3N6UA

Effector binding domain of tsar in complex with its inducer p-toluenesulfonate
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
205
structure length
205
Chain Sequence
GHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the effector binding domain of TsaR
rcsb
source organism Comamonas testosteroni
total genus 55
structure length 205
sequence length 205
ec nomenclature
pdb deposition date 2010-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3n6uA02
4R74A 1NKXA 2VD3A 4F1UA 4HTGA 4R73A 3FV1A 1B40A 1A7LA 1LAXA 5I58B 4XKNA 1QJMA 4OFOA 4QFKA 4H65A 3B6WA 2DWHA 4NF5B 1RYXA 1B1XA 3IR1A 2VGQA 3K4UA 4R72A 4Q5TA 2V25A 1XT8A 3LBSA 2NOOA 4FORA 2RKMA 3CSGA 2H98A 1US5A 1IEJA 4QSEA 3MPLA 2O51A 2QMXA 2OLBA 4NF8B 4G8HA 4Z0IA 5H8QA 1UIVA 4IO6A 2O84X 3UA8A 3TDJA 4LQ5A 4YKKA 4OQOA 2KLFA 1LAFE 4FEBA 3S9MC 1PB7A 4XTCQ 3FATA 3E4RA 3H6WA 4OFLA 3IO6A 2XX7A 1FQBA 2RINA 1A55A 4QRZA 4H6DA 3Q26A 4OZ9A 2Q89A 5CC2A 3QSLA 5KZTA 4NMYA 5H8QB 4DE8A 1US4A 1BP5A 2DXYA 4KHZE 1B3HA 5J1DA 3ILTB 1ZBMA 4OTEA 4RK9A 1IZ1A 1OMPA 4G8NA 3OMBA 2W7YA 2ZNUA 2O7UA 4R6KA 1WDNA 1R6ZA 3EN3A 2CMOA 1N3WA 4LA9A 1B7ZA 1OIBA 2YJPA 3PPOA 1BIYA 3KG2A 3EHUA 4FATA 1IUDA 3LC8A 3N26A 2Y84A 4PQJA 3CSBA 5AA4A 3G3KA 4MBPA 3LSFB 4BLAA 4G68B 3TTNA 1JVXA 4MLVA 1FTOA 1B9JA 4ELQA 1B5JA 3M3FA 2B3FA 4OYVA 1XVYA 1IXIA 4KYDA 4C1TA 4LVQA 1NH8A 1LB9A 3C33A 1D9VA 3CG1A 2F5XA 4K3FA 3C9HA 1HSJA 3SEXA 1FTJA 5L9OA 4PFTA 5I2NA 1QKBA 4JBZA 3G3FA 4ONYA 3K1MA 2XXYA 3FXUA 4ELPA 1I6BA 2I49A 3O97A 3V8XB 2QL3A 2B65A 1CB6A 4YAHX 4I1DA 2V3QA 5I2KA 2I58A 3L6GA 1MDP1 3IOUA 3PD9A 3BBRA 1FQFA 3RT8A 4OESA 4M1VA 3IOVA 1S50A 5I2NB 3O28A 2AL5A 1MQIA 2QJEA 1B51A 4GD5A 1EZPA 3OO6A 3K01A 4E0XA 1MS7A 4JWXA 4JXIA 2PMSA 3G3GA 2IEEA 2XXRA 5AA2A 2DXRA 4RPNA 4NWCA 1R1NA 1II5A 1Y1MA 3K2DA 1Q35A 4KCDA 5I2KB 1D9YA 1USYH 1QUIA 4JB7A 1USYE 4LZ7A 3U72A 3TUSA 3PUZE 4QSDA 5DVFA 3EQ1A 4U2RA 2G29A 1N7XA 1YTVA 2GHAA 2I4CA 2GRVA 2Z8FA 4F1VA 4P0GA 3DP8A 4GQOA 3QIMA 3KBRA 1GGGA 3VLVA 2OCUA 4ZEFA 4POWA 1NH7A 4G77A 3UP9A 4H5GA 1RKMA 1NNTA 3FASA 4EQBA 1UTHA 2Y7IA 1MH3A 1JEVA 1M5CA 2R6GE 1URGA 3EHTA 3AXFA 5H8SA 4L17A 2RCAA 3TQLA 1ATGA 3D4CA 3EF7A 2E1SA 1LCTA 1XC1A 1B05A 1B6HA 1MY4A 2OWTA 1SBPA 3OELA 1B3FA 5EHMA 2XXVA 1JNFA 3OEKA 2OBGA 3OXNA 4F3GA 3FXQA 1QUKA 3PV0E 3SEUA 1IQ7A 2F6PA 4I62A 3K0VA 1UTHB 4ZE9A 5ITPA 3L6HA 2HZKA 5AE4A 3GBAA 5CRYA 4ND9A 5B7DA 3M3LA 4NWDA 3PPQA 1DPEA 1YCJA 4NF6A 4H8JA 3I3VA 4KCCA 2ABHA 3T9VA 4HW8A 5DVIA 4RK2A 3CFXA 1POTA 2QMWA 2FYIA 1LSTA 1URDA 2AYSA 2PX1A 1PBQA 3IOWA 1TT1A 4OWDA 4OVJA 2XXTA 2E0SA 4EQ7A 3TTKA 1MY0A 2I0CA 3Q27A 3TODA 1B52A 3QK6A 1A54A 4JWYA 1B5HA 4R6YA 1D3KA 1WVJA 4NF6B 1QW0A 2Z23A 2LAOA 3G7WA 5CM6A 3OSRA 4FIMA 4MFIA 1MXUA 2HZLA 2O69A 3C34A 2ZYKA 2XXXA 1MPDA 3IOTA 1XS5A 1B4HA 3U92A 4IO3A 1MQHA 2UVIA 3V5AA 3VXBA 3VFJA 3KSXA 2D3IA 4LONB 2DS9A 4I8CA 2RC9A 2WKYA 1B3LA 4F31B 3T22A 2XX8A 4AB6A 4FE8A 4QFNA 3JV9A 3MP6A 4YKPA 3K6VA 3IL1B 4RPOA 1LFGA 1D4NA 1Y9UA 2HEUA 4ESWA 3TCHA 3R26A 4H0WA 1Y1ZA 2Q2AA 2A5TA 3LUYA 1CE2A 4KQPA 3UN6A 3TPAA 4FECA 3O6IA 3SESA 3IJOB 3H6UA 2VHAA 1MY3A 4NF8A 3MJNA 3MVXA 3TTLA 4F22A 1B0LA 2Q88A 1B1HA 4I9DA 1MM7A 1PDAA 3QUJA 4XKQA 3FJ7A 1AIVA 2ZYNA 3TAJA 3RTFB 3SEWA 1NNKA 3FXRA 5L9SA 2F36A 2OK2A 2ANJA 3WAFA 3PU5A 4GRKA 3OOAA 2A5TB 1M5EA 1SQYA 4BDRA 2P2AA 3A09A 1Z7NE 4X1DA 4OXVA 3OO9A 4IGTA 1NL5A 1PEBA 5KCJB 3SERA 1N04A 4F39A 4AQ4A 1Y4TA 4NE4A 2ESNA 5LOMA 4GXSB 2RF1A 4FAJA 4U21A 3B6QA 3C35A 4QSCA 3CFZA 2F78A 2PBWA 3P7IA 2THIA 4DLDA 3T9UA 2QPQA 5FTIA 1ZU0A 3N6UA 4YB6A 4Q30B 3C31A 3K1PA 1SDXA 5DTBA 3FGSA 4G68A 2DP8A 1I6AA 3CIJA 5K2XA 3TCFA 3O29A 2VP1A 5CI5A 5AA2D 4OERA 2HCAA 2V3TA 5ELVA 2QSXA 3KJ7A 3MC2A 4EUOA 3C4MA 4QFPA 4C1UA 5FHMA 3U8QA 1POY1 2AL4A 4YZZA 4N13A 1I6QA 1MDQA 4TOZA 3QUFA 3G3IA 3OSQA 5H8FA 2UVHA 2HFBA 2CZLA 1OQHA 1Z7ME 1A99A 1URSA 1LFIA 2UVGA 4EXKA 1OLCA 4XXUA 4HCYA 4U1OA 2F97A 4UA8A 4HCWA 3ECRA 2FA7A 2F35A 1BKAA 3UIFA 1TFDA 3G3HA 4ZECA 1XHYA 3TELA 5TP9A 3HPIA 4IY6A 1R9QA 1TXFA 5H8FB 2O1MA 4N07A 2XXPA 1LGBC 1ANFA 5M2VA 3O9PA 3IX1A 3IK6B 3FVGA 1FTLA 4DIGA 1FTKA 1H76A 2I3VA 4RJZA 2DWIA 4KYSA 4OMBA 1FCKA 3MAMA 1ZKBA 4FJPA 5I59B 4Z7EA 5TP9B 4GIZA 3W15C 3GBBA 3RY3A 1MXXA 5I84A 4H67A 4QFLA 3MVZA 1F9BA 2NVUB 4H8IA 1L5TA 3ZKKA 2H4IA 3RLFE 5FTHA 4THIA 3EHSA 3JZJA 3MZ9A 3MQ9A 4DXUA 1P1WA 5CMCA 4JSOA 1GTKA 3FJMA 3GLBA 3ZS6A 2XD2A 3S9EA 2I4BA 1LFHA 2H25A 1MY2A 3ODBA 2REJA 4KD5A 1UIUA 4PFYA 5TU0A 4F2OA 3MP8A 4C0RA 3BKIB 3H3GA 1QKAA 1MXVA 1N0TA 1O63A 3OD7A 2I6EA 3UGWA 3S9LC 1M5FA 3MVYA 1LBBA 4F3PA 1P1UA 5HPQA 2FNCA 1EH3A 4NF4A 3KN3A 2M8CA 4JSDA 5CMBA 4JWOA 4ZEBA 4DZ1A 3V89B 2YPNA 1MQGA 2UYEA 4QFOA 3H6VA 1PBPA 3I6VA 3IO4A 3RT6B 2HQ0A 1RYOA 3CFLA 4F2QA 3K00A 1MQJA 3OEMA 5CMMA 1SW1A 2AIXA 3MZ1A 4AB5A 1MQDA 3K6UA 4GVOA 2F6GA 1KWHA 3V83A 1B0HA 4NF4B 3KFMA 5AA3A 1P1NA 5F1QA 4R75A 1ZJLA 5KDTA 2ONSA 4RY1A 1B58A 3USDA 1PC3A 5DVJA 1A8FA 1NNFA 2RCBA 1NMUA 3R6UA 3C32A 2Q8JA 3N6TA 5EHSA 3VV5A 3CG3A 4LQ2A 1VFEA 3O6GA 1P1OA 1WODA 4G2ZA 3K6WA 4OEVA 1P1QA 4P11A 2ZYOA 3KN8A 3T93B 3GXAA 1TFAA 2V84A 1DMBA 3PMWA 5AA1A 2O7IA 5CMKA 5KDTB 1S7YA 1B7HA 1HSLA 3HN0A 1XOCA 1JEUA 2A5SA 3VVEA 3TQWA 1SI1A 2P0SA 5JTYB 4WKMA 4F3SA 2DWJA 3THIA 2DE4A 3WAEA 1OLAA 3HV1A 4EQ9A 1N7WA 4XKPA 4YKJA 3U94A 2I48A 4IGRA 1H45A 1LAHE 5IAIA 2Y7PA 4PFUA 1A8EA 4G4PA 4YU0A 2NWJA 2G93A 4H5FA 2QS3A 3CR9A 4R2FA 2RC7A 5H8NA 3KN7A 4G8MA 1ZMGA 1FW0A 4ZDMA 5ICTA 1MXYA 3TFLA 1ZLQA 2RC8A 4GL0A 1Y3PA 4M4GA 1VFDA 4O3CA 2NXOA 4BDNA 2Z8DA 1J1NA 1MXZA 4UACA 2QS4A 4TQUQ 1FQEA 4BDOA 1VE4A 1AOVA 5JEIA 3GZGA 3SKPA 3PPRA 3PD8A 3PGFA 2HXWA 3MWBA 1SW2A 3T9XB 5L8DA 2PT1A 5FHOA 3W9WA 3KEIA 2GHBA 5H8NB 1SD3A 3G3JA 3PMVA 3MVWA 5HBCA 1MY1A 4IO7A 5I57A 4R9FA 5DT6A 1GR2A 4X9TA 4MF3A 4U4XA 3Q28A 5KCJA 3IJXB 2HAVA 3ILUB 4P0IA 1XVXA 4ZEKA 4NTLA 1LAGE 1EU8A 2X7PA 2ZNTA 4OEUA 1M5DA 3SEVA 4JDFA 4E0WA 3BFTA 3EPEA 1LLSA 1B2HA 2UVJA 4TLMB 2UXAA 1LB8A 3PUWE 5I57B 4KYEA 4U23A 1O7TA 3BFUA 3S4UA 3JYRA 1UTBA 1SW5A 1ZIUA 3HO7A 3RUMA 4F19A 4BDLA 4WEDA 3PUVE 3PMXA 3O66A 2X7QA 2PT2A 2QRYA 2Z8EA 5F7VA 2DYXA 3PUXE 1OVBA 3FVNA 3KGCA 4QHQA 1YAEA 4KPTA 4U22A 2ZNSA 4QF9A 3FZVA 1B3EA 3T96B 4RYAA 1IITA 4LP2B 3QYTA 3VLWA 1DSNA 3H7MA 3H06B 3KZGA 1H44A 1UTBB 2B3BA 4ZS9A 1JW1A 3N94A 1Y3QA 2ONKE 4F18A 3TEPA 1B7UA 1B5IA 2F34A 4GOTA 3B7DA 1VSOA 3UORA 3MUQA 1QVSA 1SVXB 3M3KA 5DEXA 2DSFA 5DYHA 4KR5A 3MZBA 3CI8A 2PVUA 3HSTA 1Y4CA 2F7BA 3H4ZA 4MLQA 4GWOA 3CVGA 4Q0CA 1NFTA 2Q2CA 1FTMA 2I0BA 4DCYA 1VR5A 4ZZEA 3F11A 4PP0A 3FVKA 3S2VA 4X1BA 5DEXB 4NEDA 3UK4A 2OWSA 5ISUA 1S9TA 5I59A 3RTWB 4EXLA 1LBCA 1M5BA 4ELRA 5B70A 1BTJA 4KI0E 5ITOA 1BLFA 3VE1B 4G68C 1ZTYA 2Z22A 2REGA 3DM0A 2GH9A 2OJTA 4IO4A 1I69A 3VLUA 1PB9A 2XXHA 3T9HB 1SYIA 3C36A 5A5XA 1EZ9A 2IA4A 2HAUA 1MPBA 5AA4B 3TMGA 4ZZAA 3IORA 3MBPA 3U1OA 2F7AA 3CRBA 3RGYA 1MRPA 2ZXTA 4ECFA 3SDFA 2ZMBA 2VOZA 4HS7A 1B32A 1N76A 2OZZA 4OFJA 4ZEDA 1T0KA 3QAXA 4LZ8A 3D4GA 2DQVA 2O1LA 4XIGQ 4LZ5A 4YKIA 3K1NA 4R9GA 1N3XA 4KFQA 3MPKA 4BDMA 2GFEA 3VXCA 3TZAA 4WXJA 1DPPA 3DP4A 3B6TA 1H43A 4X48A 4LUBA 5A5XB 3I5OA 2V3UA 1MPCA 1NNPA 4PETA 1GVCA 4TLLB 4ZEIA 1IXCA 3OO8A 2PYYA 2Y7RA 1O64A 4RNSA 3IB1A 5IKBA 3A3UA 1QULA 4DXBA 1LCFA 4EDPA 2R71A 2DE3A 3DELB 3E9XA 4IO5A 5BWJA 3SETA 3A3CA 4IB2A 1A40A 4H1XA 1IIWA 4GXAA 4BDQA 4XKRA 3OO7A 4DXCA 3TCGA 3E13X 4OHNA 1Q1KA 2DOJA 4PE5B 2I3WA 5H8HA 2H99A 1YPNA 3HHFA 5FHNA 3DP6A 2XX9A 4OETA 2DVCA 3FVOA 3Q29A 1JETA 2X26A 5TPAA 4F1YA 5AA2B 2QS1A 2XD3A 1JVYA 3R7XA 2R9JA 3FV2A 4GLIA 3KOSA 4GF8A 3KJTA 5H8HB 1FQAA 2VD2A 3LSWA 4EF2A 1EZOA 3VDFA 4YMAA 3T66A 3S9NC 4MH5A 5JK4A 4OENA 3SEYA 4N6PA 2P1SA 3FD3A 5TPAB 3DLNA 5L9MA 1DOTA 3RN8A 4YB7A 2ZYMA 2H9BA 1FQDA 5CBRA 5JTYA 3PPNA 4LATA 1TWYA 1IXGA 1MG1A 4DCXA 1FQCA 2XXUA 4ZE8A 1JW5A 2O6AA 3OENA 3IB0A 1B46A 3VVFA 3O2AA 3O6HA 2BJJX 1OQGA 5K2YA 3LSXA 3W9VA 1N84A 1QUJA 3TTMA 3HHGA 1GV8A 1B4ZA 4FEDA 2DE2A 1P99A 4O3BA 4F3BA 1HSEA 3H03A 3PPPA 2DVZA 2D21A 1MM6A 1IXHA 1B3GA 3LSLA 3KSJA 3M8UA 4YB5A 3IAZA 3ONMA 2D5WA 1AH5A 2UYFA 3RQTA 1DTZA 2YLNA 3RNNA 1SW4A 2Y7KA 4GFRA 2ONRA 4U4SA 1JW4A 4IY5A 2NUVA 4WEPA 1AL3A 1AMFA 4GL8A 5HM4B 3MW0A 5I56A 3FJGA 2V93A 3K02A 3U93A 1SI0A 1PB8A 4IO2A 3H6TA 4YICA 1OVTA 3TYHA 3IB2A 2ALUA 5BUUA 4F29A 2Q9TA 4Q8RA 3LR1A 2F7CA 2XHDA 3PUYE 5CBSA 1MH4A 2H5YA 3QXMA 3TKDA 4DDDA 4RXLA 4PFWA 4O3AA 2QS2A 4ELOA 1Y20A 2Y7WA 5EYFA 3KOTA 3FUZA 2XXQA 4RA1A 1DTGA 1H3DA 1JQFA 1Y3NA 3TTRA 3K6XA 3VVDA 5I56B 2F8DA 4U1ZA 3N5LA 5ICQA 4POXA 3E3KA 3HCQA 3Q25A 2O68A 5I58A 3ZKLA 4NF5A 3RPWA 3MP1A 4YMBA 1R9LA 4R6HA 4EF1A 2DWAA 4R2BA 3FIRA 4ISUA 2XXWA 1SYHA 1ELJA 3ZSFA 2XXIA 1UQWA 4ESXA 1MXWA
chains in the Genus database with same CATH superfamily
1JP4A 4R74A 1NKXA 2VD3A 3ROJA 4MJOA 4O94A 4F1UA 4HTGA 4R73A 3FV1A 1B40A 1A7LA 1LAXA 5I58B 4XKNA 1QJMA 4OFOA 4QFKA 4H65A 3B6WA 2DWHA 4NF5B 1RYXA 1B1XA 1G0IA 3IR1A 2VGQA 3K4UA 4R72A 4Q5TA 4QBAA 2V25A 1XT8A 3LBSA 1YYZA 2NOOA 4FORA 2RKMA 3CSGA 2H98A 1US5A 1IEJA 4QSEA 4H46A 4MNPA 3MPLA 2O51A 2QMXA 2OLBA 3SZPA 4NF8B 4G8HA 4Z0IA 5H8QA 1UIVA 1NV4A 1NV6A 4IO6A 2O84X 3UA8A 4O7MA 3A29A 3TDJA 4LQ5A 2XWOA 4YKKA 1Q9DA 4OQOA 2KLFA 1LAFE 3BIGA 1FBCA 4FEBA 3S9MC 2WBDA 1PB7A 4XTCQ 3FATA 3E4RA 3H6WA 4XEQA 4GX3A 4OFLA 3IO6A 2XX7A 4GWSA 1FQBA 1KZ8A 2RINA 1A55A 5IZ1A 4QRZA 4H6DA 3Q26A 4OZ9A 2Q89A 5CC2A 3QSLA 5KZTA 4NMYA 4MNCA 5H8QB 4DE8A 1US4A 4N6DA 1BP5A 2DXYA 4KHZE 1B3HA 5J1DA 3ILTB 1ZBMA 4OTEA 4RK9A 1IZ1A 1OMPA 4G8NA 3OMBA 2W7YA 1IMBA 2ZNUA 2O7UA 4R6KA 1WDNA 1R6ZA 1BK4A 3EN3A 2CMOA 1N3WA 1IMCA 4LA9A 4JVDA 1B7ZA 1OIBA 1NUYA 2YJPA 5I5PA 3PPOA 1BIYA 3KG2A 3EHUA 4FATA 1IUDA 3LC8A 3N26A 2Y84A 4OVQA 4PQJA 3CSBA 5AA4A 3G3KA 1EYIA 4MBPA 3LSFB 4BLAA 4G68B 3TTNA 1JVXA 4MLVA 4KXPA 2HPGA 1NUWA 1FTOA 4P47A 2WBBA 1B9JA 4ELQA 1B5JA 4HE2A 3B8BA 3M3FA 1FPLA 2B3FA 4OYVA 1XVYA 3FXBA 1IXIA 4KYDA 4C1TA 4LVQA 1NH8A 1LB9A 3C33A 1D9VA 3CG1A 2F5XA 4K3FA 4GWWA 3C9HA 1HSJA 3T0JA 5IM2A 3SEXA 1FTJA 5L9OA 4PFTA 5I2NA 1QKBA 4JBZA 4OVTA 3G3FA 4ONYA 3K1MA 2XXYA 3FXUA 4ELPA 4MMPA 1I6BA 4PAFA 2I49A 3O97A 3V8XB 2QL3A 1NV1A 2B65A 1CB6A 4YAHX 4I1DA 2V3QA 5I2KA 2I58A 3L6GA 1LBVA 1MDP1 3IOUA 3PD9A 3BBRA 1FQFA 3RT8A 2P3NA 4OESA 4M1VA 3IOVA 2QVUA 4MEVA 1S50A 5I2NB 3O28A 2AL5A 1MQIA 2QJEA 1B51A 4GWYA 4GD5A 1EZPA 2Y5KA 3OO6A 3K01A 4E0XA 1MS7A 3E79A 4JWXA 4JXIA 2PMSA 3G3GA 2IEEA 2XXRA 5AA2A 2F3BA 2DXRA 4RPNA 4NWCA 4PC9A 1R1NA 1II5A 1Y1MA 3K2DA 1Q35A 1RDXA 4KCDA 5I2KB 1D9YA 1USYH 3RPLA 1QUIA 4JB7A 1DCUA 1FPIA 1USYE 4LZ7A 3U72A 3TUSA 3PUZE 4QSDA 5DVFA 3EQ1A 4U2RA 2G29A 1N7XA 4HXVA 2HXRA 1YTVA 2GHAA 2I4CA 2GRVA 2Z8FA 4F1VA 4P0GA 3DP8A 4GQOA 3QIMA 3KBRA 1GGGA 3VLVA 2OCUA 3PTYA 3RPLB 4ZEFA 4POWA 1NH7A 1FTAA 3HFUA 4G77A 3UP9A 4H5GA 1RKMA 2QVVA 2WYPA 1NNTA 3FASA 4EQBA 1UTHA 1FPGA 2Y7IA 1MH3A 1FJ9A 1JEVA 1M5CA 2R6GE 1URGA 3EHTA 3AXFA 5H8SA 4L17A 2RCAA 3TQLA 1EYJA 1IMAA 1ATGA 3D4CA 2FHYA 3EF7A 1LBZA 2E1SA 1LCTA 1XC1A 1B05A 1B6HA 1MY4A 2OWTA 1SBPA 3OELA 1B3FA 5EHMA 2XXVA 1JNFA 3OEKA 2OBGA 3OXNA 4F3GA 3FXQA 1QUKA 3PV0E 3SEUA 4OVSA 1IQ7A 2F6PA 4I62A 3K0VA 1UTHB 1CNQA 4ZE9A 1D9QA 5ITPA 3L6HA 2XWVA 2HZKA 5AE4A 3GBAA 5CRYA 4ND9A 5B7DA 3M3LA 1VDWA 4NWDA 3PPQA 1DPEA 1YCJA 4NF6A 3CHGA 4H8JA 3I3VA 4KCCA 2ABHA 5A5LA 3T9VA 4HW8A 5DVIA 4RK2A 3CFXA 1POTA 4N17A 4DI4B 2QMWA 2FYIA 1LSTA 1URDA 2AYSA 3D1RA 2PX1A 4G61A 1PBQA 3IOWA 1TT1A 4OWDA 4OVJA 2XXTA 2E0SA 4EQ7A 2CEXA 3TTKA 1MY0A 2I0CA 3Q27A 3TODA 1B52A 3QK6A 1A54A 4JWYA 1B5HA 4R6YA 4PGPA 4I40A 1D3KA 1WVJA 1FPEA 4NF6B 1QW0A 2Z23A 2Q8MA 2LAOA 3G7WA 5CM6A 3OSRA 4FIMA 4MFIA 1INPA 1MXUA 2HZLA 2O69A 3C34A 2ZYKA 2XXXA 1MPDA 3IOTA 4AS5A 1XS5A 4P3LA 1B4HA 4GWUA 4PAKA 3U92A 2B4MA 2ZZWA 4IO3A 1MQHA 2UVIA 3V5AA 3VXBA 3VFJA 3KSXA 2D3IA 4GWZA 4LONB 2DS9A 4I8CA 2RC9A 5F24A 2WKYA 1B3LA 4F31B 3T22A 2XX8A 3MYUA 4AB6A 4FE8A 2B4LA 4QFNA 5EQ8A 4MX6A 3JV9A 3MP6A 4YKPA 3K6VA 4GBWA 3IL1B 4RPOA 1LFGA 1D4NA 1Y9UA 2HEUA 1FBDA 2DDKA 1FBEA 4ESWA 3TCHA 3R26A 4H0WA 1Y1ZA 2Q2AA 4JVCA 2A5TA 3LUYA 1CE2A 4KQPA 3IFAA 3UN6A 3TPAA 4FECA 3O6IA 3SESA 3IJOB 3H6UA 2VHAA 1MY3A 4NF8A 3MJNA 1K9ZA 3MVXA 3TTLA 4F22A 1B0LA 2Q88A 1B1HA 4I9DA 1MM7A 3QUJA 1PDAA 4XKQA 3FJ7A 4N81A 1NV5A 1AIVA 2ZYNA 3TAJA 3RTFB 3SEWA 1NNKA 3FXRA 5L9SA 1FJ6A 2F36A 2OK2A 2ANJA 3WAFA 3PU5A 4X8RA 4GRKA 3OOAA 2A5TB 2OWZA 1M5EA 5ET8A 1SQYA 4BDRA 2P2AA 3A09A 1Z7NE 4X1DA 4OXVA 3OO9A 4IGTA 1NL5A 5DW8A 1PEBA 4PTKA 5KCJB 4PE3A 3SERA 1N04A 4F39A 4AQ4A 4N8GA 1Y4TA 4NE4A 2ESNA 5LOMA 4GXSB 2RF1A 4FAJA 4U21A 3B6QA 3C35A 4I3EA 4OVPA 4P8BA 4QSCA 3CFZA 1FRPA 2F78A 4H45A 2PBWA 2VPNA 3P7IA 2THIA 4DLDA 5EYGA 2HHMA 3T9UA 2QPQA 5FTIA 1ZU0A 3N6UA 4YB6A 4Q30B 3C31A 4UABA 3K1PA 1SDXA 5DTBA 1LBXA 4P56A 3FGSA 4G68A 2DP8A 1I6AA 4PBHA 3CIJA 1SPIA 4MHFA 5K2XA 3TCFA 2KR0A 3BIHA 2P3VA 3O29A 2VP1A 5CI5A 5AA2D 4OERA 2HCAA 2V3TA 5ELVA 2QSXA 3KJ7A 3MC2A 4EUOA 3C4MA 4QFPA 4C1UA 4PCDA 5FHMA 3U8QA 1POY1 2AL4A 4YZZA 4N13A 1I6QA 1MDQA 4TOZA 1RDYA 3QUFA 3G3IA 3OSQA 4GX6A 5H8FA 2UVHA 5LDZA 2HFBA 2CZLA 1OQHA 1Z7ME 1A99A 1URSA 1LFIA 2UVGA 4EXKA 4PFBA 1OLCA 4XXUA 4HCYA 4U1OA 2F97A 4UA8A 4HCWA 3ECRA 4N4UA 2FA7A 2F35A 1BKAA 3UIFA 1TFDA 3G3HA 4ZECA 1XHYA 3TELA 5TP9A 3HPIA 4IY6A 1FBGA 4O8MA 1R9QA 1TXFA 5H8FB 2O1MA 4N07A 2XXPA 4IR8A 1LGBC 2R8TA 1ANFA 1NV3A 5M2VA 1FPDA 3O9PA 3IX1A 3IK6B 3FVGA 1FTLA 4DIGA 1FTKA 1H76A 2I3VA 4RJZA 1IMDA 2DWIA 2JJKA 5ET5A 4KYSA 4PAIA 2QFLA 4OMBA 2XXKA 1FPBA 1FCKA 3FBPA 3MAMA 4FJPA 1ZKBA 5I59B 3RYDA 4Z7EA 5TP9B 4GIZA 1EYKA 3W15C 3GBBA 3RY3A 1MXXA 5I84A 4H67A 4QFLA 3MVZA 1F9BA 2NVUB 4H8IA 1L5TA 3ZKKA 2H4IA 3RLFE 5FTHA 4THIA 1FBPA 3EHSA 3JZJA 3MZ9A 3MQ9A 4DXUA 1P1WA 5CMCA 4JSOA 4AS4A 1FBFA 1GTKA 3FJMA 3GLBA 3ZS6A 2L5VA 2XD2A 3S9EA 2I4BA 1LFHA 2H25A 1MY2A 3ODBA 2REJA 4KD5A 1UIUA 4PFYA 5TU0A 4F2OA 3MP8A 4C0RA 3BKIB 3H3GA 4PFIA 5IZ3B 1QKAA 1MXVA 1N0TA 1O63A 3OD7A 2I6EA 3UGWA 3S9LC 1M5FA 3MVYA 5EQ9A 1LBBA 4F3PA 1P1UA 5HPQA 2FNCA 1EH3A 4NF4A 3KN3A 2VT5A 2M8CA 4JSDA 5CMBA 4JWOA 4ZEBA 4DZ1A 3MSTA 3V89B 2YPNA 1MQGA 2UYEA 4QFOA 3H6VA 1PBPA 4P1LA 3I6VA 3IO4A 3RT6B 2HQ0A 1RYOA 3LV0A 3CFLA 4F2QA 2KQZA 3K00A 1MQJA 3OEMA 5CMMA 5FBPA 1SW1A 1NV2A 2QVRA 2AIXA 3MZ1A 4AB5A 1MQDA 3K6UA 4GVOA 2F6GA 3T1BA 5EQ7A 1KWHA 3V83A 1B0HA 4NF4B 3KFMA 5AA3A 5IGAA 1P1NA 5F1QA 4R75A 1ZJLA 3KBZA 5KDTA 2ONSA 4XFEA 4RY1A 1B58A 3USDA 1PC3A 5DVJA 1A8FA 1NNFA 2ZZXA 2RCBA 1NUZA 1NMUA 3LUZA 3C32A 3R6UA 2Q8JA 3N6TA 4P1EA 5EHSA 3VV5A 3CG3A 4LQ2A 2FBPA 1VFEA 3O6GA 3KC0A 1P1OA 1WODA 4G2ZA 3K6WA 4OEVA 1XI6A 1P1QA 4P11A 2ZYOA 3KN8A 3T93B 1AWBA 4N91A 3GXAA 1TFAA 2V84A 1DMBA 4DI3D 3PMWA 1KA0A 5AA1A 2O7IA 5CMKA 5KDTB 1S7YA 1B7HA 1HSLA 3HN0A 1XOCA 1JEUA 1IMFA 2A5SA 3VVEA 2PFZA 3TQWA 1SI1A 2P0SA 5JTYB 4WKMA 4F3SA 2CZKA 1LEVA 2DWJA 3THIA 2DE4A 3WAEA 1OLAA 3HV1A 4EQ9A 1N7WA 4XKPA 4YKJA 3U94A 1G0HA 1NV7A 2CZIA 2I48A 4IGRA 1H45A 1LAHE 5IAIA 2Y7PA 4PDDA 4PFUA 1A8EA 4G4PA 4YU0A 2NWJA 2G93A 4H5FA 2QS3A 3CR9A 4R2FA 2RC7A 5H8NA 3KN7A 4G8MA 1ZMGA 1FW0A 4ZDMA 5ICTA 1MXYA 1ZLQA 3TFLA 2RC8A 4GL0A 1Y3PA 4M4GA 1VFDA 4O3CA 2NXOA 4BDNA 2Z8DA 1J1NA 1MXZA 4GWXA 4UACA 2QS4A 4TQUQ 2GQ1A 1FQEA 4BDOA 1VE4A 1AOVA 4NN3A 5JEIA 3GZGA 3SKPA 1FPFA 3PPRA 3PD8A 3PGFA 5J16A 2FIXA 4PDHA 2HXWA 5I7IA 3MWBA 1SW2A 3T9XB 5L8DA 2PT1A 5FHOA 1NV0A 3KEIA 3W9WA 2GHBA 5H8NB 1SD3A 2WX9A 3KC1A 3G3JA 3PMVA 3MVWA 5HBCA 1MY1A 4IO7A 5I57A 4R9FA 1YXIA 1FSAA 5DT6A 1GR2A 2XWKA 4X9TA 4MF3A 4U4XA 1NUXA 2PFYA 3Q28A 5KCJA 3IJXB 2HAVA 3ILUB 4P0IA 1XVXA 4ZEKA 4NTLA 1LAGE 4PF8A 2VPOA 1EU8A 2X7PA 2ZNTA 4OEUA 1M5DA 3SEVA 4JDFA 4E0WA 1IMEA 3BFTA 3EPEA 1LLSA 1B2HA 2UVJA 4TLMB 2UXAA 1LB8A 3PUWE 5I57B 4KYEA 4U23A 1O7TA 3BFUA 3S4UA 3JYRA 1UTBA 1SW5A 1ZIUA 3HO7A 3RUMA 4F19A 4BDLA 4WEDA 3PUVE 3PMXA 3O66A 2X7QA 2PT2A 2QRYA 2Z8EA 1FPKA 5F7VA 2DYXA 3PUXE 1OVBA 4NX1A 3FVNA 3KGCA 4QHQA 1YAEA 4KPTA 4U22A 2ZNSA 2MKZA 4QF9A 3FZVA 1B3EA 4MCOA 3T96B 4RYAA 1IITA 4LP2B 3QYTA 3VLWA 2Q74A 1DSNA 5T3JA 3H7MA 3H06B 4LN5A 5EQAA 3KZGA 1H44A 1UTBB 2B3BA 4ZS9A 1JW1A 3N94A 1Y3QA 2ONKE 2ZZVA 4F18A 3TEPA 1B7UA 5ET6A 1B5IA 2F34A 4GOTA 3B7DA 1VSOA 5EYHA 3UORA 3MUQA 4I3YA 5IZZA 1QVSA 1SVXB 3M3KA 3E78A 4XF5A 5DEXA 2DSFA 5DYHA 4HE1A 3U65A 4KR5A 3MZBA 3CI8A 2PVUA 3HSTA 2WYKA 3EKIA 4PFRA 1Y4CA 1QGXA 2F7BA 3H4ZA 4MLQA 1DK4A 2CEYA 4GWOA 3CVGA 4Q0CA 1NFTA 1RDZA 2Q2CA 1FTMA 2I0BA 1FPJA 4DCYA 1VR5A 4FBPA 4ZZEA 3F11A 4PP0A 3FVKA 3S2VA 4X1BA 5DEXB 5I3SA 4NEDA 3UK4A 4NQ8A 2OWSA 5ISUA 1S9TA 5I59A 3RTWB 4EXLA 1LBCA 1M5BA 4ELRA 5B70A 1BTJA 4KI0E 5ITOA 1BLFA 4PF6A 3VE1B 4G68C 1ZTYA 2Z22A 2REGA 3DM0A 2GH9A 2OJTA 4IO4A 1I69A 3VLUA 2V4CA 1PB9A 2CZHA 2XXHA 3T9HB 1SYIA 3C36A 5A5XA 1EZ9A 1NI9A 2IA4A 4NF0A 3QMFA 3NOHA 2HAUA 1MPBA 4N8YA 5AA4B 3TMGA 4ZZAA 4PBQA 3IORA 3MBPA 3U1OA 2F7AA 3CRBA 4OVRA 3RGYA 1MRPA 2ZXTA 4ECFA 3SDFA 2ZMBA 2VOZA 4HS7A 4OA4A 1B32A 1N76A 1FBHA 3IFCA 2OZZA 4OFJA 4ZEDA 1T0KA 3QAXA 4HE0A 4LZ8A 3D4GA 2DQVA 2O1LA 4XIGQ 4LZ5A 4YKIA 1DBZA 3K1NA 4R9GA 1N3XA 4KFQA 3MPKA 5IZ3A 4BDMA 2GFEA 3VXCA 3TZAA 4NGUA 4WXJA 2BJIA 1DPPA 3DP4A 3B6TA 1H43A 4MNIA 4X48A 4LUBA 5A5XB 3I5OA 2V3UA 1MPCA 1NNPA 4PETA 1GVCA 4TLLB 4ZEIA 1IXCA 3OO8A 2PYYA 2Y7RA 1O64A 4RNSA 3IB1A 5IKBA 3A3UA 1QULA 4DXBA 1LCFA 4EDPA 2R71A 2DE3A 3DELB 3E9XA 2F3DA 4IO5A 5BWJA 3SETA 3A3CA 4IB2A 1A40A 4H1XA 1IIWA 4GXAA 4BDQA 4XKRA 3OO7A 4OANA 4DXCA 3TCGA 3E13X 4OHNA 1Q1KA 2DOJA 4PE5B 2I3WA 2FIEA 4GX4A 5H8HA 2H99A 1YPNA 3HHFA 5FHNA 3DP6A 4P9KA 2XX9A 4OETA 2DVCA 3FVOA 3Q29A 1JETA 1LBYA 2X26A 5TPAA 4JVIA 4N15A 4F1YA 5AA2B 2PCRA 2QS1A 4NAPA 2XD3A 1JVYA 3R7XA 4GBVA 2R9JA 3FV2A 4X04A 4GLIA 3KOSA 4GF8A 3KJTA 2WEFA 3GYYA 5H8HB 1FQAA 2VD2A 3LSWA 4EF2A 1EZOA 3VDFA 4YMAA 3T66A 3S9NC 4MH5A 5JK4A 4OENA 3SEYA 4N6PA 2P1SA 3FD3A 5TPAB 3DLNA 5L9MA 1DOTA 3RN8A 4YB7A 4PGNA 2ZYMA 2H9BA 2FVZA 1FQDA 5CBRA 5JTYA 5ET7A 3PPNA 4LATA 1TWYA 1IXGA 1MG1A 4DCXA 1FQCA 2XXUA 4ZE8A 1JW5A 2O6AA 3OENA 3IB0A 1B46A 3VVFA 3O2AA 3O6HA 2BJJX 1OQGA 5K2YA 3LSXA 5ESYA 3W9VA 1N84A 1QUJA 3TTMA 3HHGA 1GV8A 1B4ZA 4FEDA 2DE2A 1P99A 4O7IA 4O3BA 4F3BA 1HSEA 2OX3A 3H03A 3PPPA 2DVZA 2D21A 1MM6A 2Y5LA 1IXHA 4MAGA 1KA1A 1B3GA 3LSLA 3KSJA 3M8UA 4YB5A 3IAZA 3ONMA 2D5WA 1AH5A 2UYFA 3RQTA 1DTZA 1LBWA 2YLNA 3RNNA 1SW4A 3ISPA 2Y7KA 4GFRA 2ONRA 4U4SA 4IY5A 1JW4A 2NUVA 4WEPA 1AL3A 1AMFA 4GL8A 5HM4B 3MW0A 4NG7A 4N6KA 5I56A 3FJGA 2V93A 3K02A 3U93A 1SI0A 1PB8A 4IO2A 3H6TA 4YICA 1OVTA 3TYHA 3IB2A 2ALUA 5BUUA 4F29A 2Q9TA 4Q8RA 3LR1A 2F7CA 2XHDA 3PUYE 5CBSA 1MH4A 2H5YA 4MIJA 3QXMA 3TKDA 4DDDA 4RXLA 4PFWA 4O3AA 2QS2A 3KOTA 1Y20A 2Y7WA 5EYFA 4ELOA 3B50A 3FUZA 2XXQA 4RA1A 1DTGA 1K9YA 1H3DA 1JQFA 1Y3NA 3TTRA 3K6XA 3VVDA 5I56B 2XA5A 2F8DA 4U1ZA 3N5LA 5ICQA 4POXA 3E3KA 3HCQA 3Q25A 2O68A 5I58A 3ZKLA 5LTCA 1YZ0A 4NF5A 3RPWA 3MP1A 4YMBA 1R9LA 4R6HA 4QXDA 2DWAA 4R2BA 4EF1A 2XWIA 3FIRA 4ISUA 2XXWA 1SYHA 1ELJA 3ZSFA 2XXIA 1UQWA 4ESXA 1MXWA 4NHBA
chains in the Genus database with same CATH topology
4R74A 1NKXA 2VD3A 4F1UA 4HTGA 4R73A 3FV1A 1B40A 1A7LA 1LAXA 5I58B 4XKNA 1QJMA 4OFOA 4QFKA 4H65A 3B6WA 2DWHA 4NF5B 1RYXA 1B1XA 3IR1A 2VGQA 3K4UA 4R72A 4Q5TA 2V25A 1XT8A 3LBSA 2NOOA 4FORA 2RKMA 3CSGA 2H98A 1US5A 1IEJA 4QSEA 3MPLA 2O51A 2QMXA 2OLBA 4NF8B 4G8HA 4Z0IA 5H8QA 1UIVA 4IO6A 2O84X 3UA8A 3TDJA 4LQ5A 4YKKA 4OQOA 2KLFA 1LAFE 4FEBA 3S9MC 1PB7A 4XTCQ 3FATA 3E4RA 3H6WA 4OFLA 3IO6A 2XX7A 1FQBA 2RINA 1A55A 4QRZA 4H6DA 3Q26A 4OZ9A 2Q89A 5CC2A 3QSLA 5KZTA 4NMYA 5H8QB 4DE8A 1US4A 1BP5A 2DXYA 4KHZE 1B3HA 5J1DA 3ILTB 1ZBMA 4OTEA 4RK9A 1IZ1A 1OMPA 4G8NA 3OMBA 2W7YA 2ZNUA 2O7UA 4R6KA 1WDNA 1R6ZA 3EN3A 2CMOA 1N3WA 4LA9A 1B7ZA 1OIBA 2YJPA 3PPOA 1BIYA 3KG2A 3EHUA 4FATA 1IUDA 3LC8A 3N26A 2Y84A 4PQJA 3CSBA 5AA4A 3G3KA 4MBPA 3LSFB 4BLAA 4G68B 3TTNA 1JVXA 4MLVA 1FTOA 1B9JA 4ELQA 1B5JA 3M3FA 2B3FA 4OYVA 1XVYA 1IXIA 4KYDA 4C1TA 4LVQA 1NH8A 1LB9A 3C33A 1D9VA 3CG1A 2F5XA 4K3FA 3C9HA 1HSJA 3SEXA 1FTJA 5L9OA 4PFTA 5I2NA 1QKBA 4JBZA 3G3FA 4ONYA 3K1MA 2XXYA 3FXUA 4ELPA 1I6BA 2I49A 3O97A 3V8XB 2QL3A 2B65A 1CB6A 4YAHX 4I1DA 2V3QA 5I2KA 2I58A 3L6GA 1MDP1 3IOUA 3PD9A 3BBRA 1FQFA 3RT8A 4OESA 4M1VA 3IOVA 1S50A 5I2NB 3O28A 2AL5A 1MQIA 2QJEA 1B51A 4GD5A 1EZPA 3OO6A 3K01A 4E0XA 1MS7A 4JWXA 4JXIA 2PMSA 3G3GA 2IEEA 2XXRA 5AA2A 2DXRA 4RPNA 4NWCA 1R1NA 1II5A 1Y1MA 3K2DA 1Q35A 4KCDA 5I2KB 1D9YA 1USYH 1QUIA 4JB7A 1USYE 4LZ7A 3U72A 3TUSA 3PUZE 4QSDA 5DVFA 3EQ1A 4U2RA 2G29A 1N7XA 1YTVA 2GHAA 2I4CA 2GRVA 2Z8FA 4F1VA 4P0GA 3DP8A 4GQOA 3QIMA 3KBRA 1GGGA 3VLVA 2OCUA 4ZEFA 4POWA 1NH7A 4G77A 3UP9A 4H5GA 1RKMA 1NNTA 3FASA 4EQBA 1UTHA 2Y7IA 1MH3A 1JEVA 1M5CA 2R6GE 1URGA 3EHTA 3AXFA 5H8SA 4L17A 2RCAA 3TQLA 1ATGA 3D4CA 3EF7A 2E1SA 1LCTA 1XC1A 1B05A 1B6HA 1MY4A 2OWTA 1SBPA 3OELA 1B3FA 5EHMA 2XXVA 1JNFA 3OEKA 2OBGA 3OXNA 4F3GA 3FXQA 1QUKA 3PV0E 3SEUA 1IQ7A 2F6PA 4I62A 3K0VA 1UTHB 4ZE9A 5ITPA 3L6HA 2HZKA 5AE4A 3GBAA 5CRYA 4ND9A 5B7DA 3M3LA 4NWDA 3PPQA 1DPEA 1YCJA 4NF6A 4H8JA 3I3VA 4KCCA 2ABHA 3T9VA 4HW8A 5DVIA 4RK2A 3CFXA 1POTA 2QMWA 2FYIA 1LSTA 1URDA 2AYSA 2PX1A 1PBQA 3IOWA 1TT1A 4OWDA 4OVJA 2XXTA 2E0SA 4EQ7A 3TTKA 1MY0A 2I0CA 3Q27A 3TODA 1B52A 3QK6A 1A54A 4JWYA 1B5HA 4R6YA 1D3KA 1WVJA 4NF6B 1QW0A 2Z23A 2LAOA 3G7WA 5CM6A 3OSRA 4FIMA 4MFIA 1MXUA 2HZLA 2O69A 3C34A 2ZYKA 2XXXA 1MPDA 3IOTA 1XS5A 1B4HA 3U92A 4IO3A 1MQHA 2UVIA 3V5AA 3VXBA 3VFJA 3KSXA 2D3IA 4LONB 2DS9A 4I8CA 2RC9A 2WKYA 1B3LA 4F31B 3T22A 2XX8A 4AB6A 4FE8A 4QFNA 3JV9A 3MP6A 4YKPA 3K6VA 3IL1B 4RPOA 1LFGA 1D4NA 1Y9UA 2HEUA 4ESWA 3TCHA 3R26A 4H0WA 1Y1ZA 2Q2AA 2A5TA 3LUYA 1CE2A 4KQPA 3UN6A 3TPAA 4FECA 3O6IA 3SESA 3IJOB 3H6UA 2VHAA 1MY3A 4NF8A 3MJNA 3MVXA 3TTLA 4F22A 1B0LA 2Q88A 1B1HA 4I9DA 1MM7A 1PDAA 3QUJA 4XKQA 3FJ7A 1AIVA 2ZYNA 3TAJA 3RTFB 3SEWA 1NNKA 3FXRA 5L9SA 2F36A 2OK2A 2ANJA 3WAFA 3PU5A 4GRKA 3OOAA 2A5TB 1M5EA 1SQYA 4BDRA 2P2AA 3A09A 1Z7NE 4X1DA 4OXVA 3OO9A 4IGTA 1NL5A 1PEBA 5KCJB 3SERA 1N04A 4F39A 4AQ4A 1Y4TA 4NE4A 2ESNA 5LOMA 4GXSB 2RF1A 4FAJA 4U21A 3B6QA 3C35A 4QSCA 3CFZA 2F78A 2PBWA 3P7IA 2THIA 4DLDA 3T9UA 2QPQA 5FTIA 1ZU0A 3N6UA 4YB6A 4Q30B 3C31A 3K1PA 1SDXA 5DTBA 3FGSA 4G68A 2DP8A 1I6AA 3CIJA 5K2XA 3TCFA 3O29A 2VP1A 5CI5A 5AA2D 4OERA 2HCAA 2V3TA 5ELVA 2QSXA 3KJ7A 3MC2A 4EUOA 3C4MA 4QFPA 4C1UA 5FHMA 3U8QA 1POY1 2AL4A 4YZZA 4N13A 1I6QA 1MDQA 4TOZA 3QUFA 3G3IA 3OSQA 5H8FA 2UVHA 2HFBA 2CZLA 1OQHA 1Z7ME 1A99A 1URSA 1LFIA 2UVGA 4EXKA 1OLCA 4XXUA 4HCYA 4U1OA 2F97A 4UA8A 4HCWA 3ECRA 2FA7A 2F35A 1BKAA 3UIFA 1TFDA 3G3HA 4ZECA 1XHYA 3TELA 5TP9A 3HPIA 4IY6A 1R9QA 1TXFA 5H8FB 2O1MA 4N07A 2XXPA 1LGBC 1ANFA 5M2VA 3O9PA 3IX1A 3IK6B 3FVGA 1FTLA 4DIGA 1FTKA 1H76A 2I3VA 4RJZA 2DWIA 4KYSA 4OMBA 1FCKA 3MAMA 1ZKBA 4FJPA 5I59B 4Z7EA 5TP9B 4GIZA 3W15C 3GBBA 3RY3A 1MXXA 5I84A 4H67A 4QFLA 3MVZA 1F9BA 2NVUB 4H8IA 1L5TA 3ZKKA 2H4IA 3RLFE 5FTHA 4THIA 3EHSA 3JZJA 3MZ9A 3MQ9A 4DXUA 1P1WA 5CMCA 4JSOA 1GTKA 3FJMA 3GLBA 3ZS6A 2XD2A 3S9EA 2I4BA 1LFHA 2H25A 1MY2A 3ODBA 2REJA 4KD5A 1UIUA 4PFYA 5TU0A 4F2OA 3MP8A 4C0RA 3BKIB 3H3GA 1QKAA 1MXVA 1N0TA 1O63A 3OD7A 2I6EA 3UGWA 3S9LC 1M5FA 3MVYA 1LBBA 4F3PA 1P1UA 5HPQA 2FNCA 1EH3A 4NF4A 3KN3A 2M8CA 4JSDA 5CMBA 4JWOA 4ZEBA 4DZ1A 3V89B 2YPNA 1MQGA 2UYEA 4QFOA 3H6VA 1PBPA 3I6VA 3IO4A 3RT6B 2HQ0A 1RYOA 3CFLA 4F2QA 3K00A 1MQJA 3OEMA 5CMMA 1SW1A 2AIXA 3MZ1A 4AB5A 1MQDA 3K6UA 4GVOA 2F6GA 1KWHA 3V83A 1B0HA 4NF4B 3KFMA 5AA3A 1P1NA 5F1QA 4R75A 1ZJLA 5KDTA 2ONSA 4RY1A 1B58A 3USDA 1PC3A 5DVJA 1A8FA 1NNFA 2RCBA 1NMUA 3R6UA 3C32A 2Q8JA 3N6TA 5EHSA 3VV5A 3CG3A 4LQ2A 1VFEA 3O6GA 1P1OA 1WODA 4G2ZA 3K6WA 4OEVA 1P1QA 4P11A 2ZYOA 3KN8A 3T93B 3GXAA 1TFAA 2V84A 1DMBA 3PMWA 5AA1A 2O7IA 5CMKA 5KDTB 1S7YA 1B7HA 1HSLA 3HN0A 1XOCA 1JEUA 2A5SA 3VVEA 3TQWA 1SI1A 2P0SA 5JTYB 4WKMA 4F3SA 2DWJA 3THIA 2DE4A 3WAEA 1OLAA 3HV1A 4EQ9A 1N7WA 4XKPA 4YKJA 3U94A 2I48A 4IGRA 1H45A 1LAHE 5IAIA 2Y7PA 4PFUA 1A8EA 4G4PA 4YU0A 2NWJA 2G93A 4H5FA 2QS3A 3CR9A 4R2FA 2RC7A 5H8NA 3KN7A 4G8MA 1ZMGA 1FW0A 4ZDMA 5ICTA 1MXYA 3TFLA 1ZLQA 2RC8A 4GL0A 1Y3PA 4M4GA 1VFDA 4O3CA 2NXOA 4BDNA 2Z8DA 1J1NA 1MXZA 4UACA 2QS4A 4TQUQ 1FQEA 4BDOA 1VE4A 1AOVA 5JEIA 3GZGA 3SKPA 3PPRA 3PD8A 3PGFA 2HXWA 3MWBA 1SW2A 3T9XB 5L8DA 2PT1A 5FHOA 3W9WA 3KEIA 2GHBA 5H8NB 1SD3A 3G3JA 3PMVA 3MVWA 5HBCA 1MY1A 4IO7A 5I57A 4R9FA 5DT6A 1GR2A 4X9TA 4MF3A 4U4XA 3Q28A 5KCJA 3IJXB 2HAVA 3ILUB 4P0IA 1XVXA 4ZEKA 4NTLA 1LAGE 1EU8A 2X7PA 2ZNTA 4OEUA 1M5DA 3SEVA 4JDFA 4E0WA 3BFTA 3EPEA 1LLSA 1B2HA 2UVJA 4TLMB 2UXAA 1LB8A 3PUWE 5I57B 4KYEA 4U23A 1O7TA 3BFUA 3S4UA 3JYRA 1UTBA 1SW5A 1ZIUA 3HO7A 3RUMA 4F19A 4BDLA 4WEDA 3PUVE 3PMXA 3O66A 2X7QA 2PT2A 2QRYA 2Z8EA 5F7VA 2DYXA 3PUXE 1OVBA 3FVNA 3KGCA 4QHQA 1YAEA 4KPTA 4U22A 2ZNSA 4QF9A 3FZVA 1B3EA 3T96B 4RYAA 1IITA 4LP2B 3QYTA 3VLWA 1DSNA 3H7MA 3H06B 3KZGA 1H44A 1UTBB 2B3BA 4ZS9A 1JW1A 3N94A 1Y3QA 2ONKE 4F18A 3TEPA 1B7UA 1B5IA 2F34A 4GOTA 3B7DA 1VSOA 3UORA 3MUQA 1QVSA 1SVXB 3M3KA 5DEXA 2DSFA 5DYHA 4KR5A 3MZBA 3CI8A 2PVUA 3HSTA 1Y4CA 2F7BA 3H4ZA 4MLQA 4GWOA 3CVGA 4Q0CA 1NFTA 2Q2CA 1FTMA 2I0BA 4DCYA 1VR5A 4ZZEA 3F11A 4PP0A 3FVKA 3S2VA 4X1BA 5DEXB 4NEDA 3UK4A 2OWSA 5ISUA 1S9TA 5I59A 3RTWB 4EXLA 1LBCA 1M5BA 4ELRA 5B70A 1BTJA 4KI0E 5ITOA 1BLFA 3VE1B 4G68C 1ZTYA 2Z22A 2REGA 3DM0A 2GH9A 2OJTA 4IO4A 1I69A 3VLUA 1PB9A 2XXHA 3T9HB 1SYIA 3C36A 5A5XA 1EZ9A 2IA4A 2HAUA 1MPBA 5AA4B 3TMGA 4ZZAA 3IORA 3MBPA 3U1OA 2F7AA 3CRBA 3RGYA 1MRPA 2ZXTA 4ECFA 3SDFA 2ZMBA 2VOZA 4HS7A 1B32A 1N76A 2OZZA 4OFJA 4ZEDA 1T0KA 3QAXA 4LZ8A 3D4GA 2DQVA 2O1LA 4XIGQ 4LZ5A 4YKIA 3K1NA 4R9GA 1N3XA 4KFQA 3MPKA 4BDMA 2GFEA 3VXCA 3TZAA 4WXJA 1DPPA 3DP4A 3B6TA 1H43A 4X48A 4LUBA 5A5XB 3I5OA 2V3UA 1MPCA 1NNPA 4PETA 1GVCA 4TLLB 4ZEIA 1IXCA 3OO8A 2PYYA 2Y7RA 1O64A 4RNSA 3IB1A 5IKBA 3A3UA 1QULA 4DXBA 1LCFA 4EDPA 2R71A 2DE3A 3DELB 3E9XA 4IO5A 5BWJA 3SETA 3A3CA 4IB2A 1A40A 4H1XA 1IIWA 4GXAA 4BDQA 4XKRA 3OO7A 4DXCA 3TCGA 3E13X 4OHNA 1Q1KA 2DOJA 4PE5B 2I3WA 5H8HA 2H99A 1YPNA 3HHFA 5FHNA 3DP6A 2XX9A 4OETA 2DVCA 3FVOA 3Q29A 1JETA 2X26A 5TPAA 4F1YA 5AA2B 2QS1A 2XD3A 1JVYA 3R7XA 2R9JA 3FV2A 4GLIA 3KOSA 4GF8A 3KJTA 5H8HB 1FQAA 2VD2A 3LSWA 4EF2A 1EZOA 3VDFA 4YMAA 3T66A 3S9NC 4MH5A 5JK4A 4OENA 3SEYA 4N6PA 2P1SA 3FD3A 5TPAB 3DLNA 5L9MA 1DOTA 3RN8A 4YB7A 2ZYMA 2H9BA 1FQDA 5CBRA 5JTYA 3PPNA 4LATA 1TWYA 1IXGA 1MG1A 4DCXA 1FQCA 2XXUA 4ZE8A 1JW5A 2O6AA 3OENA 3IB0A 1B46A 3VVFA 3O2AA 3O6HA 2BJJX 1OQGA 5K2YA 3LSXA 3W9VA 1N84A 1QUJA 3TTMA 3HHGA 1GV8A 1B4ZA 4FEDA 2DE2A 1P99A 4O3BA 4F3BA 1HSEA 3H03A 3PPPA 2DVZA 2D21A 1MM6A 1IXHA 1B3GA 3LSLA 3KSJA 3M8UA 4YB5A 3IAZA 3ONMA 2D5WA 1AH5A 2UYFA 3RQTA 1DTZA 2YLNA 3RNNA 1SW4A 2Y7KA 4GFRA 2ONRA 4U4SA 1JW4A 4IY5A 2NUVA 4WEPA 1AL3A 1AMFA 4GL8A 5HM4B 3MW0A 5I56A 3FJGA 2V93A 3K02A 3U93A 1SI0A 1PB8A 4IO2A 3H6TA 4YICA 1OVTA 3TYHA 3IB2A 2ALUA 5BUUA 4F29A 2Q9TA 4Q8RA 3LR1A 2F7CA 2XHDA 3PUYE 5CBSA 1MH4A 2H5YA 3QXMA 3TKDA 4DDDA 4RXLA 4PFWA 4O3AA 2QS2A 4ELOA 1Y20A 2Y7WA 5EYFA 3KOTA 3FUZA 2XXQA 4RA1A 1DTGA 1H3DA 1JQFA 1Y3NA 3TTRA 3K6XA 3VVDA 5I56B 2F8DA 4U1ZA 3N5LA 5ICQA 4POXA 3E3KA 3HCQA 3Q25A 2O68A 5I58A 3ZKLA 4NF5A 3RPWA 3MP1A 4YMBA 1R9LA 4R6HA 4EF1A 2DWAA 4R2BA 3FIRA 4ISUA 2XXWA 1SYHA 1ELJA 3ZSFA 2XXIA 1UQWA 4ESXA 1MXWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R74 A;  1NKX A;  2VD3 A;  4F1U A;  4HTG A;  4R73 A;  3FV1 A;  1B40 A;  1A7L A;  1LAX A;  5I58 B;  4XKN A;  1QJM A;  4OFO A;  4QFK A;  4H65 A;  3B6W A;  2DWH A;  4NF5 B;  1RYX A;  1B1X A;  3IR1 A;  2VGQ A;  3K4U A;  4R72 A;  4Q5T A;  2V25 A;  1XT8 A;  3LBS A;  2NOO A;  4FOR A;  2RKM A;  3CSG A;  2H98 A;  1US5 A;  1IEJ A;  4QSE A;  3MPL A;  2O51 A;  2QMX A;  2OLB A;  4NF8 B;  4G8H A;  4Z0I A;  5H8Q A;  1UIV A;  4IO6 A;  2O84 X;  3UA8 A;  3TDJ A;  4LQ5 A;  4YKK A;  4OQO A;  2KLF A;  1LAF E;  4FEB A;  3S9M C;  1PB7 A;  4XTC Q;  3FAT A;  3E4R A;  3H6W A;  4OFL A;  3IO6 A;  2XX7 A;  1FQB A;  2RIN A;  1A55 A;  4QRZ A;  4H6D A;  3Q26 A;  4OZ9 A;  2Q89 A;  5CC2 A;  3QSL A;  5KZT A;  4NMY A;  5H8Q B;  4DE8 A;  1US4 A;  1BP5 A;  2DXY A;  4KHZ E;  1B3H A;  5J1D A;  3ILT B;  1ZBM A;  4OTE A;  4RK9 A;  1IZ1 A;  1OMP A;  4G8N A;  3OMB A;  2W7Y A;  2ZNU A;  2O7U A;  4R6K A;  1WDN A;  1R6Z A;  3EN3 A;  2CMO A;  1N3W A;  4LA9 A;  1B7Z A;  1OIB A;  2YJP A;  3PPO A;  1BIY A;  3KG2 A;  3EHU A;  4FAT A;  1IUD A;  3LC8 A;  3N26 A;  2Y84 A;  4PQJ A;  3CSB A;  5AA4 A;  3G3K A;  4MBP A;  3LSF B;  4BLA A;  4G68 B;  3TTN A;  1JVX A;  4MLV A;  1FTO A;  1B9J A;  4ELQ A;  1B5J A;  3M3F A;  2B3F A;  4OYV A;  1XVY A;  1IXI A;  4KYD A;  4C1T A;  4LVQ A;  1NH8 A;  1LB9 A;  3C33 A;  1D9V A;  3CG1 A;  2F5X A;  4K3F A;  3C9H A;  1HSJ A;  3SEX A;  1FTJ A;  5L9O A;  4PFT A;  5I2N A;  1QKB A;  4JBZ A;  3G3F A;  4ONY A;  3K1M A;  2XXY A;  3FXU A;  4ELP A;  1I6B A;  2I49 A;  3O97 A;  3V8X B;  2QL3 A;  2B65 A;  1CB6 A;  4YAH X;  4I1D A;  2V3Q A;  5I2K A;  2I58 A;  3L6G A;  1MDP 1;  3IOU A;  3PD9 A;  3BBR A;  1FQF A;  3RT8 A;  4OES A;  4M1V A;  3IOV A;  1S50 A;  5I2N B;  3O28 A;  2AL5 A;  1MQI A;  2QJE A;  1B51 A;  4GD5 A;  1EZP A;  3OO6 A;  3K01 A;  4E0X A;  1MS7 A;  4JWX A;  4JXI A;  2PMS A;  3G3G A;  2IEE A;  2XXR A;  5AA2 A;  2DXR A;  4RPN A;  4NWC A;  1R1N A;  1II5 A;  1Y1M A;  3K2D A;  1Q35 A;  4KCD A;  5I2K B;  1D9Y A;  1USY H;  1QUI A;  4JB7 A;  1USY E;  4LZ7 A;  3U72 A;  3TUS A;  3PUZ E;  4QSD A;  5DVF A;  3EQ1 A;  4U2R A;  2G29 A;  1N7X A;  1YTV A;  2GHA A;  2I4C A;  2GRV A;  2Z8F A;  4F1V A;  4P0G A;  3DP8 A;  4GQO A;  3QIM A;  3KBR A;  1GGG A;  3VLV A;  2OCU A;  4ZEF A;  4POW A;  1NH7 A;  4G77 A;  3UP9 A;  4H5G A;  1RKM A;  1NNT A;  3FAS A;  4EQB A;  1UTH A;  2Y7I A;  1MH3 A;  1JEV A;  1M5C A;  2R6G E;  1URG A;  3EHT A;  3AXF A;  5H8S A;  4L17 A;  2RCA A;  3TQL A;  1ATG A;  3D4C A;  3EF7 A;  2E1S A;  1LCT A;  1XC1 A;  1B05 A;  1B6H A;  1MY4 A;  2OWT A;  1SBP A;  3OEL A;  1B3F A;  5EHM A;  2XXV A;  1JNF A;  3OEK A;  2OBG A;  3OXN A;  4F3G A;  3FXQ A;  1QUK A;  3PV0 E;  3SEU A;  1IQ7 A;  2F6P A;  4I62 A;  3K0V A;  1UTH B;  4ZE9 A;  5ITP A;  3L6H A;  2HZK A;  5AE4 A;  3GBA A;  5CRY A;  4ND9 A;  5B7D A;  3M3L A;  4NWD A;  3PPQ A;  1DPE A;  1YCJ A;  4NF6 A;  4H8J A;  3I3V A;  4KCC A;  2ABH A;  3T9V A;  4HW8 A;  5DVI A;  4RK2 A;  3CFX A;  1POT A;  2QMW A;  2FYI A;  1LST A;  1URD A;  2AYS A;  2PX1 A;  1PBQ A;  3IOW A;  1TT1 A;  4OWD A;  4OVJ A;  2XXT A;  2E0S A;  4EQ7 A;  3TTK A;  1MY0 A;  2I0C A;  3Q27 A;  3TOD A;  1B52 A;  3QK6 A;  1A54 A;  4JWY A;  1B5H A;  4R6Y A;  1D3K A;  1WVJ A;  4NF6 B;  1QW0 A;  2Z23 A;  2LAO A;  3G7W A;  5CM6 A;  3OSR A;  4FIM A;  4MFI A;  1MXU A;  2HZL A;  2O69 A;  3C34 A;  2ZYK A;  2XXX A;  1MPD A;  3IOT A;  1XS5 A;  1B4H A;  3U92 A;  4IO3 A;  1MQH A;  2UVI A;  3V5A A;  3VXB A;  3VFJ A;  3KSX A;  2D3I A;  4LON B;  2DS9 A;  4I8C A;  2RC9 A;  2WKY A;  1B3L A;  4F31 B;  3T22 A;  2XX8 A;  4AB6 A;  4FE8 A;  4QFN A;  3JV9 A;  3MP6 A;  4YKP A;  3K6V A;  3IL1 B;  4RPO A;  1LFG A;  1D4N A;  1Y9U A;  2HEU A;  4ESW A;  3TCH A;  3R26 A;  4H0W A;  1Y1Z A;  2Q2A A;  2A5T A;  3LUY A;  1CE2 A;  4KQP A;  3UN6 A;  3TPA A;  4FEC A;  3O6I A;  3SES A;  3IJO B;  3H6U A;  2VHA A;  1MY3 A;  4NF8 A;  3MJN A;  3MVX A;  3TTL A;  4F22 A;  1B0L A;  2Q88 A;  1B1H A;  4I9D A;  1MM7 A;  1PDA A;  3QUJ A;  4XKQ A;  3FJ7 A;  1AIV A;  2ZYN A;  3TAJ A;  3RTF B;  3SEW A;  1NNK A;  3FXR A;  5L9S A;  2F36 A;  2OK2 A;  2ANJ A;  3WAF A;  3PU5 A;  4GRK A;  3OOA A;  2A5T B;  1M5E A;  1SQY A;  4BDR A;  2P2A A;  3A09 A;  1Z7N E;  4X1D A;  4OXV A;  3OO9 A;  4IGT A;  1NL5 A;  1PEB A;  5KCJ B;  3SER A;  1N04 A;  4F39 A;  4AQ4 A;  1Y4T A;  4NE4 A;  2ESN A;  5LOM A;  4GXS B;  2RF1 A;  4FAJ A;  4U21 A;  3B6Q A;  3C35 A;  4QSC A;  3CFZ A;  2F78 A;  2PBW A;  3P7I A;  2THI A;  4DLD A;  3T9U A;  2QPQ A;  5FTI A;  1ZU0 A;  3N6U A;  4YB6 A;  4Q30 B;  3C31 A;  3K1P A;  1SDX A;  5DTB A;  3FGS A;  4G68 A;  2DP8 A;  1I6A A;  3CIJ A;  5K2X A;  3TCF A;  3O29 A;  2VP1 A;  5CI5 A;  5AA2 D;  4OER A;  2HCA A;  2V3T A;  5ELV A;  2QSX A;  3KJ7 A;  3MC2 A;  4EUO A;  3C4M A;  4QFP A;  4C1U A;  5FHM A;  3U8Q A;  1POY 1;  2AL4 A;  4YZZ A;  4N13 A;  1I6Q A;  1MDQ A;  4TOZ A;  3QUF A;  3G3I A;  3OSQ A;  5H8F A;  2UVH A;  2HFB A;  2CZL A;  1OQH A;  1Z7M E;  1A99 A;  1URS A;  1LFI A;  2UVG A;  4EXK A;  1OLC A;  4XXU A;  4HCY A;  4U1O A;  2F97 A;  4UA8 A;  4HCW A;  3ECR A;  2FA7 A;  2F35 A;  1BKA A;  3UIF A;  1TFD A;  3G3H A;  4ZEC A;  1XHY A;  3TEL A;  5TP9 A;  3HPI A;  4IY6 A;  1R9Q A;  1TXF A;  5H8F B;  2O1M A;  4N07 A;  2XXP A;  1LGB C;  1ANF A;  5M2V A;  3O9P A;  3IX1 A;  3IK6 B;  3FVG A;  1FTL A;  4DIG A;  1FTK A;  1H76 A;  2I3V A;  4RJZ A;  2DWI A;  4KYS A;  4OMB A;  1FCK A;  3MAM A;  1ZKB A;  4FJP A;  5I59 B;  4Z7E A;  5TP9 B;  4GIZ A;  3W15 C;  3GBB A;  3RY3 A;  1MXX A;  5I84 A;  4H67 A;  4QFL A;  3MVZ A;  1F9B A;  2NVU B;  4H8I A;  1L5T A;  3ZKK A;  2H4I A;  3RLF E;  5FTH A;  4THI A;  3EHS A;  3JZJ A;  3MZ9 A;  3MQ9 A;  4DXU A;  1P1W A;  5CMC A;  4JSO A;  1GTK A;  3FJM A;  3GLB A;  3ZS6 A;  2XD2 A;  3S9E A;  2I4B A;  1LFH A;  2H25 A;  1MY2 A;  3ODB A;  2REJ A;  4KD5 A;  1UIU A;  4PFY A;  5TU0 A;  4F2O A;  3MP8 A;  4C0R A;  3BKI B;  3H3G A;  1QKA A;  1MXV A;  1N0T A;  1O63 A;  3OD7 A;  2I6E A;  3UGW A;  3S9L C;  1M5F A;  3MVY A;  1LBB A;  4F3P A;  1P1U A;  5HPQ A;  2FNC A;  1EH3 A;  4NF4 A;  3KN3 A;  2M8C A;  4JSD A;  5CMB A;  4JWO A;  4ZEB A;  4DZ1 A;  3V89 B;  2YPN A;  1MQG A;  2UYE A;  4QFO A;  3H6V A;  1PBP A;  3I6V A;  3IO4 A;  3RT6 B;  2HQ0 A;  1RYO A;  3CFL A;  4F2Q A;  3K00 A;  1MQJ A;  3OEM A;  5CMM A;  1SW1 A;  2AIX A;  3MZ1 A;  4AB5 A;  1MQD A;  3K6U A;  4GVO A;  2F6G A;  1KWH A;  3V83 A;  1B0H A;  4NF4 B;  3KFM A;  5AA3 A;  1P1N A;  5F1Q A;  4R75 A;  1ZJL A;  5KDT A;  2ONS A;  4RY1 A;  1B58 A;  3USD A;  1PC3 A;  5DVJ A;  1A8F A;  1NNF A;  2RCB A;  1NMU A;  3R6U A;  3C32 A;  2Q8J A;  3N6T A;  5EHS A;  3VV5 A;  3CG3 A;  4LQ2 A;  1VFE A;  3O6G A;  1P1O A;  1WOD A;  4G2Z A;  3K6W A;  4OEV A;  1P1Q A;  4P11 A;  2ZYO A;  3KN8 A;  3T93 B;  3GXA A;  1TFA A;  2V84 A;  1DMB A;  3PMW A;  5AA1 A;  2O7I A;  5CMK A;  5KDT B;  1S7Y A;  1B7H A;  1HSL A;  3HN0 A;  1XOC A;  1JEU A;  2A5S A;  3VVE A;  3TQW A;  1SI1 A;  2P0S A;  5JTY B;  4WKM A;  4F3S A;  2DWJ A;  3THI A;  2DE4 A;  3WAE A;  1OLA A;  3HV1 A;  4EQ9 A;  1N7W A;  4XKP A;  4YKJ A;  3U94 A;  2I48 A;  4IGR A;  1H45 A;  1LAH E;  5IAI A;  2Y7P A;  4PFU A;  1A8E A;  4G4P A;  4YU0 A;  2NWJ A;  2G93 A;  4H5F A;  2QS3 A;  3CR9 A;  4R2F A;  2RC7 A;  5H8N A;  3KN7 A;  4G8M A;  1ZMG A;  1FW0 A;  4ZDM A;  5ICT A;  1MXY A;  3TFL A;  1ZLQ A;  2RC8 A;  4GL0 A;  1Y3P A;  4M4G A;  1VFD A;  4O3C A;  2NXO A;  4BDN A;  2Z8D A;  1J1N A;  1MXZ A;  4UAC A;  2QS4 A;  4TQU Q;  1FQE A;  4BDO A;  1VE4 A;  1AOV A;  5JEI A;  3GZG A;  3SKP A;  3PPR A;  3PD8 A;  3PGF A;  2HXW A;  3MWB A;  1SW2 A;  3T9X B;  5L8D A;  2PT1 A;  5FHO A;  3W9W A;  3KEI A;  2GHB A;  5H8N B;  1SD3 A;  3G3J A;  3PMV A;  3MVW A;  5HBC A;  1MY1 A;  4IO7 A;  5I57 A;  4R9F A;  5DT6 A;  1GR2 A;  4X9T A;  4MF3 A;  4U4X A;  3Q28 A;  5KCJ A;  3IJX B;  2HAV A;  3ILU B;  4P0I A;  1XVX A;  4ZEK A;  4NTL A;  1LAG E;  1EU8 A;  2X7P A;  2ZNT A;  4OEU A;  1M5D A;  3SEV A;  4JDF A;  4E0W A;  3BFT A;  3EPE A;  1LLS A;  1B2H A;  2UVJ A;  4TLM B;  2UXA A;  1LB8 A;  3PUW E;  5I57 B;  4KYE A;  4U23 A;  1O7T A;  3BFU A;  3S4U A;  3JYR A;  1UTB A;  1SW5 A;  1ZIU A;  3HO7 A;  3RUM A;  4F19 A;  4BDL A;  4WED A;  3PUV E;  3PMX A;  3O66 A;  2X7Q A;  2PT2 A;  2QRY A;  2Z8E A;  5F7V A;  2DYX A;  3PUX E;  1OVB A;  3FVN A;  3KGC A;  4QHQ A;  1YAE A;  4KPT A;  4U22 A;  2ZNS A;  4QF9 A;  3FZV A;  1B3E A;  3T96 B;  4RYA A;  1IIT A;  4LP2 B;  3QYT A;  3VLW A;  1DSN A;  3H7M A;  3H06 B;  3KZG A;  1H44 A;  1UTB B;  2B3B A;  4ZS9 A;  1JW1 A;  3N94 A;  1Y3Q A;  2ONK E;  4F18 A;  3TEP A;  1B7U A;  1B5I A;  2F34 A;  4GOT A;  3B7D A;  1VSO A;  3UOR A;  3MUQ A;  1QVS A;  1SVX B;  3M3K A;  5DEX A;  2DSF A;  5DYH A;  4KR5 A;  3MZB A;  3CI8 A;  2PVU A;  3HST A;  1Y4C A;  2F7B A;  3H4Z A;  4MLQ A;  4GWO A;  3CVG A;  4Q0C A;  1NFT A;  2Q2C A;  1FTM A;  2I0B A;  4DCY A;  1VR5 A;  4ZZE A;  3F11 A;  4PP0 A;  3FVK A;  3S2V A;  4X1B A;  5DEX B;  4NED A;  3UK4 A;  2OWS A;  5ISU A;  1S9T A;  5I59 A;  3RTW B;  4EXL A;  1LBC A;  1M5B A;  4ELR A;  5B70 A;  1BTJ A;  4KI0 E;  5ITO A;  1BLF A;  3VE1 B;  4G68 C;  1ZTY A;  2Z22 A;  2REG A;  3DM0 A;  2GH9 A;  2OJT A;  4IO4 A;  1I69 A;  3VLU A;  1PB9 A;  2XXH A;  3T9H B;  1SYI A;  3C36 A;  5A5X A;  1EZ9 A;  2IA4 A;  2HAU A;  1MPB A;  5AA4 B;  3TMG A;  4ZZA A;  3IOR A;  3MBP A;  3U1O A;  2F7A A;  3CRB A;  3RGY A;  1MRP A;  2ZXT A;  4ECF A;  3SDF A;  2ZMB A;  2VOZ A;  4HS7 A;  1B32 A;  1N76 A;  2OZZ A;  4OFJ A;  4ZED A;  1T0K A;  3QAX A;  4LZ8 A;  3D4G A;  2DQV A;  2O1L A;  4XIG Q;  4LZ5 A;  4YKI A;  3K1N A;  4R9G A;  1N3X A;  4KFQ A;  3MPK A;  4BDM A;  2GFE A;  3VXC A;  3TZA A;  4WXJ A;  1DPP A;  3DP4 A;  3B6T A;  1H43 A;  4X48 A;  4LUB A;  5A5X B;  3I5O A;  2V3U A;  1MPC A;  1NNP A;  4PET A;  1GVC A;  4TLL B;  4ZEI A;  1IXC A;  3OO8 A;  2PYY A;  2Y7R A;  1O64 A;  4RNS A;  3IB1 A;  5IKB A;  3A3U A;  1QUL A;  4DXB A;  1LCF A;  4EDP A;  2R71 A;  2DE3 A;  3DEL B;  3E9X A;  4IO5 A;  5BWJ A;  3SET A;  3A3C A;  4IB2 A;  1A40 A;  4H1X A;  1IIW A;  4GXA A;  4BDQ A;  4XKR A;  3OO7 A;  4DXC A;  3TCG A;  3E13 X;  4OHN A;  1Q1K A;  2DOJ A;  4PE5 B;  2I3W A;  5H8H A;  2H99 A;  1YPN A;  3HHF A;  5FHN A;  3DP6 A;  2XX9 A;  4OET A;  2DVC A;  3FVO A;  3Q29 A;  1JET A;  2X26 A;  5TPA A;  4F1Y A;  5AA2 B;  2QS1 A;  2XD3 A;  1JVY A;  3R7X A;  2R9J A;  3FV2 A;  4GLI A;  3KOS A;  4GF8 A;  3KJT A;  5H8H B;  1FQA A;  2VD2 A;  3LSW A;  4EF2 A;  1EZO A;  3VDF A;  4YMA A;  3T66 A;  3S9N C;  4MH5 A;  5JK4 A;  4OEN A;  3SEY A;  4N6P A;  2P1S A;  3FD3 A;  5TPA B;  3DLN A;  5L9M A;  1DOT A;  3RN8 A;  4YB7 A;  2ZYM A;  2H9B A;  1FQD A;  5CBR A;  5JTY A;  3PPN A;  4LAT A;  1TWY A;  1IXG A;  1MG1 A;  4DCX A;  1FQC A;  2XXU A;  4ZE8 A;  1JW5 A;  2O6A A;  3OEN A;  3IB0 A;  1B46 A;  3VVF A;  3O2A A;  3O6H A;  2BJJ X;  1OQG A;  5K2Y A;  3LSX A;  3W9V A;  1N84 A;  1QUJ A;  3TTM A;  3HHG A;  1GV8 A;  1B4Z A;  4FED A;  2DE2 A;  1P99 A;  4O3B A;  4F3B A;  1HSE A;  3H03 A;  3PPP A;  2DVZ A;  2D21 A;  1MM6 A;  1IXH A;  1B3G A;  3LSL A;  3KSJ A;  3M8U A;  4YB5 A;  3IAZ A;  3ONM A;  2D5W A;  1AH5 A;  2UYF A;  3RQT A;  1DTZ A;  2YLN A;  3RNN A;  1SW4 A;  2Y7K A;  4GFR A;  2ONR A;  4U4S A;  1JW4 A;  4IY5 A;  2NUV A;  4WEP A;  1AL3 A;  1AMF A;  4GL8 A;  5HM4 B;  3MW0 A;  5I56 A;  3FJG A;  2V93 A;  3K02 A;  3U93 A;  1SI0 A;  1PB8 A;  4IO2 A;  3H6T A;  4YIC A;  1OVT A;  3TYH A;  3IB2 A;  2ALU A;  5BUU A;  4F29 A;  2Q9T A;  4Q8R A;  3LR1 A;  2F7C A;  2XHD A;  3PUY E;  5CBS A;  1MH4 A;  2H5Y A;  3QXM A;  3TKD A;  4DDD A;  4RXL A;  4PFW A;  4O3A A;  2QS2 A;  4ELO A;  1Y20 A;  2Y7W A;  5EYF A;  3KOT A;  3FUZ A;  2XXQ A;  4RA1 A;  1DTG A;  1H3D A;  1JQF A;  1Y3N A;  3TTR A;  3K6X A;  3VVD A;  5I56 B;  2F8D A;  4U1Z A;  3N5L A;  5ICQ A;  4POX A;  3E3K A;  3HCQ A;  3Q25 A;  2O68 A;  5I58 A;  3ZKL A;  4NF5 A;  3RPW A;  3MP1 A;  4YMB A;  1R9L A;  4R6H A;  4EF1 A;  2DWA A;  4R2B A;  3FIR A;  4ISU A;  2XXW A;  1SYH A;  1ELJ A;  3ZSF A;  2XXI A;  1UQW A;  4ESX A;  1MXW A; 
#chains in the Genus database with same CATH topology
 1JP4 A;  4R74 A;  1NKX A;  2VD3 A;  3ROJ A;  4MJO A;  4O94 A;  4F1U A;  4HTG A;  4R73 A;  3FV1 A;  1B40 A;  1A7L A;  1LAX A;  5I58 B;  4XKN A;  1QJM A;  4OFO A;  4QFK A;  4H65 A;  3B6W A;  2DWH A;  4NF5 B;  1RYX A;  1B1X A;  1G0I A;  3IR1 A;  2VGQ A;  3K4U A;  4R72 A;  4Q5T A;  4QBA A;  2V25 A;  1XT8 A;  3LBS A;  1YYZ A;  2NOO A;  4FOR A;  2RKM A;  3CSG A;  2H98 A;  1US5 A;  1IEJ A;  4QSE A;  4H46 A;  4MNP A;  3MPL A;  2O51 A;  2QMX A;  2OLB A;  3SZP A;  4NF8 B;  4G8H A;  4Z0I A;  5H8Q A;  1UIV A;  1NV4 A;  1NV6 A;  4IO6 A;  2O84 X;  3UA8 A;  4O7M A;  3A29 A;  3TDJ A;  4LQ5 A;  2XWO A;  4YKK A;  1Q9D A;  4OQO A;  2KLF A;  1LAF E;  3BIG A;  1FBC A;  4FEB A;  3S9M C;  2WBD A;  1PB7 A;  4XTC Q;  3FAT A;  3E4R A;  3H6W A;  4XEQ A;  4GX3 A;  4OFL A;  3IO6 A;  2XX7 A;  4GWS A;  1FQB A;  1KZ8 A;  2RIN A;  1A55 A;  5IZ1 A;  4QRZ A;  4H6D A;  3Q26 A;  4OZ9 A;  2Q89 A;  5CC2 A;  3QSL A;  5KZT A;  4NMY A;  4MNC A;  5H8Q B;  4DE8 A;  1US4 A;  4N6D A;  1BP5 A;  2DXY A;  4KHZ E;  1B3H A;  5J1D A;  3ILT B;  1ZBM A;  4OTE A;  4RK9 A;  1IZ1 A;  1OMP A;  4G8N A;  3OMB A;  2W7Y A;  1IMB A;  2ZNU A;  2O7U A;  4R6K A;  1WDN A;  1R6Z A;  1BK4 A;  3EN3 A;  2CMO A;  1N3W A;  1IMC A;  4LA9 A;  4JVD A;  1B7Z A;  1OIB A;  1NUY A;  2YJP A;  5I5P A;  3PPO A;  1BIY A;  3KG2 A;  3EHU A;  4FAT A;  1IUD A;  3LC8 A;  3N26 A;  2Y84 A;  4OVQ A;  4PQJ A;  3CSB A;  5AA4 A;  3G3K A;  1EYI A;  4MBP A;  3LSF B;  4BLA A;  4G68 B;  3TTN A;  1JVX A;  4MLV A;  4KXP A;  2HPG A;  1NUW A;  1FTO A;  4P47 A;  2WBB A;  1B9J A;  4ELQ A;  1B5J A;  4HE2 A;  3B8B A;  3M3F A;  1FPL A;  2B3F A;  4OYV A;  1XVY A;  3FXB A;  1IXI A;  4KYD A;  4C1T A;  4LVQ A;  1NH8 A;  1LB9 A;  3C33 A;  1D9V A;  3CG1 A;  2F5X A;  4K3F A;  4GWW A;  3C9H A;  1HSJ A;  3T0J A;  5IM2 A;  3SEX A;  1FTJ A;  5L9O A;  4PFT A;  5I2N A;  1QKB A;  4JBZ A;  4OVT A;  3G3F A;  4ONY A;  3K1M A;  2XXY A;  3FXU A;  4ELP A;  4MMP A;  1I6B A;  4PAF A;  2I49 A;  3O97 A;  3V8X B;  2QL3 A;  1NV1 A;  2B65 A;  1CB6 A;  4YAH X;  4I1D A;  2V3Q A;  5I2K A;  2I58 A;  3L6G A;  1LBV A;  1MDP 1;  3IOU A;  3PD9 A;  3BBR A;  1FQF A;  3RT8 A;  2P3N A;  4OES A;  4M1V A;  3IOV A;  2QVU A;  4MEV A;  1S50 A;  5I2N B;  3O28 A;  2AL5 A;  1MQI A;  2QJE A;  1B51 A;  4GWY A;  4GD5 A;  1EZP A;  2Y5K A;  3OO6 A;  3K01 A;  4E0X A;  1MS7 A;  3E79 A;  4JWX A;  4JXI A;  2PMS A;  3G3G A;  2IEE A;  2XXR A;  5AA2 A;  2F3B A;  2DXR A;  4RPN A;  4NWC A;  4PC9 A;  1R1N A;  1II5 A;  1Y1M A;  3K2D A;  1Q35 A;  1RDX A;  4KCD A;  5I2K B;  1D9Y A;  1USY H;  3RPL A;  1QUI A;  4JB7 A;  1DCU A;  1FPI A;  1USY E;  4LZ7 A;  3U72 A;  3TUS A;  3PUZ E;  4QSD A;  5DVF A;  3EQ1 A;  4U2R A;  2G29 A;  1N7X A;  4HXV A;  2HXR A;  1YTV A;  2GHA A;  2I4C A;  2GRV A;  2Z8F A;  4F1V A;  4P0G A;  3DP8 A;  4GQO A;  3QIM A;  3KBR A;  1GGG A;  3VLV A;  2OCU A;  3PTY A;  3RPL B;  4ZEF A;  4POW A;  1NH7 A;  1FTA A;  3HFU A;  4G77 A;  3UP9 A;  4H5G A;  1RKM A;  2QVV A;  2WYP A;  1NNT A;  3FAS A;  4EQB A;  1UTH A;  1FPG A;  2Y7I A;  1MH3 A;  1FJ9 A;  1JEV A;  1M5C A;  2R6G E;  1URG A;  3EHT A;  3AXF A;  5H8S A;  4L17 A;  2RCA A;  3TQL A;  1EYJ A;  1IMA A;  1ATG A;  3D4C A;  2FHY A;  3EF7 A;  1LBZ A;  2E1S A;  1LCT A;  1XC1 A;  1B05 A;  1B6H A;  1MY4 A;  2OWT A;  1SBP A;  3OEL A;  1B3F A;  5EHM A;  2XXV A;  1JNF A;  3OEK A;  2OBG A;  3OXN A;  4F3G A;  3FXQ A;  1QUK A;  3PV0 E;  3SEU A;  4OVS A;  1IQ7 A;  2F6P A;  4I62 A;  3K0V A;  1UTH B;  1CNQ A;  4ZE9 A;  1D9Q A;  5ITP A;  3L6H A;  2XWV A;  2HZK A;  5AE4 A;  3GBA A;  5CRY A;  4ND9 A;  5B7D A;  3M3L A;  1VDW A;  4NWD A;  3PPQ A;  1DPE A;  1YCJ A;  4NF6 A;  3CHG A;  4H8J A;  3I3V A;  4KCC A;  2ABH A;  5A5L A;  3T9V A;  4HW8 A;  5DVI A;  4RK2 A;  3CFX A;  1POT A;  4N17 A;  4DI4 B;  2QMW A;  2FYI A;  1LST A;  1URD A;  2AYS A;  3D1R A;  2PX1 A;  4G61 A;  1PBQ A;  3IOW A;  1TT1 A;  4OWD A;  4OVJ A;  2XXT A;  2E0S A;  4EQ7 A;  2CEX A;  3TTK A;  1MY0 A;  2I0C A;  3Q27 A;  3TOD A;  1B52 A;  3QK6 A;  1A54 A;  4JWY A;  1B5H A;  4R6Y A;  4PGP A;  4I40 A;  1D3K A;  1WVJ A;  1FPE A;  4NF6 B;  1QW0 A;  2Z23 A;  2Q8M A;  2LAO A;  3G7W A;  5CM6 A;  3OSR A;  4FIM A;  4MFI A;  1INP A;  1MXU A;  2HZL A;  2O69 A;  3C34 A;  2ZYK A;  2XXX A;  1MPD A;  3IOT A;  4AS5 A;  1XS5 A;  4P3L A;  1B4H A;  4GWU A;  4PAK A;  3U92 A;  2B4M A;  2ZZW A;  4IO3 A;  1MQH A;  2UVI A;  3V5A A;  3VXB A;  3VFJ A;  3KSX A;  2D3I A;  4GWZ A;  4LON B;  2DS9 A;  4I8C A;  2RC9 A;  5F24 A;  2WKY A;  1B3L A;  4F31 B;  3T22 A;  2XX8 A;  3MYU A;  4AB6 A;  4FE8 A;  2B4L A;  4QFN A;  5EQ8 A;  4MX6 A;  3JV9 A;  3MP6 A;  4YKP A;  3K6V A;  4GBW A;  3IL1 B;  4RPO A;  1LFG A;  1D4N A;  1Y9U A;  2HEU A;  1FBD A;  2DDK A;  1FBE A;  4ESW A;  3TCH A;  3R26 A;  4H0W A;  1Y1Z A;  2Q2A A;  4JVC A;  2A5T A;  3LUY A;  1CE2 A;  4KQP A;  3IFA A;  3UN6 A;  3TPA A;  4FEC A;  3O6I A;  3SES A;  3IJO B;  3H6U A;  2VHA A;  1MY3 A;  4NF8 A;  3MJN A;  1K9Z A;  3MVX A;  3TTL A;  4F22 A;  1B0L A;  2Q88 A;  1B1H A;  4I9D A;  1MM7 A;  3QUJ A;  1PDA A;  4XKQ A;  3FJ7 A;  4N81 A;  1NV5 A;  1AIV A;  2ZYN A;  3TAJ A;  3RTF B;  3SEW A;  1NNK A;  3FXR A;  5L9S A;  1FJ6 A;  2F36 A;  2OK2 A;  2ANJ A;  3WAF A;  3PU5 A;  4X8R A;  4GRK A;  3OOA A;  2A5T B;  2OWZ A;  1M5E A;  5ET8 A;  1SQY A;  4BDR A;  2P2A A;  3A09 A;  1Z7N E;  4X1D A;  4OXV A;  3OO9 A;  4IGT A;  1NL5 A;  5DW8 A;  1PEB A;  4PTK A;  5KCJ B;  4PE3 A;  3SER A;  1N04 A;  4F39 A;  4AQ4 A;  4N8G A;  1Y4T A;  4NE4 A;  2ESN A;  5LOM A;  4GXS B;  2RF1 A;  4FAJ A;  4U21 A;  3B6Q A;  3C35 A;  4I3E A;  4OVP A;  4P8B A;  4QSC A;  3CFZ A;  1FRP A;  2F78 A;  4H45 A;  2PBW A;  2VPN A;  3P7I A;  2THI A;  4DLD A;  5EYG A;  2HHM A;  3T9U A;  2QPQ A;  5FTI A;  1ZU0 A;  3N6U A;  4YB6 A;  4Q30 B;  3C31 A;  4UAB A;  3K1P A;  1SDX A;  5DTB A;  1LBX A;  4P56 A;  3FGS A;  4G68 A;  2DP8 A;  1I6A A;  4PBH A;  3CIJ A;  1SPI A;  4MHF A;  5K2X A;  3TCF A;  2KR0 A;  3BIH A;  2P3V A;  3O29 A;  2VP1 A;  5CI5 A;  5AA2 D;  4OER A;  2HCA A;  2V3T A;  5ELV A;  2QSX A;  3KJ7 A;  3MC2 A;  4EUO A;  3C4M A;  4QFP A;  4C1U A;  4PCD A;  5FHM A;  3U8Q A;  1POY 1;  2AL4 A;  4YZZ A;  4N13 A;  1I6Q A;  1MDQ A;  4TOZ A;  1RDY A;  3QUF A;  3G3I A;  3OSQ A;  4GX6 A;  5H8F A;  2UVH A;  5LDZ A;  2HFB A;  2CZL A;  1OQH A;  1Z7M E;  1A99 A;  1URS A;  1LFI A;  2UVG A;  4EXK A;  4PFB A;  1OLC A;  4XXU A;  4HCY A;  4U1O A;  2F97 A;  4UA8 A;  4HCW A;  3ECR A;  4N4U A;  2FA7 A;  2F35 A;  1BKA A;  3UIF A;  1TFD A;  3G3H A;  4ZEC A;  1XHY A;  3TEL A;  5TP9 A;  3HPI A;  4IY6 A;  1FBG A;  4O8M A;  1R9Q A;  1TXF A;  5H8F B;  2O1M A;  4N07 A;  2XXP A;  4IR8 A;  1LGB C;  2R8T A;  1ANF A;  1NV3 A;  5M2V A;  1FPD A;  3O9P A;  3IX1 A;  3IK6 B;  3FVG A;  1FTL A;  4DIG A;  1FTK A;  1H76 A;  2I3V A;  4RJZ A;  1IMD A;  2DWI A;  2JJK A;  5ET5 A;  4KYS A;  4PAI A;  2QFL A;  4OMB A;  2XXK A;  1FPB A;  1FCK A;  3FBP A;  3MAM A;  4FJP A;  1ZKB A;  5I59 B;  3RYD A;  4Z7E A;  5TP9 B;  4GIZ A;  1EYK A;  3W15 C;  3GBB A;  3RY3 A;  1MXX A;  5I84 A;  4H67 A;  4QFL A;  3MVZ A;  1F9B A;  2NVU B;  4H8I A;  1L5T A;  3ZKK A;  2H4I A;  3RLF E;  5FTH A;  4THI A;  1FBP A;  3EHS A;  3JZJ A;  3MZ9 A;  3MQ9 A;  4DXU A;  1P1W A;  5CMC A;  4JSO A;  4AS4 A;  1FBF A;  1GTK A;  3FJM A;  3GLB A;  3ZS6 A;  2L5V A;  2XD2 A;  3S9E A;  2I4B A;  1LFH A;  2H25 A;  1MY2 A;  3ODB A;  2REJ A;  4KD5 A;  1UIU A;  4PFY A;  5TU0 A;  4F2O A;  3MP8 A;  4C0R A;  3BKI B;  3H3G A;  4PFI A;  5IZ3 B;  1QKA A;  1MXV A;  1N0T A;  1O63 A;  3OD7 A;  2I6E A;  3UGW A;  3S9L C;  1M5F A;  3MVY A;  5EQ9 A;  1LBB A;  4F3P A;  1P1U A;  5HPQ A;  2FNC A;  1EH3 A;  4NF4 A;  3KN3 A;  2VT5 A;  2M8C A;  4JSD A;  5CMB A;  4JWO A;  4ZEB A;  4DZ1 A;  3MST A;  3V89 B;  2YPN A;  1MQG A;  2UYE A;  4QFO A;  3H6V A;  1PBP A;  4P1L A;  3I6V A;  3IO4 A;  3RT6 B;  2HQ0 A;  1RYO A;  3LV0 A;  3CFL A;  4F2Q A;  2KQZ A;  3K00 A;  1MQJ A;  3OEM A;  5CMM A;  5FBP A;  1SW1 A;  1NV2 A;  2QVR A;  2AIX A;  3MZ1 A;  4AB5 A;  1MQD A;  3K6U A;  4GVO A;  2F6G A;  3T1B A;  5EQ7 A;  1KWH A;  3V83 A;  1B0H A;  4NF4 B;  3KFM A;  5AA3 A;  5IGA A;  1P1N A;  5F1Q A;  4R75 A;  1ZJL A;  3KBZ A;  5KDT A;  2ONS A;  4XFE A;  4RY1 A;  1B58 A;  3USD A;  1PC3 A;  5DVJ A;  1A8F A;  1NNF A;  2ZZX A;  2RCB A;  1NUZ A;  1NMU A;  3LUZ A;  3C32 A;  3R6U A;  2Q8J A;  3N6T A;  4P1E A;  5EHS A;  3VV5 A;  3CG3 A;  4LQ2 A;  2FBP A;  1VFE A;  3O6G A;  3KC0 A;  1P1O A;  1WOD A;  4G2Z A;  3K6W A;  4OEV A;  1XI6 A;  1P1Q A;  4P11 A;  2ZYO A;  3KN8 A;  3T93 B;  1AWB A;  4N91 A;  3GXA A;  1TFA A;  2V84 A;  1DMB A;  4DI3 D;  3PMW A;  1KA0 A;  5AA1 A;  2O7I A;  5CMK A;  5KDT B;  1S7Y A;  1B7H A;  1HSL A;  3HN0 A;  1XOC A;  1JEU A;  1IMF A;  2A5S A;  3VVE A;  2PFZ A;  3TQW A;  1SI1 A;  2P0S A;  5JTY B;  4WKM A;  4F3S A;  2CZK A;  1LEV A;  2DWJ A;  3THI A;  2DE4 A;  3WAE A;  1OLA A;  3HV1 A;  4EQ9 A;  1N7W A;  4XKP A;  4YKJ A;  3U94 A;  1G0H A;  1NV7 A;  2CZI A;  2I48 A;  4IGR A;  1H45 A;  1LAH E;  5IAI A;  2Y7P A;  4PDD A;  4PFU A;  1A8E A;  4G4P A;  4YU0 A;  2NWJ A;  2G93 A;  4H5F A;  2QS3 A;  3CR9 A;  4R2F A;  2RC7 A;  5H8N A;  3KN7 A;  4G8M A;  1ZMG A;  1FW0 A;  4ZDM A;  5ICT A;  1MXY A;  1ZLQ A;  3TFL A;  2RC8 A;  4GL0 A;  1Y3P A;  4M4G A;  1VFD A;  4O3C A;  2NXO A;  4BDN A;  2Z8D A;  1J1N A;  1MXZ A;  4GWX A;  4UAC A;  2QS4 A;  4TQU Q;  2GQ1 A;  1FQE A;  4BDO A;  1VE4 A;  1AOV A;  4NN3 A;  5JEI A;  3GZG A;  3SKP A;  1FPF A;  3PPR A;  3PD8 A;  3PGF A;  5J16 A;  2FIX A;  4PDH A;  2HXW A;  5I7I A;  3MWB A;  1SW2 A;  3T9X B;  5L8D A;  2PT1 A;  5FHO A;  1NV0 A;  3KEI A;  3W9W A;  2GHB A;  5H8N B;  1SD3 A;  2WX9 A;  3KC1 A;  3G3J A;  3PMV A;  3MVW A;  5HBC A;  1MY1 A;  4IO7 A;  5I57 A;  4R9F A;  1YXI A;  1FSA A;  5DT6 A;  1GR2 A;  2XWK A;  4X9T A;  4MF3 A;  4U4X A;  1NUX A;  2PFY A;  3Q28 A;  5KCJ A;  3IJX B;  2HAV A;  3ILU B;  4P0I A;  1XVX A;  4ZEK A;  4NTL A;  1LAG E;  4PF8 A;  2VPO A;  1EU8 A;  2X7P A;  2ZNT A;  4OEU A;  1M5D A;  3SEV A;  4JDF A;  4E0W A;  1IME A;  3BFT A;  3EPE A;  1LLS A;  1B2H A;  2UVJ A;  4TLM B;  2UXA A;  1LB8 A;  3PUW E;  5I57 B;  4KYE A;  4U23 A;  1O7T A;  3BFU A;  3S4U A;  3JYR A;  1UTB A;  1SW5 A;  1ZIU A;  3HO7 A;  3RUM A;  4F19 A;  4BDL A;  4WED A;  3PUV E;  3PMX A;  3O66 A;  2X7Q A;  2PT2 A;  2QRY A;  2Z8E A;  1FPK A;  5F7V A;  2DYX A;  3PUX E;  1OVB A;  4NX1 A;  3FVN A;  3KGC A;  4QHQ A;  1YAE A;  4KPT A;  4U22 A;  2ZNS A;  2MKZ A;  4QF9 A;  3FZV A;  1B3E A;  4MCO A;  3T96 B;  4RYA A;  1IIT A;  4LP2 B;  3QYT A;  3VLW A;  2Q74 A;  1DSN A;  5T3J A;  3H7M A;  3H06 B;  4LN5 A;  5EQA A;  3KZG A;  1H44 A;  1UTB B;  2B3B A;  4ZS9 A;  1JW1 A;  3N94 A;  1Y3Q A;  2ONK E;  2ZZV A;  4F18 A;  3TEP A;  1B7U A;  5ET6 A;  1B5I A;  2F34 A;  4GOT A;  3B7D A;  1VSO A;  5EYH A;  3UOR A;  3MUQ A;  4I3Y A;  5IZZ A;  1QVS A;  1SVX B;  3M3K A;  3E78 A;  4XF5 A;  5DEX A;  2DSF A;  5DYH A;  4HE1 A;  3U65 A;  4KR5 A;  3MZB A;  3CI8 A;  2PVU A;  3HST A;  2WYK A;  3EKI A;  4PFR A;  1Y4C A;  1QGX A;  2F7B A;  3H4Z A;  4MLQ A;  1DK4 A;  2CEY A;  4GWO A;  3CVG A;  4Q0C A;  1NFT A;  1RDZ A;  2Q2C A;  1FTM A;  2I0B A;  1FPJ A;  4DCY A;  1VR5 A;  4FBP A;  4ZZE A;  3F11 A;  4PP0 A;  3FVK A;  3S2V A;  4X1B A;  5DEX B;  5I3S A;  4NED A;  3UK4 A;  4NQ8 A;  2OWS A;  5ISU A;  1S9T A;  5I59 A;  3RTW B;  4EXL A;  1LBC A;  1M5B A;  4ELR A;  5B70 A;  1BTJ A;  4KI0 E;  5ITO A;  1BLF A;  4PF6 A;  3VE1 B;  4G68 C;  1ZTY A;  2Z22 A;  2REG A;  3DM0 A;  2GH9 A;  2OJT A;  4IO4 A;  1I69 A;  3VLU A;  2V4C A;  1PB9 A;  2CZH A;  2XXH A;  3T9H B;  1SYI A;  3C36 A;  5A5X A;  1EZ9 A;  1NI9 A;  2IA4 A;  4NF0 A;  3QMF A;  3NOH A;  2HAU A;  1MPB A;  4N8Y A;  5AA4 B;  3TMG A;  4ZZA A;  4PBQ A;  3IOR A;  3MBP A;  3U1O A;  2F7A A;  3CRB A;  4OVR A;  3RGY A;  1MRP A;  2ZXT A;  4ECF A;  3SDF A;  2ZMB A;  2VOZ A;  4HS7 A;  4OA4 A;  1B32 A;  1N76 A;  1FBH A;  3IFC A;  2OZZ A;  4OFJ A;  4ZED A;  1T0K A;  3QAX A;  4HE0 A;  4LZ8 A;  3D4G A;  2DQV A;  2O1L A;  4XIG Q;  4LZ5 A;  4YKI A;  1DBZ A;  3K1N A;  4R9G A;  1N3X A;  4KFQ A;  3MPK A;  5IZ3 A;  4BDM A;  2GFE A;  3VXC A;  3TZA A;  4NGU A;  4WXJ A;  2BJI A;  1DPP A;  3DP4 A;  3B6T A;  1H43 A;  4MNI A;  4X48 A;  4LUB A;  5A5X B;  3I5O A;  2V3U A;  1MPC A;  1NNP A;  4PET A;  1GVC A;  4TLL B;  4ZEI A;  1IXC A;  3OO8 A;  2PYY A;  2Y7R A;  1O64 A;  4RNS A;  3IB1 A;  5IKB A;  3A3U A;  1QUL A;  4DXB A;  1LCF A;  4EDP A;  2R71 A;  2DE3 A;  3DEL B;  3E9X A;  2F3D A;  4IO5 A;  5BWJ A;  3SET A;  3A3C A;  4IB2 A;  1A40 A;  4H1X A;  1IIW A;  4GXA A;  4BDQ A;  4XKR A;  3OO7 A;  4OAN A;  4DXC A;  3TCG A;  3E13 X;  4OHN A;  1Q1K A;  2DOJ A;  4PE5 B;  2I3W A;  2FIE A;  4GX4 A;  5H8H A;  2H99 A;  1YPN A;  3HHF A;  5FHN A;  3DP6 A;  4P9K A;  2XX9 A;  4OET A;  2DVC A;  3FVO A;  3Q29 A;  1JET A;  1LBY A;  2X26 A;  5TPA A;  4JVI A;  4N15 A;  4F1Y A;  5AA2 B;  2PCR A;  2QS1 A;  4NAP A;  2XD3 A;  1JVY A;  3R7X A;  4GBV A;  2R9J A;  3FV2 A;  4X04 A;  4GLI A;  3KOS A;  4GF8 A;  3KJT A;  2WEF A;  3GYY A;  5H8H B;  1FQA A;  2VD2 A;  3LSW A;  4EF2 A;  1EZO A;  3VDF A;  4YMA A;  3T66 A;  3S9N C;  4MH5 A;  5JK4 A;  4OEN A;  3SEY A;  4N6P A;  2P1S A;  3FD3 A;  5TPA B;  3DLN A;  5L9M A;  1DOT A;  3RN8 A;  4YB7 A;  4PGN A;  2ZYM A;  2H9B A;  2FVZ A;  1FQD A;  5CBR A;  5JTY A;  5ET7 A;  3PPN A;  4LAT A;  1TWY A;  1IXG A;  1MG1 A;  4DCX A;  1FQC A;  2XXU A;  4ZE8 A;  1JW5 A;  2O6A A;  3OEN A;  3IB0 A;  1B46 A;  3VVF A;  3O2A A;  3O6H A;  2BJJ X;  1OQG A;  5K2Y A;  3LSX A;  5ESY A;  3W9V A;  1N84 A;  1QUJ A;  3TTM A;  3HHG A;  1GV8 A;  1B4Z A;  4FED A;  2DE2 A;  1P99 A;  4O7I A;  4O3B A;  4F3B A;  1HSE A;  2OX3 A;  3H03 A;  3PPP A;  2DVZ A;  2D21 A;  1MM6 A;  2Y5L A;  1IXH A;  4MAG A;  1KA1 A;  1B3G A;  3LSL A;  3KSJ A;  3M8U A;  4YB5 A;  3IAZ A;  3ONM A;  2D5W A;  1AH5 A;  2UYF A;  3RQT A;  1DTZ A;  1LBW A;  2YLN A;  3RNN A;  1SW4 A;  3ISP A;  2Y7K A;  4GFR A;  2ONR A;  4U4S A;  4IY5 A;  1JW4 A;  2NUV A;  4WEP A;  1AL3 A;  1AMF A;  4GL8 A;  5HM4 B;  3MW0 A;  4NG7 A;  4N6K A;  5I56 A;  3FJG A;  2V93 A;  3K02 A;  3U93 A;  1SI0 A;  1PB8 A;  4IO2 A;  3H6T A;  4YIC A;  1OVT A;  3TYH A;  3IB2 A;  2ALU A;  5BUU A;  4F29 A;  2Q9T A;  4Q8R A;  3LR1 A;  2F7C A;  2XHD A;  3PUY E;  5CBS A;  1MH4 A;  2H5Y A;  4MIJ A;  3QXM A;  3TKD A;  4DDD A;  4RXL A;  4PFW A;  4O3A A;  2QS2 A;  3KOT A;  1Y20 A;  2Y7W A;  5EYF A;  4ELO A;  3B50 A;  3FUZ A;  2XXQ A;  4RA1 A;  1DTG A;  1K9Y A;  1H3D A;  1JQF A;  1Y3N A;  3TTR A;  3K6X A;  3VVD A;  5I56 B;  2XA5 A;  2F8D A;  4U1Z A;  3N5L A;  5ICQ A;  4POX A;  3E3K A;  3HCQ A;  3Q25 A;  2O68 A;  5I58 A;  3ZKL A;  5LTC A;  1YZ0 A;  4NF5 A;  3RPW A;  3MP1 A;  4YMB A;  1R9L A;  4R6H A;  4QXD A;  2DWA A;  4R2B A;  4EF1 A;  2XWI A;  3FIR A;  4ISU A;  2XXW A;  1SYH A;  1ELJ A;  3ZSF A;  2XXI A;  1UQW A;  4ESX A;  1MXW A;  4NHB A; 
#chains in the Genus database with same CATH homology
 4R74 A;  1NKX A;  2VD3 A;  4F1U A;  4HTG A;  4R73 A;  3FV1 A;  1B40 A;  1A7L A;  1LAX A;  5I58 B;  4XKN A;  1QJM A;  4OFO A;  4QFK A;  4H65 A;  3B6W A;  2DWH A;  4NF5 B;  1RYX A;  1B1X A;  3IR1 A;  2VGQ A;  3K4U A;  4R72 A;  4Q5T A;  2V25 A;  1XT8 A;  3LBS A;  2NOO A;  4FOR A;  2RKM A;  3CSG A;  2H98 A;  1US5 A;  1IEJ A;  4QSE A;  3MPL A;  2O51 A;  2QMX A;  2OLB A;  4NF8 B;  4G8H A;  4Z0I A;  5H8Q A;  1UIV A;  4IO6 A;  2O84 X;  3UA8 A;  3TDJ A;  4LQ5 A;  4YKK A;  4OQO A;  2KLF A;  1LAF E;  4FEB A;  3S9M C;  1PB7 A;  4XTC Q;  3FAT A;  3E4R A;  3H6W A;  4OFL A;  3IO6 A;  2XX7 A;  1FQB A;  2RIN A;  1A55 A;  4QRZ A;  4H6D A;  3Q26 A;  4OZ9 A;  2Q89 A;  5CC2 A;  3QSL A;  5KZT A;  4NMY A;  5H8Q B;  4DE8 A;  1US4 A;  1BP5 A;  2DXY A;  4KHZ E;  1B3H A;  5J1D A;  3ILT B;  1ZBM A;  4OTE A;  4RK9 A;  1IZ1 A;  1OMP A;  4G8N A;  3OMB A;  2W7Y A;  2ZNU A;  2O7U A;  4R6K A;  1WDN A;  1R6Z A;  3EN3 A;  2CMO A;  1N3W A;  4LA9 A;  1B7Z A;  1OIB A;  2YJP A;  3PPO A;  1BIY A;  3KG2 A;  3EHU A;  4FAT A;  1IUD A;  3LC8 A;  3N26 A;  2Y84 A;  4PQJ A;  3CSB A;  5AA4 A;  3G3K A;  4MBP A;  3LSF B;  4BLA A;  4G68 B;  3TTN A;  1JVX A;  4MLV A;  1FTO A;  1B9J A;  4ELQ A;  1B5J A;  3M3F A;  2B3F A;  4OYV A;  1XVY A;  1IXI A;  4KYD A;  4C1T A;  4LVQ A;  1NH8 A;  1LB9 A;  3C33 A;  1D9V A;  3CG1 A;  2F5X A;  4K3F A;  3C9H A;  1HSJ A;  3SEX A;  1FTJ A;  5L9O A;  4PFT A;  5I2N A;  1QKB A;  4JBZ A;  3G3F A;  4ONY A;  3K1M A;  2XXY A;  3FXU A;  4ELP A;  1I6B A;  2I49 A;  3O97 A;  3V8X B;  2QL3 A;  2B65 A;  1CB6 A;  4YAH X;  4I1D A;  2V3Q A;  5I2K A;  2I58 A;  3L6G A;  1MDP 1;  3IOU A;  3PD9 A;  3BBR A;  1FQF A;  3RT8 A;  4OES A;  4M1V A;  3IOV A;  1S50 A;  5I2N B;  3O28 A;  2AL5 A;  1MQI A;  2QJE A;  1B51 A;  4GD5 A;  1EZP A;  3OO6 A;  3K01 A;  4E0X A;  1MS7 A;  4JWX A;  4JXI A;  2PMS A;  3G3G A;  2IEE A;  2XXR A;  5AA2 A;  2DXR A;  4RPN A;  4NWC A;  1R1N A;  1II5 A;  1Y1M A;  3K2D A;  1Q35 A;  4KCD A;  5I2K B;  1D9Y A;  1USY H;  1QUI A;  4JB7 A;  1USY E;  4LZ7 A;  3U72 A;  3TUS A;  3PUZ E;  4QSD A;  5DVF A;  3EQ1 A;  4U2R A;  2G29 A;  1N7X A;  1YTV A;  2GHA A;  2I4C A;  2GRV A;  2Z8F A;  4F1V A;  4P0G A;  3DP8 A;  4GQO A;  3QIM A;  3KBR A;  1GGG A;  3VLV A;  2OCU A;  4ZEF A;  4POW A;  1NH7 A;  4G77 A;  3UP9 A;  4H5G A;  1RKM A;  1NNT A;  3FAS A;  4EQB A;  1UTH A;  2Y7I A;  1MH3 A;  1JEV A;  1M5C A;  2R6G E;  1URG A;  3EHT A;  3AXF A;  5H8S A;  4L17 A;  2RCA A;  3TQL A;  1ATG A;  3D4C A;  3EF7 A;  2E1S A;  1LCT A;  1XC1 A;  1B05 A;  1B6H A;  1MY4 A;  2OWT A;  1SBP A;  3OEL A;  1B3F A;  5EHM A;  2XXV A;  1JNF A;  3OEK A;  2OBG A;  3OXN A;  4F3G A;  3FXQ A;  1QUK A;  3PV0 E;  3SEU A;  1IQ7 A;  2F6P A;  4I62 A;  3K0V A;  1UTH B;  4ZE9 A;  5ITP A;  3L6H A;  2HZK A;  5AE4 A;  3GBA A;  5CRY A;  4ND9 A;  5B7D A;  3M3L A;  4NWD A;  3PPQ A;  1DPE A;  1YCJ A;  4NF6 A;  4H8J A;  3I3V A;  4KCC A;  2ABH A;  3T9V A;  4HW8 A;  5DVI A;  4RK2 A;  3CFX A;  1POT A;  2QMW A;  2FYI A;  1LST A;  1URD A;  2AYS A;  2PX1 A;  1PBQ A;  3IOW A;  1TT1 A;  4OWD A;  4OVJ A;  2XXT A;  2E0S A;  4EQ7 A;  3TTK A;  1MY0 A;  2I0C A;  3Q27 A;  3TOD A;  1B52 A;  3QK6 A;  1A54 A;  4JWY A;  1B5H A;  4R6Y A;  1D3K A;  1WVJ A;  4NF6 B;  1QW0 A;  2Z23 A;  2LAO A;  3G7W A;  5CM6 A;  3OSR A;  4FIM A;  4MFI A;  1MXU A;  2HZL A;  2O69 A;  3C34 A;  2ZYK A;  2XXX A;  1MPD A;  3IOT A;  1XS5 A;  1B4H A;  3U92 A;  4IO3 A;  1MQH A;  2UVI A;  3V5A A;  3VXB A;  3VFJ A;  3KSX A;  2D3I A;  4LON B;  2DS9 A;  4I8C A;  2RC9 A;  2WKY A;  1B3L A;  4F31 B;  3T22 A;  2XX8 A;  4AB6 A;  4FE8 A;  4QFN A;  3JV9 A;  3MP6 A;  4YKP A;  3K6V A;  3IL1 B;  4RPO A;  1LFG A;  1D4N A;  1Y9U A;  2HEU A;  4ESW A;  3TCH A;  3R26 A;  4H0W A;  1Y1Z A;  2Q2A A;  2A5T A;  3LUY A;  1CE2 A;  4KQP A;  3UN6 A;  3TPA A;  4FEC A;  3O6I A;  3SES A;  3IJO B;  3H6U A;  2VHA A;  1MY3 A;  4NF8 A;  3MJN A;  3MVX A;  3TTL A;  4F22 A;  1B0L A;  2Q88 A;  1B1H A;  4I9D A;  1MM7 A;  1PDA A;  3QUJ A;  4XKQ A;  3FJ7 A;  1AIV A;  2ZYN A;  3TAJ A;  3RTF B;  3SEW A;  1NNK A;  3FXR A;  5L9S A;  2F36 A;  2OK2 A;  2ANJ A;  3WAF A;  3PU5 A;  4GRK A;  3OOA A;  2A5T B;  1M5E A;  1SQY A;  4BDR A;  2P2A A;  3A09 A;  1Z7N E;  4X1D A;  4OXV A;  3OO9 A;  4IGT A;  1NL5 A;  1PEB A;  5KCJ B;  3SER A;  1N04 A;  4F39 A;  4AQ4 A;  1Y4T A;  4NE4 A;  2ESN A;  5LOM A;  4GXS B;  2RF1 A;  4FAJ A;  4U21 A;  3B6Q A;  3C35 A;  4QSC A;  3CFZ A;  2F78 A;  2PBW A;  3P7I A;  2THI A;  4DLD A;  3T9U A;  2QPQ A;  5FTI A;  1ZU0 A;  3N6U A;  4YB6 A;  4Q30 B;  3C31 A;  3K1P A;  1SDX A;  5DTB A;  3FGS A;  4G68 A;  2DP8 A;  1I6A A;  3CIJ A;  5K2X A;  3TCF A;  3O29 A;  2VP1 A;  5CI5 A;  5AA2 D;  4OER A;  2HCA A;  2V3T A;  5ELV A;  2QSX A;  3KJ7 A;  3MC2 A;  4EUO A;  3C4M A;  4QFP A;  4C1U A;  5FHM A;  3U8Q A;  1POY 1;  2AL4 A;  4YZZ A;  4N13 A;  1I6Q A;  1MDQ A;  4TOZ A;  3QUF A;  3G3I A;  3OSQ A;  5H8F A;  2UVH A;  2HFB A;  2CZL A;  1OQH A;  1Z7M E;  1A99 A;  1URS A;  1LFI A;  2UVG A;  4EXK A;  1OLC A;  4XXU A;  4HCY A;  4U1O A;  2F97 A;  4UA8 A;  4HCW A;  3ECR A;  2FA7 A;  2F35 A;  1BKA A;  3UIF A;  1TFD A;  3G3H A;  4ZEC A;  1XHY A;  3TEL A;  5TP9 A;  3HPI A;  4IY6 A;  1R9Q A;  1TXF A;  5H8F B;  2O1M A;  4N07 A;  2XXP A;  1LGB C;  1ANF A;  5M2V A;  3O9P A;  3IX1 A;  3IK6 B;  3FVG A;  1FTL A;  4DIG A;  1FTK A;  1H76 A;  2I3V A;  4RJZ A;  2DWI A;  4KYS A;  4OMB A;  1FCK A;  3MAM A;  1ZKB A;  4FJP A;  5I59 B;  4Z7E A;  5TP9 B;  4GIZ A;  3W15 C;  3GBB A;  3RY3 A;  1MXX A;  5I84 A;  4H67 A;  4QFL A;  3MVZ A;  1F9B A;  2NVU B;  4H8I A;  1L5T A;  3ZKK A;  2H4I A;  3RLF E;  5FTH A;  4THI A;  3EHS A;  3JZJ A;  3MZ9 A;  3MQ9 A;  4DXU A;  1P1W A;  5CMC A;  4JSO A;  1GTK A;  3FJM A;  3GLB A;  3ZS6 A;  2XD2 A;  3S9E A;  2I4B A;  1LFH A;  2H25 A;  1MY2 A;  3ODB A;  2REJ A;  4KD5 A;  1UIU A;  4PFY A;  5TU0 A;  4F2O A;  3MP8 A;  4C0R A;  3BKI B;  3H3G A;  1QKA A;  1MXV A;  1N0T A;  1O63 A;  3OD7 A;  2I6E A;  3UGW A;  3S9L C;  1M5F A;  3MVY A;  1LBB A;  4F3P A;  1P1U A;  5HPQ A;  2FNC A;  1EH3 A;  4NF4 A;  3KN3 A;  2M8C A;  4JSD A;  5CMB A;  4JWO A;  4ZEB A;  4DZ1 A;  3V89 B;  2YPN A;  1MQG A;  2UYE A;  4QFO A;  3H6V A;  1PBP A;  3I6V A;  3IO4 A;  3RT6 B;  2HQ0 A;  1RYO A;  3CFL A;  4F2Q A;  3K00 A;  1MQJ A;  3OEM A;  5CMM A;  1SW1 A;  2AIX A;  3MZ1 A;  4AB5 A;  1MQD A;  3K6U A;  4GVO A;  2F6G A;  1KWH A;  3V83 A;  1B0H A;  4NF4 B;  3KFM A;  5AA3 A;  1P1N A;  5F1Q A;  4R75 A;  1ZJL A;  5KDT A;  2ONS A;  4RY1 A;  1B58 A;  3USD A;  1PC3 A;  5DVJ A;  1A8F A;  1NNF A;  2RCB A;  1NMU A;  3R6U A;  3C32 A;  2Q8J A;  3N6T A;  5EHS A;  3VV5 A;  3CG3 A;  4LQ2 A;  1VFE A;  3O6G A;  1P1O A;  1WOD A;  4G2Z A;  3K6W A;  4OEV A;  1P1Q A;  4P11 A;  2ZYO A;  3KN8 A;  3T93 B;  3GXA A;  1TFA A;  2V84 A;  1DMB A;  3PMW A;  5AA1 A;  2O7I A;  5CMK A;  5KDT B;  1S7Y A;  1B7H A;  1HSL A;  3HN0 A;  1XOC A;  1JEU A;  2A5S A;  3VVE A;  3TQW A;  1SI1 A;  2P0S A;  5JTY B;  4WKM A;  4F3S A;  2DWJ A;  3THI A;  2DE4 A;  3WAE A;  1OLA A;  3HV1 A;  4EQ9 A;  1N7W A;  4XKP A;  4YKJ A;  3U94 A;  2I48 A;  4IGR A;  1H45 A;  1LAH E;  5IAI A;  2Y7P A;  4PFU A;  1A8E A;  4G4P A;  4YU0 A;  2NWJ A;  2G93 A;  4H5F A;  2QS3 A;  3CR9 A;  4R2F A;  2RC7 A;  5H8N A;  3KN7 A;  4G8M A;  1ZMG A;  1FW0 A;  4ZDM A;  5ICT A;  1MXY A;  3TFL A;  1ZLQ A;  2RC8 A;  4GL0 A;  1Y3P A;  4M4G A;  1VFD A;  4O3C A;  2NXO A;  4BDN A;  2Z8D A;  1J1N A;  1MXZ A;  4UAC A;  2QS4 A;  4TQU Q;  1FQE A;  4BDO A;  1VE4 A;  1AOV A;  5JEI A;  3GZG A;  3SKP A;  3PPR A;  3PD8 A;  3PGF A;  2HXW A;  3MWB A;  1SW2 A;  3T9X B;  5L8D A;  2PT1 A;  5FHO A;  3W9W A;  3KEI A;  2GHB A;  5H8N B;  1SD3 A;  3G3J A;  3PMV A;  3MVW A;  5HBC A;  1MY1 A;  4IO7 A;  5I57 A;  4R9F A;  5DT6 A;  1GR2 A;  4X9T A;  4MF3 A;  4U4X A;  3Q28 A;  5KCJ A;  3IJX B;  2HAV A;  3ILU B;  4P0I A;  1XVX A;  4ZEK A;  4NTL A;  1LAG E;  1EU8 A;  2X7P A;  2ZNT A;  4OEU A;  1M5D A;  3SEV A;  4JDF A;  4E0W A;  3BFT A;  3EPE A;  1LLS A;  1B2H A;  2UVJ A;  4TLM B;  2UXA A;  1LB8 A;  3PUW E;  5I57 B;  4KYE A;  4U23 A;  1O7T A;  3BFU A;  3S4U A;  3JYR A;  1UTB A;  1SW5 A;  1ZIU A;  3HO7 A;  3RUM A;  4F19 A;  4BDL A;  4WED A;  3PUV E;  3PMX A;  3O66 A;  2X7Q A;  2PT2 A;  2QRY A;  2Z8E A;  5F7V A;  2DYX A;  3PUX E;  1OVB A;  3FVN A;  3KGC A;  4QHQ A;  1YAE A;  4KPT A;  4U22 A;  2ZNS A;  4QF9 A;  3FZV A;  1B3E A;  3T96 B;  4RYA A;  1IIT A;  4LP2 B;  3QYT A;  3VLW A;  1DSN A;  3H7M A;  3H06 B;  3KZG A;  1H44 A;  1UTB B;  2B3B A;  4ZS9 A;  1JW1 A;  3N94 A;  1Y3Q A;  2ONK E;  4F18 A;  3TEP A;  1B7U A;  1B5I A;  2F34 A;  4GOT A;  3B7D A;  1VSO A;  3UOR A;  3MUQ A;  1QVS A;  1SVX B;  3M3K A;  5DEX A;  2DSF A;  5DYH A;  4KR5 A;  3MZB A;  3CI8 A;  2PVU A;  3HST A;  1Y4C A;  2F7B A;  3H4Z A;  4MLQ A;  4GWO A;  3CVG A;  4Q0C A;  1NFT A;  2Q2C A;  1FTM A;  2I0B A;  4DCY A;  1VR5 A;  4ZZE A;  3F11 A;  4PP0 A;  3FVK A;  3S2V A;  4X1B A;  5DEX B;  4NED A;  3UK4 A;  2OWS A;  5ISU A;  1S9T A;  5I59 A;  3RTW B;  4EXL A;  1LBC A;  1M5B A;  4ELR A;  5B70 A;  1BTJ A;  4KI0 E;  5ITO A;  1BLF A;  3VE1 B;  4G68 C;  1ZTY A;  2Z22 A;  2REG A;  3DM0 A;  2GH9 A;  2OJT A;  4IO4 A;  1I69 A;  3VLU A;  1PB9 A;  2XXH A;  3T9H B;  1SYI A;  3C36 A;  5A5X A;  1EZ9 A;  2IA4 A;  2HAU A;  1MPB A;  5AA4 B;  3TMG A;  4ZZA A;  3IOR A;  3MBP A;  3U1O A;  2F7A A;  3CRB A;  3RGY A;  1MRP A;  2ZXT A;  4ECF A;  3SDF A;  2ZMB A;  2VOZ A;  4HS7 A;  1B32 A;  1N76 A;  2OZZ A;  4OFJ A;  4ZED A;  1T0K A;  3QAX A;  4LZ8 A;  3D4G A;  2DQV A;  2O1L A;  4XIG Q;  4LZ5 A;  4YKI A;  3K1N A;  4R9G A;  1N3X A;  4KFQ A;  3MPK A;  4BDM A;  2GFE A;  3VXC A;  3TZA A;  4WXJ A;  1DPP A;  3DP4 A;  3B6T A;  1H43 A;  4X48 A;  4LUB A;  5A5X B;  3I5O A;  2V3U A;  1MPC A;  1NNP A;  4PET A;  1GVC A;  4TLL B;  4ZEI A;  1IXC A;  3OO8 A;  2PYY A;  2Y7R A;  1O64 A;  4RNS A;  3IB1 A;  5IKB A;  3A3U A;  1QUL A;  4DXB A;  1LCF A;  4EDP A;  2R71 A;  2DE3 A;  3DEL B;  3E9X A;  4IO5 A;  5BWJ A;  3SET A;  3A3C A;  4IB2 A;  1A40 A;  4H1X A;  1IIW A;  4GXA A;  4BDQ A;  4XKR A;  3OO7 A;  4DXC A;  3TCG A;  3E13 X;  4OHN A;  1Q1K A;  2DOJ A;  4PE5 B;  2I3W A;  5H8H A;  2H99 A;  1YPN A;  3HHF A;  5FHN A;  3DP6 A;  2XX9 A;  4OET A;  2DVC A;  3FVO A;  3Q29 A;  1JET A;  2X26 A;  5TPA A;  4F1Y A;  5AA2 B;  2QS1 A;  2XD3 A;  1JVY A;  3R7X A;  2R9J A;  3FV2 A;  4GLI A;  3KOS A;  4GF8 A;  3KJT A;  5H8H B;  1FQA A;  2VD2 A;  3LSW A;  4EF2 A;  1EZO A;  3VDF A;  4YMA A;  3T66 A;  3S9N C;  4MH5 A;  5JK4 A;  4OEN A;  3SEY A;  4N6P A;  2P1S A;  3FD3 A;  5TPA B;  3DLN A;  5L9M A;  1DOT A;  3RN8 A;  4YB7 A;  2ZYM A;  2H9B A;  1FQD A;  5CBR A;  5JTY A;  3PPN A;  4LAT A;  1TWY A;  1IXG A;  1MG1 A;  4DCX A;  1FQC A;  2XXU A;  4ZE8 A;  1JW5 A;  2O6A A;  3OEN A;  3IB0 A;  1B46 A;  3VVF A;  3O2A A;  3O6H A;  2BJJ X;  1OQG A;  5K2Y A;  3LSX A;  3W9V A;  1N84 A;  1QUJ A;  3TTM A;  3HHG A;  1GV8 A;  1B4Z A;  4FED A;  2DE2 A;  1P99 A;  4O3B A;  4F3B A;  1HSE A;  3H03 A;  3PPP A;  2DVZ A;  2D21 A;  1MM6 A;  1IXH A;  1B3G A;  3LSL A;  3KSJ A;  3M8U A;  4YB5 A;  3IAZ A;  3ONM A;  2D5W A;  1AH5 A;  2UYF A;  3RQT A;  1DTZ A;  2YLN A;  3RNN A;  1SW4 A;  2Y7K A;  4GFR A;  2ONR A;  4U4S A;  1JW4 A;  4IY5 A;  2NUV A;  4WEP A;  1AL3 A;  1AMF A;  4GL8 A;  5HM4 B;  3MW0 A;  5I56 A;  3FJG A;  2V93 A;  3K02 A;  3U93 A;  1SI0 A;  1PB8 A;  4IO2 A;  3H6T A;  4YIC A;  1OVT A;  3TYH A;  3IB2 A;  2ALU A;  5BUU A;  4F29 A;  2Q9T A;  4Q8R A;  3LR1 A;  2F7C A;  2XHD A;  3PUY E;  5CBS A;  1MH4 A;  2H5Y A;  3QXM A;  3TKD A;  4DDD A;  4RXL A;  4PFW A;  4O3A A;  2QS2 A;  4ELO A;  1Y20 A;  2Y7W A;  5EYF A;  3KOT A;  3FUZ A;  2XXQ A;  4RA1 A;  1DTG A;  1H3D A;  1JQF A;  1Y3N A;  3TTR A;  3K6X A;  3VVD A;  5I56 B;  2F8D A;  4U1Z A;  3N5L A;  5ICQ A;  4POX A;  3E3K A;  3HCQ A;  3Q25 A;  2O68 A;  5I58 A;  3ZKL A;  4NF5 A;  3RPW A;  3MP1 A;  4YMB A;  1R9L A;  4R6H A;  4EF1 A;  2DWA A;  4R2B A;  3FIR A;  4ISU A;  2XXW A;  1SYH A;  1ELJ A;  3ZSF A;  2XXI A;  1UQW A;  4ESX A;  1MXW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...