2B3FA

Thermus thermophilus glucose/galactose binding protein bound with galactose
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
392
structure length
392
Chain Sequence
MKLEIFSWWAGDEGPALEALIRLYKQKYPGVEVINATVTGGAGVNARAVLKTRMLGGDPPDTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLQAFPKGLIDLISYKGGIWSVPVNIHRSNVMWYLPAKLKGWGVNPPRTWDKFLATCQTLKQKGLEAPLALGENWTQQHLWESVALAVLGPDDWNNLWNGKLKFTDPKAVRAWEVFGRVLDCANKDAAGLSWQQAVDRVVQGKAAFNIMGDWAAGYMTTTLKLKPGTDFAWAPSPGTQGVFMMLSDSFGLPKGAKNRQNAINWLRLVGSKEGQDTSNPLKGSIAARLDSDPSKYNAYGQSAMRDWRSNRIVGSLVHGAVAPESFMSQFGTVMEIFLQTRNPQAAANAAQAIADQVGLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The crystal structure of a thermophilic glucose binding protein reveals adaptations that interconvert mono and di-saccharide binding sites.
pubmed doi rcsb
source organism Thermus thermophilus hb27
molecule tags Sugar binding protein
molecule keywords glucose-binding protein
total genus 155
structure length 392
sequence length 392
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2b3fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2b3fA02
3B6TA 3Q25A 1R6ZA 1JEVA 1EZ9A 3UORA 1LAHE 4ISUA 1ZTYA 4M1VA 2XXWA 3TODA 3UK4A 1HSLA 1MXUA 1Y3PA 4F2OA 4EXKA 4QFOA 4UA8A 2AL4A 2R9JA 3H03A 1VE4A 4R9FA 4F1UA 4JWOA 1EU8A 1DMBA 4TOZA 1BKAA 3V8XB 5I56B 1JW4A 1PB8A 3OELA 5AA2A 1OLCA 1F9BA 1EZPA 3A09A 3T9XB 3W9VA 4IO2A 2CMOA 1OQHA 2ABHA 3PU5A 3L6GA 3PUVE 3SEYA 1Y4CA 3FXUA 1A8FA 2G93A 2UXAA 2Z22A 1MY3A 3H06B 5TU0A 3RUMA 3KOTA 4IO4A 2H99A 2D21A 1Z7NE 2OZZA 2Q2CA 2R6GE 1DOTA 4RK2A 3S9NC 2VOZA 1B3LA 4QRZA 3H6TA 3IAZA 4YB5A 1Y3QA 2O6AA 4POWA 4KQPA 2ZXTA 2ONKE 1T0KA 4X48A 4LQ5A 3I6VA 5H8QB 3S9MC 1UQWA 4Q5TA 4C1TA 2E1SA 1FW0A 2CZLA 3K0VA 2DE2A 4MFIA 4I1DA 5I59B 4H8IA 3QK6A 3JV9A 4NF8A 2P2AA 2REJA 3HV1A 3UP9A 2HXWA 4ZE8A 4GVOA 3RNNA 4OYVA 5HPQA 3O9PA 5HBCA 4MLQA 4K3FA 5FTIA 4N6PA 4FATA 1Y1ZA 2VGQA 3R26A 3MW0A 3IORA 3FIRA 2XXYA 1M5FA 3IL1B 2THIA 4JSDA 4Z7EA 3CFXA 1UTBB 1GGGA 4DXCA 1LCTA 5AA4B 5F1QA 3BFUA 1N0TA 1JETA 1N7WA 3PUZE 3T9UA 4YMBA 5F7VA 3O2AA 1SDXA 1S7YA 1ZKBA 4H5GA 4QF9A 3V83A 1JW1A 4GFRA 1FTJA 4JXIA 2XXQA 4ZS9A 1N04A 2UYEA 3KJTA 4L17A 5FHMA 1Y9UA 2H98A 1URGA 3MVWA 4Q30B 4U23A 1B2HA 4F3BA 3MJNA 2PYYA 1H44A 3OSQA 1JQFA 3IB0A 1IQ7A 1QUJA 5H8FA 3TELA 4G8NA 1B32A 4BDQA 3EF7A 4KI0E 2I58A 3SDFA 3TKDA 4ELQA 1EH3A 1B51A 5AA3A 4HS7A 3PUYE 5ITPA 1YTVA 1XVXA 2E0SA 4WKMA 4U2RA 4GIZA 4XKRA 3TEPA 2R71A 5K2XA 4GD5A 3DLNA 1B3FA 4O3AA 5EHSA 4BDOA 3MP1A 4RNSA 4OFLA 3KBRA 3M8UA 1FTLA 4PFUA 3S9EA 1A7LA 3M3KA 4R9GA 3VFJA 4WEPA 1AMFA 1MM6A 4YKIA 1EZOA 4X1BA 1MS7A 1MQDA 3C36A 4PFWA 4RYAA 3S4UA 3U8QA 5DEXA 4EF2A 2F97A 4NWCA 4X1DA 1B46A 2I4BA 3FVGA 3MP6A 2UVHA 4G68A 2Z8DA 5H8NA 4C1UA 5I57A 3TTMA 1LBCA 3Q27A 2UVGA 1LBBA 4HTGA 4OFOA 1OIBA 1TWYA 1ZJLA 2RKMA 4F18A 1SW2A 5JEIA 1P1QA 4OETA 5JTYA 3VVDA 3KN8A 4AB5A 1B05A 1LSTA 2X7PA 2AL5A 3CFLA 3OO7A 2DVZA 2ZYNA 2NOOA 1OQGA 4OVJA 4YKJA 4DIGA 5A5XB 4F19A 2Y7IA 4G2ZA 3TUSA 2O1LA 3FJ7A 4F3PA 1HSJA 3A3CA 3QYTA 3FV1A 3TQLA 3MPLA 2XXTA 1URSA 4JSOA 3SKPA 1URDA 3KSXA 2DE3A 3K6XA 3KN7A 1M5EA 1IXCA 4JDFA 3CIJA 1AOVA 2F6PA 2Y7PA 3DP8A 1M5DA 5CC2A 3ILTB 3IO6A 1FCKA 5CM6A 3VVEA 4GXSB 5I2NB 1AL3A 4OMBA 2DYXA 2IEEA 3ODBA 3HPIA 1LB8A 3WAFA 2OWSA 1QW0A 4MLVA 4OFJA 2ANJA 5I84A 3PMXA 5CMMA 3LC8A 4IO3A 4KHZE 4KR5A 4P0GA 2V93A 1LFIA 2QL3A 2Y84A 3MZBA 1OLAA 3BBRA 3G3KA 4MBPA 2QJEA 1A55A 4NEDA 4R6YA 1FTKA 2I6EA 4U1ZA 3CFZA 4EQ7A 1MH3A 2DVCA 3FZVA 1MPCA 1BP5A 5ICQA 4BDLA 4NWDA 4OHNA 1IZ1A 5H8QA 2HCAA 3U92A 4FAJA 5TP9A 3G3IA 2A5TB 4EQ9A 2OBGA 3EQ1A 5KDTB 3MP8A 3V89B 2DWAA 4P11A 1H76A 4DZ1A 5CRYA 2REGA 4QFLA 3KZGA 2XXRA 4FEBA 4GL8A 1TT1A 3OEMA 4ZEDA 2Z8EA 1DPEA 1WDNA 1SW1A 1MY4A 2I0BA 1FQFA 2Q88A 2QMWA 3C35A 3IB2A 3IJOB 3K2DA 3KN3A 3L6HA 3RTWB 5L9SA 1XOCA 2VHAA 2O68A 1GTKA 1M5BA 1NH8A 4YKKA 2ALUA 1UTHB 4PQJA 3DP4A 1SBPA 3U1OA 1AIVA 2F5XA 4EDPA 2V3TA 3IK6B 5I2NA 1XS5A 4KCDA 4XTCQ 1IXHA 3S2VA 4QSEA 5CI5A 4Q8RA 2RC7A 3PPPA 3KG2A 3MVYA 4IB2A 3QUJA 1B5JA 4ZEIA 2XXPA 2F34A 2XXIA 2ZMBA 2ZNTA 3OSRA 3C31A 3O29A 2F6GA 2O1MA 4FJPA 4KPTA 1MY0A 4F3SA 3RTFB 3HSTA 5A5XA 3K00A 1ZIUA 3TZAA 1US4A 3PPQA 4RPOA 1O7TA 3OXNA 4NF6A 5H8FB 3FGSA 4R6HA 2DE4A 1PBQA 3OO9A 4YKPA 4GXAA 4NE4A 1A40A 4F31B 3PUWE 5KDTA 5FHOA 1ATGA 5CMBA 1SW5A 3HHGA 1H45A 1GV8A 2RC8A 2UYFA 3JYRA 5M2VA 3T9HB 1N3WA 1VR5A 3CI8A 3GBBA 3PD8A 5JK4A 4GQOA 3RLFE 2I48A 1POTA 1B0HA 2I3WA 2Z8FA 2H25A 4LA9A 2QS4A 4ZEKA 3TTNA 4F29A 4DXUA 3RPWA 2H5YA 3P7IA 1NFTA 2Y7WA 4BDRA 4R2FA 3LSLA 1B1XA 2O51A 1JVXA 3LSXA 3LSWA 3G3FA 4OWDA 4WEDA 1ANFA 2DWJA 4O3CA 1GVCA 1TFDA 1B3GA 3DELB 3W15C 4DLDA 4R74A 5FTHA 3USDA 1B0LA 1XVYA 1NH7A 1B40A 4R75A 5AA1A 3ZS6A 4F1VA 4U1OA 3U94A 4R73A 4DXBA 3FD3A 4LVQA 5AA2B 4ZE9A 3LR1A 3KOSA 2QS2A 3RQTA 1NKXA 1TFAA 3WAEA 4RPNA 2ONRA 4ELPA 4ND9A 1FQAA 3N5LA 3SESA 1QKBA 4H67A 3OO6A 1MM7A 2D3IA 2O69A 1LLSA 3H7MA 3VLVA 5CBRA 4RA1A 1JW5A 4P0IA 5AA2D 2V3QA 2QMXA 4IGRA 4E0WA 2NWJA 1MPBA 4THIA 4YAHX 4GRKA 4GWOA 1I69A 1UIVA 1XHYA 1QUIA 1D9YA 2ESNA 4WXJA 3EHSA 2X7QA 3K6UA 3N6UA 4KFQA 4XKQA 1LAXA 3DP6A 3ILUB 3QAXA 4FE8A 3MWBA 4KYEA 1A99A 1CE2A 1Y4TA 3RN8A 4PETA 1B4HA 1NNFA 3C32A 2ZYMA 3O6HA 1Y20A 1PDAA 2DS9A 3CSGA 4ELOA 5H8SA 4G8MA 2DP8A 1XC1A 5I56A 3IOTA 1ZMGA 1LB9A 1LCFA 4N13A 2I0CA 2Z23A 3CVGA 1ZLQA 3K6WA 4E0XA 5KCJA 4EUOA 2Q9TA 1Y1MA 2F8DA 3K02A 3ZKKA 3AXFA 3KEIA 3TYHA 2QS1A 1B7HA 3FVOA 2RCAA 3BFTA 4OTEA 2RF1A 3MQ9A 1IITA 4GL0A 5DEXB 3VE1B 3QIMA 3SEXA 1D9VA 1GR2A 1MY1A 5H8NB 1IEJA 2ZYKA 3ONMA 1USYE 2PMSA 2FA7A 3FJMA 4YU0A 1IIWA 2UVJA 4IGTA 3TAJA 4NMYA 2QS3A 2RCBA 3CSBA 3G3HA 3E3KA 3OD7A 3PPRA 1SYHA 5ICTA 1RYOA 2D5WA 4H6DA 4PFYA 4TQUQ 3TTKA 4IY6A 4X9TA 3N6TA 1FTMA 4NF4A 1AH5A 5KZTA 4FEDA 2G29A 3I3VA 2BJJX 2F36A 2FYIA 2V25A 2VD2A 2NXOA 3BKIB 3LUYA 3TDJA 4PE5B 4I62A 5B70A 2Q8JA 2DOJA 2IA4A 1B58A 2PBWA 3CR9A 2O7IA 1Z7ME 1WODA 4G4PA 4OESA 4RK9A 4R2BA 3OMBA 3E9XA 4N07A 3H6WA 1P1NA 3O97A 3QXMA 4EXLA 1B5IA 3M3LA 1SQYA 3UGWA 5IAIA 3PD9A 2ZYOA 2NUVA 1JNFA 3A3UA 3PMWA 3R7XA 3SEUA 4F2QA 5DVFA 2VD3A 4NF6B 3IOVA 2FNCA 3TCHA 3JZJA 2OK2A 3F11A 1MRPA 1QJMA 5KCJB 1JEUA 3GXAA 3IB1A 1OVBA 2OCUA 3N26A 4IO7A 2XD2A 3MVXA 3VLWA 3FXRA 4GOTA 2HEUA 3PUXE 1MDQA 4QSCA 4Z0IA 1NNKA 2DSFA 4KCCA 3U93A 2XXVA 3HCQA 3CG1A 3VXCA 3FUZA 4ECFA 3CG3A 4HCYA 1FTOA 3B6WA 2I3VA 3ZSFA 1PC3A 3O6GA 5DVJA 4RY1A 1VFEA 5L9MA 4H5FA 4UACA 2Y7KA 1MY2A 4NF4B 1FQBA 4ZZAA 3U72A 3UN6A 2RINA 4AQ4A 4C0RA 1PB7A 4LUBA 4G68C 1XT8A 1OVTA 1SI0A 2O84X 2I4CA 4LZ8A 4NF5B 5B7DA 2YPNA 3E13X 3EN3A 3M3FA 1NL5A 1N76A 3T66A 4YZZA 4QHQA 3V5AA 5I57B 1LAGE 4OZ9A 3MBPA 1YPNA 1ZU0A 3C34A 4PP0A 3VVFA 1IXGA 3IX1A 1Q1KA 1YCJA 3R6UA 4Q0CA 1MXXA 3Q26A 3ZKLA 5I58B 5CMKA 2O7UA 4IY5A 1I6AA 1P99A 1SW4A 1B3EA 1Y3NA 2RC9A 1B7ZA 3FVNA 2H9BA 3MAMA 3KGCA 4GLIA 4ONYA 5TPAA 3RT6B 3TMGA 1MDP1 3K4UA 2M8CA 3GLBA 1FQDA 1N3XA 3H6UA 4BDMA 5CBSA 3K1PA 4KYSA 2HFBA 1NNPA 2P0SA 1MQGA 1ELJA 1R1NA 2OLBA 4H8JA 1SD3A 1YAEA 4RXLA 5L9OA 5ELVA 2PT1A 4IO5A 4XKPA 1QUKA 3KSJA 1QVSA 4JBZA 4I9DA 2XXUA 4U4XA 5BWJA 3VDFA 2H4IA 4H65A 2PT2A 3T96B 2OWTA 4QSDA 1A54A 2WKYA 2ZNUA 4OEVA 4BLAA 1O64A 2PVUA 3OEKA 1SVXB 4POXA 2KLFA 3SERA 2X26A 3FJGA 4NTLA 4ZDMA 3UA8A 1II5A 3VLUA 3FVKA 3K1MA 3O28A 3MC2A 4MH5A 1UTHA 4F39A 3HHFA 3TTRA 2V84A 4LP2B 1PEBA 1I6QA 3EHUA 3FASA 3OO8A 5CMCA 3MPKA 2XX8A 3CRBA 1B1HA 1J1NA 3PMVA 3K01A 4XXUA 4F22A 5AA4A 1B4ZA 3SEVA 1DSNA 4JWXA 3H6VA 1ZBMA 2NVUB 1MH4A 3RY3A 1FQCA 5DVIA 5TPAB 3C4MA 1OMPA 3B7DA 2A5SA 3C33A 3LBSA 5H8HA 4U4SA 5TP9B 4MF3A 5IKBA 3FV2A 1PB9A 3HN0A 3KJ7A 2XX9A 3G7WA 4H0WA 4O3BA 2DXRA 4NF8B 4OXVA 1DTGA 3EHTA 3N94A 3Q29A 4JB7A 3SEWA 1MPDA 1USYH 1FQEA 4OERA 5I2KB 2DQVA 3E4RA 4GF8A 3I5OA 4NF5A 4YB6A 3TFLA 1MXWA 1VFDA 1DPPA 1IUDA 1PBPA 2HZLA 1QULA 4IO6A 5ITOA 3G3GA 3GZGA 4H1XA 4LONB 1S9TA 3THIA 4QFNA 1D3KA 1MXZA 2B65A 1B52A 4U22A 5DT6A 4ZZEA 2UVIA 2YJPA 4LZ5A 1MQIA 1IXIA 2VP1A 3TCGA 4ESXA 1LFHA 4BDNA 2F7BA 4RJZA 3SETA 4LZ7A 1JVYA 5K2YA 1N84A 3PPNA 5EHMA 3IO4A 2HQ0A 5BUUA 1RYXA 3HO7A 4R72A 4DCXA 2OJTA 2Q89A 2XD3A 1DTZA 4OEUA 2F35A 4QFKA 1HSEA 4XIGQ 2GH9A 5EYFA 1UIUA 3IR1A 4FECA 2QPQA 3PPOA 2F7CA 1P1OA 2YLNA 4HW8A 3RGYA 5H8HB 3PGFA 2F78A 1A8EA 3RT8A 1CB6A 3MZ9A 4HCWA 4M4GA 3H3GA 3T22A 1M5CA 1LFGA 4KYDA 1SYIA 3K1NA 1R9QA 2DWHA 1O63A 2XX7A 1MG1A 2LAOA 2PX1A 2Y7RA 1UTBA 1MXVA 4FORA 3TCFA 2GFEA 2Q2AA 3UIFA 4ELRA 4DDDA 3MVZA 1B9JA 4F3GA 2A5TA 3ECRA 3DM0A 3GBAA 3Q28A 4YB7A 2DWIA 2QSXA 2F7AA 5I58A 3OOAA 1NMUA 2HAUA 5HM4B 2ONSA 3D4CA 4LATA 1MXYA 4ESWA 5LOMA 4G68B 2HAVA 2XHDA 2GHBA 3IJXB 4DE8A 3O6IA 1BIYA 1S50A 1P1WA 2QRYA 1QKAA 3C9HA 1WVJA 4G8HA 2B3BA 4KD5A 4DCYA 4XKNA 2AIXA 1R9LA 1RKMA 3D4GA 3G3JA 5I59A 3W9WA 5DTBA 1D4NA 3MUQA 2GHAA 4LQ2A 1B6HA 1B5HA 2B3FA 4TLMB 5AE4A 2DXYA 4ZEFA 3MZ1A 3PV0E 3B6QA 1BLFA 1LAFE 3TPAA 1H3DA 4AB6A 3S9LC 2GRVA 2P1SA 1B7UA 4TLLB 1MQJA 5J1DA 3IOUA 4JWYA 1TXFA 2I49A 4ZEBA 3O66A 1BTJA 2XXHA 4OENA 1B3HA 1H43A 1VSOA 1P1UA 4G77A 1NNTA 1SI1A 3TTLA 1Q35A 4OQOA 3TQWA 4YMAA 3T9VA 4I8CA 3VV5A 3LSFB 3K6VA 4PFTA 5I2KA 1MQHA 2XXXA 4EQBA 4ZECA 2W7YA 4R6KA 5L8DA 3IOWA 5FHNA 4FIMA 1LGBC 3OENA 3FXQA 2V3UA 3KFMA 3FATA 5ISUA 2ZNSA 5JTYB 1POY1 3T93B 2HZKA 3VXBA 1US5A 1I6BA 3QUFA 5DYHA 4EF1A 4F1YA 3EPEA 1L5TA 2AYSA 1KWHA 3H4ZA 4YICA 3QSLA 4U21A 1N7XA 4QFPA
chains in the Genus database with same CATH superfamily
3B6TA 1LAHE 1DK4A 1MXUA 3B8BA 5FBPA 1OLCA 1EZPA 2CMOA 3SEYA 1Y4CA 3FXUA 2D21A 2OZZA 1B3LA 4QRZA 3H6TA 3IAZA 4YB5A 4X48A 3I6VA 1FW0A 5I59B 3JV9A 2P2AA 2REJA 3UP9A 4GVOA 3RNNA 5HPQA 3O9PA 4MLQA 5FTIA 4N6PA 3FIRA 4Z7EA 1N0TA 1N7WA 4QF9A 4JXIA 2WBBA 5LDZA 4JVDA 4U23A 4F3BA 3OSQA 5H8FA 4P8BA 4PFRA 3PUYE 4NHBA 1YTVA 4WKMA 4XKRA 2R71A 4O3AA 4RNSA 4R9GA 3U8QA 1MS7A 3S4UA 5DEXA 1B46A 2Z8DA 1LBCA 4HTGA 2RKMA 4F18A 1SW2A 3KN8A 1B05A 3CFLA 2Q8MA 2DVZA 2ZYNA 4DIGA 5A5XB 4G2ZA 1NV0A 2O1LA 1HSJA 3MPLA 4JSOA 4NAPA 3SKPA 3K6XA 1M5EA 1IXCA 1AOVA 4MNPA 3ILTB 1FCKA 2B4LA 3ODBA 3WAFA 3PMXA 5CMMA 2QL3A 2Y84A 3MZBA 1Q9DA 4U1ZA 4EQ7A 2F3BA 1RDZA 4NWDA 4OHNA 2OBGA 4P11A 2REGA 4QFLA 2XXRA 4FEBA 4ZEDA 1LEVA 2Z8EA 2Q88A 3K2DA 1FQFA 3IB2A 3KN3A 3C35A 3RTWB 5IZ3B 2CZHA 2VHAA 4YKKA 1SBPA 1AIVA 2V3TA 2QFLA 1XS5A 2RC7A 4IB2A 2F34A 2XXIA 3OSRA 1CNQA 3C31A 4P1LA 4MCOA 4FJPA 5A5XA 5H8FB 4NF6A 2DE4A 1PBQA 4YKPA 4GXAA 3PUWE 5KDTA 2GQ1A 4G61A 5CMBA 2UYFA 3CI8A 3PD8A 3RLFE 1B0HA 4F29A 3A29A 4R2FA 1JVXA 3LSWA 4NG7A 4WEDA 1ANFA 2DWJA 3ZS6A 4F1VA 3FD3A 4LVQA 3LR1A 3RQTA 1QKBA 2ZZWA 1MM7A 1LLSA 5AA2D 4THIA 4GWOA 1UIVA 4P1EA 1QUIA 5ET5A 4KFQA 4XKQA 1LAXA 2ZYMA 5H8SA 4N81A 1XC1A 5EQAA 5KCJA 1ZLQA 4E0XA 4EUOA 3K02A 3ZKKA 5EQ8A 3FVOA 4GL0A 3QIMA 1MY1A 5H8NB 1IEJA 1EYIA 2PMSA 1LBVA 4PF8A 4N8GA 4NMYA 3G3HA 3PPRA 1SYHA 1RYOA 4PFYA 4IY6A 3N6TA 1AH5A 1DBZA 3LUYA 2BJJX 2FYIA 2V25A 2NXOA 5B70A 1B58A 4G4PA 4R2BA 2QVUA 1KA0A 5IAIA 1B5IA 4N17A 2FBPA 3SEUA 5IGAA 2VD3A 2FNCA 3TCHA 2OK2A 3F11A 1QJMA 4IO7A 2HXRA 3FXRA 2HEUA 1NI9A 2DSFA 4GWZA 4KCCA 3U93A 2XXVA 4ECFA 4PFIA 3ZSFA 1BK4A 1INPA 1PC3A 5L9MA 1VFEA 4H5FA 4UACA 1MY2A 3U72A 3UN6A 2RINA 2I4CA 3EN3A 3M3FA 4YZZA 4OZ9A 2WBDA 1YPNA 4Q0CA 1YCJA 4X04A 3ZKLA 2O7UA 1P99A 3FVNA 1Y3NA 1LBXA 2ZZXA 4ONYA 3TMGA 3RT6B 1MDP1 2M8CA 1FQDA 4PFBA 3H6UA 4PBQA 1ELJA 1R1NA 4RXLA 1EYKA 5BWJA 4H65A 4OEVA 1O64A 3OEKA 3SERA 2VPOA 2X26A 3VLUA 3EHUA 5CMCA 2XX8A 3PMVA 1B4ZA 3LUZA 1RDYA 4JWXA 1MH4A 4PGPA 3C4MA 1IMDA 3FV2A 1PB9A 4MIJA 3EHTA 1MPDA 1FBDA 4OERA 4GF8A 1VFDA 2KR0A 3GZGA 3MYUA 1S9TA 4LONB 3THIA 1D3KA 2P3NA 2B65A 2YJPA 1IMFA 4LZ7A 3PPNA 5BUUA 4DCXA 2Q89A 4XIGQ 4OEUA 2GH9A 4JVIA 4FECA 2QPQA 3PPOA 1P1OA 3RGYA 2F78A 1A8EA 1FBFA 4KYDA 2XX7A 2Y7RA 2GFEA 4F3GA 3GBAA 3Q28A 1DCUA 2F7AA 1MXYA 4ESWA 3IJXB 3S9MC 4KD5A 1QKAA 1WVJA 4XKNA 1B6HA 5AE4A 3TPAA 4OVRA 3IOUA 4JWYA 1KZ8A 4ZEBA 3O66A 2XXHA 4OENA 1VSOA 4H45A 4MHFA 4I8CA 4PFTA 1MQHA 2PFZA 4FIMA 3FATA 1POY1 2HZKA 1I6BA 1L5TA 4QFPA 3UK4A 2XXWA 2AL4A 2R9JA 1VE4A 4JWOA 1EU8A 1DMBA 3V8XB 5I56B 1PB8A 3OELA 5EYHA 3A09A 1FJ6A 1IMAA 2UXAA 2Z22A 4IO4A 2H99A 4FBPA 2ONKE 1YZ0A 4C1TA 4Q5TA 2E1SA 1G0IA 2DE2A 4MFIA 3QK6A 2HXWA 4ZE8A 1NV7A 4OYVA 4K3FA 3IORA 2XXYA 3RPLB 4XEQA 2V4CA 1GGGA 3PUZE 3T9UA 1JETA 4YMBA 3O2AA 4H5GA 1ZKBA 2FVZA 2DDKA 2UYEA 3KJTA 4L17A 5FHMA 4NF0A 2PYYA 3IB0A 1IQ7A 3TELA 1B32A 4KI0E 1EH3A 3B50A 2XXKA 1QGXA 1FPGA 4GD5A 3DLNA 1NUZA 3KBRA 3M8UA 1A7LA 4WEPA 4PFWA 4X1DA 4G68A 3MP6A 4HE1A 5I57A 2UVGA 4OFOA 1ZJLA 1NV2A 4I3EA 3VVDA 4AB5A 1LSTA 3T0JA 1FTAA 1OQGA 4OVJA 4F3PA 3TQLA 1FBGA 4MNIA 4GWUA 2KQZA 1URSA 1URDA 1FBEA 4GXSB 5I2NB 4OMBA 4N6DA 4OFJA 4KXPA 1IMCA 2V93A 1FBCA 3G3KA 2Y5LA 2QJEA 4NEDA 2I6EA 2XA5A 1MPCA 1BP5A 4BDLA 3U92A 4FAJA 3G3IA 5KDTB 3V89B 4GL8A 1TT1A 3OEMA 5F24A 4NQ8A 1DPEA 1GTKA 4PQJA 3U1OA 4EDPA 5I2NA 3IK6B 3S2VA 2PCRA 2ZMBA 2ZNTA 2F6GA 3RTFB 4PBHA 3OXNA 3FGSA 4R6HA 3OO9A 1FPFA 3HHGA 1H45A 5M2VA 5JK4A 1VR5A 2Z8FA 2H25A 3RPWA 2H5YA 3P7IA 1NFTA 4BDRA 4GBVA 4PAIA 4DLDA 1GVCA 3DELB 4R75A 5AA1A 1B40A 3PTYA 4DXBA 3T1BA 3WAEA 1TFAA 2O69A 3H7MA 3VLVA 2CEYA 5I7IA 1JW5A 2NWJA 2ESNA 3EHSA 2X7QA 3ILUB 4FE8A 3MWBA 4XF5A 1A99A 1CE2A 4PC9A 3O6HA 4ELOA 3IFAA 3RPLA 1LB9A 4N13A 3CVGA 3K6WA 1Y1MA 1B7HA 4N8YA 3SEXA 1D9VA 4YU0A 3ONMA 2FA7A 3FJMA 4IGTA 3OD7A 1FPDA 4OA4A 2G29A 5KZTA 2VD2A 3BKIB 3TDJA 2DOJA 2PBWA 2O7IA 4OESA 3E9XA 3QXMA 3M3LA 4GWXA 2ZYOA 4I40A 4F2QA 2QVRA 1K9ZA 3IOVA 1OVBA 2OCUA 2XD2A 3MVXA 2P3VA 3PUXE 4XFEA 4HCYA 1FTOA 3B6WA 4GBWA 2Y7KA 1FQBA 4ZZAA 3EKIA 4AQ4A 1LBWA 4G68C 3NOHA 4LZ8A 2O84X 5B7DA 1N76A 3V5AA 3C34A 4PP0A 2HPGA 1IXGA 3U65A 3IX1A 1Q1KA 1MXXA 3Q26A 4HW8A 3MAMA 1SW4A 3PGFA 5TPAA 3VDFA 3KGCA 4NN3A 4BDMA 2FIXA 5CBSA 3K1PA 2HFBA 2P0SA 1SD3A 1YAEA 3D1RA 4XKPA 1QVSA 4JBZA 2XXUA 2H4IA 2PT2A 1A54A 1NUYA 2PVUA 1SVXB 4ZDMA 3MC2A 4MH5A 3TTRA 2V84A 4LP2B 5ET8A 3OO8A 3MPKA 1J1NA 4XXUA 5AA4A 1ZBMA 3RY3A 5TPAB 5H8HA 5TP9B 4MF3A 3HN0A 4H0WA 4P47A 2DXRA 4NF8B 4OXVA 3N94A 3SEWA 1IUDA 4JVCA 5ITOA 4QFNA 1MXZA 2VP1A 3TCGA 4ESXA 5EHMA 2HQ0A 1RYXA 3IFCA 2OJTA 4QFKA 1UIUA 5H8HB 3RT8A 2XWIA 2LAOA 1SPIA 1UTBA 1MXVA 2VPNA 2Q2AA 1FRPA 4DDDA 3MVZA 3ECRA 5I58A 4LATA 2XHDA 2GHBA 4DE8A 1P1WA 2QRYA 2B3BA 5I59A 1RKMA 3MUQA 2GHAA 1B5HA 3HFUA 4TLMB 4ZEFA 3PV0E 1LAFE 2P1SA 1B7UA 4TLLB 1K9YA 2I49A 1H43A 5IM2A 4OQOA 3TQWA 4YMAA 3T9VA 5I2KA 4EQBA 5L8DA 1LGBC 4GX4A 5ISUA 5JTYB 4F1YA 3EPEA 1G0HA 1R6ZA 1EZ9A 3TODA 4ISUA 1ZTYA 4M1VA 1HSLA 4F2OA 3H03A 4F1UA 4R9FA 1JW4A 4O7MA 1OQHA 3PUVE 3L6GA 2B4MA 1A8FA 2G93A 3H06B 1MY3A 3KOTA 4OVTA 3LV0A 1Z7NE 2R6GE 2Q2CA 1DOTA 4I3YA 2OWZA 2O6AA 4POWA 4KQPA 2ZXTA 5H8QB 3K0VA 3RYDA 4H8IA 3HV1A 4FATA 2VGQA 3R26A 3MW0A 3BIGA 3IL1B 2THIA 1UTBB 3KBZA 4DXCA 5AA4B 5F1QA 3BFUA 2CZKA 4P3LA 1SDXA 1S7YA 2QVVA 3V83A 1JW1A 4GFRA 1FTJA 2XXQA 2BJIA 4ZS9A 4O8MA 1Y9UA 3SZPA 4Q30B 3MJNA 1H44A 1JQFA 1QUJA 5EQ7A 3TKDA 1B51A 5AA3A 5ITPA 2E0SA 4U2RA 3TEPA 4BDOA 1B3FA 4OVQA 1FTLA 3S9EA 3M3KA 1MM6A 4YKIA 1EZOA 4X1BA 3C36A 1MQDA 4EF2A 2F97A 4NWCA 5H8NA 4C1UA 4H46A 1LBBA 5ESYA 5JTYA 4OETA 5I3SA 3OO7A 2X7PA 4YKJA 2NOOA 3TUSA 3FJ7A 3A3CA 3QYTA 1FSAA 3FV1A 2XXTA 3KSXA 4JDFA 3CIJA 2F6PA 4N6KA 3DP8A 1M5DA 5CC2A 3VVEA 2DYXA 2IEEA 1LB8A 4HE2A 2ANJA 3LC8A 4IO3A 4KHZE 4KR5A 3BBRA 4MBPA 1FTKA 1MH3A 2DVCA 5H8QA 4GWWA 4HXVA 3EQ1A 4DZ1A 3BIHA 3KZGA 5LTCA 1WDNA 1MY4A 2QMWA 1T0KA 3L6HA 1XOCA 1M5BA 1NH8A 3DP4A 2F5XA 4KCDA 2F3DA 4Q8RA 3KG2A 1B5JA 2XXPA 3O29A 2O1MA 4KPTA 1MY0A 4F3SA 3QMFA 3HSTA 3K00A 3TZAA 1US4A 4RPOA 4F31B 1A40A 4MAGA 5A5LA 1SW5A 2RC8A 3T9HB 4GQOA 1POTA 2I3WA 4ZEKA 3LSLA 1B1XA 3LSXA 5ET6A 2CEXA 4O3CA 3W15C 1TFDA 3USDA 1B0LA 1XVYA 1NH7A 4U1OA 4ZE9A 3KOSA 2QS2A 1NKXA 1VDWA 2ONRA 1FQAA 1NV1A 4H67A 3OO6A 4X8RA 5CBRA 4RA1A 4P0IA 2V3QA 2JJKA 2QMXA 4E0WA 1MPBA 1XHYA 4WXJA 5J16A 3K6UA 3DP6A 3QAXA 3RN8A 3C32A 3IOTA 2I0CA 2Z23A 4PF6A 2F8DA 3AXFA 4N15A 2RCAA 2RF1A 1IITA 1USYE 4MX6A 1IIWA 2UVJA 2MKZA 3TAJA 2QS3A 2RCBA 3CSBA 5ICTA 2D5WA 4TQUQ 3TTKA 3E79A 2F36A 4PE5B 4I62A 2WEFA 3CR9A 4RK9A 4PDDA 1P1NA 3O97A 4EXLA 3UGWA 3PD9A 3PMWA 1NV4A 1JEUA 3GXAA 4PAFA 1NUWA 3VLWA 4N91A 4QSCA 4Z0IA 1NNKA 3VXCA 3HCQA 5EQ9A 3CG3A 1XI6A 4MNCA 1FPIA 5DVJA 4LUBA 1XT8A 4NF5B 3E13X 3T66A 4QHQA 3VVFA 1FPLA 3R6UA 5CMKA 1I6AA 1B7ZA 2H9BA 3GLBA 1N3XA 4KYSA 4H8JA 5L9OA 2PT1A 1QUKA 4I9DA 4QBAA 2OWTA 2WKYA 2ZNUA 4BLAA 2KLFA 3HHFA 1I6QA 3FASA 1NUXA 2WX9A 3CRBA 3GYYA 4F22A 3K01A 2L5VA 1DSNA 2XWVA 5DVIA 1OMPA 3B7DA 3LBSA 2XX9A 3G7WA 4O3BA 2HHMA 3Q29A 4JB7A 1USYH 1FQEA 4UABA 4NF5A 1NV3A 1MXWA 2HZLA 5DT6A 4LZ5A 1LFHA 4IR8A 3KC1A 4BDNA 2F7BA 1JVYA 5K2YA 1N84A 4R72A 2XD3A 1DTZA 2F35A 1HSEA 5EYFA 3IR1A 2F7CA 2OX3A 2FHYA 1KA1A 1CB6A 3CHGA 3K1NA 4GWSA 2DWHA 1O63A 3TCFA 3UIFA 2A5TA 3DM0A 4GX3A 3OOAA 5HM4B 2HAUA 2ONSA 5LOMA 2HAVA 3O6IA 1BIYA 1S50A 1AWBA 3C9HA 4DCYA 3D4GA 3W9WA 4PGNA 2DXYA 1FJ9A 5J1DA 1TXFA 4G77A 1NNTA 3VV5A 3LSFB 3K6VA 2W7YA 4R6KA 3IOWA 5FHNA 1NV5A 2ZNSA 3T93B 1US5A 5DYHA 1D9QA 4QXDA 3H4ZA 1FBHA 3QSLA 1N7XA 3Q25A 3UORA 1JEVA 1Y3PA 4EXKA 4QFOA 4UA8A 2CZIA 4TOZA 1BKAA 4PTKA 5AA2A 1F9BA 3T9XB 3W9VA 4IO2A 3PU5A 2ABHA 5TU0A 3RUMA 4RK2A 3S9NC 2VOZA 1Y3QA 4LQ5A 1UQWA 2CZLA 4I1DA 4NF8A 3E78A 5HBCA 4PE3A 1Y1ZA 4PCDA 1M5FA 5EYGA 4JSDA 2XWOA 3CFXA 1LCTA 5F7VA 1N04A 2H98A 1URGA 3MVWA 1B2HA 4G8NA 4BDQA 3EF7A 2I58A 3SDFA 4ELQA 4HS7A 1XVXA 1FBPA 4GIZA 5K2XA 5EHSA 3MP1A 2WYKA 4OFLA 4PFUA 4MJOA 3VFJA 2ZZVA 1AMFA 4RYAA 5T3JA 2I4BA 3FVGA 2UVHA 3TTMA 3Q27A 1OIBA 1TWYA 5JEIA 1P1QA 2AL5A 4F19A 2Y7IA 2DE3A 3KN7A 2XWKA 2Y7PA 3IO6A 5CM6A 1AL3A 3HPIA 2OWSA 1QW0A 4MLVA 5I84A 1IMBA 4P0GA 1LFIA 4PDHA 1OLAA 4DI4B 4R6YA 1A55A 3CFZA 3FZVA 1IZ1A 2HCAA 5TP9A 2A5TB 4EQ9A 3MP8A 2DWAA 1H76A 5CRYA 4OVSA 1SW1A 2I0BA 3IJOB 3SETA 5L9SA 2O68A 2ALUA 1UTHB 4MMPA 4XTCQ 5IZ1A 1IXHA 4QSEA 5CI5A 3PPPA 3MVYA 3QUJA 3MSTA 4ZEIA 3FBPA 4P9KA 1ZIUA 3PPQA 1O7TA 4NE4A 5FHOA 1ATGA 1GV8A 1LBYA 3JYRA 1N3WA 3GBBA 2I48A 3TTNA 4LA9A 2QS4A 4DXUA 2Y7WA 1FPKA 2O51A 3G3FA 4OWDA 1B3GA 4R74A 5FTHA 3U94A 4R73A 5AA2B 3ISPA 4ELPA 4RPNA 4AS4A 4MEVA 4ND9A 3SESA 3N5LA 1FPBA 2D3IA 5DW8A 4NX1A 4IGRA 4O7IA 4YAHX 4GRKA 1I69A 1D9YA 3N6UA 4KYEA 1Y4TA 1IMEA 4PETA 1B4HA 1NNFA 4PAKA 1PDAA 1Y20A 2DS9A 3CSGA 4G8MA 2DP8A 5I56A 1ZMGA 1LCFA 2Q9TA 3KEIA 3TYHA 2QS1A 3BFTA 4OTEA 3MQ9A 5DEXB 3VE1B 1GR2A 2ZYKA 5IZ3A 3E3KA 4H6DA 1YYZA 4X9TA 1FTMA 4NF4A 4FEDA 3I3VA 4DI3D 4P56A 2Q8JA 2IA4A 1Z7ME 1WODA 3OMBA 4N07A 3H6WA 1SQYA 2NUVA 4N4UA 1JNFA 2WYPA 3A3UA 3R7XA 5DVFA 4NF6B 3JZJA 1MRPA 5KCJB 3IB1A 3N26A 5ET7A 4GOTA 4GWYA 1MDQA 2Q74A 3CG1A 3FUZA 2I3VA 3O6GA 4RY1A 4NF4B 4C0RA 1PB7A 2Y5KA 1OVTA 1SI0A 2YPNA 4NGUA 1NL5A 5I57B 1LAGE 3FXBA 3MBPA 1ZU0A 5I58B 4IY5A 2RC9A 1B3EA 4GLIA 3K4UA 4O94A 1NNPA 1MQGA 4GX6A 2OLBA 5ELVA 4IO5A 1LBZA 3KSJA 4U4XA 1FPEA 3T96B 4QSDA 4POXA 3FJGA 4NTLA 3UA8A 1II5A 3FVKA 3K1MA 3O28A 1UTHA 4F39A 5I5PA 4OANA 1PEBA 3ROJA 1B1HA 3SEVA 3H6VA 2NVUB 1FQCA 2A5SA 3C33A 4U4SA 5IKBA 3KJ7A 1DTGA 5I2KB 2DQVA 3E4RA 3TFLA 3I5OA 4YB6A 1DPPA 1PBPA 4IO6A 1QULA 3G3GA 4H1XA 4U22A 1B52A 2VT5A 4ZZEA 2UVIA 1MQIA 1IXIA 4RJZA 1FPJA 3IO4A 1JP4A 3HO7A 3KC0A 2PFYA 2YLNA 4LN5A 3MZ9A 4HCWA 4M4GA 3H3GA 3T22A 1M5CA 1LFGA 1SYIA 1R9QA 4OVPA 1MG1A 2PX1A 2FIEA 4FORA 1YXIA 4ELRA 1B9JA 4YB7A 2DWIA 2QSXA 5IZZA 1NMUA 3D4CA 4G68B 5ICQA 4G8HA 2AIXA 1R9LA 3G3JA 5DTBA 1D4NA 4LQ2A 2B3FA 3MZ1A 3B6QA 1BLFA 4AB6A 3S9LC 1H3DA 2GRVA 1MQJA 1BTJA 1B3HA 2R8TA 1P1UA 1EYJA 1SI1A 3TTLA 1Q35A 4HE0A 2XXXA 4ZECA 1RDXA 4AS5A 3OENA 3FXQA 2V3UA 3KFMA 1NV6A 3VXBA 4EF1A 3QUFA 2AYSA 1KWHA 4YICA 4U21A
chains in the Genus database with same CATH topology
3B6TA 3Q25A 1R6ZA 1JEVA 1EZ9A 3UORA 1LAHE 4ISUA 1ZTYA 4M1VA 2XXWA 3TODA 3UK4A 1HSLA 1MXUA 1Y3PA 4F2OA 4EXKA 4QFOA 4UA8A 2AL4A 2R9JA 3H03A 1VE4A 4R9FA 4F1UA 4JWOA 1EU8A 1DMBA 4TOZA 1BKAA 3V8XB 5I56B 1JW4A 1PB8A 3OELA 5AA2A 1OLCA 1F9BA 1EZPA 3A09A 3T9XB 3W9VA 4IO2A 2CMOA 1OQHA 2ABHA 3PU5A 3L6GA 3PUVE 3SEYA 1Y4CA 3FXUA 1A8FA 2G93A 2UXAA 2Z22A 1MY3A 3H06B 5TU0A 3RUMA 3KOTA 4IO4A 2H99A 2D21A 1Z7NE 2OZZA 2Q2CA 2R6GE 1DOTA 4RK2A 3S9NC 2VOZA 1B3LA 4QRZA 3H6TA 3IAZA 4YB5A 1Y3QA 2O6AA 4POWA 4KQPA 2ZXTA 2ONKE 1T0KA 4X48A 4LQ5A 3I6VA 5H8QB 3S9MC 1UQWA 4Q5TA 4C1TA 2E1SA 1FW0A 2CZLA 3K0VA 2DE2A 4MFIA 4I1DA 5I59B 4H8IA 3QK6A 3JV9A 4NF8A 2P2AA 2REJA 3HV1A 3UP9A 2HXWA 4ZE8A 4GVOA 3RNNA 4OYVA 5HPQA 3O9PA 5HBCA 4MLQA 4K3FA 5FTIA 4N6PA 4FATA 1Y1ZA 2VGQA 3R26A 3MW0A 3IORA 3FIRA 2XXYA 1M5FA 3IL1B 2THIA 4JSDA 4Z7EA 3CFXA 1UTBB 1GGGA 4DXCA 1LCTA 5AA4B 5F1QA 3BFUA 1N0TA 1JETA 1N7WA 3PUZE 3T9UA 4YMBA 5F7VA 3O2AA 1SDXA 1S7YA 1ZKBA 4H5GA 4QF9A 3V83A 1JW1A 4GFRA 1FTJA 4JXIA 2XXQA 4ZS9A 1N04A 2UYEA 3KJTA 4L17A 5FHMA 1Y9UA 2H98A 1URGA 3MVWA 4Q30B 4U23A 1B2HA 4F3BA 3MJNA 2PYYA 1H44A 3OSQA 1JQFA 3IB0A 1IQ7A 1QUJA 5H8FA 3TELA 4G8NA 1B32A 4BDQA 3EF7A 4KI0E 2I58A 3SDFA 3TKDA 4ELQA 1EH3A 1B51A 5AA3A 4HS7A 3PUYE 5ITPA 1YTVA 1XVXA 2E0SA 4WKMA 4U2RA 4GIZA 4XKRA 3TEPA 2R71A 5K2XA 4GD5A 3DLNA 1B3FA 4O3AA 5EHSA 4BDOA 3MP1A 4RNSA 4OFLA 3KBRA 3M8UA 1FTLA 4PFUA 3S9EA 1A7LA 3M3KA 4R9GA 3VFJA 4WEPA 1AMFA 1MM6A 4YKIA 1EZOA 4X1BA 1MS7A 1MQDA 3C36A 4PFWA 4RYAA 3S4UA 3U8QA 5DEXA 4EF2A 2F97A 4NWCA 4X1DA 1B46A 2I4BA 3FVGA 3MP6A 2UVHA 4G68A 2Z8DA 5H8NA 4C1UA 5I57A 3TTMA 1LBCA 3Q27A 2UVGA 1LBBA 4HTGA 4OFOA 1OIBA 1TWYA 1ZJLA 2RKMA 4F18A 1SW2A 5JEIA 1P1QA 4OETA 5JTYA 3VVDA 3KN8A 4AB5A 1B05A 1LSTA 2X7PA 2AL5A 3CFLA 3OO7A 2DVZA 2ZYNA 2NOOA 1OQGA 4OVJA 4YKJA 4DIGA 5A5XB 4F19A 2Y7IA 4G2ZA 3TUSA 2O1LA 3FJ7A 4F3PA 1HSJA 3A3CA 3QYTA 3FV1A 3TQLA 3MPLA 2XXTA 1URSA 4JSOA 3SKPA 1URDA 3KSXA 2DE3A 3K6XA 3KN7A 1M5EA 1IXCA 4JDFA 3CIJA 1AOVA 2F6PA 2Y7PA 3DP8A 1M5DA 5CC2A 3ILTB 3IO6A 1FCKA 5CM6A 3VVEA 4GXSB 5I2NB 1AL3A 4OMBA 2DYXA 2IEEA 3ODBA 3HPIA 1LB8A 3WAFA 2OWSA 1QW0A 4MLVA 4OFJA 2ANJA 5I84A 3PMXA 5CMMA 3LC8A 4IO3A 4KHZE 4KR5A 4P0GA 2V93A 1LFIA 2QL3A 2Y84A 3MZBA 1OLAA 3BBRA 3G3KA 4MBPA 2QJEA 1A55A 4NEDA 4R6YA 1FTKA 2I6EA 4U1ZA 3CFZA 4EQ7A 1MH3A 2DVCA 3FZVA 1MPCA 1BP5A 5ICQA 4BDLA 4NWDA 4OHNA 1IZ1A 5H8QA 2HCAA 3U92A 4FAJA 5TP9A 3G3IA 2A5TB 4EQ9A 2OBGA 3EQ1A 5KDTB 3MP8A 3V89B 2DWAA 4P11A 1H76A 4DZ1A 5CRYA 2REGA 4QFLA 3KZGA 2XXRA 4FEBA 4GL8A 1TT1A 3OEMA 4ZEDA 2Z8EA 1DPEA 1WDNA 1SW1A 1MY4A 2I0BA 1FQFA 2Q88A 2QMWA 3C35A 3IB2A 3IJOB 3K2DA 3KN3A 3L6HA 3RTWB 5L9SA 1XOCA 2VHAA 2O68A 1GTKA 1M5BA 1NH8A 4YKKA 2ALUA 1UTHB 4PQJA 3DP4A 1SBPA 3U1OA 1AIVA 2F5XA 4EDPA 2V3TA 3IK6B 5I2NA 1XS5A 4KCDA 4XTCQ 1IXHA 3S2VA 4QSEA 5CI5A 4Q8RA 2RC7A 3PPPA 3KG2A 3MVYA 4IB2A 3QUJA 1B5JA 4ZEIA 2XXPA 2F34A 2XXIA 2ZMBA 2ZNTA 3OSRA 3C31A 3O29A 2F6GA 2O1MA 4FJPA 4KPTA 1MY0A 4F3SA 3RTFB 3HSTA 5A5XA 3K00A 1ZIUA 3TZAA 1US4A 3PPQA 4RPOA 1O7TA 3OXNA 4NF6A 5H8FB 3FGSA 4R6HA 2DE4A 1PBQA 3OO9A 4YKPA 4GXAA 4NE4A 1A40A 4F31B 3PUWE 5KDTA 5FHOA 1ATGA 5CMBA 1SW5A 3HHGA 1H45A 1GV8A 2RC8A 2UYFA 3JYRA 5M2VA 3T9HB 1N3WA 1VR5A 3CI8A 3GBBA 3PD8A 5JK4A 4GQOA 3RLFE 2I48A 1POTA 1B0HA 2I3WA 2Z8FA 2H25A 4LA9A 2QS4A 4ZEKA 3TTNA 4F29A 4DXUA 3RPWA 2H5YA 3P7IA 1NFTA 2Y7WA 4BDRA 4R2FA 3LSLA 1B1XA 2O51A 1JVXA 3LSXA 3LSWA 3G3FA 4OWDA 4WEDA 1ANFA 2DWJA 4O3CA 1GVCA 1TFDA 1B3GA 3DELB 3W15C 4DLDA 4R74A 5FTHA 3USDA 1B0LA 1XVYA 1NH7A 1B40A 4R75A 5AA1A 3ZS6A 4F1VA 4U1OA 3U94A 4R73A 4DXBA 3FD3A 4LVQA 5AA2B 4ZE9A 3LR1A 3KOSA 2QS2A 3RQTA 1NKXA 1TFAA 3WAEA 4RPNA 2ONRA 4ELPA 4ND9A 1FQAA 3N5LA 3SESA 1QKBA 4H67A 3OO6A 1MM7A 2D3IA 2O69A 1LLSA 3H7MA 3VLVA 5CBRA 4RA1A 1JW5A 4P0IA 5AA2D 2V3QA 2QMXA 4IGRA 4E0WA 2NWJA 1MPBA 4THIA 4YAHX 4GRKA 4GWOA 1I69A 1UIVA 1XHYA 1QUIA 1D9YA 2ESNA 4WXJA 3EHSA 2X7QA 3K6UA 3N6UA 4KFQA 4XKQA 1LAXA 3DP6A 3ILUB 3QAXA 4FE8A 3MWBA 4KYEA 1A99A 1CE2A 1Y4TA 3RN8A 4PETA 1B4HA 1NNFA 3C32A 2ZYMA 3O6HA 1Y20A 1PDAA 2DS9A 3CSGA 4ELOA 5H8SA 4G8MA 2DP8A 1XC1A 5I56A 3IOTA 1ZMGA 1LB9A 1LCFA 4N13A 2I0CA 2Z23A 3CVGA 1ZLQA 3K6WA 4E0XA 5KCJA 4EUOA 2Q9TA 1Y1MA 2F8DA 3K02A 3ZKKA 3AXFA 3KEIA 3TYHA 2QS1A 1B7HA 3FVOA 2RCAA 3BFTA 4OTEA 2RF1A 3MQ9A 1IITA 4GL0A 5DEXB 3VE1B 3QIMA 3SEXA 1D9VA 1GR2A 1MY1A 5H8NB 1IEJA 2ZYKA 3ONMA 1USYE 2PMSA 2FA7A 3FJMA 4YU0A 1IIWA 2UVJA 4IGTA 3TAJA 4NMYA 2QS3A 2RCBA 3CSBA 3G3HA 3E3KA 3OD7A 3PPRA 1SYHA 5ICTA 1RYOA 2D5WA 4H6DA 4PFYA 4TQUQ 3TTKA 4IY6A 4X9TA 3N6TA 1FTMA 4NF4A 1AH5A 5KZTA 4FEDA 2G29A 3I3VA 2BJJX 2F36A 2FYIA 2V25A 2VD2A 2NXOA 3BKIB 3LUYA 3TDJA 4PE5B 4I62A 5B70A 2Q8JA 2DOJA 2IA4A 1B58A 2PBWA 3CR9A 2O7IA 1Z7ME 1WODA 4G4PA 4OESA 4RK9A 4R2BA 3OMBA 3E9XA 4N07A 3H6WA 1P1NA 3O97A 3QXMA 4EXLA 1B5IA 3M3LA 1SQYA 3UGWA 5IAIA 3PD9A 2ZYOA 2NUVA 1JNFA 3A3UA 3PMWA 3R7XA 3SEUA 4F2QA 5DVFA 2VD3A 4NF6B 3IOVA 2FNCA 3TCHA 3JZJA 2OK2A 3F11A 1MRPA 1QJMA 5KCJB 1JEUA 3GXAA 3IB1A 1OVBA 2OCUA 3N26A 4IO7A 2XD2A 3MVXA 3VLWA 3FXRA 4GOTA 2HEUA 3PUXE 1MDQA 4QSCA 4Z0IA 1NNKA 2DSFA 4KCCA 3U93A 2XXVA 3HCQA 3CG1A 3VXCA 3FUZA 4ECFA 3CG3A 4HCYA 1FTOA 3B6WA 2I3VA 3ZSFA 1PC3A 3O6GA 5DVJA 4RY1A 1VFEA 5L9MA 4H5FA 4UACA 2Y7KA 1MY2A 4NF4B 1FQBA 4ZZAA 3U72A 3UN6A 2RINA 4AQ4A 4C0RA 1PB7A 4LUBA 4G68C 1XT8A 1OVTA 1SI0A 2O84X 2I4CA 4LZ8A 4NF5B 5B7DA 2YPNA 3E13X 3EN3A 3M3FA 1NL5A 1N76A 3T66A 4YZZA 4QHQA 3V5AA 5I57B 1LAGE 4OZ9A 3MBPA 1YPNA 1ZU0A 3C34A 4PP0A 3VVFA 1IXGA 3IX1A 1Q1KA 1YCJA 3R6UA 4Q0CA 1MXXA 3Q26A 3ZKLA 5I58B 5CMKA 2O7UA 4IY5A 1I6AA 1P99A 1SW4A 1B3EA 1Y3NA 2RC9A 1B7ZA 3FVNA 2H9BA 3MAMA 3KGCA 4GLIA 4ONYA 5TPAA 3RT6B 3TMGA 1MDP1 3K4UA 2M8CA 3GLBA 1FQDA 1N3XA 3H6UA 4BDMA 5CBSA 3K1PA 4KYSA 2HFBA 1NNPA 2P0SA 1MQGA 1ELJA 1R1NA 2OLBA 4H8JA 1SD3A 1YAEA 4RXLA 5L9OA 5ELVA 2PT1A 4IO5A 4XKPA 1QUKA 3KSJA 1QVSA 4JBZA 4I9DA 2XXUA 4U4XA 5BWJA 3VDFA 2H4IA 4H65A 2PT2A 3T96B 2OWTA 4QSDA 1A54A 2WKYA 2ZNUA 4OEVA 4BLAA 1O64A 2PVUA 3OEKA 1SVXB 4POXA 2KLFA 3SERA 2X26A 3FJGA 4NTLA 4ZDMA 3UA8A 1II5A 3VLUA 3FVKA 3K1MA 3O28A 3MC2A 4MH5A 1UTHA 4F39A 3HHFA 3TTRA 2V84A 4LP2B 1PEBA 1I6QA 3EHUA 3FASA 3OO8A 5CMCA 3MPKA 2XX8A 3CRBA 1B1HA 1J1NA 3PMVA 3K01A 4XXUA 4F22A 5AA4A 1B4ZA 3SEVA 1DSNA 4JWXA 3H6VA 1ZBMA 2NVUB 1MH4A 3RY3A 1FQCA 5DVIA 5TPAB 3C4MA 1OMPA 3B7DA 2A5SA 3C33A 3LBSA 5H8HA 4U4SA 5TP9B 4MF3A 5IKBA 3FV2A 1PB9A 3HN0A 3KJ7A 2XX9A 3G7WA 4H0WA 4O3BA 2DXRA 4NF8B 4OXVA 1DTGA 3EHTA 3N94A 3Q29A 4JB7A 3SEWA 1MPDA 1USYH 1FQEA 4OERA 5I2KB 2DQVA 3E4RA 4GF8A 3I5OA 4NF5A 4YB6A 3TFLA 1MXWA 1VFDA 1DPPA 1IUDA 1PBPA 2HZLA 1QULA 4IO6A 5ITOA 3G3GA 3GZGA 4H1XA 4LONB 1S9TA 3THIA 4QFNA 1D3KA 1MXZA 2B65A 1B52A 4U22A 5DT6A 4ZZEA 2UVIA 2YJPA 4LZ5A 1MQIA 1IXIA 2VP1A 3TCGA 4ESXA 1LFHA 4BDNA 2F7BA 4RJZA 3SETA 4LZ7A 1JVYA 5K2YA 1N84A 3PPNA 5EHMA 3IO4A 2HQ0A 5BUUA 1RYXA 3HO7A 4R72A 4DCXA 2OJTA 2Q89A 2XD3A 1DTZA 4OEUA 2F35A 4QFKA 1HSEA 4XIGQ 2GH9A 5EYFA 1UIUA 3IR1A 4FECA 2QPQA 3PPOA 2F7CA 1P1OA 2YLNA 4HW8A 3RGYA 5H8HB 3PGFA 2F78A 1A8EA 3RT8A 1CB6A 3MZ9A 4HCWA 4M4GA 3H3GA 3T22A 1M5CA 1LFGA 4KYDA 1SYIA 3K1NA 1R9QA 2DWHA 1O63A 2XX7A 1MG1A 2LAOA 2PX1A 2Y7RA 1UTBA 1MXVA 4FORA 3TCFA 2GFEA 2Q2AA 3UIFA 4ELRA 4DDDA 3MVZA 1B9JA 4F3GA 2A5TA 3ECRA 3DM0A 3GBAA 3Q28A 4YB7A 2DWIA 2QSXA 2F7AA 5I58A 3OOAA 1NMUA 2HAUA 5HM4B 2ONSA 3D4CA 4LATA 1MXYA 4ESWA 5LOMA 4G68B 2HAVA 2XHDA 2GHBA 3IJXB 4DE8A 3O6IA 1BIYA 1S50A 1P1WA 2QRYA 1QKAA 3C9HA 1WVJA 4G8HA 2B3BA 4KD5A 4DCYA 4XKNA 2AIXA 1R9LA 1RKMA 3D4GA 3G3JA 5I59A 3W9WA 5DTBA 1D4NA 3MUQA 2GHAA 4LQ2A 1B6HA 1B5HA 2B3FA 4TLMB 5AE4A 2DXYA 4ZEFA 3MZ1A 3PV0E 3B6QA 1BLFA 1LAFE 3TPAA 1H3DA 4AB6A 3S9LC 2GRVA 2P1SA 1B7UA 4TLLB 1MQJA 5J1DA 3IOUA 4JWYA 1TXFA 2I49A 4ZEBA 3O66A 1BTJA 2XXHA 4OENA 1B3HA 1H43A 1VSOA 1P1UA 4G77A 1NNTA 1SI1A 3TTLA 1Q35A 4OQOA 3TQWA 4YMAA 3T9VA 4I8CA 3VV5A 3LSFB 3K6VA 4PFTA 5I2KA 1MQHA 2XXXA 4EQBA 4ZECA 2W7YA 4R6KA 5L8DA 3IOWA 5FHNA 4FIMA 1LGBC 3OENA 3FXQA 2V3UA 3KFMA 3FATA 5ISUA 2ZNSA 5JTYB 1POY1 3T93B 2HZKA 3VXBA 1US5A 1I6BA 3QUFA 5DYHA 4EF1A 4F1YA 3EPEA 1L5TA 2AYSA 1KWHA 3H4ZA 4YICA 3QSLA 4U21A 1N7XA 4QFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6T A;  3Q25 A;  1R6Z A;  1JEV A;  1EZ9 A;  3UOR A;  1LAH E;  4ISU A;  1ZTY A;  4M1V A;  2XXW A;  3TOD A;  3UK4 A;  1HSL A;  1MXU A;  1Y3P A;  4F2O A;  4EXK A;  4QFO A;  4UA8 A;  2AL4 A;  2R9J A;  3H03 A;  1VE4 A;  4R9F A;  4F1U A;  4JWO A;  1EU8 A;  1DMB A;  4TOZ A;  1BKA A;  3V8X B;  5I56 B;  1JW4 A;  1PB8 A;  3OEL A;  5AA2 A;  1OLC A;  1F9B A;  1EZP A;  3A09 A;  3T9X B;  3W9V A;  4IO2 A;  2CMO A;  1OQH A;  2ABH A;  3PU5 A;  3L6G A;  3PUV E;  3SEY A;  1Y4C A;  3FXU A;  1A8F A;  2G93 A;  2UXA A;  2Z22 A;  1MY3 A;  3H06 B;  5TU0 A;  3RUM A;  3KOT A;  4IO4 A;  2H99 A;  2D21 A;  1Z7N E;  2OZZ A;  2Q2C A;  2R6G E;  1DOT A;  4RK2 A;  3S9N C;  2VOZ A;  1B3L A;  4QRZ A;  3H6T A;  3IAZ A;  4YB5 A;  1Y3Q A;  2O6A A;  4POW A;  4KQP A;  2ZXT A;  2ONK E;  1T0K A;  4X48 A;  4LQ5 A;  3I6V A;  5H8Q B;  3S9M C;  1UQW A;  4Q5T A;  4C1T A;  2E1S A;  1FW0 A;  2CZL A;  3K0V A;  2DE2 A;  4MFI A;  4I1D A;  5I59 B;  4H8I A;  3QK6 A;  3JV9 A;  4NF8 A;  2P2A A;  2REJ A;  3HV1 A;  3UP9 A;  2HXW A;  4ZE8 A;  4GVO A;  3RNN A;  4OYV A;  5HPQ A;  3O9P A;  5HBC A;  4MLQ A;  4K3F A;  5FTI A;  4N6P A;  4FAT A;  1Y1Z A;  2VGQ A;  3R26 A;  3MW0 A;  3IOR A;  3FIR A;  2XXY A;  1M5F A;  3IL1 B;  2THI A;  4JSD A;  4Z7E A;  3CFX A;  1UTB B;  1GGG A;  4DXC A;  1LCT A;  5AA4 B;  5F1Q A;  3BFU A;  1N0T A;  1JET A;  1N7W A;  3PUZ E;  3T9U A;  4YMB A;  5F7V A;  3O2A A;  1SDX A;  1S7Y A;  1ZKB A;  4H5G A;  4QF9 A;  3V83 A;  1JW1 A;  4GFR A;  1FTJ A;  4JXI A;  2XXQ A;  4ZS9 A;  1N04 A;  2UYE A;  3KJT A;  4L17 A;  5FHM A;  1Y9U A;  2H98 A;  1URG A;  3MVW A;  4Q30 B;  4U23 A;  1B2H A;  4F3B A;  3MJN A;  2PYY A;  1H44 A;  3OSQ A;  1JQF A;  3IB0 A;  1IQ7 A;  1QUJ A;  5H8F A;  3TEL A;  4G8N A;  1B32 A;  4BDQ A;  3EF7 A;  4KI0 E;  2I58 A;  3SDF A;  3TKD A;  4ELQ A;  1EH3 A;  1B51 A;  5AA3 A;  4HS7 A;  3PUY E;  5ITP A;  1YTV A;  1XVX A;  2E0S A;  4WKM A;  4U2R A;  4GIZ A;  4XKR A;  3TEP A;  2R71 A;  5K2X A;  4GD5 A;  3DLN A;  1B3F A;  4O3A A;  5EHS A;  4BDO A;  3MP1 A;  4RNS A;  4OFL A;  3KBR A;  3M8U A;  1FTL A;  4PFU A;  3S9E A;  1A7L A;  3M3K A;  4R9G A;  3VFJ A;  4WEP A;  1AMF A;  1MM6 A;  4YKI A;  1EZO A;  4X1B A;  1MS7 A;  1MQD A;  3C36 A;  4PFW A;  4RYA A;  3S4U A;  3U8Q A;  5DEX A;  4EF2 A;  2F97 A;  4NWC A;  4X1D A;  1B46 A;  2I4B A;  3FVG A;  3MP6 A;  2UVH A;  4G68 A;  2Z8D A;  5H8N A;  4C1U A;  5I57 A;  3TTM A;  1LBC A;  3Q27 A;  2UVG A;  1LBB A;  4HTG A;  4OFO A;  1OIB A;  1TWY A;  1ZJL A;  2RKM A;  4F18 A;  1SW2 A;  5JEI A;  1P1Q A;  4OET A;  5JTY A;  3VVD A;  3KN8 A;  4AB5 A;  1B05 A;  1LST A;  2X7P A;  2AL5 A;  3CFL A;  3OO7 A;  2DVZ A;  2ZYN A;  2NOO A;  1OQG A;  4OVJ A;  4YKJ A;  4DIG A;  5A5X B;  4F19 A;  2Y7I A;  4G2Z A;  3TUS A;  2O1L A;  3FJ7 A;  4F3P A;  1HSJ A;  3A3C A;  3QYT A;  3FV1 A;  3TQL A;  3MPL A;  2XXT A;  1URS A;  4JSO A;  3SKP A;  1URD A;  3KSX A;  2DE3 A;  3K6X A;  3KN7 A;  1M5E A;  1IXC A;  4JDF A;  3CIJ A;  1AOV A;  2F6P A;  2Y7P A;  3DP8 A;  1M5D A;  5CC2 A;  3ILT B;  3IO6 A;  1FCK A;  5CM6 A;  3VVE A;  4GXS B;  5I2N B;  1AL3 A;  4OMB A;  2DYX A;  2IEE A;  3ODB A;  3HPI A;  1LB8 A;  3WAF A;  2OWS A;  1QW0 A;  4MLV A;  4OFJ A;  2ANJ A;  5I84 A;  3PMX A;  5CMM A;  3LC8 A;  4IO3 A;  4KHZ E;  4KR5 A;  4P0G A;  2V93 A;  1LFI A;  2QL3 A;  2Y84 A;  3MZB A;  1OLA A;  3BBR A;  3G3K A;  4MBP A;  2QJE A;  1A55 A;  4NED A;  4R6Y A;  1FTK A;  2I6E A;  4U1Z A;  3CFZ A;  4EQ7 A;  1MH3 A;  2DVC A;  3FZV A;  1MPC A;  1BP5 A;  5ICQ A;  4BDL A;  4NWD A;  4OHN A;  1IZ1 A;  5H8Q A;  2HCA A;  3U92 A;  4FAJ A;  5TP9 A;  3G3I A;  2A5T B;  4EQ9 A;  2OBG A;  3EQ1 A;  5KDT B;  3MP8 A;  3V89 B;  2DWA A;  4P11 A;  1H76 A;  4DZ1 A;  5CRY A;  2REG A;  4QFL A;  3KZG A;  2XXR A;  4FEB A;  4GL8 A;  1TT1 A;  3OEM A;  4ZED A;  2Z8E A;  1DPE A;  1WDN A;  1SW1 A;  1MY4 A;  2I0B A;  1FQF A;  2Q88 A;  2QMW A;  3C35 A;  3IB2 A;  3IJO B;  3K2D A;  3KN3 A;  3L6H A;  3RTW B;  5L9S A;  1XOC A;  2VHA A;  2O68 A;  1GTK A;  1M5B A;  1NH8 A;  4YKK A;  2ALU A;  1UTH B;  4PQJ A;  3DP4 A;  1SBP A;  3U1O A;  1AIV A;  2F5X A;  4EDP A;  2V3T A;  3IK6 B;  5I2N A;  1XS5 A;  4KCD A;  4XTC Q;  1IXH A;  3S2V A;  4QSE A;  5CI5 A;  4Q8R A;  2RC7 A;  3PPP A;  3KG2 A;  3MVY A;  4IB2 A;  3QUJ A;  1B5J A;  4ZEI A;  2XXP A;  2F34 A;  2XXI A;  2ZMB A;  2ZNT A;  3OSR A;  3C31 A;  3O29 A;  2F6G A;  2O1M A;  4FJP A;  4KPT A;  1MY0 A;  4F3S A;  3RTF B;  3HST A;  5A5X A;  3K00 A;  1ZIU A;  3TZA A;  1US4 A;  3PPQ A;  4RPO A;  1O7T A;  3OXN A;  4NF6 A;  5H8F B;  3FGS A;  4R6H A;  2DE4 A;  1PBQ A;  3OO9 A;  4YKP A;  4GXA A;  4NE4 A;  1A40 A;  4F31 B;  3PUW E;  5KDT A;  5FHO A;  1ATG A;  5CMB A;  1SW5 A;  3HHG A;  1H45 A;  1GV8 A;  2RC8 A;  2UYF A;  3JYR A;  5M2V A;  3T9H B;  1N3W A;  1VR5 A;  3CI8 A;  3GBB A;  3PD8 A;  5JK4 A;  4GQO A;  3RLF E;  2I48 A;  1POT A;  1B0H A;  2I3W A;  2Z8F A;  2H25 A;  4LA9 A;  2QS4 A;  4ZEK A;  3TTN A;  4F29 A;  4DXU A;  3RPW A;  2H5Y A;  3P7I A;  1NFT A;  2Y7W A;  4BDR A;  4R2F A;  3LSL A;  1B1X A;  2O51 A;  1JVX A;  3LSX A;  3LSW A;  3G3F A;  4OWD A;  4WED A;  1ANF A;  2DWJ A;  4O3C A;  1GVC A;  1TFD A;  1B3G A;  3DEL B;  3W15 C;  4DLD A;  4R74 A;  5FTH A;  3USD A;  1B0L A;  1XVY A;  1NH7 A;  1B40 A;  4R75 A;  5AA1 A;  3ZS6 A;  4F1V A;  4U1O A;  3U94 A;  4R73 A;  4DXB A;  3FD3 A;  4LVQ A;  5AA2 B;  4ZE9 A;  3LR1 A;  3KOS A;  2QS2 A;  3RQT A;  1NKX A;  1TFA A;  3WAE A;  4RPN A;  2ONR A;  4ELP A;  4ND9 A;  1FQA A;  3N5L A;  3SES A;  1QKB A;  4H67 A;  3OO6 A;  1MM7 A;  2D3I A;  2O69 A;  1LLS A;  3H7M A;  3VLV A;  5CBR A;  4RA1 A;  1JW5 A;  4P0I A;  5AA2 D;  2V3Q A;  2QMX A;  4IGR A;  4E0W A;  2NWJ A;  1MPB A;  4THI A;  4YAH X;  4GRK A;  4GWO A;  1I69 A;  1UIV A;  1XHY A;  1QUI A;  1D9Y A;  2ESN A;  4WXJ A;  3EHS A;  2X7Q A;  3K6U A;  3N6U A;  4KFQ A;  4XKQ A;  1LAX A;  3DP6 A;  3ILU B;  3QAX A;  4FE8 A;  3MWB A;  4KYE A;  1A99 A;  1CE2 A;  1Y4T A;  3RN8 A;  4PET A;  1B4H A;  1NNF A;  3C32 A;  2ZYM A;  3O6H A;  1Y20 A;  1PDA A;  2DS9 A;  3CSG A;  4ELO A;  5H8S A;  4G8M A;  2DP8 A;  1XC1 A;  5I56 A;  3IOT A;  1ZMG A;  1LB9 A;  1LCF A;  4N13 A;  2I0C A;  2Z23 A;  3CVG A;  1ZLQ A;  3K6W A;  4E0X A;  5KCJ A;  4EUO A;  2Q9T A;  1Y1M A;  2F8D A;  3K02 A;  3ZKK A;  3AXF A;  3KEI A;  3TYH A;  2QS1 A;  1B7H A;  3FVO A;  2RCA A;  3BFT A;  4OTE A;  2RF1 A;  3MQ9 A;  1IIT A;  4GL0 A;  5DEX B;  3VE1 B;  3QIM A;  3SEX A;  1D9V A;  1GR2 A;  1MY1 A;  5H8N B;  1IEJ A;  2ZYK A;  3ONM A;  1USY E;  2PMS A;  2FA7 A;  3FJM A;  4YU0 A;  1IIW A;  2UVJ A;  4IGT A;  3TAJ A;  4NMY A;  2QS3 A;  2RCB A;  3CSB A;  3G3H A;  3E3K A;  3OD7 A;  3PPR A;  1SYH A;  5ICT A;  1RYO A;  2D5W A;  4H6D A;  4PFY A;  4TQU Q;  3TTK A;  4IY6 A;  4X9T A;  3N6T A;  1FTM A;  4NF4 A;  1AH5 A;  5KZT A;  4FED A;  2G29 A;  3I3V A;  2BJJ X;  2F36 A;  2FYI A;  2V25 A;  2VD2 A;  2NXO A;  3BKI B;  3LUY A;  3TDJ A;  4PE5 B;  4I62 A;  5B70 A;  2Q8J A;  2DOJ A;  2IA4 A;  1B58 A;  2PBW A;  3CR9 A;  2O7I A;  1Z7M E;  1WOD A;  4G4P A;  4OES A;  4RK9 A;  4R2B A;  3OMB A;  3E9X A;  4N07 A;  3H6W A;  1P1N A;  3O97 A;  3QXM A;  4EXL A;  1B5I A;  3M3L A;  1SQY A;  3UGW A;  5IAI A;  3PD9 A;  2ZYO A;  2NUV A;  1JNF A;  3A3U A;  3PMW A;  3R7X A;  3SEU A;  4F2Q A;  5DVF A;  2VD3 A;  4NF6 B;  3IOV A;  2FNC A;  3TCH A;  3JZJ A;  2OK2 A;  3F11 A;  1MRP A;  1QJM A;  5KCJ B;  1JEU A;  3GXA A;  3IB1 A;  1OVB A;  2OCU A;  3N26 A;  4IO7 A;  2XD2 A;  3MVX A;  3VLW A;  3FXR A;  4GOT A;  2HEU A;  3PUX E;  1MDQ A;  4QSC A;  4Z0I A;  1NNK A;  2DSF A;  4KCC A;  3U93 A;  2XXV A;  3HCQ A;  3CG1 A;  3VXC A;  3FUZ A;  4ECF A;  3CG3 A;  4HCY A;  1FTO A;  3B6W A;  2I3V A;  3ZSF A;  1PC3 A;  3O6G A;  5DVJ A;  4RY1 A;  1VFE A;  5L9M A;  4H5F A;  4UAC A;  2Y7K A;  1MY2 A;  4NF4 B;  1FQB A;  4ZZA A;  3U72 A;  3UN6 A;  2RIN A;  4AQ4 A;  4C0R A;  1PB7 A;  4LUB A;  4G68 C;  1XT8 A;  1OVT A;  1SI0 A;  2O84 X;  2I4C A;  4LZ8 A;  4NF5 B;  5B7D A;  2YPN A;  3E13 X;  3EN3 A;  3M3F A;  1NL5 A;  1N76 A;  3T66 A;  4YZZ A;  4QHQ A;  3V5A A;  5I57 B;  1LAG E;  4OZ9 A;  3MBP A;  1YPN A;  1ZU0 A;  3C34 A;  4PP0 A;  3VVF A;  1IXG A;  3IX1 A;  1Q1K A;  1YCJ A;  3R6U A;  4Q0C A;  1MXX A;  3Q26 A;  3ZKL A;  5I58 B;  5CMK A;  2O7U A;  4IY5 A;  1I6A A;  1P99 A;  1SW4 A;  1B3E A;  1Y3N A;  2RC9 A;  1B7Z A;  3FVN A;  2H9B A;  3MAM A;  3KGC A;  4GLI A;  4ONY A;  5TPA A;  3RT6 B;  3TMG A;  1MDP 1;  3K4U A;  2M8C A;  3GLB A;  1FQD A;  1N3X A;  3H6U A;  4BDM A;  5CBS A;  3K1P A;  4KYS A;  2HFB A;  1NNP A;  2P0S A;  1MQG A;  1ELJ A;  1R1N A;  2OLB A;  4H8J A;  1SD3 A;  1YAE A;  4RXL A;  5L9O A;  5ELV A;  2PT1 A;  4IO5 A;  4XKP A;  1QUK A;  3KSJ A;  1QVS A;  4JBZ A;  4I9D A;  2XXU A;  4U4X A;  5BWJ A;  3VDF A;  2H4I A;  4H65 A;  2PT2 A;  3T96 B;  2OWT A;  4QSD A;  1A54 A;  2WKY A;  2ZNU A;  4OEV A;  4BLA A;  1O64 A;  2PVU A;  3OEK A;  1SVX B;  4POX A;  2KLF A;  3SER A;  2X26 A;  3FJG A;  4NTL A;  4ZDM A;  3UA8 A;  1II5 A;  3VLU A;  3FVK A;  3K1M A;  3O28 A;  3MC2 A;  4MH5 A;  1UTH A;  4F39 A;  3HHF A;  3TTR A;  2V84 A;  4LP2 B;  1PEB A;  1I6Q A;  3EHU A;  3FAS A;  3OO8 A;  5CMC A;  3MPK A;  2XX8 A;  3CRB A;  1B1H A;  1J1N A;  3PMV A;  3K01 A;  4XXU A;  4F22 A;  5AA4 A;  1B4Z A;  3SEV A;  1DSN A;  4JWX A;  3H6V A;  1ZBM A;  2NVU B;  1MH4 A;  3RY3 A;  1FQC A;  5DVI A;  5TPA B;  3C4M A;  1OMP A;  3B7D A;  2A5S A;  3C33 A;  3LBS A;  5H8H A;  4U4S A;  5TP9 B;  4MF3 A;  5IKB A;  3FV2 A;  1PB9 A;  3HN0 A;  3KJ7 A;  2XX9 A;  3G7W A;  4H0W A;  4O3B A;  2DXR A;  4NF8 B;  4OXV A;  1DTG A;  3EHT A;  3N94 A;  3Q29 A;  4JB7 A;  3SEW A;  1MPD A;  1USY H;  1FQE A;  4OER A;  5I2K B;  2DQV A;  3E4R A;  4GF8 A;  3I5O A;  4NF5 A;  4YB6 A;  3TFL A;  1MXW A;  1VFD A;  1DPP A;  1IUD A;  1PBP A;  2HZL A;  1QUL A;  4IO6 A;  5ITO A;  3G3G A;  3GZG A;  4H1X A;  4LON B;  1S9T A;  3THI A;  4QFN A;  1D3K A;  1MXZ A;  2B65 A;  1B52 A;  4U22 A;  5DT6 A;  4ZZE A;  2UVI A;  2YJP A;  4LZ5 A;  1MQI A;  1IXI A;  2VP1 A;  3TCG A;  4ESX A;  1LFH A;  4BDN A;  2F7B A;  4RJZ A;  3SET A;  4LZ7 A;  1JVY A;  5K2Y A;  1N84 A;  3PPN A;  5EHM A;  3IO4 A;  2HQ0 A;  5BUU A;  1RYX A;  3HO7 A;  4R72 A;  4DCX A;  2OJT A;  2Q89 A;  2XD3 A;  1DTZ A;  4OEU A;  2F35 A;  4QFK A;  1HSE A;  4XIG Q;  2GH9 A;  5EYF A;  1UIU A;  3IR1 A;  4FEC A;  2QPQ A;  3PPO A;  2F7C A;  1P1O A;  2YLN A;  4HW8 A;  3RGY A;  5H8H B;  3PGF A;  2F78 A;  1A8E A;  3RT8 A;  1CB6 A;  3MZ9 A;  4HCW A;  4M4G A;  3H3G A;  3T22 A;  1M5C A;  1LFG A;  4KYD A;  1SYI A;  3K1N A;  1R9Q A;  2DWH A;  1O63 A;  2XX7 A;  1MG1 A;  2LAO A;  2PX1 A;  2Y7R A;  1UTB A;  1MXV A;  4FOR A;  3TCF A;  2GFE A;  2Q2A A;  3UIF A;  4ELR A;  4DDD A;  3MVZ A;  1B9J A;  4F3G A;  2A5T A;  3ECR A;  3DM0 A;  3GBA A;  3Q28 A;  4YB7 A;  2DWI A;  2QSX A;  2F7A A;  5I58 A;  3OOA A;  1NMU A;  2HAU A;  5HM4 B;  2ONS A;  3D4C A;  4LAT A;  1MXY A;  4ESW A;  5LOM A;  4G68 B;  2HAV A;  2XHD A;  2GHB A;  3IJX B;  4DE8 A;  3O6I A;  1BIY A;  1S50 A;  1P1W A;  2QRY A;  1QKA A;  3C9H A;  1WVJ A;  4G8H A;  2B3B A;  4KD5 A;  4DCY A;  4XKN A;  2AIX A;  1R9L A;  1RKM A;  3D4G A;  3G3J A;  5I59 A;  3W9W A;  5DTB A;  1D4N A;  3MUQ A;  2GHA A;  4LQ2 A;  1B6H A;  1B5H A;  2B3F A;  4TLM B;  5AE4 A;  2DXY A;  4ZEF A;  3MZ1 A;  3PV0 E;  3B6Q A;  1BLF A;  1LAF E;  3TPA A;  1H3D A;  4AB6 A;  3S9L C;  2GRV A;  2P1S A;  1B7U A;  4TLL B;  1MQJ A;  5J1D A;  3IOU A;  4JWY A;  1TXF A;  2I49 A;  4ZEB A;  3O66 A;  1BTJ A;  2XXH A;  4OEN A;  1B3H A;  1H43 A;  1VSO A;  1P1U A;  4G77 A;  1NNT A;  1SI1 A;  3TTL A;  1Q35 A;  4OQO A;  3TQW A;  4YMA A;  3T9V A;  4I8C A;  3VV5 A;  3LSF B;  3K6V A;  4PFT A;  5I2K A;  1MQH A;  2XXX A;  4EQB A;  4ZEC A;  2W7Y A;  4R6K A;  5L8D A;  3IOW A;  5FHN A;  4FIM A;  1LGB C;  3OEN A;  3FXQ A;  2V3U A;  3KFM A;  3FAT A;  5ISU A;  2ZNS A;  5JTY B;  1POY 1;  3T93 B;  2HZK A;  3VXB A;  1US5 A;  1I6B A;  3QUF A;  5DYH A;  4EF1 A;  4F1Y A;  3EPE A;  1L5T A;  2AYS A;  1KWH A;  3H4Z A;  4YIC A;  3QSL A;  4U21 A;  1N7X A;  4QFP A; 
#chains in the Genus database with same CATH topology
 3B6T A;  1LAH E;  1DK4 A;  1MXU A;  3B8B A;  5FBP A;  1OLC A;  1EZP A;  2CMO A;  3SEY A;  1Y4C A;  3FXU A;  2D21 A;  2OZZ A;  1B3L A;  4QRZ A;  3H6T A;  3IAZ A;  4YB5 A;  4X48 A;  3I6V A;  1FW0 A;  5I59 B;  3JV9 A;  2P2A A;  2REJ A;  3UP9 A;  4GVO A;  3RNN A;  5HPQ A;  3O9P A;  4MLQ A;  5FTI A;  4N6P A;  3FIR A;  4Z7E A;  1N0T A;  1N7W A;  4QF9 A;  4JXI A;  2WBB A;  5LDZ A;  4JVD A;  4U23 A;  4F3B A;  3OSQ A;  5H8F A;  4P8B A;  4PFR A;  3PUY E;  4NHB A;  1YTV A;  4WKM A;  4XKR A;  2R71 A;  4O3A A;  4RNS A;  4R9G A;  3U8Q A;  1MS7 A;  3S4U A;  5DEX A;  1B46 A;  2Z8D A;  1LBC A;  4HTG A;  2RKM A;  4F18 A;  1SW2 A;  3KN8 A;  1B05 A;  3CFL A;  2Q8M A;  2DVZ A;  2ZYN A;  4DIG A;  5A5X B;  4G2Z A;  1NV0 A;  2O1L A;  1HSJ A;  3MPL A;  4JSO A;  4NAP A;  3SKP A;  3K6X A;  1M5E A;  1IXC A;  1AOV A;  4MNP A;  3ILT B;  1FCK A;  2B4L A;  3ODB A;  3WAF A;  3PMX A;  5CMM A;  2QL3 A;  2Y84 A;  3MZB A;  1Q9D A;  4U1Z A;  4EQ7 A;  2F3B A;  1RDZ A;  4NWD A;  4OHN A;  2OBG A;  4P11 A;  2REG A;  4QFL A;  2XXR A;  4FEB A;  4ZED A;  1LEV A;  2Z8E A;  2Q88 A;  3K2D A;  1FQF A;  3IB2 A;  3KN3 A;  3C35 A;  3RTW B;  5IZ3 B;  2CZH A;  2VHA A;  4YKK A;  1SBP A;  1AIV A;  2V3T A;  2QFL A;  1XS5 A;  2RC7 A;  4IB2 A;  2F34 A;  2XXI A;  3OSR A;  1CNQ A;  3C31 A;  4P1L A;  4MCO A;  4FJP A;  5A5X A;  5H8F B;  4NF6 A;  2DE4 A;  1PBQ A;  4YKP A;  4GXA A;  3PUW E;  5KDT A;  2GQ1 A;  4G61 A;  5CMB A;  2UYF A;  3CI8 A;  3PD8 A;  3RLF E;  1B0H A;  4F29 A;  3A29 A;  4R2F A;  1JVX A;  3LSW A;  4NG7 A;  4WED A;  1ANF A;  2DWJ A;  3ZS6 A;  4F1V A;  3FD3 A;  4LVQ A;  3LR1 A;  3RQT A;  1QKB A;  2ZZW A;  1MM7 A;  1LLS A;  5AA2 D;  4THI A;  4GWO A;  1UIV A;  4P1E A;  1QUI A;  5ET5 A;  4KFQ A;  4XKQ A;  1LAX A;  2ZYM A;  5H8S A;  4N81 A;  1XC1 A;  5EQA A;  5KCJ A;  1ZLQ A;  4E0X A;  4EUO A;  3K02 A;  3ZKK A;  5EQ8 A;  3FVO A;  4GL0 A;  3QIM A;  1MY1 A;  5H8N B;  1IEJ A;  1EYI A;  2PMS A;  1LBV A;  4PF8 A;  4N8G A;  4NMY A;  3G3H A;  3PPR A;  1SYH A;  1RYO A;  4PFY A;  4IY6 A;  3N6T A;  1AH5 A;  1DBZ A;  3LUY A;  2BJJ X;  2FYI A;  2V25 A;  2NXO A;  5B70 A;  1B58 A;  4G4P A;  4R2B A;  2QVU A;  1KA0 A;  5IAI A;  1B5I A;  4N17 A;  2FBP A;  3SEU A;  5IGA A;  2VD3 A;  2FNC A;  3TCH A;  2OK2 A;  3F11 A;  1QJM A;  4IO7 A;  2HXR A;  3FXR A;  2HEU A;  1NI9 A;  2DSF A;  4GWZ A;  4KCC A;  3U93 A;  2XXV A;  4ECF A;  4PFI A;  3ZSF A;  1BK4 A;  1INP A;  1PC3 A;  5L9M A;  1VFE A;  4H5F A;  4UAC A;  1MY2 A;  3U72 A;  3UN6 A;  2RIN A;  2I4C A;  3EN3 A;  3M3F A;  4YZZ A;  4OZ9 A;  2WBD A;  1YPN A;  4Q0C A;  1YCJ A;  4X04 A;  3ZKL A;  2O7U A;  1P99 A;  3FVN A;  1Y3N A;  1LBX A;  2ZZX A;  4ONY A;  3TMG A;  3RT6 B;  1MDP 1;  2M8C A;  1FQD A;  4PFB A;  3H6U A;  4PBQ A;  1ELJ A;  1R1N A;  4RXL A;  1EYK A;  5BWJ A;  4H65 A;  4OEV A;  1O64 A;  3OEK A;  3SER A;  2VPO A;  2X26 A;  3VLU A;  3EHU A;  5CMC A;  2XX8 A;  3PMV A;  1B4Z A;  3LUZ A;  1RDY A;  4JWX A;  1MH4 A;  4PGP A;  3C4M A;  1IMD A;  3FV2 A;  1PB9 A;  4MIJ A;  3EHT A;  1MPD A;  1FBD A;  4OER A;  4GF8 A;  1VFD A;  2KR0 A;  3GZG A;  3MYU A;  1S9T A;  4LON B;  3THI A;  1D3K A;  2P3N A;  2B65 A;  2YJP A;  1IMF A;  4LZ7 A;  3PPN A;  5BUU A;  4DCX A;  2Q89 A;  4XIG Q;  4OEU A;  2GH9 A;  4JVI A;  4FEC A;  2QPQ A;  3PPO A;  1P1O A;  3RGY A;  2F78 A;  1A8E A;  1FBF A;  4KYD A;  2XX7 A;  2Y7R A;  2GFE A;  4F3G A;  3GBA A;  3Q28 A;  1DCU A;  2F7A A;  1MXY A;  4ESW A;  3IJX B;  3S9M C;  4KD5 A;  1QKA A;  1WVJ A;  4XKN A;  1B6H A;  5AE4 A;  3TPA A;  4OVR A;  3IOU A;  4JWY A;  1KZ8 A;  4ZEB A;  3O66 A;  2XXH A;  4OEN A;  1VSO A;  4H45 A;  4MHF A;  4I8C A;  4PFT A;  1MQH A;  2PFZ A;  4FIM A;  3FAT A;  1POY 1;  2HZK A;  1I6B A;  1L5T A;  4QFP A;  3UK4 A;  2XXW A;  2AL4 A;  2R9J A;  1VE4 A;  4JWO A;  1EU8 A;  1DMB A;  3V8X B;  5I56 B;  1PB8 A;  3OEL A;  5EYH A;  3A09 A;  1FJ6 A;  1IMA A;  2UXA A;  2Z22 A;  4IO4 A;  2H99 A;  4FBP A;  2ONK E;  1YZ0 A;  4C1T A;  4Q5T A;  2E1S A;  1G0I A;  2DE2 A;  4MFI A;  3QK6 A;  2HXW A;  4ZE8 A;  1NV7 A;  4OYV A;  4K3F A;  3IOR A;  2XXY A;  3RPL B;  4XEQ A;  2V4C A;  1GGG A;  3PUZ E;  3T9U A;  1JET A;  4YMB A;  3O2A A;  4H5G A;  1ZKB A;  2FVZ A;  2DDK A;  2UYE A;  3KJT A;  4L17 A;  5FHM A;  4NF0 A;  2PYY A;  3IB0 A;  1IQ7 A;  3TEL A;  1B32 A;  4KI0 E;  1EH3 A;  3B50 A;  2XXK A;  1QGX A;  1FPG A;  4GD5 A;  3DLN A;  1NUZ A;  3KBR A;  3M8U A;  1A7L A;  4WEP A;  4PFW A;  4X1D A;  4G68 A;  3MP6 A;  4HE1 A;  5I57 A;  2UVG A;  4OFO A;  1ZJL A;  1NV2 A;  4I3E A;  3VVD A;  4AB5 A;  1LST A;  3T0J A;  1FTA A;  1OQG A;  4OVJ A;  4F3P A;  3TQL A;  1FBG A;  4MNI A;  4GWU A;  2KQZ A;  1URS A;  1URD A;  1FBE A;  4GXS B;  5I2N B;  4OMB A;  4N6D A;  4OFJ A;  4KXP A;  1IMC A;  2V93 A;  1FBC A;  3G3K A;  2Y5L A;  2QJE A;  4NED A;  2I6E A;  2XA5 A;  1MPC A;  1BP5 A;  4BDL A;  3U92 A;  4FAJ A;  3G3I A;  5KDT B;  3V89 B;  4GL8 A;  1TT1 A;  3OEM A;  5F24 A;  4NQ8 A;  1DPE A;  1GTK A;  4PQJ A;  3U1O A;  4EDP A;  5I2N A;  3IK6 B;  3S2V A;  2PCR A;  2ZMB A;  2ZNT A;  2F6G A;  3RTF B;  4PBH A;  3OXN A;  3FGS A;  4R6H A;  3OO9 A;  1FPF A;  3HHG A;  1H45 A;  5M2V A;  5JK4 A;  1VR5 A;  2Z8F A;  2H25 A;  3RPW A;  2H5Y A;  3P7I A;  1NFT A;  4BDR A;  4GBV A;  4PAI A;  4DLD A;  1GVC A;  3DEL B;  4R75 A;  5AA1 A;  1B40 A;  3PTY A;  4DXB A;  3T1B A;  3WAE A;  1TFA A;  2O69 A;  3H7M A;  3VLV A;  2CEY A;  5I7I A;  1JW5 A;  2NWJ A;  2ESN A;  3EHS A;  2X7Q A;  3ILU B;  4FE8 A;  3MWB A;  4XF5 A;  1A99 A;  1CE2 A;  4PC9 A;  3O6H A;  4ELO A;  3IFA A;  3RPL A;  1LB9 A;  4N13 A;  3CVG A;  3K6W A;  1Y1M A;  1B7H A;  4N8Y A;  3SEX A;  1D9V A;  4YU0 A;  3ONM A;  2FA7 A;  3FJM A;  4IGT A;  3OD7 A;  1FPD A;  4OA4 A;  2G29 A;  5KZT A;  2VD2 A;  3BKI B;  3TDJ A;  2DOJ A;  2PBW A;  2O7I A;  4OES A;  3E9X A;  3QXM A;  3M3L A;  4GWX A;  2ZYO A;  4I40 A;  4F2Q A;  2QVR A;  1K9Z A;  3IOV A;  1OVB A;  2OCU A;  2XD2 A;  3MVX A;  2P3V A;  3PUX E;  4XFE A;  4HCY A;  1FTO A;  3B6W A;  4GBW A;  2Y7K A;  1FQB A;  4ZZA A;  3EKI A;  4AQ4 A;  1LBW A;  4G68 C;  3NOH A;  4LZ8 A;  2O84 X;  5B7D A;  1N76 A;  3V5A A;  3C34 A;  4PP0 A;  2HPG A;  1IXG A;  3U65 A;  3IX1 A;  1Q1K A;  1MXX A;  3Q26 A;  4HW8 A;  3MAM A;  1SW4 A;  3PGF A;  5TPA A;  3VDF A;  3KGC A;  4NN3 A;  4BDM A;  2FIX A;  5CBS A;  3K1P A;  2HFB A;  2P0S A;  1SD3 A;  1YAE A;  3D1R A;  4XKP A;  1QVS A;  4JBZ A;  2XXU A;  2H4I A;  2PT2 A;  1A54 A;  1NUY A;  2PVU A;  1SVX B;  4ZDM A;  3MC2 A;  4MH5 A;  3TTR A;  2V84 A;  4LP2 B;  5ET8 A;  3OO8 A;  3MPK A;  1J1N A;  4XXU A;  5AA4 A;  1ZBM A;  3RY3 A;  5TPA B;  5H8H A;  5TP9 B;  4MF3 A;  3HN0 A;  4H0W A;  4P47 A;  2DXR A;  4NF8 B;  4OXV A;  3N94 A;  3SEW A;  1IUD A;  4JVC A;  5ITO A;  4QFN A;  1MXZ A;  2VP1 A;  3TCG A;  4ESX A;  5EHM A;  2HQ0 A;  1RYX A;  3IFC A;  2OJT A;  4QFK A;  1UIU A;  5H8H B;  3RT8 A;  2XWI A;  2LAO A;  1SPI A;  1UTB A;  1MXV A;  2VPN A;  2Q2A A;  1FRP A;  4DDD A;  3MVZ A;  3ECR A;  5I58 A;  4LAT A;  2XHD A;  2GHB A;  4DE8 A;  1P1W A;  2QRY A;  2B3B A;  5I59 A;  1RKM A;  3MUQ A;  2GHA A;  1B5H A;  3HFU A;  4TLM B;  4ZEF A;  3PV0 E;  1LAF E;  2P1S A;  1B7U A;  4TLL B;  1K9Y A;  2I49 A;  1H43 A;  5IM2 A;  4OQO A;  3TQW A;  4YMA A;  3T9V A;  5I2K A;  4EQB A;  5L8D A;  1LGB C;  4GX4 A;  5ISU A;  5JTY B;  4F1Y A;  3EPE A;  1G0H A;  1R6Z A;  1EZ9 A;  3TOD A;  4ISU A;  1ZTY A;  4M1V A;  1HSL A;  4F2O A;  3H03 A;  4F1U A;  4R9F A;  1JW4 A;  4O7M A;  1OQH A;  3PUV E;  3L6G A;  2B4M A;  1A8F A;  2G93 A;  3H06 B;  1MY3 A;  3KOT A;  4OVT A;  3LV0 A;  1Z7N E;  2R6G E;  2Q2C A;  1DOT A;  4I3Y A;  2OWZ A;  2O6A A;  4POW A;  4KQP A;  2ZXT A;  5H8Q B;  3K0V A;  3RYD A;  4H8I A;  3HV1 A;  4FAT A;  2VGQ A;  3R26 A;  3MW0 A;  3BIG A;  3IL1 B;  2THI A;  1UTB B;  3KBZ A;  4DXC A;  5AA4 B;  5F1Q A;  3BFU A;  2CZK A;  4P3L A;  1SDX A;  1S7Y A;  2QVV A;  3V83 A;  1JW1 A;  4GFR A;  1FTJ A;  2XXQ A;  2BJI A;  4ZS9 A;  4O8M A;  1Y9U A;  3SZP A;  4Q30 B;  3MJN A;  1H44 A;  1JQF A;  1QUJ A;  5EQ7 A;  3TKD A;  1B51 A;  5AA3 A;  5ITP A;  2E0S A;  4U2R A;  3TEP A;  4BDO A;  1B3F A;  4OVQ A;  1FTL A;  3S9E A;  3M3K A;  1MM6 A;  4YKI A;  1EZO A;  4X1B A;  3C36 A;  1MQD A;  4EF2 A;  2F97 A;  4NWC A;  5H8N A;  4C1U A;  4H46 A;  1LBB A;  5ESY A;  5JTY A;  4OET A;  5I3S A;  3OO7 A;  2X7P A;  4YKJ A;  2NOO A;  3TUS A;  3FJ7 A;  3A3C A;  3QYT A;  1FSA A;  3FV1 A;  2XXT A;  3KSX A;  4JDF A;  3CIJ A;  2F6P A;  4N6K A;  3DP8 A;  1M5D A;  5CC2 A;  3VVE A;  2DYX A;  2IEE A;  1LB8 A;  4HE2 A;  2ANJ A;  3LC8 A;  4IO3 A;  4KHZ E;  4KR5 A;  3BBR A;  4MBP A;  1FTK A;  1MH3 A;  2DVC A;  5H8Q A;  4GWW A;  4HXV A;  3EQ1 A;  4DZ1 A;  3BIH A;  3KZG A;  5LTC A;  1WDN A;  1MY4 A;  2QMW A;  1T0K A;  3L6H A;  1XOC A;  1M5B A;  1NH8 A;  3DP4 A;  2F5X A;  4KCD A;  2F3D A;  4Q8R A;  3KG2 A;  1B5J A;  2XXP A;  3O29 A;  2O1M A;  4KPT A;  1MY0 A;  4F3S A;  3QMF A;  3HST A;  3K00 A;  3TZA A;  1US4 A;  4RPO A;  4F31 B;  1A40 A;  4MAG A;  5A5L A;  1SW5 A;  2RC8 A;  3T9H B;  4GQO A;  1POT A;  2I3W A;  4ZEK A;  3LSL A;  1B1X A;  3LSX A;  5ET6 A;  2CEX A;  4O3C A;  3W15 C;  1TFD A;  3USD A;  1B0L A;  1XVY A;  1NH7 A;  4U1O A;  4ZE9 A;  3KOS A;  2QS2 A;  1NKX A;  1VDW A;  2ONR A;  1FQA A;  1NV1 A;  4H67 A;  3OO6 A;  4X8R A;  5CBR A;  4RA1 A;  4P0I A;  2V3Q A;  2JJK A;  2QMX A;  4E0W A;  1MPB A;  1XHY A;  4WXJ A;  5J16 A;  3K6U A;  3DP6 A;  3QAX A;  3RN8 A;  3C32 A;  3IOT A;  2I0C A;  2Z23 A;  4PF6 A;  2F8D A;  3AXF A;  4N15 A;  2RCA A;  2RF1 A;  1IIT A;  1USY E;  4MX6 A;  1IIW A;  2UVJ A;  2MKZ A;  3TAJ A;  2QS3 A;  2RCB A;  3CSB A;  5ICT A;  2D5W A;  4TQU Q;  3TTK A;  3E79 A;  2F36 A;  4PE5 B;  4I62 A;  2WEF A;  3CR9 A;  4RK9 A;  4PDD A;  1P1N A;  3O97 A;  4EXL A;  3UGW A;  3PD9 A;  3PMW A;  1NV4 A;  1JEU A;  3GXA A;  4PAF A;  1NUW A;  3VLW A;  4N91 A;  4QSC A;  4Z0I A;  1NNK A;  3VXC A;  3HCQ A;  5EQ9 A;  3CG3 A;  1XI6 A;  4MNC A;  1FPI A;  5DVJ A;  4LUB A;  1XT8 A;  4NF5 B;  3E13 X;  3T66 A;  4QHQ A;  3VVF A;  1FPL A;  3R6U A;  5CMK A;  1I6A A;  1B7Z A;  2H9B A;  3GLB A;  1N3X A;  4KYS A;  4H8J A;  5L9O A;  2PT1 A;  1QUK A;  4I9D A;  4QBA A;  2OWT A;  2WKY A;  2ZNU A;  4BLA A;  2KLF A;  3HHF A;  1I6Q A;  3FAS A;  1NUX A;  2WX9 A;  3CRB A;  3GYY A;  4F22 A;  3K01 A;  2L5V A;  1DSN A;  2XWV A;  5DVI A;  1OMP A;  3B7D A;  3LBS A;  2XX9 A;  3G7W A;  4O3B A;  2HHM A;  3Q29 A;  4JB7 A;  1USY H;  1FQE A;  4UAB A;  4NF5 A;  1NV3 A;  1MXW A;  2HZL A;  5DT6 A;  4LZ5 A;  1LFH A;  4IR8 A;  3KC1 A;  4BDN A;  2F7B A;  1JVY A;  5K2Y A;  1N84 A;  4R72 A;  2XD3 A;  1DTZ A;  2F35 A;  1HSE A;  5EYF A;  3IR1 A;  2F7C A;  2OX3 A;  2FHY A;  1KA1 A;  1CB6 A;  3CHG A;  3K1N A;  4GWS A;  2DWH A;  1O63 A;  3TCF A;  3UIF A;  2A5T A;  3DM0 A;  4GX3 A;  3OOA A;  5HM4 B;  2HAU A;  2ONS A;  5LOM A;  2HAV A;  3O6I A;  1BIY A;  1S50 A;  1AWB A;  3C9H A;  4DCY A;  3D4G A;  3W9W A;  4PGN A;  2DXY A;  1FJ9 A;  5J1D A;  1TXF A;  4G77 A;  1NNT A;  3VV5 A;  3LSF B;  3K6V A;  2W7Y A;  4R6K A;  3IOW A;  5FHN A;  1NV5 A;  2ZNS A;  3T93 B;  1US5 A;  5DYH A;  1D9Q A;  4QXD A;  3H4Z A;  1FBH A;  3QSL A;  1N7X A;  3Q25 A;  3UOR A;  1JEV A;  1Y3P A;  4EXK A;  4QFO A;  4UA8 A;  2CZI A;  4TOZ A;  1BKA A;  4PTK A;  5AA2 A;  1F9B A;  3T9X B;  3W9V A;  4IO2 A;  3PU5 A;  2ABH A;  5TU0 A;  3RUM A;  4RK2 A;  3S9N C;  2VOZ A;  1Y3Q A;  4LQ5 A;  1UQW A;  2CZL A;  4I1D A;  4NF8 A;  3E78 A;  5HBC A;  4PE3 A;  1Y1Z A;  4PCD A;  1M5F A;  5EYG A;  4JSD A;  2XWO A;  3CFX A;  1LCT A;  5F7V A;  1N04 A;  2H98 A;  1URG A;  3MVW A;  1B2H A;  4G8N A;  4BDQ A;  3EF7 A;  2I58 A;  3SDF A;  4ELQ A;  4HS7 A;  1XVX A;  1FBP A;  4GIZ A;  5K2X A;  5EHS A;  3MP1 A;  2WYK A;  4OFL A;  4PFU A;  4MJO A;  3VFJ A;  2ZZV A;  1AMF A;  4RYA A;  5T3J A;  2I4B A;  3FVG A;  2UVH A;  3TTM A;  3Q27 A;  1OIB A;  1TWY A;  5JEI A;  1P1Q A;  2AL5 A;  4F19 A;  2Y7I A;  2DE3 A;  3KN7 A;  2XWK A;  2Y7P A;  3IO6 A;  5CM6 A;  1AL3 A;  3HPI A;  2OWS A;  1QW0 A;  4MLV A;  5I84 A;  1IMB A;  4P0G A;  1LFI A;  4PDH A;  1OLA A;  4DI4 B;  4R6Y A;  1A55 A;  3CFZ A;  3FZV A;  1IZ1 A;  2HCA A;  5TP9 A;  2A5T B;  4EQ9 A;  3MP8 A;  2DWA A;  1H76 A;  5CRY A;  4OVS A;  1SW1 A;  2I0B A;  3IJO B;  3SET A;  5L9S A;  2O68 A;  2ALU A;  1UTH B;  4MMP A;  4XTC Q;  5IZ1 A;  1IXH A;  4QSE A;  5CI5 A;  3PPP A;  3MVY A;  3QUJ A;  3MST A;  4ZEI A;  3FBP A;  4P9K A;  1ZIU A;  3PPQ A;  1O7T A;  4NE4 A;  5FHO A;  1ATG A;  1GV8 A;  1LBY A;  3JYR A;  1N3W A;  3GBB A;  2I48 A;  3TTN A;  4LA9 A;  2QS4 A;  4DXU A;  2Y7W A;  1FPK A;  2O51 A;  3G3F A;  4OWD A;  1B3G A;  4R74 A;  5FTH A;  3U94 A;  4R73 A;  5AA2 B;  3ISP A;  4ELP A;  4RPN A;  4AS4 A;  4MEV A;  4ND9 A;  3SES A;  3N5L A;  1FPB A;  2D3I A;  5DW8 A;  4NX1 A;  4IGR A;  4O7I A;  4YAH X;  4GRK A;  1I69 A;  1D9Y A;  3N6U A;  4KYE A;  1Y4T A;  1IME A;  4PET A;  1B4H A;  1NNF A;  4PAK A;  1PDA A;  1Y20 A;  2DS9 A;  3CSG A;  4G8M A;  2DP8 A;  5I56 A;  1ZMG A;  1LCF A;  2Q9T A;  3KEI A;  3TYH A;  2QS1 A;  3BFT A;  4OTE A;  3MQ9 A;  5DEX B;  3VE1 B;  1GR2 A;  2ZYK A;  5IZ3 A;  3E3K A;  4H6D A;  1YYZ A;  4X9T A;  1FTM A;  4NF4 A;  4FED A;  3I3V A;  4DI3 D;  4P56 A;  2Q8J A;  2IA4 A;  1Z7M E;  1WOD A;  3OMB A;  4N07 A;  3H6W A;  1SQY A;  2NUV A;  4N4U A;  1JNF A;  2WYP A;  3A3U A;  3R7X A;  5DVF A;  4NF6 B;  3JZJ A;  1MRP A;  5KCJ B;  3IB1 A;  3N26 A;  5ET7 A;  4GOT A;  4GWY A;  1MDQ A;  2Q74 A;  3CG1 A;  3FUZ A;  2I3V A;  3O6G A;  4RY1 A;  4NF4 B;  4C0R A;  1PB7 A;  2Y5K A;  1OVT A;  1SI0 A;  2YPN A;  4NGU A;  1NL5 A;  5I57 B;  1LAG E;  3FXB A;  3MBP A;  1ZU0 A;  5I58 B;  4IY5 A;  2RC9 A;  1B3E A;  4GLI A;  3K4U A;  4O94 A;  1NNP A;  1MQG A;  4GX6 A;  2OLB A;  5ELV A;  4IO5 A;  1LBZ A;  3KSJ A;  4U4X A;  1FPE A;  3T96 B;  4QSD A;  4POX A;  3FJG A;  4NTL A;  3UA8 A;  1II5 A;  3FVK A;  3K1M A;  3O28 A;  1UTH A;  4F39 A;  5I5P A;  4OAN A;  1PEB A;  3ROJ A;  1B1H A;  3SEV A;  3H6V A;  2NVU B;  1FQC A;  2A5S A;  3C33 A;  4U4S A;  5IKB A;  3KJ7 A;  1DTG A;  5I2K B;  2DQV A;  3E4R A;  3TFL A;  3I5O A;  4YB6 A;  1DPP A;  1PBP A;  4IO6 A;  1QUL A;  3G3G A;  4H1X A;  4U22 A;  1B52 A;  2VT5 A;  4ZZE A;  2UVI A;  1MQI A;  1IXI A;  4RJZ A;  1FPJ A;  3IO4 A;  1JP4 A;  3HO7 A;  3KC0 A;  2PFY A;  2YLN A;  4LN5 A;  3MZ9 A;  4HCW A;  4M4G A;  3H3G A;  3T22 A;  1M5C A;  1LFG A;  1SYI A;  1R9Q A;  4OVP A;  1MG1 A;  2PX1 A;  2FIE A;  4FOR A;  1YXI A;  4ELR A;  1B9J A;  4YB7 A;  2DWI A;  2QSX A;  5IZZ A;  1NMU A;  3D4C A;  4G68 B;  5ICQ A;  4G8H A;  2AIX A;  1R9L A;  3G3J A;  5DTB A;  1D4N A;  4LQ2 A;  2B3F A;  3MZ1 A;  3B6Q A;  1BLF A;  4AB6 A;  3S9L C;  1H3D A;  2GRV A;  1MQJ A;  1BTJ A;  1B3H A;  2R8T A;  1P1U A;  1EYJ A;  1SI1 A;  3TTL A;  1Q35 A;  4HE0 A;  2XXX A;  4ZEC A;  1RDX A;  4AS5 A;  3OEN A;  3FXQ A;  2V3U A;  3KFM A;  1NV6 A;  3VXB A;  4EF1 A;  3QUF A;  2AYS A;  1KWH A;  4YIC A;  4U21 A; 
#chains in the Genus database with same CATH homology
 3B6T A;  3Q25 A;  1R6Z A;  1JEV A;  1EZ9 A;  3UOR A;  1LAH E;  4ISU A;  1ZTY A;  4M1V A;  2XXW A;  3TOD A;  3UK4 A;  1HSL A;  1MXU A;  1Y3P A;  4F2O A;  4EXK A;  4QFO A;  4UA8 A;  2AL4 A;  2R9J A;  3H03 A;  1VE4 A;  4R9F A;  4F1U A;  4JWO A;  1EU8 A;  1DMB A;  4TOZ A;  1BKA A;  3V8X B;  5I56 B;  1JW4 A;  1PB8 A;  3OEL A;  5AA2 A;  1OLC A;  1F9B A;  1EZP A;  3A09 A;  3T9X B;  3W9V A;  4IO2 A;  2CMO A;  1OQH A;  2ABH A;  3PU5 A;  3L6G A;  3PUV E;  3SEY A;  1Y4C A;  3FXU A;  1A8F A;  2G93 A;  2UXA A;  2Z22 A;  1MY3 A;  3H06 B;  5TU0 A;  3RUM A;  3KOT A;  4IO4 A;  2H99 A;  2D21 A;  1Z7N E;  2OZZ A;  2Q2C A;  2R6G E;  1DOT A;  4RK2 A;  3S9N C;  2VOZ A;  1B3L A;  4QRZ A;  3H6T A;  3IAZ A;  4YB5 A;  1Y3Q A;  2O6A A;  4POW A;  4KQP A;  2ZXT A;  2ONK E;  1T0K A;  4X48 A;  4LQ5 A;  3I6V A;  5H8Q B;  3S9M C;  1UQW A;  4Q5T A;  4C1T A;  2E1S A;  1FW0 A;  2CZL A;  3K0V A;  2DE2 A;  4MFI A;  4I1D A;  5I59 B;  4H8I A;  3QK6 A;  3JV9 A;  4NF8 A;  2P2A A;  2REJ A;  3HV1 A;  3UP9 A;  2HXW A;  4ZE8 A;  4GVO A;  3RNN A;  4OYV A;  5HPQ A;  3O9P A;  5HBC A;  4MLQ A;  4K3F A;  5FTI A;  4N6P A;  4FAT A;  1Y1Z A;  2VGQ A;  3R26 A;  3MW0 A;  3IOR A;  3FIR A;  2XXY A;  1M5F A;  3IL1 B;  2THI A;  4JSD A;  4Z7E A;  3CFX A;  1UTB B;  1GGG A;  4DXC A;  1LCT A;  5AA4 B;  5F1Q A;  3BFU A;  1N0T A;  1JET A;  1N7W A;  3PUZ E;  3T9U A;  4YMB A;  5F7V A;  3O2A A;  1SDX A;  1S7Y A;  1ZKB A;  4H5G A;  4QF9 A;  3V83 A;  1JW1 A;  4GFR A;  1FTJ A;  4JXI A;  2XXQ A;  4ZS9 A;  1N04 A;  2UYE A;  3KJT A;  4L17 A;  5FHM A;  1Y9U A;  2H98 A;  1URG A;  3MVW A;  4Q30 B;  4U23 A;  1B2H A;  4F3B A;  3MJN A;  2PYY A;  1H44 A;  3OSQ A;  1JQF A;  3IB0 A;  1IQ7 A;  1QUJ A;  5H8F A;  3TEL A;  4G8N A;  1B32 A;  4BDQ A;  3EF7 A;  4KI0 E;  2I58 A;  3SDF A;  3TKD A;  4ELQ A;  1EH3 A;  1B51 A;  5AA3 A;  4HS7 A;  3PUY E;  5ITP A;  1YTV A;  1XVX A;  2E0S A;  4WKM A;  4U2R A;  4GIZ A;  4XKR A;  3TEP A;  2R71 A;  5K2X A;  4GD5 A;  3DLN A;  1B3F A;  4O3A A;  5EHS A;  4BDO A;  3MP1 A;  4RNS A;  4OFL A;  3KBR A;  3M8U A;  1FTL A;  4PFU A;  3S9E A;  1A7L A;  3M3K A;  4R9G A;  3VFJ A;  4WEP A;  1AMF A;  1MM6 A;  4YKI A;  1EZO A;  4X1B A;  1MS7 A;  1MQD A;  3C36 A;  4PFW A;  4RYA A;  3S4U A;  3U8Q A;  5DEX A;  4EF2 A;  2F97 A;  4NWC A;  4X1D A;  1B46 A;  2I4B A;  3FVG A;  3MP6 A;  2UVH A;  4G68 A;  2Z8D A;  5H8N A;  4C1U A;  5I57 A;  3TTM A;  1LBC A;  3Q27 A;  2UVG A;  1LBB A;  4HTG A;  4OFO A;  1OIB A;  1TWY A;  1ZJL A;  2RKM A;  4F18 A;  1SW2 A;  5JEI A;  1P1Q A;  4OET A;  5JTY A;  3VVD A;  3KN8 A;  4AB5 A;  1B05 A;  1LST A;  2X7P A;  2AL5 A;  3CFL A;  3OO7 A;  2DVZ A;  2ZYN A;  2NOO A;  1OQG A;  4OVJ A;  4YKJ A;  4DIG A;  5A5X B;  4F19 A;  2Y7I A;  4G2Z A;  3TUS A;  2O1L A;  3FJ7 A;  4F3P A;  1HSJ A;  3A3C A;  3QYT A;  3FV1 A;  3TQL A;  3MPL A;  2XXT A;  1URS A;  4JSO A;  3SKP A;  1URD A;  3KSX A;  2DE3 A;  3K6X A;  3KN7 A;  1M5E A;  1IXC A;  4JDF A;  3CIJ A;  1AOV A;  2F6P A;  2Y7P A;  3DP8 A;  1M5D A;  5CC2 A;  3ILT B;  3IO6 A;  1FCK A;  5CM6 A;  3VVE A;  4GXS B;  5I2N B;  1AL3 A;  4OMB A;  2DYX A;  2IEE A;  3ODB A;  3HPI A;  1LB8 A;  3WAF A;  2OWS A;  1QW0 A;  4MLV A;  4OFJ A;  2ANJ A;  5I84 A;  3PMX A;  5CMM A;  3LC8 A;  4IO3 A;  4KHZ E;  4KR5 A;  4P0G A;  2V93 A;  1LFI A;  2QL3 A;  2Y84 A;  3MZB A;  1OLA A;  3BBR A;  3G3K A;  4MBP A;  2QJE A;  1A55 A;  4NED A;  4R6Y A;  1FTK A;  2I6E A;  4U1Z A;  3CFZ A;  4EQ7 A;  1MH3 A;  2DVC A;  3FZV A;  1MPC A;  1BP5 A;  5ICQ A;  4BDL A;  4NWD A;  4OHN A;  1IZ1 A;  5H8Q A;  2HCA A;  3U92 A;  4FAJ A;  5TP9 A;  3G3I A;  2A5T B;  4EQ9 A;  2OBG A;  3EQ1 A;  5KDT B;  3MP8 A;  3V89 B;  2DWA A;  4P11 A;  1H76 A;  4DZ1 A;  5CRY A;  2REG A;  4QFL A;  3KZG A;  2XXR A;  4FEB A;  4GL8 A;  1TT1 A;  3OEM A;  4ZED A;  2Z8E A;  1DPE A;  1WDN A;  1SW1 A;  1MY4 A;  2I0B A;  1FQF A;  2Q88 A;  2QMW A;  3C35 A;  3IB2 A;  3IJO B;  3K2D A;  3KN3 A;  3L6H A;  3RTW B;  5L9S A;  1XOC A;  2VHA A;  2O68 A;  1GTK A;  1M5B A;  1NH8 A;  4YKK A;  2ALU A;  1UTH B;  4PQJ A;  3DP4 A;  1SBP A;  3U1O A;  1AIV A;  2F5X A;  4EDP A;  2V3T A;  3IK6 B;  5I2N A;  1XS5 A;  4KCD A;  4XTC Q;  1IXH A;  3S2V A;  4QSE A;  5CI5 A;  4Q8R A;  2RC7 A;  3PPP A;  3KG2 A;  3MVY A;  4IB2 A;  3QUJ A;  1B5J A;  4ZEI A;  2XXP A;  2F34 A;  2XXI A;  2ZMB A;  2ZNT A;  3OSR A;  3C31 A;  3O29 A;  2F6G A;  2O1M A;  4FJP A;  4KPT A;  1MY0 A;  4F3S A;  3RTF B;  3HST A;  5A5X A;  3K00 A;  1ZIU A;  3TZA A;  1US4 A;  3PPQ A;  4RPO A;  1O7T A;  3OXN A;  4NF6 A;  5H8F B;  3FGS A;  4R6H A;  2DE4 A;  1PBQ A;  3OO9 A;  4YKP A;  4GXA A;  4NE4 A;  1A40 A;  4F31 B;  3PUW E;  5KDT A;  5FHO A;  1ATG A;  5CMB A;  1SW5 A;  3HHG A;  1H45 A;  1GV8 A;  2RC8 A;  2UYF A;  3JYR A;  5M2V A;  3T9H B;  1N3W A;  1VR5 A;  3CI8 A;  3GBB A;  3PD8 A;  5JK4 A;  4GQO A;  3RLF E;  2I48 A;  1POT A;  1B0H A;  2I3W A;  2Z8F A;  2H25 A;  4LA9 A;  2QS4 A;  4ZEK A;  3TTN A;  4F29 A;  4DXU A;  3RPW A;  2H5Y A;  3P7I A;  1NFT A;  2Y7W A;  4BDR A;  4R2F A;  3LSL A;  1B1X A;  2O51 A;  1JVX A;  3LSX A;  3LSW A;  3G3F A;  4OWD A;  4WED A;  1ANF A;  2DWJ A;  4O3C A;  1GVC A;  1TFD A;  1B3G A;  3DEL B;  3W15 C;  4DLD A;  4R74 A;  5FTH A;  3USD A;  1B0L A;  1XVY A;  1NH7 A;  1B40 A;  4R75 A;  5AA1 A;  3ZS6 A;  4F1V A;  4U1O A;  3U94 A;  4R73 A;  4DXB A;  3FD3 A;  4LVQ A;  5AA2 B;  4ZE9 A;  3LR1 A;  3KOS A;  2QS2 A;  3RQT A;  1NKX A;  1TFA A;  3WAE A;  4RPN A;  2ONR A;  4ELP A;  4ND9 A;  1FQA A;  3N5L A;  3SES A;  1QKB A;  4H67 A;  3OO6 A;  1MM7 A;  2D3I A;  2O69 A;  1LLS A;  3H7M A;  3VLV A;  5CBR A;  4RA1 A;  1JW5 A;  4P0I A;  5AA2 D;  2V3Q A;  2QMX A;  4IGR A;  4E0W A;  2NWJ A;  1MPB A;  4THI A;  4YAH X;  4GRK A;  4GWO A;  1I69 A;  1UIV A;  1XHY A;  1QUI A;  1D9Y A;  2ESN A;  4WXJ A;  3EHS A;  2X7Q A;  3K6U A;  3N6U A;  4KFQ A;  4XKQ A;  1LAX A;  3DP6 A;  3ILU B;  3QAX A;  4FE8 A;  3MWB A;  4KYE A;  1A99 A;  1CE2 A;  1Y4T A;  3RN8 A;  4PET A;  1B4H A;  1NNF A;  3C32 A;  2ZYM A;  3O6H A;  1Y20 A;  1PDA A;  2DS9 A;  3CSG A;  4ELO A;  5H8S A;  4G8M A;  2DP8 A;  1XC1 A;  5I56 A;  3IOT A;  1ZMG A;  1LB9 A;  1LCF A;  4N13 A;  2I0C A;  2Z23 A;  3CVG A;  1ZLQ A;  3K6W A;  4E0X A;  5KCJ A;  4EUO A;  2Q9T A;  1Y1M A;  2F8D A;  3K02 A;  3ZKK A;  3AXF A;  3KEI A;  3TYH A;  2QS1 A;  1B7H A;  3FVO A;  2RCA A;  3BFT A;  4OTE A;  2RF1 A;  3MQ9 A;  1IIT A;  4GL0 A;  5DEX B;  3VE1 B;  3QIM A;  3SEX A;  1D9V A;  1GR2 A;  1MY1 A;  5H8N B;  1IEJ A;  2ZYK A;  3ONM A;  1USY E;  2PMS A;  2FA7 A;  3FJM A;  4YU0 A;  1IIW A;  2UVJ A;  4IGT A;  3TAJ A;  4NMY A;  2QS3 A;  2RCB A;  3CSB A;  3G3H A;  3E3K A;  3OD7 A;  3PPR A;  1SYH A;  5ICT A;  1RYO A;  2D5W A;  4H6D A;  4PFY A;  4TQU Q;  3TTK A;  4IY6 A;  4X9T A;  3N6T A;  1FTM A;  4NF4 A;  1AH5 A;  5KZT A;  4FED A;  2G29 A;  3I3V A;  2BJJ X;  2F36 A;  2FYI A;  2V25 A;  2VD2 A;  2NXO A;  3BKI B;  3LUY A;  3TDJ A;  4PE5 B;  4I62 A;  5B70 A;  2Q8J A;  2DOJ A;  2IA4 A;  1B58 A;  2PBW A;  3CR9 A;  2O7I A;  1Z7M E;  1WOD A;  4G4P A;  4OES A;  4RK9 A;  4R2B A;  3OMB A;  3E9X A;  4N07 A;  3H6W A;  1P1N A;  3O97 A;  3QXM A;  4EXL A;  1B5I A;  3M3L A;  1SQY A;  3UGW A;  5IAI A;  3PD9 A;  2ZYO A;  2NUV A;  1JNF A;  3A3U A;  3PMW A;  3R7X A;  3SEU A;  4F2Q A;  5DVF A;  2VD3 A;  4NF6 B;  3IOV A;  2FNC A;  3TCH A;  3JZJ A;  2OK2 A;  3F11 A;  1MRP A;  1QJM A;  5KCJ B;  1JEU A;  3GXA A;  3IB1 A;  1OVB A;  2OCU A;  3N26 A;  4IO7 A;  2XD2 A;  3MVX A;  3VLW A;  3FXR A;  4GOT A;  2HEU A;  3PUX E;  1MDQ A;  4QSC A;  4Z0I A;  1NNK A;  2DSF A;  4KCC A;  3U93 A;  2XXV A;  3HCQ A;  3CG1 A;  3VXC A;  3FUZ A;  4ECF A;  3CG3 A;  4HCY A;  1FTO A;  3B6W A;  2I3V A;  3ZSF A;  1PC3 A;  3O6G A;  5DVJ A;  4RY1 A;  1VFE A;  5L9M A;  4H5F A;  4UAC A;  2Y7K A;  1MY2 A;  4NF4 B;  1FQB A;  4ZZA A;  3U72 A;  3UN6 A;  2RIN A;  4AQ4 A;  4C0R A;  1PB7 A;  4LUB A;  4G68 C;  1XT8 A;  1OVT A;  1SI0 A;  2O84 X;  2I4C A;  4LZ8 A;  4NF5 B;  5B7D A;  2YPN A;  3E13 X;  3EN3 A;  3M3F A;  1NL5 A;  1N76 A;  3T66 A;  4YZZ A;  4QHQ A;  3V5A A;  5I57 B;  1LAG E;  4OZ9 A;  3MBP A;  1YPN A;  1ZU0 A;  3C34 A;  4PP0 A;  3VVF A;  1IXG A;  3IX1 A;  1Q1K A;  1YCJ A;  3R6U A;  4Q0C A;  1MXX A;  3Q26 A;  3ZKL A;  5I58 B;  5CMK A;  2O7U A;  4IY5 A;  1I6A A;  1P99 A;  1SW4 A;  1B3E A;  1Y3N A;  2RC9 A;  1B7Z A;  3FVN A;  2H9B A;  3MAM A;  3KGC A;  4GLI A;  4ONY A;  5TPA A;  3RT6 B;  3TMG A;  1MDP 1;  3K4U A;  2M8C A;  3GLB A;  1FQD A;  1N3X A;  3H6U A;  4BDM A;  5CBS A;  3K1P A;  4KYS A;  2HFB A;  1NNP A;  2P0S A;  1MQG A;  1ELJ A;  1R1N A;  2OLB A;  4H8J A;  1SD3 A;  1YAE A;  4RXL A;  5L9O A;  5ELV A;  2PT1 A;  4IO5 A;  4XKP A;  1QUK A;  3KSJ A;  1QVS A;  4JBZ A;  4I9D A;  2XXU A;  4U4X A;  5BWJ A;  3VDF A;  2H4I A;  4H65 A;  2PT2 A;  3T96 B;  2OWT A;  4QSD A;  1A54 A;  2WKY A;  2ZNU A;  4OEV A;  4BLA A;  1O64 A;  2PVU A;  3OEK A;  1SVX B;  4POX A;  2KLF A;  3SER A;  2X26 A;  3FJG A;  4NTL A;  4ZDM A;  3UA8 A;  1II5 A;  3VLU A;  3FVK A;  3K1M A;  3O28 A;  3MC2 A;  4MH5 A;  1UTH A;  4F39 A;  3HHF A;  3TTR A;  2V84 A;  4LP2 B;  1PEB A;  1I6Q A;  3EHU A;  3FAS A;  3OO8 A;  5CMC A;  3MPK A;  2XX8 A;  3CRB A;  1B1H A;  1J1N A;  3PMV A;  3K01 A;  4XXU A;  4F22 A;  5AA4 A;  1B4Z A;  3SEV A;  1DSN A;  4JWX A;  3H6V A;  1ZBM A;  2NVU B;  1MH4 A;  3RY3 A;  1FQC A;  5DVI A;  5TPA B;  3C4M A;  1OMP A;  3B7D A;  2A5S A;  3C33 A;  3LBS A;  5H8H A;  4U4S A;  5TP9 B;  4MF3 A;  5IKB A;  3FV2 A;  1PB9 A;  3HN0 A;  3KJ7 A;  2XX9 A;  3G7W A;  4H0W A;  4O3B A;  2DXR A;  4NF8 B;  4OXV A;  1DTG A;  3EHT A;  3N94 A;  3Q29 A;  4JB7 A;  3SEW A;  1MPD A;  1USY H;  1FQE A;  4OER A;  5I2K B;  2DQV A;  3E4R A;  4GF8 A;  3I5O A;  4NF5 A;  4YB6 A;  3TFL A;  1MXW A;  1VFD A;  1DPP A;  1IUD A;  1PBP A;  2HZL A;  1QUL A;  4IO6 A;  5ITO A;  3G3G A;  3GZG A;  4H1X A;  4LON B;  1S9T A;  3THI A;  4QFN A;  1D3K A;  1MXZ A;  2B65 A;  1B52 A;  4U22 A;  5DT6 A;  4ZZE A;  2UVI A;  2YJP A;  4LZ5 A;  1MQI A;  1IXI A;  2VP1 A;  3TCG A;  4ESX A;  1LFH A;  4BDN A;  2F7B A;  4RJZ A;  3SET A;  4LZ7 A;  1JVY A;  5K2Y A;  1N84 A;  3PPN A;  5EHM A;  3IO4 A;  2HQ0 A;  5BUU A;  1RYX A;  3HO7 A;  4R72 A;  4DCX A;  2OJT A;  2Q89 A;  2XD3 A;  1DTZ A;  4OEU A;  2F35 A;  4QFK A;  1HSE A;  4XIG Q;  2GH9 A;  5EYF A;  1UIU A;  3IR1 A;  4FEC A;  2QPQ A;  3PPO A;  2F7C A;  1P1O A;  2YLN A;  4HW8 A;  3RGY A;  5H8H B;  3PGF A;  2F78 A;  1A8E A;  3RT8 A;  1CB6 A;  3MZ9 A;  4HCW A;  4M4G A;  3H3G A;  3T22 A;  1M5C A;  1LFG A;  4KYD A;  1SYI A;  3K1N A;  1R9Q A;  2DWH A;  1O63 A;  2XX7 A;  1MG1 A;  2LAO A;  2PX1 A;  2Y7R A;  1UTB A;  1MXV A;  4FOR A;  3TCF A;  2GFE A;  2Q2A A;  3UIF A;  4ELR A;  4DDD A;  3MVZ A;  1B9J A;  4F3G A;  2A5T A;  3ECR A;  3DM0 A;  3GBA A;  3Q28 A;  4YB7 A;  2DWI A;  2QSX A;  2F7A A;  5I58 A;  3OOA A;  1NMU A;  2HAU A;  5HM4 B;  2ONS A;  3D4C A;  4LAT A;  1MXY A;  4ESW A;  5LOM A;  4G68 B;  2HAV A;  2XHD A;  2GHB A;  3IJX B;  4DE8 A;  3O6I A;  1BIY A;  1S50 A;  1P1W A;  2QRY A;  1QKA A;  3C9H A;  1WVJ A;  4G8H A;  2B3B A;  4KD5 A;  4DCY A;  4XKN A;  2AIX A;  1R9L A;  1RKM A;  3D4G A;  3G3J A;  5I59 A;  3W9W A;  5DTB A;  1D4N A;  3MUQ A;  2GHA A;  4LQ2 A;  1B6H A;  1B5H A;  2B3F A;  4TLM B;  5AE4 A;  2DXY A;  4ZEF A;  3MZ1 A;  3PV0 E;  3B6Q A;  1BLF A;  1LAF E;  3TPA A;  1H3D A;  4AB6 A;  3S9L C;  2GRV A;  2P1S A;  1B7U A;  4TLL B;  1MQJ A;  5J1D A;  3IOU A;  4JWY A;  1TXF A;  2I49 A;  4ZEB A;  3O66 A;  1BTJ A;  2XXH A;  4OEN A;  1B3H A;  1H43 A;  1VSO A;  1P1U A;  4G77 A;  1NNT A;  1SI1 A;  3TTL A;  1Q35 A;  4OQO A;  3TQW A;  4YMA A;  3T9V A;  4I8C A;  3VV5 A;  3LSF B;  3K6V A;  4PFT A;  5I2K A;  1MQH A;  2XXX A;  4EQB A;  4ZEC A;  2W7Y A;  4R6K A;  5L8D A;  3IOW A;  5FHN A;  4FIM A;  1LGB C;  3OEN A;  3FXQ A;  2V3U A;  3KFM A;  3FAT A;  5ISU A;  2ZNS A;  5JTY B;  1POY 1;  3T93 B;  2HZK A;  3VXB A;  1US5 A;  1I6B A;  3QUF A;  5DYH A;  4EF1 A;  4F1Y A;  3EPE A;  1L5T A;  2AYS A;  1KWH A;  3H4Z A;  4YIC A;  3QSL A;  4U21 A;  1N7X A;  4QFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...