1Y9UA

Bordetella ferric binding protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
314
Chain Sequence
DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFAGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anion-independent iron coordination by the Campylobacter jejuni ferric binding protein
pubmed doi rcsb
source organism Bordetella pertussis tohama i
molecule tags Metal binding protein
molecule keywords putative iron binding protein
total genus 112
structure length 314
sequence length 318
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA02
3FGSA 3MVWA 2W7YA 5KDTA 5H8NB 1GVCA 2F6GA 2XXWA 4GF8A 3C33A 3QSLA 5DVIA 3T96B 1O63A 4G8NA 2I58A 2DS9A 5H8QB 2DWJA 5I84A 2Q8JA 3FJ7A 4PP0A 1B05A 3G7WA 1ELJA 4F3GA 3U1OA 3M3KA 4OFJA 2Y7RA 1TFAA 4N6PA 3JV9A 4WKMA 2V93A 4F1YA 1B46A 4KPTA 3VVDA 2DP8A 1I6AA 1NMUA 2R71A 3CFLA 1EZ9A 1M5FA 3TPAA 3T66A 4U22A 4ZEDA 1XS5A 3TCFA 2FA7A 3IB1A 4ONYA 4R75A 4U4SA 2XHDA 3LBSA 2DSFA 2ALUA 2XX7A 3KEIA 4BDLA 5ICQA 3LUYA 3MW0A 4H6DA 4MLVA 4NF4A 2REJA 2XXQA 4R74A 1NNFA 1A7LA 4GVOA 1OIBA 1QJMA 3K0VA 4XKPA 5CMCA 1LFGA 5H8SA 3VXCA 4E0XA 4FIMA 3KN3A 2THIA 4UACA 1B0LA 4AB5A 1A54A 1EH3A 4H5GA 3ZKKA 3PMVA 1OMPA 5H8HB 1URDA 5I56A 1HSEA 2D5WA 4R6HA 1DPPA 3IO4A 5I2NB 1R9LA 3IX1A 3IOUA 4N07A 1SYIA 3S9MC 1LAHE 4NMYA 1B5IA 3CI8A 1UTHB 4G8MA 4NF5A 4OZ9A 2H5YA 5DTBA 1Y4CA 3R26A 5HM4B 3EPEA 2F7CA 4JWOA 4PFYA 1L5TA 4OMBA 3VVFA 5KCJA 1B3EA 4G68B 3FD3A 3TQWA 3BKIB 4THIA 3MVZA 3PU5A 3QUJA 4OESA 2VHAA 3LSWA 2UVHA 3H3GA 1MY1A 3S9LC 4M4GA 4DZ1A 4KR5A 4OEUA 1BP5A 4AB6A 5AA3A 4IO7A 4F2QA 3F11A 1PB9A 3MVXA 4GOTA 2ZNUA 3CRBA 1N0TA 3MZ1A 3TTLA 3TMGA 1B9JA 2H99A 1B4ZA 4POXA 2RC9A 2XXVA 4R9GA 1Y20A 3RQTA 5CMKA 3RNNA 5CC2A 3UIFA 2XD2A 3O9PA 4ZEKA 1A99A 2P2AA 1B7ZA 4PFUA 3TYHA 3VE1B 2ZXTA 1FQBA 3PPQA 3PPPA 3K6UA 5JK4A 1CE2A 1DPEA 2ZYKA 3FJGA 3KG2A 4N13A 4H0WA 4KHZE 1A55A 3CSGA 1SI0A 2PYYA 3PUVE 1O7TA 4F1UA 3N6TA 4R9FA 2RCAA 3V8XB 1QUKA 1US4A 3TUSA 1JNFA 1QW0A 2XX9A 2CZLA 1M5CA 3S2VA 2XXXA 4PQJA 3SESA 1B2HA 1J1NA 1OVTA 3MAMA 3T22A 4DCXA 1ZTYA 4JWYA 5L9MA 1AOVA 4KYSA 2GH9A 3KJ7A 2DE2A 4IO2A 3C4MA 3DP4A 1B3GA 1OQHA 1Y3QA 1II5A 1H43A 4GIZA 4MF3A 2ZYNA 3TTKA 1MQDA 3N94A 1B40A 4QFKA 2VD2A 2F5XA 2YLNA 3CG3A 4GWOA 2OZZA 3DP8A 3QK6A 2A5TA 4LATA 4F2OA 1JW4A 3TQLA 2HQ0A 1H3DA 1MY4A 2O69A 2B3FA 4XKNA 2REGA 3PGFA 1WVJA 3HHGA 4XKRA 1MXXA 3KBRA 3K1PA 3KOTA 1OQGA 4NF8A 3G3HA 5K2XA 2D21A 1B32A 4U1ZA 1PBPA 2V25A 1RYXA 1YAEA 1QKAA 2I4BA 4NF6A 5L9OA 3O6IA 3FV2A 1MY2A 3OOAA 3OO9A 4GFRA 3N26A 4TQUQ 1SW2A 3QAXA 1LB8A 2IA4A 1XVXA 1LBCA 3R6UA 4U21A 5AA1A 4EQBA 4ZDMA 4F22A 1MM6A 1IZ1A 1NNPA 3PMXA 2X7PA 4YMAA 2I3VA 2NOOA 3C35A 3OELA 2HAUA 2DWHA 2Z8DA 1Q35A 1KWHA 3H06B 3H6VA 1MQJA 4ELQA 1EZPA 4HW8A 5EHSA 3H6TA 2F35A 2O51A 3K2DA 3KOSA 3MJNA 3H4ZA 2GHAA 3OSQA 4IGRA 4BDRA 5A5XA 2ZYMA 1MDP1 3DELB 4GLIA 1Y1MA 1IXCA 2F36A 4QSCA 4AQ4A 1Z7ME 3V5AA 3B6TA 1I6BA 3MUQA 5H8FA 5IAIA 1D4NA 3PUXE 1R1NA 3PV0E 3H6WA 1SI1A 1P1OA 2FYIA 3LSLA 3VVEA 4HCWA 2B65A 3UORA 2I48A 1DOTA 1Y4TA 3H7MA 3FUZA 5TP9A 4I9DA 3RGYA 1JVYA 1MXUA 3L6HA 1USYH 4KFQA 3GZGA 1M5DA 1N76A 3MP6A 5EYFA 5TPAB 3SETA 2Q2CA 4ELRA 3W9WA 1IXHA 2I0BA 3O6HA 5AA2A 4H1XA 4JSDA 4PFWA 3R7XA 1MS7A 5I57B 1POY1 1BLFA 2XXHA 3D4GA 3EHTA 2O6AA 1DMBA 4YB7A 1LAGE 3ECRA 3MP8A 3VLVA 2O7IA 5DVFA 3JYRA 3W9VA 2QMWA 4XXUA 3M3FA 1GV8A 3KN8A 3CFZA 1XOCA 4H65A 3RTFB 1DTGA 1P1UA 3VV5A 2X26A 2PX1A 3TTRA 4PE5B 3AXFA 3KJTA 1FTMA 3BFTA 4Q5TA 3KSJA 1URSA 3RY3A 1LAFE 3I3VA 5DEXB 3VDFA 4Q8RA 1RKMA 1IUDA 1H76A 3K01A 4O3CA 3PPOA 3M8UA 4WEPA 3TCHA 4BDQA 3B6WA 2DXRA 3HCQA 3ODBA 3CFXA 4JBZA 4OHNA 3G3IA 1RYOA 1H45A 3I6VA 4P0GA 4YZZA 3CG1A 4UA8A 3RPWA 5JEIA 3U93A 4YMBA 3T9HB 4DXUA 1S50A 4TOZA 4YKIA 1LLSA 3OO8A 2X7QA 3PD8A 4H67A 3TFLA 3T9VA 3MC2A 3E13X 3OO7A 5AA4A 2V3QA 5I2KA 4Z0IA 4C0RA 1NL5A 1LFIA 5JTYB 1B6HA 4POWA 3SERA 2G29A 2PMSA 4U4XA 3EQ1A 5FTHA 3SDFA 1SBPA 2CMOA 1MQIA 1MDQA 1MY0A 3HSTA 4HCYA 4G77A 2FNCA 3FVNA 2RKMA 2AYSA 3QIMA 4X1BA 3RLFE 3FASA 4F1VA 1GTKA 2NVUB 1MPDA 3O28A 2GRVA 1VSOA 1B51A 1JEUA 1MPBA 1Y3NA 1AL3A 1MG1A 2Q88A 1B1HA 3PUZE 4OQOA 1FQFA 2E1SA 4GQOA 3V89B 1P1NA 1HSLA 2DOJA 3G3KA 1SW1A 4BDMA 4U2RA 1JW1A 5I59B 3IB2A 3H03A 3ILTB 2UXAA 3WAFA 3P7IA 4KCDA 4KD5A 4R2BA 5CBSA 1S7YA 4DDDA 3EN3A 4GRKA 3USDA 2HAVA 1BTJA 1UTBA 4P0IA 4Q0CA 3KGCA 3QYTA 4LZ5A 2O68A 2IEEA 1SD3A 3B6QA 3DLNA 1Y1ZA 3PMWA 3E3KA 4K3FA 5F1QA 4BLAA 1JVXA 2YJPA 4R6YA 2B3BA 3RT6B 2ABHA 3RT8A 1MM7A 1PEBA 1POTA 3UA8A 3TDJA 5I58A 2RINA 1MXVA 1FW0A 1EU8A 1XT8A 4ISUA 1XHYA 3GLBA 4NWDA 4P11A 5CMBA 3O97A 3Q27A 4GL8A 1IXGA 3JZJA 3QXMA 4YU0A 5EHMA 3U94A 4F3PA 5L9SA 2F34A 3SEVA 3MP1A 4FEBA 3LSFB 1QKBA 2Y7WA 3EHSA 5H8NA 5KDTB 5LOMA 1A40A 1MQHA 2V3TA 2HXWA 4FORA 3RTWB 4ZE9A 4ZS9A 4OFLA 4QFLA 5H8QA 3VFJA 2Z8FA 3O6GA 5CM6A 1VR5A 2PBWA 4HTGA 2QJEA 4JDFA 1FQCA 4DLDA 2XXYA 3H6UA 3OO6A 4RA1A 1ZU0A 4KQPA 1S9TA 4ELOA 1CB6A 1F9BA 1LFHA 1D3KA 1ZJLA 3IO6A 4F3BA 1TXFA 2VGQA 1TFDA 3CVGA 1M5BA 3HO7A 2ESNA 2VOZA 1NKXA 1O64A 1UQWA 4BDOA 1B7HA 1USYE 4ZEIA 4EXKA 4GXAA 3S4UA 4IGTA 4EQ7A 4QFPA 1AIVA 1FQEA 2Z8EA 3K6WA 4Q30B 4ND9A 1NNTA 2F6PA 2R9JA 1NFTA 4NF4B 1B58A 2QMXA 2XXIA 3KFMA 5ITPA 1ZIUA 4QF9A 3T9UA 4OETA 4FEDA 5K2YA 2QRYA 3Q25A 5IKBA 3MZ9A 1DTZA 3V83A 3IOTA 4FJPA 4R6KA 1A8EA 2I3WA 3KSXA 5ELVA 5ICTA 1LBBA 1OLAA 2DE3A 2H9BA 2OLBA 3FVOA 4O3AA 3T93B 4EDPA 4DXBA 4ESXA 5HPQA 1B0HA 1NH7A 5H8HA 5I56B 1PB8A 1ATGA 4ZE8A 4OEVA 3T9XB 3L6GA 2ANJA 1NNKA 4C1TA 4LZ7A 4ELPA 5I2NA 4GD5A 4IB2A 3B7DA 3ONMA 4OWDA 3SEXA 4C1UA 3IR1A 4F18A 1D9VA 5B70A 1QUIA 1LGBC 3UK4A 2DQVA 3MPKA 4NWCA 2PT2A 1UTHA 3BBRA 3OEMA 3Q26A 4NF5B 4YKKA 1YPNA 2QS3A 1FTKA 1MXWA 5KCJB 1B5JA 1NH8A 2RC7A 2QL3A 3K6VA 1WODA 4R73A 1B52A 1MXYA 4G68A 4ZEBA 5M2VA 4E0WA 3VLUA 2ONKE 3RN8A 3DM0A 3OSRA 2H25A 3VXBA 1B3LA 4YKPA 3W15C 2F78A 4EF2A 5BWJA 4IO3A 3FJMA 2DWIA 3E9XA 4NEDA 2QPQA 1AH5A 3TTMA 3MBPA 2YPNA 3MWBA 1IIWA 1D9YA 4M1VA 1PDAA 2UVIA 1AMFA 4YICA 2LAOA 3MPLA 1YCJA 3TKDA 4RXLA 4EQ9A 5CBRA 3PPRA 1GGGA 2HEUA 1QVSA 3LSXA 1Q1KA 3IORA 1ZKBA 4LUBA 2NWJA 1LCFA 2RF1A 3C34A 2D3IA 1VE4A 1IQ7A 2F97A 4U1OA 1FQAA 1N04A 2AL4A 2DVCA 4I62A 4IO6A 1I69A 1MRPA 4EF1A 1B4HA 4JSOA 2Q2AA 2VP1A 4ESWA 2AIXA 4QHQA 4FATA 4BDNA 4TLMB 1SYHA 3MQ9A 4L17A 3K00A 3S9NC 4X1DA 3RUMA 2DYXA 3DP6A 4EXLA 1N7XA 1EZOA 1H44A 3K4UA 3SEWA 1FTJA 1JQFA 3TEPA 5DT6A 1TWYA 1BKAA 5CMMA 2UVJA 3IAZA 1LAXA 3MVYA 1LB9A 1PC3A 1TT1A 2OBGA 1YTVA 3Q29A 3U92A 1US5A 3IB0A 4R2FA 4F3SA 3GBAA 2HZLA 4FECA 1PBQA 4GL0A 2QS1A 1ZBMA 2A5TB 2GFEA 3FATA 3G3FA 4QSEA 2KLFA 3D4CA 1MQGA 3EF7A 5FTIA 1QULA 1OLCA 3K02A 2Z23A 3A3CA 3CIJA 1P1WA 4XKQA 1DSNA 3ZKLA 5DYHA 4R72A 3I5OA 3FXRA 4NF8B 4WXJA 1ZLQA 5HBCA 2XXPA 1Z7NE 3FZVA 3LC8A 2GHBA 2M8CA 4NF6B 1OVBA 2BJJX 4YKJA 2UYFA 3M3LA 3A3UA 3K1NA 4LONB 1MH4A 4H8IA 4F19A 4DIGA 4WEDA 4OFOA 1ANFA 4DE8A 1IXIA 1LSTA 4Z7EA 3HV1A 3N6UA 3IJXB 4OENA 2WKYA 1GR2A 2PVUA 4ZECA 2I6EA 3OD7A 3K1MA 3PUWE 5ISUA 3E4RA 2RCBA 3FVKA 5A5XB 1VFEA 1N3XA 4X48A 3VLWA 3FXQA 3C32A 3IK6B 2HCAA 4QSDA 3TAJA 2A5SA 1MPCA 3N5LA 2UYEA 3O29A 4JB7A 4RK2A 5H8FB 4IO5A 5TU0A 3WAEA 4OTEA 2XD3A 3ZSFA 2OWSA 1N84A 2XXTA 4KI0E 2G93A 1QUJA 4H8JA 4KCCA 3Q28A 3C9HA 2XXRA 1XC1A 1WDNA 2OCUA 4MLQA 2HFBA 4G8HA 1XVYA 5TP9B 4NE4A 1IITA 2Y7PA 2QS4A 4TLLB 1LCTA 2I4CA 3IJOB 3G3GA 4ZZEA 5TPAA 3THIA 5BUUA 4U23A 1ZMGA 1SVXB 2HZKA 2VD3A 4HS7A 2XX8A 1SDXA 5AA2B 5I57A 1JW5A 2OK2A 4F29A 4QFOA 3GXAA 3SEYA 4G4PA 3PUYE 4OERA 1MY3A 1R9QA 3PD9A 3IOWA 3FV1A 2F8DA 1R6ZA 3FIRA 2V3UA 3OXNA 2R6GE 1IEJA 3BFUA 4KYDA 2ZYOA 2O84X 1PB7A 2NUVA 2ONSA 5AE4A 3S9EA 4X9TA 1MH3A 1JEVA 1T0KA 1M5EA 3PPNA 3A09A 5DEXA 2Y7KA 3U8QA 4FAJA 2NXOA 2ONRA 5FHOA 5L8DA 4F31B 2P1SA 2O1LA 4IO4A 1SQYA 2F7AA 2PT1A 4ZZAA 4O3BA 5AA2D 3FXUA 4MBPA 3UP9A 3U72A 3O2AA 4GXSB 4RPNA 3C36A 2QSXA 1MXZA 4QFNA 2DWAA 2ZNTA 2DVZA 1P99A 2I49A 2Y84A 3CR9A 2OJTA 3GBBA 4PFTA 5DVJA 4LZ8A 4FE8A 2OWTA 4G2ZA 1FQDA 1B1XA 1UIVA 2O1MA 1B3HA 3HHFA 4LA9A 3SEUA 2RC8A 4RYAA 4DCYA 3CSBA 4LQ5A 3OENA 5AA4B 3QUFA 5FHNA 3ZS6A 1URGA 5I2KB 5B7DA 2H4IA 4RY1A 4I8CA 4ZEFA 5JTYA 2P0SA 4IY6A 1HSJA 1P1QA 2V84A 1JETA 4RPOA 4YB6A 2Y7IA 3UN6A 2F7BA 2Q89A 4NTLA 1B3FA 5ITOA 4OVJA 1Y3PA 2DXYA 1FCKA 1N3WA 3G3JA 4G68C 1FTLA 1I6QA 2AL5A 4LQ2A 4QRZA 4RK9A 1B5HA 3UGWA 4JWXA 4RJZA 3KN7A 3OMBA 3IOVA 4KYEA 3FVGA 4MFIA 3TTNA 5FHMA 2QS2A 3HPIA 5CRYA 3KZGA 3ILUB 3TELA 3HN0A 4DXCA 4H5FA 5I59A 4LVQA 2Q9TA 3TZAA 5F7VA 4EUOA 4RNSA 5KZTA 1UIUA 4JXIA 2E0SA 1Y9UA 2I0CA 1UTBB 1A8FA 1N7WA 1SW4A 2Z22A 2DE4A 4I1DA 2ZMBA 3MZBA 2O7UA 3LR1A 4IY5A 3SKPA 3TCGA 4YAHX 5CI5A 2UVGA 2ZNSA 3IL1B 3K6XA 4LP2B 3TODA 1VFDA 1SW5A 3OEKA 4MH5A 5I58B 3O66A 1B7UA 5J1DA 4ECFA 2H98A 4XTCQ 4XIGQ 4OYVA 3EHUA 1BIYA 4YB5A 1FTOA 4PETA 2XXUA 4F39A 4OXVA 3C31A
chains in the Genus database with same CATH superfamily
3MVWA 5KDTA 1GVCA 2XXWA 5DVIA 2DS9A 5I84A 3G7WA 1ELJA 3JV9A 4WKMA 2DP8A 4GBWA 1NMUA 1EZ9A 1FPFA 4U22A 1XS5A 4XFEA 3TCFA 3LBSA 3KEIA 1NNFA 3K0VA 1DK4A 3KN3A 4AB5A 4H5GA 1OMPA 4R6HA 5I2NB 1R9LA 3IX1A 2XWOA 4OZ9A 4JWOA 4PFYA 4OMBA 2F3DA 1Q9DA 3TQWA 4THIA 3QUJA 3LSWA 2UVHA 3H3GA 1MY1A 4M4GA 4KR5A 3TTLA 2RC9A 1Y20A 4PF8A 5CMKA 2XD2A 4ZEKA 3TYHA 2ZXTA 3KG2A 5I5PA 1A55A 2PYYA 1QUKA 1QW0A 2MKZA 2XX9A 2CZLA 2XXXA 3SESA 1J1NA 1ZTYA 5L9MA 1OQHA 1H43A 2VPOA 2HQ0A 2O69A 4XKNA 3KBRA 3SEYA 2D21A 4U1ZA 1RYXA 1YAEA 3O6IA 3OO9A 2IA4A 4EQBA 4PAIA 3OELA 3H06B 1Q35A 1EZPA 1MQJA 4HW8A 2F35A 4IGRA 4H45A 4GLIA 2F36A 1IXCA 4GWUA 5H8FA 1P1OA 2FYIA 4OVSA 3FUZA 5TP9A 3RGYA 1FBCA 1M5DA 3MP6A 4ELRA 5EYFA 3W9WA 4H1XA 3R7XA 1MS7A 4GWWA 2O6AA 3VLVA 4P9KA 2QMWA 1GV8A 3KN8A 1DTGA 1P1UA 2PX1A 3KJTA 3BFTA 3RY3A 1LAFE 3B6WA 3HCQA 1H45A 3I6VA 4P0GA 3CG1A 5EQ9A 4YMBA 3T9HB 1S50A 1LLSA 2X7QA 3PD8A 4H67A 3OO7A 5I2KA 4MNPA 4OVPA 2PMSA 3SDFA 1SBPA 4HCYA 3FVNA 4F1VA 3QIMA 3FASA 2GRVA 1MPBA 1MG1A 2Q88A 3G3KA 4MHFA 1SW1A 4U2RA 1JW1A 3IB2A 2UXAA 4KCDA 4KD5A 4GRKA 4Q0CA 3QYTA 3B6QA 2IEEA 5F1QA 2YJPA 4MMPA 2B3BA 3RT6B 1XT8A 3Q27A 3IFCA 2OX3A 3SEVA 4FEBA 1QKBA 5KDTB 5H8NA 1A40A 3RTWB 3O6GA 1VR5A 4JDFA 1ZU0A 4ELOA 1CB6A 1F9BA 3IO6A 4F3BA 3HO7A 4EXKA 4GXAA 4EQ7A 4ND9A 1NNTA 1NFTA 4NF4B 2QMXA 3KFMA 4QF9A 3T9UA 4OETA 4FEDA 2QRYA 3Q25A 3MZ9A 2KQZA 3IOTA 2I3WA 2DE3A 3T93B 2CZHA 2FIXA 1B0HA 1PB8A 1ATGA 3T9XB 3ONMA 5B70A 4O7MA 3MPKA 3OEMA 4NF5B 2QS3A 1FTKA 1MXWA 1B5JA 1NH8A 3K6VA 1WODA 1IMBA 3DM0A 3OSRA 4EF2A 1NV2A 1AH5A 1XI6A 5I3SA 3TTMA 2UVIA 3TKDA 4RXLA 1DBZA 3C34A 1VE4A 1IQ7A 1FQAA 1I69A 1MRPA 4EF1A 4JSOA 4FATA 4BDNA 3MQ9A 4L17A 4X1DA 2DYXA 1TWYA 3MVYA 1PC3A 3IB0A 4F3SA 1RDZA 3GBAA 1PBQA 4GL0A 1FJ6A 2QS1A 2A5TB 3FATA 3G3FA 5FTIA 4XF5A 3K02A 4XKQA 1DSNA 4R72A 5HBCA 4NF6B 3A3UA 4H8IA 4DIGA 4DE8A 3HV1A 2I6EA 5ET5A 3K1MA 5ISUA 3FVKA 2RCBA 2KR0A 5H8FB 5TU0A 4OTEA 3ZSFA 2CZIA 1QUJA 3C9HA 2QVVA 2HFBA 1XVYA 5TP9B 4NE4A 4TLLB 1SVXB 2HZKA 5AA2B 1SDXA 5I57A 1MY3A 1R9QA 2VPNA 4N17A 3BFUA 4KYDA 2NUVA 1JEVA 2Y7KA 4FAJA 5L8DA 2O1LA 1SQYA 2PT1A 3FXUA 3UP9A 3U72A 4GXSB 3C36A 1MXZA 2ZNTA 4PFTA 5DVJA 3CR9A 2OJTA 3GBBA 4LZ8A 4FE8A 4LA9A 3HHFA 3SEUA 1IMEA 4JVDA 1FSAA 3ROJA 2H4IA 4I8CA 5JTYA 2P0SA 4IY6A 1IMDA 1P1QA 4JVCA 1KA0A 4LN5A 1Y3PA 1I6QA 2AL5A 5IM2A 3UGWA 1NUYA 4MJOA 5I59A 2QVRA 3TZAA 5KZTA 1UIUA 2E0SA 2Z22A 2O7UA 3LR1A 4YAHX 2ZNSA 3K6XA 1B7UA 5J1DA 1FTAA 5F24A 4OYVA 4MNCA 1FTOA 3LV0A 2XXUA 4OXVA 4N4UA 5H8NB 4HE1A 4QBAA 5H8QB 3M3KA 4OFJA 4N6PA 1TFAA 4KPTA 2WYPA 3T66A 3LUZA 2FA7A 3IB1A 4ONYA 1LBZA 2DSFA 3BIGA 5ICQA 4H6DA 4MLVA 4NF4A 2XXQA 4R74A 1RDXA 5EYGA 1QJMA 3MYUA 5H8SA 4E0XA 4FIMA 2THIA 1B0LA 1A54A 1EH3A 1FBHA 2D5WA 1DPPA 3IOUA 1SYIA 1B5IA 4NF5A 1INPA 5DTBA 3EPEA 1EYIA 3VVFA 1B3EA 4PFIA 3FD3A 3MVZA 2VHAA 1LBWA 4IO7A 1NUXA 1LEVA 2ZNUA 3CRBA 1N0TA 3MZ1A 3KC1A 1B9JA 2V4CA 4POXA 2XXVA 4R9GA 4PTKA 3RNNA 5CC2A 1NV0A 4GX4A 3VE1B 4PFUA 3PPQA 3K6UA 1CE2A 4N13A 4H0WA 4KHZE 2OWZA 4F1UA 3TUSA 1JNFA 1M5CA 4PQJA 1OVTA 3T22A 3HFUA 3DP4A 1Y3QA 1II5A 4MF3A 4QFKA 2F5XA 2JJKA 3DP8A 3QK6A 2A5TA 1MY4A 2B3FA 3PGFA 4XKRA 3G3HA 5FBPA 4NF6A 4PC9A 3OOAA 3R6UA 4U21A 1MM6A 1IZ1A 1NNPA 2I3VA 4O8MA 4ELQA 3T1BA 1KWHA 2O51A 3H4ZA 4AQ4A 1Y1MA 3V5AA 5IAIA 1D4NA 4GWYA 3H6WA 3LSLA 4HCWA 2B65A 2I48A 1DOTA 4OVQA 3H7MA 1JVYA 4KFQA 2P3NA 3GZGA 1N76A 5TPAB 3SETA 2Q2CA 1IXHA 2I0BA 3O6HA 5AA2A 4JSDA 4PFWA 5I57B 2XXHA 5LDZA 4YB7A 1LAGE 5DVFA 3CFZA 5IZ3A 2X26A 1FTMA 4Q5TA 3I3VA 1IUDA 4O3CA 3PPOA 3TCHA 2DXRA 3CFXA 1RYOA 4P56A 4YZZA 3RPWA 3MC2A 3E13X 1LFIA 5JTYB 4POWA 4P47A 5FTHA 3EQ1A 1MDQA 1MY0A 3HSTA 1LBYA 1KZ8A 1MPDA 1JEUA 1B1HA 4OVRA 1FQFA 2DOJA 5J16A 4BDMA 5I59B 4R2BA 1BK4A 5CBSA 1S7YA 4DDDA 3EN3A 3USDA 2HAVA 3CHGA 4LZ5A 1AWBA 1SD3A 3DLNA 3PMWA 3E3KA 2PCRA 3RT8A 3UA8A 2XWIA 1MXVA 5HM4B 5CMBA 1XHYA 4P11A 4YU0A 2WBDA 3JZJA 5L9SA 3MP1A 1FBEA 4FORA 4ZE9A 4OFLA 4QFLA 5H8QA 3VFJA 5ESYA 3OO6A 2XA5A 1TXFA 1TFDA 2ESNA 2VOZA 3E79A 1FBDA 1AIVA 4Q30B 1KA1A 1B58A 1ZIUA 3V83A 5ICTA 3KSXA 4KXPA 1LBBA 2H9BA 4XEQA 4DXBA 4ESXA 5I56B 3L6GA 2ANJA 4ELPA 4GD5A 4IB2A 4C1UA 3IR1A 1D9VA 1LGBC 3BBRA 5KCJB 2RC7A 4R73A 1MXYA 3W15C 4YKPA 5BWJA 4IO3A 3FJMA 3FBPA 2QPQA 3MBPA 2YPNA 5IZ1A 1PDAA 2LAOA 3MPLA 1YCJA 2FVZA 5IGAA 3IORA 1LCFA 2D3IA 5ET6A 4U1OA 2AL4A 4I62A 2VP1A 4ESWA 4TLMB 3S9NC 3K00A 1N7XA 4PGPA 1EZOA 1H44A 5I7IA 2ZZXA 1FTJA 2UVJA 1LB9A 2OBGA 3U92A 1US5A 4QSEA 2KLFA 3D4CA 3EF7A 1OLCA 3A3CA 4OANA 3ZKLA 5DYHA 3FXRA 4WXJA 1ZLQA 2XXPA 4X8RA 1Z7NE 3LC8A 4YKJA 1FRPA 3M3LA 4LONB 1MH4A 4F19A 4OFOA 1IXIA 4Z7EA 3N6UA 4OENA 2WKYA 4ZECA 4MAGA 1VFEA 1N3XA 4X48A 3VLWA 3FXQA 1NUZA 4QSDA 3TAJA 2UYEA 4JB7A 4RK2A 3WAEA 1N84A 4KCCA 3Q28A 1XC1A 2OCUA 4MNIA 1IITA 2Y7PA 4NAPA 4ZZEA 3G3GA 5TPAA 1NUWA 4U23A 4N8GA 4F29A 3PUYE 3PD9A 2WBBA 2XXKA 2V3UA 5IZ3B 1IEJA 2ONSA 1M5EA 3PPNA 3A09A 5DEXA 3U8QA 3T0JA 4F31B 4IO4A 5AA2D 2F7AA 4RPNA 2QSXA 2DVZA 2Y84A 1K9YA 1B1XA 4DCYA 3OENA 5AA4B 3QUFA 3ZS6A 4ZEFA 4NX1A 2Y7IA 3UN6A 1B3FA 4P8BA 4N81A 4G68C 4RK9A 3OMBA 3IOVA 4KYEA 4MFIA 2QS2A 3HPIA 2PFZA 5LTCA 3TELA 2FHYA 2Q9TA 4PF6A 4RNSA 2QFLA 4JXIA 2I0CA 1UTBB 3TCGA 2UVGA 3B50A 1VFDA 1SW5A 3OEKA 4ECFA 1BIYA 4PETA 3FGSA 2R8TA 4GF8A 3C33A 3QSLA 1O63A 4G8NA 2I58A 2WEFA 4H46A 4PP0A 1B05A 4F1YA 2Y7RA 2V93A 3VVDA 4MIJA 2R71A 1M5FA 3TPAA 4R75A 2ALUA 2P3VA 1A7LA 4GVOA 1OIBA 3PTYA 5CMCA 1LFGA 1FJ9A 2CEXA 1NV4A 3PMVA 5H8HB 5I56A 3IO4A 3SZPA 1LAHE 3CI8A 1FBFA 3R26A 5KCJA 2F7CA 4G68B 3BKIB 4OESA 4QXDA 1NI9A 4NF0A 1BP5A 4F2QA 3F11A 1PB9A 4GOTA 2H99A 3UIFA 1K9ZA 4MX6A 1A99A 2P2AA 5JK4A 2ZYKA 3CSGA 1SI0A 3PUVE 3N6TA 4R9FA 2RCAA 2XWVA 1YZ0A 1FPKA 3MSTA 3MAMA 1AOVA 4JWYA 4KYSA 3KJ7A 4PDHA 3ISPA 2ZYNA 3TTKA 1B40A 2YLNA 4GWOA 3CG3A 2OZZA 2PFYA 1JW4A 2REGA 3HHGA 1MXXA 1OQGA 4NF8A 1B32A 5L9OA 1QKAA 2I4BA 1SW2A 3QMFA 4F22A 4ZDMA 3PMXA 2X7PA 5T3JA 3H6VA 5EHSA 3MJNA 3OSQA 5A5XA 2ZYMA 1MDP1 4N8YA 3DELB 4QSCA 3PUXE 1R1NA 3VVEA 4I9DA 1POY1 3D4GA 1DMBA 3ECRA 2O7IA 4XXUA 4PFRA 4H65A 3VV5A 4PE5B 5DW8A 4JVIA 3KSJA 1URSA 3GYYA 5DEXB 3VDFA 4Q8RA 1RKMA 4WEPA 4BDQA 3M8UA 3G3IA 4DXUA 1LBXA 4YKIA 3TFLA 3T9VA 1NV5A 5AA4A 2V3QA 4Z0IA 1NL5A 3SERA 4U4XA 4G77A 2FNCA 2AYSA 4G61A 1VSOA 1Y3NA 3S9LC 4GQOA 1P1NA 3ILTB 3P7IA 1LBVA 3BIHA 1UTBA 1BTJA 3KGCA 1Y1ZA 1FPEA 4BLAA 2ABHA 1PEBA 1POTA 5I58A 2RINA 2WYKA 1FW0A 1EU8A 4ISUA 4NWDA 3O97A 1IXGA 3QXMA 2F34A 3LSFB 5LOMA 2HXWA 4ZS9A 2Z8FA 2PBWA 4HTGA 4HE2A 1IMCA 4RA1A 1S9TA 1LFHA 1ZJLA 2VGQA 4PAFA 3CVGA 1M5BA 1NKXA 1O64A 2FBPA 4BDOA 1USYE 4ZEIA 2F6PA 2R9JA 5K2YA 5IKBA 1DTZA 4FJPA 4R6KA 1A8EA 5ELVA 1OLAA 4O3AA 4EDPA 5H8HA 4DI4B 4OWDA 1D9QA 1QGXA 2CEYA 4X04A 3Q26A 1YPNA 1YXIA 4G68A 4ZEBA 5M2VA 2ONKE 3RN8A 1RDYA 2DWIA 3E9XA 4NEDA 4M1VA 1AMFA 4YICA 5CBRA 3PPRA 1GGGA 1QVSA 3LSXA 4LUBA 2RF1A 1N04A 4IO6A 2Q2AA 2AIXA 4QHQA 1IMFA 1SYHA 4EXLA 1FPDA 2F3BA 3SEWA 3K4UA 3TEPA 1JQFA 2QVUA 5DT6A 1BKAA 3IAZA 1TT1A 1YTVA 4R2FA 2HZLA 3KC0A 1ZBMA 1MQGA 3RPLA 1P1WA 2FIEA 3I5OA 4N15A 4NF8B 1CNQA 3FZVA 2GHBA 4WEDA 3D1RA 3IJXB 1GR2A 3PUWE 5A5XB 5ET7A 3O29A 4NHBA 4NGUA 2XD3A 3KBZA 2OWSA 2XXTA 2G93A 4H8JA 4MLQA 2QS4A 3IJOB 2I4CA 3THIA 2B4MA 2OK2A 4G4PA 4OERA 3FV1A 2F8DA 3OXNA 2R6GE 2ZYOA 2O84X 1PB7A 2ONRA 2P1SA 4GWXA 2OWTA 1UIVA 1B3HA 5ET8A 3CSBA 4LQ5A 4PAKA 5FHNA 1URGA 5B7DA 4RPOA 2V84A 1JETA 4YB6A 2Q89A 4NTLA 5ITOA 4OVJA 1FCKA 3G3JA 1FTLA 4QRZA 1B5HA 2HPGA 5EQ7A 3FVGA 5FHMA 5CRYA 3KZGA 3ILUB 4H5FA 5F7VA 4PCDA 1FPGA 1Y9UA 1N7WA 4IY5A 4I1DA 2DE4A 4DLDA 3MZBA 2Y5KA 3SKPA 4LP2B 1FPIA 5I58B 2H98A 4XTCQ 4XIGQ 3EHUA 4YB5A 2GH9A 4NN3A 2W7YA 2F6GA 3T96B 4I3EA 2Y5LA 4UABA 1FBGA 2DWJA 2Q8JA 3FJ7A 4F3GA 3U1OA 1B46A 1I6AA 3CFLA 4ZEDA 4U4SA 2XHDA 4BDLA 4N91A 2XX7A 3LUYA 3MW0A 2REJA 4XKPA 3VXCA 4UACA 3ZKKA 1URDA 1HSEA 1YYZA 4N07A 4PFBA 3S9MC 4NMYA 4DI3D 1UTHB 4G8MA 2H5YA 4GWZA 1Y4CA 1L5TA 2GQ1A 3PU5A 4OEUA 4AB6A 5AA3A 3MVXA 3E78A 3TMGA 1B4ZA 3RQTA 4OVTA 3O9PA 1B7ZA 1FQBA 3PPPA 1DPEA 3FJGA 1O7TA 3V8XB 1US4A 1SPIA 3S2VA 1B2HA 4DCXA 2DE2A 4IO2A 3C4MA 1B3GA 4GIZA 1MQDA 3N94A 2VD2A 1VDWA 4LATA 4F2OA 2HHMA 3TQLA 1H3DA 4AS5A 3RPLB 1WVJA 3K1PA 3KOTA 5K2XA 1PBPA 2V25A 3FV2A 1MY2A 4GFRA 3N26A 4TQUQ 3QAXA 1LB8A 1XVXA 1LBCA 5AA1A 4YMAA 2NOOA 3C35A 2HAUA 2DWHA 2Z8DA 4N6DA 5EQ8A 3H6TA 3KOSA 3K2DA 4BDRA 2GHAA 1Z7ME 2B4LA 3B6TA 1I6BA 3MUQA 4FBPA 2Q74A 3PV0E 1SI1A 3UORA 1Y4TA 1MXUA 1FPBA 3L6HA 1USYH 1EYJA 2VT5A 1BLFA 3EHTA 4GWSA 3U65A 4DZ1A 3MP8A 3W9VA 3JYRA 3M3FA 1XOCA 3RTFB 1NV6A 4MCOA 3AXFA 4P1LA 1H76A 3K01A 1EYKA 3ODBA 4JBZA 4OHNA 1JP4A 4UA8A 5JEIA 4AS4A 3U93A 4TOZA 3OO8A 2BJIA 4C0RA 1FBPA 2ZZWA 1B6HA 2G29A 4HE0A 2CMOA 1MQIA 1NV1A 2RKMA 4X1BA 3RLFE 1GTKA 2NVUB 4O7IA 3O28A 1B51A 4I3YA 1AL3A 3PUZE 4OQOA 2E1SA 3V89B 1HSLA 3H03A 3WAFA 4P0IA 1FPJA 2O68A 1FPLA 4K3FA 1JVXA 2HXRA 4R6YA 4PBHA 1MM7A 3TDJA 4NQ8A 5EQAA 3GLBA 4GL8A 3U94A 4F3PA 4PGNA 5EHMA 3EHSA 2Y7WA 1MQHA 4GX6A 2V3TA 5CM6A 2QJEA 1FQCA 2XXYA 3H6UA 4KQPA 2WX9A 1D3KA 2XWKA 1UQWA 1B7HA 3S4UA 4IGTA 4QFPA 1FQEA 2Z8EA 3K6WA 3EKIA 2XXIA 5ITPA 2OLBA 3FVOA 5HPQA 1NH7A 4HXVA 4ZE8A 4OEVA 4C1TA 1NNKA 5I2NA 4LZ7A 4F18A 3B7DA 3SEXA 3FXBA 1QUIA 3UK4A 2DQVA 4NWCA 1UTHA 4YKKA 2QL3A 1B52A 4E0WA 3VLUA 2H25A 3VXBA 1B3LA 2F78A 4O94A 3MWBA 1IIWA 1D9YA 4EQ9A 3RYDA 2HEUA 1Q1KA 1ZKBA 2NWJA 1G0IA 2F97A 2DVCA 4IR8A 1B4HA 3NOHA 4PE3A 4GX3A 1DCUA 3RUMA 2L5VA 3DP6A 5CMMA 1LAXA 3Q29A 4FECA 2GFEA 3TTRA 1QULA 2Z23A 3CIJA 5A5LA 4PBQA 2M8CA 1OVBA 2BJJX 2UYFA 3K1NA 1ANFA 1LSTA 1NV3A 2PVUA 4OA4A 3OD7A 5IZZA 3E4RA 4P1EA 3C32A 3IK6B 2HCAA 2A5SA 1MPCA 3N5LA 4IO5A 1T0KA 3B8BA 4KI0E 2XXRA 4MEVA 4P3LA 1WDNA 4G8HA 2ZZVA 1LCTA 5BUUA 1ZMGA 2VD3A 4HS7A 2XX8A 1JW5A 4QFOA 3GXAA 3IOWA 3FIRA 1R6ZA 2CZKA 5AE4A 3S9EA 4X9TA 1MH3A 1G0HA 2NXOA 5FHOA 4ZZAA 4O3BA 4MBPA 3O2AA 4QFNA 2DWAA 2I49A 1P99A 3A29A 4G2ZA 1FQDA 2O1MA 1IMAA 2RC8A 4RYAA 1NV7A 5I2KB 4RY1A 4PDDA 1HSJA 2F7BA 2DXYA 1N3WA 4LQ2A 4JWXA 4RJZA 3IFAA 3KN7A 3TTNA 4I40A 3HN0A 4DXCA 5EYHA 4LVQA 2Q8MA 4EUOA 4N6KA 1A8FA 1SW4A 2ZMBA 2DDKA 5CI5A 3IL1B 3TODA 4NG7A 4GBVA 4MH5A 3O66A 2PT2A 4F39A 3C31A
chains in the Genus database with same CATH topology
3FGSA 3MVWA 2W7YA 5KDTA 5H8NB 1GVCA 2F6GA 2XXWA 4GF8A 3C33A 3QSLA 5DVIA 3T96B 1O63A 4G8NA 2I58A 2DS9A 5H8QB 2DWJA 5I84A 2Q8JA 3FJ7A 4PP0A 1B05A 3G7WA 1ELJA 4F3GA 3U1OA 3M3KA 4OFJA 2Y7RA 1TFAA 4N6PA 3JV9A 4WKMA 2V93A 4F1YA 1B46A 4KPTA 3VVDA 2DP8A 1I6AA 1NMUA 2R71A 3CFLA 1EZ9A 1M5FA 3TPAA 3T66A 4U22A 4ZEDA 1XS5A 3TCFA 2FA7A 3IB1A 4ONYA 4R75A 4U4SA 2XHDA 3LBSA 2DSFA 2ALUA 2XX7A 3KEIA 4BDLA 5ICQA 3LUYA 3MW0A 4H6DA 4MLVA 4NF4A 2REJA 2XXQA 4R74A 1NNFA 1A7LA 4GVOA 1OIBA 1QJMA 3K0VA 4XKPA 5CMCA 1LFGA 5H8SA 3VXCA 4E0XA 4FIMA 3KN3A 2THIA 4UACA 1B0LA 4AB5A 1A54A 1EH3A 4H5GA 3ZKKA 3PMVA 1OMPA 5H8HB 1URDA 5I56A 1HSEA 2D5WA 4R6HA 1DPPA 3IO4A 5I2NB 1R9LA 3IX1A 3IOUA 4N07A 1SYIA 3S9MC 1LAHE 4NMYA 1B5IA 3CI8A 1UTHB 4G8MA 4NF5A 4OZ9A 2H5YA 5DTBA 1Y4CA 3R26A 5HM4B 3EPEA 2F7CA 4JWOA 4PFYA 1L5TA 4OMBA 3VVFA 5KCJA 1B3EA 4G68B 3FD3A 3TQWA 3BKIB 4THIA 3MVZA 3PU5A 3QUJA 4OESA 2VHAA 3LSWA 2UVHA 3H3GA 1MY1A 3S9LC 4M4GA 4DZ1A 4KR5A 4OEUA 1BP5A 4AB6A 5AA3A 4IO7A 4F2QA 3F11A 1PB9A 3MVXA 4GOTA 2ZNUA 3CRBA 1N0TA 3MZ1A 3TTLA 3TMGA 1B9JA 2H99A 1B4ZA 4POXA 2RC9A 2XXVA 4R9GA 1Y20A 3RQTA 5CMKA 3RNNA 5CC2A 3UIFA 2XD2A 3O9PA 4ZEKA 1A99A 2P2AA 1B7ZA 4PFUA 3TYHA 3VE1B 2ZXTA 1FQBA 3PPQA 3PPPA 3K6UA 5JK4A 1CE2A 1DPEA 2ZYKA 3FJGA 3KG2A 4N13A 4H0WA 4KHZE 1A55A 3CSGA 1SI0A 2PYYA 3PUVE 1O7TA 4F1UA 3N6TA 4R9FA 2RCAA 3V8XB 1QUKA 1US4A 3TUSA 1JNFA 1QW0A 2XX9A 2CZLA 1M5CA 3S2VA 2XXXA 4PQJA 3SESA 1B2HA 1J1NA 1OVTA 3MAMA 3T22A 4DCXA 1ZTYA 4JWYA 5L9MA 1AOVA 4KYSA 2GH9A 3KJ7A 2DE2A 4IO2A 3C4MA 3DP4A 1B3GA 1OQHA 1Y3QA 1II5A 1H43A 4GIZA 4MF3A 2ZYNA 3TTKA 1MQDA 3N94A 1B40A 4QFKA 2VD2A 2F5XA 2YLNA 3CG3A 4GWOA 2OZZA 3DP8A 3QK6A 2A5TA 4LATA 4F2OA 1JW4A 3TQLA 2HQ0A 1H3DA 1MY4A 2O69A 2B3FA 4XKNA 2REGA 3PGFA 1WVJA 3HHGA 4XKRA 1MXXA 3KBRA 3K1PA 3KOTA 1OQGA 4NF8A 3G3HA 5K2XA 2D21A 1B32A 4U1ZA 1PBPA 2V25A 1RYXA 1YAEA 1QKAA 2I4BA 4NF6A 5L9OA 3O6IA 3FV2A 1MY2A 3OOAA 3OO9A 4GFRA 3N26A 4TQUQ 1SW2A 3QAXA 1LB8A 2IA4A 1XVXA 1LBCA 3R6UA 4U21A 5AA1A 4EQBA 4ZDMA 4F22A 1MM6A 1IZ1A 1NNPA 3PMXA 2X7PA 4YMAA 2I3VA 2NOOA 3C35A 3OELA 2HAUA 2DWHA 2Z8DA 1Q35A 1KWHA 3H06B 3H6VA 1MQJA 4ELQA 1EZPA 4HW8A 5EHSA 3H6TA 2F35A 2O51A 3K2DA 3KOSA 3MJNA 3H4ZA 2GHAA 3OSQA 4IGRA 4BDRA 5A5XA 2ZYMA 1MDP1 3DELB 4GLIA 1Y1MA 1IXCA 2F36A 4QSCA 4AQ4A 1Z7ME 3V5AA 3B6TA 1I6BA 3MUQA 5H8FA 5IAIA 1D4NA 3PUXE 1R1NA 3PV0E 3H6WA 1SI1A 1P1OA 2FYIA 3LSLA 3VVEA 4HCWA 2B65A 3UORA 2I48A 1DOTA 1Y4TA 3H7MA 3FUZA 5TP9A 4I9DA 3RGYA 1JVYA 1MXUA 3L6HA 1USYH 4KFQA 3GZGA 1M5DA 1N76A 3MP6A 5EYFA 5TPAB 3SETA 2Q2CA 4ELRA 3W9WA 1IXHA 2I0BA 3O6HA 5AA2A 4H1XA 4JSDA 4PFWA 3R7XA 1MS7A 5I57B 1POY1 1BLFA 2XXHA 3D4GA 3EHTA 2O6AA 1DMBA 4YB7A 1LAGE 3ECRA 3MP8A 3VLVA 2O7IA 5DVFA 3JYRA 3W9VA 2QMWA 4XXUA 3M3FA 1GV8A 3KN8A 3CFZA 1XOCA 4H65A 3RTFB 1DTGA 1P1UA 3VV5A 2X26A 2PX1A 3TTRA 4PE5B 3AXFA 3KJTA 1FTMA 3BFTA 4Q5TA 3KSJA 1URSA 3RY3A 1LAFE 3I3VA 5DEXB 3VDFA 4Q8RA 1RKMA 1IUDA 1H76A 3K01A 4O3CA 3PPOA 3M8UA 4WEPA 3TCHA 4BDQA 3B6WA 2DXRA 3HCQA 3ODBA 3CFXA 4JBZA 4OHNA 3G3IA 1RYOA 1H45A 3I6VA 4P0GA 4YZZA 3CG1A 4UA8A 3RPWA 5JEIA 3U93A 4YMBA 3T9HB 4DXUA 1S50A 4TOZA 4YKIA 1LLSA 3OO8A 2X7QA 3PD8A 4H67A 3TFLA 3T9VA 3MC2A 3E13X 3OO7A 5AA4A 2V3QA 5I2KA 4Z0IA 4C0RA 1NL5A 1LFIA 5JTYB 1B6HA 4POWA 3SERA 2G29A 2PMSA 4U4XA 3EQ1A 5FTHA 3SDFA 1SBPA 2CMOA 1MQIA 1MDQA 1MY0A 3HSTA 4HCYA 4G77A 2FNCA 3FVNA 2RKMA 2AYSA 3QIMA 4X1BA 3RLFE 3FASA 4F1VA 1GTKA 2NVUB 1MPDA 3O28A 2GRVA 1VSOA 1B51A 1JEUA 1MPBA 1Y3NA 1AL3A 1MG1A 2Q88A 1B1HA 3PUZE 4OQOA 1FQFA 2E1SA 4GQOA 3V89B 1P1NA 1HSLA 2DOJA 3G3KA 1SW1A 4BDMA 4U2RA 1JW1A 5I59B 3IB2A 3H03A 3ILTB 2UXAA 3WAFA 3P7IA 4KCDA 4KD5A 4R2BA 5CBSA 1S7YA 4DDDA 3EN3A 4GRKA 3USDA 2HAVA 1BTJA 1UTBA 4P0IA 4Q0CA 3KGCA 3QYTA 4LZ5A 2O68A 2IEEA 1SD3A 3B6QA 3DLNA 1Y1ZA 3PMWA 3E3KA 4K3FA 5F1QA 4BLAA 1JVXA 2YJPA 4R6YA 2B3BA 3RT6B 2ABHA 3RT8A 1MM7A 1PEBA 1POTA 3UA8A 3TDJA 5I58A 2RINA 1MXVA 1FW0A 1EU8A 1XT8A 4ISUA 1XHYA 3GLBA 4NWDA 4P11A 5CMBA 3O97A 3Q27A 4GL8A 1IXGA 3JZJA 3QXMA 4YU0A 5EHMA 3U94A 4F3PA 5L9SA 2F34A 3SEVA 3MP1A 4FEBA 3LSFB 1QKBA 2Y7WA 3EHSA 5H8NA 5KDTB 5LOMA 1A40A 1MQHA 2V3TA 2HXWA 4FORA 3RTWB 4ZE9A 4ZS9A 4OFLA 4QFLA 5H8QA 3VFJA 2Z8FA 3O6GA 5CM6A 1VR5A 2PBWA 4HTGA 2QJEA 4JDFA 1FQCA 4DLDA 2XXYA 3H6UA 3OO6A 4RA1A 1ZU0A 4KQPA 1S9TA 4ELOA 1CB6A 1F9BA 1LFHA 1D3KA 1ZJLA 3IO6A 4F3BA 1TXFA 2VGQA 1TFDA 3CVGA 1M5BA 3HO7A 2ESNA 2VOZA 1NKXA 1O64A 1UQWA 4BDOA 1B7HA 1USYE 4ZEIA 4EXKA 4GXAA 3S4UA 4IGTA 4EQ7A 4QFPA 1AIVA 1FQEA 2Z8EA 3K6WA 4Q30B 4ND9A 1NNTA 2F6PA 2R9JA 1NFTA 4NF4B 1B58A 2QMXA 2XXIA 3KFMA 5ITPA 1ZIUA 4QF9A 3T9UA 4OETA 4FEDA 5K2YA 2QRYA 3Q25A 5IKBA 3MZ9A 1DTZA 3V83A 3IOTA 4FJPA 4R6KA 1A8EA 2I3WA 3KSXA 5ELVA 5ICTA 1LBBA 1OLAA 2DE3A 2H9BA 2OLBA 3FVOA 4O3AA 3T93B 4EDPA 4DXBA 4ESXA 5HPQA 1B0HA 1NH7A 5H8HA 5I56B 1PB8A 1ATGA 4ZE8A 4OEVA 3T9XB 3L6GA 2ANJA 1NNKA 4C1TA 4LZ7A 4ELPA 5I2NA 4GD5A 4IB2A 3B7DA 3ONMA 4OWDA 3SEXA 4C1UA 3IR1A 4F18A 1D9VA 5B70A 1QUIA 1LGBC 3UK4A 2DQVA 3MPKA 4NWCA 2PT2A 1UTHA 3BBRA 3OEMA 3Q26A 4NF5B 4YKKA 1YPNA 2QS3A 1FTKA 1MXWA 5KCJB 1B5JA 1NH8A 2RC7A 2QL3A 3K6VA 1WODA 4R73A 1B52A 1MXYA 4G68A 4ZEBA 5M2VA 4E0WA 3VLUA 2ONKE 3RN8A 3DM0A 3OSRA 2H25A 3VXBA 1B3LA 4YKPA 3W15C 2F78A 4EF2A 5BWJA 4IO3A 3FJMA 2DWIA 3E9XA 4NEDA 2QPQA 1AH5A 3TTMA 3MBPA 2YPNA 3MWBA 1IIWA 1D9YA 4M1VA 1PDAA 2UVIA 1AMFA 4YICA 2LAOA 3MPLA 1YCJA 3TKDA 4RXLA 4EQ9A 5CBRA 3PPRA 1GGGA 2HEUA 1QVSA 3LSXA 1Q1KA 3IORA 1ZKBA 4LUBA 2NWJA 1LCFA 2RF1A 3C34A 2D3IA 1VE4A 1IQ7A 2F97A 4U1OA 1FQAA 1N04A 2AL4A 2DVCA 4I62A 4IO6A 1I69A 1MRPA 4EF1A 1B4HA 4JSOA 2Q2AA 2VP1A 4ESWA 2AIXA 4QHQA 4FATA 4BDNA 4TLMB 1SYHA 3MQ9A 4L17A 3K00A 3S9NC 4X1DA 3RUMA 2DYXA 3DP6A 4EXLA 1N7XA 1EZOA 1H44A 3K4UA 3SEWA 1FTJA 1JQFA 3TEPA 5DT6A 1TWYA 1BKAA 5CMMA 2UVJA 3IAZA 1LAXA 3MVYA 1LB9A 1PC3A 1TT1A 2OBGA 1YTVA 3Q29A 3U92A 1US5A 3IB0A 4R2FA 4F3SA 3GBAA 2HZLA 4FECA 1PBQA 4GL0A 2QS1A 1ZBMA 2A5TB 2GFEA 3FATA 3G3FA 4QSEA 2KLFA 3D4CA 1MQGA 3EF7A 5FTIA 1QULA 1OLCA 3K02A 2Z23A 3A3CA 3CIJA 1P1WA 4XKQA 1DSNA 3ZKLA 5DYHA 4R72A 3I5OA 3FXRA 4NF8B 4WXJA 1ZLQA 5HBCA 2XXPA 1Z7NE 3FZVA 3LC8A 2GHBA 2M8CA 4NF6B 1OVBA 2BJJX 4YKJA 2UYFA 3M3LA 3A3UA 3K1NA 4LONB 1MH4A 4H8IA 4F19A 4DIGA 4WEDA 4OFOA 1ANFA 4DE8A 1IXIA 1LSTA 4Z7EA 3HV1A 3N6UA 3IJXB 4OENA 2WKYA 1GR2A 2PVUA 4ZECA 2I6EA 3OD7A 3K1MA 3PUWE 5ISUA 3E4RA 2RCBA 3FVKA 5A5XB 1VFEA 1N3XA 4X48A 3VLWA 3FXQA 3C32A 3IK6B 2HCAA 4QSDA 3TAJA 2A5SA 1MPCA 3N5LA 2UYEA 3O29A 4JB7A 4RK2A 5H8FB 4IO5A 5TU0A 3WAEA 4OTEA 2XD3A 3ZSFA 2OWSA 1N84A 2XXTA 4KI0E 2G93A 1QUJA 4H8JA 4KCCA 3Q28A 3C9HA 2XXRA 1XC1A 1WDNA 2OCUA 4MLQA 2HFBA 4G8HA 1XVYA 5TP9B 4NE4A 1IITA 2Y7PA 2QS4A 4TLLB 1LCTA 2I4CA 3IJOB 3G3GA 4ZZEA 5TPAA 3THIA 5BUUA 4U23A 1ZMGA 1SVXB 2HZKA 2VD3A 4HS7A 2XX8A 1SDXA 5AA2B 5I57A 1JW5A 2OK2A 4F29A 4QFOA 3GXAA 3SEYA 4G4PA 3PUYE 4OERA 1MY3A 1R9QA 3PD9A 3IOWA 3FV1A 2F8DA 1R6ZA 3FIRA 2V3UA 3OXNA 2R6GE 1IEJA 3BFUA 4KYDA 2ZYOA 2O84X 1PB7A 2NUVA 2ONSA 5AE4A 3S9EA 4X9TA 1MH3A 1JEVA 1T0KA 1M5EA 3PPNA 3A09A 5DEXA 2Y7KA 3U8QA 4FAJA 2NXOA 2ONRA 5FHOA 5L8DA 4F31B 2P1SA 2O1LA 4IO4A 1SQYA 2F7AA 2PT1A 4ZZAA 4O3BA 5AA2D 3FXUA 4MBPA 3UP9A 3U72A 3O2AA 4GXSB 4RPNA 3C36A 2QSXA 1MXZA 4QFNA 2DWAA 2ZNTA 2DVZA 1P99A 2I49A 2Y84A 3CR9A 2OJTA 3GBBA 4PFTA 5DVJA 4LZ8A 4FE8A 2OWTA 4G2ZA 1FQDA 1B1XA 1UIVA 2O1MA 1B3HA 3HHFA 4LA9A 3SEUA 2RC8A 4RYAA 4DCYA 3CSBA 4LQ5A 3OENA 5AA4B 3QUFA 5FHNA 3ZS6A 1URGA 5I2KB 5B7DA 2H4IA 4RY1A 4I8CA 4ZEFA 5JTYA 2P0SA 4IY6A 1HSJA 1P1QA 2V84A 1JETA 4RPOA 4YB6A 2Y7IA 3UN6A 2F7BA 2Q89A 4NTLA 1B3FA 5ITOA 4OVJA 1Y3PA 2DXYA 1FCKA 1N3WA 3G3JA 4G68C 1FTLA 1I6QA 2AL5A 4LQ2A 4QRZA 4RK9A 1B5HA 3UGWA 4JWXA 4RJZA 3KN7A 3OMBA 3IOVA 4KYEA 3FVGA 4MFIA 3TTNA 5FHMA 2QS2A 3HPIA 5CRYA 3KZGA 3ILUB 3TELA 3HN0A 4DXCA 4H5FA 5I59A 4LVQA 2Q9TA 3TZAA 5F7VA 4EUOA 4RNSA 5KZTA 1UIUA 4JXIA 2E0SA 1Y9UA 2I0CA 1UTBB 1A8FA 1N7WA 1SW4A 2Z22A 2DE4A 4I1DA 2ZMBA 3MZBA 2O7UA 3LR1A 4IY5A 3SKPA 3TCGA 4YAHX 5CI5A 2UVGA 2ZNSA 3IL1B 3K6XA 4LP2B 3TODA 1VFDA 1SW5A 3OEKA 4MH5A 5I58B 3O66A 1B7UA 5J1DA 4ECFA 2H98A 4XTCQ 4XIGQ 4OYVA 3EHUA 1BIYA 4YB5A 1FTOA 4PETA 2XXUA 4F39A 4OXVA 3C31A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FGS A;  3MVW A;  2W7Y A;  5KDT A;  5H8N B;  1GVC A;  2F6G A;  2XXW A;  4GF8 A;  3C33 A;  3QSL A;  5DVI A;  3T96 B;  1O63 A;  4G8N A;  2I58 A;  2DS9 A;  5H8Q B;  2DWJ A;  5I84 A;  2Q8J A;  3FJ7 A;  4PP0 A;  1B05 A;  3G7W A;  1ELJ A;  4F3G A;  3U1O A;  3M3K A;  4OFJ A;  2Y7R A;  1TFA A;  4N6P A;  3JV9 A;  4WKM A;  2V93 A;  4F1Y A;  1B46 A;  4KPT A;  3VVD A;  2DP8 A;  1I6A A;  1NMU A;  2R71 A;  3CFL A;  1EZ9 A;  1M5F A;  3TPA A;  3T66 A;  4U22 A;  4ZED A;  1XS5 A;  3TCF A;  2FA7 A;  3IB1 A;  4ONY A;  4R75 A;  4U4S A;  2XHD A;  3LBS A;  2DSF A;  2ALU A;  2XX7 A;  3KEI A;  4BDL A;  5ICQ A;  3LUY A;  3MW0 A;  4H6D A;  4MLV A;  4NF4 A;  2REJ A;  2XXQ A;  4R74 A;  1NNF A;  1A7L A;  4GVO A;  1OIB A;  1QJM A;  3K0V A;  4XKP A;  5CMC A;  1LFG A;  5H8S A;  3VXC A;  4E0X A;  4FIM A;  3KN3 A;  2THI A;  4UAC A;  1B0L A;  4AB5 A;  1A54 A;  1EH3 A;  4H5G A;  3ZKK A;  3PMV A;  1OMP A;  5H8H B;  1URD A;  5I56 A;  1HSE A;  2D5W A;  4R6H A;  1DPP A;  3IO4 A;  5I2N B;  1R9L A;  3IX1 A;  3IOU A;  4N07 A;  1SYI A;  3S9M C;  1LAH E;  4NMY A;  1B5I A;  3CI8 A;  1UTH B;  4G8M A;  4NF5 A;  4OZ9 A;  2H5Y A;  5DTB A;  1Y4C A;  3R26 A;  5HM4 B;  3EPE A;  2F7C A;  4JWO A;  4PFY A;  1L5T A;  4OMB A;  3VVF A;  5KCJ A;  1B3E A;  4G68 B;  3FD3 A;  3TQW A;  3BKI B;  4THI A;  3MVZ A;  3PU5 A;  3QUJ A;  4OES A;  2VHA A;  3LSW A;  2UVH A;  3H3G A;  1MY1 A;  3S9L C;  4M4G A;  4DZ1 A;  4KR5 A;  4OEU A;  1BP5 A;  4AB6 A;  5AA3 A;  4IO7 A;  4F2Q A;  3F11 A;  1PB9 A;  3MVX A;  4GOT A;  2ZNU A;  3CRB A;  1N0T A;  3MZ1 A;  3TTL A;  3TMG A;  1B9J A;  2H99 A;  1B4Z A;  4POX A;  2RC9 A;  2XXV A;  4R9G A;  1Y20 A;  3RQT A;  5CMK A;  3RNN A;  5CC2 A;  3UIF A;  2XD2 A;  3O9P A;  4ZEK A;  1A99 A;  2P2A A;  1B7Z A;  4PFU A;  3TYH A;  3VE1 B;  2ZXT A;  1FQB A;  3PPQ A;  3PPP A;  3K6U A;  5JK4 A;  1CE2 A;  1DPE A;  2ZYK A;  3FJG A;  3KG2 A;  4N13 A;  4H0W A;  4KHZ E;  1A55 A;  3CSG A;  1SI0 A;  2PYY A;  3PUV E;  1O7T A;  4F1U A;  3N6T A;  4R9F A;  2RCA A;  3V8X B;  1QUK A;  1US4 A;  3TUS A;  1JNF A;  1QW0 A;  2XX9 A;  2CZL A;  1M5C A;  3S2V A;  2XXX A;  4PQJ A;  3SES A;  1B2H A;  1J1N A;  1OVT A;  3MAM A;  3T22 A;  4DCX A;  1ZTY A;  4JWY A;  5L9M A;  1AOV A;  4KYS A;  2GH9 A;  3KJ7 A;  2DE2 A;  4IO2 A;  3C4M A;  3DP4 A;  1B3G A;  1OQH A;  1Y3Q A;  1II5 A;  1H43 A;  4GIZ A;  4MF3 A;  2ZYN A;  3TTK A;  1MQD A;  3N94 A;  1B40 A;  4QFK A;  2VD2 A;  2F5X A;  2YLN A;  3CG3 A;  4GWO A;  2OZZ A;  3DP8 A;  3QK6 A;  2A5T A;  4LAT A;  4F2O A;  1JW4 A;  3TQL A;  2HQ0 A;  1H3D A;  1MY4 A;  2O69 A;  2B3F A;  4XKN A;  2REG A;  3PGF A;  1WVJ A;  3HHG A;  4XKR A;  1MXX A;  3KBR A;  3K1P A;  3KOT A;  1OQG A;  4NF8 A;  3G3H A;  5K2X A;  2D21 A;  1B32 A;  4U1Z A;  1PBP A;  2V25 A;  1RYX A;  1YAE A;  1QKA A;  2I4B A;  4NF6 A;  5L9O A;  3O6I A;  3FV2 A;  1MY2 A;  3OOA A;  3OO9 A;  4GFR A;  3N26 A;  4TQU Q;  1SW2 A;  3QAX A;  1LB8 A;  2IA4 A;  1XVX A;  1LBC A;  3R6U A;  4U21 A;  5AA1 A;  4EQB A;  4ZDM A;  4F22 A;  1MM6 A;  1IZ1 A;  1NNP A;  3PMX A;  2X7P A;  4YMA A;  2I3V A;  2NOO A;  3C35 A;  3OEL A;  2HAU A;  2DWH A;  2Z8D A;  1Q35 A;  1KWH A;  3H06 B;  3H6V A;  1MQJ A;  4ELQ A;  1EZP A;  4HW8 A;  5EHS A;  3H6T A;  2F35 A;  2O51 A;  3K2D A;  3KOS A;  3MJN A;  3H4Z A;  2GHA A;  3OSQ A;  4IGR A;  4BDR A;  5A5X A;  2ZYM A;  1MDP 1;  3DEL B;  4GLI A;  1Y1M A;  1IXC A;  2F36 A;  4QSC A;  4AQ4 A;  1Z7M E;  3V5A A;  3B6T A;  1I6B A;  3MUQ A;  5H8F A;  5IAI A;  1D4N A;  3PUX E;  1R1N A;  3PV0 E;  3H6W A;  1SI1 A;  1P1O A;  2FYI A;  3LSL A;  3VVE A;  4HCW A;  2B65 A;  3UOR A;  2I48 A;  1DOT A;  1Y4T A;  3H7M A;  3FUZ A;  5TP9 A;  4I9D A;  3RGY A;  1JVY A;  1MXU A;  3L6H A;  1USY H;  4KFQ A;  3GZG A;  1M5D A;  1N76 A;  3MP6 A;  5EYF A;  5TPA B;  3SET A;  2Q2C A;  4ELR A;  3W9W A;  1IXH A;  2I0B A;  3O6H A;  5AA2 A;  4H1X A;  4JSD A;  4PFW A;  3R7X A;  1MS7 A;  5I57 B;  1POY 1;  1BLF A;  2XXH A;  3D4G A;  3EHT A;  2O6A A;  1DMB A;  4YB7 A;  1LAG E;  3ECR A;  3MP8 A;  3VLV A;  2O7I A;  5DVF A;  3JYR A;  3W9V A;  2QMW A;  4XXU A;  3M3F A;  1GV8 A;  3KN8 A;  3CFZ A;  1XOC A;  4H65 A;  3RTF B;  1DTG A;  1P1U A;  3VV5 A;  2X26 A;  2PX1 A;  3TTR A;  4PE5 B;  3AXF A;  3KJT A;  1FTM A;  3BFT A;  4Q5T A;  3KSJ A;  1URS A;  3RY3 A;  1LAF E;  3I3V A;  5DEX B;  3VDF A;  4Q8R A;  1RKM A;  1IUD A;  1H76 A;  3K01 A;  4O3C A;  3PPO A;  3M8U A;  4WEP A;  3TCH A;  4BDQ A;  3B6W A;  2DXR A;  3HCQ A;  3ODB A;  3CFX A;  4JBZ A;  4OHN A;  3G3I A;  1RYO A;  1H45 A;  3I6V A;  4P0G A;  4YZZ A;  3CG1 A;  4UA8 A;  3RPW A;  5JEI A;  3U93 A;  4YMB A;  3T9H B;  4DXU A;  1S50 A;  4TOZ A;  4YKI A;  1LLS A;  3OO8 A;  2X7Q A;  3PD8 A;  4H67 A;  3TFL A;  3T9V A;  3MC2 A;  3E13 X;  3OO7 A;  5AA4 A;  2V3Q A;  5I2K A;  4Z0I A;  4C0R A;  1NL5 A;  1LFI A;  5JTY B;  1B6H A;  4POW A;  3SER A;  2G29 A;  2PMS A;  4U4X A;  3EQ1 A;  5FTH A;  3SDF A;  1SBP A;  2CMO A;  1MQI A;  1MDQ A;  1MY0 A;  3HST A;  4HCY A;  4G77 A;  2FNC A;  3FVN A;  2RKM A;  2AYS A;  3QIM A;  4X1B A;  3RLF E;  3FAS A;  4F1V A;  1GTK A;  2NVU B;  1MPD A;  3O28 A;  2GRV A;  1VSO A;  1B51 A;  1JEU A;  1MPB A;  1Y3N A;  1AL3 A;  1MG1 A;  2Q88 A;  1B1H A;  3PUZ E;  4OQO A;  1FQF A;  2E1S A;  4GQO A;  3V89 B;  1P1N A;  1HSL A;  2DOJ A;  3G3K A;  1SW1 A;  4BDM A;  4U2R A;  1JW1 A;  5I59 B;  3IB2 A;  3H03 A;  3ILT B;  2UXA A;  3WAF A;  3P7I A;  4KCD A;  4KD5 A;  4R2B A;  5CBS A;  1S7Y A;  4DDD A;  3EN3 A;  4GRK A;  3USD A;  2HAV A;  1BTJ A;  1UTB A;  4P0I A;  4Q0C A;  3KGC A;  3QYT A;  4LZ5 A;  2O68 A;  2IEE A;  1SD3 A;  3B6Q A;  3DLN A;  1Y1Z A;  3PMW A;  3E3K A;  4K3F A;  5F1Q A;  4BLA A;  1JVX A;  2YJP A;  4R6Y A;  2B3B A;  3RT6 B;  2ABH A;  3RT8 A;  1MM7 A;  1PEB A;  1POT A;  3UA8 A;  3TDJ A;  5I58 A;  2RIN A;  1MXV A;  1FW0 A;  1EU8 A;  1XT8 A;  4ISU A;  1XHY A;  3GLB A;  4NWD A;  4P11 A;  5CMB A;  3O97 A;  3Q27 A;  4GL8 A;  1IXG A;  3JZJ A;  3QXM A;  4YU0 A;  5EHM A;  3U94 A;  4F3P A;  5L9S A;  2F34 A;  3SEV A;  3MP1 A;  4FEB A;  3LSF B;  1QKB A;  2Y7W A;  3EHS A;  5H8N A;  5KDT B;  5LOM A;  1A40 A;  1MQH A;  2V3T A;  2HXW A;  4FOR A;  3RTW B;  4ZE9 A;  4ZS9 A;  4OFL A;  4QFL A;  5H8Q A;  3VFJ A;  2Z8F A;  3O6G A;  5CM6 A;  1VR5 A;  2PBW A;  4HTG A;  2QJE A;  4JDF A;  1FQC A;  4DLD A;  2XXY A;  3H6U A;  3OO6 A;  4RA1 A;  1ZU0 A;  4KQP A;  1S9T A;  4ELO A;  1CB6 A;  1F9B A;  1LFH A;  1D3K A;  1ZJL A;  3IO6 A;  4F3B A;  1TXF A;  2VGQ A;  1TFD A;  3CVG A;  1M5B A;  3HO7 A;  2ESN A;  2VOZ A;  1NKX A;  1O64 A;  1UQW A;  4BDO A;  1B7H A;  1USY E;  4ZEI A;  4EXK A;  4GXA A;  3S4U A;  4IGT A;  4EQ7 A;  4QFP A;  1AIV A;  1FQE A;  2Z8E A;  3K6W A;  4Q30 B;  4ND9 A;  1NNT A;  2F6P A;  2R9J A;  1NFT A;  4NF4 B;  1B58 A;  2QMX A;  2XXI A;  3KFM A;  5ITP A;  1ZIU A;  4QF9 A;  3T9U A;  4OET A;  4FED A;  5K2Y A;  2QRY A;  3Q25 A;  5IKB A;  3MZ9 A;  1DTZ A;  3V83 A;  3IOT A;  4FJP A;  4R6K A;  1A8E A;  2I3W A;  3KSX A;  5ELV A;  5ICT A;  1LBB A;  1OLA A;  2DE3 A;  2H9B A;  2OLB A;  3FVO A;  4O3A A;  3T93 B;  4EDP A;  4DXB A;  4ESX A;  5HPQ A;  1B0H A;  1NH7 A;  5H8H A;  5I56 B;  1PB8 A;  1ATG A;  4ZE8 A;  4OEV A;  3T9X B;  3L6G A;  2ANJ A;  1NNK A;  4C1T A;  4LZ7 A;  4ELP A;  5I2N A;  4GD5 A;  4IB2 A;  3B7D A;  3ONM A;  4OWD A;  3SEX A;  4C1U A;  3IR1 A;  4F18 A;  1D9V A;  5B70 A;  1QUI A;  1LGB C;  3UK4 A;  2DQV A;  3MPK A;  4NWC A;  2PT2 A;  1UTH A;  3BBR A;  3OEM A;  3Q26 A;  4NF5 B;  4YKK A;  1YPN A;  2QS3 A;  1FTK A;  1MXW A;  5KCJ B;  1B5J A;  1NH8 A;  2RC7 A;  2QL3 A;  3K6V A;  1WOD A;  4R73 A;  1B52 A;  1MXY A;  4G68 A;  4ZEB A;  5M2V A;  4E0W A;  3VLU A;  2ONK E;  3RN8 A;  3DM0 A;  3OSR A;  2H25 A;  3VXB A;  1B3L A;  4YKP A;  3W15 C;  2F78 A;  4EF2 A;  5BWJ A;  4IO3 A;  3FJM A;  2DWI A;  3E9X A;  4NED A;  2QPQ A;  1AH5 A;  3TTM A;  3MBP A;  2YPN A;  3MWB A;  1IIW A;  1D9Y A;  4M1V A;  1PDA A;  2UVI A;  1AMF A;  4YIC A;  2LAO A;  3MPL A;  1YCJ A;  3TKD A;  4RXL A;  4EQ9 A;  5CBR A;  3PPR A;  1GGG A;  2HEU A;  1QVS A;  3LSX A;  1Q1K A;  3IOR A;  1ZKB A;  4LUB A;  2NWJ A;  1LCF A;  2RF1 A;  3C34 A;  2D3I A;  1VE4 A;  1IQ7 A;  2F97 A;  4U1O A;  1FQA A;  1N04 A;  2AL4 A;  2DVC A;  4I62 A;  4IO6 A;  1I69 A;  1MRP A;  4EF1 A;  1B4H A;  4JSO A;  2Q2A A;  2VP1 A;  4ESW A;  2AIX A;  4QHQ A;  4FAT A;  4BDN A;  4TLM B;  1SYH A;  3MQ9 A;  4L17 A;  3K00 A;  3S9N C;  4X1D A;  3RUM A;  2DYX A;  3DP6 A;  4EXL A;  1N7X A;  1EZO A;  1H44 A;  3K4U A;  3SEW A;  1FTJ A;  1JQF A;  3TEP A;  5DT6 A;  1TWY A;  1BKA A;  5CMM A;  2UVJ A;  3IAZ A;  1LAX A;  3MVY A;  1LB9 A;  1PC3 A;  1TT1 A;  2OBG A;  1YTV A;  3Q29 A;  3U92 A;  1US5 A;  3IB0 A;  4R2F A;  4F3S A;  3GBA A;  2HZL A;  4FEC A;  1PBQ A;  4GL0 A;  2QS1 A;  1ZBM A;  2A5T B;  2GFE A;  3FAT A;  3G3F A;  4QSE A;  2KLF A;  3D4C A;  1MQG A;  3EF7 A;  5FTI A;  1QUL A;  1OLC A;  3K02 A;  2Z23 A;  3A3C A;  3CIJ A;  1P1W A;  4XKQ A;  1DSN A;  3ZKL A;  5DYH A;  4R72 A;  3I5O A;  3FXR A;  4NF8 B;  4WXJ A;  1ZLQ A;  5HBC A;  2XXP A;  1Z7N E;  3FZV A;  3LC8 A;  2GHB A;  2M8C A;  4NF6 B;  1OVB A;  2BJJ X;  4YKJ A;  2UYF A;  3M3L A;  3A3U A;  3K1N A;  4LON B;  1MH4 A;  4H8I A;  4F19 A;  4DIG A;  4WED A;  4OFO A;  1ANF A;  4DE8 A;  1IXI A;  1LST A;  4Z7E A;  3HV1 A;  3N6U A;  3IJX B;  4OEN A;  2WKY A;  1GR2 A;  2PVU A;  4ZEC A;  2I6E A;  3OD7 A;  3K1M A;  3PUW E;  5ISU A;  3E4R A;  2RCB A;  3FVK A;  5A5X B;  1VFE A;  1N3X A;  4X48 A;  3VLW A;  3FXQ A;  3C32 A;  3IK6 B;  2HCA A;  4QSD A;  3TAJ A;  2A5S A;  1MPC A;  3N5L A;  2UYE A;  3O29 A;  4JB7 A;  4RK2 A;  5H8F B;  4IO5 A;  5TU0 A;  3WAE A;  4OTE A;  2XD3 A;  3ZSF A;  2OWS A;  1N84 A;  2XXT A;  4KI0 E;  2G93 A;  1QUJ A;  4H8J A;  4KCC A;  3Q28 A;  3C9H A;  2XXR A;  1XC1 A;  1WDN A;  2OCU A;  4MLQ A;  2HFB A;  4G8H A;  1XVY A;  5TP9 B;  4NE4 A;  1IIT A;  2Y7P A;  2QS4 A;  4TLL B;  1LCT A;  2I4C A;  3IJO B;  3G3G A;  4ZZE A;  5TPA A;  3THI A;  5BUU A;  4U23 A;  1ZMG A;  1SVX B;  2HZK A;  2VD3 A;  4HS7 A;  2XX8 A;  1SDX A;  5AA2 B;  5I57 A;  1JW5 A;  2OK2 A;  4F29 A;  4QFO A;  3GXA A;  3SEY A;  4G4P A;  3PUY E;  4OER A;  1MY3 A;  1R9Q A;  3PD9 A;  3IOW A;  3FV1 A;  2F8D A;  1R6Z A;  3FIR A;  2V3U A;  3OXN A;  2R6G E;  1IEJ A;  3BFU A;  4KYD A;  2ZYO A;  2O84 X;  1PB7 A;  2NUV A;  2ONS A;  5AE4 A;  3S9E A;  4X9T A;  1MH3 A;  1JEV A;  1T0K A;  1M5E A;  3PPN A;  3A09 A;  5DEX A;  2Y7K A;  3U8Q A;  4FAJ A;  2NXO A;  2ONR A;  5FHO A;  5L8D A;  4F31 B;  2P1S A;  2O1L A;  4IO4 A;  1SQY A;  2F7A A;  2PT1 A;  4ZZA A;  4O3B A;  5AA2 D;  3FXU A;  4MBP A;  3UP9 A;  3U72 A;  3O2A A;  4GXS B;  4RPN A;  3C36 A;  2QSX A;  1MXZ A;  4QFN A;  2DWA A;  2ZNT A;  2DVZ A;  1P99 A;  2I49 A;  2Y84 A;  3CR9 A;  2OJT A;  3GBB A;  4PFT A;  5DVJ A;  4LZ8 A;  4FE8 A;  2OWT A;  4G2Z A;  1FQD A;  1B1X A;  1UIV A;  2O1M A;  1B3H A;  3HHF A;  4LA9 A;  3SEU A;  2RC8 A;  4RYA A;  4DCY A;  3CSB A;  4LQ5 A;  3OEN A;  5AA4 B;  3QUF A;  5FHN A;  3ZS6 A;  1URG A;  5I2K B;  5B7D A;  2H4I A;  4RY1 A;  4I8C A;  4ZEF A;  5JTY A;  2P0S A;  4IY6 A;  1HSJ A;  1P1Q A;  2V84 A;  1JET A;  4RPO A;  4YB6 A;  2Y7I A;  3UN6 A;  2F7B A;  2Q89 A;  4NTL A;  1B3F A;  5ITO A;  4OVJ A;  1Y3P A;  2DXY A;  1FCK A;  1N3W A;  3G3J A;  4G68 C;  1FTL A;  1I6Q A;  2AL5 A;  4LQ2 A;  4QRZ A;  4RK9 A;  1B5H A;  3UGW A;  4JWX A;  4RJZ A;  3KN7 A;  3OMB A;  3IOV A;  4KYE A;  3FVG A;  4MFI A;  3TTN A;  5FHM A;  2QS2 A;  3HPI A;  5CRY A;  3KZG A;  3ILU B;  3TEL A;  3HN0 A;  4DXC A;  4H5F A;  5I59 A;  4LVQ A;  2Q9T A;  3TZA A;  5F7V A;  4EUO A;  4RNS A;  5KZT A;  1UIU A;  4JXI A;  2E0S A;  1Y9U A;  2I0C A;  1UTB B;  1A8F A;  1N7W A;  1SW4 A;  2Z22 A;  2DE4 A;  4I1D A;  2ZMB A;  3MZB A;  2O7U A;  3LR1 A;  4IY5 A;  3SKP A;  3TCG A;  4YAH X;  5CI5 A;  2UVG A;  2ZNS A;  3IL1 B;  3K6X A;  4LP2 B;  3TOD A;  1VFD A;  1SW5 A;  3OEK A;  4MH5 A;  5I58 B;  3O66 A;  1B7U A;  5J1D A;  4ECF A;  2H98 A;  4XTC Q;  4XIG Q;  4OYV A;  3EHU A;  1BIY A;  4YB5 A;  1FTO A;  4PET A;  2XXU A;  4F39 A;  4OXV A;  3C31 A; 
#chains in the Genus database with same CATH topology
 3MVW A;  5KDT A;  1GVC A;  2XXW A;  5DVI A;  2DS9 A;  5I84 A;  3G7W A;  1ELJ A;  3JV9 A;  4WKM A;  2DP8 A;  4GBW A;  1NMU A;  1EZ9 A;  1FPF A;  4U22 A;  1XS5 A;  4XFE A;  3TCF A;  3LBS A;  3KEI A;  1NNF A;  3K0V A;  1DK4 A;  3KN3 A;  4AB5 A;  4H5G A;  1OMP A;  4R6H A;  5I2N B;  1R9L A;  3IX1 A;  2XWO A;  4OZ9 A;  4JWO A;  4PFY A;  4OMB A;  2F3D A;  1Q9D A;  3TQW A;  4THI A;  3QUJ A;  3LSW A;  2UVH A;  3H3G A;  1MY1 A;  4M4G A;  4KR5 A;  3TTL A;  2RC9 A;  1Y20 A;  4PF8 A;  5CMK A;  2XD2 A;  4ZEK A;  3TYH A;  2ZXT A;  3KG2 A;  5I5P A;  1A55 A;  2PYY A;  1QUK A;  1QW0 A;  2MKZ A;  2XX9 A;  2CZL A;  2XXX A;  3SES A;  1J1N A;  1ZTY A;  5L9M A;  1OQH A;  1H43 A;  2VPO A;  2HQ0 A;  2O69 A;  4XKN A;  3KBR A;  3SEY A;  2D21 A;  4U1Z A;  1RYX A;  1YAE A;  3O6I A;  3OO9 A;  2IA4 A;  4EQB A;  4PAI A;  3OEL A;  3H06 B;  1Q35 A;  1EZP A;  1MQJ A;  4HW8 A;  2F35 A;  4IGR A;  4H45 A;  4GLI A;  2F36 A;  1IXC A;  4GWU A;  5H8F A;  1P1O A;  2FYI A;  4OVS A;  3FUZ A;  5TP9 A;  3RGY A;  1FBC A;  1M5D A;  3MP6 A;  4ELR A;  5EYF A;  3W9W A;  4H1X A;  3R7X A;  1MS7 A;  4GWW A;  2O6A A;  3VLV A;  4P9K A;  2QMW A;  1GV8 A;  3KN8 A;  1DTG A;  1P1U A;  2PX1 A;  3KJT A;  3BFT A;  3RY3 A;  1LAF E;  3B6W A;  3HCQ A;  1H45 A;  3I6V A;  4P0G A;  3CG1 A;  5EQ9 A;  4YMB A;  3T9H B;  1S50 A;  1LLS A;  2X7Q A;  3PD8 A;  4H67 A;  3OO7 A;  5I2K A;  4MNP A;  4OVP A;  2PMS A;  3SDF A;  1SBP A;  4HCY A;  3FVN A;  4F1V A;  3QIM A;  3FAS A;  2GRV A;  1MPB A;  1MG1 A;  2Q88 A;  3G3K A;  4MHF A;  1SW1 A;  4U2R A;  1JW1 A;  3IB2 A;  2UXA A;  4KCD A;  4KD5 A;  4GRK A;  4Q0C A;  3QYT A;  3B6Q A;  2IEE A;  5F1Q A;  2YJP A;  4MMP A;  2B3B A;  3RT6 B;  1XT8 A;  3Q27 A;  3IFC A;  2OX3 A;  3SEV A;  4FEB A;  1QKB A;  5KDT B;  5H8N A;  1A40 A;  3RTW B;  3O6G A;  1VR5 A;  4JDF A;  1ZU0 A;  4ELO A;  1CB6 A;  1F9B A;  3IO6 A;  4F3B A;  3HO7 A;  4EXK A;  4GXA A;  4EQ7 A;  4ND9 A;  1NNT A;  1NFT A;  4NF4 B;  2QMX A;  3KFM A;  4QF9 A;  3T9U A;  4OET A;  4FED A;  2QRY A;  3Q25 A;  3MZ9 A;  2KQZ A;  3IOT A;  2I3W A;  2DE3 A;  3T93 B;  2CZH A;  2FIX A;  1B0H A;  1PB8 A;  1ATG A;  3T9X B;  3ONM A;  5B70 A;  4O7M A;  3MPK A;  3OEM A;  4NF5 B;  2QS3 A;  1FTK A;  1MXW A;  1B5J A;  1NH8 A;  3K6V A;  1WOD A;  1IMB A;  3DM0 A;  3OSR A;  4EF2 A;  1NV2 A;  1AH5 A;  1XI6 A;  5I3S A;  3TTM A;  2UVI A;  3TKD A;  4RXL A;  1DBZ A;  3C34 A;  1VE4 A;  1IQ7 A;  1FQA A;  1I69 A;  1MRP A;  4EF1 A;  4JSO A;  4FAT A;  4BDN A;  3MQ9 A;  4L17 A;  4X1D A;  2DYX A;  1TWY A;  3MVY A;  1PC3 A;  3IB0 A;  4F3S A;  1RDZ A;  3GBA A;  1PBQ A;  4GL0 A;  1FJ6 A;  2QS1 A;  2A5T B;  3FAT A;  3G3F A;  5FTI A;  4XF5 A;  3K02 A;  4XKQ A;  1DSN A;  4R72 A;  5HBC A;  4NF6 B;  3A3U A;  4H8I A;  4DIG A;  4DE8 A;  3HV1 A;  2I6E A;  5ET5 A;  3K1M A;  5ISU A;  3FVK A;  2RCB A;  2KR0 A;  5H8F B;  5TU0 A;  4OTE A;  3ZSF A;  2CZI A;  1QUJ A;  3C9H A;  2QVV A;  2HFB A;  1XVY A;  5TP9 B;  4NE4 A;  4TLL B;  1SVX B;  2HZK A;  5AA2 B;  1SDX A;  5I57 A;  1MY3 A;  1R9Q A;  2VPN A;  4N17 A;  3BFU A;  4KYD A;  2NUV A;  1JEV A;  2Y7K A;  4FAJ A;  5L8D A;  2O1L A;  1SQY A;  2PT1 A;  3FXU A;  3UP9 A;  3U72 A;  4GXS B;  3C36 A;  1MXZ A;  2ZNT A;  4PFT A;  5DVJ A;  3CR9 A;  2OJT A;  3GBB A;  4LZ8 A;  4FE8 A;  4LA9 A;  3HHF A;  3SEU A;  1IME A;  4JVD A;  1FSA A;  3ROJ A;  2H4I A;  4I8C A;  5JTY A;  2P0S A;  4IY6 A;  1IMD A;  1P1Q A;  4JVC A;  1KA0 A;  4LN5 A;  1Y3P A;  1I6Q A;  2AL5 A;  5IM2 A;  3UGW A;  1NUY A;  4MJO A;  5I59 A;  2QVR A;  3TZA A;  5KZT A;  1UIU A;  2E0S A;  2Z22 A;  2O7U A;  3LR1 A;  4YAH X;  2ZNS A;  3K6X A;  1B7U A;  5J1D A;  1FTA A;  5F24 A;  4OYV A;  4MNC A;  1FTO A;  3LV0 A;  2XXU A;  4OXV A;  4N4U A;  5H8N B;  4HE1 A;  4QBA A;  5H8Q B;  3M3K A;  4OFJ A;  4N6P A;  1TFA A;  4KPT A;  2WYP A;  3T66 A;  3LUZ A;  2FA7 A;  3IB1 A;  4ONY A;  1LBZ A;  2DSF A;  3BIG A;  5ICQ A;  4H6D A;  4MLV A;  4NF4 A;  2XXQ A;  4R74 A;  1RDX A;  5EYG A;  1QJM A;  3MYU A;  5H8S A;  4E0X A;  4FIM A;  2THI A;  1B0L A;  1A54 A;  1EH3 A;  1FBH A;  2D5W A;  1DPP A;  3IOU A;  1SYI A;  1B5I A;  4NF5 A;  1INP A;  5DTB A;  3EPE A;  1EYI A;  3VVF A;  1B3E A;  4PFI A;  3FD3 A;  3MVZ A;  2VHA A;  1LBW A;  4IO7 A;  1NUX A;  1LEV A;  2ZNU A;  3CRB A;  1N0T A;  3MZ1 A;  3KC1 A;  1B9J A;  2V4C A;  4POX A;  2XXV A;  4R9G A;  4PTK A;  3RNN A;  5CC2 A;  1NV0 A;  4GX4 A;  3VE1 B;  4PFU A;  3PPQ A;  3K6U A;  1CE2 A;  4N13 A;  4H0W A;  4KHZ E;  2OWZ A;  4F1U A;  3TUS A;  1JNF A;  1M5C A;  4PQJ A;  1OVT A;  3T22 A;  3HFU A;  3DP4 A;  1Y3Q A;  1II5 A;  4MF3 A;  4QFK A;  2F5X A;  2JJK A;  3DP8 A;  3QK6 A;  2A5T A;  1MY4 A;  2B3F A;  3PGF A;  4XKR A;  3G3H A;  5FBP A;  4NF6 A;  4PC9 A;  3OOA A;  3R6U A;  4U21 A;  1MM6 A;  1IZ1 A;  1NNP A;  2I3V A;  4O8M A;  4ELQ A;  3T1B A;  1KWH A;  2O51 A;  3H4Z A;  4AQ4 A;  1Y1M A;  3V5A A;  5IAI A;  1D4N A;  4GWY A;  3H6W A;  3LSL A;  4HCW A;  2B65 A;  2I48 A;  1DOT A;  4OVQ A;  3H7M A;  1JVY A;  4KFQ A;  2P3N A;  3GZG A;  1N76 A;  5TPA B;  3SET A;  2Q2C A;  1IXH A;  2I0B A;  3O6H A;  5AA2 A;  4JSD A;  4PFW A;  5I57 B;  2XXH A;  5LDZ A;  4YB7 A;  1LAG E;  5DVF A;  3CFZ A;  5IZ3 A;  2X26 A;  1FTM A;  4Q5T A;  3I3V A;  1IUD A;  4O3C A;  3PPO A;  3TCH A;  2DXR A;  3CFX A;  1RYO A;  4P56 A;  4YZZ A;  3RPW A;  3MC2 A;  3E13 X;  1LFI A;  5JTY B;  4POW A;  4P47 A;  5FTH A;  3EQ1 A;  1MDQ A;  1MY0 A;  3HST A;  1LBY A;  1KZ8 A;  1MPD A;  1JEU A;  1B1H A;  4OVR A;  1FQF A;  2DOJ A;  5J16 A;  4BDM A;  5I59 B;  4R2B A;  1BK4 A;  5CBS A;  1S7Y A;  4DDD A;  3EN3 A;  3USD A;  2HAV A;  3CHG A;  4LZ5 A;  1AWB A;  1SD3 A;  3DLN A;  3PMW A;  3E3K A;  2PCR A;  3RT8 A;  3UA8 A;  2XWI A;  1MXV A;  5HM4 B;  5CMB A;  1XHY A;  4P11 A;  4YU0 A;  2WBD A;  3JZJ A;  5L9S A;  3MP1 A;  1FBE A;  4FOR A;  4ZE9 A;  4OFL A;  4QFL A;  5H8Q A;  3VFJ A;  5ESY A;  3OO6 A;  2XA5 A;  1TXF A;  1TFD A;  2ESN A;  2VOZ A;  3E79 A;  1FBD A;  1AIV A;  4Q30 B;  1KA1 A;  1B58 A;  1ZIU A;  3V83 A;  5ICT A;  3KSX A;  4KXP A;  1LBB A;  2H9B A;  4XEQ A;  4DXB A;  4ESX A;  5I56 B;  3L6G A;  2ANJ A;  4ELP A;  4GD5 A;  4IB2 A;  4C1U A;  3IR1 A;  1D9V A;  1LGB C;  3BBR A;  5KCJ B;  2RC7 A;  4R73 A;  1MXY A;  3W15 C;  4YKP A;  5BWJ A;  4IO3 A;  3FJM A;  3FBP A;  2QPQ A;  3MBP A;  2YPN A;  5IZ1 A;  1PDA A;  2LAO A;  3MPL A;  1YCJ A;  2FVZ A;  5IGA A;  3IOR A;  1LCF A;  2D3I A;  5ET6 A;  4U1O A;  2AL4 A;  4I62 A;  2VP1 A;  4ESW A;  4TLM B;  3S9N C;  3K00 A;  1N7X A;  4PGP A;  1EZO A;  1H44 A;  5I7I A;  2ZZX A;  1FTJ A;  2UVJ A;  1LB9 A;  2OBG A;  3U92 A;  1US5 A;  4QSE A;  2KLF A;  3D4C A;  3EF7 A;  1OLC A;  3A3C A;  4OAN A;  3ZKL A;  5DYH A;  3FXR A;  4WXJ A;  1ZLQ A;  2XXP A;  4X8R A;  1Z7N E;  3LC8 A;  4YKJ A;  1FRP A;  3M3L A;  4LON B;  1MH4 A;  4F19 A;  4OFO A;  1IXI A;  4Z7E A;  3N6U A;  4OEN A;  2WKY A;  4ZEC A;  4MAG A;  1VFE A;  1N3X A;  4X48 A;  3VLW A;  3FXQ A;  1NUZ A;  4QSD A;  3TAJ A;  2UYE A;  4JB7 A;  4RK2 A;  3WAE A;  1N84 A;  4KCC A;  3Q28 A;  1XC1 A;  2OCU A;  4MNI A;  1IIT A;  2Y7P A;  4NAP A;  4ZZE A;  3G3G A;  5TPA A;  1NUW A;  4U23 A;  4N8G A;  4F29 A;  3PUY E;  3PD9 A;  2WBB A;  2XXK A;  2V3U A;  5IZ3 B;  1IEJ A;  2ONS A;  1M5E A;  3PPN A;  3A09 A;  5DEX A;  3U8Q A;  3T0J A;  4F31 B;  4IO4 A;  5AA2 D;  2F7A A;  4RPN A;  2QSX A;  2DVZ A;  2Y84 A;  1K9Y A;  1B1X A;  4DCY A;  3OEN A;  5AA4 B;  3QUF A;  3ZS6 A;  4ZEF A;  4NX1 A;  2Y7I A;  3UN6 A;  1B3F A;  4P8B A;  4N81 A;  4G68 C;  4RK9 A;  3OMB A;  3IOV A;  4KYE A;  4MFI A;  2QS2 A;  3HPI A;  2PFZ A;  5LTC A;  3TEL A;  2FHY A;  2Q9T A;  4PF6 A;  4RNS A;  2QFL A;  4JXI A;  2I0C A;  1UTB B;  3TCG A;  2UVG A;  3B50 A;  1VFD A;  1SW5 A;  3OEK A;  4ECF A;  1BIY A;  4PET A;  3FGS A;  2R8T A;  4GF8 A;  3C33 A;  3QSL A;  1O63 A;  4G8N A;  2I58 A;  2WEF A;  4H46 A;  4PP0 A;  1B05 A;  4F1Y A;  2Y7R A;  2V93 A;  3VVD A;  4MIJ A;  2R71 A;  1M5F A;  3TPA A;  4R75 A;  2ALU A;  2P3V A;  1A7L A;  4GVO A;  1OIB A;  3PTY A;  5CMC A;  1LFG A;  1FJ9 A;  2CEX A;  1NV4 A;  3PMV A;  5H8H B;  5I56 A;  3IO4 A;  3SZP A;  1LAH E;  3CI8 A;  1FBF A;  3R26 A;  5KCJ A;  2F7C A;  4G68 B;  3BKI B;  4OES A;  4QXD A;  1NI9 A;  4NF0 A;  1BP5 A;  4F2Q A;  3F11 A;  1PB9 A;  4GOT A;  2H99 A;  3UIF A;  1K9Z A;  4MX6 A;  1A99 A;  2P2A A;  5JK4 A;  2ZYK A;  3CSG A;  1SI0 A;  3PUV E;  3N6T A;  4R9F A;  2RCA A;  2XWV A;  1YZ0 A;  1FPK A;  3MST A;  3MAM A;  1AOV A;  4JWY A;  4KYS A;  3KJ7 A;  4PDH A;  3ISP A;  2ZYN A;  3TTK A;  1B40 A;  2YLN A;  4GWO A;  3CG3 A;  2OZZ A;  2PFY A;  1JW4 A;  2REG A;  3HHG A;  1MXX A;  1OQG A;  4NF8 A;  1B32 A;  5L9O A;  1QKA A;  2I4B A;  1SW2 A;  3QMF A;  4F22 A;  4ZDM A;  3PMX A;  2X7P A;  5T3J A;  3H6V A;  5EHS A;  3MJN A;  3OSQ A;  5A5X A;  2ZYM A;  1MDP 1;  4N8Y A;  3DEL B;  4QSC A;  3PUX E;  1R1N A;  3VVE A;  4I9D A;  1POY 1;  3D4G A;  1DMB A;  3ECR A;  2O7I A;  4XXU A;  4PFR A;  4H65 A;  3VV5 A;  4PE5 B;  5DW8 A;  4JVI A;  3KSJ A;  1URS A;  3GYY A;  5DEX B;  3VDF A;  4Q8R A;  1RKM A;  4WEP A;  4BDQ A;  3M8U A;  3G3I A;  4DXU A;  1LBX A;  4YKI A;  3TFL A;  3T9V A;  1NV5 A;  5AA4 A;  2V3Q A;  4Z0I A;  1NL5 A;  3SER A;  4U4X A;  4G77 A;  2FNC A;  2AYS A;  4G61 A;  1VSO A;  1Y3N A;  3S9L C;  4GQO A;  1P1N A;  3ILT B;  3P7I A;  1LBV A;  3BIH A;  1UTB A;  1BTJ A;  3KGC A;  1Y1Z A;  1FPE A;  4BLA A;  2ABH A;  1PEB A;  1POT A;  5I58 A;  2RIN A;  2WYK A;  1FW0 A;  1EU8 A;  4ISU A;  4NWD A;  3O97 A;  1IXG A;  3QXM A;  2F34 A;  3LSF B;  5LOM A;  2HXW A;  4ZS9 A;  2Z8F A;  2PBW A;  4HTG A;  4HE2 A;  1IMC A;  4RA1 A;  1S9T A;  1LFH A;  1ZJL A;  2VGQ A;  4PAF A;  3CVG A;  1M5B A;  1NKX A;  1O64 A;  2FBP A;  4BDO A;  1USY E;  4ZEI A;  2F6P A;  2R9J A;  5K2Y A;  5IKB A;  1DTZ A;  4FJP A;  4R6K A;  1A8E A;  5ELV A;  1OLA A;  4O3A A;  4EDP A;  5H8H A;  4DI4 B;  4OWD A;  1D9Q A;  1QGX A;  2CEY A;  4X04 A;  3Q26 A;  1YPN A;  1YXI A;  4G68 A;  4ZEB A;  5M2V A;  2ONK E;  3RN8 A;  1RDY A;  2DWI A;  3E9X A;  4NED A;  4M1V A;  1AMF A;  4YIC A;  5CBR A;  3PPR A;  1GGG A;  1QVS A;  3LSX A;  4LUB A;  2RF1 A;  1N04 A;  4IO6 A;  2Q2A A;  2AIX A;  4QHQ A;  1IMF A;  1SYH A;  4EXL A;  1FPD A;  2F3B A;  3SEW A;  3K4U A;  3TEP A;  1JQF A;  2QVU A;  5DT6 A;  1BKA A;  3IAZ A;  1TT1 A;  1YTV A;  4R2F A;  2HZL A;  3KC0 A;  1ZBM A;  1MQG A;  3RPL A;  1P1W A;  2FIE A;  3I5O A;  4N15 A;  4NF8 B;  1CNQ A;  3FZV A;  2GHB A;  4WED A;  3D1R A;  3IJX B;  1GR2 A;  3PUW E;  5A5X B;  5ET7 A;  3O29 A;  4NHB A;  4NGU A;  2XD3 A;  3KBZ A;  2OWS A;  2XXT A;  2G93 A;  4H8J A;  4MLQ A;  2QS4 A;  3IJO B;  2I4C A;  3THI A;  2B4M A;  2OK2 A;  4G4P A;  4OER A;  3FV1 A;  2F8D A;  3OXN A;  2R6G E;  2ZYO A;  2O84 X;  1PB7 A;  2ONR A;  2P1S A;  4GWX A;  2OWT A;  1UIV A;  1B3H A;  5ET8 A;  3CSB A;  4LQ5 A;  4PAK A;  5FHN A;  1URG A;  5B7D A;  4RPO A;  2V84 A;  1JET A;  4YB6 A;  2Q89 A;  4NTL A;  5ITO A;  4OVJ A;  1FCK A;  3G3J A;  1FTL A;  4QRZ A;  1B5H A;  2HPG A;  5EQ7 A;  3FVG A;  5FHM A;  5CRY A;  3KZG A;  3ILU B;  4H5F A;  5F7V A;  4PCD A;  1FPG A;  1Y9U A;  1N7W A;  4IY5 A;  4I1D A;  2DE4 A;  4DLD A;  3MZB A;  2Y5K A;  3SKP A;  4LP2 B;  1FPI A;  5I58 B;  2H98 A;  4XTC Q;  4XIG Q;  3EHU A;  4YB5 A;  2GH9 A;  4NN3 A;  2W7Y A;  2F6G A;  3T96 B;  4I3E A;  2Y5L A;  4UAB A;  1FBG A;  2DWJ A;  2Q8J A;  3FJ7 A;  4F3G A;  3U1O A;  1B46 A;  1I6A A;  3CFL A;  4ZED A;  4U4S A;  2XHD A;  4BDL A;  4N91 A;  2XX7 A;  3LUY A;  3MW0 A;  2REJ A;  4XKP A;  3VXC A;  4UAC A;  3ZKK A;  1URD A;  1HSE A;  1YYZ A;  4N07 A;  4PFB A;  3S9M C;  4NMY A;  4DI3 D;  1UTH B;  4G8M A;  2H5Y A;  4GWZ A;  1Y4C A;  1L5T A;  2GQ1 A;  3PU5 A;  4OEU A;  4AB6 A;  5AA3 A;  3MVX A;  3E78 A;  3TMG A;  1B4Z A;  3RQT A;  4OVT A;  3O9P A;  1B7Z A;  1FQB A;  3PPP A;  1DPE A;  3FJG A;  1O7T A;  3V8X B;  1US4 A;  1SPI A;  3S2V A;  1B2H A;  4DCX A;  2DE2 A;  4IO2 A;  3C4M A;  1B3G A;  4GIZ A;  1MQD A;  3N94 A;  2VD2 A;  1VDW A;  4LAT A;  4F2O A;  2HHM A;  3TQL A;  1H3D A;  4AS5 A;  3RPL B;  1WVJ A;  3K1P A;  3KOT A;  5K2X A;  1PBP A;  2V25 A;  3FV2 A;  1MY2 A;  4GFR A;  3N26 A;  4TQU Q;  3QAX A;  1LB8 A;  1XVX A;  1LBC A;  5AA1 A;  4YMA A;  2NOO A;  3C35 A;  2HAU A;  2DWH A;  2Z8D A;  4N6D A;  5EQ8 A;  3H6T A;  3KOS A;  3K2D A;  4BDR A;  2GHA A;  1Z7M E;  2B4L A;  3B6T A;  1I6B A;  3MUQ A;  4FBP A;  2Q74 A;  3PV0 E;  1SI1 A;  3UOR A;  1Y4T A;  1MXU A;  1FPB A;  3L6H A;  1USY H;  1EYJ A;  2VT5 A;  1BLF A;  3EHT A;  4GWS A;  3U65 A;  4DZ1 A;  3MP8 A;  3W9V A;  3JYR A;  3M3F A;  1XOC A;  3RTF B;  1NV6 A;  4MCO A;  3AXF A;  4P1L A;  1H76 A;  3K01 A;  1EYK A;  3ODB A;  4JBZ A;  4OHN A;  1JP4 A;  4UA8 A;  5JEI A;  4AS4 A;  3U93 A;  4TOZ A;  3OO8 A;  2BJI A;  4C0R A;  1FBP A;  2ZZW A;  1B6H A;  2G29 A;  4HE0 A;  2CMO A;  1MQI A;  1NV1 A;  2RKM A;  4X1B A;  3RLF E;  1GTK A;  2NVU B;  4O7I A;  3O28 A;  1B51 A;  4I3Y A;  1AL3 A;  3PUZ E;  4OQO A;  2E1S A;  3V89 B;  1HSL A;  3H03 A;  3WAF A;  4P0I A;  1FPJ A;  2O68 A;  1FPL A;  4K3F A;  1JVX A;  2HXR A;  4R6Y A;  4PBH A;  1MM7 A;  3TDJ A;  4NQ8 A;  5EQA A;  3GLB A;  4GL8 A;  3U94 A;  4F3P A;  4PGN A;  5EHM A;  3EHS A;  2Y7W A;  1MQH A;  4GX6 A;  2V3T A;  5CM6 A;  2QJE A;  1FQC A;  2XXY A;  3H6U A;  4KQP A;  2WX9 A;  1D3K A;  2XWK A;  1UQW A;  1B7H A;  3S4U A;  4IGT A;  4QFP A;  1FQE A;  2Z8E A;  3K6W A;  3EKI A;  2XXI A;  5ITP A;  2OLB A;  3FVO A;  5HPQ A;  1NH7 A;  4HXV A;  4ZE8 A;  4OEV A;  4C1T A;  1NNK A;  5I2N A;  4LZ7 A;  4F18 A;  3B7D A;  3SEX A;  3FXB A;  1QUI A;  3UK4 A;  2DQV A;  4NWC A;  1UTH A;  4YKK A;  2QL3 A;  1B52 A;  4E0W A;  3VLU A;  2H25 A;  3VXB A;  1B3L A;  2F78 A;  4O94 A;  3MWB A;  1IIW A;  1D9Y A;  4EQ9 A;  3RYD A;  2HEU A;  1Q1K A;  1ZKB A;  2NWJ A;  1G0I A;  2F97 A;  2DVC A;  4IR8 A;  1B4H A;  3NOH A;  4PE3 A;  4GX3 A;  1DCU A;  3RUM A;  2L5V A;  3DP6 A;  5CMM A;  1LAX A;  3Q29 A;  4FEC A;  2GFE A;  3TTR A;  1QUL A;  2Z23 A;  3CIJ A;  5A5L A;  4PBQ A;  2M8C A;  1OVB A;  2BJJ X;  2UYF A;  3K1N A;  1ANF A;  1LST A;  1NV3 A;  2PVU A;  4OA4 A;  3OD7 A;  5IZZ A;  3E4R A;  4P1E A;  3C32 A;  3IK6 B;  2HCA A;  2A5S A;  1MPC A;  3N5L A;  4IO5 A;  1T0K A;  3B8B A;  4KI0 E;  2XXR A;  4MEV A;  4P3L A;  1WDN A;  4G8H A;  2ZZV A;  1LCT A;  5BUU A;  1ZMG A;  2VD3 A;  4HS7 A;  2XX8 A;  1JW5 A;  4QFO A;  3GXA A;  3IOW A;  3FIR A;  1R6Z A;  2CZK A;  5AE4 A;  3S9E A;  4X9T A;  1MH3 A;  1G0H A;  2NXO A;  5FHO A;  4ZZA A;  4O3B A;  4MBP A;  3O2A A;  4QFN A;  2DWA A;  2I49 A;  1P99 A;  3A29 A;  4G2Z A;  1FQD A;  2O1M A;  1IMA A;  2RC8 A;  4RYA A;  1NV7 A;  5I2K B;  4RY1 A;  4PDD A;  1HSJ A;  2F7B A;  2DXY A;  1N3W A;  4LQ2 A;  4JWX A;  4RJZ A;  3IFA A;  3KN7 A;  3TTN A;  4I40 A;  3HN0 A;  4DXC A;  5EYH A;  4LVQ A;  2Q8M A;  4EUO A;  4N6K A;  1A8F A;  1SW4 A;  2ZMB A;  2DDK A;  5CI5 A;  3IL1 B;  3TOD A;  4NG7 A;  4GBV A;  4MH5 A;  3O66 A;  2PT2 A;  4F39 A;  3C31 A; 
#chains in the Genus database with same CATH homology
 3FGS A;  3MVW A;  2W7Y A;  5KDT A;  5H8N B;  1GVC A;  2F6G A;  2XXW A;  4GF8 A;  3C33 A;  3QSL A;  5DVI A;  3T96 B;  1O63 A;  4G8N A;  2I58 A;  2DS9 A;  5H8Q B;  2DWJ A;  5I84 A;  2Q8J A;  3FJ7 A;  4PP0 A;  1B05 A;  3G7W A;  1ELJ A;  4F3G A;  3U1O A;  3M3K A;  4OFJ A;  2Y7R A;  1TFA A;  4N6P A;  3JV9 A;  4WKM A;  2V93 A;  4F1Y A;  1B46 A;  4KPT A;  3VVD A;  2DP8 A;  1I6A A;  1NMU A;  2R71 A;  3CFL A;  1EZ9 A;  1M5F A;  3TPA A;  3T66 A;  4U22 A;  4ZED A;  1XS5 A;  3TCF A;  2FA7 A;  3IB1 A;  4ONY A;  4R75 A;  4U4S A;  2XHD A;  3LBS A;  2DSF A;  2ALU A;  2XX7 A;  3KEI A;  4BDL A;  5ICQ A;  3LUY A;  3MW0 A;  4H6D A;  4MLV A;  4NF4 A;  2REJ A;  2XXQ A;  4R74 A;  1NNF A;  1A7L A;  4GVO A;  1OIB A;  1QJM A;  3K0V A;  4XKP A;  5CMC A;  1LFG A;  5H8S A;  3VXC A;  4E0X A;  4FIM A;  3KN3 A;  2THI A;  4UAC A;  1B0L A;  4AB5 A;  1A54 A;  1EH3 A;  4H5G A;  3ZKK A;  3PMV A;  1OMP A;  5H8H B;  1URD A;  5I56 A;  1HSE A;  2D5W A;  4R6H A;  1DPP A;  3IO4 A;  5I2N B;  1R9L A;  3IX1 A;  3IOU A;  4N07 A;  1SYI A;  3S9M C;  1LAH E;  4NMY A;  1B5I A;  3CI8 A;  1UTH B;  4G8M A;  4NF5 A;  4OZ9 A;  2H5Y A;  5DTB A;  1Y4C A;  3R26 A;  5HM4 B;  3EPE A;  2F7C A;  4JWO A;  4PFY A;  1L5T A;  4OMB A;  3VVF A;  5KCJ A;  1B3E A;  4G68 B;  3FD3 A;  3TQW A;  3BKI B;  4THI A;  3MVZ A;  3PU5 A;  3QUJ A;  4OES A;  2VHA A;  3LSW A;  2UVH A;  3H3G A;  1MY1 A;  3S9L C;  4M4G A;  4DZ1 A;  4KR5 A;  4OEU A;  1BP5 A;  4AB6 A;  5AA3 A;  4IO7 A;  4F2Q A;  3F11 A;  1PB9 A;  3MVX A;  4GOT A;  2ZNU A;  3CRB A;  1N0T A;  3MZ1 A;  3TTL A;  3TMG A;  1B9J A;  2H99 A;  1B4Z A;  4POX A;  2RC9 A;  2XXV A;  4R9G A;  1Y20 A;  3RQT A;  5CMK A;  3RNN A;  5CC2 A;  3UIF A;  2XD2 A;  3O9P A;  4ZEK A;  1A99 A;  2P2A A;  1B7Z A;  4PFU A;  3TYH A;  3VE1 B;  2ZXT A;  1FQB A;  3PPQ A;  3PPP A;  3K6U A;  5JK4 A;  1CE2 A;  1DPE A;  2ZYK A;  3FJG A;  3KG2 A;  4N13 A;  4H0W A;  4KHZ E;  1A55 A;  3CSG A;  1SI0 A;  2PYY A;  3PUV E;  1O7T A;  4F1U A;  3N6T A;  4R9F A;  2RCA A;  3V8X B;  1QUK A;  1US4 A;  3TUS A;  1JNF A;  1QW0 A;  2XX9 A;  2CZL A;  1M5C A;  3S2V A;  2XXX A;  4PQJ A;  3SES A;  1B2H A;  1J1N A;  1OVT A;  3MAM A;  3T22 A;  4DCX A;  1ZTY A;  4JWY A;  5L9M A;  1AOV A;  4KYS A;  2GH9 A;  3KJ7 A;  2DE2 A;  4IO2 A;  3C4M A;  3DP4 A;  1B3G A;  1OQH A;  1Y3Q A;  1II5 A;  1H43 A;  4GIZ A;  4MF3 A;  2ZYN A;  3TTK A;  1MQD A;  3N94 A;  1B40 A;  4QFK A;  2VD2 A;  2F5X A;  2YLN A;  3CG3 A;  4GWO A;  2OZZ A;  3DP8 A;  3QK6 A;  2A5T A;  4LAT A;  4F2O A;  1JW4 A;  3TQL A;  2HQ0 A;  1H3D A;  1MY4 A;  2O69 A;  2B3F A;  4XKN A;  2REG A;  3PGF A;  1WVJ A;  3HHG A;  4XKR A;  1MXX A;  3KBR A;  3K1P A;  3KOT A;  1OQG A;  4NF8 A;  3G3H A;  5K2X A;  2D21 A;  1B32 A;  4U1Z A;  1PBP A;  2V25 A;  1RYX A;  1YAE A;  1QKA A;  2I4B A;  4NF6 A;  5L9O A;  3O6I A;  3FV2 A;  1MY2 A;  3OOA A;  3OO9 A;  4GFR A;  3N26 A;  4TQU Q;  1SW2 A;  3QAX A;  1LB8 A;  2IA4 A;  1XVX A;  1LBC A;  3R6U A;  4U21 A;  5AA1 A;  4EQB A;  4ZDM A;  4F22 A;  1MM6 A;  1IZ1 A;  1NNP A;  3PMX A;  2X7P A;  4YMA A;  2I3V A;  2NOO A;  3C35 A;  3OEL A;  2HAU A;  2DWH A;  2Z8D A;  1Q35 A;  1KWH A;  3H06 B;  3H6V A;  1MQJ A;  4ELQ A;  1EZP A;  4HW8 A;  5EHS A;  3H6T A;  2F35 A;  2O51 A;  3K2D A;  3KOS A;  3MJN A;  3H4Z A;  2GHA A;  3OSQ A;  4IGR A;  4BDR A;  5A5X A;  2ZYM A;  1MDP 1;  3DEL B;  4GLI A;  1Y1M A;  1IXC A;  2F36 A;  4QSC A;  4AQ4 A;  1Z7M E;  3V5A A;  3B6T A;  1I6B A;  3MUQ A;  5H8F A;  5IAI A;  1D4N A;  3PUX E;  1R1N A;  3PV0 E;  3H6W A;  1SI1 A;  1P1O A;  2FYI A;  3LSL A;  3VVE A;  4HCW A;  2B65 A;  3UOR A;  2I48 A;  1DOT A;  1Y4T A;  3H7M A;  3FUZ A;  5TP9 A;  4I9D A;  3RGY A;  1JVY A;  1MXU A;  3L6H A;  1USY H;  4KFQ A;  3GZG A;  1M5D A;  1N76 A;  3MP6 A;  5EYF A;  5TPA B;  3SET A;  2Q2C A;  4ELR A;  3W9W A;  1IXH A;  2I0B A;  3O6H A;  5AA2 A;  4H1X A;  4JSD A;  4PFW A;  3R7X A;  1MS7 A;  5I57 B;  1POY 1;  1BLF A;  2XXH A;  3D4G A;  3EHT A;  2O6A A;  1DMB A;  4YB7 A;  1LAG E;  3ECR A;  3MP8 A;  3VLV A;  2O7I A;  5DVF A;  3JYR A;  3W9V A;  2QMW A;  4XXU A;  3M3F A;  1GV8 A;  3KN8 A;  3CFZ A;  1XOC A;  4H65 A;  3RTF B;  1DTG A;  1P1U A;  3VV5 A;  2X26 A;  2PX1 A;  3TTR A;  4PE5 B;  3AXF A;  3KJT A;  1FTM A;  3BFT A;  4Q5T A;  3KSJ A;  1URS A;  3RY3 A;  1LAF E;  3I3V A;  5DEX B;  3VDF A;  4Q8R A;  1RKM A;  1IUD A;  1H76 A;  3K01 A;  4O3C A;  3PPO A;  3M8U A;  4WEP A;  3TCH A;  4BDQ A;  3B6W A;  2DXR A;  3HCQ A;  3ODB A;  3CFX A;  4JBZ A;  4OHN A;  3G3I A;  1RYO A;  1H45 A;  3I6V A;  4P0G A;  4YZZ A;  3CG1 A;  4UA8 A;  3RPW A;  5JEI A;  3U93 A;  4YMB A;  3T9H B;  4DXU A;  1S50 A;  4TOZ A;  4YKI A;  1LLS A;  3OO8 A;  2X7Q A;  3PD8 A;  4H67 A;  3TFL A;  3T9V A;  3MC2 A;  3E13 X;  3OO7 A;  5AA4 A;  2V3Q A;  5I2K A;  4Z0I A;  4C0R A;  1NL5 A;  1LFI A;  5JTY B;  1B6H A;  4POW A;  3SER A;  2G29 A;  2PMS A;  4U4X A;  3EQ1 A;  5FTH A;  3SDF A;  1SBP A;  2CMO A;  1MQI A;  1MDQ A;  1MY0 A;  3HST A;  4HCY A;  4G77 A;  2FNC A;  3FVN A;  2RKM A;  2AYS A;  3QIM A;  4X1B A;  3RLF E;  3FAS A;  4F1V A;  1GTK A;  2NVU B;  1MPD A;  3O28 A;  2GRV A;  1VSO A;  1B51 A;  1JEU A;  1MPB A;  1Y3N A;  1AL3 A;  1MG1 A;  2Q88 A;  1B1H A;  3PUZ E;  4OQO A;  1FQF A;  2E1S A;  4GQO A;  3V89 B;  1P1N A;  1HSL A;  2DOJ A;  3G3K A;  1SW1 A;  4BDM A;  4U2R A;  1JW1 A;  5I59 B;  3IB2 A;  3H03 A;  3ILT B;  2UXA A;  3WAF A;  3P7I A;  4KCD A;  4KD5 A;  4R2B A;  5CBS A;  1S7Y A;  4DDD A;  3EN3 A;  4GRK A;  3USD A;  2HAV A;  1BTJ A;  1UTB A;  4P0I A;  4Q0C A;  3KGC A;  3QYT A;  4LZ5 A;  2O68 A;  2IEE A;  1SD3 A;  3B6Q A;  3DLN A;  1Y1Z A;  3PMW A;  3E3K A;  4K3F A;  5F1Q A;  4BLA A;  1JVX A;  2YJP A;  4R6Y A;  2B3B A;  3RT6 B;  2ABH A;  3RT8 A;  1MM7 A;  1PEB A;  1POT A;  3UA8 A;  3TDJ A;  5I58 A;  2RIN A;  1MXV A;  1FW0 A;  1EU8 A;  1XT8 A;  4ISU A;  1XHY A;  3GLB A;  4NWD A;  4P11 A;  5CMB A;  3O97 A;  3Q27 A;  4GL8 A;  1IXG A;  3JZJ A;  3QXM A;  4YU0 A;  5EHM A;  3U94 A;  4F3P A;  5L9S A;  2F34 A;  3SEV A;  3MP1 A;  4FEB A;  3LSF B;  1QKB A;  2Y7W A;  3EHS A;  5H8N A;  5KDT B;  5LOM A;  1A40 A;  1MQH A;  2V3T A;  2HXW A;  4FOR A;  3RTW B;  4ZE9 A;  4ZS9 A;  4OFL A;  4QFL A;  5H8Q A;  3VFJ A;  2Z8F A;  3O6G A;  5CM6 A;  1VR5 A;  2PBW A;  4HTG A;  2QJE A;  4JDF A;  1FQC A;  4DLD A;  2XXY A;  3H6U A;  3OO6 A;  4RA1 A;  1ZU0 A;  4KQP A;  1S9T A;  4ELO A;  1CB6 A;  1F9B A;  1LFH A;  1D3K A;  1ZJL A;  3IO6 A;  4F3B A;  1TXF A;  2VGQ A;  1TFD A;  3CVG A;  1M5B A;  3HO7 A;  2ESN A;  2VOZ A;  1NKX A;  1O64 A;  1UQW A;  4BDO A;  1B7H A;  1USY E;  4ZEI A;  4EXK A;  4GXA A;  3S4U A;  4IGT A;  4EQ7 A;  4QFP A;  1AIV A;  1FQE A;  2Z8E A;  3K6W A;  4Q30 B;  4ND9 A;  1NNT A;  2F6P A;  2R9J A;  1NFT A;  4NF4 B;  1B58 A;  2QMX A;  2XXI A;  3KFM A;  5ITP A;  1ZIU A;  4QF9 A;  3T9U A;  4OET A;  4FED A;  5K2Y A;  2QRY A;  3Q25 A;  5IKB A;  3MZ9 A;  1DTZ A;  3V83 A;  3IOT A;  4FJP A;  4R6K A;  1A8E A;  2I3W A;  3KSX A;  5ELV A;  5ICT A;  1LBB A;  1OLA A;  2DE3 A;  2H9B A;  2OLB A;  3FVO A;  4O3A A;  3T93 B;  4EDP A;  4DXB A;  4ESX A;  5HPQ A;  1B0H A;  1NH7 A;  5H8H A;  5I56 B;  1PB8 A;  1ATG A;  4ZE8 A;  4OEV A;  3T9X B;  3L6G A;  2ANJ A;  1NNK A;  4C1T A;  4LZ7 A;  4ELP A;  5I2N A;  4GD5 A;  4IB2 A;  3B7D A;  3ONM A;  4OWD A;  3SEX A;  4C1U A;  3IR1 A;  4F18 A;  1D9V A;  5B70 A;  1QUI A;  1LGB C;  3UK4 A;  2DQV A;  3MPK A;  4NWC A;  2PT2 A;  1UTH A;  3BBR A;  3OEM A;  3Q26 A;  4NF5 B;  4YKK A;  1YPN A;  2QS3 A;  1FTK A;  1MXW A;  5KCJ B;  1B5J A;  1NH8 A;  2RC7 A;  2QL3 A;  3K6V A;  1WOD A;  4R73 A;  1B52 A;  1MXY A;  4G68 A;  4ZEB A;  5M2V A;  4E0W A;  3VLU A;  2ONK E;  3RN8 A;  3DM0 A;  3OSR A;  2H25 A;  3VXB A;  1B3L A;  4YKP A;  3W15 C;  2F78 A;  4EF2 A;  5BWJ A;  4IO3 A;  3FJM A;  2DWI A;  3E9X A;  4NED A;  2QPQ A;  1AH5 A;  3TTM A;  3MBP A;  2YPN A;  3MWB A;  1IIW A;  1D9Y A;  4M1V A;  1PDA A;  2UVI A;  1AMF A;  4YIC A;  2LAO A;  3MPL A;  1YCJ A;  3TKD A;  4RXL A;  4EQ9 A;  5CBR A;  3PPR A;  1GGG A;  2HEU A;  1QVS A;  3LSX A;  1Q1K A;  3IOR A;  1ZKB A;  4LUB A;  2NWJ A;  1LCF A;  2RF1 A;  3C34 A;  2D3I A;  1VE4 A;  1IQ7 A;  2F97 A;  4U1O A;  1FQA A;  1N04 A;  2AL4 A;  2DVC A;  4I62 A;  4IO6 A;  1I69 A;  1MRP A;  4EF1 A;  1B4H A;  4JSO A;  2Q2A A;  2VP1 A;  4ESW A;  2AIX A;  4QHQ A;  4FAT A;  4BDN A;  4TLM B;  1SYH A;  3MQ9 A;  4L17 A;  3K00 A;  3S9N C;  4X1D A;  3RUM A;  2DYX A;  3DP6 A;  4EXL A;  1N7X A;  1EZO A;  1H44 A;  3K4U A;  3SEW A;  1FTJ A;  1JQF A;  3TEP A;  5DT6 A;  1TWY A;  1BKA A;  5CMM A;  2UVJ A;  3IAZ A;  1LAX A;  3MVY A;  1LB9 A;  1PC3 A;  1TT1 A;  2OBG A;  1YTV A;  3Q29 A;  3U92 A;  1US5 A;  3IB0 A;  4R2F A;  4F3S A;  3GBA A;  2HZL A;  4FEC A;  1PBQ A;  4GL0 A;  2QS1 A;  1ZBM A;  2A5T B;  2GFE A;  3FAT A;  3G3F A;  4QSE A;  2KLF A;  3D4C A;  1MQG A;  3EF7 A;  5FTI A;  1QUL A;  1OLC A;  3K02 A;  2Z23 A;  3A3C A;  3CIJ A;  1P1W A;  4XKQ A;  1DSN A;  3ZKL A;  5DYH A;  4R72 A;  3I5O A;  3FXR A;  4NF8 B;  4WXJ A;  1ZLQ A;  5HBC A;  2XXP A;  1Z7N E;  3FZV A;  3LC8 A;  2GHB A;  2M8C A;  4NF6 B;  1OVB A;  2BJJ X;  4YKJ A;  2UYF A;  3M3L A;  3A3U A;  3K1N A;  4LON B;  1MH4 A;  4H8I A;  4F19 A;  4DIG A;  4WED A;  4OFO A;  1ANF A;  4DE8 A;  1IXI A;  1LST A;  4Z7E A;  3HV1 A;  3N6U A;  3IJX B;  4OEN A;  2WKY A;  1GR2 A;  2PVU A;  4ZEC A;  2I6E A;  3OD7 A;  3K1M A;  3PUW E;  5ISU A;  3E4R A;  2RCB A;  3FVK A;  5A5X B;  1VFE A;  1N3X A;  4X48 A;  3VLW A;  3FXQ A;  3C32 A;  3IK6 B;  2HCA A;  4QSD A;  3TAJ A;  2A5S A;  1MPC A;  3N5L A;  2UYE A;  3O29 A;  4JB7 A;  4RK2 A;  5H8F B;  4IO5 A;  5TU0 A;  3WAE A;  4OTE A;  2XD3 A;  3ZSF A;  2OWS A;  1N84 A;  2XXT A;  4KI0 E;  2G93 A;  1QUJ A;  4H8J A;  4KCC A;  3Q28 A;  3C9H A;  2XXR A;  1XC1 A;  1WDN A;  2OCU A;  4MLQ A;  2HFB A;  4G8H A;  1XVY A;  5TP9 B;  4NE4 A;  1IIT A;  2Y7P A;  2QS4 A;  4TLL B;  1LCT A;  2I4C A;  3IJO B;  3G3G A;  4ZZE A;  5TPA A;  3THI A;  5BUU A;  4U23 A;  1ZMG A;  1SVX B;  2HZK A;  2VD3 A;  4HS7 A;  2XX8 A;  1SDX A;  5AA2 B;  5I57 A;  1JW5 A;  2OK2 A;  4F29 A;  4QFO A;  3GXA A;  3SEY A;  4G4P A;  3PUY E;  4OER A;  1MY3 A;  1R9Q A;  3PD9 A;  3IOW A;  3FV1 A;  2F8D A;  1R6Z A;  3FIR A;  2V3U A;  3OXN A;  2R6G E;  1IEJ A;  3BFU A;  4KYD A;  2ZYO A;  2O84 X;  1PB7 A;  2NUV A;  2ONS A;  5AE4 A;  3S9E A;  4X9T A;  1MH3 A;  1JEV A;  1T0K A;  1M5E A;  3PPN A;  3A09 A;  5DEX A;  2Y7K A;  3U8Q A;  4FAJ A;  2NXO A;  2ONR A;  5FHO A;  5L8D A;  4F31 B;  2P1S A;  2O1L A;  4IO4 A;  1SQY A;  2F7A A;  2PT1 A;  4ZZA A;  4O3B A;  5AA2 D;  3FXU A;  4MBP A;  3UP9 A;  3U72 A;  3O2A A;  4GXS B;  4RPN A;  3C36 A;  2QSX A;  1MXZ A;  4QFN A;  2DWA A;  2ZNT A;  2DVZ A;  1P99 A;  2I49 A;  2Y84 A;  3CR9 A;  2OJT A;  3GBB A;  4PFT A;  5DVJ A;  4LZ8 A;  4FE8 A;  2OWT A;  4G2Z A;  1FQD A;  1B1X A;  1UIV A;  2O1M A;  1B3H A;  3HHF A;  4LA9 A;  3SEU A;  2RC8 A;  4RYA A;  4DCY A;  3CSB A;  4LQ5 A;  3OEN A;  5AA4 B;  3QUF A;  5FHN A;  3ZS6 A;  1URG A;  5I2K B;  5B7D A;  2H4I A;  4RY1 A;  4I8C A;  4ZEF A;  5JTY A;  2P0S A;  4IY6 A;  1HSJ A;  1P1Q A;  2V84 A;  1JET A;  4RPO A;  4YB6 A;  2Y7I A;  3UN6 A;  2F7B A;  2Q89 A;  4NTL A;  1B3F A;  5ITO A;  4OVJ A;  1Y3P A;  2DXY A;  1FCK A;  1N3W A;  3G3J A;  4G68 C;  1FTL A;  1I6Q A;  2AL5 A;  4LQ2 A;  4QRZ A;  4RK9 A;  1B5H A;  3UGW A;  4JWX A;  4RJZ A;  3KN7 A;  3OMB A;  3IOV A;  4KYE A;  3FVG A;  4MFI A;  3TTN A;  5FHM A;  2QS2 A;  3HPI A;  5CRY A;  3KZG A;  3ILU B;  3TEL A;  3HN0 A;  4DXC A;  4H5F A;  5I59 A;  4LVQ A;  2Q9T A;  3TZA A;  5F7V A;  4EUO A;  4RNS A;  5KZT A;  1UIU A;  4JXI A;  2E0S A;  1Y9U A;  2I0C A;  1UTB B;  1A8F A;  1N7W A;  1SW4 A;  2Z22 A;  2DE4 A;  4I1D A;  2ZMB A;  3MZB A;  2O7U A;  3LR1 A;  4IY5 A;  3SKP A;  3TCG A;  4YAH X;  5CI5 A;  2UVG A;  2ZNS A;  3IL1 B;  3K6X A;  4LP2 B;  3TOD A;  1VFD A;  1SW5 A;  3OEK A;  4MH5 A;  5I58 B;  3O66 A;  1B7U A;  5J1D A;  4ECF A;  2H98 A;  4XTC Q;  4XIG Q;  4OYV A;  3EHU A;  1BIY A;  4YB5 A;  1FTO A;  4PET A;  2XXU A;  4F39 A;  4OXV A;  3C31 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...