  1D9Y A;  1FQB A;  3KFM A;  1MDP 1;  1ELJ A;  1N76 A;  3U8Q A;  4OWD A;  4RPN A;  3MUQ A;  4NF5 B;  3UA8 A;  1A8F A;  4KR5 A;  3CG1 A;  1D3K A;  4H5G A;  3THI A;  4IY6 A;  3WAF A;  3O2A A;  2ONR A;  3B6Q A;  1EZO A;  1IXC A;  5J1D A;  3HHF A;  3G3K A;  3QIM A;  3OSQ A;  1I6A A;  4JWY A;  4MLQ A;  4WXJ A;  1PB7 A;  1P1Q A;  3RPW A;  3FVO A;  3G3I A;  5CI5 A;  1SW4 A;  3ONM A;  2DE3 A;  2PVU A;  4QFK A;  4GLI A;  3TEP A;  2G29 A;  3IB0 A;  1QW0 A;  1GR2 A;  3FAS A;  1IXH A;  2PT2 A;  1OVT A;  3OEN A;  5I57 B;  1Z7M E;  1I6Q A;  3A3U A;  2D3I A;  1BIY A;  4NF8 B;  1Z7N E;  4YB7 A;  2I0B A;  4G68 C;  1TFD A;  4DXB A;  3H3G A;  5F7V A;  1MXU A;  2QL3 A;  1Y3N A;  2Q9T A;  2W7Y A;  4ZZE A;  5HPQ A;  2X7P A;  3V83 A;  4OFO A;  1XT8 A;  4DIG A;  5LOM A;  2H98 A;  5AA4 A;  1IXI A;  4PFT A;  4ZEK A;  5KDT A;  2XXQ A;  3E3K A;  2F35 A;  4F3P A;  3T9U A;  3IJO B;  3T22 A;  2F6P A;  2DXR A;  4ND9 A;  4JSD A;  1US4 A;  2DE2 A;  4WED A;  3K00 A;  3EHS A;  2F5X A;  3OO9 A;  3H6T A;  5HM4 B;  3PMX A;  4ESX A;  1A8E A;  3ZKK A;  2RIN A;  4JDF A;  4Z7E A;  2ZNT A;  5KCJ A;  2ONK E;  4RA1 A;  3A3C A;  4G8M A;  3K02 A;  5DVJ A;  3G3J A;  3KGC A;  1UIV A;  1XOC A;  4XXU A;  1A54 A;  4O3B A;  4ZEB A;  1B7Z A;  1LCF A;  1JNF A;  4POW A;  3TTK A;  2D5W A;  2VD2 A;  4U4S A;  5I2N B;  2ZMB A;  1GTK A;  2QPQ A;  1Q1K A;  2X26 A;  4X1D A;  1J1N A;  2D21 A;  3IJX B;  4LQ5 A;  3U92 A;  1LLS A;  1A55 A;  5DEX A;  3SEW A;  1B7H A;  1MH3 A;  2VP1 A;  4EQ7 A;  1P1O A;  1SQY A;  2DP8 A;  3Q25 A;  1ZJL A;  1DMB A;  3MZB A;  2XX8 A;  4H8J A;  4IO2 A;  3KSJ A;  2O69 A;  1BTJ A;  3QUJ A;  3PMW A;  5TPA B;  3PPO A;  1MY2 A;  3PUY E;  2O68 A;  4U22 A;  3DEL B;  4O3C A;  2X7Q A;  1M5B A;  2RCA A;  3IX1 A;  4H1X A;  4FAT A;  4QRZ A;  3QYT A;  5L9O A;  4QSD A;  5AA1 A;  5FHN A;  3W9V A;  3OEK A;  1N0T A;  2F34 A;  1DTG A;  4THI A;  3IK6 B;  3MVX A;  2XHD A;  3K4U A;  2E1S A;  4Q30 B;  4G8H A;  4LUB A;  1MY1 A;  4U4X A;  2I58 A;  3ZS6 A;  2Q2A A;  4QSC A;  1Y9U A;  1H44 A;  1IEJ A;  4F19 A;  3K1N A;  4KCC A;  5M2V A;  4BDL A;  1FTJ A;  3EF7 A;  4R6H A;  1D9V A;  4GWO A;  5DEX B;  2M8C A;  4M4G A;  3UK4 A;  1JW4 A;  5ISU A;  2DQV A;  2XXU A;  3SKP A;  3EN3 A;  4R75 A;  4JWX A;  1QUJ A;  2OLB A;  2XX9 A;  3MQ9 A;  3N6T A;  2PYY A;  3CRB A;  2Y7K A;  3MZ9 A;  4BDQ A;  3MPL A;  3TTM A;  4R2B A;  5H8N B;  2E0S A;  1JW1 A;  2YJP A;  3H03 A;  1MG1 A;  5BUU A;  2NXO A;  3SDF A;  2I4B A;  2XXP A;  5AA2 A;  5L9S A;  1ZBM A;  2V3T A;  3FJG A;  1EU8 A;  3TFL A;  4LQ2 A;  3ODB A;  4BDN A;  1B1H A;  1FQF A;  3TZA A;  4MF3 A;  1QUK A;  3PV0 E;  1IQ7 A;  2V25 A;  1MDQ A;  1GVC A;  4ZDM A;  1SI1 A;  4F2O A;  1NH7 A;  4KYE A;  1MM6 A;  1SI0 A;  3C4M A;  1ZMG A;  3PMV A;  1AOV A;  4FAJ A;  1OQH A;  4PP0 A;  3EPE A;  2F78 A;  3T66 A;  4EXK A;  3O6H A;  3OSR A;  4NF6 A;  1N3X A;  2XXH A;  4KFQ A;  4ZEC A;  1B4Z A;  3ECR A;  1Y3P A;  4QF9 A;  3RUM A;  2FNC A;  5JTY A;  2QMX A;  4R2F A;  1II5 A;  1DTZ A;  5ICT A;  3KG2 A;  3C35 A;  1FTK A;  1LFI A;  2A5S A;  2Y7I A;  4YB6 A;  5H8H A;  2F6G A;  5A5X A;  4OES A;  2I6E A;  2DWI A;  1MY4 A;  3LSX A;  1PC3 A;  3CR9 A;  1FQA A;  4Z0I A;  1YPN A;  3N26 A;  3FZV A;  2H9B A;  3MW0 A;  4F3B A;  1M5D A;  2ONS A;  1NNK A;  3VLV A;  3Q27 A;  3IOT A;  3CSB A;  4H5F A;  1SBP A;  4OFJ A;  1PBQ A;  4HCY A;  3VVE A;  1EZ9 A;  3H7M A;  3HCQ A;  1PBP A;  1HSL A;  1B3L A;  4NE4 A;  4QFL A;  2DXY A;  1LGB C;  3GBB A;  3T9H B;  3K6U A;  3KOT A;  4EQB A;  4OEU A;  4OHN A;  2Z8E A;  1M5F A;  2Q2C A;  3EHT A;  4C1T A;  3FXQ A;  1B9J A;  1TXF A;  4IO5 A;  1UTH A;  1L5T A;  1FQC A;  4ELR A;  4QFO A;  2H99 A;  3BFU A;  3IAZ A;  3A09 A;  3QXM A;  2R71 A;  1MXW A;  2XXT A;  5IKB A;  1ZTY A;  1OLC A;  2O84 X;  1RYX A;  3K01 A;  1US5 A;  5JTY B;  3S4U A;  4AB5 A;  2HCA A;  4OVJ A;  4FED A;  4TOZ A;  3TAJ A;  4PFW A;  3FJ7 A;  1MXY A;  3LSF B;  3MP6 A;  4MBP A;  1B6H A;  4PQJ A;  2QS3 A;  2XXW A;  4KQP A;  4GL8 A;  4F22 A;  3FV2 A;  2B3F A;  4F1U A;  4ZED A;  3Q26 A;  5CBR A;  1JVY A;  2OZZ A;  3CG3 A;  3G3G A;  1UTB B;  3SES A;  1SW1 A;  4G77 A;  4G8N A;  4X48 A;  4FEC A;  1POT A;  4OTE A;  2HAU A;  4GFR A;  2UVI A;  1XC1 A;  2F97 A;  3W9W A;  1FW0 A;  2XD2 A;  3O6I A;  1LBB A;  2V3U A;  2Z8D A;  3RLF E;  4AQ4 A;  2Z23 A;  1ZLQ A;  2ESN A;  2DSF A;  5B7D A;  3I3V A;  1JEU A;  4HW8 A;  1VFD A;  3H6W A;  4U23 A;  4YB5 A;  2ZYM A;  4R73 A;  1F9B A;  3KOS A;  1P1W A;  4K3F A;  1VSO A;  3S9E A;  4LZ8 A;  2O1L A;  3K6V A;  4YKP A;  3CSG A;  2I3W A;  1Y1M A;  1FTM A;  4ZEI A;  1AH5 A;  4R9F A;  3QUF A;  2DE4 A;  5I58 A;  4XKR A;  2NOO A;  4EQ9 A;  4PFY A;  1MQH A;  2XXV A;  3K1P A;  4YAH X;  4EDP A;  1SD3 A;  4I1D A;  1B4H A;  3TCH A;  3ILT B;  5JEI A;  5HBC A;  3SEX A;  2UYF A;  4NED A;  4JSO A;  4JXI A;  3CIJ A;  3C9H A;  3IOR A;  3FVK A;  3OOA A;  4I9D A;  3FXU A;  4ISU A;  2IEE A;  1AIV A;  1FCK A;  3L6H A;  3MZ1 A;  1Y20 A;  1XVX A;  3MP1 A;  3MPK A;  3SEY A;  4QFP A;  4ELQ A;  1OVB A;  3MAM A;  1P1N A;  4RK2 A;  1USY H;  2UYE A;  1S7Y A;  3AXF A;  1SYI A;  2WKY A;  3KZG A;  2YPN A;  2DVC A;  2FA7 A;  3O29 A;  2HFB A;  2ZNS A;  1HSE A;  1QUL A;  4ZEF A;  4YKK A;  1SDX A;  4ESW A;  1SYH A;  1DSN A;  5AA4 B;  2O6A A;  5AE4 A;  5KDT B;  2F7B A;  4DDD A;  3CFX A;  5EHM A;  3K6W A;  2NVU B;  2QS4 A;  5I56 A;  3OO7 A;  1H45 A;  3HN0 A;  3QK6 A;  3RGY A;  3KJ7 A;  1MPB A;  3HST A;  1OMP A;  1VFE A;  3PUV E;  3VXB A;  2Y7P A;  4UA8 A;  4X1B A;  3K6X A;  4DE8 A;  1PEB A;  2Z8F A;  2G93 A;  5KCJ B;  3IO6 A;  1JW5 A;  5CM6 A;  4R6Y A;  4F1V A;  1N7W A;  1QUI A;  1TWY A;  3HPI A;  1ZU0 A;  3PD9 A;  4G68 A;  2ZYN A;  1A99 A;  2I0C A;  3D4G A;  4IY5 A;  5B70 A;  2R9J A;  3VXC A;  1B5H A;  2DS9 A;  4GRK A;  4NF4 A;  4ZS9 A;  4GXS B;  2XD3 A;  3JZJ A;  1UIU A;  3KEI A;  1YAE A;  1B2H A;  2XXI A;  4ZE8 A;  5H8F A;  4OEN A;  1Y3Q A;  3DP4 A;  1B51 A;  3C33 A;  5DTB A;  1MPC A;  3H4Z A;  2REJ A;  1NMU A;  4C0R A;  4RK9 A;  4JB7 A;  4R9G A;  3RT8 A;  3FVN A;  5H8Q A;  3TOD A;  3MVY A;  4WEP A;  2F7A A;  1PDA A;  1XHY A;  3L6G A;  4GIZ A;  4E0W A;  3FVG A;  3PPQ A;  1LAF E;  2QSX A;  1POY 1;  4L17 A;  3GLB A;  3PUX E;  3CVG A;  1OQG A;  2OBG A;  1S50 A;  2PBW A;  4EF1 A;  3GZG A;  4BLA A;  2O7I A;  3C31 A;  2A5T A;  1NFT A;  1WOD A;  1UQW A;  2YLN A;  3UP9 A;  4GL0 A;  5IAI A;  2ANJ A;  1NKX A;  2OWS A;  3VLU A;  2I49 A;  1BLF A;  1H3D A;  2RC7 A;  3TUS A;  1O63 A;  2B3B A;  2BJJ X;  1PB9 A;  3R26 A;  4WKM A;  3S2V A;  1LAH E;  4F31 B;  3TTR A;  5L8D A;  3V5A A;  1DOT A;  3H6V A;  2GFE A;  4IGR A;  4Q5T A;  1A40 A;  3E4R A;  2OWT A;  1LCT A;  3RTF B;  3O9P A;  2FYI A;  5H8F B;  1URS A;  4PET A;  1Y4C A;  4YIC A;  4OFL A;  3IO4 A;  4N6P A;  2PMS A;  5H8S A;  4KCD A;  2QRY A;  5I59 A;  1VE4 A;  3Q29 A;  1B5I A;  4OZ9 A;  2XXY A;  3PPP A;  4QHQ A;  4Q8R A;  3QAX A;  4GVO A;  3RN8 A;  2DWJ A;  4FJP A;  4U1O A;  3WAE A;  1URD A;  3CFL A;  2OCU A;  3KBR A;  3M3K A;  1QJM A;  1H43 A;  4ECF A;  4GF8 A;  5ELV A;  4N13 A;  2ALU A;  1RKM A;  1NNP A;  1FQD A;  1N3W A;  1N7X A;  4NWC A;  5AA2 B;  3B6W A;  1B3G A;  3K0V A;  3PPR A;  2XXR A;  5DYH A;  1MY3 A;  4NF5 A;  3T9X B;  3LBS A;  3MVZ A;  5I2K A;  5KZT A;  3TCG A;  1JET A;  3T9V A;  3UN6 A;  3TDJ A;  3Q28 A;  3ILU B;  5CMM A;  1ZKB A;  1B3H A;  5AA2 D;  3USD A;  1LST A;  4JWO A;  3RQT A;  3S9M C;  2NWJ A;  1ATG A;  2CZL A;  5CC2 A;  1FQE A;  3LUY A;  3MBP A;  4H0W A;  4OER A;  3ZSF A;  4R74 A;  5CMC A;  2QS2 A;  3MJN A;  3T93 B;  4ELO A;  1LFH A;  3PGF A;  3U1O A;  2R6G E;  4OET A;  3HHG A;  4NF6 B;  4DXU A;  3QSL A;  5TP9 A;  3TPA A;  4F18 A;  3BFT A;  5I57 A;  3LR1 A;  4DCY A;  4MH5 A;  4NF8 A;  2Y84 A;  1O7T A;  3PUW E;  2PX1 A;  3IOV A;  4GXA A;  1N84 A;  2O7U A;  5H8H B;  5A5X B;  2P2A A;  4LA9 A;  2ABH A;  4IO7 A;  3FD3 A;  1GGG A;  3V8X B;  4IGT A;  1AMF A;  4G2Z A;  2DWA A;  1IXG A;  4ELP A;  4G4P A;  2GRV A;  1QKA A;  5I2K B;  3K2D A;  2GHA A;  3KN7 A;  1R9Q A;  2DYX A;  4P0I A;  2AYS A;  3TKD A;  1GV8 A;  4RXL A;  4LVQ A;  4YMA A;  2NUV A;  4NMY A;  2V84 A;  1LBC A;  3R6U A;  2QS1 A;  4F2Q A;  3VDF A;  5BWJ A;  1LB8 A;  5K2Y A;  2Z22 A;  1B0L A;  4YMB A;  3E13 X;  1OLA A;  2RKM A;  1B32 A;  3VVD A;  2F36 A;  5DVF A;  4RPO A;  5FTH A;  2B65 A;  1MS7 A;  1UTH B;  3OD7 A;  2UVH A;  1FTL A;  1R9L A;  4TQU Q;  3OXN A;  3K1M A;  2HZK A;  3FIR A;  5TP9 B;  5I2N A;  1PB8 A;  1MPD A;  3MWB A;  4KHZ E;  4X9T A;  4TLM B;  4YZZ A;  1P1U A;  4EUO A;  2DOJ A;  4EF2 A;  4ZZA A;  4YKJ A;  3DP6 A;  2QMW A;  4E0X A;  1RYO A;  3OO8 A;  2V3Q A;  1S9T A;  4O3A A;  1VR5 A;  2F8D A;  2GH9 A;  3H06 B;  1H76 A;  1SW2 A;  1USY E;  1LB9 A;  2H25 A;  3W15 C;  4F3S A;  3T96 B;  3PD8 A;  5TPA A;  1EH3 A;  1YCJ A;  3G7W A;  4BDO A;  3PUZ E;  4U1Z A;  4DCX A;  1N04 A;  4ZE9 A;  3IB1 A;  2UVJ A;  1WVJ A;  3U94 A;  5L9M A;  3FV1 A;  4R72 A;  3N5L A;  3N6U A;  3OMB A;  3IOW A;  4KYD A;  1MY0 A;  1URG A;  2H5Y A;  4P11 A;  4F39 A;  5ICQ A;  3EHU A;  3I5O A;  1JEV A;  1T0K A;  1YTV A;  3HV1 A;  1HSJ A;  1TFA A;  4UAC A;  5EYF A;  1M5E A;  4OXV A;  4BDR A;  1QVS A;  1FTO A;  1MH4 A;  4M1V A;  1SW5 A;  3JV9 A;  3RNN A;  5ITP A;  2AIX A;  4RNS A;  3MVW A;  1ZIU A;  4YKI A;  2Q88 A;  5EHS A;  3LSW A;  4OMB A;  4HTG A;  3G3H A;  4H67 A;  3SET A;  3TCF A;  1KWH A;  1MM7 A;  5CMB A;  1B1X A;  1P99 A;  1B58 A;  2UVG A;  4IB2 A;  4I8C A;  1JVX A;  3C34 A;  2DVZ A;  1B3E A;  3CFZ A;  3U72 A;  2ZNU A;  3M3F A;  5I84 A;  5I58 B;  2XX7 A;  3C36 A;  4YU0 A;  3TQL A;  3M3L A;  2DWH A;  3O97 A;  2QJE A;  3RT6 B;  3VE1 B;  1B0H A;  3FGS A;  3U93 A;  4OEV A;  3OEM A;  2Q8J A;  5AA3 A;  4Q0C A;  2OJT A;  4OYV A;  1OIB A;  3B6T A;  3I6V A;  4F3G A;  2REG A;  3D4C A;  2HXW A;  3RTW B;  4PFU A;  2Y7R A;  5H8N A;  3VFJ A;  4POX A;  3UOR A;  3UGW A;  1BP5 A;  1I69 A;  4FOR A;  3UIF A;  5FHM A;  3O6G A;  4I62 A;  4GQO A;  5FHO A;  4XKQ A;  2THI A;  1MQJ A;  4U21 A;  3SEU A;  4JBZ A;  5FTI A;  4LAT A;  3VVF A;  4RY1 A;  5CMK A;  2HZL A;  2HAV A;  5JK4 A;  3MC2 A;  1MQD A;  4ONY A;  2I3V A;  4NWD A;  2CMO A;  1MXX A;  4IO3 A;  3KSX A;  4GD5 A;  4R6K A;  2RC9 A;  3KJT A;  3OEL A;  4XIG Q;  5I56 B;  2XXX A;  3G3F A;  3LC8 A;  1O64 A;  3JYR A;  4LP2 B;  4HS7 A;  1BKA A;  4LZ5 A;  4AB6 A;  3KN8 A;  2I48 A;  3PPN A;  1D4N A;  2O51 A;  3DM0 A;  2RF1 A;  1R6Z A;  3IOU A;  5F1Q A;  3GBA A;  1A7L A;  1MXZ A;  4H8I A;  5CBS A;  4DZ1 A;  4OQO A;  2AL4 A;  1XS5 A;  1M5C A;  1IZ1 A;  4H6D A;  4G68 B;  1IIW A;  1B5J A;  3VV5 A;  4MLV A;  1I6B A;  3IB2 A;  4KI0 E;  2P0S A;  4KD5 A;  2VGQ A;  4EXL A;  4PE5 B;  4QFN A;  4HCW A;  4NF4 B;  2AL5 A;  2LAO A;  4GOT A;  4F29 A;  2PT1 A;  1CB6 A;  4U2R A;  1R1N A;  1QKB A;  1NL5 A;  2VOZ A;  1WDN A;  3LSL A;  4N07 A;  3MP8 A;  2UXA A;  4DXC A;  3P7I A;  2OK2 A;  4LON B;  3FXR A;  4DLD A;  1MQG A;  3N94 A;  4C1U A;  5CRY A;  2P1S A;  4NTL A;  3TTL A;  3FAT A;  3DLN A;  4KYS A;  5H8Q B;  3H6U A;  2RCB A;  1ANF A;  1B3F A;  1LAG E;  1Q35 A;  3CI8 A;  3HO7 A;  3EQ1 A;  5TU0 A;  1XVY A;  4IO6 A;  1DPP A;  2VHA A;  1NNT A;  2ZYK A;  4FEB A;  4H65 A;  3V89 B;  1SVX B;  1B40 A;  4RJZ A;  3R7X A;  2GHB A;  3TYH A;  4MFI A;  3TMG A;  3O28 A;  4XKN A;  2HQ0 A;  3BBR A;  1NH8 A;  3S9N C;  3OO6 A;  1LAX A;  2V93 A;  1AL3 A;  2O1M A;  2A5T B;  4XTC Q;  1IUD A;  2Y7W A;  1NNF A;  3SEV A;  2IA4 A;  1JQF A;  4LZ7 A;  1B46 A;  2RC8 A;  3E9X A;  4KPT A;  1CE2 A; 
#chains in the Genus database with same CATH topology
 3C32 A;  2Q89 A;  3F11 A;  2HXR A;  1LBX A;  1MRP A;  2H4I A;  1UTB A;  4FIM A;  3IL1 B;  4PTK A;  5IZ3 A;  1Y4T A;  1Y1Z A;  4N15 A;  1MXV A;  1IIT A;  3BKI B;  4RYA A;  4MMP A;  3S9L C;  1EZP A;  3FJM A;  3TTN A;  3VLW A;  3DP8 A;  1FPF A;  2HEU A;  1LBV A;  3BIG A;  2F3D A;  5ITO A;  1B7U A;  3TEL A;  4TLL B;  5K2X A;  4PFI A;  1DPE A;  3M8U A;  4QSE A;  5I59 B;  3TQW A;  3KN3 A;  4PAI A;  2ZXT A;  4GWY A;  4BDM A;  1TT1 A;  4FE8 A;  4XKP A;  4P0G A;  2ZYO A;  1LFG A;  4KXP A;  3GXA A;  4IO4 A;  2VD3 A;  2Y5L A;  3FUZ A;  3ZKL A;  4PC9 A;  3IR1 A;  3O66 A;  4IR8 A;  3B7D A;  2I4C A;  2KLF A;  3SER A;  3PU5 A;  1B05 A;  4F1Y A;  2F7C A;  1MQI A;  5DVI A;  3RY3 A;  5DT6 A;  1B52 A;  1D9Y A;  1FQB A;  3KFM A;  1MDP 1;  1ELJ A;  1N76 A;  3U8Q A;  4OWD A;  4RPN A;  3MUQ A;  4NF5 B;  3UA8 A;  1A8F A;  4KR5 A;  3CG1 A;  1D3K A;  3U65 A;  4H5G A;  3THI A;  4IY6 A;  3WAF A;  3O2A A;  2ONR A;  3B6Q A;  1EZO A;  5EYG A;  1IXC A;  5J1D A;  3KBZ A;  3HHF A;  3G3K A;  1FPI A;  3QIM A;  3OSQ A;  1I6A A;  4JWY A;  4MLQ A;  4WXJ A;  1PB7 A;  1P1Q A;  4PFB A;  3RPW A;  1D9Q A;  3FVO A;  3G3I A;  5CI5 A;  1SW4 A;  4GWW A;  3ONM A;  2DE3 A;  2PVU A;  4QFK A;  1NV3 A;  4GLI A;  3TEP A;  2G29 A;  3IB0 A;  1QW0 A;  1GR2 A;  4HE0 A;  3FAS A;  1IXH A;  1FSA A;  2PT2 A;  1OVT A;  1FBP A;  3OEN A;  5I57 B;  1Z7M E;  1I6Q A;  3A3U A;  2D3I A;  4NF8 B;  1BIY A;  1FBE A;  1Z7N E;  4YB7 A;  2I0B A;  4G68 C;  1TFD A;  5FBP A;  4DXB A;  3H3G A;  5F7V A;  1MXU A;  2QL3 A;  1Y3N A;  2Q9T A;  2W7Y A;  4ZZE A;  5HPQ A;  2X7P A;  3V83 A;  4OFO A;  1XT8 A;  4DIG A;  5LOM A;  2H98 A;  5EQ7 A;  1FBH A;  5AA4 A;  1IXI A;  4PFT A;  4ZEK A;  5KDT A;  2XXQ A;  3E3K A;  2F35 A;  4F3P A;  3T9U A;  3IJO B;  3T22 A;  2F6P A;  2DXR A;  4ND9 A;  4JSD A;  1US4 A;  2DE2 A;  4WED A;  3K00 A;  3EHS A;  2F5X A;  3OO9 A;  3H6T A;  1KA0 A;  5HM4 B;  3PMX A;  4XEQ A;  4ESX A;  1A8E A;  3ZKK A;  4PDD A;  2RIN A;  4JDF A;  4Z7E A;  2ZNT A;  5KCJ A;  2ONK E;  2CEY A;  4RA1 A;  3A3C A;  4G8M A;  3RPL B;  4I3Y A;  3K02 A;  5DVJ A;  3G3J A;  3KGC A;  1UIV A;  1XOC A;  3MST A;  4XXU A;  1A54 A;  4O3B A;  4ZEB A;  1B7Z A;  1LCF A;  1FPB A;  1JNF A;  4POW A;  3TTK A;  4FBP A;  2D5W A;  2VD2 A;  1FJ6 A;  4U4S A;  5I2N B;  1IME A;  2ZMB A;  1GTK A;  2QPQ A;  1Q1K A;  2QVR A;  2X26 A;  4MAG A;  4X1D A;  1J1N A;  2D21 A;  3IJX B;  4QXD A;  4LQ5 A;  3U92 A;  1LLS A;  1A55 A;  5DEX A;  3SEW A;  4N6K A;  1B7H A;  1MH3 A;  4P47 A;  2VP1 A;  4EQ7 A;  1P1O A;  1SQY A;  2DP8 A;  3Q25 A;  1ZJL A;  1DMB A;  3MZB A;  2XX8 A;  4H8J A;  4IO2 A;  3KSJ A;  2O69 A;  1BTJ A;  3QUJ A;  3PMW A;  5TPA B;  3PPO A;  1MY2 A;  3PUY E;  2O68 A;  4U22 A;  3DEL B;  3A29 A;  4O3C A;  2X7Q A;  1M5B A;  4QBA A;  2RCA A;  3IX1 A;  4H1X A;  4FAT A;  4QRZ A;  3QYT A;  5L9O A;  3NOH A;  4QSD A;  1RDZ A;  5AA1 A;  5FHN A;  3W9V A;  3GYY A;  3OEK A;  1N0T A;  2F34 A;  1DTG A;  4THI A;  3IK6 B;  3MVX A;  2XHD A;  3K4U A;  2B4M A;  2E1S A;  4Q30 B;  2FIE A;  4G8H A;  4AS4 A;  4PF8 A;  4LUB A;  1MY1 A;  3E79 A;  4U4X A;  2I58 A;  3ZS6 A;  2Q2A A;  4QSC A;  4NX1 A;  1Y9U A;  1H44 A;  1IEJ A;  4F19 A;  3K1N A;  4KCC A;  5M2V A;  4BDL A;  1FTJ A;  3EF7 A;  4R6H A;  1D9V A;  4I40 A;  4GWO A;  4XFE A;  5DEX B;  2M8C A;  2QVV A;  4M4G A;  4PF6 A;  1JW4 A;  3UK4 A;  5ISU A;  2DQV A;  2XXU A;  3SKP A;  1QGX A;  3EN3 A;  4R75 A;  4JWX A;  1QUJ A;  2OLB A;  2XX9 A;  3MQ9 A;  3N6T A;  5DW8 A;  2PYY A;  3CRB A;  2Y7K A;  3MYU A;  3MZ9 A;  4BDQ A;  3MPL A;  3TTM A;  3FBP A;  4G61 A;  4R2B A;  2Q74 A;  4NAP A;  5H8N B;  2E0S A;  1JW1 A;  2YJP A;  3H03 A;  1MG1 A;  5BUU A;  2NXO A;  3SDF A;  2I4B A;  2XXP A;  4O94 A;  5AA2 A;  5L9S A;  1ZBM A;  2V3T A;  3FJG A;  1EU8 A;  3TFL A;  3BIH A;  4LQ2 A;  3ODB A;  4BDN A;  1B1H A;  1FQF A;  3TZA A;  4MF3 A;  1QUK A;  3LUZ A;  3T0J A;  3PV0 E;  1IQ7 A;  2V25 A;  1MDQ A;  1GVC A;  4ZDM A;  1SI1 A;  4F2O A;  1NH7 A;  4KYE A;  1MM6 A;  4N81 A;  1SI0 A;  3C4M A;  1ZMG A;  3PMV A;  1AOV A;  4FAJ A;  4X04 A;  1OQH A;  4PP0 A;  2XWO A;  3EPE A;  2F78 A;  3T66 A;  2PFZ A;  4EXK A;  3O6H A;  4NHB A;  2PFY A;  3OSR A;  4NF6 A;  1N3X A;  2XXH A;  4KFQ A;  1YYZ A;  4ZEC A;  1B4Z A;  3IFC A;  3ECR A;  1Y3P A;  2VPN A;  4QF9 A;  3RUM A;  5ESY A;  2FNC A;  5JTY A;  2QMX A;  2VPO A;  2XXK A;  4R2F A;  1II5 A;  1DTZ A;  5ICT A;  3KG2 A;  3C35 A;  1FTK A;  1LFI A;  2GQ1 A;  3IFA A;  4X8R A;  1NV7 A;  2A5S A;  2Y7I A;  4YB6 A;  4N91 A;  1NUY A;  5H8H A;  2F6G A;  5A5X A;  4OES A;  2I6E A;  2DWI A;  4MNP A;  1YXI A;  1MY4 A;  3LSX A;  1PC3 A;  3CR9 A;  1FPK A;  1FQA A;  4Z0I A;  2WBD A;  1YPN A;  2PCR A;  3N26 A;  3FZV A;  2H9B A;  3MW0 A;  4F3B A;  1M5D A;  4OVS A;  2ONS A;  1NNK A;  3VLV A;  1DBZ A;  3Q27 A;  3IOT A;  3CSB A;  4H5F A;  1RDX A;  2CZH A;  1SBP A;  4OFJ A;  1PBQ A;  4HCY A;  3VVE A;  1EZ9 A;  3H7M A;  3HCQ A;  1PBP A;  1HSL A;  1B3L A;  4QFL A;  4NE4 A;  2DXY A;  1LGB C;  2WX9 A;  3GBB A;  3T9H B;  4HE2 A;  3K6U A;  3KOT A;  4EQB A;  4OEU A;  4OHN A;  1K9Y A;  2Z8E A;  1M5F A;  2Q2C A;  3EHT A;  4C1T A;  3FXQ A;  1B9J A;  1TXF A;  2VT5 A;  4IO5 A;  1UTH A;  1L5T A;  1FQC A;  4ELR A;  4QFO A;  2H99 A;  3BFU A;  3IAZ A;  3A09 A;  3QXM A;  2R71 A;  1MXW A;  2XXT A;  2FVZ A;  3T1B A;  1INP A;  5IKB A;  1IMC A;  1ZTY A;  1OLC A;  2O84 X;  1RYX A;  3K01 A;  1US5 A;  5JTY B;  3S4U A;  4AB5 A;  4OVR A;  2HCA A;  4OVJ A;  1EYI A;  4FED A;  4TOZ A;  3TAJ A;  4PFW A;  3CHG A;  3FJ7 A;  1MXY A;  3LSF B;  3MP6 A;  1IMF A;  4MBP A;  1B6H A;  4PQJ A;  2QS3 A;  2XXW A;  4KQP A;  4GL8 A;  4F22 A;  3FV2 A;  2B3F A;  5LDZ A;  4F1U A;  4ZED A;  4MJO A;  3Q26 A;  5CBR A;  1JVY A;  2OZZ A;  3CG3 A;  3G3G A;  1UTB B;  3SES A;  5F24 A;  1SW1 A;  4G77 A;  5IZ3 B;  4G8N A;  1FBD A;  4X48 A;  4FEC A;  1POT A;  1XI6 A;  4OTE A;  2HAU A;  2MKZ A;  4GFR A;  2UVI A;  1XC1 A;  2F97 A;  3W9W A;  1FW0 A;  2XD2 A;  3O6I A;  1LBB A;  3E78 A;  2V3U A;  2Z8D A;  3RLF E;  4AQ4 A;  2Z23 A;  1ZLQ A;  2ESN A;  2DSF A;  5B7D A;  3I3V A;  1JEU A;  4HW8 A;  1Q9D A;  4MX6 A;  1VFD A;  3H6W A;  4U23 A;  4YB5 A;  2ZYM A;  4R73 A;  1F9B A;  3KOS A;  1LEV A;  1P1W A;  4K3F A;  1VSO A;  3S9E A;  4LZ8 A;  2L5V A;  2O1L A;  3K6V A;  4P1E A;  2WBB A;  4YKP A;  3CSG A;  4P9K A;  2I3W A;  1Y1M A;  1FTM A;  4ZEI A;  1AH5 A;  4R9F A;  3QUF A;  2DE4 A;  5I58 A;  4XKR A;  2NOO A;  4EQ9 A;  4PFY A;  1MQH A;  3KC0 A;  2XXV A;  3K1P A;  4YAH X;  4EDP A;  1SD3 A;  4I1D A;  1B4H A;  4GX3 A;  3TCH A;  1NV2 A;  3ILT B;  5JEI A;  5HBC A;  3SEX A;  2UYF A;  4NED A;  4JSO A;  4JXI A;  3CIJ A;  3C9H A;  3IOR A;  3FVK A;  3OOA A;  4PCD A;  4I9D A;  5EYH A;  3FXU A;  4ISU A;  4DI4 B;  2IEE A;  1AIV A;  1FCK A;  3L6H A;  3MZ1 A;  1Y20 A;  1XVX A;  3MP1 A;  3MPK A;  3SEY A;  4NG7 A;  4QFP A;  4ELQ A;  1OVB A;  3MAM A;  1P1N A;  4RK2 A;  1USY H;  2UYE A;  1S7Y A;  3AXF A;  3B50 A;  1SYI A;  2WKY A;  3KZG A;  2YPN A;  5IM2 A;  5ET7 A;  2F3B A;  4N6D A;  2DVC A;  2FA7 A;  3O29 A;  2HFB A;  2ZNS A;  1HSE A;  1QUL A;  4ZEF A;  4GWZ A;  4YKK A;  1SDX A;  4AS5 A;  4ESW A;  1SYH A;  3LV0 A;  1DSN A;  2OWZ A;  5AA4 B;  2O6A A;  5AE4 A;  5KDT B;  2F7B A;  4DDD A;  3CFX A;  5EHM A;  3K6W A;  2NVU B;  2QS4 A;  5I56 A;  3OO7 A;  3SZP A;  4OAN A;  1H45 A;  1EYK A;  3HN0 A;  3QK6 A;  3RGY A;  3KJ7 A;  4NGU A;  1MPB A;  3HST A;  1OMP A;  1VFE A;  3PUV E;  3VXB A;  2Y7P A;  2BJI A;  4UA8 A;  4X1B A;  3K6X A;  4DE8 A;  1PEB A;  2Z8F A;  2G93 A;  4PBH A;  5KCJ B;  3IO6 A;  1JW5 A;  2WYK A;  5CM6 A;  4R6Y A;  4F1V A;  1N7W A;  4JVC A;  1QUI A;  1TWY A;  3HPI A;  1ZU0 A;  3PD9 A;  4G68 A;  2ZYN A;  1A99 A;  2I0C A;  3D4G A;  4IY5 A;  5B70 A;  2R9J A;  3VXC A;  2WEF A;  1B5H A;  2DS9 A;  4GRK A;  4NF4 A;  4ZS9 A;  4GXS B;  2QFL A;  2XD3 A;  3JZJ A;  4P3L A;  1UIU A;  1FBC A;  3KEI A;  1YAE A;  1B2H A;  1FTA A;  2XXI A;  1NV0 A;  5ET5 A;  4ZE8 A;  5H8F A;  4OEN A;  1Y3Q A;  3DP4 A;  1KZ8 A;  1B51 A;  3C33 A;  5DTB A;  1MPC A;  3H4Z A;  2Q8M A;  2REJ A;  1NMU A;  4C0R A;  2FIX A;  4RK9 A;  4JB7 A;  4R9G A;  3RT8 A;  3FVN A;  5H8Q A;  3TOD A;  3MVY A;  4JVD A;  4WEP A;  2F7A A;  1PDA A;  2XWI A;  1XHY A;  3L6G A;  4GIZ A;  1IMA A;  1FRP A;  4E0W A;  3FVG A;  3PPQ A;  4MHF A;  1LAF E;  2QSX A;  1POY 1;  4L17 A;  3GLB A;  3PUX E;  3CVG A;  1OQG A;  4NQ8 A;  2OBG A;  1S50 A;  2ZZX A;  2PBW A;  4EF1 A;  3GZG A;  4BLA A;  2O7I A;  3C31 A;  2A5T A;  1NFT A;  1WOD A;  1UQW A;  2DDK A;  2YLN A;  4GL0 A;  3UP9 A;  5IAI A;  2ANJ A;  1NKX A;  1FPE A;  2OWS A;  3VLU A;  2I49 A;  1BLF A;  1H3D A;  2RC7 A;  4JVI A;  3TUS A;  4N4U A;  1O63 A;  2B3B A;  1G0H A;  1FPJ A;  4P1L A;  2BJJ X;  1PB9 A;  3R26 A;  4WKM A;  3S2V A;  1LAH E;  2ZZW A;  4F31 B;  3TTR A;  5L8D A;  3V5A A;  1DOT A;  3H6V A;  2GFE A;  4IGR A;  4Q5T A;  1A40 A;  3E4R A;  2OWT A;  1LCT A;  3RTF B;  1FPD A;  3O9P A;  2FYI A;  5H8F B;  1URS A;  3B8B A;  4PET A;  1Y4C A;  4YIC A;  4OFL A;  4P8B A;  3IO4 A;  4N6P A;  2PMS A;  1NV4 A;  5H8S A;  1FJ9 A;  4KCD A;  4GWX A;  2QRY A;  5I59 A;  1VE4 A;  3Q29 A;  1B5I A;  4OZ9 A;  2XXY A;  3PPP A;  4QHQ A;  4Q8R A;  3QAX A;  4GVO A;  3RN8 A;  2DWJ A;  1DCU A;  4FJP A;  2XWV A;  4U1O A;  3WAE A;  1URD A;  3CFL A;  1DK4 A;  2OCU A;  4MNC A;  3KBR A;  3M3K A;  1QJM A;  1H43 A;  4ECF A;  4GF8 A;  5ELV A;  4N13 A;  2ALU A;  1RKM A;  1NNP A;  1FQD A;  1N3W A;  1N7X A;  4NWC A;  5AA2 B;  3B6W A;  1NUW A;  1B3G A;  3K0V A;  3PPR A;  2XXR A;  4N8G A;  2KQZ A;  2CEX A;  5DYH A;  1MY3 A;  4NF5 A;  5ET6 A;  3T9X B;  5IZZ A;  3LBS A;  3MVZ A;  5I2K A;  1AWB A;  5KZT A;  5I3S A;  3TCG A;  1JET A;  1K9Z A;  3T9V A;  3TDJ A;  3UN6 A;  3Q28 A;  3ILU B;  5CMM A;  5LTC A;  4OVP A;  4O7M A;  1ZKB A;  1B3H A;  5AA2 D;  4GBW A;  3USD A;  1LST A;  4JWO A;  3RQT A;  3S9M C;  2NWJ A;  1ATG A;  2CZL A;  4O8M A;  5CC2 A;  1FQE A;  3LUY A;  3PTY A;  3MBP A;  1IMB A;  4H0W A;  4OER A;  3ZSF A;  1FBF A;  4R74 A;  4H45 A;  2QS2 A;  3MJN A;  5CMC A;  3T93 B;  4ELO A;  1LFH A;  3PGF A;  4GX6 A;  3U1O A;  3FXB A;  2R6G E;  4PGN A;  4OET A;  3HHG A;  4NF6 B;  4DXU A;  3QSL A;  5TP9 A;  3TPA A;  4F18 A;  4DI3 D;  1FBG A;  3BFT A;  5I57 A;  3LR1 A;  4DCY A;  4HXV A;  4MH5 A;  4NF8 A;  2Y84 A;  1LBY A;  1RDY A;  1O7T A;  3PUW E;  2PX1 A;  1NI9 A;  3IOV A;  4GXA A;  1N84 A;  4H46 A;  2O7U A;  5H8H B;  5A5X B;  2P2A A;  4LA9 A;  2ABH A;  4IO7 A;  3FD3 A;  1GGG A;  3V8X B;  4IGT A;  1AMF A;  4G2Z A;  2DWA A;  1IXG A;  4MNI A;  1G0I A;  1NV1 A;  4ELP A;  1FPG A;  4G4P A;  2GRV A;  1QKA A;  4MIJ A;  5I2K B;  3K2D A;  2GHA A;  4NF0 A;  3KN7 A;  1R9Q A;  2DYX A;  4P0I A;  2AYS A;  3TKD A;  1GV8 A;  4RXL A;  4PAK A;  4LVQ A;  4YMA A;  5IZ1 A;  2NUV A;  4NMY A;  1VDW A;  1KA1 A;  2V84 A;  1LBC A;  3R6U A;  1LBZ A;  2QS1 A;  4F2Q A;  3VDF A;  5BWJ A;  1LB8 A;  5K2Y A;  2Z22 A;  3RPL A;  3ISP A;  1B0L A;  4YMB A;  3E13 X;  1OLA A;  2RKM A;  1B32 A;  4P56 A;  4GWS A;  4O7I A;  3VVD A;  2F36 A;  1CNQ A;  5DVF A;  4RPO A;  5ET8 A;  5FTH A;  2B65 A;  1MS7 A;  1UTH B;  3OD7 A;  2UVH A;  1FTL A;  1R9L A;  4TQU Q;  3OXN A;  3K1M A;  2HZK A;  1IMD A;  4XF5 A;  3FIR A;  5TP9 B;  5I2N A;  1PB8 A;  1MPD A;  3MWB A;  4KHZ E;  4X9T A;  4TLM B;  4YZZ A;  1P1U A;  4EUO A;  2DOJ A;  4EF2 A;  4ZZA A;  4GWU A;  4YKJ A;  3DP6 A;  2QMW A;  4E0X A;  1RYO A;  3OO8 A;  2V3Q A;  1S9T A;  4O3A A;  1VR5 A;  2F8D A;  2GH9 A;  3H06 B;  1H76 A;  1SW2 A;  1USY E;  1LB9 A;  2H25 A;  3W15 C;  4F3S A;  1NV5 A;  3T96 B;  5I5P A;  3PD8 A;  5TPA A;  1EH3 A;  1YCJ A;  3G7W A;  4BDO A;  3PUZ E;  4U1Z A;  4PFR A;  4DCX A;  1N04 A;  1SPI A;  4ZE9 A;  3IB1 A;  2UVJ A;  1WVJ A;  3U94 A;  5L9M A;  2OX3 A;  3FV1 A;  4R72 A;  3N5L A;  3N6U A;  2CZI A;  3OMB A;  3IOW A;  1FPL A;  4KYD A;  1MY0 A;  1JP4 A;  1URG A;  2H5Y A;  4P11 A;  4F39 A;  5ICQ A;  3EHU A;  3I5O A;  1JEV A;  4N8Y A;  1T0K A;  1YTV A;  3HV1 A;  1HSJ A;  1TFA A;  4UAC A;  5EYF A;  1M5E A;  4OXV A;  4BDR A;  1QVS A;  1FTO A;  1MH4 A;  4M1V A;  3HFU A;  1SW5 A;  5IGA A;  3JV9 A;  3RNN A;  5ITP A;  2AIX A;  4RNS A;  3MVW A;  1ZIU A;  4YKI A;  2Q88 A;  5EHS A;  3LSW A;  4OMB A;  2V4C A;  4HTG A;  3G3H A;  4H67 A;  3SET A;  3TCF A;  1NV6 A;  1KWH A;  2FHY A;  1MM7 A;  5CMB A;  1B1X A;  1P99 A;  1B58 A;  2UVG A;  3QMF A;  4IB2 A;  4I8C A;  2JJK A;  1JVX A;  3C34 A;  2DVZ A;  4MEV A;  4NN3 A;  1B3E A;  3CFZ A;  3U72 A;  2P3N A;  2ZNU A;  3M3F A;  5I84 A;  5I58 B;  5I7I A;  3ROJ A;  4N17 A;  2XX7 A;  3C36 A;  4YU0 A;  5EQ9 A;  3TQL A;  3M3L A;  2DWH A;  2B4L A;  3O97 A;  2HPG A;  2QJE A;  3RT6 B;  1NUX A;  3VE1 B;  1B0H A;  3FGS A;  3U93 A;  4OEV A;  3OEM A;  2Q8J A;  5AA3 A;  4Q0C A;  2OJT A;  4OYV A;  1OIB A;  3B6T A;  3I6V A;  5A5L A;  4F3G A;  2REG A;  3D4C A;  5EQ8 A;  2FBP A;  2HXW A;  3RTW B;  2HHM A;  4PFU A;  2Y7R A;  5H8N A;  3VFJ A;  4POX A;  4PDH A;  3UOR A;  3UGW A;  1BP5 A;  1I69 A;  4FOR A;  4MCO A;  3UIF A;  1NUZ A;  5FHM A;  3O6G A;  4I62 A;  4GBV A;  4GQO A;  4GX4 A;  5FHO A;  4XKQ A;  2THI A;  1MQJ A;  2ZZV A;  1LBW A;  4U21 A;  5J16 A;  2R8T A;  3SEU A;  4JBZ A;  5FTI A;  4LAT A;  3VVF A;  4RY1 A;  5CMK A;  2HZL A;  2HAV A;  5JK4 A;  3MC2 A;  1MQD A;  4ONY A;  2I3V A;  4NWD A;  2CMO A;  1MXX A;  4IO3 A;  3KSX A;  4LN5 A;  4GD5 A;  4R6K A;  2RC9 A;  3KJT A;  3OEL A;  4XIG Q;  5I56 B;  2XXX A;  3G3F A;  3LC8 A;  2P3V A;  1O64 A;  3JYR A;  4LP2 B;  4HS7 A;  1BKA A;  4LZ5 A;  4AB6 A;  3KN8 A;  2I48 A;  3PPN A;  1D4N A;  2O51 A;  2CZK A;  3DM0 A;  2RF1 A;  1R6Z A;  3IOU A;  5F1Q A;  3GBA A;  1A7L A;  1MXZ A;  4H8I A;  3RYD A;  1YZ0 A;  5CBS A;  4DZ1 A;  4OQO A;  2AL4 A;  1XS5 A;  1M5C A;  1IZ1 A;  4H6D A;  4G68 B;  4UAB A;  1IIW A;  1B5J A;  3VV5 A;  4MLV A;  1I6B A;  2WYP A;  2XA5 A;  3IB2 A;  4KI0 E;  4PE3 A;  2P0S A;  5T3J A;  4KD5 A;  2VGQ A;  4I3E A;  2QVU A;  4PE5 B;  4EXL A;  4QFN A;  4HCW A;  4NF4 B;  5EQA A;  2AL5 A;  2LAO A;  4GOT A;  4HE1 A;  2PT1 A;  1CB6 A;  4F29 A;  4U2R A;  3EKI A;  2KR0 A;  1R1N A;  1QKB A;  1NL5 A;  2VOZ A;  1WDN A;  3LSL A;  4N07 A;  3MP8 A;  2XWK A;  2UXA A;  4DXC A;  3P7I A;  2OK2 A;  4LON B;  3FXR A;  1MQG A;  4DLD A;  3N94 A;  4C1U A;  5CRY A;  2P1S A;  2Y5K A;  4NTL A;  3TTL A;  4PAF A;  3FAT A;  3DLN A;  4KYS A;  5H8Q B;  4PBQ A;  3H6U A;  2RCB A;  1ANF A;  1B3F A;  1LAG E;  4OA4 A;  1Q35 A;  3CI8 A;  3HO7 A;  3EQ1 A;  5TU0 A;  1XVY A;  4IO6 A;  1DPP A;  2VHA A;  1NNT A;  2ZYK A;  4FEB A;  4H65 A;  3V89 B;  1SVX B;  1EYJ A;  1B40 A;  4RJZ A;  3R7X A;  2GHB A;  3D1R A;  3TYH A;  4MFI A;  3TMG A;  3O28 A;  4XKN A;  2HQ0 A;  3KC1 A;  1BK4 A;  3BBR A;  4OVT A;  4PGP A;  1NH8 A;  3S9N C;  4OVQ A;  3OO6 A;  1LAX A;  2V93 A;  1AL3 A;  2O1M A;  2A5T B;  4XTC Q;  1IUD A;  2Y7W A;  1NNF A;  3SEV A;  2IA4 A;  1JQF A;  4LZ7 A;  1B46 A;  2RC8 A;  3E9X A;  4KPT A;  1CE2 A; 
#chains in the Genus database with same CATH homology
 3C32 A;  2Q89 A;  3F11 A;  1MRP A;  2H4I A;  1UTB A;  4FIM A;  3IL1 B;  1Y4T A;  1Y1Z A;  1MXV A;  1IIT A;  3BKI B;  4RYA A;  3S9L C;  1EZP A;  3FJM A;  3TTN A;  3VLW A;  3DP8 A;  2HEU A;  5ITO A;  1B7U A;  3TEL A;  4TLL B;  5K2X A;  1DPE A;  3M8U A;  4QSE A;  5I59 B;  3TQW A;  3KN3 A;  2ZXT A;  4BDM A;  1TT1 A;  4FE8 A;  4XKP A;  4P0G A;  2ZYO A;  1LFG A;  3GXA A;  4IO4 A;  2VD3 A;  3FUZ A;  3ZKL A;  3IR1 A;  3O66 A;  3B7D A;  2I4C A;  2KLF A;  3SER A;  3PU5 A;  1B05 A;  4F1Y A;  2F7C A;  1MQI A;  5DVI A;  3RY3 A;  5DT6 A;  1B52 A;  1D9Y A;  1FQB A;  3KFM A;  1MDP 1;  1ELJ A;  1N76 A;  3U8Q A;  4OWD A;  4RPN A;  3MUQ A;  4NF5 B;  3UA8 A;  1A8F A;  4KR5 A;  3CG1 A;  1D3K A;  4H5G A;  3THI A;  4IY6 A;  3WAF A;  3O2A A;  2ONR A;  3B6Q A;  1EZO A;  1IXC A;  5J1D A;  3HHF A;  3G3K A;  3QIM A;  3OSQ A;  1I6A A;  4JWY A;  4MLQ A;  4WXJ A;  1PB7 A;  1P1Q A;  3RPW A;  3FVO A;  3G3I A;  5CI5 A;  1SW4 A;  3ONM A;  2DE3 A;  2PVU A;  4QFK A;  4GLI A;  3TEP A;  2G29 A;  3IB0 A;  1QW0 A;  1GR2 A;  3FAS A;  1IXH A;  2PT2 A;  1OVT A;  3OEN A;  5I57 B;  1Z7M E;  1I6Q A;  3A3U A;  2D3I A;  1BIY A;  4NF8 B;  1Z7N E;  4YB7 A;  2I0B A;  4G68 C;  1TFD A;  4DXB A;  3H3G A;  5F7V A;  1MXU A;  2QL3 A;  1Y3N A;  2Q9T A;  2W7Y A;  4ZZE A;  5HPQ A;  2X7P A;  3V83 A;  4OFO A;  1XT8 A;  4DIG A;  5LOM A;  2H98 A;  5AA4 A;  1IXI A;  4PFT A;  4ZEK A;  5KDT A;  2XXQ A;  3E3K A;  2F35 A;  4F3P A;  3T9U A;  3IJO B;  3T22 A;  2F6P A;  2DXR A;  4ND9 A;  4JSD A;  1US4 A;  2DE2 A;  4WED A;  3K00 A;  3EHS A;  2F5X A;  3OO9 A;  3H6T A;  5HM4 B;  3PMX A;  4ESX A;  1A8E A;  3ZKK A;  2RIN A;  4JDF A;  4Z7E A;  2ZNT A;  5KCJ A;  2ONK E;  4RA1 A;  3A3C A;  4G8M A;  3K02 A;  5DVJ A;  3G3J A;  3KGC A;  1UIV A;  1XOC A;  4XXU A;  1A54 A;  4O3B A;  4ZEB A;  1B7Z A;  1LCF A;  1JNF A;  4POW A;  3TTK A;  2D5W A;  2VD2 A;  4U4S A;  5I2N B;  2ZMB A;  1GTK A;  2QPQ A;  1Q1K A;  2X26 A;  4X1D A;  1J1N A;  2D21 A;  3IJX B;  4LQ5 A;  3U92 A;  1LLS A;  1A55 A;  5DEX A;  3SEW A;  1B7H A;  1MH3 A;  2VP1 A;  4EQ7 A;  1P1O A;  1SQY A;  2DP8 A;  3Q25 A;  1ZJL A;  1DMB A;  3MZB A;  2XX8 A;  4H8J A;  4IO2 A;  3KSJ A;  2O69 A;  1BTJ A;  3QUJ A;  3PMW A;  5TPA B;  3PPO A;  1MY2 A;  3PUY E;  2O68 A;  4U22 A;  3DEL B;  4O3C A;  2X7Q A;  1M5B A;  2RCA A;  3IX1 A;  4H1X A;  4FAT A;  4QRZ A;  3QYT A;  5L9O A;  4QSD A;  5AA1 A;  5FHN A;  3W9V A;  3OEK A;  1N0T A;  2F34 A;  1DTG A;  4THI A;  3IK6 B;  3MVX A;  2XHD A;  3K4U A;  2E1S A;  4Q30 B;  4G8H A;  4LUB A;  1MY1 A;  4U4X A;  2I58 A;  3ZS6 A;  2Q2A A;  4QSC A;  1Y9U A;  1H44 A;  1IEJ A;  4F19 A;  3K1N A;  4KCC A;  5M2V A;  4BDL A;  1FTJ A;  3EF7 A;  4R6H A;  1D9V A;  4GWO A;  5DEX B;  2M8C A;  4M4G A;  3UK4 A;  1JW4 A;  5ISU A;  2DQV A;  2XXU A;  3SKP A;  3EN3 A;  4R75 A;  4JWX A;  1QUJ A;  2OLB A;  2XX9 A;  3MQ9 A;  3N6T A;  2PYY A;  3CRB A;  2Y7K A;  3MZ9 A;  4BDQ A;  3MPL A;  3TTM A;  4R2B A;  5H8N B;  2E0S A;  1JW1 A;  2YJP A;  3H03 A;  1MG1 A;  5BUU A;  2NXO A;  3SDF A;  2I4B A;  2XXP A;  5AA2 A;  5L9S A;  1ZBM A;  2V3T A;  3FJG A;  1EU8 A;  3TFL A;  4LQ2 A;  3ODB A;  4BDN A;  1B1H A;  1FQF A;  3TZA A;  4MF3 A;  1QUK A;  3PV0 E;  1IQ7 A;  2V25 A;  1MDQ A;  1GVC A;  4ZDM A;  1SI1 A;  4F2O A;  1NH7 A;  4KYE A;  1MM6 A;  1SI0 A;  3C4M A;  1ZMG A;  3PMV A;  1AOV A;  4FAJ A;  1OQH A;  4PP0 A;  3EPE A;  2F78 A;  3T66 A;  4EXK A;  3O6H A;  3OSR A;  4NF6 A;  1N3X A;  2XXH A;  4KFQ A;  4ZEC A;  1B4Z A;  3ECR A;  1Y3P A;  4QF9 A;  3RUM A;  2FNC A;  5JTY A;  2QMX A;  4R2F A;  1II5 A;  1DTZ A;  5ICT A;  3KG2 A;  3C35 A;  1FTK A;  1LFI A;  2A5S A;  2Y7I A;  4YB6 A;  5H8H A;  2F6G A;  5A5X A;  4OES A;  2I6E A;  2DWI A;  1MY4 A;  3LSX A;  1PC3 A;  3CR9 A;  1FQA A;  4Z0I A;  1YPN A;  3N26 A;  3FZV A;  2H9B A;  3MW0 A;  4F3B A;  1M5D A;  2ONS A;  1NNK A;  3VLV A;  3Q27 A;  3IOT A;  3CSB A;  4H5F A;  1SBP A;  4OFJ A;  1PBQ A;  4HCY A;  3VVE A;  1EZ9 A;  3H7M A;  3HCQ A;  1PBP A;  1HSL A;  1B3L A;  4NE4 A;  4QFL A;  2DXY A;  1LGB C;  3GBB A;  3T9H B;  3K6U A;  3KOT A;  4EQB A;  4OEU A;  4OHN A;  2Z8E A;  1M5F A;  2Q2C A;  3EHT A;  4C1T A;  3FXQ A;  1B9J A;  1TXF A;  4IO5 A;  1UTH A;  1L5T A;  1FQC A;  4ELR A;  4QFO A;  2H99 A;  3BFU A;  3IAZ A;  3A09 A;  3QXM A;  2R71 A;  1MXW A;  2XXT A;  5IKB A;  1ZTY A;  1OLC A;  2O84 X;  1RYX A;  3K01 A;  1US5 A;  5JTY B;  3S4U A;  4AB5 A;  2HCA A;  4OVJ A;  4FED A;  4TOZ A;  3TAJ A;  4PFW A;  3FJ7 A;  1MXY A;  3LSF B;  3MP6 A;  4MBP A;  1B6H A;  4PQJ A;  2QS3 A;  2XXW A;  4KQP A;  4GL8 A;  4F22 A;  3FV2 A;  2B3F A;  4F1U A;  4ZED A;  3Q26 A;  5CBR A;  1JVY A;  2OZZ A;  3CG3 A;  3G3G A;  1UTB B;  3SES A;  1SW1 A;  4G77 A;  4G8N A;  4X48 A;  4FEC A;  1POT A;  4OTE A;  2HAU A;  4GFR A;  2UVI A;  1XC1 A;  2F97 A;  3W9W A;  1FW0 A;  2XD2 A;  3O6I A;  1LBB A;  2V3U A;  2Z8D A;  3RLF E;  4AQ4 A;  2Z23 A;  1ZLQ A;  2ESN A;  2DSF A;  5B7D A;  3I3V A;  1JEU A;  4HW8 A;  1VFD A;  3H6W A;  4U23 A;  4YB5 A;  2ZYM A;  4R73 A;  1F9B A;  3KOS A;  1P1W A;  4K3F A;  1VSO A;  3S9E A;  4LZ8 A;  2O1L A;  3K6V A;  4YKP A;  3CSG A;  2I3W A;  1Y1M A;  1FTM A;  4ZEI A;  1AH5 A;  4R9F A;  3QUF A;  2DE4 A;  5I58 A;  4XKR A;  2NOO A;  4EQ9 A;  4PFY A;  1MQH A;  2XXV A;  3K1P A;  4YAH X;  4EDP A;  1SD3 A;  4I1D A;  1B4H A;  3TCH A;  3ILT B;  5JEI A;  5HBC A;  3SEX A;  2UYF A;  4NED A;  4JSO A;  4JXI A;  3CIJ A;  3C9H A;  3IOR A;  3FVK A;  3OOA A;  4I9D A;  3FXU A;  4ISU A;  2IEE A;  1AIV A;  1FCK A;  3L6H A;  3MZ1 A;  1Y20 A;  1XVX A;  3MP1 A;  3MPK A;  3SEY A;  4QFP A;  4ELQ A;  1OVB A;  3MAM A;  1P1N A;  4RK2 A;  1USY H;  2UYE A;  1S7Y A;  3AXF A;  1SYI A;  2WKY A;  3KZG A;  2YPN A;  2DVC A;  2FA7 A;  3O29 A;  2HFB A;  2ZNS A;  1HSE A;  1QUL A;  4ZEF A;  4YKK A;  1SDX A;  4ESW A;  1SYH A;  1DSN A;  5AA4 B;  2O6A A;  5AE4 A;  5KDT B;  2F7B A;  4DDD A;  3CFX A;  5EHM A;  3K6W A;  2NVU B;  2QS4 A;  5I56 A;  3OO7 A;  1H45 A;  3HN0 A;  3QK6 A;  3RGY A;  3KJ7 A;  1MPB A;  3HST A;  1OMP A;  1VFE A;  3PUV E;  3VXB A;  2Y7P A;  4UA8 A;  4X1B A;  3K6X A;  4DE8 A;  1PEB A;  2Z8F A;  2G93 A;  5KCJ B;  3IO6 A;  1JW5 A;  5CM6 A;  4R6Y A;  4F1V A;  1N7W A;  1QUI A;  1TWY A;  3HPI A;  1ZU0 A;  3PD9 A;  4G68 A;  2ZYN A;  1A99 A;  2I0C A;  3D4G A;  4IY5 A;  5B70 A;  2R9J A;  3VXC A;  1B5H A;  2DS9 A;  4GRK A;  4NF4 A;  4ZS9 A;  4GXS B;  2XD3 A;  3JZJ A;  1UIU A;  3KEI A;  1YAE A;  1B2H A;  2XXI A;  4ZE8 A;  5H8F A;  4OEN A;  1Y3Q A;  3DP4 A;  1B51 A;  3C33 A;  5DTB A;  1MPC A;  3H4Z A;  2REJ A;  1NMU A;  4C0R A;  4RK9 A;  4JB7 A;  4R9G A;  3RT8 A;  3FVN A;  5H8Q A;  3TOD A;  3MVY A;  4WEP A;  2F7A A;  1PDA A;  1XHY A;  3L6G A;  4GIZ A;  4E0W A;  3FVG A;  3PPQ A;  1LAF E;  2QSX A;  1POY 1;  4L17 A;  3GLB A;  3PUX E;  3CVG A;  1OQG A;  2OBG A;  1S50 A;  2PBW A;  4EF1 A;  3GZG A;  4BLA A;  2O7I A;  3C31 A;  2A5T A;  1NFT A;  1WOD A;  1UQW A;  2YLN A;  3UP9 A;  4GL0 A;  5IAI A;  2ANJ A;  1NKX A;  2OWS A;  3VLU A;  2I49 A;  1BLF A;  1H3D A;  2RC7 A;  3TUS A;  1O63 A;  2B3B A;  2BJJ X;  1PB9 A;  3R26 A;  4WKM A;  3S2V A;  1LAH E;  4F31 B;  3TTR A;  5L8D A;  3V5A A;  1DOT A;  3H6V A;  2GFE A;  4IGR A;  4Q5T A;  1A40 A;  3E4R A;  2OWT A;  1LCT A;  3RTF B;  3O9P A;  2FYI A;  5H8F B;  1URS A;  4PET A;  1Y4C A;  4YIC A;  4OFL A;  3IO4 A;  4N6P A;  2PMS A;  5H8S A;  4KCD A;  2QRY A;  5I59 A;  1VE4 A;  3Q29 A;  1B5I A;  4OZ9 A;  2XXY A;  3PPP A;  4QHQ A;  4Q8R A;  3QAX A;  4GVO A;  3RN8 A;  2DWJ A;  4FJP A;  4U1O A;  3WAE A;  1URD A;  3CFL A;  2OCU A;  3KBR A;  3M3K A;  1QJM A;  1H43 A;  4ECF A;  4GF8 A;  5ELV A;  4N13 A;  2ALU A;  1RKM A;  1NNP A;  1FQD A;  1N3W A;  1N7X A;  4NWC A;  5AA2 B;  3B6W A;  1B3G A;  3K0V A;  3PPR A;  2XXR A;  5DYH A;  1MY3 A;  4NF5 A;  3T9X B;  3LBS A;  3MVZ A;  5I2K A;  5KZT A;  3TCG A;  1JET A;  3T9V A;  3UN6 A;  3TDJ A;  3Q28 A;  3ILU B;  5CMM A;  1ZKB A;  1B3H A;  5AA2 D;  3USD A;  1LST A;  4JWO A;  3RQT A;  3S9M C;  2NWJ A;  1ATG A;  2CZL A;  5CC2 A;  1FQE A;  3LUY A;  3MBP A;  4H0W A;  4OER A;  3ZSF A;  4R74 A;  5CMC A;  2QS2 A;  3MJN A;  3T93 B;  4ELO A;  1LFH A;  3PGF A;  3U1O A;  2R6G E;  4OET A;  3HHG A;  4NF6 B;  4DXU A;  3QSL A;  5TP9 A;  3TPA A;  4F18 A;  3BFT A;  5I57 A;  3LR1 A;  4DCY A;  4MH5 A;  4NF8 A;  2Y84 A;  1O7T A;  3PUW E;  2PX1 A;  3IOV A;  4GXA A;  1N84 A;  2O7U A;  5H8H B;  5A5X B;  2P2A A;  4LA9 A;  2ABH A;  4IO7 A;  3FD3 A;  1GGG A;  3V8X B;  4IGT A;  1AMF A;  4G2Z A;  2DWA A;  1IXG A;  4ELP A;  4G4P A;  2GRV A;  1QKA A;  5I2K B;  3K2D A;  2GHA A;  3KN7 A;  1R9Q A;  2DYX A;  4P0I A;  2AYS A;  3TKD A;  1GV8 A;  4RXL A;  4LVQ A;  4YMA A;  2NUV A;  4NMY A;  2V84 A;  1LBC A;  3R6U A;  2QS1 A;  4F2Q A;  3VDF A;  5BWJ A;  1LB8 A;  5K2Y A;  2Z22 A;  1B0L A;  4YMB A;  3E13 X;  1OLA A;  2RKM A;  1B32 A;  3VVD A;  2F36 A;  5DVF A;  4RPO A;  5FTH A;  2B65 A;  1MS7 A;  1UTH B;  3OD7 A;  2UVH A;  1FTL A;  1R9L A;  4TQU Q;  3OXN A;  3K1M A;  2HZK A;  3FIR A;  5TP9 B;  5I2N A;  1PB8 A;  1MPD A;  3MWB A;  4KHZ E;  4X9T A;  4TLM B;  4YZZ A;  1P1U A;  4EUO A;  2DOJ A;  4EF2 A;  4ZZA A;  4YKJ A;  3DP6 A;  2QMW A;  4E0X A;  1RYO A;  3OO8 A;  2V3Q A;  1S9T A;  4O3A A;  1VR5 A;  2F8D A;  2GH9 A;  3H06 B;  1H76 A;  1SW2 A;  1USY E;  1LB9 A;  2H25 A;  3W15 C;  4F3S A;  3T96 B;  3PD8 A;  5TPA A;  1EH3 A;  1YCJ A;  3G7W A;  4BDO A;  3PUZ E;  4U1Z A;  4DCX A;  1N04 A;  4ZE9 A;  3IB1 A;  2UVJ A;  1WVJ A;  3U94 A;  5L9M A;  3FV1 A;  4R72 A;  3N5L A;  3N6U A;  3OMB A;  3IOW A;  4KYD A;  1MY0 A;  1URG A;  2H5Y A;  4P11 A;  4F39 A;  5ICQ A;  3EHU A;  3I5O A;  1JEV A;  1T0K A;  1YTV A;  3HV1 A;  1HSJ A;  1TFA A;  4UAC A;  5EYF A;  1M5E A;  4OXV A;  4BDR A;  1QVS A;  1FTO A;  1MH4 A;  4M1V A;  1SW5 A;  3JV9 A;  3RNN A;  5ITP A;  2AIX A;  4RNS A;  3MVW A;  1ZIU A;  4YKI A;  2Q88 A;  5EHS A;  3LSW A;  4OMB A;  4HTG A;  3G3H A;  4H67 A;  3SET A;  3TCF A;  1KWH A;  1MM7 A;  5CMB A;  1B1X A;  1P99 A;  1B58 A;  2UVG A;  4IB2 A;  4I8C A;  1JVX A;  3C34 A;  2DVZ A;  1B3E A;  3CFZ A;  3U72 A;  2ZNU A;  3M3F A;  5I84 A;  5I58 B;  2XX7 A;  3C36 A;  4YU0 A;  3TQL A;  3M3L A;  2DWH A;  3O97 A;  2QJE A;  3RT6 B;  3VE1 B;  1B0H A;  3FGS A;  3U93 A;  4OEV A;  3OEM A;  2Q8J A;  5AA3 A;  4Q0C A;  2OJT A;  4OYV A;  1OIB A;  3B6T A;  3I6V A;  4F3G A;  2REG A;  3D4C A;  2HXW A;  3RTW B;  4PFU A;  2Y7R A;  5H8N A;  3VFJ A;  4POX A;  3UOR A;  3UGW A;  1BP5 A;  1I69 A;  4FOR A;  3UIF A;  5FHM A;  3O6G A;  4I62 A;  4GQO A;  5FHO A;  4XKQ A;  2THI A;  1MQJ A;  4U21 A;  3SEU A;  4JBZ A;  5FTI A;  4LAT A;  3VVF A;  4RY1 A;  5CMK A;  2HZL A;  2HAV A;  5JK4 A;  3MC2 A;  1MQD A;  4ONY A;  2I3V A;  4NWD A;  2CMO A;  1MXX A;  4IO3 A;  3KSX A;  4GD5 A;  4R6K A;  2RC9 A;  3KJT A;  3OEL A;  4XIG Q;  5I56 B;  2XXX A;  3G3F A;  3LC8 A;  1O64 A;  3JYR A;  4LP2 B;  4HS7 A;  1BKA A;  4LZ5 A;  4AB6 A;  3KN8 A;  2I48 A;  3PPN A;  1D4N A;  2O51 A;  3DM0 A;  2RF1 A;  1R6Z A;  3IOU A;  5F1Q A;  3GBA A;  1A7L A;  1MXZ A;  4H8I A;  5CBS A;  4DZ1 A;  4OQO A;  2AL4 A;  1XS5 A;  1M5C A;  1IZ1 A;  4H6D A;  4G68 B;  1IIW A;  1B5J A;  3VV5 A;  4MLV A;  1I6B A;  3IB2 A;  4KI0 E;  2P0S A;  4KD5 A;  2VGQ A;  4EXL A;  4PE5 B;  4QFN A;  4HCW A;  4NF4 B;  2AL5 A;  2LAO A;  4GOT A;  4F29 A;  2PT1 A;  1CB6 A;  4U2R A;  1R1N A;  1QKB A;  1NL5 A;  2VOZ A;  1WDN A;  3LSL A;  4N07 A;  3MP8 A;  2UXA A;  4DXC A;  3P7I A;  2OK2 A;  4LON B;  3FXR A;  4DLD A;  1MQG A;  3N94 A;  4C1U A;  5CRY A;  2P1S A;  4NTL A;  3TTL A;  3FAT A;  3DLN A;  4KYS A;  5H8Q B;  3H6U A;  2RCB A;  1ANF A;  1B3F A;  1LAG E;  1Q35 A;  3CI8 A;  3HO7 A;  3EQ1 A;  5TU0 A;  1XVY A;  4IO6 A;  1DPP A;  2VHA A;  1NNT A;  2ZYK A;  4FEB A;  4H65 A;  3V89 B;  1SVX B;  1B40 A;  4RJZ A;  3R7X A;  2GHB A;  3TYH A;  4MFI A;  3TMG A;  3O28 A;  4XKN A;  2HQ0 A;  3BBR A;  1NH8 A;  3S9N C;  3OO6 A;  1LAX A;  2V93 A;  1AL3 A;  2O1M A;  2A5T B;  4XTC Q;  1IUD A;  2Y7W A;  1NNF A;  3SEV A;  2IA4 A;  1JQF A;  4LZ7 A;  1B46 A;  2RC8 A;  3E9X A;  4KPT A;  1CE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...