2B3FA

Thermus thermophilus glucose/galactose binding protein bound with galactose
Total Genus 155
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
155
sequence length
392
structure length
392
Chain Sequence
MKLEIFSWWAGDEGPALEALIRLYKQKYPGVEVINATVTGGAGVNARAVLKTRMLGGDPPDTFQVHAGMELIGTWVVANRMEDLSALFRQEGWLQAFPKGLIDLISYKGGIWSVPVNIHRSNVMWYLPAKLKGWGVNPPRTWDKFLATCQTLKQKGLEAPLALGENWTQQHLWESVALAVLGPDDWNNLWNGKLKFTDPKAVRAWEVFGRVLDCANKDAAGLSWQQAVDRVVQGKAAFNIMGDWAAGYMTTTLKLKPGTDFAWAPSPGTQGVFMMLSDSFGLPKGAKNRQNAINWLRLVGSKEGQDTSNPLKGSIAARLDSDPSKYNAYGQSAMRDWRSNRIVGSLVHGAVAPESFMSQFGTVMEIFLQTRNPQAAANAAQAIADQVGLGRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords glucose-binding protein
publication title The crystal structure of a thermophilic glucose binding protein reveals adaptations that interconvert mono and di-saccharide binding sites.
pubmed doi rcsb
source organism Thermus thermophilus hb27
total genus 155
structure length 392
sequence length 392
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2005-09-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2b3fA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2b3fA02
1P99A 1OQHA 3IOUA 3ODBA 4ZECA 1PDAA 1MXWA 3IOTA 1N7WA 3PUYE 4EQ9A 1LB8A 1LBCA 4ONYA 1YPNA 1QUKA 4NTLA 3THIA 1XS5A 5AA4A 4AB6A 4GL8A 5L9SA 4OESA 1B5HA 4YZZA 3DP8A 2UVHA 3KEIA 4YU0A 4P0GA 5I59B 2BJJX 4ZZAA 1MQDA 2AL5A 2M8CA 2PMSA 5H8HB 1B0HA 1ZIUA 2YJPA 3ZKLA 1SI0A 2RC8A 4NE4A 4RPOA 3JV9A 4KPTA 2X7PA 4R6KA 1RYXA 3PMWA 1FQDA 3R6UA 4R74A 4X1BA 4LATA 4Z7EA 4ZEBA 2Q9TA 4YKKA 4GL0A 4ESWA 4X48A 4Z0IA 1XOCA 2Z22A 2UVJA 3K1NA 4XIGQ 4OFJA 5CC2A 1XVXA 3HSTA 3MC2A 4HCWA 3PV0E 2NOOA 1MY4A 4F2OA 4QFKA 3TCFA 4N13A 2Q8JA 1B3LA 1B1HA 4EQBA 4L17A 4AB5A 2I0CA 1UTHA 1CB6A 4FEDA 1LAHE 1EH3A 4G2ZA 2AIXA 4OYVA 4DZ1A 1B7ZA 3SESA 4XKPA 1H44A 3KSXA 4JWXA 4U1OA 5ITPA 3LC8A 3OO9A 2Z8EA 2B65A 1R9QA 2HEUA 5DTBA 3OO7A 4DXBA 1TFAA 4QFPA 5I56B 1IXHA 3O97A 1VFEA 3A09A 1Y3PA 5I2KB 1JEUA 1XVYA 3MVZA 5CMKA 1LCTA 3TDJA 1US5A 2VD3A 5FHOA 3R26A 3Q27A 4POXA 4R73A 3C32A 4LVQA 3TCGA 3D4CA 3BFUA 2Z8FA 5H8FB 3RLFE 2HXWA 5JEIA 5H8NB 2DE2A 4NF4B 1QUIA 3IB2A 2X7QA 1USYH 2QPQA 1FTJA 3U72A 1SQYA 3H06B 1VE4A 1D3KA 1AIVA 2YPNA 3C31A 5I57A 4XTCQ 3UORA 2I58A 1N0TA 4GWOA 3WAFA 1B52A 1MRPA 3K1MA 1I6QA 2RCAA 4U2RA 3V89B 1R1NA 2Y7RA 1B58A 1DPEA 2Y84A 3Q26A 3K6WA 4JB7A 5AA2B 1I6BA 2AYSA 2Y7KA 1NNKA 3AXFA 2XX8A 2B3BA 1MY1A 2DS9A 4N07A 3ECRA 2F36A 2VP1A 3TTLA 1J1NA 4JDFA 4ZS9A 2DOJA 2ONKE 4GXSB 3RNNA 3QK6A 2P1SA 1Z7ME 2Z23A 2UXAA 1KWHA 2F5XA 4U4SA 4EXLA 2OBGA 1H45A 4C1TA 2XX7A 2UYFA 3G3GA 3S9EA 3T22A 2O1LA 4H8JA 3MWBA 1IXGA 1M5EA 3M3LA 4PQJA 3H4ZA 3PPQA 5L8DA 5BUUA 3TAJA 2H25A 1B4HA 3BKIB 1B05A 4LA9A 5JTYB 1O64A 4EQ7A 4DLDA 3H6WA 1A8FA 1Y3NA 1BKAA 1URDA 1HSLA 1US4A 2ZYOA 2HAVA 4LUBA 1DSNA 1EZPA 3E3KA 4I9DA 3IB1A 3K4UA 3CI8A 1IIWA 3K0VA 1N84A 2Q2AA 3HO7A 4DCXA 4RYAA 2XD2A 3VLVA 3MP8A 1N76A 1DTGA 2G29A 4KI0E 3S4UA 5H8QB 1MQGA 1O7TA 4IO2A 3GZGA 3K02A 1A99A 3G3JA 2V3TA 2DSFA 4NF5A 5HPQA 1Q35A 1UTBB 3SEWA 3T9HB 1M5FA 1MPCA 1B32A 3VVFA 1NMUA 2XXYA 1ZU0A 1FCKA 2R71A 3S9LC 4YKPA 4NF8A 1MXZA 5EHMA 3ZS6A 2G93A 3IOWA 4DCYA 4C0RA 5I58B 1BLFA 3EF7A 3TCHA 1PB7A 2REJA 5DT6A 2QL3A 1IUDA 3ILUB 1MXVA 5ITOA 1NNTA 4F3GA 2ZNSA 1SDXA 3QUFA 4XXUA 3P7IA 4XKQA 4TLLB 4OQOA 1FQEA 1LFGA 5DEXB 2D3IA 1MPBA 3DP4A 5I59A 3KN3A 5HBCA 4IO5A 1OVTA 1MY2A 3SEXA 2QS3A 3W15C 3HCQA 3O2AA 5H8HA 3CSGA 2R9JA 2I3WA 1PC3A 4G8MA 3RUMA 4WXJA 2VD2A 3N26A 3HN0A 4X9TA 1NFTA 3MQ9A 2HCAA 3H7MA 4GF8A 4F31B 2UVIA 3IJOB 4U4XA 1MDP1 5K2YA 1FTKA 1GV8A 1D4NA 3OO6A 2Y7WA 3K6XA 1LFIA 2DVCA 3CFXA 3IAZA 2O7IA 4RK2A 3VLWA 5K2XA 4MLVA 1POY1 2O84X 3PPRA 4F22A 5I2NB 2RINA 4OMBA 1IQ7A 2F6PA 3IORA 3H6UA 1JQFA 1YTVA 3FD3A 2KLFA 2XXWA 4FAJA 4G4PA 2Q89A 4M4GA 4FORA 3SKPA 1P1UA 5CI5A 2R6GE 2XXPA 1OLCA 4IB2A 5CRYA 3KJTA 1H76A 3VFJA 2ONRA 1IZ1A 2A5SA 4E0XA 1GTKA 5I56A 5KZTA 1JEVA 2GHBA 3T93B 5I2KA 3IB0A 1AMFA 3OOAA 1BIYA 1NNFA 3N5LA 4ZZEA 5AA3A 3CFZA 3RTWB 4U1ZA 4BDOA 2ZYMA 2Y7PA 1SYHA 3EHSA 1PEBA 4YB6A 4EUOA 5H8FA 1GVCA 4RXLA 5H8NA 4NF4A 4EF1A 2UVGA 1DOTA 1QKBA 5KCJB 3IX1A 2V84A 2PYYA 3N6TA 2XHDA 4ELPA 1QVSA 3KFMA 2ZNTA 5TP9B 1A8EA 5TPAA 4NWCA 1CE2A 4QF9A 2XXVA 1B3HA 2QS1A 3RQTA 2V93A 3VVEA 4PP0A 5FHNA 5KDTB 5AA2A 1EZ9A 2DXYA 1N3WA 1PBPA 2DWHA 2LAOA 1XHYA 5EYFA 2Q2CA 3RGYA 3FXRA 4HTGA 1GGGA 3TZAA 1P1WA 5EHSA 3RPWA 2Z8DA 1MQHA 2F7CA 4P11A 3SEUA 4O3AA 3LBSA 3I5OA 4RY1A 1FTMA 1H43A 1AOVA 3Q28A 5ICQA 4MH5A 3O6GA 1QJMA 1PBQA 4E0WA 2HAUA 4UACA 3C36A 3PUXE 1WODA 3S2VA 3TTKA 1LSTA 1XT8A 2H98A 3MZ1A 3N6UA 1Y3QA 4YAHX 4WKMA 4QFLA 3PPPA 2NVUB 4OZ9A 4IO3A 4GRKA 1DMBA 4YKIA 3B6WA 3BFTA 1A40A 4OEVA 3S9NC 2ZYKA 1II5A 4N6PA 4X1DA 4Q30B 1MQJA 4YMAA 1N7XA 2PX1A 4BDRA 1B5IA 4KYSA 3IR1A 5JTYA 3MVWA 4OXVA 4IY6A 5JK4A 5F1QA 2UYEA 1B0LA 2ANJA 3RN8A 3G3FA 3WAEA 2DYXA 1VSOA 4KFQA 4F29A 3B6QA 1S50A 2DP8A 3M8UA 4AQ4A 1ANFA 5H8SA 2CZLA 4KCCA 2XXUA 3SETA 3F11A 1AH5A 2XXXA 4IO7A 2ONSA 5L9MA 4OEUA 1S9TA 3DLNA 4MFIA 3CG3A 5DVJA 5H8QA 3H6TA 3IK6B 1Y1MA 1SVXB 3TKDA 1SI1A 3MZ9A 1UTBA 4LZ5A 4Q8RA 4JXIA 4QRZA 4BDMA 3E13X 4F3BA 1EU8A 4ELOA 3VXBA 1A55A 4HW8A 3QXMA 3EQ1A 3KBRA 5I58A 4H1XA 3RTFB 1MXXA 3LR1A 2F6GA 4YICA 3TFLA 1LCFA 3M3FA 4OERA 2I0BA 3IJXB 3LSXA 4QFNA 1B1XA 3K6UA 4IY5A 4OHNA 3T9UA 3QIMA 2NXOA 3PD9A 3CR9A 5DEXA 3U93A 3PU5A 3L6HA 4ZEIA 4HCYA 1QUJA 4U23A 2FYIA 1DTZA 1FTLA 4K3FA 5AA2D 3FJMA 2OZZA 5J1DA 4DXCA 3IO4A 4R2FA 1RYOA 4P0IA 4I1DA 4R72A 1R6ZA 3OELA 3E9XA 3JZJA 3TUSA 5B7DA 1QW0A 1PB9A 2VGQA 3M3KA 4NEDA 4XKRA 2I6EA 2W7YA 4KYDA 3KSJA 3O6IA 4QSCA 4O3BA 3CG1A 2QMXA 2QSXA 2FNCA 3FJGA 4H8IA 1B40A 1TXFA 4GD5A 4Q5TA 1ELJA 4JSOA 3TELA 4FATA 3DELB 4NF6B 3OXNA 3PMXA 2HZLA 5I2NA 3SEYA 1HSJA 4KHZE 3FJ7A 5FHMA 2I49A 3SDFA 4RNSA 2DE4A 3ZKKA 1Y4TA 1JNFA 1VR5A 2XXTA 3LSLA 4MBPA 2DWJA 3T9VA 3VLUA 1URSA 4OVJA 3HHGA 3FIRA 4EXKA 4DDDA 2F8DA 2HZKA 1O63A 1P1NA 2P2AA 4F19A 3DP6A 1T0KA 2PBWA 3FZVA 3HV1A 4PFUA 1MPDA 4ND9A 1A54A 2OLBA 1MM7A 1SD3A 5BWJA 4BDQA 1LB9A 3H6VA 2D5WA 3DM0A 1Y4CA 4G68B 5AE4A 3TYHA 4KYEA 4H5FA 4EDPA 1NH8A 4OTEA 3KG2A 3TQWA 1FW0A 1MG1A 1P1OA 1NNPA 4LQ5A 4WEPA 5FTIA 4DIGA 1B46A 4Q0CA 1YAEA 2VOZA 3S9MC 4O3CA 3C33A 4JWOA 4JWYA 5KCJA 2XXIA 3FVOA 2IA4A 3MW0A 2F34A 3QSLA 5TP9A 3QYTA 3MBPA 3LSWA 1UIUA 3VV5A 5ICTA 4OFLA 2OCUA 4PFYA 5CM6A 1JVYA 1I69A 4F3PA 1UIVA 3W9WA 3OD7A 5KDTA 3TMGA 1MXUA 2B3FA 1S7YA 5A5XB 1B3EA 2H5YA 1ZTYA 4QFOA 3K2DA 4QSEA 3T66A 4LZ8A 3MVYA 2ESNA 4XKNA 1B3GA 4FE8A 4G8NA 4RPNA 4RJZA 4WEDA 3G3IA 2H9BA 3R7XA 3C35A 3FUZA 3V8XB 2O51A 1WVJA 4DE8A 4PE5B 2NUVA 2ZNUA 3QUJA 4BDNA 4GLIA 2H4IA 1SW5A 1ATGA 3RY3A 5CMCA 2QS2A 1JW5A 2PVUA 1B7HA 3KJ7A 4NF5B 2DXRA 4TQUQ 2DQVA 2QJEA 2QS4A 1B2HA 1GR2A 2ABHA 4IGTA 2Y7IA 3E4RA 3O28A 3FASA 3UGWA 3LSFB 4ISUA 2O6AA 5L9OA 1TFDA 5AA1A 1MQIA 1YCJA 1B51A 3MVXA 4PETA 4BDLA 1XC1A 3MPLA 3EHUA 2RF1A 2V3QA 3UA8A 1IXIA 2AL4A 4ZDMA 1QKAA 1MDQA 3FVKA 3U92A 4PFTA 3TQLA 4ECFA 1Z7NE 4H65A 5LOMA 1B4ZA 4GXAA 4YB5A 1PB8A 3H03A 2XXQA 4JSDA 5DVIA 1N3XA 3EPEA 3FVGA 3FV2A 3CRBA 1FQFA 3CIJA 4MF3A 2Q88A 1QULA 4POWA 3KGCA 1SW2A 3I3VA 4ZEKA 3JYRA 3IL1B 4R75A 4ZEDA 3OMBA 3O66A 5HM4B 1TWYA 1JVXA 4NWDA 1D9YA 4RK9A 4THIA 1POTA 1MY3A 1MS7A 5ELVA 1D9VA 2A5TB 3GLBA 3O9PA 2QMWA 5F7VA 4F2QA 3MPKA 1B3FA 1JETA 1LFHA 1DPPA 4F1YA 3PMVA 4DXUA 2GRVA 5TU0A 4YB7A 1BTJA 4OETA 3RT6B 3G7WA 5DYHA 4FEBA 2HFBA 2O7UA 4U22A 3UN6A 1JW4A 5IKBA 2H99A 1LGBC 1MXYA 2O1MA 3MAMA 2YLNA 1FQBA 2XD3A 2GH9A 2E0SA 4QSDA 3QAXA 3UIFA 2REGA 4ELRA 3K6VA 3UP9A 4FJPA 3RT8A 3CFLA 1MM6A 4H0WA 3Q29A 3CVGA 1URGA 3HHFA 3HPIA 4LP2B 3T9XB 1NKXA 5AA4B 2OWTA 4IO6A 3U94A 2X26A 5CBRA 3PPNA 5I84A 2P0SA 4ELQA 1ZLQA 2QRYA 1P1QA 4NF6A 2RCBA 1A7LA 2VHAA 4UA8A 4RA1A 4R9GA 1FQAA 3OEMA 1L5TA 4YKJA 5TPAB 2V3UA 4H67A 3W9VA 3C9HA 3PUZE 4KD5A 4MLQA 1R9LA 1MH3A 2F78A 3O6HA 4GQOA 4LONB 3K1PA 4FIMA 4ZE8A 3KOSA 1MH4A 2F7AA 4M1VA 5DVFA 3VE1B 2ZMBA 3TTNA 1Q1KA 4QHQA 3K01A 1Y20A 1IEJA 3FVNA 1FTOA 3VVDA 3VXCA 3BBRA 1WDNA 2I4CA 3C34A 3A3UA 3PD8A 3B6TA 3PUVE 2I48A 3PUWE 4H6DA 4G68A 1UTHB 1OVBA 2ALUA 1ZJLA 4JBZA 2RKMA 2O68A 3MZBA 2D21A 2DVZA 3ZSFA 1RKMA 5ISUA 2I3VA 4H5GA 3D4GA 3G3HA 4GVOA 4OWDA 4YMBA 4U21A 5FTHA 4ZEFA 3H3GA 4R6YA 3PPOA 3OO8A 1MY0A 1ZMGA 1NH7A 3ONMA 3GBAA 5IAIA 2IEEA 1LLSA 3OSQA 2NWJA 1LAGE 1OLAA 3TEPA 2OJTA 1NL5A 1EZOA 2CMOA 4OFOA 5CMMA 1SYIA 1TT1A 1BP5A 2F97A 5A5XA 3GBBA 2HQ0A 2OK2A 5CBSA 4G77A 3UK4A 1F9BA 4ZE9A 2XX9A 2RC9A 3U8QA 3I6VA 4TOZA 4F18A 4IO4A 5I57B 3V83A 3N94A 3OENA 4HS7A 4KR5A 3TTMA 2ZXTA 3VDFA 2O69A 4NMYA 1B6HA 4KQPA 3LUYA 1ZKBA 3CSBA 3T96B 3FGSA 1N04A 4F1UA 3GXAA 2ZYNA 1I6AA 3FATA 1B7UA 4OENA 4R9FA 4PFWA 4R6HA 2XXRA 3KOTA 3MUQA 2F35A 4R2BA 4LZ7A 1B9JA 3Q25A 1M5CA 3TODA 3MP1A 4GOTA 4BLAA 4TLMB 3G3KA 3IO6A 3FV1A 4I62A 3SEVA 3USDA 4IGRA 1B5JA 1OMPA 1LAXA 3C4MA 3TPAA 4C1UA 1OIBA 2V25A 2PT2A 4I8CA 4F1VA 3U1OA 1Y1ZA 1SW4A 1UQWA 4F3SA 1USYE 4GFRA 3IOVA 3ILTB 3EHTA 1VFDA 4KCDA 1SW1A 4GIZA 4F39A 1Y9UA 5B70A 1M5DA 1IXCA 2GHAA 1FQCA 2THIA 4LQ2A 1ZBMA 1LBBA 3K00A 3B7DA 3PGFA 3KZGA 3KN8A 1OQGA 4FECA 2XXHA 1JW1A 2PT1A 3KN7A 1IITA 3FXQA 2A5TA 2I4BA 4ESXA 5CMBA 1AL3A 1M5BA 2DWAA 3FXUA 3OEKA 1LAFE 4EF2A 3SERA 2E1SA 2OWSA 1HSEA 2DWIA 3A3CA 2GFEA 3MP6A 3O29A 1SBPA 3EN3A 2WKYA 2DE3A 3TTRA 3V5AA 3OSRA 1H3DA 3MJNA 2FA7A 4G68C 2RC7A 4G8HA 5M2VA 3L6GA 4NF8B 2F7BA
chains in the Genus database with same CATH superfamily
2WYKA 1P99A 1OQHA 3IOUA 2KR0A 3ODBA 4ZECA 4H46A 1PDAA 1MXWA 1G0HA 3IOTA 2FVZA 1N7WA 3PUYE 4EQ9A 3T0JA 1LB8A 1LBCA 4ONYA 1YPNA 1QUKA 4NTLA 3THIA 1XS5A 5AA4A 5DW8A 4X8RA 4AB6A 4GL8A 5L9SA 4OESA 1B5HA 4O7IA 4YZZA 3DP8A 2UVHA 4N6KA 3KEIA 4YU0A 4P0GA 5I59B 2BJJX 4ZZAA 1MQDA 2AL5A 2M8CA 2PMSA 5H8HB 1B0HA 1ZIUA 4N8YA 4PC9A 5FBPA 1QGXA 4PGPA 2YJPA 3ZKLA 1SI0A 2RC8A 1FPGA 4QXDA 4NE4A 4RPOA 2QVUA 4LN5A 3JV9A 4KPTA 2X7PA 4R6KA 1RYXA 3PMWA 2PFYA 1FQDA 3R6UA 4R74A 4X1BA 4LATA 4Z7EA 4ZEBA 2Q9TA 4PF6A 4YKKA 5IZ1A 1FRPA 4GL0A 4ESWA 4X48A 4Z0IA 1DCUA 1XOCA 2Z22A 2UVJA 2XWVA 3B50A 3K1NA 4XIGQ 4OFJA 5CC2A 1FBFA 1XVXA 3HSTA 3MC2A 4HCWA 3PV0E 2NOOA 1MY4A 4F2OA 4QFKA 3TCFA 4N13A 4OVPA 2Q8JA 1B3LA 1B1HA 4EQBA 4L17A 4AB5A 2I0CA 1UTHA 1CB6A 4FEDA 1LAHE 1EH3A 4G2ZA 2AIXA 4OYVA 4P56A 4DZ1A 1B7ZA 5J16A 3SESA 4XKPA 1H44A 3KSXA 4JWXA 4U1OA 3SZPA 5ITPA 2PFZA 3LC8A 3OO9A 4AS4A 4OVQA 2Z8EA 2B65A 1R9QA 2HEUA 5DTBA 3OO7A 4DXBA 1TFAA 1FJ9A 1FBEA 4QFPA 5I56B 1IXHA 3O97A 1VFEA 3A09A 1Y3PA 5I2KB 1JEUA 1XVYA 3MVZA 5CMKA 1LCTA 3TDJA 5IZ3A 1US5A 2VD3A 5FHOA 3R26A 1LBVA 3Q27A 4POXA 4R73A 3C32A 4LVQA 3TCGA 3D4CA 3BFUA 2Z8FA 5H8FB 3RLFE 1FBHA 3E79A 3LV0A 2HXWA 5JEIA 5H8NB 2DE2A 2CEYA 4NF4B 1QUIA 3IB2A 2X7QA 1USYH 1K9YA 2QPQA 1FTJA 3U72A 1SQYA 3FBPA 3H06B 1VE4A 1D3KA 1AIVA 2YPNA 3C31A 5I57A 1DK4A 4XTCQ 3UORA 2I58A 1N0TA 1IMDA 4GWOA 3WAFA 1B52A 1MRPA 3K1MA 1I6QA 2RCAA 4U2RA 3V89B 4P8BA 1R1NA 2Y7RA 1B58A 1DPEA 2L5VA 4PGNA 2Y84A 3Q26A 3K6WA 4JB7A 5AA2B 1I6BA 2AYSA 2Y7KA 1NNKA 3AXFA 2XX8A 2B3BA 1MY1A 2DS9A 3PTYA 4QBAA 4N07A 4GX4A 1DBZA 3ECRA 4JVCA 2F36A 5EQAA 2VP1A 3TTLA 1J1NA 4JDFA 4ZS9A 2DOJA 1NI9A 2ONKE 4GXSB 3RNNA 3QK6A 5I3SA 2P1SA 1Z7ME 3RPLB 2QVRA 2Z23A 2BJIA 2UXAA 1KWHA 2F5XA 4U4SA 4EXLA 2OBGA 1FSAA 1H45A 4C1TA 4MIJA 2XX7A 4MHFA 2UYFA 3G3GA 3S9EA 3T22A 2O1LA 4H8JA 3MWBA 2WX9A 1IXGA 1M5EA 3M3LA 4MCOA 5EQ8A 3U65A 4PQJA 2WBDA 1FPJA 3H4ZA 3PPQA 5L8DA 4N4UA 5BUUA 3TAJA 2H25A 3CHGA 1B4HA 1NUZA 3BKIB 1B05A 4LA9A 4H45A 5JTYB 1O64A 4EQ7A 4DLDA 3H6WA 1A8FA 1Y3NA 1BKAA 1URDA 4MEVA 4O8MA 1HSLA 5A5LA 1US4A 2ZYOA 2HAVA 2VT5A 4LUBA 1DSNA 1EZPA 2FIEA 3E3KA 4I9DA 1NUYA 3BIGA 3IB1A 3K4UA 5EQ9A 3CI8A 1IIWA 3K0VA 1N84A 2Q2AA 3HO7A 4DCXA 3IFCA 4RYAA 2XD2A 3VLVA 5ET5A 3MP8A 1N76A 2QVVA 1DTGA 2G29A 4KI0E 3S4UA 5H8QB 1MQGA 1O7TA 4IO2A 3GZGA 3K02A 1A99A 5IGAA 3G3JA 2V3TA 2DSFA 4NF5A 5HPQA 1Q35A 1UTBB 3SEWA 3T9HB 1M5FA 1NV4A 1MPCA 1B32A 3VVFA 1NMUA 2XXYA 1ZU0A 1FCKA 2R71A 3S9LC 4YKPA 2GQ1A 2CZKA 3GYYA 4NF8A 1MXZA 5EHMA 1INPA 3ZS6A 2G93A 1LBWA 3IOWA 4DCYA 4PFBA 4C0RA 5I58B 1BLFA 3EF7A 4I40A 3TCHA 1PB7A 2REJA 5DT6A 2QL3A 3E78A 1IUDA 3ILUB 1MXVA 5ITOA 1NNTA 4F3GA 2ZNSA 1SDXA 3QUFA 4XXUA 3P7IA 4XKQA 4TLLB 4OQOA 4AS5A 1FQEA 1LFGA 2P3NA 5DEXB 2D3IA 1MPBA 3DP4A 1NV1A 5I59A 3KN3A 5HBCA 1NV0A 4IO5A 1OVTA 1MY2A 3SEXA 2QS3A 3W15C 3HCQA 3O2AA 5H8HA 3CSGA 2R9JA 2I3WA 1PC3A 4G8MA 3RUMA 4WXJA 2VD2A 3N26A 3HN0A 4X9TA 1NFTA 3MQ9A 2HCAA 1KA1A 2DDKA 3LUZA 1EYJA 3H7MA 4GF8A 4F31B 5LTCA 2UVIA 3IJOB 4U4XA 1FBDA 1MDP1 5K2YA 1FTKA 1GV8A 1D4NA 1IMEA 3OO6A 2Y7WA 1Q9DA 3K6XA 1LFIA 2DVCA 3CFXA 3IAZA 2O7IA 4RK2A 3VLWA 5K2XA 4MLVA 1POY1 2O84X 3PPRA 4F22A 5I2NB 2RINA 4OMBA 3EKIA 1IQ7A 4GWUA 2F6PA 3IORA 3H6UA 2XWKA 1JQFA 1YTVA 1LEVA 2KLFA 3FD3A 2XXWA 4FAJA 2CZHA 4G4PA 2Q89A 4M4GA 4FORA 3SKPA 1P1UA 5CI5A 1LBXA 2R6GE 2XXPA 1OLCA 4IB2A 5CRYA 3KJTA 1H76A 4MNPA 3VFJA 2ONRA 1IZ1A 2A5SA 4O7MA 4E0XA 1GTKA 5I56A 5KZTA 1JEVA 2GHBA 5EYHA 1FPLA 3T93B 5I2KA 3IB0A 1AMFA 3OOAA 1BIYA 1NNFA 3N5LA 4ZZEA 2OX3A 5AA3A 4NN3A 3CFZA 3RTWB 4U1ZA 4BDOA 2ZYMA 2Y7PA 1SYHA 3EHSA 1PEBA 4YB6A 4EUOA 5H8FA 1GVCA 2CZIA 4RXLA 4GX3A 5H8NA 1RDYA 4NF4A 4EF1A 2UVGA 1DOTA 1QKBA 5KCJB 3IX1A 2V84A 4PF8A 2PYYA 3N6TA 2XHDA 4ELPA 3KFMA 1QVSA 1XI6A 2ZNTA 1A8EA 5TP9B 5TPAA 4NWCA 1CE2A 4QF9A 1IMCA 2XXVA 1B3HA 2QS1A 3RQTA 2V93A 3VVEA 4NAPA 4PP0A 5FHNA 5KDTB 5AA2A 4MX6A 1EZ9A 2DXYA 1N3WA 1PBPA 2DWHA 2LAOA 4XEQA 1XHYA 5EYFA 2Q2CA 1LBZA 3RGYA 3FXRA 4HTGA 1GGGA 3TZAA 1P1WA 5EHSA 3RPWA 2Z8DA 4PAKA 1MQHA 2F7CA 4P11A 2ZZVA 3SEUA 4O3AA 3LBSA 3RPLA 4OA4A 3I5OA 4NG7A 4RY1A 1FTMA 1H43A 1AOVA 3Q28A 5ICQA 4MH5A 3O6GA 1QJMA 4N6DA 1PBQA 4E0WA 2HAUA 4UACA 2Y5LA 3C36A 3PUXE 1WODA 3S2VA 3TTKA 1LSTA 1XT8A 2H98A 3MZ1A 3N6UA 1Y3QA 4YAHX 4WKMA 4QFLA 4P47A 3PPPA 2NVUB 4OZ9A 4IO3A 4GRKA 1NV6A 1DMBA 4YKIA 3B6WA 3BFTA 1A40A 4OEVA 3S9NC 2ZYKA 1II5A 4N6PA 4X1DA 4Q30B 1MQJA 1FTAA 4YMAA 1N7XA 2PX1A 4BDRA 1B5IA 4KYSA 2CEXA 4GWWA 3IR1A 5JTYA 4MAGA 3MVWA 4OXVA 1NV2A 4IY6A 5JK4A 5F1QA 1IMBA 2UYEA 4GWSA 1B0LA 2ANJA 3RN8A 3G3FA 3WAEA 2DYXA 1VSOA 4KFQA 4F29A 3B6QA 1S50A 1IMFA 2DP8A 3M8UA 4AQ4A 1ANFA 5H8SA 2CZLA 4KCCA 2XXUA 3SETA 5EQ7A 3F11A 1AH5A 2XXXA 4IO7A 2ONSA 2B4LA 5L9MA 4OEUA 1S9TA 3DLNA 4MFIA 2VPNA 3CG3A 5DVJA 5H8QA 3H6TA 3IK6B 1Y1MA 1SVXB 3TKDA 1SI1A 3MZ9A 1UTBA 1EYKA 4LZ5A 4Q8RA 4JXIA 4QRZA 4BDMA 3E13X 4F3BA 1EU8A 4OVRA 3MSTA 4N15A 3VXBA 4ELOA 1A55A 4HW8A 3QXMA 3EQ1A 3KBRA 5I58A 4H1XA 3RTFB 1MXXA 3LR1A 2F6GA 4YICA 3TFLA 1LCFA 3M3FA 4OERA 2I0BA 3IJXB 3LSXA 1FPKA 4QFNA 1B1XA 3K6UA 4IY5A 4OHNA 3T9UA 3KC1A 1YXIA 3QIMA 2NXOA 3PD9A 2VPOA 3CR9A 5DEXA 3U93A 3PU5A 3L6HA 4ZEIA 4HCYA 1QUJA 4U23A 2FYIA 1DTZA 1FTLA 2ZZWA 4K3FA 5AA2D 3FJMA 2OZZA 1LBYA 5J1DA 3KC0A 4DXCA 4N91A 1NV3A 3IO4A 4R2FA 2OWZA 1RYOA 4P0IA 4PAFA 4I1DA 4R72A 3ROJA 1R6ZA 3OELA 3E9XA 3JZJA 3TUSA 4XFEA 5B7DA 1QW0A 1PB9A 2VGQA 3M3KA 4NEDA 4XKRA 2I6EA 2W7YA 4KYDA 3KSJA 3O6IA 4QSCA 2WEFA 4O3BA 3CG1A 1IMAA 2QMXA 2QSXA 2FNCA 3FJGA 1NV7A 4H8IA 1B40A 1TXFA 4GD5A 4Q5TA 1ELJA 4JSOA 4P1LA 3TELA 4FATA 3DELB 4NF6B 4NX1A 3OXNA 4MMPA 3PMXA 2HZLA 5I2NA 3SEYA 1HSJA 4KHZE 3FJ7A 5FHMA 2I49A 3SDFA 4PBQA 4RNSA 4N8GA 2DE4A 3ZKKA 1NUWA 1Y4TA 1JNFA 1VR5A 2XXTA 3LSLA 4MBPA 2DWJA 3T9VA 3VLUA 1URSA 4OVJA 3HHGA 3FIRA 4XF5A 4EXKA 4DDDA 4PFIA 2F8DA 2HZKA 1O63A 1P1NA 2P2AA 4P9KA 4F19A 3DP6A 1T0KA 2PBWA 3FZVA 3HV1A 4PFUA 1MPDA 4ND9A 1A54A 2OLBA 1MM7A 1SD3A 5BWJA 4BDQA 1LB9A 3H6VA 2D5WA 3DM0A 1Y4CA 4G68B 5AE4A 3TYHA 4KYEA 5T3JA 2JJKA 4H5FA 4EDPA 1NH8A 4OTEA 3KG2A 3TQWA 1FW0A 1MG1A 1P1OA 1NNPA 4LQ5A 4WEPA 5FTIA 4DIGA 1B46A 4Q0CA 1YAEA 2HHMA 2VOZA 3S9MC 3A29A 4O3CA 2FHYA 3C33A 4JWOA 4JWYA 5KCJA 2XXIA 4I3EA 3FVOA 2IA4A 3MW0A 3ISPA 2F34A 3QSLA 4OVTA 5TP9A 3QYTA 3MBPA 3LSWA 1UIUA 3VV5A 2PCRA 5ICTA 4P3LA 4OFLA 2OCUA 1FBGA 4PFYA 5CM6A 1KA0A 1JVYA 1I69A 4F3PA 1UIVA 3W9WA 3OD7A 5KDTA 3TMGA 1MXUA 2B3FA 4PTKA 1S7YA 5A5XB 1B3EA 2H5YA 1ZTYA 4QFOA 1RDXA 3K2DA 4QSEA 3T66A 2XWIA 4LZ8A 1JP4A 2MKZA 1FJ6A 3MVYA 2ESNA 1YZ0A 4XKNA 1B3GA 4FE8A 4G8NA 4RPNA 1RDZA 4RJZA 4WEDA 3G3IA 2H9BA 4N81A 3R7XA 3C35A 3FUZA 3V8XB 2O51A 1WVJA 4DE8A 4GBVA 4PE5B 2NUVA 2ZNUA 4PDDA 3QUJA 3IFAA 4PBHA 1AWBA 4BDNA 4GLIA 4HE1A 2H4IA 1SW5A 1ATGA 3RY3A 1FPEA 1FPDA 3MYUA 5CMCA 2QS2A 1JW5A 2PVUA 1B7HA 3KJ7A 4NF5B 2DXRA 4TQUQ 2DQVA 2QJEA 4X04A 2QS4A 4OVSA 5IZZA 1B2HA 1GR2A 2ABHA 1SPIA 4IGTA 2ZZXA 2Y7IA 3E4RA 2Q8MA 3O28A 3FASA 3UGWA 3LSFB 4ISUA 1CNQA 2O6AA 5L9OA 1TFDA 5AA1A 3HFUA 1MQIA 4GWXA 1YCJA 1B51A 3MVXA 4PETA 4BDLA 1XC1A 3MPLA 3EHUA 2RF1A 2V3QA 3UA8A 4HE0A 1IXIA 2AL4A 1FBCA 4ZDMA 1QKAA 1MDQA 2HXRA 3FVKA 3U92A 4PFTA 3TQLA 4ECFA 1Z7NE 4H65A 5LOMA 1B4ZA 4GXAA 4YB5A 1PB8A 3H03A 2XXQA 4JSDA 5DVIA 1N3XA 3EPEA 3FVGA 3FV2A 3CRBA 1FQFA 3CIJA 4MF3A 2Q88A 1QULA 4POWA 3KGCA 1SW2A 3I3VA 4ZEKA 3JYRA 3IL1B 4JVIA 4R75A 4ZEDA 3OMBA 3O66A 5HM4B 1TWYA 1JVXA 4NWDA 1D9YA 4RK9A 1EYIA 4THIA 4GX6A 1POTA 1MY3A 1MS7A 5ELVA 1D9VA 2A5TB 3GLBA 3O9PA 2QMWA 4DI4B 1K9ZA 4MJOA 5F7VA 4F2QA 4O94A 3MPKA 1B3FA 1JETA 1LFHA 1DPPA 4F1YA 3PMVA 4DXUA 1D9QA 2GRVA 2WYPA 5TU0A 4I3YA 4YB7A 1BTJA 4OETA 3RT6B 3G7WA 5DYHA 1KZ8A 4FEBA 2HFBA 2O7UA 4U22A 2P3VA 3UN6A 4UABA 1JW4A 5IKBA 2H99A 1LGBC 1MXYA 5ESYA 2O1MA 3MAMA 2YLNA 5EYGA 5I5PA 1FQBA 2XD3A 2GH9A 2E0SA 4QSDA 3QAXA 3UIFA 2REGA 4ELRA 3K6VA 3UP9A 4FJPA 1FPIA 3RT8A 3CFLA 1MM6A 2B4MA 4H0WA 3Q29A 3CVGA 1BK4A 1URGA 3HHFA 3HPIA 4LP2B 3T9XB 1NKXA 2FBPA 5ET8A 2QFLA 5AA4B 2OWTA 1FBPA 4IO6A 3U94A 2X26A 5CBRA 3PPNA 5I84A 4GBWA 2P0SA 4ELQA 1ZLQA 4PCDA 2F3DA 2QRYA 1P1QA 4MNCA 2KQZA 4NF6A 2RCBA 4NQ8A 1A7LA 2VHAA 4UA8A 4RA1A 4R9GA 1FQAA 3OEMA 1L5TA 4YKJA 5F24A 5TPAB 2V3UA 4H67A 4MNIA 3W9VA 3C9HA 3PUZE 4KD5A 4MLQA 1R9LA 1MH3A 2F78A 3O6HA 4GQOA 4LONB 3K1PA 4FIMA 4ZE8A 3KOSA 1MH4A 2F7AA 4M1VA 5DVFA 3VE1B 2ZMBA 3TTNA 1Q1KA 4QHQA 3K01A 1Y20A 1IEJA 3FVNA 1FTOA 3VVDA 3BIHA 3VXCA 3BBRA 1WDNA 3NOHA 2I4CA 3C34A 3A3UA 3PD8A 3B6TA 3PUVE 2I48A 3PUWE 4H6DA 4G68A 1UTHB 4PDHA 1OVBA 2ALUA 1ZJLA 4G61A 4JBZA 2RKMA 2O68A 3MZBA 2D21A 2DVZA 5LDZA 3ZSFA 1RKMA 5ISUA 2I3VA 3QMFA 4H5GA 3D4GA 4HXVA 3G3HA 2F3BA 4GVOA 4OWDA 4DI3D 4YMBA 4U21A 2V4CA 5FTHA 4ZEFA 3H3GA 4R6YA 3PPOA 2R8TA 3OO8A 1MY0A 1ZMGA 1NH7A 3ONMA 3GBAA 1YYZA 5IAIA 2IEEA 1LLSA 1FPFA 3OSQA 5IZ3B 2NWJA 1LAGE 1OLAA 5IM2A 3TEPA 2OJTA 1NL5A 1EZOA 2CMOA 2XWOA 5ET7A 4OFOA 5CMMA 1SYIA 1TT1A 2HPGA 4N17A 1BP5A 4NGUA 2F97A 5A5XA 3GBBA 2HQ0A 2OK2A 5CBSA 4G77A 4KXPA 3D1RA 3UK4A 1F9BA 4ZE9A 2XX9A 2RC9A 3U8QA 3I6VA 4TOZA 4F18A 4IO4A 5I57B 3V83A 3N94A 3OENA 4HS7A 4KR5A 3TTMA 4NHBA 2ZXTA 3B8BA 4JVDA 1NUXA 3VDFA 2O69A 4NMYA 1B6HA 4KQPA 3LUYA 5ET6A 1ZKBA 3CSBA 3T96B 3FGSA 1N04A 4F1UA 3GXAA 2Q74A 2ZYNA 1I6AA 3FATA 1B7UA 4OENA 4R9FA 4PFWA 4R6HA 2XXRA 3KOTA 3MUQA 2F35A 4R2BA 4LZ7A 1B9JA 3Q25A 3FXBA 1M5CA 3TODA 3MP1A 1G0IA 4GOTA 4BLAA 4TLMB 3G3KA 3IO6A 3FV1A 4P1EA 4IR8A 4I62A 3SEVA 3USDA 2Y5KA 4IGRA 5I7IA 1B5JA 1OMPA 1LAXA 3C4MA 4PAIA 3TPAA 4C1UA 1OIBA 2V25A 2PT2A 4I8CA 4F1VA 3U1OA 4GWYA 1Y1ZA 1SW4A 1UQWA 1NV5A 4F3SA 1USYE 4GFRA 3IOVA 3ILTB 3RYDA 3EHTA 2FIXA 4PE3A 4PFRA 1VFDA 4KCDA 1SW1A 4GIZA 4F39A 4HE2A 1Y9UA 5B70A 1M5DA 1IXCA 2GHAA 1VDWA 4FBPA 1FQCA 2THIA 4LQ2A 1ZBMA 1LBBA 3K00A 3B7DA 3PGFA 3KZGA 3KN8A 1OQGA 3KBZA 4FECA 2WBBA 4NF0A 2XXHA 1JW1A 2PT1A 3KN7A 1IITA 4GWZA 3FXQA 2XA5A 2A5TA 2I4BA 4ESXA 5CMBA 1AL3A 1M5BA 2DWAA 3FXUA 3OEKA 1LAFE 4EF2A 3SERA 2E1SA 3T1BA 2OWSA 1HSEA 2DWIA 3A3CA 2GFEA 3MP6A 3O29A 1SBPA 3EN3A 1FPBA 2WKYA 4OANA 2DE3A 3TTRA 3V5AA 3OSRA 1H3DA 3MJNA 2FA7A 4G68C 2RC7A 4G8HA 5M2VA 3L6GA 4NF8B 2F7BA 2XXKA
chains in the Genus database with same CATH topology
1P99A 1OQHA 3IOUA 3ODBA 4ZECA 1PDAA 1MXWA 3IOTA 1N7WA 3PUYE 4EQ9A 1LB8A 1LBCA 4ONYA 1YPNA 1QUKA 4NTLA 3THIA 1XS5A 5AA4A 4AB6A 4GL8A 5L9SA 4OESA 1B5HA 4YZZA 3DP8A 2UVHA 3KEIA 4YU0A 4P0GA 5I59B 2BJJX 4ZZAA 1MQDA 2AL5A 2M8CA 2PMSA 5H8HB 1B0HA 1ZIUA 2YJPA 3ZKLA 1SI0A 2RC8A 4NE4A 4RPOA 3JV9A 4KPTA 2X7PA 4R6KA 1RYXA 3PMWA 1FQDA 3R6UA 4R74A 4X1BA 4LATA 4Z7EA 4ZEBA 2Q9TA 4YKKA 4GL0A 4ESWA 4X48A 4Z0IA 1XOCA 2Z22A 2UVJA 3K1NA 4XIGQ 4OFJA 5CC2A 1XVXA 3HSTA 3MC2A 4HCWA 3PV0E 2NOOA 1MY4A 4F2OA 4QFKA 3TCFA 4N13A 2Q8JA 1B3LA 1B1HA 4EQBA 4L17A 4AB5A 2I0CA 1UTHA 1CB6A 4FEDA 1LAHE 1EH3A 4G2ZA 2AIXA 4OYVA 4DZ1A 1B7ZA 3SESA 4XKPA 1H44A 3KSXA 4JWXA 4U1OA 5ITPA 3LC8A 3OO9A 2Z8EA 2B65A 1R9QA 2HEUA 5DTBA 3OO7A 4DXBA 1TFAA 4QFPA 5I56B 1IXHA 3O97A 1VFEA 3A09A 1Y3PA 5I2KB 1JEUA 1XVYA 3MVZA 5CMKA 1LCTA 3TDJA 1US5A 2VD3A 5FHOA 3R26A 3Q27A 4POXA 4R73A 3C32A 4LVQA 3TCGA 3D4CA 3BFUA 2Z8FA 5H8FB 3RLFE 2HXWA 5JEIA 5H8NB 2DE2A 4NF4B 1QUIA 3IB2A 2X7QA 1USYH 2QPQA 1FTJA 3U72A 1SQYA 3H06B 1VE4A 1D3KA 1AIVA 2YPNA 3C31A 5I57A 4XTCQ 3UORA 2I58A 1N0TA 4GWOA 3WAFA 1B52A 1MRPA 3K1MA 1I6QA 2RCAA 4U2RA 3V89B 1R1NA 2Y7RA 1B58A 1DPEA 2Y84A 3Q26A 3K6WA 4JB7A 5AA2B 1I6BA 2AYSA 2Y7KA 1NNKA 3AXFA 2XX8A 2B3BA 1MY1A 2DS9A 4N07A 3ECRA 2F36A 2VP1A 3TTLA 1J1NA 4JDFA 4ZS9A 2DOJA 2ONKE 4GXSB 3RNNA 3QK6A 2P1SA 1Z7ME 2Z23A 2UXAA 1KWHA 2F5XA 4U4SA 4EXLA 2OBGA 1H45A 4C1TA 2XX7A 2UYFA 3G3GA 3S9EA 3T22A 2O1LA 4H8JA 3MWBA 1IXGA 1M5EA 3M3LA 4PQJA 3H4ZA 3PPQA 5L8DA 5BUUA 3TAJA 2H25A 1B4HA 3BKIB 1B05A 4LA9A 5JTYB 1O64A 4EQ7A 4DLDA 3H6WA 1A8FA 1Y3NA 1BKAA 1URDA 1HSLA 1US4A 2ZYOA 2HAVA 4LUBA 1DSNA 1EZPA 3E3KA 4I9DA 3IB1A 3K4UA 3CI8A 1IIWA 3K0VA 1N84A 2Q2AA 3HO7A 4DCXA 4RYAA 2XD2A 3VLVA 3MP8A 1N76A 1DTGA 2G29A 4KI0E 3S4UA 5H8QB 1MQGA 1O7TA 4IO2A 3GZGA 3K02A 1A99A 3G3JA 2V3TA 2DSFA 4NF5A 5HPQA 1Q35A 1UTBB 3SEWA 3T9HB 1M5FA 1MPCA 1B32A 3VVFA 1NMUA 2XXYA 1ZU0A 1FCKA 2R71A 3S9LC 4YKPA 4NF8A 1MXZA 5EHMA 3ZS6A 2G93A 3IOWA 4DCYA 4C0RA 5I58B 1BLFA 3EF7A 3TCHA 1PB7A 2REJA 5DT6A 2QL3A 1IUDA 3ILUB 1MXVA 5ITOA 1NNTA 4F3GA 2ZNSA 1SDXA 3QUFA 4XXUA 3P7IA 4XKQA 4TLLB 4OQOA 1FQEA 1LFGA 5DEXB 2D3IA 1MPBA 3DP4A 5I59A 3KN3A 5HBCA 4IO5A 1OVTA 1MY2A 3SEXA 2QS3A 3W15C 3HCQA 3O2AA 5H8HA 3CSGA 2R9JA 2I3WA 1PC3A 4G8MA 3RUMA 4WXJA 2VD2A 3N26A 3HN0A 4X9TA 1NFTA 3MQ9A 2HCAA 3H7MA 4GF8A 4F31B 2UVIA 3IJOB 4U4XA 1MDP1 5K2YA 1FTKA 1GV8A 1D4NA 3OO6A 2Y7WA 3K6XA 1LFIA 2DVCA 3CFXA 3IAZA 2O7IA 4RK2A 3VLWA 5K2XA 4MLVA 1POY1 2O84X 3PPRA 4F22A 5I2NB 2RINA 4OMBA 1IQ7A 2F6PA 3IORA 3H6UA 1JQFA 1YTVA 3FD3A 2KLFA 2XXWA 4FAJA 4G4PA 2Q89A 4M4GA 4FORA 3SKPA 1P1UA 5CI5A 2R6GE 2XXPA 1OLCA 4IB2A 5CRYA 3KJTA 1H76A 3VFJA 2ONRA 1IZ1A 2A5SA 4E0XA 1GTKA 5I56A 5KZTA 1JEVA 2GHBA 3T93B 5I2KA 3IB0A 1AMFA 3OOAA 1BIYA 1NNFA 3N5LA 4ZZEA 5AA3A 3CFZA 3RTWB 4U1ZA 4BDOA 2ZYMA 2Y7PA 1SYHA 3EHSA 1PEBA 4YB6A 4EUOA 5H8FA 1GVCA 4RXLA 5H8NA 4NF4A 4EF1A 2UVGA 1DOTA 1QKBA 5KCJB 3IX1A 2V84A 2PYYA 3N6TA 2XHDA 4ELPA 1QVSA 3KFMA 2ZNTA 5TP9B 1A8EA 5TPAA 4NWCA 1CE2A 4QF9A 2XXVA 1B3HA 2QS1A 3RQTA 2V93A 3VVEA 4PP0A 5FHNA 5KDTB 5AA2A 1EZ9A 2DXYA 1N3WA 1PBPA 2DWHA 2LAOA 1XHYA 5EYFA 2Q2CA 3RGYA 3FXRA 4HTGA 1GGGA 3TZAA 1P1WA 5EHSA 3RPWA 2Z8DA 1MQHA 2F7CA 4P11A 3SEUA 4O3AA 3LBSA 3I5OA 4RY1A 1FTMA 1H43A 1AOVA 3Q28A 5ICQA 4MH5A 3O6GA 1QJMA 1PBQA 4E0WA 2HAUA 4UACA 3C36A 3PUXE 1WODA 3S2VA 3TTKA 1LSTA 1XT8A 2H98A 3MZ1A 3N6UA 1Y3QA 4YAHX 4WKMA 4QFLA 3PPPA 2NVUB 4OZ9A 4IO3A 4GRKA 1DMBA 4YKIA 3B6WA 3BFTA 1A40A 4OEVA 3S9NC 2ZYKA 1II5A 4N6PA 4X1DA 4Q30B 1MQJA 4YMAA 1N7XA 2PX1A 4BDRA 1B5IA 4KYSA 3IR1A 5JTYA 3MVWA 4OXVA 4IY6A 5JK4A 5F1QA 2UYEA 1B0LA 2ANJA 3RN8A 3G3FA 3WAEA 2DYXA 1VSOA 4KFQA 4F29A 3B6QA 1S50A 2DP8A 3M8UA 4AQ4A 1ANFA 5H8SA 2CZLA 4KCCA 2XXUA 3SETA 3F11A 1AH5A 2XXXA 4IO7A 2ONSA 5L9MA 4OEUA 1S9TA 3DLNA 4MFIA 3CG3A 5DVJA 5H8QA 3H6TA 3IK6B 1Y1MA 1SVXB 3TKDA 1SI1A 3MZ9A 1UTBA 4LZ5A 4Q8RA 4JXIA 4QRZA 4BDMA 3E13X 4F3BA 1EU8A 4ELOA 3VXBA 1A55A 4HW8A 3QXMA 3EQ1A 3KBRA 5I58A 4H1XA 3RTFB 1MXXA 3LR1A 2F6GA 4YICA 3TFLA 1LCFA 3M3FA 4OERA 2I0BA 3IJXB 3LSXA 4QFNA 1B1XA 3K6UA 4IY5A 4OHNA 3T9UA 3QIMA 2NXOA 3PD9A 3CR9A 5DEXA 3U93A 3PU5A 3L6HA 4ZEIA 4HCYA 1QUJA 4U23A 2FYIA 1DTZA 1FTLA 4K3FA 5AA2D 3FJMA 2OZZA 5J1DA 4DXCA 3IO4A 4R2FA 1RYOA 4P0IA 4I1DA 4R72A 1R6ZA 3OELA 3E9XA 3JZJA 3TUSA 5B7DA 1QW0A 1PB9A 2VGQA 3M3KA 4NEDA 4XKRA 2I6EA 2W7YA 4KYDA 3KSJA 3O6IA 4QSCA 4O3BA 3CG1A 2QMXA 2QSXA 2FNCA 3FJGA 4H8IA 1B40A 1TXFA 4GD5A 4Q5TA 1ELJA 4JSOA 3TELA 4FATA 3DELB 4NF6B 3OXNA 3PMXA 2HZLA 5I2NA 3SEYA 1HSJA 4KHZE 3FJ7A 5FHMA 2I49A 3SDFA 4RNSA 2DE4A 3ZKKA 1Y4TA 1JNFA 1VR5A 2XXTA 3LSLA 4MBPA 2DWJA 3T9VA 3VLUA 1URSA 4OVJA 3HHGA 3FIRA 4EXKA 4DDDA 2F8DA 2HZKA 1O63A 1P1NA 2P2AA 4F19A 3DP6A 1T0KA 2PBWA 3FZVA 3HV1A 4PFUA 1MPDA 4ND9A 1A54A 2OLBA 1MM7A 1SD3A 5BWJA 4BDQA 1LB9A 3H6VA 2D5WA 3DM0A 1Y4CA 4G68B 5AE4A 3TYHA 4KYEA 4H5FA 4EDPA 1NH8A 4OTEA 3KG2A 3TQWA 1FW0A 1MG1A 1P1OA 1NNPA 4LQ5A 4WEPA 5FTIA 4DIGA 1B46A 4Q0CA 1YAEA 2VOZA 3S9MC 4O3CA 3C33A 4JWOA 4JWYA 5KCJA 2XXIA 3FVOA 2IA4A 3MW0A 2F34A 3QSLA 5TP9A 3QYTA 3MBPA 3LSWA 1UIUA 3VV5A 5ICTA 4OFLA 2OCUA 4PFYA 5CM6A 1JVYA 1I69A 4F3PA 1UIVA 3W9WA 3OD7A 5KDTA 3TMGA 1MXUA 2B3FA 1S7YA 5A5XB 1B3EA 2H5YA 1ZTYA 4QFOA 3K2DA 4QSEA 3T66A 4LZ8A 3MVYA 2ESNA 4XKNA 1B3GA 4FE8A 4G8NA 4RPNA 4RJZA 4WEDA 3G3IA 2H9BA 3R7XA 3C35A 3FUZA 3V8XB 2O51A 1WVJA 4DE8A 4PE5B 2NUVA 2ZNUA 3QUJA 4BDNA 4GLIA 2H4IA 1SW5A 1ATGA 3RY3A 5CMCA 2QS2A 1JW5A 2PVUA 1B7HA 3KJ7A 4NF5B 2DXRA 4TQUQ 2DQVA 2QJEA 2QS4A 1B2HA 1GR2A 2ABHA 4IGTA 2Y7IA 3E4RA 3O28A 3FASA 3UGWA 3LSFB 4ISUA 2O6AA 5L9OA 1TFDA 5AA1A 1MQIA 1YCJA 1B51A 3MVXA 4PETA 4BDLA 1XC1A 3MPLA 3EHUA 2RF1A 2V3QA 3UA8A 1IXIA 2AL4A 4ZDMA 1QKAA 1MDQA 3FVKA 3U92A 4PFTA 3TQLA 4ECFA 1Z7NE 4H65A 5LOMA 1B4ZA 4GXAA 4YB5A 1PB8A 3H03A 2XXQA 4JSDA 5DVIA 1N3XA 3EPEA 3FVGA 3FV2A 3CRBA 1FQFA 3CIJA 4MF3A 2Q88A 1QULA 4POWA 3KGCA 1SW2A 3I3VA 4ZEKA 3JYRA 3IL1B 4R75A 4ZEDA 3OMBA 3O66A 5HM4B 1TWYA 1JVXA 4NWDA 1D9YA 4RK9A 4THIA 1POTA 1MY3A 1MS7A 5ELVA 1D9VA 2A5TB 3GLBA 3O9PA 2QMWA 5F7VA 4F2QA 3MPKA 1B3FA 1JETA 1LFHA 1DPPA 4F1YA 3PMVA 4DXUA 2GRVA 5TU0A 4YB7A 1BTJA 4OETA 3RT6B 3G7WA 5DYHA 4FEBA 2HFBA 2O7UA 4U22A 3UN6A 1JW4A 5IKBA 2H99A 1LGBC 1MXYA 2O1MA 3MAMA 2YLNA 1FQBA 2XD3A 2GH9A 2E0SA 4QSDA 3QAXA 3UIFA 2REGA 4ELRA 3K6VA 3UP9A 4FJPA 3RT8A 3CFLA 1MM6A 4H0WA 3Q29A 3CVGA 1URGA 3HHFA 3HPIA 4LP2B 3T9XB 1NKXA 5AA4B 2OWTA 4IO6A 3U94A 2X26A 5CBRA 3PPNA 5I84A 2P0SA 4ELQA 1ZLQA 2QRYA 1P1QA 4NF6A 2RCBA 1A7LA 2VHAA 4UA8A 4RA1A 4R9GA 1FQAA 3OEMA 1L5TA 4YKJA 5TPAB 2V3UA 4H67A 3W9VA 3C9HA 3PUZE 4KD5A 4MLQA 1R9LA 1MH3A 2F78A 3O6HA 4GQOA 4LONB 3K1PA 4FIMA 4ZE8A 3KOSA 1MH4A 2F7AA 4M1VA 5DVFA 3VE1B 2ZMBA 3TTNA 1Q1KA 4QHQA 3K01A 1Y20A 1IEJA 3FVNA 1FTOA 3VVDA 3VXCA 3BBRA 1WDNA 2I4CA 3C34A 3A3UA 3PD8A 3B6TA 3PUVE 2I48A 3PUWE 4H6DA 4G68A 1UTHB 1OVBA 2ALUA 1ZJLA 4JBZA 2RKMA 2O68A 3MZBA 2D21A 2DVZA 3ZSFA 1RKMA 5ISUA 2I3VA 4H5GA 3D4GA 3G3HA 4GVOA 4OWDA 4YMBA 4U21A 5FTHA 4ZEFA 3H3GA 4R6YA 3PPOA 3OO8A 1MY0A 1ZMGA 1NH7A 3ONMA 3GBAA 5IAIA 2IEEA 1LLSA 3OSQA 2NWJA 1LAGE 1OLAA 3TEPA 2OJTA 1NL5A 1EZOA 2CMOA 4OFOA 5CMMA 1SYIA 1TT1A 1BP5A 2F97A 5A5XA 3GBBA 2HQ0A 2OK2A 5CBSA 4G77A 3UK4A 1F9BA 4ZE9A 2XX9A 2RC9A 3U8QA 3I6VA 4TOZA 4F18A 4IO4A 5I57B 3V83A 3N94A 3OENA 4HS7A 4KR5A 3TTMA 2ZXTA 3VDFA 2O69A 4NMYA 1B6HA 4KQPA 3LUYA 1ZKBA 3CSBA 3T96B 3FGSA 1N04A 4F1UA 3GXAA 2ZYNA 1I6AA 3FATA 1B7UA 4OENA 4R9FA 4PFWA 4R6HA 2XXRA 3KOTA 3MUQA 2F35A 4R2BA 4LZ7A 1B9JA 3Q25A 1M5CA 3TODA 3MP1A 4GOTA 4BLAA 4TLMB 3G3KA 3IO6A 3FV1A 4I62A 3SEVA 3USDA 4IGRA 1B5JA 1OMPA 1LAXA 3C4MA 3TPAA 4C1UA 1OIBA 2V25A 2PT2A 4I8CA 4F1VA 3U1OA 1Y1ZA 1SW4A 1UQWA 4F3SA 1USYE 4GFRA 3IOVA 3ILTB 3EHTA 1VFDA 4KCDA 1SW1A 4GIZA 4F39A 1Y9UA 5B70A 1M5DA 1IXCA 2GHAA 1FQCA 2THIA 4LQ2A 1ZBMA 1LBBA 3K00A 3B7DA 3PGFA 3KZGA 3KN8A 1OQGA 4FECA 2XXHA 1JW1A 2PT1A 3KN7A 1IITA 3FXQA 2A5TA 2I4BA 4ESXA 5CMBA 1AL3A 1M5BA 2DWAA 3FXUA 3OEKA 1LAFE 4EF2A 3SERA 2E1SA 2OWSA 1HSEA 2DWIA 3A3CA 2GFEA 3MP6A 3O29A 1SBPA 3EN3A 2WKYA 2DE3A 3TTRA 3V5AA 3OSRA 1H3DA 3MJNA 2FA7A 4G68C 2RC7A 4G8HA 5M2VA 3L6GA 4NF8B 2F7BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P99 A;  1OQH A;  3IOU A;  3ODB A;  4ZEC A;  1PDA A;  1MXW A;  3IOT A;  1N7W A;  3PUY E;  4EQ9 A;  1LB8 A;  1LBC A;  4ONY A;  1YPN A;  1QUK A;  4NTL A;  3THI A;  1XS5 A;  5AA4 A;  4AB6 A;  4GL8 A;  5L9S A;  4OES A;  1B5H A;  4YZZ A;  3DP8 A;  2UVH A;  3KEI A;  4YU0 A;  4P0G A;  5I59 B;  2BJJ X;  4ZZA A;  1MQD A;  2AL5 A;  2M8C A;  2PMS A;  5H8H B;  1B0H A;  1ZIU A;  2YJP A;  3ZKL A;  1SI0 A;  2RC8 A;  4NE4 A;  4RPO A;  3JV9 A;  4KPT A;  2X7P A;  4R6K A;  1RYX A;  3PMW A;  1FQD A;  3R6U A;  4R74 A;  4X1B A;  4LAT A;  4Z7E A;  4ZEB A;  2Q9T A;  4YKK A;  4GL0 A;  4ESW A;  4X48 A;  4Z0I A;  1XOC A;  2Z22 A;  2UVJ A;  3K1N A;  4XIG Q;  4OFJ A;  5CC2 A;  1XVX A;  3HST A;  3MC2 A;  4HCW A;  3PV0 E;  2NOO A;  1MY4 A;  4F2O A;  4QFK A;  3TCF A;  4N13 A;  2Q8J A;  1B3L A;  1B1H A;  4EQB A;  4L17 A;  4AB5 A;  2I0C A;  1UTH A;  1CB6 A;  4FED A;  1LAH E;  1EH3 A;  4G2Z A;  2AIX A;  4OYV A;  4DZ1 A;  1B7Z A;  3SES A;  4XKP A;  1H44 A;  3KSX A;  4JWX A;  4U1O A;  5ITP A;  3LC8 A;  3OO9 A;  2Z8E A;  2B65 A;  1R9Q A;  2HEU A;  5DTB A;  3OO7 A;  4DXB A;  1TFA A;  4QFP A;  5I56 B;  1IXH A;  3O97 A;  1VFE A;  3A09 A;  1Y3P A;  5I2K B;  1JEU A;  1XVY A;  3MVZ A;  5CMK A;  1LCT A;  3TDJ A;  1US5 A;  2VD3 A;  5FHO A;  3R26 A;  3Q27 A;  4POX A;  4R73 A;  3C32 A;  4LVQ A;  3TCG A;  3D4C A;  3BFU A;  2Z8F A;  5H8F B;  3RLF E;  2HXW A;  5JEI A;  5H8N B;  2DE2 A;  4NF4 B;  1QUI A;  3IB2 A;  2X7Q A;  1USY H;  2QPQ A;  1FTJ A;  3U72 A;  1SQY A;  3H06 B;  1VE4 A;  1D3K A;  1AIV A;  2YPN A;  3C31 A;  5I57 A;  4XTC Q;  3UOR A;  2I58 A;  1N0T A;  4GWO A;  3WAF A;  1B52 A;  1MRP A;  3K1M A;  1I6Q A;  2RCA A;  4U2R A;  3V89 B;  1R1N A;  2Y7R A;  1B58 A;  1DPE A;  2Y84 A;  3Q26 A;  3K6W A;  4JB7 A;  5AA2 B;  1I6B A;  2AYS A;  2Y7K A;  1NNK A;  3AXF A;  2XX8 A;  2B3B A;  1MY1 A;  2DS9 A;  4N07 A;  3ECR A;  2F36 A;  2VP1 A;  3TTL A;  1J1N A;  4JDF A;  4ZS9 A;  2DOJ A;  2ONK E;  4GXS B;  3RNN A;  3QK6 A;  2P1S A;  1Z7M E;  2Z23 A;  2UXA A;  1KWH A;  2F5X A;  4U4S A;  4EXL A;  2OBG A;  1H45 A;  4C1T A;  2XX7 A;  2UYF A;  3G3G A;  3S9E A;  3T22 A;  2O1L A;  4H8J A;  3MWB A;  1IXG A;  1M5E A;  3M3L A;  4PQJ A;  3H4Z A;  3PPQ A;  5L8D A;  5BUU A;  3TAJ A;  2H25 A;  1B4H A;  3BKI B;  1B05 A;  4LA9 A;  5JTY B;  1O64 A;  4EQ7 A;  4DLD A;  3H6W A;  1A8F A;  1Y3N A;  1BKA A;  1URD A;  1HSL A;  1US4 A;  2ZYO A;  2HAV A;  4LUB A;  1DSN A;  1EZP A;  3E3K A;  4I9D A;  3IB1 A;  3K4U A;  3CI8 A;  1IIW A;  3K0V A;  1N84 A;  2Q2A A;  3HO7 A;  4DCX A;  4RYA A;  2XD2 A;  3VLV A;  3MP8 A;  1N76 A;  1DTG A;  2G29 A;  4KI0 E;  3S4U A;  5H8Q B;  1MQG A;  1O7T A;  4IO2 A;  3GZG A;  3K02 A;  1A99 A;  3G3J A;  2V3T A;  2DSF A;  4NF5 A;  5HPQ A;  1Q35 A;  1UTB B;  3SEW A;  3T9H B;  1M5F A;  1MPC A;  1B32 A;  3VVF A;  1NMU A;  2XXY A;  1ZU0 A;  1FCK A;  2R71 A;  3S9L C;  4YKP A;  4NF8 A;  1MXZ A;  5EHM A;  3ZS6 A;  2G93 A;  3IOW A;  4DCY A;  4C0R A;  5I58 B;  1BLF A;  3EF7 A;  3TCH A;  1PB7 A;  2REJ A;  5DT6 A;  2QL3 A;  1IUD A;  3ILU B;  1MXV A;  5ITO A;  1NNT A;  4F3G A;  2ZNS A;  1SDX A;  3QUF A;  4XXU A;  3P7I A;  4XKQ A;  4TLL B;  4OQO A;  1FQE A;  1LFG A;  5DEX B;  2D3I A;  1MPB A;  3DP4 A;  5I59 A;  3KN3 A;  5HBC A;  4IO5 A;  1OVT A;  1MY2 A;  3SEX A;  2QS3 A;  3W15 C;  3HCQ A;  3O2A A;  5H8H A;  3CSG A;  2R9J A;  2I3W A;  1PC3 A;  4G8M A;  3RUM A;  4WXJ A;  2VD2 A;  3N26 A;  3HN0 A;  4X9T A;  1NFT A;  3MQ9 A;  2HCA A;  3H7M A;  4GF8 A;  4F31 B;  2UVI A;  3IJO B;  4U4X A;  1MDP 1;  5K2Y A;  1FTK A;  1GV8 A;  1D4N A;  3OO6 A;  2Y7W A;  3K6X A;  1LFI A;  2DVC A;  3CFX A;  3IAZ A;  2O7I A;  4RK2 A;  3VLW A;  5K2X A;  4MLV A;  1POY 1;  2O84 X;  3PPR A;  4F22 A;  5I2N B;  2RIN A;  4OMB A;  1IQ7 A;  2F6P A;  3IOR A;  3H6U A;  1JQF A;  1YTV A;  3FD3 A;  2KLF A;  2XXW A;  4FAJ A;  4G4P A;  2Q89 A;  4M4G A;  4FOR A;  3SKP A;  1P1U A;  5CI5 A;  2R6G E;  2XXP A;  1OLC A;  4IB2 A;  5CRY A;  3KJT A;  1H76 A;  3VFJ A;  2ONR A;  1IZ1 A;  2A5S A;  4E0X A;  1GTK A;  5I56 A;  5KZT A;  1JEV A;  2GHB A;  3T93 B;  5I2K A;  3IB0 A;  1AMF A;  3OOA A;  1BIY A;  1NNF A;  3N5L A;  4ZZE A;  5AA3 A;  3CFZ A;  3RTW B;  4U1Z A;  4BDO A;  2ZYM A;  2Y7P A;  1SYH A;  3EHS A;  1PEB A;  4YB6 A;  4EUO A;  5H8F A;  1GVC A;  4RXL A;  5H8N A;  4NF4 A;  4EF1 A;  2UVG A;  1DOT A;  1QKB A;  5KCJ B;  3IX1 A;  2V84 A;  2PYY A;  3N6T A;  2XHD A;  4ELP A;  1QVS A;  3KFM A;  2ZNT A;  5TP9 B;  1A8E A;  5TPA A;  4NWC A;  1CE2 A;  4QF9 A;  2XXV A;  1B3H A;  2QS1 A;  3RQT A;  2V93 A;  3VVE A;  4PP0 A;  5FHN A;  5KDT B;  5AA2 A;  1EZ9 A;  2DXY A;  1N3W A;  1PBP A;  2DWH A;  2LAO A;  1XHY A;  5EYF A;  2Q2C A;  3RGY A;  3FXR A;  4HTG A;  1GGG A;  3TZA A;  1P1W A;  5EHS A;  3RPW A;  2Z8D A;  1MQH A;  2F7C A;  4P11 A;  3SEU A;  4O3A A;  3LBS A;  3I5O A;  4RY1 A;  1FTM A;  1H43 A;  1AOV A;  3Q28 A;  5ICQ A;  4MH5 A;  3O6G A;  1QJM A;  1PBQ A;  4E0W A;  2HAU A;  4UAC A;  3C36 A;  3PUX E;  1WOD A;  3S2V A;  3TTK A;  1LST A;  1XT8 A;  2H98 A;  3MZ1 A;  3N6U A;  1Y3Q A;  4YAH X;  4WKM A;  4QFL A;  3PPP A;  2NVU B;  4OZ9 A;  4IO3 A;  4GRK A;  1DMB A;  4YKI A;  3B6W A;  3BFT A;  1A40 A;  4OEV A;  3S9N C;  2ZYK A;  1II5 A;  4N6P A;  4X1D A;  4Q30 B;  1MQJ A;  4YMA A;  1N7X A;  2PX1 A;  4BDR A;  1B5I A;  4KYS A;  3IR1 A;  5JTY A;  3MVW A;  4OXV A;  4IY6 A;  5JK4 A;  5F1Q A;  2UYE A;  1B0L A;  2ANJ A;  3RN8 A;  3G3F A;  3WAE A;  2DYX A;  1VSO A;  4KFQ A;  4F29 A;  3B6Q A;  1S50 A;  2DP8 A;  3M8U A;  4AQ4 A;  1ANF A;  5H8S A;  2CZL A;  4KCC A;  2XXU A;  3SET A;  3F11 A;  1AH5 A;  2XXX A;  4IO7 A;  2ONS A;  5L9M A;  4OEU A;  1S9T A;  3DLN A;  4MFI A;  3CG3 A;  5DVJ A;  5H8Q A;  3H6T A;  3IK6 B;  1Y1M A;  1SVX B;  3TKD A;  1SI1 A;  3MZ9 A;  1UTB A;  4LZ5 A;  4Q8R A;  4JXI A;  4QRZ A;  4BDM A;  3E13 X;  4F3B A;  1EU8 A;  4ELO A;  3VXB A;  1A55 A;  4HW8 A;  3QXM A;  3EQ1 A;  3KBR A;  5I58 A;  4H1X A;  3RTF B;  1MXX A;  3LR1 A;  2F6G A;  4YIC A;  3TFL A;  1LCF A;  3M3F A;  4OER A;  2I0B A;  3IJX B;  3LSX A;  4QFN A;  1B1X A;  3K6U A;  4IY5 A;  4OHN A;  3T9U A;  3QIM A;  2NXO A;  3PD9 A;  3CR9 A;  5DEX A;  3U93 A;  3PU5 A;  3L6H A;  4ZEI A;  4HCY A;  1QUJ A;  4U23 A;  2FYI A;  1DTZ A;  1FTL A;  4K3F A;  5AA2 D;  3FJM A;  2OZZ A;  5J1D A;  4DXC A;  3IO4 A;  4R2F A;  1RYO A;  4P0I A;  4I1D A;  4R72 A;  1R6Z A;  3OEL A;  3E9X A;  3JZJ A;  3TUS A;  5B7D A;  1QW0 A;  1PB9 A;  2VGQ A;  3M3K A;  4NED A;  4XKR A;  2I6E A;  2W7Y A;  4KYD A;  3KSJ A;  3O6I A;  4QSC A;  4O3B A;  3CG1 A;  2QMX A;  2QSX A;  2FNC A;  3FJG A;  4H8I A;  1B40 A;  1TXF A;  4GD5 A;  4Q5T A;  1ELJ A;  4JSO A;  3TEL A;  4FAT A;  3DEL B;  4NF6 B;  3OXN A;  3PMX A;  2HZL A;  5I2N A;  3SEY A;  1HSJ A;  4KHZ E;  3FJ7 A;  5FHM A;  2I49 A;  3SDF A;  4RNS A;  2DE4 A;  3ZKK A;  1Y4T A;  1JNF A;  1VR5 A;  2XXT A;  3LSL A;  4MBP A;  2DWJ A;  3T9V A;  3VLU A;  1URS A;  4OVJ A;  3HHG A;  3FIR A;  4EXK A;  4DDD A;  2F8D A;  2HZK A;  1O63 A;  1P1N A;  2P2A A;  4F19 A;  3DP6 A;  1T0K A;  2PBW A;  3FZV A;  3HV1 A;  4PFU A;  1MPD A;  4ND9 A;  1A54 A;  2OLB A;  1MM7 A;  1SD3 A;  5BWJ A;  4BDQ A;  1LB9 A;  3H6V A;  2D5W A;  3DM0 A;  1Y4C A;  4G68 B;  5AE4 A;  3TYH A;  4KYE A;  4H5F A;  4EDP A;  1NH8 A;  4OTE A;  3KG2 A;  3TQW A;  1FW0 A;  1MG1 A;  1P1O A;  1NNP A;  4LQ5 A;  4WEP A;  5FTI A;  4DIG A;  1B46 A;  4Q0C A;  1YAE A;  2VOZ A;  3S9M C;  4O3C A;  3C33 A;  4JWO A;  4JWY A;  5KCJ A;  2XXI A;  3FVO A;  2IA4 A;  3MW0 A;  2F34 A;  3QSL A;  5TP9 A;  3QYT A;  3MBP A;  3LSW A;  1UIU A;  3VV5 A;  5ICT A;  4OFL A;  2OCU A;  4PFY A;  5CM6 A;  1JVY A;  1I69 A;  4F3P A;  1UIV A;  3W9W A;  3OD7 A;  5KDT A;  3TMG A;  1MXU A;  2B3F A;  1S7Y A;  5A5X B;  1B3E A;  2H5Y A;  1ZTY A;  4QFO A;  3K2D A;  4QSE A;  3T66 A;  4LZ8 A;  3MVY A;  2ESN A;  4XKN A;  1B3G A;  4FE8 A;  4G8N A;  4RPN A;  4RJZ A;  4WED A;  3G3I A;  2H9B A;  3R7X A;  3C35 A;  3FUZ A;  3V8X B;  2O51 A;  1WVJ A;  4DE8 A;  4PE5 B;  2NUV A;  2ZNU A;  3QUJ A;  4BDN A;  4GLI A;  2H4I A;  1SW5 A;  1ATG A;  3RY3 A;  5CMC A;  2QS2 A;  1JW5 A;  2PVU A;  1B7H A;  3KJ7 A;  4NF5 B;  2DXR A;  4TQU Q;  2DQV A;  2QJE A;  2QS4 A;  1B2H A;  1GR2 A;  2ABH A;  4IGT A;  2Y7I A;  3E4R A;  3O28 A;  3FAS A;  3UGW A;  3LSF B;  4ISU A;  2O6A A;  5L9O A;  1TFD A;  5AA1 A;  1MQI A;  1YCJ A;  1B51 A;  3MVX A;  4PET A;  4BDL A;  1XC1 A;  3MPL A;  3EHU A;  2RF1 A;  2V3Q A;  3UA8 A;  1IXI A;  2AL4 A;  4ZDM A;  1QKA A;  1MDQ A;  3FVK A;  3U92 A;  4PFT A;  3TQL A;  4ECF A;  1Z7N E;  4H65 A;  5LOM A;  1B4Z A;  4GXA A;  4YB5 A;  1PB8 A;  3H03 A;  2XXQ A;  4JSD A;  5DVI A;  1N3X A;  3EPE A;  3FVG A;  3FV2 A;  3CRB A;  1FQF A;  3CIJ A;  4MF3 A;  2Q88 A;  1QUL A;  4POW A;  3KGC A;  1SW2 A;  3I3V A;  4ZEK A;  3JYR A;  3IL1 B;  4R75 A;  4ZED A;  3OMB A;  3O66 A;  5HM4 B;  1TWY A;  1JVX A;  4NWD A;  1D9Y A;  4RK9 A;  4THI A;  1POT A;  1MY3 A;  1MS7 A;  5ELV A;  1D9V A;  2A5T B;  3GLB A;  3O9P A;  2QMW A;  5F7V A;  4F2Q A;  3MPK A;  1B3F A;  1JET A;  1LFH A;  1DPP A;  4F1Y A;  3PMV A;  4DXU A;  2GRV A;  5TU0 A;  4YB7 A;  1BTJ A;  4OET A;  3RT6 B;  3G7W A;  5DYH A;  4FEB A;  2HFB A;  2O7U A;  4U22 A;  3UN6 A;  1JW4 A;  5IKB A;  2H99 A;  1LGB C;  1MXY A;  2O1M A;  3MAM A;  2YLN A;  1FQB A;  2XD3 A;  2GH9 A;  2E0S A;  4QSD A;  3QAX A;  3UIF A;  2REG A;  4ELR A;  3K6V A;  3UP9 A;  4FJP A;  3RT8 A;  3CFL A;  1MM6 A;  4H0W A;  3Q29 A;  3CVG A;  1URG A;  3HHF A;  3HPI A;  4LP2 B;  3T9X B;  1NKX A;  5AA4 B;  2OWT A;  4IO6 A;  3U94 A;  2X26 A;  5CBR A;  3PPN A;  5I84 A;  2P0S A;  4ELQ A;  1ZLQ A;  2QRY A;  1P1Q A;  4NF6 A;  2RCB A;  1A7L A;  2VHA A;  4UA8 A;  4RA1 A;  4R9G A;  1FQA A;  3OEM A;  1L5T A;  4YKJ A;  5TPA B;  2V3U A;  4H67 A;  3W9V A;  3C9H A;  3PUZ E;  4KD5 A;  4MLQ A;  1R9L A;  1MH3 A;  2F78 A;  3O6H A;  4GQO A;  4LON B;  3K1P A;  4FIM A;  4ZE8 A;  3KOS A;  1MH4 A;  2F7A A;  4M1V A;  5DVF A;  3VE1 B;  2ZMB A;  3TTN A;  1Q1K A;  4QHQ A;  3K01 A;  1Y20 A;  1IEJ A;  3FVN A;  1FTO A;  3VVD A;  3VXC A;  3BBR A;  1WDN A;  2I4C A;  3C34 A;  3A3U A;  3PD8 A;  3B6T A;  3PUV E;  2I48 A;  3PUW E;  4H6D A;  4G68 A;  1UTH B;  1OVB A;  2ALU A;  1ZJL A;  4JBZ A;  2RKM A;  2O68 A;  3MZB A;  2D21 A;  2DVZ A;  3ZSF A;  1RKM A;  5ISU A;  2I3V A;  4H5G A;  3D4G A;  3G3H A;  4GVO A;  4OWD A;  4YMB A;  4U21 A;  5FTH A;  4ZEF A;  3H3G A;  4R6Y A;  3PPO A;  3OO8 A;  1MY0 A;  1ZMG A;  1NH7 A;  3ONM A;  3GBA A;  5IAI A;  2IEE A;  1LLS A;  3OSQ A;  2NWJ A;  1LAG E;  1OLA A;  3TEP A;  2OJT A;  1NL5 A;  1EZO A;  2CMO A;  4OFO A;  5CMM A;  1SYI A;  1TT1 A;  1BP5 A;  2F97 A;  5A5X A;  3GBB A;  2HQ0 A;  2OK2 A;  5CBS A;  4G77 A;  3UK4 A;  1F9B A;  4ZE9 A;  2XX9 A;  2RC9 A;  3U8Q A;  3I6V A;  4TOZ A;  4F18 A;  4IO4 A;  5I57 B;  3V83 A;  3N94 A;  3OEN A;  4HS7 A;  4KR5 A;  3TTM A;  2ZXT A;  3VDF A;  2O69 A;  4NMY A;  1B6H A;  4KQP A;  3LUY A;  1ZKB A;  3CSB A;  3T96 B;  3FGS A;  1N04 A;  4F1U A;  3GXA A;  2ZYN A;  1I6A A;  3FAT A;  1B7U A;  4OEN A;  4R9F A;  4PFW A;  4R6H A;  2XXR A;  3KOT A;  3MUQ A;  2F35 A;  4R2B A;  4LZ7 A;  1B9J A;  3Q25 A;  1M5C A;  3TOD A;  3MP1 A;  4GOT A;  4BLA A;  4TLM B;  3G3K A;  3IO6 A;  3FV1 A;  4I62 A;  3SEV A;  3USD A;  4IGR A;  1B5J A;  1OMP A;  1LAX A;  3C4M A;  3TPA A;  4C1U A;  1OIB A;  2V25 A;  2PT2 A;  4I8C A;  4F1V A;  3U1O A;  1Y1Z A;  1SW4 A;  1UQW A;  4F3S A;  1USY E;  4GFR A;  3IOV A;  3ILT B;  3EHT A;  1VFD A;  4KCD A;  1SW1 A;  4GIZ A;  4F39 A;  1Y9U A;  5B70 A;  1M5D A;  1IXC A;  2GHA A;  1FQC A;  2THI A;  4LQ2 A;  1ZBM A;  1LBB A;  3K00 A;  3B7D A;  3PGF A;  3KZG A;  3KN8 A;  1OQG A;  4FEC A;  2XXH A;  1JW1 A;  2PT1 A;  3KN7 A;  1IIT A;  3FXQ A;  2A5T A;  2I4B A;  4ESX A;  5CMB A;  1AL3 A;  1M5B A;  2DWA A;  3FXU A;  3OEK A;  1LAF E;  4EF2 A;  3SER A;  2E1S A;  2OWS A;  1HSE A;  2DWI A;  3A3C A;  2GFE A;  3MP6 A;  3O29 A;  1SBP A;  3EN3 A;  2WKY A;  2DE3 A;  3TTR A;  3V5A A;  3OSR A;  1H3D A;  3MJN A;  2FA7 A;  4G68 C;  2RC7 A;  4G8H A;  5M2V A;  3L6G A;  4NF8 B;  2F7B A; 
#chains in the Genus database with same CATH topology
 2WYK A;  1P99 A;  1OQH A;  3IOU A;  2KR0 A;  3ODB A;  4ZEC A;  4H46 A;  1PDA A;  1MXW A;  1G0H A;  3IOT A;  2FVZ A;  1N7W A;  3PUY E;  4EQ9 A;  3T0J A;  1LB8 A;  1LBC A;  4ONY A;  1YPN A;  1QUK A;  4NTL A;  3THI A;  1XS5 A;  5AA4 A;  5DW8 A;  4X8R A;  4AB6 A;  4GL8 A;  5L9S A;  4OES A;  1B5H A;  4O7I A;  4YZZ A;  3DP8 A;  2UVH A;  4N6K A;  3KEI A;  4YU0 A;  4P0G A;  5I59 B;  2BJJ X;  4ZZA A;  1MQD A;  2AL5 A;  2M8C A;  2PMS A;  5H8H B;  1B0H A;  1ZIU A;  4N8Y A;  4PC9 A;  5FBP A;  1QGX A;  4PGP A;  2YJP A;  3ZKL A;  1SI0 A;  2RC8 A;  1FPG A;  4QXD A;  4NE4 A;  4RPO A;  2QVU A;  4LN5 A;  3JV9 A;  4KPT A;  2X7P A;  4R6K A;  1RYX A;  3PMW A;  2PFY A;  1FQD A;  3R6U A;  4R74 A;  4X1B A;  4LAT A;  4Z7E A;  4ZEB A;  2Q9T A;  4PF6 A;  4YKK A;  5IZ1 A;  1FRP A;  4GL0 A;  4ESW A;  4X48 A;  4Z0I A;  1DCU A;  1XOC A;  2Z22 A;  2UVJ A;  2XWV A;  3B50 A;  3K1N A;  4XIG Q;  4OFJ A;  5CC2 A;  1FBF A;  1XVX A;  3HST A;  3MC2 A;  4HCW A;  3PV0 E;  2NOO A;  1MY4 A;  4F2O A;  4QFK A;  3TCF A;  4N13 A;  4OVP A;  2Q8J A;  1B3L A;  1B1H A;  4EQB A;  4L17 A;  4AB5 A;  2I0C A;  1UTH A;  1CB6 A;  4FED A;  1LAH E;  1EH3 A;  4G2Z A;  2AIX A;  4OYV A;  4P56 A;  4DZ1 A;  1B7Z A;  5J16 A;  3SES A;  4XKP A;  1H44 A;  3KSX A;  4JWX A;  4U1O A;  3SZP A;  5ITP A;  2PFZ A;  3LC8 A;  3OO9 A;  4AS4 A;  4OVQ A;  2Z8E A;  2B65 A;  1R9Q A;  2HEU A;  5DTB A;  3OO7 A;  4DXB A;  1TFA A;  1FJ9 A;  1FBE A;  4QFP A;  5I56 B;  1IXH A;  3O97 A;  1VFE A;  3A09 A;  1Y3P A;  5I2K B;  1JEU A;  1XVY A;  3MVZ A;  5CMK A;  1LCT A;  3TDJ A;  5IZ3 A;  1US5 A;  2VD3 A;  5FHO A;  3R26 A;  1LBV A;  3Q27 A;  4POX A;  4R73 A;  3C32 A;  4LVQ A;  3TCG A;  3D4C A;  3BFU A;  2Z8F A;  5H8F B;  3RLF E;  1FBH A;  3E79 A;  3LV0 A;  2HXW A;  5JEI A;  5H8N B;  2DE2 A;  2CEY A;  4NF4 B;  1QUI A;  3IB2 A;  2X7Q A;  1USY H;  1K9Y A;  2QPQ A;  1FTJ A;  3U72 A;  1SQY A;  3FBP A;  3H06 B;  1VE4 A;  1D3K A;  1AIV A;  2YPN A;  3C31 A;  5I57 A;  1DK4 A;  4XTC Q;  3UOR A;  2I58 A;  1N0T A;  1IMD A;  4GWO A;  3WAF A;  1B52 A;  1MRP A;  3K1M A;  1I6Q A;  2RCA A;  4U2R A;  3V89 B;  4P8B A;  1R1N A;  2Y7R A;  1B58 A;  1DPE A;  2L5V A;  4PGN A;  2Y84 A;  3Q26 A;  3K6W A;  4JB7 A;  5AA2 B;  1I6B A;  2AYS A;  2Y7K A;  1NNK A;  3AXF A;  2XX8 A;  2B3B A;  1MY1 A;  2DS9 A;  3PTY A;  4QBA A;  4N07 A;  4GX4 A;  1DBZ A;  3ECR A;  4JVC A;  2F36 A;  5EQA A;  2VP1 A;  3TTL A;  1J1N A;  4JDF A;  4ZS9 A;  2DOJ A;  1NI9 A;  2ONK E;  4GXS B;  3RNN A;  3QK6 A;  5I3S A;  2P1S A;  1Z7M E;  3RPL B;  2QVR A;  2Z23 A;  2BJI A;  2UXA A;  1KWH A;  2F5X A;  4U4S A;  4EXL A;  2OBG A;  1FSA A;  1H45 A;  4C1T A;  4MIJ A;  2XX7 A;  4MHF A;  2UYF A;  3G3G A;  3S9E A;  3T22 A;  2O1L A;  4H8J A;  3MWB A;  2WX9 A;  1IXG A;  1M5E A;  3M3L A;  4MCO A;  5EQ8 A;  3U65 A;  4PQJ A;  2WBD A;  1FPJ A;  3H4Z A;  3PPQ A;  5L8D A;  4N4U A;  5BUU A;  3TAJ A;  2H25 A;  3CHG A;  1B4H A;  1NUZ A;  3BKI B;  1B05 A;  4LA9 A;  4H45 A;  5JTY B;  1O64 A;  4EQ7 A;  4DLD A;  3H6W A;  1A8F A;  1Y3N A;  1BKA A;  1URD A;  4MEV A;  4O8M A;  1HSL A;  5A5L A;  1US4 A;  2ZYO A;  2HAV A;  2VT5 A;  4LUB A;  1DSN A;  1EZP A;  2FIE A;  3E3K A;  4I9D A;  1NUY A;  3BIG A;  3IB1 A;  3K4U A;  5EQ9 A;  3CI8 A;  1IIW A;  3K0V A;  1N84 A;  2Q2A A;  3HO7 A;  4DCX A;  3IFC A;  4RYA A;  2XD2 A;  3VLV A;  5ET5 A;  3MP8 A;  1N76 A;  2QVV A;  1DTG A;  2G29 A;  4KI0 E;  3S4U A;  5H8Q B;  1MQG A;  1O7T A;  4IO2 A;  3GZG A;  3K02 A;  1A99 A;  5IGA A;  3G3J A;  2V3T A;  2DSF A;  4NF5 A;  5HPQ A;  1Q35 A;  1UTB B;  3SEW A;  3T9H B;  1M5F A;  1NV4 A;  1MPC A;  1B32 A;  3VVF A;  1NMU A;  2XXY A;  1ZU0 A;  1FCK A;  2R71 A;  3S9L C;  4YKP A;  2GQ1 A;  2CZK A;  3GYY A;  4NF8 A;  1MXZ A;  5EHM A;  1INP A;  3ZS6 A;  2G93 A;  1LBW A;  3IOW A;  4DCY A;  4PFB A;  4C0R A;  5I58 B;  1BLF A;  3EF7 A;  4I40 A;  3TCH A;  1PB7 A;  2REJ A;  5DT6 A;  2QL3 A;  3E78 A;  1IUD A;  3ILU B;  1MXV A;  5ITO A;  1NNT A;  4F3G A;  2ZNS A;  1SDX A;  3QUF A;  4XXU A;  3P7I A;  4XKQ A;  4TLL B;  4OQO A;  4AS5 A;  1FQE A;  1LFG A;  2P3N A;  5DEX B;  2D3I A;  1MPB A;  3DP4 A;  1NV1 A;  5I59 A;  3KN3 A;  5HBC A;  1NV0 A;  4IO5 A;  1OVT A;  1MY2 A;  3SEX A;  2QS3 A;  3W15 C;  3HCQ A;  3O2A A;  5H8H A;  3CSG A;  2R9J A;  2I3W A;  1PC3 A;  4G8M A;  3RUM A;  4WXJ A;  2VD2 A;  3N26 A;  3HN0 A;  4X9T A;  1NFT A;  3MQ9 A;  2HCA A;  1KA1 A;  2DDK A;  3LUZ A;  1EYJ A;  3H7M A;  4GF8 A;  4F31 B;  5LTC A;  2UVI A;  3IJO B;  4U4X A;  1FBD A;  1MDP 1;  5K2Y A;  1FTK A;  1GV8 A;  1D4N A;  1IME A;  3OO6 A;  2Y7W A;  1Q9D A;  3K6X A;  1LFI A;  2DVC A;  3CFX A;  3IAZ A;  2O7I A;  4RK2 A;  3VLW A;  5K2X A;  4MLV A;  1POY 1;  2O84 X;  3PPR A;  4F22 A;  5I2N B;  2RIN A;  4OMB A;  3EKI A;  1IQ7 A;  4GWU A;  2F6P A;  3IOR A;  3H6U A;  2XWK A;  1JQF A;  1YTV A;  1LEV A;  2KLF A;  3FD3 A;  2XXW A;  4FAJ A;  2CZH A;  4G4P A;  2Q89 A;  4M4G A;  4FOR A;  3SKP A;  1P1U A;  5CI5 A;  1LBX A;  2R6G E;  2XXP A;  1OLC A;  4IB2 A;  5CRY A;  3KJT A;  1H76 A;  4MNP A;  3VFJ A;  2ONR A;  1IZ1 A;  2A5S A;  4O7M A;  4E0X A;  1GTK A;  5I56 A;  5KZT A;  1JEV A;  2GHB A;  5EYH A;  1FPL A;  3T93 B;  5I2K A;  3IB0 A;  1AMF A;  3OOA A;  1BIY A;  1NNF A;  3N5L A;  4ZZE A;  2OX3 A;  5AA3 A;  4NN3 A;  3CFZ A;  3RTW B;  4U1Z A;  4BDO A;  2ZYM A;  2Y7P A;  1SYH A;  3EHS A;  1PEB A;  4YB6 A;  4EUO A;  5H8F A;  1GVC A;  2CZI A;  4RXL A;  4GX3 A;  5H8N A;  1RDY A;  4NF4 A;  4EF1 A;  2UVG A;  1DOT A;  1QKB A;  5KCJ B;  3IX1 A;  2V84 A;  4PF8 A;  2PYY A;  3N6T A;  2XHD A;  4ELP A;  3KFM A;  1QVS A;  1XI6 A;  2ZNT A;  1A8E A;  5TP9 B;  5TPA A;  4NWC A;  1CE2 A;  4QF9 A;  1IMC A;  2XXV A;  1B3H A;  2QS1 A;  3RQT A;  2V93 A;  3VVE A;  4NAP A;  4PP0 A;  5FHN A;  5KDT B;  5AA2 A;  4MX6 A;  1EZ9 A;  2DXY A;  1N3W A;  1PBP A;  2DWH A;  2LAO A;  4XEQ A;  1XHY A;  5EYF A;  2Q2C A;  1LBZ A;  3RGY A;  3FXR A;  4HTG A;  1GGG A;  3TZA A;  1P1W A;  5EHS A;  3RPW A;  2Z8D A;  4PAK A;  1MQH A;  2F7C A;  4P11 A;  2ZZV A;  3SEU A;  4O3A A;  3LBS A;  3RPL A;  4OA4 A;  3I5O A;  4NG7 A;  4RY1 A;  1FTM A;  1H43 A;  1AOV A;  3Q28 A;  5ICQ A;  4MH5 A;  3O6G A;  1QJM A;  4N6D A;  1PBQ A;  4E0W A;  2HAU A;  4UAC A;  2Y5L A;  3C36 A;  3PUX E;  1WOD A;  3S2V A;  3TTK A;  1LST A;  1XT8 A;  2H98 A;  3MZ1 A;  3N6U A;  1Y3Q A;  4YAH X;  4WKM A;  4QFL A;  4P47 A;  3PPP A;  2NVU B;  4OZ9 A;  4IO3 A;  4GRK A;  1NV6 A;  1DMB A;  4YKI A;  3B6W A;  3BFT A;  1A40 A;  4OEV A;  3S9N C;  2ZYK A;  1II5 A;  4N6P A;  4X1D A;  4Q30 B;  1MQJ A;  1FTA A;  4YMA A;  1N7X A;  2PX1 A;  4BDR A;  1B5I A;  4KYS A;  2CEX A;  4GWW A;  3IR1 A;  5JTY A;  4MAG A;  3MVW A;  4OXV A;  1NV2 A;  4IY6 A;  5JK4 A;  5F1Q A;  1IMB A;  2UYE A;  4GWS A;  1B0L A;  2ANJ A;  3RN8 A;  3G3F A;  3WAE A;  2DYX A;  1VSO A;  4KFQ A;  4F29 A;  3B6Q A;  1S50 A;  1IMF A;  2DP8 A;  3M8U A;  4AQ4 A;  1ANF A;  5H8S A;  2CZL A;  4KCC A;  2XXU A;  3SET A;  5EQ7 A;  3F11 A;  1AH5 A;  2XXX A;  4IO7 A;  2ONS A;  2B4L A;  5L9M A;  4OEU A;  1S9T A;  3DLN A;  4MFI A;  2VPN A;  3CG3 A;  5DVJ A;  5H8Q A;  3H6T A;  3IK6 B;  1Y1M A;  1SVX B;  3TKD A;  1SI1 A;  3MZ9 A;  1UTB A;  1EYK A;  4LZ5 A;  4Q8R A;  4JXI A;  4QRZ A;  4BDM A;  3E13 X;  4F3B A;  1EU8 A;  4OVR A;  3MST A;  4N15 A;  3VXB A;  4ELO A;  1A55 A;  4HW8 A;  3QXM A;  3EQ1 A;  3KBR A;  5I58 A;  4H1X A;  3RTF B;  1MXX A;  3LR1 A;  2F6G A;  4YIC A;  3TFL A;  1LCF A;  3M3F A;  4OER A;  2I0B A;  3IJX B;  3LSX A;  1FPK A;  4QFN A;  1B1X A;  3K6U A;  4IY5 A;  4OHN A;  3T9U A;  3KC1 A;  1YXI A;  3QIM A;  2NXO A;  3PD9 A;  2VPO A;  3CR9 A;  5DEX A;  3U93 A;  3PU5 A;  3L6H A;  4ZEI A;  4HCY A;  1QUJ A;  4U23 A;  2FYI A;  1DTZ A;  1FTL A;  2ZZW A;  4K3F A;  5AA2 D;  3FJM A;  2OZZ A;  1LBY A;  5J1D A;  3KC0 A;  4DXC A;  4N91 A;  1NV3 A;  3IO4 A;  4R2F A;  2OWZ A;  1RYO A;  4P0I A;  4PAF A;  4I1D A;  4R72 A;  3ROJ A;  1R6Z A;  3OEL A;  3E9X A;  3JZJ A;  3TUS A;  4XFE A;  5B7D A;  1QW0 A;  1PB9 A;  2VGQ A;  3M3K A;  4NED A;  4XKR A;  2I6E A;  2W7Y A;  4KYD A;  3KSJ A;  3O6I A;  4QSC A;  2WEF A;  4O3B A;  3CG1 A;  1IMA A;  2QMX A;  2QSX A;  2FNC A;  3FJG A;  1NV7 A;  4H8I A;  1B40 A;  1TXF A;  4GD5 A;  4Q5T A;  1ELJ A;  4JSO A;  4P1L A;  3TEL A;  4FAT A;  3DEL B;  4NF6 B;  4NX1 A;  3OXN A;  4MMP A;  3PMX A;  2HZL A;  5I2N A;  3SEY A;  1HSJ A;  4KHZ E;  3FJ7 A;  5FHM A;  2I49 A;  3SDF A;  4PBQ A;  4RNS A;  4N8G A;  2DE4 A;  3ZKK A;  1NUW A;  1Y4T A;  1JNF A;  1VR5 A;  2XXT A;  3LSL A;  4MBP A;  2DWJ A;  3T9V A;  3VLU A;  1URS A;  4OVJ A;  3HHG A;  3FIR A;  4XF5 A;  4EXK A;  4DDD A;  4PFI A;  2F8D A;  2HZK A;  1O63 A;  1P1N A;  2P2A A;  4P9K A;  4F19 A;  3DP6 A;  1T0K A;  2PBW A;  3FZV A;  3HV1 A;  4PFU A;  1MPD A;  4ND9 A;  1A54 A;  2OLB A;  1MM7 A;  1SD3 A;  5BWJ A;  4BDQ A;  1LB9 A;  3H6V A;  2D5W A;  3DM0 A;  1Y4C A;  4G68 B;  5AE4 A;  3TYH A;  4KYE A;  5T3J A;  2JJK A;  4H5F A;  4EDP A;  1NH8 A;  4OTE A;  3KG2 A;  3TQW A;  1FW0 A;  1MG1 A;  1P1O A;  1NNP A;  4LQ5 A;  4WEP A;  5FTI A;  4DIG A;  1B46 A;  4Q0C A;  1YAE A;  2HHM A;  2VOZ A;  3S9M C;  3A29 A;  4O3C A;  2FHY A;  3C33 A;  4JWO A;  4JWY A;  5KCJ A;  2XXI A;  4I3E A;  3FVO A;  2IA4 A;  3MW0 A;  3ISP A;  2F34 A;  3QSL A;  4OVT A;  5TP9 A;  3QYT A;  3MBP A;  3LSW A;  1UIU A;  3VV5 A;  2PCR A;  5ICT A;  4P3L A;  4OFL A;  2OCU A;  1FBG A;  4PFY A;  5CM6 A;  1KA0 A;  1JVY A;  1I69 A;  4F3P A;  1UIV A;  3W9W A;  3OD7 A;  5KDT A;  3TMG A;  1MXU A;  2B3F A;  4PTK A;  1S7Y A;  5A5X B;  1B3E A;  2H5Y A;  1ZTY A;  4QFO A;  1RDX A;  3K2D A;  4QSE A;  3T66 A;  2XWI A;  4LZ8 A;  1JP4 A;  2MKZ A;  1FJ6 A;  3MVY A;  2ESN A;  1YZ0 A;  4XKN A;  1B3G A;  4FE8 A;  4G8N A;  4RPN A;  1RDZ A;  4RJZ A;  4WED A;  3G3I A;  2H9B A;  4N81 A;  3R7X A;  3C35 A;  3FUZ A;  3V8X B;  2O51 A;  1WVJ A;  4DE8 A;  4GBV A;  4PE5 B;  2NUV A;  2ZNU A;  4PDD A;  3QUJ A;  3IFA A;  4PBH A;  1AWB A;  4BDN A;  4GLI A;  4HE1 A;  2H4I A;  1SW5 A;  1ATG A;  3RY3 A;  1FPE A;  1FPD A;  3MYU A;  5CMC A;  2QS2 A;  1JW5 A;  2PVU A;  1B7H A;  3KJ7 A;  4NF5 B;  2DXR A;  4TQU Q;  2DQV A;  2QJE A;  4X04 A;  2QS4 A;  4OVS A;  5IZZ A;  1B2H A;  1GR2 A;  2ABH A;  1SPI A;  4IGT A;  2ZZX A;  2Y7I A;  3E4R A;  2Q8M A;  3O28 A;  3FAS A;  3UGW A;  3LSF B;  4ISU A;  1CNQ A;  2O6A A;  5L9O A;  1TFD A;  5AA1 A;  3HFU A;  1MQI A;  4GWX A;  1YCJ A;  1B51 A;  3MVX A;  4PET A;  4BDL A;  1XC1 A;  3MPL A;  3EHU A;  2RF1 A;  2V3Q A;  3UA8 A;  4HE0 A;  1IXI A;  2AL4 A;  1FBC A;  4ZDM A;  1QKA A;  1MDQ A;  2HXR A;  3FVK A;  3U92 A;  4PFT A;  3TQL A;  4ECF A;  1Z7N E;  4H65 A;  5LOM A;  1B4Z A;  4GXA A;  4YB5 A;  1PB8 A;  3H03 A;  2XXQ A;  4JSD A;  5DVI A;  1N3X A;  3EPE A;  3FVG A;  3FV2 A;  3CRB A;  1FQF A;  3CIJ A;  4MF3 A;  2Q88 A;  1QUL A;  4POW A;  3KGC A;  1SW2 A;  3I3V A;  4ZEK A;  3JYR A;  3IL1 B;  4JVI A;  4R75 A;  4ZED A;  3OMB A;  3O66 A;  5HM4 B;  1TWY A;  1JVX A;  4NWD A;  1D9Y A;  4RK9 A;  1EYI A;  4THI A;  4GX6 A;  1POT A;  1MY3 A;  1MS7 A;  5ELV A;  1D9V A;  2A5T B;  3GLB A;  3O9P A;  2QMW A;  4DI4 B;  1K9Z A;  4MJO A;  5F7V A;  4F2Q A;  4O94 A;  3MPK A;  1B3F A;  1JET A;  1LFH A;  1DPP A;  4F1Y A;  3PMV A;  4DXU A;  1D9Q A;  2GRV A;  2WYP A;  5TU0 A;  4I3Y A;  4YB7 A;  1BTJ A;  4OET A;  3RT6 B;  3G7W A;  5DYH A;  1KZ8 A;  4FEB A;  2HFB A;  2O7U A;  4U22 A;  2P3V A;  3UN6 A;  4UAB A;  1JW4 A;  5IKB A;  2H99 A;  1LGB C;  1MXY A;  5ESY A;  2O1M A;  3MAM A;  2YLN A;  5EYG A;  5I5P A;  1FQB A;  2XD3 A;  2GH9 A;  2E0S A;  4QSD A;  3QAX A;  3UIF A;  2REG A;  4ELR A;  3K6V A;  3UP9 A;  4FJP A;  1FPI A;  3RT8 A;  3CFL A;  1MM6 A;  2B4M A;  4H0W A;  3Q29 A;  3CVG A;  1BK4 A;  1URG A;  3HHF A;  3HPI A;  4LP2 B;  3T9X B;  1NKX A;  2FBP A;  5ET8 A;  2QFL A;  5AA4 B;  2OWT A;  1FBP A;  4IO6 A;  3U94 A;  2X26 A;  5CBR A;  3PPN A;  5I84 A;  4GBW A;  2P0S A;  4ELQ A;  1ZLQ A;  4PCD A;  2F3D A;  2QRY A;  1P1Q A;  4MNC A;  2KQZ A;  4NF6 A;  2RCB A;  4NQ8 A;  1A7L A;  2VHA A;  4UA8 A;  4RA1 A;  4R9G A;  1FQA A;  3OEM A;  1L5T A;  4YKJ A;  5F24 A;  5TPA B;  2V3U A;  4H67 A;  4MNI A;  3W9V A;  3C9H A;  3PUZ E;  4KD5 A;  4MLQ A;  1R9L A;  1MH3 A;  2F78 A;  3O6H A;  4GQO A;  4LON B;  3K1P A;  4FIM A;  4ZE8 A;  3KOS A;  1MH4 A;  2F7A A;  4M1V A;  5DVF A;  3VE1 B;  2ZMB A;  3TTN A;  1Q1K A;  4QHQ A;  3K01 A;  1Y20 A;  1IEJ A;  3FVN A;  1FTO A;  3VVD A;  3BIH A;  3VXC A;  3BBR A;  1WDN A;  3NOH A;  2I4C A;  3C34 A;  3A3U A;  3PD8 A;  3B6T A;  3PUV E;  2I48 A;  3PUW E;  4H6D A;  4G68 A;  1UTH B;  4PDH A;  1OVB A;  2ALU A;  1ZJL A;  4G61 A;  4JBZ A;  2RKM A;  2O68 A;  3MZB A;  2D21 A;  2DVZ A;  5LDZ A;  3ZSF A;  1RKM A;  5ISU A;  2I3V A;  3QMF A;  4H5G A;  3D4G A;  4HXV A;  3G3H A;  2F3B A;  4GVO A;  4OWD A;  4DI3 D;  4YMB A;  4U21 A;  2V4C A;  5FTH A;  4ZEF A;  3H3G A;  4R6Y A;  3PPO A;  2R8T A;  3OO8 A;  1MY0 A;  1ZMG A;  1NH7 A;  3ONM A;  3GBA A;  1YYZ A;  5IAI A;  2IEE A;  1LLS A;  1FPF A;  3OSQ A;  5IZ3 B;  2NWJ A;  1LAG E;  1OLA A;  5IM2 A;  3TEP A;  2OJT A;  1NL5 A;  1EZO A;  2CMO A;  2XWO A;  5ET7 A;  4OFO A;  5CMM A;  1SYI A;  1TT1 A;  2HPG A;  4N17 A;  1BP5 A;  4NGU A;  2F97 A;  5A5X A;  3GBB A;  2HQ0 A;  2OK2 A;  5CBS A;  4G77 A;  4KXP A;  3D1R A;  3UK4 A;  1F9B A;  4ZE9 A;  2XX9 A;  2RC9 A;  3U8Q A;  3I6V A;  4TOZ A;  4F18 A;  4IO4 A;  5I57 B;  3V83 A;  3N94 A;  3OEN A;  4HS7 A;  4KR5 A;  3TTM A;  4NHB A;  2ZXT A;  3B8B A;  4JVD A;  1NUX A;  3VDF A;  2O69 A;  4NMY A;  1B6H A;  4KQP A;  3LUY A;  5ET6 A;  1ZKB A;  3CSB A;  3T96 B;  3FGS A;  1N04 A;  4F1U A;  3GXA A;  2Q74 A;  2ZYN A;  1I6A A;  3FAT A;  1B7U A;  4OEN A;  4R9F A;  4PFW A;  4R6H A;  2XXR A;  3KOT A;  3MUQ A;  2F35 A;  4R2B A;  4LZ7 A;  1B9J A;  3Q25 A;  3FXB A;  1M5C A;  3TOD A;  3MP1 A;  1G0I A;  4GOT A;  4BLA A;  4TLM B;  3G3K A;  3IO6 A;  3FV1 A;  4P1E A;  4IR8 A;  4I62 A;  3SEV A;  3USD A;  2Y5K A;  4IGR A;  5I7I A;  1B5J A;  1OMP A;  1LAX A;  3C4M A;  4PAI A;  3TPA A;  4C1U A;  1OIB A;  2V25 A;  2PT2 A;  4I8C A;  4F1V A;  3U1O A;  4GWY A;  1Y1Z A;  1SW4 A;  1UQW A;  1NV5 A;  4F3S A;  1USY E;  4GFR A;  3IOV A;  3ILT B;  3RYD A;  3EHT A;  2FIX A;  4PE3 A;  4PFR A;  1VFD A;  4KCD A;  1SW1 A;  4GIZ A;  4F39 A;  4HE2 A;  1Y9U A;  5B70 A;  1M5D A;  1IXC A;  2GHA A;  1VDW A;  4FBP A;  1FQC A;  2THI A;  4LQ2 A;  1ZBM A;  1LBB A;  3K00 A;  3B7D A;  3PGF A;  3KZG A;  3KN8 A;  1OQG A;  3KBZ A;  4FEC A;  2WBB A;  4NF0 A;  2XXH A;  1JW1 A;  2PT1 A;  3KN7 A;  1IIT A;  4GWZ A;  3FXQ A;  2XA5 A;  2A5T A;  2I4B A;  4ESX A;  5CMB A;  1AL3 A;  1M5B A;  2DWA A;  3FXU A;  3OEK A;  1LAF E;  4EF2 A;  3SER A;  2E1S A;  3T1B A;  2OWS A;  1HSE A;  2DWI A;  3A3C A;  2GFE A;  3MP6 A;  3O29 A;  1SBP A;  3EN3 A;  1FPB A;  2WKY A;  4OAN A;  2DE3 A;  3TTR A;  3V5A A;  3OSR A;  1H3D A;  3MJN A;  2FA7 A;  4G68 C;  2RC7 A;  4G8H A;  5M2V A;  3L6G A;  4NF8 B;  2F7B A;  2XXK A; 
#chains in the Genus database with same CATH homology
 1P99 A;  1OQH A;  3IOU A;  3ODB A;  4ZEC A;  1PDA A;  1MXW A;  3IOT A;  1N7W A;  3PUY E;  4EQ9 A;  1LB8 A;  1LBC A;  4ONY A;  1YPN A;  1QUK A;  4NTL A;  3THI A;  1XS5 A;  5AA4 A;  4AB6 A;  4GL8 A;  5L9S A;  4OES A;  1B5H A;  4YZZ A;  3DP8 A;  2UVH A;  3KEI A;  4YU0 A;  4P0G A;  5I59 B;  2BJJ X;  4ZZA A;  1MQD A;  2AL5 A;  2M8C A;  2PMS A;  5H8H B;  1B0H A;  1ZIU A;  2YJP A;  3ZKL A;  1SI0 A;  2RC8 A;  4NE4 A;  4RPO A;  3JV9 A;  4KPT A;  2X7P A;  4R6K A;  1RYX A;  3PMW A;  1FQD A;  3R6U A;  4R74 A;  4X1B A;  4LAT A;  4Z7E A;  4ZEB A;  2Q9T A;  4YKK A;  4GL0 A;  4ESW A;  4X48 A;  4Z0I A;  1XOC A;  2Z22 A;  2UVJ A;  3K1N A;  4XIG Q;  4OFJ A;  5CC2 A;  1XVX A;  3HST A;  3MC2 A;  4HCW A;  3PV0 E;  2NOO A;  1MY4 A;  4F2O A;  4QFK A;  3TCF A;  4N13 A;  2Q8J A;  1B3L A;  1B1H A;  4EQB A;  4L17 A;  4AB5 A;  2I0C A;  1UTH A;  1CB6 A;  4FED A;  1LAH E;  1EH3 A;  4G2Z A;  2AIX A;  4OYV A;  4DZ1 A;  1B7Z A;  3SES A;  4XKP A;  1H44 A;  3KSX A;  4JWX A;  4U1O A;  5ITP A;  3LC8 A;  3OO9 A;  2Z8E A;  2B65 A;  1R9Q A;  2HEU A;  5DTB A;  3OO7 A;  4DXB A;  1TFA A;  4QFP A;  5I56 B;  1IXH A;  3O97 A;  1VFE A;  3A09 A;  1Y3P A;  5I2K B;  1JEU A;  1XVY A;  3MVZ A;  5CMK A;  1LCT A;  3TDJ A;  1US5 A;  2VD3 A;  5FHO A;  3R26 A;  3Q27 A;  4POX A;  4R73 A;  3C32 A;  4LVQ A;  3TCG A;  3D4C A;  3BFU A;  2Z8F A;  5H8F B;  3RLF E;  2HXW A;  5JEI A;  5H8N B;  2DE2 A;  4NF4 B;  1QUI A;  3IB2 A;  2X7Q A;  1USY H;  2QPQ A;  1FTJ A;  3U72 A;  1SQY A;  3H06 B;  1VE4 A;  1D3K A;  1AIV A;  2YPN A;  3C31 A;  5I57 A;  4XTC Q;  3UOR A;  2I58 A;  1N0T A;  4GWO A;  3WAF A;  1B52 A;  1MRP A;  3K1M A;  1I6Q A;  2RCA A;  4U2R A;  3V89 B;  1R1N A;  2Y7R A;  1B58 A;  1DPE A;  2Y84 A;  3Q26 A;  3K6W A;  4JB7 A;  5AA2 B;  1I6B A;  2AYS A;  2Y7K A;  1NNK A;  3AXF A;  2XX8 A;  2B3B A;  1MY1 A;  2DS9 A;  4N07 A;  3ECR A;  2F36 A;  2VP1 A;  3TTL A;  1J1N A;  4JDF A;  4ZS9 A;  2DOJ A;  2ONK E;  4GXS B;  3RNN A;  3QK6 A;  2P1S A;  1Z7M E;  2Z23 A;  2UXA A;  1KWH A;  2F5X A;  4U4S A;  4EXL A;  2OBG A;  1H45 A;  4C1T A;  2XX7 A;  2UYF A;  3G3G A;  3S9E A;  3T22 A;  2O1L A;  4H8J A;  3MWB A;  1IXG A;  1M5E A;  3M3L A;  4PQJ A;  3H4Z A;  3PPQ A;  5L8D A;  5BUU A;  3TAJ A;  2H25 A;  1B4H A;  3BKI B;  1B05 A;  4LA9 A;  5JTY B;  1O64 A;  4EQ7 A;  4DLD A;  3H6W A;  1A8F A;  1Y3N A;  1BKA A;  1URD A;  1HSL A;  1US4 A;  2ZYO A;  2HAV A;  4LUB A;  1DSN A;  1EZP A;  3E3K A;  4I9D A;  3IB1 A;  3K4U A;  3CI8 A;  1IIW A;  3K0V A;  1N84 A;  2Q2A A;  3HO7 A;  4DCX A;  4RYA A;  2XD2 A;  3VLV A;  3MP8 A;  1N76 A;  1DTG A;  2G29 A;  4KI0 E;  3S4U A;  5H8Q B;  1MQG A;  1O7T A;  4IO2 A;  3GZG A;  3K02 A;  1A99 A;  3G3J A;  2V3T A;  2DSF A;  4NF5 A;  5HPQ A;  1Q35 A;  1UTB B;  3SEW A;  3T9H B;  1M5F A;  1MPC A;  1B32 A;  3VVF A;  1NMU A;  2XXY A;  1ZU0 A;  1FCK A;  2R71 A;  3S9L C;  4YKP A;  4NF8 A;  1MXZ A;  5EHM A;  3ZS6 A;  2G93 A;  3IOW A;  4DCY A;  4C0R A;  5I58 B;  1BLF A;  3EF7 A;  3TCH A;  1PB7 A;  2REJ A;  5DT6 A;  2QL3 A;  1IUD A;  3ILU B;  1MXV A;  5ITO A;  1NNT A;  4F3G A;  2ZNS A;  1SDX A;  3QUF A;  4XXU A;  3P7I A;  4XKQ A;  4TLL B;  4OQO A;  1FQE A;  1LFG A;  5DEX B;  2D3I A;  1MPB A;  3DP4 A;  5I59 A;  3KN3 A;  5HBC A;  4IO5 A;  1OVT A;  1MY2 A;  3SEX A;  2QS3 A;  3W15 C;  3HCQ A;  3O2A A;  5H8H A;  3CSG A;  2R9J A;  2I3W A;  1PC3 A;  4G8M A;  3RUM A;  4WXJ A;  2VD2 A;  3N26 A;  3HN0 A;  4X9T A;  1NFT A;  3MQ9 A;  2HCA A;  3H7M A;  4GF8 A;  4F31 B;  2UVI A;  3IJO B;  4U4X A;  1MDP 1;  5K2Y A;  1FTK A;  1GV8 A;  1D4N A;  3OO6 A;  2Y7W A;  3K6X A;  1LFI A;  2DVC A;  3CFX A;  3IAZ A;  2O7I A;  4RK2 A;  3VLW A;  5K2X A;  4MLV A;  1POY 1;  2O84 X;  3PPR A;  4F22 A;  5I2N B;  2RIN A;  4OMB A;  1IQ7 A;  2F6P A;  3IOR A;  3H6U A;  1JQF A;  1YTV A;  3FD3 A;  2KLF A;  2XXW A;  4FAJ A;  4G4P A;  2Q89 A;  4M4G A;  4FOR A;  3SKP A;  1P1U A;  5CI5 A;  2R6G E;  2XXP A;  1OLC A;  4IB2 A;  5CRY A;  3KJT A;  1H76 A;  3VFJ A;  2ONR A;  1IZ1 A;  2A5S A;  4E0X A;  1GTK A;  5I56 A;  5KZT A;  1JEV A;  2GHB A;  3T93 B;  5I2K A;  3IB0 A;  1AMF A;  3OOA A;  1BIY A;  1NNF A;  3N5L A;  4ZZE A;  5AA3 A;  3CFZ A;  3RTW B;  4U1Z A;  4BDO A;  2ZYM A;  2Y7P A;  1SYH A;  3EHS A;  1PEB A;  4YB6 A;  4EUO A;  5H8F A;  1GVC A;  4RXL A;  5H8N A;  4NF4 A;  4EF1 A;  2UVG A;  1DOT A;  1QKB A;  5KCJ B;  3IX1 A;  2V84 A;  2PYY A;  3N6T A;  2XHD A;  4ELP A;  1QVS A;  3KFM A;  2ZNT A;  5TP9 B;  1A8E A;  5TPA A;  4NWC A;  1CE2 A;  4QF9 A;  2XXV A;  1B3H A;  2QS1 A;  3RQT A;  2V93 A;  3VVE A;  4PP0 A;  5FHN A;  5KDT B;  5AA2 A;  1EZ9 A;  2DXY A;  1N3W A;  1PBP A;  2DWH A;  2LAO A;  1XHY A;  5EYF A;  2Q2C A;  3RGY A;  3FXR A;  4HTG A;  1GGG A;  3TZA A;  1P1W A;  5EHS A;  3RPW A;  2Z8D A;  1MQH A;  2F7C A;  4P11 A;  3SEU A;  4O3A A;  3LBS A;  3I5O A;  4RY1 A;  1FTM A;  1H43 A;  1AOV A;  3Q28 A;  5ICQ A;  4MH5 A;  3O6G A;  1QJM A;  1PBQ A;  4E0W A;  2HAU A;  4UAC A;  3C36 A;  3PUX E;  1WOD A;  3S2V A;  3TTK A;  1LST A;  1XT8 A;  2H98 A;  3MZ1 A;  3N6U A;  1Y3Q A;  4YAH X;  4WKM A;  4QFL A;  3PPP A;  2NVU B;  4OZ9 A;  4IO3 A;  4GRK A;  1DMB A;  4YKI A;  3B6W A;  3BFT A;  1A40 A;  4OEV A;  3S9N C;  2ZYK A;  1II5 A;  4N6P A;  4X1D A;  4Q30 B;  1MQJ A;  4YMA A;  1N7X A;  2PX1 A;  4BDR A;  1B5I A;  4KYS A;  3IR1 A;  5JTY A;  3MVW A;  4OXV A;  4IY6 A;  5JK4 A;  5F1Q A;  2UYE A;  1B0L A;  2ANJ A;  3RN8 A;  3G3F A;  3WAE A;  2DYX A;  1VSO A;  4KFQ A;  4F29 A;  3B6Q A;  1S50 A;  2DP8 A;  3M8U A;  4AQ4 A;  1ANF A;  5H8S A;  2CZL A;  4KCC A;  2XXU A;  3SET A;  3F11 A;  1AH5 A;  2XXX A;  4IO7 A;  2ONS A;  5L9M A;  4OEU A;  1S9T A;  3DLN A;  4MFI A;  3CG3 A;  5DVJ A;  5H8Q A;  3H6T A;  3IK6 B;  1Y1M A;  1SVX B;  3TKD A;  1SI1 A;  3MZ9 A;  1UTB A;  4LZ5 A;  4Q8R A;  4JXI A;  4QRZ A;  4BDM A;  3E13 X;  4F3B A;  1EU8 A;  4ELO A;  3VXB A;  1A55 A;  4HW8 A;  3QXM A;  3EQ1 A;  3KBR A;  5I58 A;  4H1X A;  3RTF B;  1MXX A;  3LR1 A;  2F6G A;  4YIC A;  3TFL A;  1LCF A;  3M3F A;  4OER A;  2I0B A;  3IJX B;  3LSX A;  4QFN A;  1B1X A;  3K6U A;  4IY5 A;  4OHN A;  3T9U A;  3QIM A;  2NXO A;  3PD9 A;  3CR9 A;  5DEX A;  3U93 A;  3PU5 A;  3L6H A;  4ZEI A;  4HCY A;  1QUJ A;  4U23 A;  2FYI A;  1DTZ A;  1FTL A;  4K3F A;  5AA2 D;  3FJM A;  2OZZ A;  5J1D A;  4DXC A;  3IO4 A;  4R2F A;  1RYO A;  4P0I A;  4I1D A;  4R72 A;  1R6Z A;  3OEL A;  3E9X A;  3JZJ A;  3TUS A;  5B7D A;  1QW0 A;  1PB9 A;  2VGQ A;  3M3K A;  4NED A;  4XKR A;  2I6E A;  2W7Y A;  4KYD A;  3KSJ A;  3O6I A;  4QSC A;  4O3B A;  3CG1 A;  2QMX A;  2QSX A;  2FNC A;  3FJG A;  4H8I A;  1B40 A;  1TXF A;  4GD5 A;  4Q5T A;  1ELJ A;  4JSO A;  3TEL A;  4FAT A;  3DEL B;  4NF6 B;  3OXN A;  3PMX A;  2HZL A;  5I2N A;  3SEY A;  1HSJ A;  4KHZ E;  3FJ7 A;  5FHM A;  2I49 A;  3SDF A;  4RNS A;  2DE4 A;  3ZKK A;  1Y4T A;  1JNF A;  1VR5 A;  2XXT A;  3LSL A;  4MBP A;  2DWJ A;  3T9V A;  3VLU A;  1URS A;  4OVJ A;  3HHG A;  3FIR A;  4EXK A;  4DDD A;  2F8D A;  2HZK A;  1O63 A;  1P1N A;  2P2A A;  4F19 A;  3DP6 A;  1T0K A;  2PBW A;  3FZV A;  3HV1 A;  4PFU A;  1MPD A;  4ND9 A;  1A54 A;  2OLB A;  1MM7 A;  1SD3 A;  5BWJ A;  4BDQ A;  1LB9 A;  3H6V A;  2D5W A;  3DM0 A;  1Y4C A;  4G68 B;  5AE4 A;  3TYH A;  4KYE A;  4H5F A;  4EDP A;  1NH8 A;  4OTE A;  3KG2 A;  3TQW A;  1FW0 A;  1MG1 A;  1P1O A;  1NNP A;  4LQ5 A;  4WEP A;  5FTI A;  4DIG A;  1B46 A;  4Q0C A;  1YAE A;  2VOZ A;  3S9M C;  4O3C A;  3C33 A;  4JWO A;  4JWY A;  5KCJ A;  2XXI A;  3FVO A;  2IA4 A;  3MW0 A;  2F34 A;  3QSL A;  5TP9 A;  3QYT A;  3MBP A;  3LSW A;  1UIU A;  3VV5 A;  5ICT A;  4OFL A;  2OCU A;  4PFY A;  5CM6 A;  1JVY A;  1I69 A;  4F3P A;  1UIV A;  3W9W A;  3OD7 A;  5KDT A;  3TMG A;  1MXU A;  2B3F A;  1S7Y A;  5A5X B;  1B3E A;  2H5Y A;  1ZTY A;  4QFO A;  3K2D A;  4QSE A;  3T66 A;  4LZ8 A;  3MVY A;  2ESN A;  4XKN A;  1B3G A;  4FE8 A;  4G8N A;  4RPN A;  4RJZ A;  4WED A;  3G3I A;  2H9B A;  3R7X A;  3C35 A;  3FUZ A;  3V8X B;  2O51 A;  1WVJ A;  4DE8 A;  4PE5 B;  2NUV A;  2ZNU A;  3QUJ A;  4BDN A;  4GLI A;  2H4I A;  1SW5 A;  1ATG A;  3RY3 A;  5CMC A;  2QS2 A;  1JW5 A;  2PVU A;  1B7H A;  3KJ7 A;  4NF5 B;  2DXR A;  4TQU Q;  2DQV A;  2QJE A;  2QS4 A;  1B2H A;  1GR2 A;  2ABH A;  4IGT A;  2Y7I A;  3E4R A;  3O28 A;  3FAS A;  3UGW A;  3LSF B;  4ISU A;  2O6A A;  5L9O A;  1TFD A;  5AA1 A;  1MQI A;  1YCJ A;  1B51 A;  3MVX A;  4PET A;  4BDL A;  1XC1 A;  3MPL A;  3EHU A;  2RF1 A;  2V3Q A;  3UA8 A;  1IXI A;  2AL4 A;  4ZDM A;  1QKA A;  1MDQ A;  3FVK A;  3U92 A;  4PFT A;  3TQL A;  4ECF A;  1Z7N E;  4H65 A;  5LOM A;  1B4Z A;  4GXA A;  4YB5 A;  1PB8 A;  3H03 A;  2XXQ A;  4JSD A;  5DVI A;  1N3X A;  3EPE A;  3FVG A;  3FV2 A;  3CRB A;  1FQF A;  3CIJ A;  4MF3 A;  2Q88 A;  1QUL A;  4POW A;  3KGC A;  1SW2 A;  3I3V A;  4ZEK A;  3JYR A;  3IL1 B;  4R75 A;  4ZED A;  3OMB A;  3O66 A;  5HM4 B;  1TWY A;  1JVX A;  4NWD A;  1D9Y A;  4RK9 A;  4THI A;  1POT A;  1MY3 A;  1MS7 A;  5ELV A;  1D9V A;  2A5T B;  3GLB A;  3O9P A;  2QMW A;  5F7V A;  4F2Q A;  3MPK A;  1B3F A;  1JET A;  1LFH A;  1DPP A;  4F1Y A;  3PMV A;  4DXU A;  2GRV A;  5TU0 A;  4YB7 A;  1BTJ A;  4OET A;  3RT6 B;  3G7W A;  5DYH A;  4FEB A;  2HFB A;  2O7U A;  4U22 A;  3UN6 A;  1JW4 A;  5IKB A;  2H99 A;  1LGB C;  1MXY A;  2O1M A;  3MAM A;  2YLN A;  1FQB A;  2XD3 A;  2GH9 A;  2E0S A;  4QSD A;  3QAX A;  3UIF A;  2REG A;  4ELR A;  3K6V A;  3UP9 A;  4FJP A;  3RT8 A;  3CFL A;  1MM6 A;  4H0W A;  3Q29 A;  3CVG A;  1URG A;  3HHF A;  3HPI A;  4LP2 B;  3T9X B;  1NKX A;  5AA4 B;  2OWT A;  4IO6 A;  3U94 A;  2X26 A;  5CBR A;  3PPN A;  5I84 A;  2P0S A;  4ELQ A;  1ZLQ A;  2QRY A;  1P1Q A;  4NF6 A;  2RCB A;  1A7L A;  2VHA A;  4UA8 A;  4RA1 A;  4R9G A;  1FQA A;  3OEM A;  1L5T A;  4YKJ A;  5TPA B;  2V3U A;  4H67 A;  3W9V A;  3C9H A;  3PUZ E;  4KD5 A;  4MLQ A;  1R9L A;  1MH3 A;  2F78 A;  3O6H A;  4GQO A;  4LON B;  3K1P A;  4FIM A;  4ZE8 A;  3KOS A;  1MH4 A;  2F7A A;  4M1V A;  5DVF A;  3VE1 B;  2ZMB A;  3TTN A;  1Q1K A;  4QHQ A;  3K01 A;  1Y20 A;  1IEJ A;  3FVN A;  1FTO A;  3VVD A;  3VXC A;  3BBR A;  1WDN A;  2I4C A;  3C34 A;  3A3U A;  3PD8 A;  3B6T A;  3PUV E;  2I48 A;  3PUW E;  4H6D A;  4G68 A;  1UTH B;  1OVB A;  2ALU A;  1ZJL A;  4JBZ A;  2RKM A;  2O68 A;  3MZB A;  2D21 A;  2DVZ A;  3ZSF A;  1RKM A;  5ISU A;  2I3V A;  4H5G A;  3D4G A;  3G3H A;  4GVO A;  4OWD A;  4YMB A;  4U21 A;  5FTH A;  4ZEF A;  3H3G A;  4R6Y A;  3PPO A;  3OO8 A;  1MY0 A;  1ZMG A;  1NH7 A;  3ONM A;  3GBA A;  5IAI A;  2IEE A;  1LLS A;  3OSQ A;  2NWJ A;  1LAG E;  1OLA A;  3TEP A;  2OJT A;  1NL5 A;  1EZO A;  2CMO A;  4OFO A;  5CMM A;  1SYI A;  1TT1 A;  1BP5 A;  2F97 A;  5A5X A;  3GBB A;  2HQ0 A;  2OK2 A;  5CBS A;  4G77 A;  3UK4 A;  1F9B A;  4ZE9 A;  2XX9 A;  2RC9 A;  3U8Q A;  3I6V A;  4TOZ A;  4F18 A;  4IO4 A;  5I57 B;  3V83 A;  3N94 A;  3OEN A;  4HS7 A;  4KR5 A;  3TTM A;  2ZXT A;  3VDF A;  2O69 A;  4NMY A;  1B6H A;  4KQP A;  3LUY A;  1ZKB A;  3CSB A;  3T96 B;  3FGS A;  1N04 A;  4F1U A;  3GXA A;  2ZYN A;  1I6A A;  3FAT A;  1B7U A;  4OEN A;  4R9F A;  4PFW A;  4R6H A;  2XXR A;  3KOT A;  3MUQ A;  2F35 A;  4R2B A;  4LZ7 A;  1B9J A;  3Q25 A;  1M5C A;  3TOD A;  3MP1 A;  4GOT A;  4BLA A;  4TLM B;  3G3K A;  3IO6 A;  3FV1 A;  4I62 A;  3SEV A;  3USD A;  4IGR A;  1B5J A;  1OMP A;  1LAX A;  3C4M A;  3TPA A;  4C1U A;  1OIB A;  2V25 A;  2PT2 A;  4I8C A;  4F1V A;  3U1O A;  1Y1Z A;  1SW4 A;  1UQW A;  4F3S A;  1USY E;  4GFR A;  3IOV A;  3ILT B;  3EHT A;  1VFD A;  4KCD A;  1SW1 A;  4GIZ A;  4F39 A;  1Y9U A;  5B70 A;  1M5D A;  1IXC A;  2GHA A;  1FQC A;  2THI A;  4LQ2 A;  1ZBM A;  1LBB A;  3K00 A;  3B7D A;  3PGF A;  3KZG A;  3KN8 A;  1OQG A;  4FEC A;  2XXH A;  1JW1 A;  2PT1 A;  3KN7 A;  1IIT A;  3FXQ A;  2A5T A;  2I4B A;  4ESX A;  5CMB A;  1AL3 A;  1M5B A;  2DWA A;  3FXU A;  3OEK A;  1LAF E;  4EF2 A;  3SER A;  2E1S A;  2OWS A;  1HSE A;  2DWI A;  3A3C A;  2GFE A;  3MP6 A;  3O29 A;  1SBP A;  3EN3 A;  2WKY A;  2DE3 A;  3TTR A;  3V5A A;  3OSR A;  1H3D A;  3MJN A;  2FA7 A;  4G68 C;  2RC7 A;  4G8H A;  5M2V A;  3L6G A;  4NF8 B;  2F7B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...