1Y9UA

Bordetella ferric binding protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
314
Chain Sequence
DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFAGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords putative iron binding protein
publication title Anion-independent iron coordination by the Campylobacter jejuni ferric binding protein
pubmed doi rcsb
source organism Bordetella pertussis tohama i
total genus 112
structure length 314
sequence length 318
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA02
2Q2AA 1MXZA 4P0IA 1J1NA 3O6IA 5FHNA 1FCKA 1OLAA 5CMKA 1MM7A 5CBRA 1B7UA 4Q8RA 3K6WA 1MY3A 4POXA 5CMMA 2VGQA 3KJTA 4NWCA 3MPKA 4F31B 1FQCA 1O64A 3V89B 1QUKA 1NH8A 1MM6A 2QL3A 1EZ9A 1P1OA 3O6HA 1A8EA 3SDFA 4H0WA 3D4CA 3T96B 4FIMA 3KFMA 3ZS6A 1IXHA 2ZYOA 1PBPA 1VFDA 3U94A 4NF5B 2XX8A 2RKMA 3TCHA 3T9XB 4H8IA 2XXHA 3C34A 3FVOA 3OXNA 1NNTA 4HTGA 1MH4A 3VLUA 2DOJA 4QFPA 5CMCA 4KCCA 1EZPA 3K02A 1IZ1A 1O63A 2I3WA 4F1YA 1LFGA 4G4PA 3FD3A 4F3SA 1XVYA 2Q88A 4NEDA 3FZVA 3EF7A 2GHAA 4QFKA 3O6GA 4RY1A 3RGYA 1II5A 3G3FA 2B3FA 2H98A 3RPWA 3FATA 3S9LC 4EXKA 3GLBA 4H6DA 3MW0A 5I56A 4ELOA 4EF1A 1JEVA 2PT1A 3C36A 5H8HA 3QXMA 1N7WA 4BLAA 2PX1A 2YJPA 4RPNA 4YKIA 5CC2A 3K0VA 3N6UA 4OQOA 4QRZA 1FTOA 5CRYA 2ONRA 3E4RA 4EF2A 4ECFA 2B65A 3L6HA 5L9OA 3OO9A 2ANJA 3VVEA 3BBRA 1MS7A 1OMPA 2OJTA 3U1OA 5KZTA 3DP4A 2VD3A 2Y7WA 4AQ4A 2O6AA 2RCAA 3FJGA 2O7UA 3MJNA 2O7IA 1XOCA 1JW5A 4XIGQ 4DXCA 2ZYMA 1Z7ME 5CBSA 4LZ8A 3KSJA 3TFLA 4XKQA 4OEVA 3TPAA 3UP9A 4Q0CA 5ICQA 2GFEA 1JVYA 3KSXA 1EZOA 1SI0A 1NNPA 2PBWA 1B3EA 1B3HA 1B51A 1B3GA 1PB7A 3LSXA 4X1BA 4R2BA 1N76A 4ESWA 1SVXB 1R6ZA 3I3VA 1QJMA 4FAJA 1ZBMA 1SD3A 1SBPA 1Q1KA 4GLIA 2QJEA 4OHNA 1M5DA 1ZKBA 3H7MA 2R71A 5M2VA 5HM4B 1Y3NA 1AOVA 4KI0E 1LBCA 3B6QA 1POY1 1IITA 1NNFA 2PMSA 3TZAA 2HQ0A 1H44A 4Q30B 5AA4A 4X1DA 1B7HA 3IOUA 4IGRA 1UQWA 3TQLA 1UIUA 3G3KA 5F7VA 2UYEA 4THIA 2UVIA 1B4ZA 4XKNA 1NH7A 1USYH 3MAMA 2HFBA 2XHDA 1OVTA 1TXFA 4YB5A 1URSA 5L9SA 1Y3PA 5I56B 1PB9A 1B40A 1B5JA 2QSXA 5H8HB 3EQ1A 1AL3A 1MRPA 2P2AA 2H9BA 3M3FA 4ZEBA 1LAFE 5I59A 1GTKA 1PB8A 3P7IA 2F7CA 4GXAA 1SYHA 1LCFA 1HSLA 1JETA 4IO4A 4DE8A 3SERA 3A3CA 3MZ1A 1UTBB 1USYE 5EHMA 3RN8A 2Q2CA 2RINA 3T9HB 4FORA 2P1SA 1MPCA 5L8DA 4NF8B 2F7BA 4H65A 1OQGA 3FJ7A 2F5XA 1TT1A 1LFIA 1MQJA 4JXIA 2I48A 4IY6A 2ONKE 3H06B 5CMBA 1UIVA 3O9PA 3T9UA 3KGCA 4I62A 2O68A 4NTLA 2AYSA 3E13X 4WXJA 1P1QA 2I3VA 4OFJA 3G3IA 3CG3A 5HBCA 1BLFA 5DEXA 5ITPA 3ODBA 4MLQA 3ILTB 4PFTA 4BDLA 4RYAA 3MP6A 3IR1A 4R2FA 3VVFA 4FJPA 1IXCA 4KYSA 3GZGA 1Y1MA 3U8QA 3PU5A 2REJA 3IX1A 1MY1A 2F97A 2Y84A 3RT8A 4ISUA 1JW1A 1DTZA 2R9JA 1Y4TA 5AA2A 4ZEFA 2CMOA 5ICTA 3M8UA 4GD5A 1N04A 4R6YA 2V84A 4PFWA 4F1UA 4BDMA 2OWTA 3QUFA 3MVZA 4H5FA 4MBPA 3H4ZA 4AB6A 5AA4B 1NMUA 2LAOA 4NF6A 3QSLA 2RF1A 4R6KA 1P1UA 3C31A 2Q89A 5KDTA 4U22A 5KCJB 1MDP1 2XXXA 3OSRA 1XVXA 3TTRA 4YKJA 3ECRA 4LATA 3TODA 5H8NA 1AMFA 4ZZAA 4H5GA 2VHAA 2ZNUA 4E0XA 3GBBA 4HW8A 3BKIB 3PUYE 4ELRA 3MWBA 2QPQA 2Z22A 3IB1A 3R7XA 1B0LA 5DVIA 4U23A 3RUMA 2QRYA 3RY3A 2Z8EA 2AIXA 1N3XA 1LLSA 5ELVA 2F35A 1PDAA 1FQDA 2QMWA 1FQBA 1ZTYA 2ALUA 4QSCA 3IB0A 4ND9A 1DOTA 1YPNA 2V3UA 4O3CA 1N84A 3SKPA 4U4XA 4LVQA 1JW4A 4JBZA 5TU0A 3MZBA 5TP9A 3N26A 2PVUA 1QVSA 2RC7A 3CFLA 2KLFA 4IO7A 4OZ9A 1TFAA 3LUYA 3PD8A 4X9TA 5DT6A 2D21A 2XD3A 2Y7RA 3MZ9A 1JVXA 2Z23A 1M5EA 2I4BA 2DXRA 1RKMA 5EYFA 3PUXE 3KN8A 4Z0IA 5K2XA 4OVJA 2Y7KA 3PPRA 4KD5A 4IGTA 1NL5A 1MY4A 4K3FA 4N13A 3N6TA 2HZLA 1D9YA 4YMBA 2XXTA 4F39A 1JEUA 2ZYKA 3TMGA 4PFUA 1RYOA 2Z8FA 4DXUA 3HV1A 3OENA 4IO3A 3QIMA 3H6TA 2FYIA 1MG1A 2DQVA 5J1DA 4KCDA 5I57B 3IK6B 1B5HA 4FEDA 4HS7A 3VFJA 1BTJA 3MC2A 3HPIA 2XX9A 4EUOA 4YB6A 2QS1A 2UYFA 4NF6B 4R9GA 4TOZA 5KDTB 1FW0A 1MQGA 4G8NA 4GXSB 1B7ZA 5H8QB 3MVYA 1DPEA 3UN6A 3UGWA 1MQIA 1M5FA 1FTKA 4GRKA 4NF4A 5H8NB 4F3GA 1F9BA 2QS2A 4GL0A 1B3LA 3IL1B 3V5AA 5I2KB 4G68C 2X7PA 4KFQA 2RC9A 2ZXTA 1P99A 1PC3A 3N94A 1WODA 1ZJLA 3BFTA 4LZ7A 3MVWA 1XHYA 3T22A 4Z7EA 3TEPA 4U2RA 5FTHA 3M3LA 3A09A 3PMXA 3MP1A 1SW5A 3FGSA 1ZLQA 4JSDA 3L6GA 3B7DA 4QF9A 3FXQA 3K1NA 4QSEA 1DSNA 5TP9B 4MFIA 3SETA 3VE1B 3G3GA 5TPAA 3PPOA 3SEYA 3ONMA 2AL5A 2Q8JA 5L9MA 4XKRA 1S50A 2XXUA 2PT2A 1MXYA 2HAUA 2X7QA 4ZEDA 4QFOA 2R6GE 1I69A 1CE2A 1B05A 3W9WA 4ELPA 1I6AA 1JQFA 4R72A 3KG2A 4LQ5A 1EH3A 1B32A 4PETA 1SW4A 1M5CA 4DCYA 4U1OA 2B3BA 3B6TA 3IO6A 4MF3A 3TTKA 2DWIA 5I2NA 4G68A 1B6HA 2ZNTA 1Z7NE 4KYDA 3SESA 2Y7PA 1QUIA 2XXQA 4MH5A 2REGA 3RQTA 2VD2A 1H45A 1LB9A 3SEWA 1XT8A 1N0TA 4RXLA 3E3KA 3EHTA 1IEJA 1M5BA 3VLVA 2XXWA 3KN7A 1FQAA 2HAVA 2O1LA 4ZEKA 2OZZA 3CI8A 3H6UA 5IKBA 1S7YA 5AE4A 2HXWA 1A54A 1N7XA 3IB2A 1Q35A 4R74A 1MY0A 1XC1A 3GBAA 1MH3A 2PYYA 5FHOA 2DYXA 3PPQA 2DVCA 1D9VA 4RJZA 3UK4A 4P11A 3N5LA 1DPPA 2UVJA 1ZMGA 3LBSA 2QS4A 3G7WA 2I4CA 1MQDA 1EU8A 2GH9A 1H43A 3EHUA 3QAXA 3D4GA 3VDFA 1UTHA 2NXOA 2A5SA 5B70A 3TCFA 2O84X 4BDNA 1QKAA 3C35A 1MXXA 3CSGA 1JNFA 3O2AA 4WKMA 3CFZA 3W15C 5A5XA 3KEIA 5AA2D 1MY2A 4N6PA 4OESA 5JTYA 3U92A 4PP0A 1B4HA 1ZU0A 3PMWA 2V3TA 1B2HA 4ZE9A 4IO2A 3VXBA 3HO7A 4X48A 3FIRA 3TQWA 2E0SA 1XS5A 4BDOA 3IOTA 5TPAB 3FJMA 1S9TA 1A40A 4XTCQ 3FXUA 4IO5A 4TLMB 2O51A 5H8SA 1YCJA 3K2DA 3T9VA 1AIVA 1GR2A 3EHSA 3QUJA 4F29A 2FA7A 4UACA 4WEDA 2OK2A 1MPDA 3B6WA 1FTMA 5FHMA 2BJJX 3Q25A 2I49A 2O69A 3ZKLA 1VE4A 4DLDA 1VSOA 2DXYA 4C1TA 5I2NB 3KJ7A 4G68B 3FVNA 1LBBA 4EQ9A 3CRBA 4PE5B 1VFEA 5IAIA 3OOAA 2ABHA 3F11A 4NF5A 3PUZE 2F8DA 1Y9UA 4GF8A 2G29A 4O3AA 2FNCA 1R1NA 4JWYA 4PFYA 3OO8A 3UORA 3UA8A 3K1PA 2VP1A 4DXBA 3T93B 4LA9A 4FEBA 4PQJA 3O29A 1BP5A 1Y20A 3MUQA 4OTEA 3H3GA 1KWHA 3LSLA 3SEXA 4OEUA 4TLLB 2Q9TA 3MQ9A 1Y4CA 1OLCA 4F2QA 1NFTA 3LR1A 2UVHA 4ZZEA 3V83A 1DTGA 4JDFA 5AA1A 2F6GA 4AB5A 5I59B 5FTIA 2ONSA 3IOWA 2OBGA 2WKYA 1GV8A 3LC8A 4F1VA 4YU0A 3VXCA 1WVJA 3M3KA 3HCQA 1MXVA 5I84A 5A5XB 3IO4A 4G77A 2DSFA 4NWDA 1QUJA 5JTYB 4R75A 3U72A 1TFDA 1N3WA 1FQEA 4C1UA 2XX7A 1SYIA 4LONB 4GIZA 3VV5A 4TQUQ 4Q5TA 3OEMA 3PPNA 4JWOA 4I9DA 1NNKA 4P0GA 5CI5A 1L5TA 5LOMA 3FASA 5JEIA 3Q29A 1T0KA 3K01A 3S9NC 1H3DA 3PUVE 1PBQA 2M8CA 1LAXA 1R9LA 5DEXB 1IIWA 3FV1A 3KBRA 1LGBC 3MPLA 3OMBA 3AXFA 1RYXA 1FTLA 5DVJA 4GOTA 4NE4A 2UXAA 3R6UA 3TTMA 4EQ7A 4IB2A 3U93A 3O66A 5EHSA 4ZS9A 3CIJA 5AA2B 1D3KA 3A3UA 5BUUA 4R9FA 3H03A 2NUVA 2IEEA 2D5WA 3DM0A 2DE3A 2V3QA 1B52A 3LSFB 3RLFE 1B0HA 3K6XA 1WDNA 5K2YA 5B7DA 1SI1A 3OSQA 2OLBA 3GXAA 2ZMBA 3MBPA 5I58A 3MVXA 3FVKA 3FXRA 3PUWE 3RTWB 1HSEA 3O97A 3C33A 1ANFA 3S9EA 4OETA 1B46A 2VOZA 5BWJA 2ZNSA 3PPPA 3Q28A 2H99A 4U1ZA 4HCWA 1BKAA 1VR5A 4POWA 1US4A 3PMVA 1TWYA 4YMAA 3R26A 1OQHA 3I6VA 4F18A 2RC8A 5ISUA 2CZLA 2NOOA 3I5OA 1GVCA 3VVDA 3HHFA 2F34A 3H6VA 5H8FA 1A55A 4DCXA 1B3FA 2OWSA 4GQOA 1SW2A 3K00A 4YICA 3FVGA 4H8JA 3K6VA 3LSWA 2O1MA 4OFLA 2XXYA 2A5TA 1B1HA 3JZJA 4LUBA 3ZKKA 4I1DA 3DLNA 3OO6A 2ZYNA 4GL8A 2YPNA 2D3IA 3OELA 3KOSA 4YKKA 1UTBA 4F3BA 5DTBA 1URDA 4ZDMA 4NF8A 4H67A 3TYHA 3C9HA 3FUZA 2NVUB 2H25A 4ZECA 1OIBA 2ESNA 4NMYA 4KR5A 4GVOA 2IA4A 3TUSA 3RTFB 4G8HA 4RA1A 2XXVA 2GHBA 2V25A 3WAEA 3T66A 3S4UA 2I6EA 4YZZA 3TDJA 4RK9A 4M1VA 1SQYA 1Y3QA 3E9XA 4RPOA 3C4MA 4YAHX 4LP2B 1Y1ZA 1I6QA 1LAHE 4ZE8A 4C0RA 1CB6A 4ESXA 3UIFA 2AL4A 4O3BA 3CFXA 4KYEA 2Z8DA 3IORA 4GWOA 3S2VA 4LQ2A 4WEPA 2DVZA 5I58B 4HCYA 3IJXB 2V93A 2I58A 1IUDA 4I8CA 4IO6A 2QS3A 4H1XA 1B1XA 3EN3A 4GFRA 5DVFA 3RT6B 2DE4A 4ZEIA 4NF4B 4KQPA 2THIA 3PGFA 1LFHA 3G3JA 3CG1A 4U21A 3SEVA 5KCJA 1P1NA 4QFNA 4JWXA 1QULA 3PD9A 4ELQA 3BFUA 2F7AA 1US5A 1ELJA 4ONYA 5DYHA 2QMXA 2NWJA 1FQFA 4RNSA 5H8FB 1PEBA 1LB8A 1NKXA 3FV2A 4KPTA 4LZ5A 1A99A 1POTA 3TCGA 4R73A 3ZSFA 4G2ZA 2A5TB 3V8XB 3IAZA 4R6HA 5ITOA 4F22A 3OD7A 2DWJA 2H5YA 4JSOA 4F3PA 1SW1A 1OVBA 2RCBA 1B5IA 1B58A 3PV0E 1MQHA 4U4SA 2I0BA 4RK2A 3Q26A 1QKBA 4XXUA 1I6BA 1HSJA 5CM6A 1URGA 3O28A 1R9QA 4DZ1A 2XXIA 4EDPA 3HN0A 2GRVA 4DIGA 4G8MA 3W9VA 3S9MC 3EPEA 3MP8A 2XD2A 3C32A 4IY5A 2HEUA 1A7LA 1IQ7A 4N07A 4JB7A 4DDDA 2OCUA 1MPBA 3CVGA 3K1MA 4QFLA 1AH5A 3VLWA 3SEUA 3KN3A 1FTJA 2UVGA 4F2OA 2F78A 1LAGE 4KHZE 1IXIA 4OERA 3QYTA 4EQBA 4FATA 1P1WA 2XXRA 3TTLA 2XXPA 2E1SA 3K6UA 1D4NA 1YTVA 3KOTA 3TKDA 1DMBA 1ATGA 1A8FA 2HZKA 2H4IA 3DP8A 3DELB 1IXGA 3IOVA 2F36A 4EXLA 2DE2A 2Y7IA 2X26A 2G93A 4YB7A 5I57A 3IJOB 3OEKA 1ZIUA 3CSBA 4MLVA 4OFOA 4FE8A 4OYVA 1MXUA 2W7YA 5HPQA 3ILUB 4QHQA 3H6WA 1MDQA 2I0CA 2P0SA 5H8QA 3CR9A 3OO7A 5JK4A 3K4UA 1QW0A 1LCTA 3QK6A 4FECA 4OMBA 1UTHB 2F6PA 3JYRA 2DS9A 1MXWA 3RNNA 4OENA 3THIA 4QSDA 2DWHA 1GGGA 1O7TA 3HHGA 5I2KA 3TTNA 2DWAA 5AA3A 4E0WA 1SDXA 3TAJA 4UA8A 2HCAA 3G3HA 3JV9A 4OWDA 5F1QA 4XKPA 3Q27A 3DP6A 1B9JA 2DP8A 4L17A 2YLNA 4F19A 3HSTA 4YKPA 4OXVA 3USDA 3TELA 1YAEA 4M4GA 1LSTA 1H76A 4BDRA 1BIYA 3KZGA 3WAFA 4BDQA
chains in the Genus database with same CATH superfamily
2Q2AA 1MXZA 4P0IA 1J1NA 3O6IA 5FHNA 1FCKA 1OLAA 5CMKA 1MM7A 5CBRA 1B7UA 2V4CA 4Q8RA 3K6WA 1MY3A 4POXA 5CMMA 2VGQA 3KJTA 4NWCA 5ET5A 4PFBA 4OVQA 3MPKA 4F31B 1IMBA 1FQCA 4XEQA 1O64A 3V89B 1QUKA 2CEXA 4MEVA 1NH8A 5IZ1A 1MM6A 2QL3A 2CEYA 1FPIA 1EZ9A 5I5PA 1FPDA 4MJOA 1P1OA 3O6HA 1A8EA 3SDFA 4H0WA 3D4CA 3T96B 4FIMA 3KFMA 3ZS6A 1IXHA 2ZYOA 1PBPA 1VFDA 2VT5A 3U94A 4NF5B 2XX8A 2RKMA 3TCHA 3T9XB 4O8MA 4H8IA 2XXHA 2FIXA 3C34A 3FVOA 3OXNA 1NNTA 4HTGA 1YZ0A 1MH4A 3VLUA 2DOJA 4QFPA 5IGAA 5CMCA 4KCCA 1AWBA 1EZPA 3K02A 1IZ1A 3U65A 1O63A 2I3WA 4F1YA 2XXKA 1LFGA 2JJKA 4G4PA 3FD3A 4F3SA 1XVYA 2Q88A 4NEDA 1FTAA 3FZVA 3EF7A 2GHAA 2ZZWA 4QFKA 1NV3A 3O6GA 4RY1A 3RGYA 1II5A 3G3FA 2B3FA 4MX6A 3IFAA 2H98A 3RPWA 3FATA 3S9LC 3CHGA 4EXKA 3GLBA 4H6DA 3MW0A 5I56A 4ELOA 4EF1A 1JEVA 2PT1A 3C36A 5H8HA 3QXMA 1N7WA 4BLAA 2PX1A 2YJPA 4RPNA 4YKIA 3B50A 5CC2A 3K0VA 3N6UA 4OQOA 4QRZA 1K9ZA 1FTOA 5CRYA 2ONRA 2ZZXA 3E4RA 4EF2A 4ECFA 2B65A 3L6HA 5L9OA 3OO9A 3RPLB 2ANJA 3VVEA 3BBRA 1MS7A 1OMPA 2B4MA 2OJTA 3U1OA 5KZTA 3DP4A 2VD3A 2Y7WA 5ESYA 4AQ4A 2O6AA 2RCAA 3FJGA 2O7UA 3MJNA 2O7IA 4NX1A 1XOCA 4NQ8A 1JW5A 4XIGQ 4DXCA 2ZYMA 1Z7ME 1EYKA 5CBSA 4LZ8A 3KSJA 3TFLA 4UABA 4XKQA 4OEVA 3TPAA 3UP9A 4N15A 4Q0CA 1FPJA 4X8RA 5ICQA 2GFEA 1JVYA 4N17A 1NV6A 3KSXA 1EZOA 1SI0A 1NNPA 2PBWA 1B3EA 4OVSA 1B3HA 1B51A 1B3GA 1PB7A 3LSXA 4X1BA 4R2BA 1N76A 5EQ9A 4ESWA 1SVXB 2CZIA 1R6ZA 3I3VA 1QJMA 4PAIA 4FAJA 1ZBMA 1SD3A 1SBPA 1Q1KA 4GLIA 2QJEA 4OHNA 1M5DA 1ZKBA 3H7MA 4N8YA 2R71A 1FJ6A 5M2VA 5HM4B 1Y3NA 4N81A 2GQ1A 4I3YA 4MHFA 1AOVA 4KI0E 4PCDA 1LBCA 2XWOA 3B6QA 1POY1 1IITA 1NNFA 2PMSA 3TZAA 2HQ0A 3EKIA 4HE0A 1H44A 5IZZA 4Q30B 1IMDA 5AA4A 4X1DA 1B7HA 3IOUA 4IGRA 1UQWA 3TQLA 1UIUA 3G3KA 5F7VA 1FPEA 2UYEA 4THIA 2UVIA 1B4ZA 4XKNA 1NH7A 1USYH 3MAMA 2XA5A 2HFBA 4XFEA 2XHDA 1OVTA 1TXFA 4YB5A 1URSA 5L9SA 4FBPA 1Y3PA 5I56B 1PB9A 1B40A 1B5JA 2QSXA 5H8HB 1NUWA 4OANA 1NV1A 3EQ1A 1AL3A 1MRPA 2P2AA 2H9BA 3M3FA 4OVRA 4ZEBA 1LAFE 5I59A 1GTKA 1PB8A 3P7IA 2F7CA 4GXAA 1SYHA 1LCFA 4I40A 1HSLA 1JETA 4DI3D 4IO4A 4DE8A 3SERA 3A3CA 4O7MA 4AS5A 3MZ1A 1UTBB 1USYE 5EHMA 1YXIA 3RN8A 2WEFA 2Q2CA 2RINA 3T9HB 4FORA 1D9QA 2P1SA 1MPCA 5L8DA 4PGNA 4NF8B 2F7BA 4H65A 1OQGA 3FJ7A 2WBDA 2F5XA 1TT1A 1LFIA 1MQJA 4JXIA 2I48A 4GWWA 4IY6A 1NV2A 2ONKE 3H06B 5CMBA 1UIVA 3O9PA 3T9UA 3A29A 3KGCA 4I62A 2O68A 4NTLA 3LUZA 2AYSA 4GX3A 3E13X 4WXJA 1P1QA 2I3VA 4OFJA 3G3IA 3CG3A 5HBCA 1BLFA 5DEXA 1FBGA 5ITPA 3ODBA 4MLQA 3ILTB 4PFTA 4LN5A 4BDLA 4RYAA 3MP6A 3IR1A 4R2FA 3VVFA 4FJPA 1IXCA 4KYSA 3GZGA 1Y1MA 5IZ3A 4OA4A 3U8QA 3PU5A 2REJA 3IX1A 1MY1A 2F97A 2Y84A 3RT8A 4GWZA 2WX9A 5EQ8A 4ISUA 1JW1A 1DTZA 1FPKA 4O7IA 2R9JA 1Y4TA 2QFLA 5AA2A 4ZEFA 2CMOA 5ICTA 3M8UA 4GD5A 1N04A 4R6YA 2V84A 1RDZA 4PFWA 4F1UA 4BDMA 2OWTA 3QUFA 3MVZA 4H5FA 4MBPA 3H4ZA 3BIHA 4AB6A 5AA4B 1NMUA 3PTYA 2LAOA 4NF6A 2KQZA 3QSLA 4MNIA 2RF1A 1FBCA 4R6KA 1P1UA 3C31A 2Q89A 1G0HA 5KDTA 4U22A 5KCJB 2XWKA 1MDP1 2XXXA 3OSRA 1XVXA 3TTRA 4DI4B 4YKJA 3ECRA 2ZZVA 4LATA 3TODA 2HPGA 1FBPA 5H8NA 4N6KA 1AMFA 2QVRA 4ZZAA 4H5GA 2VHAA 2ZNUA 4P9KA 4PAFA 5EYGA 4E0XA 3GBBA 2VPNA 4HW8A 3BKIB 3PUYE 4ELRA 3MWBA 2QPQA 2Z22A 3IB1A 3R7XA 1B0LA 5DVIA 4U23A 3RUMA 1EYIA 2QRYA 3RY3A 2Z8EA 2AIXA 1N3XA 1LLSA 5ELVA 2F35A 1PDAA 1FQDA 2QMWA 1FBHA 1FQBA 1ZTYA 2ALUA 4QSCA 3IB0A 4ND9A 1DOTA 1YPNA 5EQAA 2V3UA 4O3CA 1N84A 3SKPA 4U4XA 4LVQA 1JW4A 4JBZA 2KR0A 1KZ8A 5TU0A 4GBVA 3MZBA 5TP9A 3N26A 2PVUA 4IR8A 1QVSA 2RC7A 3CFLA 2KLFA 4P47A 4IO7A 4OZ9A 3FXBA 1TFAA 3LUYA 3PD8A 4X9TA 5DT6A 2D21A 4QXDA 2XD3A 2Y7RA 3MZ9A 1JVXA 1K9YA 2Z23A 1M5EA 3ROJA 2I4BA 2DXRA 1RKMA 5EYFA 3PUXE 4GWXA 3KN8A 5IZ3B 4N8GA 4HXVA 4Z0IA 5EYHA 5K2XA 4OVJA 2Y7KA 3PPRA 1NI9A 4KD5A 4IGTA 1NL5A 1MY4A 4K3FA 4N13A 3N6TA 2HZLA 1D9YA 4YMBA 2XXTA 4F39A 2XWIA 1JEUA 2ZYKA 3TMGA 4PFUA 1RYOA 2Z8FA 4DXUA 3HV1A 2P3VA 3OENA 4IO3A 3QIMA 3H6TA 1FBEA 2FYIA 1MG1A 2DQVA 1Q9DA 5J1DA 4KCDA 5I57B 3IK6B 1B5HA 4FEDA 4HS7A 3VFJA 4MCOA 1BTJA 3LV0A 3HPIA 2XX9A 3MC2A 4EUOA 4YB6A 2B4LA 4O94A 2QS1A 2UYFA 4H45A 4NF6B 4R9GA 4TOZA 5A5LA 5KDTB 1FW0A 1MQGA 3HFUA 4G8NA 4GXSB 1B7ZA 1FPFA 5H8QB 3MVYA 1DPEA 2FBPA 3UN6A 5FBPA 3UGWA 1MQIA 1M5FA 1FTKA 4GRKA 4NF4A 5H8NB 4OVTA 4F3GA 1F9BA 2QS2A 4GL0A 1B3LA 4X04A 1LBXA 3IL1B 2Y5KA 3V5AA 1RDYA 5I2KB 4G68C 2X7PA 4KFQA 2RC9A 2ZXTA 4HE2A 1P99A 3T1BA 1EYJA 1PC3A 3NOHA 3N94A 1WODA 2Q8MA 1ZJLA 5ET6A 1NUXA 3BFTA 4LZ7A 3MVWA 1XHYA 3T22A 4Z7EA 3TEPA 4U2RA 5FTHA 3M3LA 3A09A 4N6DA 3PMXA 3MP1A 1SW5A 3FGSA 1ZLQA 4JSDA 3L6GA 3B7DA 4QF9A 3FXQA 3K1NA 4N91A 4QSEA 1LBWA 1DSNA 5TP9B 4MFIA 3SETA 3VE1B 3G3GA 5TPAA 3PPOA 3SEYA 3ONMA 4MMPA 2AL5A 2Q8JA 5L9MA 4H46A 4XKRA 1S50A 2XXUA 2PT2A 1MXYA 2HAUA 2X7QA 4ZEDA 1IMEA 4QFOA 2R6GE 2PCRA 1I69A 1CE2A 1IMFA 1B05A 4JVDA 3W9WA 3FBPA 4ELPA 1BK4A 1I6AA 1JQFA 4JVCA 4R72A 2Y5LA 3SZPA 3KG2A 4LQ5A 1EH3A 1B32A 4PETA 1SW4A 1M5CA 4DCYA 4U1OA 2B3BA 3B6TA 3IO6A 4MF3A 3TTKA 2DWIA 4NHBA 5I2NA 4G68A 1B6HA 2ZNTA 1Z7NE 4KYDA 3SESA 2Y7PA 1QUIA 2XXQA 4MH5A 2REGA 5F24A 3RQTA 2VD2A 1NV0A 4OVPA 1H45A 1LB9A 1DBZA 3SEWA 1XT8A 2Q74A 1IMAA 1N0TA 4RXLA 3E3KA 3EHTA 1G0IA 1IEJA 1M5BA 5EQ7A 3VLVA 2XXWA 3KN7A 1FQAA 2HAVA 2O1LA 4ZEKA 2OZZA 3CI8A 4P3LA 1FPBA 3H6UA 5IKBA 1S7YA 5AE4A 1FBDA 2HXWA 1A54A 1N7XA 3IB2A 1Q35A 4G61A 4R74A 1MY0A 1XC1A 3GBAA 1MH3A 3B8BA 2MKZA 1DCUA 1DK4A 2PYYA 5FHOA 2DYXA 3PPQA 2DVCA 1D9VA 4RJZA 3UK4A 4P11A 3N5LA 1DPPA 2UVJA 1ZMGA 3LBSA 2QS4A 3G7WA 2I4CA 3KC0A 1CNQA 1MQDA 1EU8A 2GH9A 1H43A 3EHUA 3QAXA 3D4GA 3VDFA 1UTHA 2NXOA 2A5SA 5B70A 3TCFA 3RYDA 2O84X 4BDNA 1QKAA 3C35A 1MXXA 3CSGA 2WYPA 1JNFA 3O2AA 4WKMA 3CFZA 3W15C 5A5XA 3KEIA 5AA2D 1MY2A 3GYYA 4N6PA 4OESA 1LEVA 2QVUA 5JTYA 3U92A 4PP0A 1B4HA 1ZU0A 3KC1A 2F3BA 3PMWA 2V3TA 1B2HA 4ZE9A 4IO2A 3VXBA 3HO7A 4X48A 1NV4A 3FIRA 3TQWA 2E0SA 1XS5A 4BDOA 5ET7A 4GWYA 2OWZA 3IOTA 5TPAB 3FJMA 1S9TA 1A40A 4XTCQ 3FXUA 4IO5A 4TLMB 2O51A 5H8SA 1YCJA 3K2DA 3T9VA 1AIVA 1GR2A 3EHSA 3QUJA 4F29A 2FA7A 4UACA 4WEDA 2OK2A 1MPDA 3B6WA 1FTMA 5FHMA 2BJJX 3Q25A 2I49A 2O69A 3ZKLA 1VE4A 4DLDA 1VSOA 2DXYA 4C1TA 1FRPA 5I2NB 3KJ7A 4G68B 3FVNA 1LBBA 2HXRA 4EQ9A 3E78A 3CRBA 4PE5B 1VFEA 5IAIA 3OOAA 2ABHA 3F11A 4NF5A 3MSTA 3PUZE 2F8DA 1Y9UA 4GF8A 2G29A 4O3AA 2FNCA 1R1NA 1KA0A 4JWYA 4PFYA 3OO8A 1NUYA 3UORA 4PF8A 3UA8A 3K1PA 2VP1A 4DXBA 3T93B 4LA9A 4FEBA 4PQJA 3O29A 1BP5A 1Y20A 3MUQA 4MIJA 4OTEA 3H3GA 1KWHA 3LSLA 4N4UA 3SEXA 3D1RA 4OEUA 4TLLB 2Q9TA 3MQ9A 4PC9A 1Y4CA 1OLCA 4F2QA 1NFTA 3BIGA 3LR1A 2UVHA 4ZZEA 3V83A 1DTGA 4JDFA 5AA1A 2F6GA 4AB5A 5I59B 5FTIA 2ONSA 3IOWA 4HE1A 2XWVA 2OBGA 2WKYA 1GV8A 3LC8A 4F1VA 2QVVA 4YU0A 3VXCA 1WVJA 3M3KA 3HCQA 1MXVA 5I84A 5A5XB 3IO4A 4G77A 2DSFA 4NWDA 1QUJA 5JTYB 4R75A 3U72A 1TFDA 1N3WA 1FQEA 4C1UA 2XX7A 3RPLA 1SYIA 4LONB 4PDDA 4GIZA 3VV5A 4TQUQ 4Q5TA 3OEMA 3PPNA 4JWOA 4I9DA 1NNKA 1INPA 4P0GA 5CI5A 1L5TA 5LOMA 3FASA 5JEIA 3Q29A 4NGUA 1T0KA 3K01A 3S9NC 1H3DA 3PUVE 1PBQA 2M8CA 1JP4A 4PFIA 1LAXA 1R9LA 5DEXB 1IIWA 3FV1A 3KBRA 1LGBC 3MPLA 2R8TA 3OMBA 3AXFA 4MNPA 4MAGA 4QBAA 1RYXA 1FTLA 2FHYA 5DVJA 4GOTA 4NE4A 2UXAA 3R6UA 3TTMA 4MNCA 4EQ7A 4IB2A 3U93A 2L5VA 3O66A 5EHSA 4ZS9A 3CIJA 5AA2B 1D3KA 3A3UA 5BUUA 4R9FA 3H03A 2NUVA 2IEEA 2D5WA 3DM0A 2DE3A 2V3QA 1B52A 3LSFB 3RLFE 1B0HA 1LBYA 3K6XA 4I3EA 4P56A 1WDNA 5K2YA 5B7DA 4GWSA 1SI1A 3OSQA 2OLBA 3GXAA 2ZMBA 3MBPA 5I58A 3MVXA 3FVKA 3FXRA 3PUWE 4P1LA 4NF0A 3RTWB 1HSEA 3O97A 3C33A 1ANFA 3S9EA 4OETA 4PAKA 4PBHA 1B46A 2VOZA 5BWJA 2ZNSA 3PPPA 3Q28A 2H99A 4U1ZA 4HCWA 1BKAA 1VR5A 4POWA 1US4A 4PTKA 3PMVA 3ISPA 1TWYA 4YMAA 3R26A 1OQHA 3I6VA 4P1EA 4F18A 2RC8A 5ISUA 2CZLA 2NOOA 3I5OA 1GVCA 3VVDA 3HHFA 2PFYA 1VDWA 2F34A 3H6VA 5H8FA 1A55A 4DCXA 1B3FA 2OWSA 4GQOA 1SW2A 3K00A 2P3NA 4YICA 3FVGA 4H8JA 4NG7A 3K6VA 3LSWA 2O1MA 4OFLA 2XXYA 2A5TA 1B1HA 3JZJA 4LUBA 3ZKKA 5I7IA 1KA1A 4I1DA 3DLNA 1FSAA 3OO6A 2ZYNA 4GL8A 2YPNA 2D3IA 3OELA 1YYZA 3KOSA 4YKKA 1UTBA 1RDXA 4F3BA 5DTBA 1URDA 3KBZA 4ZDMA 4NF8A 4H67A 3TYHA 3C9HA 3FUZA 2NVUB 2H25A 4ZECA 2FIEA 1OIBA 2ESNA 4NMYA 4KR5A 4GVOA 3IFCA 2IA4A 3TUSA 3RTFB 4G8HA 4RA1A 2XXVA 2GHBA 2V25A 3WAEA 2PFZA 1QGXA 1NV5A 3T66A 3S4UA 2I6EA 4YZZA 3TDJA 4RK9A 4M1VA 1XI6A 1SQYA 1Y3QA 3E9XA 4RPOA 4PFRA 3C4MA 4YAHX 4LP2B 1Y1ZA 1I6QA 1LAHE 3T0JA 4ZE8A 5LDZA 4C0RA 1CB6A 4ESXA 3UIFA 2AL4A 2BJIA 4O3BA 3CFXA 4KYEA 2Z8DA 3IORA 4GWOA 3S2VA 4LQ2A 4WEPA 2DVZA 4GWUA 5I58B 2FVZA 4HCYA 3IJXB 5ET8A 1FPGA 2V93A 2I58A 3QMFA 1IUDA 4I8CA 4IO6A 2QS3A 4H1XA 1B1XA 1IMCA 3EN3A 4GFRA 1LBVA 5DVFA 3RT6B 2DE4A 2HHMA 4ZEIA 4NF4B 4KQPA 2THIA 3PGFA 1LFHA 3G3JA 3CG1A 4U21A 3SEVA 5KCJA 1P1NA 4QFNA 4JWXA 1QULA 3PD9A 4ELQA 3BFUA 2F7AA 1US5A 1LBZA 1ELJA 4ONYA 4PF6A 5DYHA 2QMXA 2NWJA 1FQFA 4RNSA 5H8FB 1PEBA 1LB8A 1NKXA 3FV2A 4KPTA 4LZ5A 1A99A 1POTA 3TCGA 4R73A 3ZSFA 4G2ZA 2A5TB 3V8XB 3IAZA 4R6HA 2OX3A 5ITOA 4F22A 2VPOA 3OD7A 2DWJA 3MYUA 2H5YA 5LTCA 4JSOA 4PE3A 3E79A 4F3PA 1SW1A 1OVBA 2RCBA 1B5IA 1B58A 3PV0E 1MQHA 4U4SA 2I0BA 4RK2A 3Q26A 1QKBA 4XXUA 1I6BA 1HSJA 5CM6A 1URGA 3O28A 1NV7A 1R9QA 4DZ1A 4PBQA 2XXIA 4EDPA 3HN0A 2GRVA 4DIGA 4G8MA 5DW8A 3W9VA 3S9MC 3EPEA 3MP8A 4JVIA 2XD2A 3C32A 4IY5A 4AS4A 2HEUA 1FPLA 1A7LA 1IQ7A 4N07A 4JB7A 4KXPA 4DDDA 4P8BA 2OCUA 1MPBA 3CVGA 1NUZA 3K1MA 4QFLA 1AH5A 3VLWA 4PDHA 3SEUA 3KN3A 1FTJA 2UVGA 2F3DA 1FBFA 4F2OA 2F78A 1LAGE 4KHZE 1IXIA 4OERA 3QYTA 4EQBA 4FATA 1P1WA 2DDKA 4NAPA 2XXRA 3TTLA 2XXPA 2E1SA 4GX6A 3K6UA 1D4NA 1YTVA 3KOTA 3TKDA 4PGPA 1DMBA 1ATGA 4NN3A 5J16A 1A8FA 2HZKA 2H4IA 3DP8A 3DELB 1IXGA 3IOVA 2F36A 4EXLA 2DE2A 2Y7IA 2CZHA 2X26A 2G93A 4YB7A 5I57A 3IJOB 3OEKA 1ZIUA 2CZKA 3CSBA 4MLVA 4OFOA 4FE8A 4OYVA 1MXUA 4GX4A 2W7YA 5HPQA 3ILUB 4QHQA 3H6WA 1MDQA 2I0CA 5T3JA 2P0SA 5H8QA 3CR9A 3OO7A 5JK4A 3K4UA 1QW0A 1LCTA 3QK6A 4FECA 4OMBA 1UTHB 2F6PA 3JYRA 1FJ9A 2DS9A 1MXWA 3RNNA 4OENA 3THIA 4QSDA 2DWHA 1GGGA 1O7TA 3HHGA 5I2KA 3TTNA 2DWAA 5AA3A 4E0WA 1SDXA 3TAJA 4UA8A 2HCAA 3G3HA 3JV9A 4OWDA 4XF5A 5F1QA 4XKPA 3Q27A 5IM2A 3DP6A 1B9JA 2WBBA 2DP8A 1SPIA 4L17A 2YLNA 4F19A 3HSTA 5I3SA 4YKPA 2WYKA 4OXVA 3USDA 3TELA 1YAEA 4M4GA 1LSTA 1H76A 4GBWA 4BDRA 1BIYA 3KZGA 3WAFA 4BDQA
chains in the Genus database with same CATH topology
2Q2AA 1MXZA 4P0IA 1J1NA 3O6IA 5FHNA 1FCKA 1OLAA 5CMKA 1MM7A 5CBRA 1B7UA 4Q8RA 3K6WA 1MY3A 4POXA 5CMMA 2VGQA 3KJTA 4NWCA 3MPKA 4F31B 1FQCA 1O64A 3V89B 1QUKA 1NH8A 1MM6A 2QL3A 1EZ9A 1P1OA 3O6HA 1A8EA 3SDFA 4H0WA 3D4CA 3T96B 4FIMA 3KFMA 3ZS6A 1IXHA 2ZYOA 1PBPA 1VFDA 3U94A 4NF5B 2XX8A 2RKMA 3TCHA 3T9XB 4H8IA 2XXHA 3C34A 3FVOA 3OXNA 1NNTA 4HTGA 1MH4A 3VLUA 2DOJA 4QFPA 5CMCA 4KCCA 1EZPA 3K02A 1IZ1A 1O63A 2I3WA 4F1YA 1LFGA 4G4PA 3FD3A 4F3SA 1XVYA 2Q88A 4NEDA 3FZVA 3EF7A 2GHAA 4QFKA 3O6GA 4RY1A 3RGYA 1II5A 3G3FA 2B3FA 2H98A 3RPWA 3FATA 3S9LC 4EXKA 3GLBA 4H6DA 3MW0A 5I56A 4ELOA 4EF1A 1JEVA 2PT1A 3C36A 5H8HA 3QXMA 1N7WA 4BLAA 2PX1A 2YJPA 4RPNA 4YKIA 5CC2A 3K0VA 3N6UA 4OQOA 4QRZA 1FTOA 5CRYA 2ONRA 3E4RA 4EF2A 4ECFA 2B65A 3L6HA 5L9OA 3OO9A 2ANJA 3VVEA 3BBRA 1MS7A 1OMPA 2OJTA 3U1OA 5KZTA 3DP4A 2VD3A 2Y7WA 4AQ4A 2O6AA 2RCAA 3FJGA 2O7UA 3MJNA 2O7IA 1XOCA 1JW5A 4XIGQ 4DXCA 2ZYMA 1Z7ME 5CBSA 4LZ8A 3KSJA 3TFLA 4XKQA 4OEVA 3TPAA 3UP9A 4Q0CA 5ICQA 2GFEA 1JVYA 3KSXA 1EZOA 1SI0A 1NNPA 2PBWA 1B3EA 1B3HA 1B51A 1B3GA 1PB7A 3LSXA 4X1BA 4R2BA 1N76A 4ESWA 1SVXB 1R6ZA 3I3VA 1QJMA 4FAJA 1ZBMA 1SD3A 1SBPA 1Q1KA 4GLIA 2QJEA 4OHNA 1M5DA 1ZKBA 3H7MA 2R71A 5M2VA 5HM4B 1Y3NA 1AOVA 4KI0E 1LBCA 3B6QA 1POY1 1IITA 1NNFA 2PMSA 3TZAA 2HQ0A 1H44A 4Q30B 5AA4A 4X1DA 1B7HA 3IOUA 4IGRA 1UQWA 3TQLA 1UIUA 3G3KA 5F7VA 2UYEA 4THIA 2UVIA 1B4ZA 4XKNA 1NH7A 1USYH 3MAMA 2HFBA 2XHDA 1OVTA 1TXFA 4YB5A 1URSA 5L9SA 1Y3PA 5I56B 1PB9A 1B40A 1B5JA 2QSXA 5H8HB 3EQ1A 1AL3A 1MRPA 2P2AA 2H9BA 3M3FA 4ZEBA 1LAFE 5I59A 1GTKA 1PB8A 3P7IA 2F7CA 4GXAA 1SYHA 1LCFA 1HSLA 1JETA 4IO4A 4DE8A 3SERA 3A3CA 3MZ1A 1UTBB 1USYE 5EHMA 3RN8A 2Q2CA 2RINA 3T9HB 4FORA 2P1SA 1MPCA 5L8DA 4NF8B 2F7BA 4H65A 1OQGA 3FJ7A 2F5XA 1TT1A 1LFIA 1MQJA 4JXIA 2I48A 4IY6A 2ONKE 3H06B 5CMBA 1UIVA 3O9PA 3T9UA 3KGCA 4I62A 2O68A 4NTLA 2AYSA 3E13X 4WXJA 1P1QA 2I3VA 4OFJA 3G3IA 3CG3A 5HBCA 1BLFA 5DEXA 5ITPA 3ODBA 4MLQA 3ILTB 4PFTA 4BDLA 4RYAA 3MP6A 3IR1A 4R2FA 3VVFA 4FJPA 1IXCA 4KYSA 3GZGA 1Y1MA 3U8QA 3PU5A 2REJA 3IX1A 1MY1A 2F97A 2Y84A 3RT8A 4ISUA 1JW1A 1DTZA 2R9JA 1Y4TA 5AA2A 4ZEFA 2CMOA 5ICTA 3M8UA 4GD5A 1N04A 4R6YA 2V84A 4PFWA 4F1UA 4BDMA 2OWTA 3QUFA 3MVZA 4H5FA 4MBPA 3H4ZA 4AB6A 5AA4B 1NMUA 2LAOA 4NF6A 3QSLA 2RF1A 4R6KA 1P1UA 3C31A 2Q89A 5KDTA 4U22A 5KCJB 1MDP1 2XXXA 3OSRA 1XVXA 3TTRA 4YKJA 3ECRA 4LATA 3TODA 5H8NA 1AMFA 4ZZAA 4H5GA 2VHAA 2ZNUA 4E0XA 3GBBA 4HW8A 3BKIB 3PUYE 4ELRA 3MWBA 2QPQA 2Z22A 3IB1A 3R7XA 1B0LA 5DVIA 4U23A 3RUMA 2QRYA 3RY3A 2Z8EA 2AIXA 1N3XA 1LLSA 5ELVA 2F35A 1PDAA 1FQDA 2QMWA 1FQBA 1ZTYA 2ALUA 4QSCA 3IB0A 4ND9A 1DOTA 1YPNA 2V3UA 4O3CA 1N84A 3SKPA 4U4XA 4LVQA 1JW4A 4JBZA 5TU0A 3MZBA 5TP9A 3N26A 2PVUA 1QVSA 2RC7A 3CFLA 2KLFA 4IO7A 4OZ9A 1TFAA 3LUYA 3PD8A 4X9TA 5DT6A 2D21A 2XD3A 2Y7RA 3MZ9A 1JVXA 2Z23A 1M5EA 2I4BA 2DXRA 1RKMA 5EYFA 3PUXE 3KN8A 4Z0IA 5K2XA 4OVJA 2Y7KA 3PPRA 4KD5A 4IGTA 1NL5A 1MY4A 4K3FA 4N13A 3N6TA 2HZLA 1D9YA 4YMBA 2XXTA 4F39A 1JEUA 2ZYKA 3TMGA 4PFUA 1RYOA 2Z8FA 4DXUA 3HV1A 3OENA 4IO3A 3QIMA 3H6TA 2FYIA 1MG1A 2DQVA 5J1DA 4KCDA 5I57B 3IK6B 1B5HA 4FEDA 4HS7A 3VFJA 1BTJA 3MC2A 3HPIA 2XX9A 4EUOA 4YB6A 2QS1A 2UYFA 4NF6B 4R9GA 4TOZA 5KDTB 1FW0A 1MQGA 4G8NA 4GXSB 1B7ZA 5H8QB 3MVYA 1DPEA 3UN6A 3UGWA 1MQIA 1M5FA 1FTKA 4GRKA 4NF4A 5H8NB 4F3GA 1F9BA 2QS2A 4GL0A 1B3LA 3IL1B 3V5AA 5I2KB 4G68C 2X7PA 4KFQA 2RC9A 2ZXTA 1P99A 1PC3A 3N94A 1WODA 1ZJLA 3BFTA 4LZ7A 3MVWA 1XHYA 3T22A 4Z7EA 3TEPA 4U2RA 5FTHA 3M3LA 3A09A 3PMXA 3MP1A 1SW5A 3FGSA 1ZLQA 4JSDA 3L6GA 3B7DA 4QF9A 3FXQA 3K1NA 4QSEA 1DSNA 5TP9B 4MFIA 3SETA 3VE1B 3G3GA 5TPAA 3PPOA 3SEYA 3ONMA 2AL5A 2Q8JA 5L9MA 4XKRA 1S50A 2XXUA 2PT2A 1MXYA 2HAUA 2X7QA 4ZEDA 4QFOA 2R6GE 1I69A 1CE2A 1B05A 3W9WA 4ELPA 1I6AA 1JQFA 4R72A 3KG2A 4LQ5A 1EH3A 1B32A 4PETA 1SW4A 1M5CA 4DCYA 4U1OA 2B3BA 3B6TA 3IO6A 4MF3A 3TTKA 2DWIA 5I2NA 4G68A 1B6HA 2ZNTA 1Z7NE 4KYDA 3SESA 2Y7PA 1QUIA 2XXQA 4MH5A 2REGA 3RQTA 2VD2A 1H45A 1LB9A 3SEWA 1XT8A 1N0TA 4RXLA 3E3KA 3EHTA 1IEJA 1M5BA 3VLVA 2XXWA 3KN7A 1FQAA 2HAVA 2O1LA 4ZEKA 2OZZA 3CI8A 3H6UA 5IKBA 1S7YA 5AE4A 2HXWA 1A54A 1N7XA 3IB2A 1Q35A 4R74A 1MY0A 1XC1A 3GBAA 1MH3A 2PYYA 5FHOA 2DYXA 3PPQA 2DVCA 1D9VA 4RJZA 3UK4A 4P11A 3N5LA 1DPPA 2UVJA 1ZMGA 3LBSA 2QS4A 3G7WA 2I4CA 1MQDA 1EU8A 2GH9A 1H43A 3EHUA 3QAXA 3D4GA 3VDFA 1UTHA 2NXOA 2A5SA 5B70A 3TCFA 2O84X 4BDNA 1QKAA 3C35A 1MXXA 3CSGA 1JNFA 3O2AA 4WKMA 3CFZA 3W15C 5A5XA 3KEIA 5AA2D 1MY2A 4N6PA 4OESA 5JTYA 3U92A 4PP0A 1B4HA 1ZU0A 3PMWA 2V3TA 1B2HA 4ZE9A 4IO2A 3VXBA 3HO7A 4X48A 3FIRA 3TQWA 2E0SA 1XS5A 4BDOA 3IOTA 5TPAB 3FJMA 1S9TA 1A40A 4XTCQ 3FXUA 4IO5A 4TLMB 2O51A 5H8SA 1YCJA 3K2DA 3T9VA 1AIVA 1GR2A 3EHSA 3QUJA 4F29A 2FA7A 4UACA 4WEDA 2OK2A 1MPDA 3B6WA 1FTMA 5FHMA 2BJJX 3Q25A 2I49A 2O69A 3ZKLA 1VE4A 4DLDA 1VSOA 2DXYA 4C1TA 5I2NB 3KJ7A 4G68B 3FVNA 1LBBA 4EQ9A 3CRBA 4PE5B 1VFEA 5IAIA 3OOAA 2ABHA 3F11A 4NF5A 3PUZE 2F8DA 1Y9UA 4GF8A 2G29A 4O3AA 2FNCA 1R1NA 4JWYA 4PFYA 3OO8A 3UORA 3UA8A 3K1PA 2VP1A 4DXBA 3T93B 4LA9A 4FEBA 4PQJA 3O29A 1BP5A 1Y20A 3MUQA 4OTEA 3H3GA 1KWHA 3LSLA 3SEXA 4OEUA 4TLLB 2Q9TA 3MQ9A 1Y4CA 1OLCA 4F2QA 1NFTA 3LR1A 2UVHA 4ZZEA 3V83A 1DTGA 4JDFA 5AA1A 2F6GA 4AB5A 5I59B 5FTIA 2ONSA 3IOWA 2OBGA 2WKYA 1GV8A 3LC8A 4F1VA 4YU0A 3VXCA 1WVJA 3M3KA 3HCQA 1MXVA 5I84A 5A5XB 3IO4A 4G77A 2DSFA 4NWDA 1QUJA 5JTYB 4R75A 3U72A 1TFDA 1N3WA 1FQEA 4C1UA 2XX7A 1SYIA 4LONB 4GIZA 3VV5A 4TQUQ 4Q5TA 3OEMA 3PPNA 4JWOA 4I9DA 1NNKA 4P0GA 5CI5A 1L5TA 5LOMA 3FASA 5JEIA 3Q29A 1T0KA 3K01A 3S9NC 1H3DA 3PUVE 1PBQA 2M8CA 1LAXA 1R9LA 5DEXB 1IIWA 3FV1A 3KBRA 1LGBC 3MPLA 3OMBA 3AXFA 1RYXA 1FTLA 5DVJA 4GOTA 4NE4A 2UXAA 3R6UA 3TTMA 4EQ7A 4IB2A 3U93A 3O66A 5EHSA 4ZS9A 3CIJA 5AA2B 1D3KA 3A3UA 5BUUA 4R9FA 3H03A 2NUVA 2IEEA 2D5WA 3DM0A 2DE3A 2V3QA 1B52A 3LSFB 3RLFE 1B0HA 3K6XA 1WDNA 5K2YA 5B7DA 1SI1A 3OSQA 2OLBA 3GXAA 2ZMBA 3MBPA 5I58A 3MVXA 3FVKA 3FXRA 3PUWE 3RTWB 1HSEA 3O97A 3C33A 1ANFA 3S9EA 4OETA 1B46A 2VOZA 5BWJA 2ZNSA 3PPPA 3Q28A 2H99A 4U1ZA 4HCWA 1BKAA 1VR5A 4POWA 1US4A 3PMVA 1TWYA 4YMAA 3R26A 1OQHA 3I6VA 4F18A 2RC8A 5ISUA 2CZLA 2NOOA 3I5OA 1GVCA 3VVDA 3HHFA 2F34A 3H6VA 5H8FA 1A55A 4DCXA 1B3FA 2OWSA 4GQOA 1SW2A 3K00A 4YICA 3FVGA 4H8JA 3K6VA 3LSWA 2O1MA 4OFLA 2XXYA 2A5TA 1B1HA 3JZJA 4LUBA 3ZKKA 4I1DA 3DLNA 3OO6A 2ZYNA 4GL8A 2YPNA 2D3IA 3OELA 3KOSA 4YKKA 1UTBA 4F3BA 5DTBA 1URDA 4ZDMA 4NF8A 4H67A 3TYHA 3C9HA 3FUZA 2NVUB 2H25A 4ZECA 1OIBA 2ESNA 4NMYA 4KR5A 4GVOA 2IA4A 3TUSA 3RTFB 4G8HA 4RA1A 2XXVA 2GHBA 2V25A 3WAEA 3T66A 3S4UA 2I6EA 4YZZA 3TDJA 4RK9A 4M1VA 1SQYA 1Y3QA 3E9XA 4RPOA 3C4MA 4YAHX 4LP2B 1Y1ZA 1I6QA 1LAHE 4ZE8A 4C0RA 1CB6A 4ESXA 3UIFA 2AL4A 4O3BA 3CFXA 4KYEA 2Z8DA 3IORA 4GWOA 3S2VA 4LQ2A 4WEPA 2DVZA 5I58B 4HCYA 3IJXB 2V93A 2I58A 1IUDA 4I8CA 4IO6A 2QS3A 4H1XA 1B1XA 3EN3A 4GFRA 5DVFA 3RT6B 2DE4A 4ZEIA 4NF4B 4KQPA 2THIA 3PGFA 1LFHA 3G3JA 3CG1A 4U21A 3SEVA 5KCJA 1P1NA 4QFNA 4JWXA 1QULA 3PD9A 4ELQA 3BFUA 2F7AA 1US5A 1ELJA 4ONYA 5DYHA 2QMXA 2NWJA 1FQFA 4RNSA 5H8FB 1PEBA 1LB8A 1NKXA 3FV2A 4KPTA 4LZ5A 1A99A 1POTA 3TCGA 4R73A 3ZSFA 4G2ZA 2A5TB 3V8XB 3IAZA 4R6HA 5ITOA 4F22A 3OD7A 2DWJA 2H5YA 4JSOA 4F3PA 1SW1A 1OVBA 2RCBA 1B5IA 1B58A 3PV0E 1MQHA 4U4SA 2I0BA 4RK2A 3Q26A 1QKBA 4XXUA 1I6BA 1HSJA 5CM6A 1URGA 3O28A 1R9QA 4DZ1A 2XXIA 4EDPA 3HN0A 2GRVA 4DIGA 4G8MA 3W9VA 3S9MC 3EPEA 3MP8A 2XD2A 3C32A 4IY5A 2HEUA 1A7LA 1IQ7A 4N07A 4JB7A 4DDDA 2OCUA 1MPBA 3CVGA 3K1MA 4QFLA 1AH5A 3VLWA 3SEUA 3KN3A 1FTJA 2UVGA 4F2OA 2F78A 1LAGE 4KHZE 1IXIA 4OERA 3QYTA 4EQBA 4FATA 1P1WA 2XXRA 3TTLA 2XXPA 2E1SA 3K6UA 1D4NA 1YTVA 3KOTA 3TKDA 1DMBA 1ATGA 1A8FA 2HZKA 2H4IA 3DP8A 3DELB 1IXGA 3IOVA 2F36A 4EXLA 2DE2A 2Y7IA 2X26A 2G93A 4YB7A 5I57A 3IJOB 3OEKA 1ZIUA 3CSBA 4MLVA 4OFOA 4FE8A 4OYVA 1MXUA 2W7YA 5HPQA 3ILUB 4QHQA 3H6WA 1MDQA 2I0CA 2P0SA 5H8QA 3CR9A 3OO7A 5JK4A 3K4UA 1QW0A 1LCTA 3QK6A 4FECA 4OMBA 1UTHB 2F6PA 3JYRA 2DS9A 1MXWA 3RNNA 4OENA 3THIA 4QSDA 2DWHA 1GGGA 1O7TA 3HHGA 5I2KA 3TTNA 2DWAA 5AA3A 4E0WA 1SDXA 3TAJA 4UA8A 2HCAA 3G3HA 3JV9A 4OWDA 5F1QA 4XKPA 3Q27A 3DP6A 1B9JA 2DP8A 4L17A 2YLNA 4F19A 3HSTA 4YKPA 4OXVA 3USDA 3TELA 1YAEA 4M4GA 1LSTA 1H76A 4BDRA 1BIYA 3KZGA 3WAFA 4BDQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Q2A A;  1MXZ A;  4P0I A;  1J1N A;  3O6I A;  5FHN A;  1FCK A;  1OLA A;  5CMK A;  1MM7 A;  5CBR A;  1B7U A;  4Q8R A;  3K6W A;  1MY3 A;  4POX A;  5CMM A;  2VGQ A;  3KJT A;  4NWC A;  3MPK A;  4F31 B;  1FQC A;  1O64 A;  3V89 B;  1QUK A;  1NH8 A;  1MM6 A;  2QL3 A;  1EZ9 A;  1P1O A;  3O6H A;  1A8E A;  3SDF A;  4H0W A;  3D4C A;  3T96 B;  4FIM A;  3KFM A;  3ZS6 A;  1IXH A;  2ZYO A;  1PBP A;  1VFD A;  3U94 A;  4NF5 B;  2XX8 A;  2RKM A;  3TCH A;  3T9X B;  4H8I A;  2XXH A;  3C34 A;  3FVO A;  3OXN A;  1NNT A;  4HTG A;  1MH4 A;  3VLU A;  2DOJ A;  4QFP A;  5CMC A;  4KCC A;  1EZP A;  3K02 A;  1IZ1 A;  1O63 A;  2I3W A;  4F1Y A;  1LFG A;  4G4P A;  3FD3 A;  4F3S A;  1XVY A;  2Q88 A;  4NED A;  3FZV A;  3EF7 A;  2GHA A;  4QFK A;  3O6G A;  4RY1 A;  3RGY A;  1II5 A;  3G3F A;  2B3F A;  2H98 A;  3RPW A;  3FAT A;  3S9L C;  4EXK A;  3GLB A;  4H6D A;  3MW0 A;  5I56 A;  4ELO A;  4EF1 A;  1JEV A;  2PT1 A;  3C36 A;  5H8H A;  3QXM A;  1N7W A;  4BLA A;  2PX1 A;  2YJP A;  4RPN A;  4YKI A;  5CC2 A;  3K0V A;  3N6U A;  4OQO A;  4QRZ A;  1FTO A;  5CRY A;  2ONR A;  3E4R A;  4EF2 A;  4ECF A;  2B65 A;  3L6H A;  5L9O A;  3OO9 A;  2ANJ A;  3VVE A;  3BBR A;  1MS7 A;  1OMP A;  2OJT A;  3U1O A;  5KZT A;  3DP4 A;  2VD3 A;  2Y7W A;  4AQ4 A;  2O6A A;  2RCA A;  3FJG A;  2O7U A;  3MJN A;  2O7I A;  1XOC A;  1JW5 A;  4XIG Q;  4DXC A;  2ZYM A;  1Z7M E;  5CBS A;  4LZ8 A;  3KSJ A;  3TFL A;  4XKQ A;  4OEV A;  3TPA A;  3UP9 A;  4Q0C A;  5ICQ A;  2GFE A;  1JVY A;  3KSX A;  1EZO A;  1SI0 A;  1NNP A;  2PBW A;  1B3E A;  1B3H A;  1B51 A;  1B3G A;  1PB7 A;  3LSX A;  4X1B A;  4R2B A;  1N76 A;  4ESW A;  1SVX B;  1R6Z A;  3I3V A;  1QJM A;  4FAJ A;  1ZBM A;  1SD3 A;  1SBP A;  1Q1K A;  4GLI A;  2QJE A;  4OHN A;  1M5D A;  1ZKB A;  3H7M A;  2R71 A;  5M2V A;  5HM4 B;  1Y3N A;  1AOV A;  4KI0 E;  1LBC A;  3B6Q A;  1POY 1;  1IIT A;  1NNF A;  2PMS A;  3TZA A;  2HQ0 A;  1H44 A;  4Q30 B;  5AA4 A;  4X1D A;  1B7H A;  3IOU A;  4IGR A;  1UQW A;  3TQL A;  1UIU A;  3G3K A;  5F7V A;  2UYE A;  4THI A;  2UVI A;  1B4Z A;  4XKN A;  1NH7 A;  1USY H;  3MAM A;  2HFB A;  2XHD A;  1OVT A;  1TXF A;  4YB5 A;  1URS A;  5L9S A;  1Y3P A;  5I56 B;  1PB9 A;  1B40 A;  1B5J A;  2QSX A;  5H8H B;  3EQ1 A;  1AL3 A;  1MRP A;  2P2A A;  2H9B A;  3M3F A;  4ZEB A;  1LAF E;  5I59 A;  1GTK A;  1PB8 A;  3P7I A;  2F7C A;  4GXA A;  1SYH A;  1LCF A;  1HSL A;  1JET A;  4IO4 A;  4DE8 A;  3SER A;  3A3C A;  3MZ1 A;  1UTB B;  1USY E;  5EHM A;  3RN8 A;  2Q2C A;  2RIN A;  3T9H B;  4FOR A;  2P1S A;  1MPC A;  5L8D A;  4NF8 B;  2F7B A;  4H65 A;  1OQG A;  3FJ7 A;  2F5X A;  1TT1 A;  1LFI A;  1MQJ A;  4JXI A;  2I48 A;  4IY6 A;  2ONK E;  3H06 B;  5CMB A;  1UIV A;  3O9P A;  3T9U A;  3KGC A;  4I62 A;  2O68 A;  4NTL A;  2AYS A;  3E13 X;  4WXJ A;  1P1Q A;  2I3V A;  4OFJ A;  3G3I A;  3CG3 A;  5HBC A;  1BLF A;  5DEX A;  5ITP A;  3ODB A;  4MLQ A;  3ILT B;  4PFT A;  4BDL A;  4RYA A;  3MP6 A;  3IR1 A;  4R2F A;  3VVF A;  4FJP A;  1IXC A;  4KYS A;  3GZG A;  1Y1M A;  3U8Q A;  3PU5 A;  2REJ A;  3IX1 A;  1MY1 A;  2F97 A;  2Y84 A;  3RT8 A;  4ISU A;  1JW1 A;  1DTZ A;  2R9J A;  1Y4T A;  5AA2 A;  4ZEF A;  2CMO A;  5ICT A;  3M8U A;  4GD5 A;  1N04 A;  4R6Y A;  2V84 A;  4PFW A;  4F1U A;  4BDM A;  2OWT A;  3QUF A;  3MVZ A;  4H5F A;  4MBP A;  3H4Z A;  4AB6 A;  5AA4 B;  1NMU A;  2LAO A;  4NF6 A;  3QSL A;  2RF1 A;  4R6K A;  1P1U A;  3C31 A;  2Q89 A;  5KDT A;  4U22 A;  5KCJ B;  1MDP 1;  2XXX A;  3OSR A;  1XVX A;  3TTR A;  4YKJ A;  3ECR A;  4LAT A;  3TOD A;  5H8N A;  1AMF A;  4ZZA A;  4H5G A;  2VHA A;  2ZNU A;  4E0X A;  3GBB A;  4HW8 A;  3BKI B;  3PUY E;  4ELR A;  3MWB A;  2QPQ A;  2Z22 A;  3IB1 A;  3R7X A;  1B0L A;  5DVI A;  4U23 A;  3RUM A;  2QRY A;  3RY3 A;  2Z8E A;  2AIX A;  1N3X A;  1LLS A;  5ELV A;  2F35 A;  1PDA A;  1FQD A;  2QMW A;  1FQB A;  1ZTY A;  2ALU A;  4QSC A;  3IB0 A;  4ND9 A;  1DOT A;  1YPN A;  2V3U A;  4O3C A;  1N84 A;  3SKP A;  4U4X A;  4LVQ A;  1JW4 A;  4JBZ A;  5TU0 A;  3MZB A;  5TP9 A;  3N26 A;  2PVU A;  1QVS A;  2RC7 A;  3CFL A;  2KLF A;  4IO7 A;  4OZ9 A;  1TFA A;  3LUY A;  3PD8 A;  4X9T A;  5DT6 A;  2D21 A;  2XD3 A;  2Y7R A;  3MZ9 A;  1JVX A;  2Z23 A;  1M5E A;  2I4B A;  2DXR A;  1RKM A;  5EYF A;  3PUX E;  3KN8 A;  4Z0I A;  5K2X A;  4OVJ A;  2Y7K A;  3PPR A;  4KD5 A;  4IGT A;  1NL5 A;  1MY4 A;  4K3F A;  4N13 A;  3N6T A;  2HZL A;  1D9Y A;  4YMB A;  2XXT A;  4F39 A;  1JEU A;  2ZYK A;  3TMG A;  4PFU A;  1RYO A;  2Z8F A;  4DXU A;  3HV1 A;  3OEN A;  4IO3 A;  3QIM A;  3H6T A;  2FYI A;  1MG1 A;  2DQV A;  5J1D A;  4KCD A;  5I57 B;  3IK6 B;  1B5H A;  4FED A;  4HS7 A;  3VFJ A;  1BTJ A;  3MC2 A;  3HPI A;  2XX9 A;  4EUO A;  4YB6 A;  2QS1 A;  2UYF A;  4NF6 B;  4R9G A;  4TOZ A;  5KDT B;  1FW0 A;  1MQG A;  4G8N A;  4GXS B;  1B7Z A;  5H8Q B;  3MVY A;  1DPE A;  3UN6 A;  3UGW A;  1MQI A;  1M5F A;  1FTK A;  4GRK A;  4NF4 A;  5H8N B;  4F3G A;  1F9B A;  2QS2 A;  4GL0 A;  1B3L A;  3IL1 B;  3V5A A;  5I2K B;  4G68 C;  2X7P A;  4KFQ A;  2RC9 A;  2ZXT A;  1P99 A;  1PC3 A;  3N94 A;  1WOD A;  1ZJL A;  3BFT A;  4LZ7 A;  3MVW A;  1XHY A;  3T22 A;  4Z7E A;  3TEP A;  4U2R A;  5FTH A;  3M3L A;  3A09 A;  3PMX A;  3MP1 A;  1SW5 A;  3FGS A;  1ZLQ A;  4JSD A;  3L6G A;  3B7D A;  4QF9 A;  3FXQ A;  3K1N A;  4QSE A;  1DSN A;  5TP9 B;  4MFI A;  3SET A;  3VE1 B;  3G3G A;  5TPA A;  3PPO A;  3SEY A;  3ONM A;  2AL5 A;  2Q8J A;  5L9M A;  4XKR A;  1S50 A;  2XXU A;  2PT2 A;  1MXY A;  2HAU A;  2X7Q A;  4ZED A;  4QFO A;  2R6G E;  1I69 A;  1CE2 A;  1B05 A;  3W9W A;  4ELP A;  1I6A A;  1JQF A;  4R72 A;  3KG2 A;  4LQ5 A;  1EH3 A;  1B32 A;  4PET A;  1SW4 A;  1M5C A;  4DCY A;  4U1O A;  2B3B A;  3B6T A;  3IO6 A;  4MF3 A;  3TTK A;  2DWI A;  5I2N A;  4G68 A;  1B6H A;  2ZNT A;  1Z7N E;  4KYD A;  3SES A;  2Y7P A;  1QUI A;  2XXQ A;  4MH5 A;  2REG A;  3RQT A;  2VD2 A;  1H45 A;  1LB9 A;  3SEW A;  1XT8 A;  1N0T A;  4RXL A;  3E3K A;  3EHT A;  1IEJ A;  1M5B A;  3VLV A;  2XXW A;  3KN7 A;  1FQA A;  2HAV A;  2O1L A;  4ZEK A;  2OZZ A;  3CI8 A;  3H6U A;  5IKB A;  1S7Y A;  5AE4 A;  2HXW A;  1A54 A;  1N7X A;  3IB2 A;  1Q35 A;  4R74 A;  1MY0 A;  1XC1 A;  3GBA A;  1MH3 A;  2PYY A;  5FHO A;  2DYX A;  3PPQ A;  2DVC A;  1D9V A;  4RJZ A;  3UK4 A;  4P11 A;  3N5L A;  1DPP A;  2UVJ A;  1ZMG A;  3LBS A;  2QS4 A;  3G7W A;  2I4C A;  1MQD A;  1EU8 A;  2GH9 A;  1H43 A;  3EHU A;  3QAX A;  3D4G A;  3VDF A;  1UTH A;  2NXO A;  2A5S A;  5B70 A;  3TCF A;  2O84 X;  4BDN A;  1QKA A;  3C35 A;  1MXX A;  3CSG A;  1JNF A;  3O2A A;  4WKM A;  3CFZ A;  3W15 C;  5A5X A;  3KEI A;  5AA2 D;  1MY2 A;  4N6P A;  4OES A;  5JTY A;  3U92 A;  4PP0 A;  1B4H A;  1ZU0 A;  3PMW A;  2V3T A;  1B2H A;  4ZE9 A;  4IO2 A;  3VXB A;  3HO7 A;  4X48 A;  3FIR A;  3TQW A;  2E0S A;  1XS5 A;  4BDO A;  3IOT A;  5TPA B;  3FJM A;  1S9T A;  1A40 A;  4XTC Q;  3FXU A;  4IO5 A;  4TLM B;  2O51 A;  5H8S A;  1YCJ A;  3K2D A;  3T9V A;  1AIV A;  1GR2 A;  3EHS A;  3QUJ A;  4F29 A;  2FA7 A;  4UAC A;  4WED A;  2OK2 A;  1MPD A;  3B6W A;  1FTM A;  5FHM A;  2BJJ X;  3Q25 A;  2I49 A;  2O69 A;  3ZKL A;  1VE4 A;  4DLD A;  1VSO A;  2DXY A;  4C1T A;  5I2N B;  3KJ7 A;  4G68 B;  3FVN A;  1LBB A;  4EQ9 A;  3CRB A;  4PE5 B;  1VFE A;  5IAI A;  3OOA A;  2ABH A;  3F11 A;  4NF5 A;  3PUZ E;  2F8D A;  1Y9U A;  4GF8 A;  2G29 A;  4O3A A;  2FNC A;  1R1N A;  4JWY A;  4PFY A;  3OO8 A;  3UOR A;  3UA8 A;  3K1P A;  2VP1 A;  4DXB A;  3T93 B;  4LA9 A;  4FEB A;  4PQJ A;  3O29 A;  1BP5 A;  1Y20 A;  3MUQ A;  4OTE A;  3H3G A;  1KWH A;  3LSL A;  3SEX A;  4OEU A;  4TLL B;  2Q9T A;  3MQ9 A;  1Y4C A;  1OLC A;  4F2Q A;  1NFT A;  3LR1 A;  2UVH A;  4ZZE A;  3V83 A;  1DTG A;  4JDF A;  5AA1 A;  2F6G A;  4AB5 A;  5I59 B;  5FTI A;  2ONS A;  3IOW A;  2OBG A;  2WKY A;  1GV8 A;  3LC8 A;  4F1V A;  4YU0 A;  3VXC A;  1WVJ A;  3M3K A;  3HCQ A;  1MXV A;  5I84 A;  5A5X B;  3IO4 A;  4G77 A;  2DSF A;  4NWD A;  1QUJ A;  5JTY B;  4R75 A;  3U72 A;  1TFD A;  1N3W A;  1FQE A;  4C1U A;  2XX7 A;  1SYI A;  4LON B;  4GIZ A;  3VV5 A;  4TQU Q;  4Q5T A;  3OEM A;  3PPN A;  4JWO A;  4I9D A;  1NNK A;  4P0G A;  5CI5 A;  1L5T A;  5LOM A;  3FAS A;  5JEI A;  3Q29 A;  1T0K A;  3K01 A;  3S9N C;  1H3D A;  3PUV E;  1PBQ A;  2M8C A;  1LAX A;  1R9L A;  5DEX B;  1IIW A;  3FV1 A;  3KBR A;  1LGB C;  3MPL A;  3OMB A;  3AXF A;  1RYX A;  1FTL A;  5DVJ A;  4GOT A;  4NE4 A;  2UXA A;  3R6U A;  3TTM A;  4EQ7 A;  4IB2 A;  3U93 A;  3O66 A;  5EHS A;  4ZS9 A;  3CIJ A;  5AA2 B;  1D3K A;  3A3U A;  5BUU A;  4R9F A;  3H03 A;  2NUV A;  2IEE A;  2D5W A;  3DM0 A;  2DE3 A;  2V3Q A;  1B52 A;  3LSF B;  3RLF E;  1B0H A;  3K6X A;  1WDN A;  5K2Y A;  5B7D A;  1SI1 A;  3OSQ A;  2OLB A;  3GXA A;  2ZMB A;  3MBP A;  5I58 A;  3MVX A;  3FVK A;  3FXR A;  3PUW E;  3RTW B;  1HSE A;  3O97 A;  3C33 A;  1ANF A;  3S9E A;  4OET A;  1B46 A;  2VOZ A;  5BWJ A;  2ZNS A;  3PPP A;  3Q28 A;  2H99 A;  4U1Z A;  4HCW A;  1BKA A;  1VR5 A;  4POW A;  1US4 A;  3PMV A;  1TWY A;  4YMA A;  3R26 A;  1OQH A;  3I6V A;  4F18 A;  2RC8 A;  5ISU A;  2CZL A;  2NOO A;  3I5O A;  1GVC A;  3VVD A;  3HHF A;  2F34 A;  3H6V A;  5H8F A;  1A55 A;  4DCX A;  1B3F A;  2OWS A;  4GQO A;  1SW2 A;  3K00 A;  4YIC A;  3FVG A;  4H8J A;  3K6V A;  3LSW A;  2O1M A;  4OFL A;  2XXY A;  2A5T A;  1B1H A;  3JZJ A;  4LUB A;  3ZKK A;  4I1D A;  3DLN A;  3OO6 A;  2ZYN A;  4GL8 A;  2YPN A;  2D3I A;  3OEL A;  3KOS A;  4YKK A;  1UTB A;  4F3B A;  5DTB A;  1URD A;  4ZDM A;  4NF8 A;  4H67 A;  3TYH A;  3C9H A;  3FUZ A;  2NVU B;  2H25 A;  4ZEC A;  1OIB A;  2ESN A;  4NMY A;  4KR5 A;  4GVO A;  2IA4 A;  3TUS A;  3RTF B;  4G8H A;  4RA1 A;  2XXV A;  2GHB A;  2V25 A;  3WAE A;  3T66 A;  3S4U A;  2I6E A;  4YZZ A;  3TDJ A;  4RK9 A;  4M1V A;  1SQY A;  1Y3Q A;  3E9X A;  4RPO A;  3C4M A;  4YAH X;  4LP2 B;  1Y1Z A;  1I6Q A;  1LAH E;  4ZE8 A;  4C0R A;  1CB6 A;  4ESX A;  3UIF A;  2AL4 A;  4O3B A;  3CFX A;  4KYE A;  2Z8D A;  3IOR A;  4GWO A;  3S2V A;  4LQ2 A;  4WEP A;  2DVZ A;  5I58 B;  4HCY A;  3IJX B;  2V93 A;  2I58 A;  1IUD A;  4I8C A;  4IO6 A;  2QS3 A;  4H1X A;  1B1X A;  3EN3 A;  4GFR A;  5DVF A;  3RT6 B;  2DE4 A;  4ZEI A;  4NF4 B;  4KQP A;  2THI A;  3PGF A;  1LFH A;  3G3J A;  3CG1 A;  4U21 A;  3SEV A;  5KCJ A;  1P1N A;  4QFN A;  4JWX A;  1QUL A;  3PD9 A;  4ELQ A;  3BFU A;  2F7A A;  1US5 A;  1ELJ A;  4ONY A;  5DYH A;  2QMX A;  2NWJ A;  1FQF A;  4RNS A;  5H8F B;  1PEB A;  1LB8 A;  1NKX A;  3FV2 A;  4KPT A;  4LZ5 A;  1A99 A;  1POT A;  3TCG A;  4R73 A;  3ZSF A;  4G2Z A;  2A5T B;  3V8X B;  3IAZ A;  4R6H A;  5ITO A;  4F22 A;  3OD7 A;  2DWJ A;  2H5Y A;  4JSO A;  4F3P A;  1SW1 A;  1OVB A;  2RCB A;  1B5I A;  1B58 A;  3PV0 E;  1MQH A;  4U4S A;  2I0B A;  4RK2 A;  3Q26 A;  1QKB A;  4XXU A;  1I6B A;  1HSJ A;  5CM6 A;  1URG A;  3O28 A;  1R9Q A;  4DZ1 A;  2XXI A;  4EDP A;  3HN0 A;  2GRV A;  4DIG A;  4G8M A;  3W9V A;  3S9M C;  3EPE A;  3MP8 A;  2XD2 A;  3C32 A;  4IY5 A;  2HEU A;  1A7L A;  1IQ7 A;  4N07 A;  4JB7 A;  4DDD A;  2OCU A;  1MPB A;  3CVG A;  3K1M A;  4QFL A;  1AH5 A;  3VLW A;  3SEU A;  3KN3 A;  1FTJ A;  2UVG A;  4F2O A;  2F78 A;  1LAG E;  4KHZ E;  1IXI A;  4OER A;  3QYT A;  4EQB A;  4FAT A;  1P1W A;  2XXR A;  3TTL A;  2XXP A;  2E1S A;  3K6U A;  1D4N A;  1YTV A;  3KOT A;  3TKD A;  1DMB A;  1ATG A;  1A8F A;  2HZK A;  2H4I A;  3DP8 A;  3DEL B;  1IXG A;  3IOV A;  2F36 A;  4EXL A;  2DE2 A;  2Y7I A;  2X26 A;  2G93 A;  4YB7 A;  5I57 A;  3IJO B;  3OEK A;  1ZIU A;  3CSB A;  4MLV A;  4OFO A;  4FE8 A;  4OYV A;  1MXU A;  2W7Y A;  5HPQ A;  3ILU B;  4QHQ A;  3H6W A;  1MDQ A;  2I0C A;  2P0S A;  5H8Q A;  3CR9 A;  3OO7 A;  5JK4 A;  3K4U A;  1QW0 A;  1LCT A;  3QK6 A;  4FEC A;  4OMB A;  1UTH B;  2F6P A;  3JYR A;  2DS9 A;  1MXW A;  3RNN A;  4OEN A;  3THI A;  4QSD A;  2DWH A;  1GGG A;  1O7T A;  3HHG A;  5I2K A;  3TTN A;  2DWA A;  5AA3 A;  4E0W A;  1SDX A;  3TAJ A;  4UA8 A;  2HCA A;  3G3H A;  3JV9 A;  4OWD A;  5F1Q A;  4XKP A;  3Q27 A;  3DP6 A;  1B9J A;  2DP8 A;  4L17 A;  2YLN A;  4F19 A;  3HST A;  4YKP A;  4OXV A;  3USD A;  3TEL A;  1YAE A;  4M4G A;  1LST A;  1H76 A;  4BDR A;  1BIY A;  3KZG A;  3WAF A;  4BDQ A; 
#chains in the Genus database with same CATH topology
 2Q2A A;  1MXZ A;  4P0I A;  1J1N A;  3O6I A;  5FHN A;  1FCK A;  1OLA A;  5CMK A;  1MM7 A;  5CBR A;  1B7U A;  2V4C A;  4Q8R A;  3K6W A;  1MY3 A;  4POX A;  5CMM A;  2VGQ A;  3KJT A;  4NWC A;  5ET5 A;  4PFB A;  4OVQ A;  3MPK A;  4F31 B;  1IMB A;  1FQC A;  4XEQ A;  1O64 A;  3V89 B;  1QUK A;  2CEX A;  4MEV A;  1NH8 A;  5IZ1 A;  1MM6 A;  2QL3 A;  2CEY A;  1FPI A;  1EZ9 A;  5I5P A;  1FPD A;  4MJO A;  1P1O A;  3O6H A;  1A8E A;  3SDF A;  4H0W A;  3D4C A;  3T96 B;  4FIM A;  3KFM A;  3ZS6 A;  1IXH A;  2ZYO A;  1PBP A;  1VFD A;  2VT5 A;  3U94 A;  4NF5 B;  2XX8 A;  2RKM A;  3TCH A;  3T9X B;  4O8M A;  4H8I A;  2XXH A;  2FIX A;  3C34 A;  3FVO A;  3OXN A;  1NNT A;  4HTG A;  1YZ0 A;  1MH4 A;  3VLU A;  2DOJ A;  4QFP A;  5IGA A;  5CMC A;  4KCC A;  1AWB A;  1EZP A;  3K02 A;  1IZ1 A;  3U65 A;  1O63 A;  2I3W A;  4F1Y A;  2XXK A;  1LFG A;  2JJK A;  4G4P A;  3FD3 A;  4F3S A;  1XVY A;  2Q88 A;  4NED A;  1FTA A;  3FZV A;  3EF7 A;  2GHA A;  2ZZW A;  4QFK A;  1NV3 A;  3O6G A;  4RY1 A;  3RGY A;  1II5 A;  3G3F A;  2B3F A;  4MX6 A;  3IFA A;  2H98 A;  3RPW A;  3FAT A;  3S9L C;  3CHG A;  4EXK A;  3GLB A;  4H6D A;  3MW0 A;  5I56 A;  4ELO A;  4EF1 A;  1JEV A;  2PT1 A;  3C36 A;  5H8H A;  3QXM A;  1N7W A;  4BLA A;  2PX1 A;  2YJP A;  4RPN A;  4YKI A;  3B50 A;  5CC2 A;  3K0V A;  3N6U A;  4OQO A;  4QRZ A;  1K9Z A;  1FTO A;  5CRY A;  2ONR A;  2ZZX A;  3E4R A;  4EF2 A;  4ECF A;  2B65 A;  3L6H A;  5L9O A;  3OO9 A;  3RPL B;  2ANJ A;  3VVE A;  3BBR A;  1MS7 A;  1OMP A;  2B4M A;  2OJT A;  3U1O A;  5KZT A;  3DP4 A;  2VD3 A;  2Y7W A;  5ESY A;  4AQ4 A;  2O6A A;  2RCA A;  3FJG A;  2O7U A;  3MJN A;  2O7I A;  4NX1 A;  1XOC A;  4NQ8 A;  1JW5 A;  4XIG Q;  4DXC A;  2ZYM A;  1Z7M E;  1EYK A;  5CBS A;  4LZ8 A;  3KSJ A;  3TFL A;  4UAB A;  4XKQ A;  4OEV A;  3TPA A;  3UP9 A;  4N15 A;  4Q0C A;  1FPJ A;  4X8R A;  5ICQ A;  2GFE A;  1JVY A;  4N17 A;  1NV6 A;  3KSX A;  1EZO A;  1SI0 A;  1NNP A;  2PBW A;  1B3E A;  4OVS A;  1B3H A;  1B51 A;  1B3G A;  1PB7 A;  3LSX A;  4X1B A;  4R2B A;  1N76 A;  5EQ9 A;  4ESW A;  1SVX B;  2CZI A;  1R6Z A;  3I3V A;  1QJM A;  4PAI A;  4FAJ A;  1ZBM A;  1SD3 A;  1SBP A;  1Q1K A;  4GLI A;  2QJE A;  4OHN A;  1M5D A;  1ZKB A;  3H7M A;  4N8Y A;  2R71 A;  1FJ6 A;  5M2V A;  5HM4 B;  1Y3N A;  4N81 A;  2GQ1 A;  4I3Y A;  4MHF A;  1AOV A;  4KI0 E;  4PCD A;  1LBC A;  2XWO A;  3B6Q A;  1POY 1;  1IIT A;  1NNF A;  2PMS A;  3TZA A;  2HQ0 A;  3EKI A;  4HE0 A;  1H44 A;  5IZZ A;  4Q30 B;  1IMD A;  5AA4 A;  4X1D A;  1B7H A;  3IOU A;  4IGR A;  1UQW A;  3TQL A;  1UIU A;  3G3K A;  5F7V A;  1FPE A;  2UYE A;  4THI A;  2UVI A;  1B4Z A;  4XKN A;  1NH7 A;  1USY H;  3MAM A;  2XA5 A;  2HFB A;  4XFE A;  2XHD A;  1OVT A;  1TXF A;  4YB5 A;  1URS A;  5L9S A;  4FBP A;  1Y3P A;  5I56 B;  1PB9 A;  1B40 A;  1B5J A;  2QSX A;  5H8H B;  1NUW A;  4OAN A;  1NV1 A;  3EQ1 A;  1AL3 A;  1MRP A;  2P2A A;  2H9B A;  3M3F A;  4OVR A;  4ZEB A;  1LAF E;  5I59 A;  1GTK A;  1PB8 A;  3P7I A;  2F7C A;  4GXA A;  1SYH A;  1LCF A;  4I40 A;  1HSL A;  1JET A;  4DI3 D;  4IO4 A;  4DE8 A;  3SER A;  3A3C A;  4O7M A;  4AS5 A;  3MZ1 A;  1UTB B;  1USY E;  5EHM A;  1YXI A;  3RN8 A;  2WEF A;  2Q2C A;  2RIN A;  3T9H B;  4FOR A;  1D9Q A;  2P1S A;  1MPC A;  5L8D A;  4PGN A;  4NF8 B;  2F7B A;  4H65 A;  1OQG A;  3FJ7 A;  2WBD A;  2F5X A;  1TT1 A;  1LFI A;  1MQJ A;  4JXI A;  2I48 A;  4GWW A;  4IY6 A;  1NV2 A;  2ONK E;  3H06 B;  5CMB A;  1UIV A;  3O9P A;  3T9U A;  3A29 A;  3KGC A;  4I62 A;  2O68 A;  4NTL A;  3LUZ A;  2AYS A;  4GX3 A;  3E13 X;  4WXJ A;  1P1Q A;  2I3V A;  4OFJ A;  3G3I A;  3CG3 A;  5HBC A;  1BLF A;  5DEX A;  1FBG A;  5ITP A;  3ODB A;  4MLQ A;  3ILT B;  4PFT A;  4LN5 A;  4BDL A;  4RYA A;  3MP6 A;  3IR1 A;  4R2F A;  3VVF A;  4FJP A;  1IXC A;  4KYS A;  3GZG A;  1Y1M A;  5IZ3 A;  4OA4 A;  3U8Q A;  3PU5 A;  2REJ A;  3IX1 A;  1MY1 A;  2F97 A;  2Y84 A;  3RT8 A;  4GWZ A;  2WX9 A;  5EQ8 A;  4ISU A;  1JW1 A;  1DTZ A;  1FPK A;  4O7I A;  2R9J A;  1Y4T A;  2QFL A;  5AA2 A;  4ZEF A;  2CMO A;  5ICT A;  3M8U A;  4GD5 A;  1N04 A;  4R6Y A;  2V84 A;  1RDZ A;  4PFW A;  4F1U A;  4BDM A;  2OWT A;  3QUF A;  3MVZ A;  4H5F A;  4MBP A;  3H4Z A;  3BIH A;  4AB6 A;  5AA4 B;  1NMU A;  3PTY A;  2LAO A;  4NF6 A;  2KQZ A;  3QSL A;  4MNI A;  2RF1 A;  1FBC A;  4R6K A;  1P1U A;  3C31 A;  2Q89 A;  1G0H A;  5KDT A;  4U22 A;  5KCJ B;  2XWK A;  1MDP 1;  2XXX A;  3OSR A;  1XVX A;  3TTR A;  4DI4 B;  4YKJ A;  3ECR A;  2ZZV A;  4LAT A;  3TOD A;  2HPG A;  1FBP A;  5H8N A;  4N6K A;  1AMF A;  2QVR A;  4ZZA A;  4H5G A;  2VHA A;  2ZNU A;  4P9K A;  4PAF A;  5EYG A;  4E0X A;  3GBB A;  2VPN A;  4HW8 A;  3BKI B;  3PUY E;  4ELR A;  3MWB A;  2QPQ A;  2Z22 A;  3IB1 A;  3R7X A;  1B0L A;  5DVI A;  4U23 A;  3RUM A;  1EYI A;  2QRY A;  3RY3 A;  2Z8E A;  2AIX A;  1N3X A;  1LLS A;  5ELV A;  2F35 A;  1PDA A;  1FQD A;  2QMW A;  1FBH A;  1FQB A;  1ZTY A;  2ALU A;  4QSC A;  3IB0 A;  4ND9 A;  1DOT A;  1YPN A;  5EQA A;  2V3U A;  4O3C A;  1N84 A;  3SKP A;  4U4X A;  4LVQ A;  1JW4 A;  4JBZ A;  2KR0 A;  1KZ8 A;  5TU0 A;  4GBV A;  3MZB A;  5TP9 A;  3N26 A;  2PVU A;  4IR8 A;  1QVS A;  2RC7 A;  3CFL A;  2KLF A;  4P47 A;  4IO7 A;  4OZ9 A;  3FXB A;  1TFA A;  3LUY A;  3PD8 A;  4X9T A;  5DT6 A;  2D21 A;  4QXD A;  2XD3 A;  2Y7R A;  3MZ9 A;  1JVX A;  1K9Y A;  2Z23 A;  1M5E A;  3ROJ A;  2I4B A;  2DXR A;  1RKM A;  5EYF A;  3PUX E;  4GWX A;  3KN8 A;  5IZ3 B;  4N8G A;  4HXV A;  4Z0I A;  5EYH A;  5K2X A;  4OVJ A;  2Y7K A;  3PPR A;  1NI9 A;  4KD5 A;  4IGT A;  1NL5 A;  1MY4 A;  4K3F A;  4N13 A;  3N6T A;  2HZL A;  1D9Y A;  4YMB A;  2XXT A;  4F39 A;  2XWI A;  1JEU A;  2ZYK A;  3TMG A;  4PFU A;  1RYO A;  2Z8F A;  4DXU A;  3HV1 A;  2P3V A;  3OEN A;  4IO3 A;  3QIM A;  3H6T A;  1FBE A;  2FYI A;  1MG1 A;  2DQV A;  1Q9D A;  5J1D A;  4KCD A;  5I57 B;  3IK6 B;  1B5H A;  4FED A;  4HS7 A;  3VFJ A;  4MCO A;  1BTJ A;  3LV0 A;  3HPI A;  2XX9 A;  3MC2 A;  4EUO A;  4YB6 A;  2B4L A;  4O94 A;  2QS1 A;  2UYF A;  4H45 A;  4NF6 B;  4R9G A;  4TOZ A;  5A5L A;  5KDT B;  1FW0 A;  1MQG A;  3HFU A;  4G8N A;  4GXS B;  1B7Z A;  1FPF A;  5H8Q B;  3MVY A;  1DPE A;  2FBP A;  3UN6 A;  5FBP A;  3UGW A;  1MQI A;  1M5F A;  1FTK A;  4GRK A;  4NF4 A;  5H8N B;  4OVT A;  4F3G A;  1F9B A;  2QS2 A;  4GL0 A;  1B3L A;  4X04 A;  1LBX A;  3IL1 B;  2Y5K A;  3V5A A;  1RDY A;  5I2K B;  4G68 C;  2X7P A;  4KFQ A;  2RC9 A;  2ZXT A;  4HE2 A;  1P99 A;  3T1B A;  1EYJ A;  1PC3 A;  3NOH A;  3N94 A;  1WOD A;  2Q8M A;  1ZJL A;  5ET6 A;  1NUX A;  3BFT A;  4LZ7 A;  3MVW A;  1XHY A;  3T22 A;  4Z7E A;  3TEP A;  4U2R A;  5FTH A;  3M3L A;  3A09 A;  4N6D A;  3PMX A;  3MP1 A;  1SW5 A;  3FGS A;  1ZLQ A;  4JSD A;  3L6G A;  3B7D A;  4QF9 A;  3FXQ A;  3K1N A;  4N91 A;  4QSE A;  1LBW A;  1DSN A;  5TP9 B;  4MFI A;  3SET A;  3VE1 B;  3G3G A;  5TPA A;  3PPO A;  3SEY A;  3ONM A;  4MMP A;  2AL5 A;  2Q8J A;  5L9M A;  4H46 A;  4XKR A;  1S50 A;  2XXU A;  2PT2 A;  1MXY A;  2HAU A;  2X7Q A;  4ZED A;  1IME A;  4QFO A;  2R6G E;  2PCR A;  1I69 A;  1CE2 A;  1IMF A;  1B05 A;  4JVD A;  3W9W A;  3FBP A;  4ELP A;  1BK4 A;  1I6A A;  1JQF A;  4JVC A;  4R72 A;  2Y5L A;  3SZP A;  3KG2 A;  4LQ5 A;  1EH3 A;  1B32 A;  4PET A;  1SW4 A;  1M5C A;  4DCY A;  4U1O A;  2B3B A;  3B6T A;  3IO6 A;  4MF3 A;  3TTK A;  2DWI A;  4NHB A;  5I2N A;  4G68 A;  1B6H A;  2ZNT A;  1Z7N E;  4KYD A;  3SES A;  2Y7P A;  1QUI A;  2XXQ A;  4MH5 A;  2REG A;  5F24 A;  3RQT A;  2VD2 A;  1NV0 A;  4OVP A;  1H45 A;  1LB9 A;  1DBZ A;  3SEW A;  1XT8 A;  2Q74 A;  1IMA A;  1N0T A;  4RXL A;  3E3K A;  3EHT A;  1G0I A;  1IEJ A;  1M5B A;  5EQ7 A;  3VLV A;  2XXW A;  3KN7 A;  1FQA A;  2HAV A;  2O1L A;  4ZEK A;  2OZZ A;  3CI8 A;  4P3L A;  1FPB A;  3H6U A;  5IKB A;  1S7Y A;  5AE4 A;  1FBD A;  2HXW A;  1A54 A;  1N7X A;  3IB2 A;  1Q35 A;  4G61 A;  4R74 A;  1MY0 A;  1XC1 A;  3GBA A;  1MH3 A;  3B8B A;  2MKZ A;  1DCU A;  1DK4 A;  2PYY A;  5FHO A;  2DYX A;  3PPQ A;  2DVC A;  1D9V A;  4RJZ A;  3UK4 A;  4P11 A;  3N5L A;  1DPP A;  2UVJ A;  1ZMG A;  3LBS A;  2QS4 A;  3G7W A;  2I4C A;  3KC0 A;  1CNQ A;  1MQD A;  1EU8 A;  2GH9 A;  1H43 A;  3EHU A;  3QAX A;  3D4G A;  3VDF A;  1UTH A;  2NXO A;  2A5S A;  5B70 A;  3TCF A;  3RYD A;  2O84 X;  4BDN A;  1QKA A;  3C35 A;  1MXX A;  3CSG A;  2WYP A;  1JNF A;  3O2A A;  4WKM A;  3CFZ A;  3W15 C;  5A5X A;  3KEI A;  5AA2 D;  1MY2 A;  3GYY A;  4N6P A;  4OES A;  1LEV A;  2QVU A;  5JTY A;  3U92 A;  4PP0 A;  1B4H A;  1ZU0 A;  3KC1 A;  2F3B A;  3PMW A;  2V3T A;  1B2H A;  4ZE9 A;  4IO2 A;  3VXB A;  3HO7 A;  4X48 A;  1NV4 A;  3FIR A;  3TQW A;  2E0S A;  1XS5 A;  4BDO A;  5ET7 A;  4GWY A;  2OWZ A;  3IOT A;  5TPA B;  3FJM A;  1S9T A;  1A40 A;  4XTC Q;  3FXU A;  4IO5 A;  4TLM B;  2O51 A;  5H8S A;  1YCJ A;  3K2D A;  3T9V A;  1AIV A;  1GR2 A;  3EHS A;  3QUJ A;  4F29 A;  2FA7 A;  4UAC A;  4WED A;  2OK2 A;  1MPD A;  3B6W A;  1FTM A;  5FHM A;  2BJJ X;  3Q25 A;  2I49 A;  2O69 A;  3ZKL A;  1VE4 A;  4DLD A;  1VSO A;  2DXY A;  4C1T A;  1FRP A;  5I2N B;  3KJ7 A;  4G68 B;  3FVN A;  1LBB A;  2HXR A;  4EQ9 A;  3E78 A;  3CRB A;  4PE5 B;  1VFE A;  5IAI A;  3OOA A;  2ABH A;  3F11 A;  4NF5 A;  3MST A;  3PUZ E;  2F8D A;  1Y9U A;  4GF8 A;  2G29 A;  4O3A A;  2FNC A;  1R1N A;  1KA0 A;  4JWY A;  4PFY A;  3OO8 A;  1NUY A;  3UOR A;  4PF8 A;  3UA8 A;  3K1P A;  2VP1 A;  4DXB A;  3T93 B;  4LA9 A;  4FEB A;  4PQJ A;  3O29 A;  1BP5 A;  1Y20 A;  3MUQ A;  4MIJ A;  4OTE A;  3H3G A;  1KWH A;  3LSL A;  4N4U A;  3SEX A;  3D1R A;  4OEU A;  4TLL B;  2Q9T A;  3MQ9 A;  4PC9 A;  1Y4C A;  1OLC A;  4F2Q A;  1NFT A;  3BIG A;  3LR1 A;  2UVH A;  4ZZE A;  3V83 A;  1DTG A;  4JDF A;  5AA1 A;  2F6G A;  4AB5 A;  5I59 B;  5FTI A;  2ONS A;  3IOW A;  4HE1 A;  2XWV A;  2OBG A;  2WKY A;  1GV8 A;  3LC8 A;  4F1V A;  2QVV A;  4YU0 A;  3VXC A;  1WVJ A;  3M3K A;  3HCQ A;  1MXV A;  5I84 A;  5A5X B;  3IO4 A;  4G77 A;  2DSF A;  4NWD A;  1QUJ A;  5JTY B;  4R75 A;  3U72 A;  1TFD A;  1N3W A;  1FQE A;  4C1U A;  2XX7 A;  3RPL A;  1SYI A;  4LON B;  4PDD A;  4GIZ A;  3VV5 A;  4TQU Q;  4Q5T A;  3OEM A;  3PPN A;  4JWO A;  4I9D A;  1NNK A;  1INP A;  4P0G A;  5CI5 A;  1L5T A;  5LOM A;  3FAS A;  5JEI A;  3Q29 A;  4NGU A;  1T0K A;  3K01 A;  3S9N C;  1H3D A;  3PUV E;  1PBQ A;  2M8C A;  1JP4 A;  4PFI A;  1LAX A;  1R9L A;  5DEX B;  1IIW A;  3FV1 A;  3KBR A;  1LGB C;  3MPL A;  2R8T A;  3OMB A;  3AXF A;  4MNP A;  4MAG A;  4QBA A;  1RYX A;  1FTL A;  2FHY A;  5DVJ A;  4GOT A;  4NE4 A;  2UXA A;  3R6U A;  3TTM A;  4MNC A;  4EQ7 A;  4IB2 A;  3U93 A;  2L5V A;  3O66 A;  5EHS A;  4ZS9 A;  3CIJ A;  5AA2 B;  1D3K A;  3A3U A;  5BUU A;  4R9F A;  3H03 A;  2NUV A;  2IEE A;  2D5W A;  3DM0 A;  2DE3 A;  2V3Q A;  1B52 A;  3LSF B;  3RLF E;  1B0H A;  1LBY A;  3K6X A;  4I3E A;  4P56 A;  1WDN A;  5K2Y A;  5B7D A;  4GWS A;  1SI1 A;  3OSQ A;  2OLB A;  3GXA A;  2ZMB A;  3MBP A;  5I58 A;  3MVX A;  3FVK A;  3FXR A;  3PUW E;  4P1L A;  4NF0 A;  3RTW B;  1HSE A;  3O97 A;  3C33 A;  1ANF A;  3S9E A;  4OET A;  4PAK A;  4PBH A;  1B46 A;  2VOZ A;  5BWJ A;  2ZNS A;  3PPP A;  3Q28 A;  2H99 A;  4U1Z A;  4HCW A;  1BKA A;  1VR5 A;  4POW A;  1US4 A;  4PTK A;  3PMV A;  3ISP A;  1TWY A;  4YMA A;  3R26 A;  1OQH A;  3I6V A;  4P1E A;  4F18 A;  2RC8 A;  5ISU A;  2CZL A;  2NOO A;  3I5O A;  1GVC A;  3VVD A;  3HHF A;  2PFY A;  1VDW A;  2F34 A;  3H6V A;  5H8F A;  1A55 A;  4DCX A;  1B3F A;  2OWS A;  4GQO A;  1SW2 A;  3K00 A;  2P3N A;  4YIC A;  3FVG A;  4H8J A;  4NG7 A;  3K6V A;  3LSW A;  2O1M A;  4OFL A;  2XXY A;  2A5T A;  1B1H A;  3JZJ A;  4LUB A;  3ZKK A;  5I7I A;  1KA1 A;  4I1D A;  3DLN A;  1FSA A;  3OO6 A;  2ZYN A;  4GL8 A;  2YPN A;  2D3I A;  3OEL A;  1YYZ A;  3KOS A;  4YKK A;  1UTB A;  1RDX A;  4F3B A;  5DTB A;  1URD A;  3KBZ A;  4ZDM A;  4NF8 A;  4H67 A;  3TYH A;  3C9H A;  3FUZ A;  2NVU B;  2H25 A;  4ZEC A;  2FIE A;  1OIB A;  2ESN A;  4NMY A;  4KR5 A;  4GVO A;  3IFC A;  2IA4 A;  3TUS A;  3RTF B;  4G8H A;  4RA1 A;  2XXV A;  2GHB A;  2V25 A;  3WAE A;  2PFZ A;  1QGX A;  1NV5 A;  3T66 A;  3S4U A;  2I6E A;  4YZZ A;  3TDJ A;  4RK9 A;  4M1V A;  1XI6 A;  1SQY A;  1Y3Q A;  3E9X A;  4RPO A;  4PFR A;  3C4M A;  4YAH X;  4LP2 B;  1Y1Z A;  1I6Q A;  1LAH E;  3T0J A;  4ZE8 A;  5LDZ A;  4C0R A;  1CB6 A;  4ESX A;  3UIF A;  2AL4 A;  2BJI A;  4O3B A;  3CFX A;  4KYE A;  2Z8D A;  3IOR A;  4GWO A;  3S2V A;  4LQ2 A;  4WEP A;  2DVZ A;  4GWU A;  5I58 B;  2FVZ A;  4HCY A;  3IJX B;  5ET8 A;  1FPG A;  2V93 A;  2I58 A;  3QMF A;  1IUD A;  4I8C A;  4IO6 A;  2QS3 A;  4H1X A;  1B1X A;  1IMC A;  3EN3 A;  4GFR A;  1LBV A;  5DVF A;  3RT6 B;  2DE4 A;  2HHM A;  4ZEI A;  4NF4 B;  4KQP A;  2THI A;  3PGF A;  1LFH A;  3G3J A;  3CG1 A;  4U21 A;  3SEV A;  5KCJ A;  1P1N A;  4QFN A;  4JWX A;  1QUL A;  3PD9 A;  4ELQ A;  3BFU A;  2F7A A;  1US5 A;  1LBZ A;  1ELJ A;  4ONY A;  4PF6 A;  5DYH A;  2QMX A;  2NWJ A;  1FQF A;  4RNS A;  5H8F B;  1PEB A;  1LB8 A;  1NKX A;  3FV2 A;  4KPT A;  4LZ5 A;  1A99 A;  1POT A;  3TCG A;  4R73 A;  3ZSF A;  4G2Z A;  2A5T B;  3V8X B;  3IAZ A;  4R6H A;  2OX3 A;  5ITO A;  4F22 A;  2VPO A;  3OD7 A;  2DWJ A;  3MYU A;  2H5Y A;  5LTC A;  4JSO A;  4PE3 A;  3E79 A;  4F3P A;  1SW1 A;  1OVB A;  2RCB A;  1B5I A;  1B58 A;  3PV0 E;  1MQH A;  4U4S A;  2I0B A;  4RK2 A;  3Q26 A;  1QKB A;  4XXU A;  1I6B A;  1HSJ A;  5CM6 A;  1URG A;  3O28 A;  1NV7 A;  1R9Q A;  4DZ1 A;  4PBQ A;  2XXI A;  4EDP A;  3HN0 A;  2GRV A;  4DIG A;  4G8M A;  5DW8 A;  3W9V A;  3S9M C;  3EPE A;  3MP8 A;  4JVI A;  2XD2 A;  3C32 A;  4IY5 A;  4AS4 A;  2HEU A;  1FPL A;  1A7L A;  1IQ7 A;  4N07 A;  4JB7 A;  4KXP A;  4DDD A;  4P8B A;  2OCU A;  1MPB A;  3CVG A;  1NUZ A;  3K1M A;  4QFL A;  1AH5 A;  3VLW A;  4PDH A;  3SEU A;  3KN3 A;  1FTJ A;  2UVG A;  2F3D A;  1FBF A;  4F2O A;  2F78 A;  1LAG E;  4KHZ E;  1IXI A;  4OER A;  3QYT A;  4EQB A;  4FAT A;  1P1W A;  2DDK A;  4NAP A;  2XXR A;  3TTL A;  2XXP A;  2E1S A;  4GX6 A;  3K6U A;  1D4N A;  1YTV A;  3KOT A;  3TKD A;  4PGP A;  1DMB A;  1ATG A;  4NN3 A;  5J16 A;  1A8F A;  2HZK A;  2H4I A;  3DP8 A;  3DEL B;  1IXG A;  3IOV A;  2F36 A;  4EXL A;  2DE2 A;  2Y7I A;  2CZH A;  2X26 A;  2G93 A;  4YB7 A;  5I57 A;  3IJO B;  3OEK A;  1ZIU A;  2CZK A;  3CSB A;  4MLV A;  4OFO A;  4FE8 A;  4OYV A;  1MXU A;  4GX4 A;  2W7Y A;  5HPQ A;  3ILU B;  4QHQ A;  3H6W A;  1MDQ A;  2I0C A;  5T3J A;  2P0S A;  5H8Q A;  3CR9 A;  3OO7 A;  5JK4 A;  3K4U A;  1QW0 A;  1LCT A;  3QK6 A;  4FEC A;  4OMB A;  1UTH B;  2F6P A;  3JYR A;  1FJ9 A;  2DS9 A;  1MXW A;  3RNN A;  4OEN A;  3THI A;  4QSD A;  2DWH A;  1GGG A;  1O7T A;  3HHG A;  5I2K A;  3TTN A;  2DWA A;  5AA3 A;  4E0W A;  1SDX A;  3TAJ A;  4UA8 A;  2HCA A;  3G3H A;  3JV9 A;  4OWD A;  4XF5 A;  5F1Q A;  4XKP A;  3Q27 A;  5IM2 A;  3DP6 A;  1B9J A;  2WBB A;  2DP8 A;  1SPI A;  4L17 A;  2YLN A;  4F19 A;  3HST A;  5I3S A;  4YKP A;  2WYK A;  4OXV A;  3USD A;  3TEL A;  1YAE A;  4M4G A;  1LST A;  1H76 A;  4GBW A;  4BDR A;  1BIY A;  3KZG A;  3WAF A;  4BDQ A; 
#chains in the Genus database with same CATH homology
 2Q2A A;  1MXZ A;  4P0I A;  1J1N A;  3O6I A;  5FHN A;  1FCK A;  1OLA A;  5CMK A;  1MM7 A;  5CBR A;  1B7U A;  4Q8R A;  3K6W A;  1MY3 A;  4POX A;  5CMM A;  2VGQ A;  3KJT A;  4NWC A;  3MPK A;  4F31 B;  1FQC A;  1O64 A;  3V89 B;  1QUK A;  1NH8 A;  1MM6 A;  2QL3 A;  1EZ9 A;  1P1O A;  3O6H A;  1A8E A;  3SDF A;  4H0W A;  3D4C A;  3T96 B;  4FIM A;  3KFM A;  3ZS6 A;  1IXH A;  2ZYO A;  1PBP A;  1VFD A;  3U94 A;  4NF5 B;  2XX8 A;  2RKM A;  3TCH A;  3T9X B;  4H8I A;  2XXH A;  3C34 A;  3FVO A;  3OXN A;  1NNT A;  4HTG A;  1MH4 A;  3VLU A;  2DOJ A;  4QFP A;  5CMC A;  4KCC A;  1EZP A;  3K02 A;  1IZ1 A;  1O63 A;  2I3W A;  4F1Y A;  1LFG A;  4G4P A;  3FD3 A;  4F3S A;  1XVY A;  2Q88 A;  4NED A;  3FZV A;  3EF7 A;  2GHA A;  4QFK A;  3O6G A;  4RY1 A;  3RGY A;  1II5 A;  3G3F A;  2B3F A;  2H98 A;  3RPW A;  3FAT A;  3S9L C;  4EXK A;  3GLB A;  4H6D A;  3MW0 A;  5I56 A;  4ELO A;  4EF1 A;  1JEV A;  2PT1 A;  3C36 A;  5H8H A;  3QXM A;  1N7W A;  4BLA A;  2PX1 A;  2YJP A;  4RPN A;  4YKI A;  5CC2 A;  3K0V A;  3N6U A;  4OQO A;  4QRZ A;  1FTO A;  5CRY A;  2ONR A;  3E4R A;  4EF2 A;  4ECF A;  2B65 A;  3L6H A;  5L9O A;  3OO9 A;  2ANJ A;  3VVE A;  3BBR A;  1MS7 A;  1OMP A;  2OJT A;  3U1O A;  5KZT A;  3DP4 A;  2VD3 A;  2Y7W A;  4AQ4 A;  2O6A A;  2RCA A;  3FJG A;  2O7U A;  3MJN A;  2O7I A;  1XOC A;  1JW5 A;  4XIG Q;  4DXC A;  2ZYM A;  1Z7M E;  5CBS A;  4LZ8 A;  3KSJ A;  3TFL A;  4XKQ A;  4OEV A;  3TPA A;  3UP9 A;  4Q0C A;  5ICQ A;  2GFE A;  1JVY A;  3KSX A;  1EZO A;  1SI0 A;  1NNP A;  2PBW A;  1B3E A;  1B3H A;  1B51 A;  1B3G A;  1PB7 A;  3LSX A;  4X1B A;  4R2B A;  1N76 A;  4ESW A;  1SVX B;  1R6Z A;  3I3V A;  1QJM A;  4FAJ A;  1ZBM A;  1SD3 A;  1SBP A;  1Q1K A;  4GLI A;  2QJE A;  4OHN A;  1M5D A;  1ZKB A;  3H7M A;  2R71 A;  5M2V A;  5HM4 B;  1Y3N A;  1AOV A;  4KI0 E;  1LBC A;  3B6Q A;  1POY 1;  1IIT A;  1NNF A;  2PMS A;  3TZA A;  2HQ0 A;  1H44 A;  4Q30 B;  5AA4 A;  4X1D A;  1B7H A;  3IOU A;  4IGR A;  1UQW A;  3TQL A;  1UIU A;  3G3K A;  5F7V A;  2UYE A;  4THI A;  2UVI A;  1B4Z A;  4XKN A;  1NH7 A;  1USY H;  3MAM A;  2HFB A;  2XHD A;  1OVT A;  1TXF A;  4YB5 A;  1URS A;  5L9S A;  1Y3P A;  5I56 B;  1PB9 A;  1B40 A;  1B5J A;  2QSX A;  5H8H B;  3EQ1 A;  1AL3 A;  1MRP A;  2P2A A;  2H9B A;  3M3F A;  4ZEB A;  1LAF E;  5I59 A;  1GTK A;  1PB8 A;  3P7I A;  2F7C A;  4GXA A;  1SYH A;  1LCF A;  1HSL A;  1JET A;  4IO4 A;  4DE8 A;  3SER A;  3A3C A;  3MZ1 A;  1UTB B;  1USY E;  5EHM A;  3RN8 A;  2Q2C A;  2RIN A;  3T9H B;  4FOR A;  2P1S A;  1MPC A;  5L8D A;  4NF8 B;  2F7B A;  4H65 A;  1OQG A;  3FJ7 A;  2F5X A;  1TT1 A;  1LFI A;  1MQJ A;  4JXI A;  2I48 A;  4IY6 A;  2ONK E;  3H06 B;  5CMB A;  1UIV A;  3O9P A;  3T9U A;  3KGC A;  4I62 A;  2O68 A;  4NTL A;  2AYS A;  3E13 X;  4WXJ A;  1P1Q A;  2I3V A;  4OFJ A;  3G3I A;  3CG3 A;  5HBC A;  1BLF A;  5DEX A;  5ITP A;  3ODB A;  4MLQ A;  3ILT B;  4PFT A;  4BDL A;  4RYA A;  3MP6 A;  3IR1 A;  4R2F A;  3VVF A;  4FJP A;  1IXC A;  4KYS A;  3GZG A;  1Y1M A;  3U8Q A;  3PU5 A;  2REJ A;  3IX1 A;  1MY1 A;  2F97 A;  2Y84 A;  3RT8 A;  4ISU A;  1JW1 A;  1DTZ A;  2R9J A;  1Y4T A;  5AA2 A;  4ZEF A;  2CMO A;  5ICT A;  3M8U A;  4GD5 A;  1N04 A;  4R6Y A;  2V84 A;  4PFW A;  4F1U A;  4BDM A;  2OWT A;  3QUF A;  3MVZ A;  4H5F A;  4MBP A;  3H4Z A;  4AB6 A;  5AA4 B;  1NMU A;  2LAO A;  4NF6 A;  3QSL A;  2RF1 A;  4R6K A;  1P1U A;  3C31 A;  2Q89 A;  5KDT A;  4U22 A;  5KCJ B;  1MDP 1;  2XXX A;  3OSR A;  1XVX A;  3TTR A;  4YKJ A;  3ECR A;  4LAT A;  3TOD A;  5H8N A;  1AMF A;  4ZZA A;  4H5G A;  2VHA A;  2ZNU A;  4E0X A;  3GBB A;  4HW8 A;  3BKI B;  3PUY E;  4ELR A;  3MWB A;  2QPQ A;  2Z22 A;  3IB1 A;  3R7X A;  1B0L A;  5DVI A;  4U23 A;  3RUM A;  2QRY A;  3RY3 A;  2Z8E A;  2AIX A;  1N3X A;  1LLS A;  5ELV A;  2F35 A;  1PDA A;  1FQD A;  2QMW A;  1FQB A;  1ZTY A;  2ALU A;  4QSC A;  3IB0 A;  4ND9 A;  1DOT A;  1YPN A;  2V3U A;  4O3C A;  1N84 A;  3SKP A;  4U4X A;  4LVQ A;  1JW4 A;  4JBZ A;  5TU0 A;  3MZB A;  5TP9 A;  3N26 A;  2PVU A;  1QVS A;  2RC7 A;  3CFL A;  2KLF A;  4IO7 A;  4OZ9 A;  1TFA A;  3LUY A;  3PD8 A;  4X9T A;  5DT6 A;  2D21 A;  2XD3 A;  2Y7R A;  3MZ9 A;  1JVX A;  2Z23 A;  1M5E A;  2I4B A;  2DXR A;  1RKM A;  5EYF A;  3PUX E;  3KN8 A;  4Z0I A;  5K2X A;  4OVJ A;  2Y7K A;  3PPR A;  4KD5 A;  4IGT A;  1NL5 A;  1MY4 A;  4K3F A;  4N13 A;  3N6T A;  2HZL A;  1D9Y A;  4YMB A;  2XXT A;  4F39 A;  1JEU A;  2ZYK A;  3TMG A;  4PFU A;  1RYO A;  2Z8F A;  4DXU A;  3HV1 A;  3OEN A;  4IO3 A;  3QIM A;  3H6T A;  2FYI A;  1MG1 A;  2DQV A;  5J1D A;  4KCD A;  5I57 B;  3IK6 B;  1B5H A;  4FED A;  4HS7 A;  3VFJ A;  1BTJ A;  3MC2 A;  3HPI A;  2XX9 A;  4EUO A;  4YB6 A;  2QS1 A;  2UYF A;  4NF6 B;  4R9G A;  4TOZ A;  5KDT B;  1FW0 A;  1MQG A;  4G8N A;  4GXS B;  1B7Z A;  5H8Q B;  3MVY A;  1DPE A;  3UN6 A;  3UGW A;  1MQI A;  1M5F A;  1FTK A;  4GRK A;  4NF4 A;  5H8N B;  4F3G A;  1F9B A;  2QS2 A;  4GL0 A;  1B3L A;  3IL1 B;  3V5A A;  5I2K B;  4G68 C;  2X7P A;  4KFQ A;  2RC9 A;  2ZXT A;  1P99 A;  1PC3 A;  3N94 A;  1WOD A;  1ZJL A;  3BFT A;  4LZ7 A;  3MVW A;  1XHY A;  3T22 A;  4Z7E A;  3TEP A;  4U2R A;  5FTH A;  3M3L A;  3A09 A;  3PMX A;  3MP1 A;  1SW5 A;  3FGS A;  1ZLQ A;  4JSD A;  3L6G A;  3B7D A;  4QF9 A;  3FXQ A;  3K1N A;  4QSE A;  1DSN A;  5TP9 B;  4MFI A;  3SET A;  3VE1 B;  3G3G A;  5TPA A;  3PPO A;  3SEY A;  3ONM A;  2AL5 A;  2Q8J A;  5L9M A;  4XKR A;  1S50 A;  2XXU A;  2PT2 A;  1MXY A;  2HAU A;  2X7Q A;  4ZED A;  4QFO A;  2R6G E;  1I69 A;  1CE2 A;  1B05 A;  3W9W A;  4ELP A;  1I6A A;  1JQF A;  4R72 A;  3KG2 A;  4LQ5 A;  1EH3 A;  1B32 A;  4PET A;  1SW4 A;  1M5C A;  4DCY A;  4U1O A;  2B3B A;  3B6T A;  3IO6 A;  4MF3 A;  3TTK A;  2DWI A;  5I2N A;  4G68 A;  1B6H A;  2ZNT A;  1Z7N E;  4KYD A;  3SES A;  2Y7P A;  1QUI A;  2XXQ A;  4MH5 A;  2REG A;  3RQT A;  2VD2 A;  1H45 A;  1LB9 A;  3SEW A;  1XT8 A;  1N0T A;  4RXL A;  3E3K A;  3EHT A;  1IEJ A;  1M5B A;  3VLV A;  2XXW A;  3KN7 A;  1FQA A;  2HAV A;  2O1L A;  4ZEK A;  2OZZ A;  3CI8 A;  3H6U A;  5IKB A;  1S7Y A;  5AE4 A;  2HXW A;  1A54 A;  1N7X A;  3IB2 A;  1Q35 A;  4R74 A;  1MY0 A;  1XC1 A;  3GBA A;  1MH3 A;  2PYY A;  5FHO A;  2DYX A;  3PPQ A;  2DVC A;  1D9V A;  4RJZ A;  3UK4 A;  4P11 A;  3N5L A;  1DPP A;  2UVJ A;  1ZMG A;  3LBS A;  2QS4 A;  3G7W A;  2I4C A;  1MQD A;  1EU8 A;  2GH9 A;  1H43 A;  3EHU A;  3QAX A;  3D4G A;  3VDF A;  1UTH A;  2NXO A;  2A5S A;  5B70 A;  3TCF A;  2O84 X;  4BDN A;  1QKA A;  3C35 A;  1MXX A;  3CSG A;  1JNF A;  3O2A A;  4WKM A;  3CFZ A;  3W15 C;  5A5X A;  3KEI A;  5AA2 D;  1MY2 A;  4N6P A;  4OES A;  5JTY A;  3U92 A;  4PP0 A;  1B4H A;  1ZU0 A;  3PMW A;  2V3T A;  1B2H A;  4ZE9 A;  4IO2 A;  3VXB A;  3HO7 A;  4X48 A;  3FIR A;  3TQW A;  2E0S A;  1XS5 A;  4BDO A;  3IOT A;  5TPA B;  3FJM A;  1S9T A;  1A40 A;  4XTC Q;  3FXU A;  4IO5 A;  4TLM B;  2O51 A;  5H8S A;  1YCJ A;  3K2D A;  3T9V A;  1AIV A;  1GR2 A;  3EHS A;  3QUJ A;  4F29 A;  2FA7 A;  4UAC A;  4WED A;  2OK2 A;  1MPD A;  3B6W A;  1FTM A;  5FHM A;  2BJJ X;  3Q25 A;  2I49 A;  2O69 A;  3ZKL A;  1VE4 A;  4DLD A;  1VSO A;  2DXY A;  4C1T A;  5I2N B;  3KJ7 A;  4G68 B;  3FVN A;  1LBB A;  4EQ9 A;  3CRB A;  4PE5 B;  1VFE A;  5IAI A;  3OOA A;  2ABH A;  3F11 A;  4NF5 A;  3PUZ E;  2F8D A;  1Y9U A;  4GF8 A;  2G29 A;  4O3A A;  2FNC A;  1R1N A;  4JWY A;  4PFY A;  3OO8 A;  3UOR A;  3UA8 A;  3K1P A;  2VP1 A;  4DXB A;  3T93 B;  4LA9 A;  4FEB A;  4PQJ A;  3O29 A;  1BP5 A;  1Y20 A;  3MUQ A;  4OTE A;  3H3G A;  1KWH A;  3LSL A;  3SEX A;  4OEU A;  4TLL B;  2Q9T A;  3MQ9 A;  1Y4C A;  1OLC A;  4F2Q A;  1NFT A;  3LR1 A;  2UVH A;  4ZZE A;  3V83 A;  1DTG A;  4JDF A;  5AA1 A;  2F6G A;  4AB5 A;  5I59 B;  5FTI A;  2ONS A;  3IOW A;  2OBG A;  2WKY A;  1GV8 A;  3LC8 A;  4F1V A;  4YU0 A;  3VXC A;  1WVJ A;  3M3K A;  3HCQ A;  1MXV A;  5I84 A;  5A5X B;  3IO4 A;  4G77 A;  2DSF A;  4NWD A;  1QUJ A;  5JTY B;  4R75 A;  3U72 A;  1TFD A;  1N3W A;  1FQE A;  4C1U A;  2XX7 A;  1SYI A;  4LON B;  4GIZ A;  3VV5 A;  4TQU Q;  4Q5T A;  3OEM A;  3PPN A;  4JWO A;  4I9D A;  1NNK A;  4P0G A;  5CI5 A;  1L5T A;  5LOM A;  3FAS A;  5JEI A;  3Q29 A;  1T0K A;  3K01 A;  3S9N C;  1H3D A;  3PUV E;  1PBQ A;  2M8C A;  1LAX A;  1R9L A;  5DEX B;  1IIW A;  3FV1 A;  3KBR A;  1LGB C;  3MPL A;  3OMB A;  3AXF A;  1RYX A;  1FTL A;  5DVJ A;  4GOT A;  4NE4 A;  2UXA A;  3R6U A;  3TTM A;  4EQ7 A;  4IB2 A;  3U93 A;  3O66 A;  5EHS A;  4ZS9 A;  3CIJ A;  5AA2 B;  1D3K A;  3A3U A;  5BUU A;  4R9F A;  3H03 A;  2NUV A;  2IEE A;  2D5W A;  3DM0 A;  2DE3 A;  2V3Q A;  1B52 A;  3LSF B;  3RLF E;  1B0H A;  3K6X A;  1WDN A;  5K2Y A;  5B7D A;  1SI1 A;  3OSQ A;  2OLB A;  3GXA A;  2ZMB A;  3MBP A;  5I58 A;  3MVX A;  3FVK A;  3FXR A;  3PUW E;  3RTW B;  1HSE A;  3O97 A;  3C33 A;  1ANF A;  3S9E A;  4OET A;  1B46 A;  2VOZ A;  5BWJ A;  2ZNS A;  3PPP A;  3Q28 A;  2H99 A;  4U1Z A;  4HCW A;  1BKA A;  1VR5 A;  4POW A;  1US4 A;  3PMV A;  1TWY A;  4YMA A;  3R26 A;  1OQH A;  3I6V A;  4F18 A;  2RC8 A;  5ISU A;  2CZL A;  2NOO A;  3I5O A;  1GVC A;  3VVD A;  3HHF A;  2F34 A;  3H6V A;  5H8F A;  1A55 A;  4DCX A;  1B3F A;  2OWS A;  4GQO A;  1SW2 A;  3K00 A;  4YIC A;  3FVG A;  4H8J A;  3K6V A;  3LSW A;  2O1M A;  4OFL A;  2XXY A;  2A5T A;  1B1H A;  3JZJ A;  4LUB A;  3ZKK A;  4I1D A;  3DLN A;  3OO6 A;  2ZYN A;  4GL8 A;  2YPN A;  2D3I A;  3OEL A;  3KOS A;  4YKK A;  1UTB A;  4F3B A;  5DTB A;  1URD A;  4ZDM A;  4NF8 A;  4H67 A;  3TYH A;  3C9H A;  3FUZ A;  2NVU B;  2H25 A;  4ZEC A;  1OIB A;  2ESN A;  4NMY A;  4KR5 A;  4GVO A;  2IA4 A;  3TUS A;  3RTF B;  4G8H A;  4RA1 A;  2XXV A;  2GHB A;  2V25 A;  3WAE A;  3T66 A;  3S4U A;  2I6E A;  4YZZ A;  3TDJ A;  4RK9 A;  4M1V A;  1SQY A;  1Y3Q A;  3E9X A;  4RPO A;  3C4M A;  4YAH X;  4LP2 B;  1Y1Z A;  1I6Q A;  1LAH E;  4ZE8 A;  4C0R A;  1CB6 A;  4ESX A;  3UIF A;  2AL4 A;  4O3B A;  3CFX A;  4KYE A;  2Z8D A;  3IOR A;  4GWO A;  3S2V A;  4LQ2 A;  4WEP A;  2DVZ A;  5I58 B;  4HCY A;  3IJX B;  2V93 A;  2I58 A;  1IUD A;  4I8C A;  4IO6 A;  2QS3 A;  4H1X A;  1B1X A;  3EN3 A;  4GFR A;  5DVF A;  3RT6 B;  2DE4 A;  4ZEI A;  4NF4 B;  4KQP A;  2THI A;  3PGF A;  1LFH A;  3G3J A;  3CG1 A;  4U21 A;  3SEV A;  5KCJ A;  1P1N A;  4QFN A;  4JWX A;  1QUL A;  3PD9 A;  4ELQ A;  3BFU A;  2F7A A;  1US5 A;  1ELJ A;  4ONY A;  5DYH A;  2QMX A;  2NWJ A;  1FQF A;  4RNS A;  5H8F B;  1PEB A;  1LB8 A;  1NKX A;  3FV2 A;  4KPT A;  4LZ5 A;  1A99 A;  1POT A;  3TCG A;  4R73 A;  3ZSF A;  4G2Z A;  2A5T B;  3V8X B;  3IAZ A;  4R6H A;  5ITO A;  4F22 A;  3OD7 A;  2DWJ A;  2H5Y A;  4JSO A;  4F3P A;  1SW1 A;  1OVB A;  2RCB A;  1B5I A;  1B58 A;  3PV0 E;  1MQH A;  4U4S A;  2I0B A;  4RK2 A;  3Q26 A;  1QKB A;  4XXU A;  1I6B A;  1HSJ A;  5CM6 A;  1URG A;  3O28 A;  1R9Q A;  4DZ1 A;  2XXI A;  4EDP A;  3HN0 A;  2GRV A;  4DIG A;  4G8M A;  3W9V A;  3S9M C;  3EPE A;  3MP8 A;  2XD2 A;  3C32 A;  4IY5 A;  2HEU A;  1A7L A;  1IQ7 A;  4N07 A;  4JB7 A;  4DDD A;  2OCU A;  1MPB A;  3CVG A;  3K1M A;  4QFL A;  1AH5 A;  3VLW A;  3SEU A;  3KN3 A;  1FTJ A;  2UVG A;  4F2O A;  2F78 A;  1LAG E;  4KHZ E;  1IXI A;  4OER A;  3QYT A;  4EQB A;  4FAT A;  1P1W A;  2XXR A;  3TTL A;  2XXP A;  2E1S A;  3K6U A;  1D4N A;  1YTV A;  3KOT A;  3TKD A;  1DMB A;  1ATG A;  1A8F A;  2HZK A;  2H4I A;  3DP8 A;  3DEL B;  1IXG A;  3IOV A;  2F36 A;  4EXL A;  2DE2 A;  2Y7I A;  2X26 A;  2G93 A;  4YB7 A;  5I57 A;  3IJO B;  3OEK A;  1ZIU A;  3CSB A;  4MLV A;  4OFO A;  4FE8 A;  4OYV A;  1MXU A;  2W7Y A;  5HPQ A;  3ILU B;  4QHQ A;  3H6W A;  1MDQ A;  2I0C A;  2P0S A;  5H8Q A;  3CR9 A;  3OO7 A;  5JK4 A;  3K4U A;  1QW0 A;  1LCT A;  3QK6 A;  4FEC A;  4OMB A;  1UTH B;  2F6P A;  3JYR A;  2DS9 A;  1MXW A;  3RNN A;  4OEN A;  3THI A;  4QSD A;  2DWH A;  1GGG A;  1O7T A;  3HHG A;  5I2K A;  3TTN A;  2DWA A;  5AA3 A;  4E0W A;  1SDX A;  3TAJ A;  4UA8 A;  2HCA A;  3G3H A;  3JV9 A;  4OWD A;  5F1Q A;  4XKP A;  3Q27 A;  3DP6 A;  1B9J A;  2DP8 A;  4L17 A;  2YLN A;  4F19 A;  3HST A;  4YKP A;  4OXV A;  3USD A;  3TEL A;  1YAE A;  4M4G A;  1LST A;  1H76 A;  4BDR A;  1BIY A;  3KZG A;  3WAF A;  4BDQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...