1Y9UA

Bordetella ferric binding protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
314
Chain Sequence
DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFAGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Anion-independent iron coordination by the Campylobacter jejuni ferric binding protein
pubmed doi rcsb
source organism Bordetella pertussis tohama i
molecule tags Metal binding protein
molecule keywords putative iron binding protein
total genus 112
structure length 314
sequence length 318
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA02
3O97A 1DPPA 4U2RA 3V83A 3KEIA 1SYIA 4YKIA 5ITOA 4F18A 4FAJA 3RUMA 3H3GA 4DDDA 1B1XA 2VOZA 4GXAA 4PFTA 1ZTYA 1SI1A 3CR9A 2P0SA 4FEDA 4IO3A 3MVYA 2DXRA 4F39A 3MBPA 3H7MA 3G3KA 4Q0CA 5I57A 2DE3A 2QRYA 4OXVA 5F1QA 5DVJA 1RKMA 2GHAA 4O3CA 5TP9B 2ONSA 1LBBA 2RINA 1A8EA 2DXYA 3RY3A 3VXCA 1XOCA 3D4GA 4OVJA 2DVCA 4BDMA 1IQ7A 1JW5A 1O7TA 2QPQA 3C9HA 3HV1A 1JQFA 2DQVA 2QMXA 2YJPA 1DOTA 2Y7KA 1XVYA 1XS5A 2H9BA 1JVXA 4NF6B 4GIZA 1LB8A 2Y7PA 5AA2A 1UTHB 1URDA 1HSJA 2XXQA 4O3BA 3MPLA 4BDOA 2V84A 2DWHA 5I57B 2F5XA 4OWDA 1R9QA 4EQBA 2O1LA 3GBBA 3SERA 4FATA 1ANFA 3QXMA 4JWXA 2Q2CA 3HHGA 1MY0A 3UA8A 3LSLA 2PVUA 1B7ZA 4Q30B 3FV1A 4QFPA 4ZS9A 4F1UA 3G3JA 5H8FA 2PYYA 2DSFA 1MY1A 4LUBA 4YB6A 2DWAA 4FIMA 4F1VA 2F8DA 5AA4B 4OYVA 2RC9A 5B7DA 2YLNA 3ILUB 2D21A 1YTVA 2OWTA 2X7PA 3PMXA 3QK6A 1M5EA 5H8FB 5AE4A 4NEDA 1Z7ME 1SDXA 4YMAA 1BTJA 2Z23A 4F3GA 1FQFA 4GVOA 4DCYA 2QS1A 4R6HA 5DVIA 4DXCA 2ZNUA 1B51A 3M8UA 3O9PA 1SW4A 4POWA 2D3IA 3IOWA 2I48A 5CBRA 5CBSA 1JVYA 3FJMA 4G68C 3TMGA 1MY2A 3IAZA 1B4ZA 2DE4A 1NNKA 1B9JA 3KOTA 3CI8A 3USDA 3W9WA 4G8MA 4XKRA 3IB2A 1HSLA 4YICA 1B3EA 3DELB 3ILTB 4OFJA 2O68A 2F7BA 3QSLA 4RK2A 4R2FA 4F22A 2XXPA 5B70A 4U23A 2H5YA 4NF5B 5I59B 5JK4A 3KN3A 4JBZA 5H8QA 4P11A 1M5FA 1CE2A 4OEVA 1N3XA 1NH8A 2F7CA 4KYSA 4HCWA 4MH5A 3RGYA 4ZEDA 4I1DA 4GD5A 3S9MC 4X1DA 3TFLA 4DIGA 3VFJA 4FJPA 4U4SA 1MS7A 1AMFA 1DTGA 4R2BA 5DYHA 3QUFA 3SETA 5KDTA 4XXUA 2XXUA 4H8JA 5L9SA 3TCFA 1WDNA 4PFUA 3PD8A 1P1WA 3T22A 4EXKA 4ECFA 3CVGA 1JETA 3P7IA 1Q35A 4LZ8A 1II5A 1MDP1 5CM6A 1B52A 2NUVA 4LQ2A 3S4UA 4QSDA 1B58A 4NF5A 2REJA 3FZVA 1MM7A 4YU0A 1B3GA 1FTKA 2D5WA 3GXAA 5I84A 2CZLA 2Z8FA 1LFIA 1H76A 3K02A 3MP6A 4IO5A 4K3FA 4R72A 1OQGA 2XXVA 3HHFA 3TTKA 4NF4A 4EQ7A 3Q28A 4HCYA 1WODA 3G3IA 1B7UA 3EHSA 3F11A 1MQDA 3MVXA 2HCAA 3Q27A 3L6HA 5TP9A 1MM6A 3OENA 3GBAA 3OSRA 5A5XA 5DT6A 4AB5A 1P1UA 3C33A 2NOOA 2F6GA 1FQDA 1H43A 1IUDA 2QS4A 3MP1A 3TQLA 4EF2A 1B40A 2PX1A 2F34A 3PUWE 3O28A 1QW0A 3CSGA 2B3BA 3K01A 4U1ZA 1YAEA 4EQ9A 2Y84A 5I56B 3E3KA 1VFEA 2PBWA 2Z8DA 3PPOA 4GOTA 2Z8EA 3CG3A 3ONMA 4I8CA 3IO4A 3CRBA 4ZEBA 4XTCQ 3FV2A 3U94A 3THIA 4I9DA 4EF1A 1H3DA 4ZZEA 1H44A 2UVGA 2RCBA 1FQBA 3RTWB 2P2AA 5JTYB 1Y3PA 3VLUA 3IJXB 4YAHX 4YMBA 2VGQA 4GRKA 2B3FA 4IGTA 4F3SA 4R73A 4YB5A 4LVQA 3V5AA 3KG2A 2H25A 1LAGE 3DM0A 4Z0IA 5H8HA 3OELA 1D9VA 4HW8A 1QKAA 3K0VA 1FW0A 4IGRA 2ZYNA 4IY5A 1QVSA 1NFTA 1Y1MA 3HO7A 3LR1A 5DTBA 2O7UA 4H1XA 4P0GA 4E0XA 2UVJA 4ONYA 2XXTA 4GQOA 4ZEKA 4ND9A 3FASA 1B5JA 4X9TA 4G77A 1GR2A 3IX1A 4QF9A 4GLIA 3K4UA 1A99A 3PPQA 5IKBA 5L8DA 4RPNA 5CI5A 2Q9TA 3W9VA 1PDAA 3C4MA 3SEWA 1MDQA 2IEEA 4G4PA 4GXSB 1PB7A 1N76A 1QKBA 4AB6A 2E0SA 3RPWA 3FXUA 3ZKKA 1N84A 2X7QA 4IO6A 3RQTA 2P1SA 3E13X 4ELOA 2ONKE 4NF4B 3OOAA 3T96B 2R71A 5I2NB 1ZKBA 1QUJA 4OFLA 3C32A 2QSXA 1Y4CA 3IOUA 4KR5A 1M5CA 4MF3A 4XIGQ 1LFHA 1BKAA 4ELPA 3TZAA 3UN6A 5LOMA 1B7HA 2XD3A 3IO6A 1IZ1A 2DWJA 2HAUA 4NF8A 1TFAA 2LAOA 3N5LA 1IITA 1TWYA 2H99A 3IB0A 3T9HB 4PFWA 3Q26A 4EUOA 3MVZA 3D4CA 1MH3A 1LAFE 4R9GA 3K6UA 3ODBA 1MXZA 2HEUA 4R74A 1B0LA 5DEXA 1XT8A 3GLBA 4U1OA 1O64A 1RYXA 5F7VA 4OQOA 5I2KB 4TLMB 3L6GA 1NH7A 1FQCA 4FORA 4KHZE 2O84X 2I4BA 3SDFA 4MBPA 1IIWA 5H8HB 2V3QA 1MXXA 4RXLA 3TEPA 4FECA 1I6AA 1PEBA 2RC7A 5ICTA 3PMWA 2I0BA 3T9UA 3FVKA 1O63A 2XXIA 5I58B 3T9VA 1LFGA 5FHOA 4C1TA 4OHNA 1OVBA 3OEKA 3M3LA 3TYHA 4BDQA 4N13A 2O7IA 2O1MA 4NE4A 2I6EA 2UXAA 4NWDA 3MC2A 2XX8A 4ISUA 3H6VA 1ZMGA 3UK4A 2Q8JA 1I69A 2Y7WA 2V3TA 1POTA 4F1YA 3RTFB 2VD2A 2QS2A 2HZLA 4IO4A 4FEBA 1SW5A 3DP8A 4AQ4A 1LGBC 3SESA 3KGCA 4F2QA 3C31A 1A54A 3OO8A 2HAVA 3MUQA 2F6PA 3QAXA 4MFIA 1PC3A 4ZZAA 1USYE 3I5OA 1LAHE 2XX7A 1B46A 3MAMA 3OD7A 1FTJA 4WXJA 4KPTA 4XKPA 4DXBA 3ECRA 1XVXA 3CFZA 3VLVA 5FTIA 4U22A 1Y4TA 3CIJA 3KJTA 3LSWA 1P99A 3KN7A 4THIA 1PBQA 2I4CA 3IORA 4G8NA 1URGA 1M5DA 2B65A 3BBRA 3N26A 3FATA 1B0HA 1S7YA 1FQAA 2QL3A 4OETA 4ELRA 3HCQA 2I58A 4FE8A 4YZZA 1IEJA 2AL4A 3BKIB 4JSDA 3TKDA 2ONRA 4H6DA 4G2ZA 2I49A 3DP6A 4IO7A 4X1BA 2V3UA 4OZ9A 3K6WA 5AA2B 2FNCA 5I2KA 4NF6A 1H45A 2I0CA 1QUIA 4TOZA 4YKKA 1GV8A 3VDFA 4EDPA 5I59A 3BFUA 4Q8RA 1UTBB 5EYFA 4JXIA 3G3GA 3KOSA 3WAEA 2ZXTA 3K6XA 1US4A 3OSQA 1LCTA 4TQUQ 3HSTA 3UIFA 4IB2A 3ZSFA 4BLAA 3LUYA 2Q88A 3N6UA 4H5GA 3RNNA 1BP5A 1S9TA 1XC1A 1POY1 1JEVA 2FYIA 3FJGA 3PPPA 3TODA 2DYXA 1MXUA 4R75A 3U1OA 5I2NA 4GFRA 4ESXA 2XXRA 4F29A 2F7AA 3EPEA 4BDNA 3RT8A 1Q1KA 3H6UA 1S50A 4LZ7A 1FTOA 5CMCA 1USYH 2Q89A 2UVIA 5TU0A 5AA4A 3SEYA 2XXXA 1B05A 2XXHA 4XKNA 1Y20A 1Y3NA 1MPDA 2F78A 4GWOA 2OJTA 3R26A 1QUKA 2XD2A 4R6YA 2DE2A 2R6GE 1PB9A 2UYFA 3B6TA 4OTEA 2NVUB 3EN3A 4JWYA 1R9LA 1CB6A 4QSCA 1UIUA 4DCXA 1MPBA 4G68B 4NWCA 1SW1A 3K1PA 1WVJA 2XXYA 2Y7IA 2Z22A 4LA9A 2PT2A 3C34A 3FUZA 1VR5A 1D4NA 2DVZA 3PUYE 2E1SA 1ZU0A 1OLAA 1L5TA 2ZYOA 3E4RA 1EU8A 3QIMA 4H67A 4ZECA 1SD3A 1FQEA 1MXWA 5KDTB 1Y9UA 1JNFA 3KSXA 1IXIA 3R6UA 4X48A 5CMMA 3EHTA 4WEPA 4WEDA 2REGA 4G8HA 1EH3A 5FTHA 4PE5B 4ZDMA 2V25A 4DE8A 1B5IA 5ICQA 3HN0A 1FTMA 1XHYA 3H6TA 3TAJA 2R9JA 3O6IA 1VE4A 1DTZA 1Y1ZA 2AYSA 4JSOA 4LZ5A 3MZ1A 4M4GA 4QSEA 4POXA 4I62A 1ZLQA 1OLCA 2A5TB 3CG1A 3G3FA 5KZTA 1MY4A 1QULA 1T0KA 3I3VA 5L9MA 2M8CA 4ZE8A 3RLFE 3OMBA 1A7LA 3U72A 4U21A 4Z7EA 3OXNA 3PMVA 3T66A 5HBCA 3KFMA 1A40A 2Q2AA 2G93A 1JW1A 3LC8A 2OZZA 2OWSA 2RCAA 5AA3A 4PP0A 1URSA 4NTLA 1LSTA 2F36A 1B4HA 3LBSA 3IB1A 1VFDA 2HFBA 1R6ZA 2OK2A 1YPNA 3V8XB 4F19A 1LAXA 1MY3A 3PD9A 1SI0A 3DP4A 3O29A 3H4ZA 1AH5A 3S9NC 4RK9A 1IXGA 2WKYA 5ELVA 3FIRA 4H65A 3PUXE 3S2VA 4BDRA 2ZYMA 1AOVA 1LCFA 1DMBA 4KI0E 4RY1A 5K2YA 4KCDA 1B6HA 3FXQA 4LP2B 5CMKA 5IAIA 1GGGA 2F35A 3LSFB 1NNFA 1VSOA 2HXWA 4KYDA 2HQ0A 3FD3A 1D3KA 4Q5TA 3A3CA 1B3FA 1NL5A 3E9XA 3KZGA 2I3WA 4G68A 3VVFA 2VP1A 2AIXA 2ZNTA 2X26A 4U4XA 5JTYA 2RC8A 5ISUA 2DOJA 3RT6B 3UORA 2AL5A 3FGSA 4OMBA 5AA1A 3W15C 1US5A 1B1HA 1HSEA 1RYOA 3DLNA 3G7WA 4OERA 2DWIA 4UA8A 5M2VA 1GVCA 3Q29A 4R9FA 1Y3QA 3OEMA 3MZ9A 3PV0E 2PT1A 3IK6B 1MQJA 3PGFA 3H06B 1NMUA 2V93A 2A5TA 1MH4A 1MXVA 3SKPA 3TUSA 3IOTA 1EZPA 5K2XA 4R6KA 3BFTA 2NXOA 4RJZA 3VV5A 2GH9A 4KCCA 4QFLA 4YB7A 1MPCA 2ABHA 2O6AA 1UQWA 2QS3A 1BIYA 4TLLB 1I6BA 3TCHA 2OCUA 2VD3A 3UP9A 4UACA 2G29A 4P0IA 1N04A 1UIVA 3H03A 3M3FA 1J1NA 1FCKA 1GTKA 3MVWA 1SYHA 3TDJA 3JYRA 3CFXA 2OBGA 4JWOA 4DXUA 3HPIA 3R7XA 3O2AA 2GHBA 3QUJA 3PUZE 5HPQA 1N7WA 2HZKA 3IL1B 4QFNA 2XX9A 3CFLA 1IXHA 3Q25A 4H8IA 1AIVA 3TPAA 3O6HA 4OESA 4MLQA 1ZIUA 3U93A 3MQ9A 4YKJA 1QJMA 5KCJB 2O69A 4ESWA 1N0TA 1B32A 1MQHA 4F3BA 1B2HA 1N3WA 4LATA 1MQIA 3V89B 4RYAA 1DPEA 4RA1A 5DVFA 5H8QB 3JV9A 1MRPA 1ELJA 3K2DA 1AL3A 2THIA 4N07A 3WAFA 3MPKA 3O6GA 3SEXA 3RN8A 4ZEIA 1N7XA 2A5SA 2BJJX 3MP8A 4PFYA 2KLFA 4L17A 4C1UA 4DZ1A 1BLFA 4GL8A 1SW2A 1NNTA 3QYTA 2H98A 1B3LA 2QMWA 1ZBMA 2DS9A 3JZJA 1TFDA 3KN8A 4QRZA 5FHMA 1A55A 2XHDA 4E0WA 3MWBA 3TTRA 1IXCA 3VE1B 4NF8B 3M3KA 3K00A 3VVEA 4ZE9A 5JEIA 1SVXB 4RPOA 3ZKLA 1P1QA 2ZNSA 3TTLA 1I6QA 4JDFA 3S9LC 3GZGA 5I56A 1LLSA 1YCJA 4F31B 1UTBA 3FVGA 4YKPA 1KWHA 1FTLA 3O66A 1A8FA 1SQYA 3PPRA 4OFOA 4C0RA 2Y7RA 3IOVA 1P1OA 2DP8A 4HTGA 2RF1A 3VLWA 3SEUA 1ZJLA 2F97A 3LSXA 4KYEA 4ZEFA 2UYEA 5EHMA 4F2OA 1LB9A 4GF8A 3N94A 4KQPA 3C35A 2PMSA 5BUUA 5TPAB 4ELQA 5L9OA 3OO9A 1MXYA 1ATGA 3KSJA 3FXRA 4IY6A 2OLBA 1MG1A 3OO6A 4F3PA 1EZOA 1TXFA 3TTNA 4GL0A 3EHUA 1B5HA 2I3VA 3CSBA 3TCGA 5I58A 5KCJA 3EQ1A 4KD5A 1Z7NE 1LBCA 3MZBA 3MW0A 3TTMA 4XKQA 5HM4B 2ANJA 5J1DA 2ALUA 5FHNA 3IJOB 1OMPA 4M1VA 4PQJA 3I6VA 5H8NA 4DLDA 1D9YA 1SBPA 3KJ7A 3TELA 2YPNA 1TT1A 1R1NA 4QFKA 5BWJA 1UTHA 2GFEA 5EHSA 3SEVA 4N6PA 3B7DA 5DEXB 1EZ9A 3PPNA 4IO2A 4QFOA 1P1NA 1MQGA 2H4IA 4RNSA 3AXFA 3UGWA 3A09A 5A5XB 1F9BA 1OQHA 3VXBA 1PB8A 2O51A 4HS7A 2VHAA 1NKXA 2W7YA 5CC2A 3VVDA 3T93B 1PBPA 3B6WA 4EXLA 2NWJA 1DSNA 3K1MA 3PU5A 3H6WA 2ZYKA 3K6VA 4PETA 3FVOA 5H8NB 3PUVE 2RKMA 1M5BA 3EF7A 4BDLA 3IR1A 3C36A 2ZMBA 4NMYA 5ITPA 4JB7A 3ZS6A 3U8QA 5CMBA 3TQWA 2QJEA 2XXWA 3FVNA 4OEUA 4LQ5A 4WKMA 1OIBA 1JW4A 4O3AA 5AA2D 3G3HA 3B6QA 2ESNA 1B3HA 1NNPA 5CRYA 3KBRA 3U92A 3S9EA 1OVTA 2IA4A 2FA7A 4LONB 1JEUA 4OENA 5H8SA 4H5FA 5TPAA 3T9XB 3A3UA 3MJNA 3FJ7A 3K1NA 3OO7A 4KFQA 4MLVA 3N6TA 2UVHA 4H0WA 2CMOA 4QHQA 2GRVA
chains in the Genus database with same CATH superfamily
3V83A 4YKIA 1SYIA 5ITOA 4O8MA 3RPLA 3H3GA 4PFTA 1ZTYA 1SI1A 3CR9A 2P0SA 3MVYA 2DXRA 4F39A 5EQ9A 2QRYA 2QVUA 2RINA 2DXYA 3D4GA 2DVCA 1JQFA 2QMXA 1XVYA 1LB8A 1HSJA 2XXQA 3MPLA 2Q2CA 3FV1A 1MY1A 2RC9A 2YLNA 2D21A 3PMXA 1Z7ME 1SDXA 2Z23A 1SW4A 5CBRA 2QVRA 1NNKA 3LV0A 3IB2A 1HSLA 4YICA 2O68A 4F22A 2XXPA 2H5YA 3KN3A 1M5FA 1NH8A 4KYSA 4HCWA 4ZEDA 3S9MC 4DIGA 4U4SA 1MS7A 1AMFA 5KDTA 4PFUA 3PD8A 1P1WA 3T22A 3P7IA 4LZ8A 5ISUA 1MDP1 1B58A 4NF5A 2D5WA 3GXAA 2CZLA 1H76A 3K02A 4EQ7A 2XXVA 4NF4A 3Q28A 1WODA 3G3IA 4N81A 1B7UA 2HCAA 1LBXA 3L6HA 3OSRA 1P1UA 3C33A 2F6GA 4GBVA 1IUDA 4EQ9A 2ZZVA 3CSGA 2B3BA 2Y84A 4I8CA 5ET8A 4ZZEA 3IJXB 4YMBA 3OELA 1QKAA 2ZYNA 1NFTA 1BK4A 1IMBA 4ND9A 4G77A 1GR2A 2FVZA 4GLIA 5IKBA 4RPNA 2Q9TA 3W9VA 3C4MA 2IEEA 1PB7A 4AB6A 4ELOA 2X7QA 4IO6A 3E13X 3OOAA 5I2NB 4OFLA 2Y5LA 1M5CA 3BIGA 3UN6A 1IZ1A 3N5LA 4OANA 3T9HB 4EUOA 1MH3A 4R9GA 5DEXA 1XT8A 1RYXA 4OQOA 1NH7A 1FQCA 2I4BA 5EYGA 5H8HB 1I6AA 1PEBA 5I58B 2XXIA 1LFGA 5FHOA 1NV3A 1SPIA 4NWDA 1K9YA 2V3TA 4PGNA 1LGBC 1A54A 2HAVA 4MAGA 1PC3A 4ZZAA 2XX7A 1B46A 3MAMA 4WXJA 4KPTA 5FTIA 4THIA 3KN7A 4NG7A 2XWIA 3IORA 2B65A 4OETA 3BBRA 1S7YA 3HCQA 4YZZA 2ONRA 4IO7A 1NV7A 4NF6A 3VDFA 4YKKA 4TOZA 4EDPA 5A5LA 4HXVA 1LBVA 1US4A 3HSTA 3UIFA 3LUYA 3N6UA 4H5GA 1POY1 1JEVA 3PPPA 5I2NA 1MXUA 2F7AA 1USYH 2Q89A 2XXHA 1Y20A 1Y3NA 1FPJA 1LBWA 1MPDA 3R26A 1QUKA 2XD2A 2DE2A 1PB9A 2UYFA 3EN3A 1R9LA 4QSCA 4NWCA 2Y7IA 4LA9A 2VT5A 4AS5A 5KDTB 4GX6A 1JNFA 2P3VA 5CMMA 2REGA 5FTHA 4ZDMA 2V25A 4DE8A 1B5IA 2HPGA 3TAJA 2AYSA 4JSOA 4LZ5A 4M4GA 4I62A 3CG1A 1QULA 3PMVA 1A40A 1B4HA 4MNPA 1YPNA 4F19A 1SI0A 3O29A 1AH5A 4RK9A 3FIRA 3S2VA 4OVSA 4BDRA 1AOVA 4KCDA 3FXQA 4LP2B 5CMKA 1GGGA 1FBEA 2F35A 2HQ0A 1K9ZA 3A3CA 1B3FA 1NL5A 3VVFA 1US5A 1HSEA 4UA8A 5M2VA 3RUMA 1Y3QA 1NI9A 1MQJA 3H06B 1NMUA 1EZPA 3BFTA 4RJZA 2GH9A 4YB7A 2OWZA 1MPCA 1I6BA 5I7IA 4FBPA 2VD3A 2XXKA 1LBZA 2CEYA 3H03A 3M3FA 1J1NA 1FCKA 1SYHA 4JWOA 4X04A 4DXUA 1N7WA 1IXHA 4H8IA 4PDHA 1JP4A 4H46A 1ZIUA 1FPDA 3MQ9A 1FSAA 4F3BA 3V89B 2FBPA 5ET6A 2JJKA 3JV9A 1ELJA 4PFRA 3MP8A 4C1UA 1BLFA 4GL8A 1SW2A 1ZBMA 4I3EA 3MWBA 3VE1B 4NF8B 3M3KA 3K00A 4ZE9A 4RPOA 3ZKLA 1P1QA 2ZNSA 1I6QA 4F31B 1KWHA 1A8FA 3PPRA 5IZ3A 1P1OA 1ZJLA 4XEQA 3LSXA 4KYEA 2UYEA 3C35A 5TPAB 4ELQA 4F3PA 5KCJA 3MZBA 2ALUA 1OMPA 4M1VA 4PQJA 4DLDA 1UTHA 1EZ9A 4QFOA 3A09A 3VVDA 3FVOA 5J16A 3EF7A 3IR1A 4JB7A 2DDKA 2P3NA 1JW4A 5AA2D 3FXBA 3U92A 3KBRA 1FPEA 2KR0A 3K1NA 4HE1A 4H0WA 4QHQA 2GRVA 3O97A 1DPPA 4U2RA 3KEIA 4FAJA 4DDDA 4GXAA 4IO3A 4OXVA 4O3CA 5TP9B 3RY3A 1O7TA 3HV1A 2YJPA 4H45A 4NF6B 4GIZA 1DBZA 2HHMA 1URDA 3E79A 2DWHA 2O1LA 3GBBA 3SERA 4FATA 1ANFA 4JWXA 1MY0A 4ZS9A 4F1UA 2PYYA 2DSFA 2DWAA 4KXPA 5B7DA 1YTVA 3QK6A 5H8FB 1KZ8A 2QS1A 4R6HA 5DVIA 1B51A 3O9PA 4MHFA 4POWA 2D3IA 3IOWA 2I48A 1JVYA 4G68C 3TMGA 1B4ZA 1B9JA 4JVDA 4DI4B 1KA0A 4XKRA 4OFJA 1DK4A 4RK2A 4NF5B 5I59B 4OEVA 1N3XA 3RGYA 4I1DA 3TFLA 4R2BA 3SETA 5L9SA 4XXUA 2XXUA 3TCFA 5I56B 1B3GA 2WYKA 2Z8FA 4IO5A 4R72A 3F11A 3Q27A 5A5XA 3OENA 3GBAA 4AB5A 2NOOA 1H43A 3TQLA 4EF2A 4U1ZA 3K01A 1VFEA 2PBWA 4GOTA 3MSTA 3ONMA 3CRBA 4I9DA 2UVGA 2RCBA 1FQBA 3V5AA 4E0XA 2O7UA 2XWKA 4ZEKA 1B5JA 4QF9A 3KC1A 3IFAA 3K4UA 5L8DA 3KBZA 4GXSB 1INPA 1FPFA 1QKBA 3RPWA 3FXUA 4PFBA 1N84A 4MMPA 2P1SA 4NF4B 3T96B 3C32A 3IOUA 4MF3A 2WBBA 4ELPA 3TZAA 2DWJA 2LAOA 2OX3A 2H99A 3D4CA 1MXZA 4R74A 1B0LA 4MEVA 3GLBA 4U1OA 1DCUA 5F7VA 5I2KB 1NV4A 3TEPA 4XFEA 1MXXA 4RXLA 5ICTA 3A29A 2I0BA 3FVKA 3U65A 4C1TA 2QVVA 3OEKA 3M3LA 4N13A 2I6EA 3MC2A 2HXRA 4ISUA 2Y7WA 1SW5A 3DP8A 5IZ3B 3KGCA 3OO8A 1QGXA 4GWSA 4MFIA 3RYDA 1FRPA 1LAHE 3OD7A 3CFZA 4U22A 1Y4TA 4IR8A 2L5VA 4P1LA 1FQAA 2I58A 2AL4A 4JSDA 4NAPA 2I49A 3DP6A 2V3UA 1H45A 1UTBB 4JXIA 3G3GA 5ESYA 1BP5A 1XC1A 5AA3A 3TODA 4LN5A 4R75A 4P56A 2XXRA 3EPEA 3RT8A 3H6UA 1S50A 5CMCA 2UVIA 3IFCA 4JWYA 1UIUA 4DCXA 1MPBA 3K1PA 2XXYA 4MIJA 2PT2A 3C34A 3FUZA 1VR5A 1D4NA 3E4RA 1FBDA 3QIMA 1SD3A 1NUYA 3KSXA 1IMCA 4WEPA 4PAKA 1EH3A 3D1RA 5I5PA 2R9JA 1VE4A 3LUZA 1Y1ZA 1IMEA 4QSEA 2A5TB 1MY4A 2VPOA 3I3VA 2M8CA 4ZE8A 1A7LA 3U72A 3T66A 5HBCA 2Q2AA 1IMDA 5EYHA 3FBPA 2OWSA 2F36A 3LBSA 1FPKA 1LAXA 5ET5A 3H4ZA 2WKYA 1YXIA 4H65A 4N17A 4KI0E 5K2YA 4RY1A 1NNFA 4KYDA 2HXWA 1D3KA 2F3DA 2I3WA 4P8BA 2AIXA 2ZNTA 5JTYA 2DOJA 2V4CA 5AA1A 4R9FA 3MZ9A 5ET7A 5K2XA 4OVRA 4QFLA 1BIYA 3UP9A 4P0IA 1N04A 2XWOA 3TDJA 3CFXA 3HPIA 2GHBA 2CEXA 3QUJA 1RDXA 2HZKA 3IL1B 2XX9A 4N4UA 4N91A 3U93A 1FPBA 2O69A 1MQHA 3ISPA 1N3WA 3HFUA 5H8QB 5DVFA 1MRPA 3WAFA 3O6GA 3RN8A 1N7XA 4DZ1A 4PE3A 3VLVA 1B3LA 2QMWA 2DS9A 2XHDA 4N8GA 5JEIA 3S9LC 4UABA 1UTBA 4YKPA 4O7MA 2Y7RA 3VLWA 2DP8A 4ZEFA 4F2OA 5EHMA 4GF8A 3N94A 4KQPA 5BUUA 5L9OA 3OO9A 1MXYA 1ATGA 3KSJA 4N6KA 2I3VA 5I58A 3TTMA 3MW0A 5J1DA 1FBFA 3TELA 4N6PA 3PPNA 4O7IA 1MQGA 4RNSA 4QXDA 4N15A 3VXBA 5CC2A 4GBWA 1PBPA 1NV6A 1LEVA 3PU5A 2ZYKA 4PFIA 3PUVE 3C36A 2ZMBA 5ITPA 2QJEA 4OEUA 4LQ5A 3G3HA 1OVTA 2FA7A 4LONB 3T9XB 3OO7A 2CMOA 4F18A 4NN3A 1B1XA 4FEDA 3H7MA 4JVCA 4Q0CA 2DE3A 5F1QA 1RKMA 1LBBA 1A8EA 1XOCA 1JW5A 2QPQA 1DOTA 1JVXA 3CHGA 4BDOA 2V84A 2F5XA 1R9QA 4EQBA 4MX6A 3PTYA 3QXMA 3HHGA 4HE0A 3LSLA 4QFPA 5H8FA 4FIMA 4OYVA 3ILUB 2OWTA 4NEDA 3BIHA 4YMAA 4F3GA 1FQFA 4DXCA 2ZNUA 5CBSA 1IMAA 1MY2A 3IAZA 3CI8A 4G8MA 3DELB 3ILTB 2F7BA 3QSLA 5B70A 4U23A 5JK4A 4JBZA 5H8QA 4NX1A 1CE2A 2F7CA 4MH5A 4GD5A 4X1DA 1DTGA 3QUFA 2F3BA 4H8JA 1WDNA 4ECFA 5CM6A 1B52A 2WYPA 4QSDA 1FTKA 1LFIA 1NUWA 4PCDA 3TTKA 4PGPA 5TP9A 5DT6A 3MP1A 2QS4A 3PUWE 1YAEA 4GWWA 3KC0A 3E3KA 2Z8EA 3IO4A 3FV2A 3THIA 1H3DA 3RTWB 2P2AA 5JTYB 1Y3PA 2VGQA 2B3FA 4IGTA 4LVQA 3KG2A 2H25A 1LAGE 3DM0A 4Z0IA 2WX9A 4IGRA 4IY5A 1Y1MA 5DTBA 4P0GA 3T0JA 4X9TA 3IX1A 1MDQA 4G4PA 2PFZA 1N76A 2E0SA 3ZKKA 2ONKE 1ZKBA 2QSXA 4XIGQ 3NOHA 1BKAA 3IO6A 4NF8A 1TWYA 4PFWA 3ODBA 1NV0A 2HEUA 1O64A 4TLMB 3L6GA 4FORA 4MBPA 1IIWA 4XF5A 4PF8A 1O63A 3T9VA 2CZHA 3GYYA 2WBDA 4BDQA 2XX8A 2KQZA 3H6VA 3UK4A 1I69A 2QS2A 4AQ4A 3SESA 4F2QA 3C31A 3MUQA 1USYE 3I5OA 4DXBA 1FTJA 4QBAA 3ECRA 1PBQA 1FBGA 4P1EA 4G8NA 1URGA 1M5DA 3N26A 4ELRA 4N8YA 2QL3A 1IEJA 3BKIB 4G2ZA 4I3YA 4OZ9A 5AA2B 5I2KA 3SZPA 1GV8A 1QUIA 5I59A 3BFUA 5EYFA 3WAEA 2ZXTA 3K6XA 3OSQA 4IB2A 3ZSFA 3RNNA 4GWXA 3FJGA 3U1OA 2DYXA 3T1BA 4GFRA 4ESXA 4F29A 4LZ7A 1FTOA 4XKNA 4GWOA 2OJTA 4R6YA 2R6GE 4OTEA 3B6TA 5EQAA 4X8RA 1CB6A 4G68B 2Z22A 1G0IA 4PF6A 1FBCA 1OLAA 2ZYOA 1MXWA 1Y9UA 3EHTA 4WEDA 4G8HA 4PDDA 4PE5B 5ICQA 1FTMA 1XHYA 2ZZWA 1DTZA 4MNCA 4POXA 1OLCA 5KZTA 1T0KA 5L9MA 3OMBA 4Z7EA 5EQ8A 4U21A 3KFMA 4PAFA 2BJIA 2G93A 1JW1A 3LC8A 2FHYA 2RCAA 4NTLA 1LSTA 1D9QA 1VFDA 1R6ZA 3PD9A 1MY3A 3DP4A 3S9NC 5ELVA 2ZYMA 1EZOA 1LCFA 3FD3A 4Q5TA 3KZGA 2VP1A 2X26A 2RC8A 3UORA 2AL5A 3FGSA 3G7WA 1RYOA 3DLNA 2DWIA 1GVCA 2PFYA 2PT1A 3IK6B 2V93A 1FTAA 5LTCA 3SKPA 3IOTA 2NXOA 2Q74A 4KCCA 2O6AA 5EQ7A 2QS3A 4TLLB 3MYUA 1RDYA 2G29A 2FIXA 4NF0A 3MVWA 3JYRA 1NUZA 3PUZE 5HPQA 3Q25A 1AIVA 3O6HA 4OESA 1IMFA 4YKJA 4ESWA 1N0TA 1Q9DA 1B2HA 1DPEA 3K2DA 4N07A 3MPKA 2BJJX 4L17A 3QYTA 3JZJA 3KN8A 4OVQA 4E0WA 3TTRA 5T3JA 4GWUA 3FVGA 1FTLA 4OFOA 4HTGA 3SEUA 1LB9A 1AWBA 4I40A 2FIEA 4IY6A 1MG1A 1TXFA 4GL0A 3EHUA 1B5HA 3ROJA 3TCGA 3EQ1A 4AS4A 4XKQA 3IJOB 3I6VA 5H8NA 1D9YA 1SBPA 4N6DA 2XA5A 1R1NA 4QFKA 3SEVA 3B7DA 4IO2A 2H4IA 2GQ1A 5A5XB 1OQHA 2O51A 4HS7A 2VHAA 1NKXA 3T93B 3B6WA 1DSNA 5H8NB 3H6WA 2RKMA 4BDLA 3ZS6A 3U8QA 5IZ1A 3FVNA 4WKMA 1OIBA 3B6QA 2ESNA 5CRYA 2IA4A 4OENA 5TPAA 1JEUA 5F24A 5H8SA 4H5FA 3FJ7A 3N6TA 2UVHA 5FBPA 4PBHA 2Q8MA 2VOZA 3MBPA 3G3KA 5I57A 5DW8A 5DVJA 2GHAA 2ONSA 3VXCA 4OVJA 4BDMA 1IQ7A 3C9HA 2DQVA 2Y7KA 1XS5A 2H9BA 2Y7PA 5AA2A 1UTHB 4O3BA 5I57B 4OWDA 1YYZA 3UA8A 2PVUA 1B7ZA 4Q30B 3G3JA 4LUBA 4GWZA 4YB6A 4F1VA 2F8DA 5AA4B 2X7PA 1M5EA 5AE4A 1BTJA 4DCYA 4GVOA 3M8UA 3FJMA 3KOTA 2DE4A 3USDA 3W9WA 2CZKA 1B3EA 4R2FA 4P11A 4MCOA 3VFJA 4FJPA 5DYHA 4EXKA 3CVGA 1JETA 1EYIA 1Q35A 1II5A 2CZIA 2NUVA 4LQ2A 3S4UA 2REJA 3FZVA 1MM7A 4YU0A 5I84A 3MP6A 4K3FA 1OQGA 3HHFA 4HCYA 3EHSA 1MQDA 3MVXA 1MM6A 1EYKA 1NUXA 1FQDA 1B40A 2PX1A 2F34A 3O28A 1QW0A 3PPOA 2Z8DA 3CG3A 4ZEBA 4XTCQ 3U94A 4EF1A 4P47A 1H44A 3VLUA 1YZ0A 4YAHX 4GRKA 1FJ6A 4F3SA 4R73A 4YB5A 5H8HA 2MKZA 1D9VA 3K0VA 1FW0A 1QVSA 3HO7A 3LR1A 4H1XA 2UVJA 4ONYA 2XXTA 4GQOA 3FASA 3E78A 1A99A 3PPQA 5CI5A 1PDAA 3SEWA 3RQTA 1NV1A 2Y5KA 2R71A 1QUJA 1Y4CA 4KR5A 1LFHA 5LOMA 1B7HA 2XD3A 2HAUA 1TFAA 1FPLA 1IITA 3IB0A 2B4LA 3Q26A 3MVZA 1NV2A 1LAFE 3K6UA 5IGAA 1FPIA 4KHZE 3SDFA 2O84X 2V3QA 4FECA 2RC7A 3PMWA 3T9UA 4OHNA 1OVBA 3TYHA 2O7IA 2O1MA 4NE4A 2UXAA 1ZMGA 2Q8JA 1KA1A 1POTA 4F1YA 3RTFB 2VD2A 2HZLA 4IO4A 4FEBA 4PTKA 2XWVA 4PBQA 3QAXA 2F6PA 4GX4A 4XKPA 1XVXA 4HW8A 3CIJA 3KJTA 3LSWA 1P99A 2I4CA 3FATA 1B0HA 4FE8A 3TKDA 4H6DA 4X1BA 3K6WA 2VPNA 2FNCA 2I0CA 2R8TA 4Q8RA 3KOSA 4TQUQ 1LCTA 4BLAA 2Q88A 1S9TA 2FYIA 4BDNA 1Q1KA 5TU0A 5AA4A 3SEYA 3B50A 2XXXA 1B05A 2F78A 5LDZA 2NVUB 1SW1A 1WVJA 2DVZA 3PUYE 1XI6A 2E1SA 1ZU0A 2QFLA 1L5TA 4H67A 1EU8A 4ZECA 1FQEA 1G0HA 4HE2A 1IXIA 3R6UA 4X48A 4G61A 3HN0A 3H6TA 3O6IA 3MZ1A 1ZLQA 3G3FA 3RLFE 3OXNA 4OVTA 2OZZA 4OVPA 4PP0A 1URSA 3EKIA 3IB1A 2HFBA 2OK2A 3V8XB 2ZZXA 1IXGA 3PUXE 3QMFA 1DMBA 5IAIA 4GX3A 1B6HA 1EYJA 5IM2A 3LSFB 1VSOA 3E9XA 1FBHA 4G68A 4U4XA 3RT6B 4OMBA 3W15C 4OERA 1B1HA 3Q29A 3OEMA 3PV0E 3PGFA 2A5TA 4NQ8A 1MH4A 1MXVA 3TUSA 1NV5A 4R6KA 3VV5A 4MJOA 2ABHA 1UQWA 4GWYA 5I3SA 4NGUA 3TCHA 2OCUA 4UACA 1UIVA 1GTKA 2OBGA 3R7XA 3O2AA 4OA4A 4QFNA 3CFLA 3TPAA 4MLQA 4NHBA 1FBPA 5KCJB 1QJMA 1B32A 4LATA 1MQIA 4RYAA 4RA1A 1AL3A 2THIA 3SEXA 4ZEIA 1CNQA 2A5SA 4PFYA 2KLFA 1NNTA 2H98A 5FHMA 4QRZA 1TFDA 1A55A 5IZZA 1IXCA 3VVEA 1SVXB 3TTLA 1FJ9A 4JDFA 3GZGA 5I56A 1LLSA 1YCJA 4C0RA 3O66A 1SQYA 3IOVA 2RF1A 4P9KA 2F97A 2WEFA 2PMSA 3FXRA 2OLBA 3OO6A 4JVIA 3TTNA 3CSBA 4KD5A 1FPGA 4O94A 1Z7NE 1LBCA 1VDWA 2ANJA 5HM4B 5FHNA 3KJ7A 2YPNA 1TT1A 4DI3D 5BWJA 2GFEA 4PAIA 5EHSA 5DEXB 1P1NA 2PCRA 4P3LA 3AXFA 3UGWA 1F9BA 1PB8A 2W7YA 4EXLA 2NWJA 3K1MA 4PETA 4PC9A 3K6VA 1M5BA 4NMYA 5CMBA 3TQWA 2XXWA 3RPLB 4MNIA 4O3AA 1B3HA 1NNPA 3S9EA 1RDZA 1LBYA 3MJNA 3B8BA 4KFQA 4MLVA 2B4MA 3A3UA
chains in the Genus database with same CATH topology
3O97A 1DPPA 4U2RA 3V83A 3KEIA 1SYIA 4YKIA 5ITOA 4F18A 4FAJA 3RUMA 3H3GA 4DDDA 1B1XA 2VOZA 4GXAA 4PFTA 1ZTYA 1SI1A 3CR9A 2P0SA 4FEDA 4IO3A 3MVYA 2DXRA 4F39A 3MBPA 3H7MA 3G3KA 4Q0CA 5I57A 2DE3A 2QRYA 4OXVA 5F1QA 5DVJA 1RKMA 2GHAA 4O3CA 5TP9B 2ONSA 1LBBA 2RINA 1A8EA 2DXYA 3RY3A 3VXCA 1XOCA 3D4GA 4OVJA 2DVCA 4BDMA 1IQ7A 1JW5A 1O7TA 2QPQA 3C9HA 3HV1A 1JQFA 2DQVA 2QMXA 2YJPA 1DOTA 2Y7KA 1XVYA 1XS5A 2H9BA 1JVXA 4NF6B 4GIZA 1LB8A 2Y7PA 5AA2A 1UTHB 1URDA 1HSJA 2XXQA 4O3BA 3MPLA 4BDOA 2V84A 2DWHA 5I57B 2F5XA 4OWDA 1R9QA 4EQBA 2O1LA 3GBBA 3SERA 4FATA 1ANFA 3QXMA 4JWXA 2Q2CA 3HHGA 1MY0A 3UA8A 3LSLA 2PVUA 1B7ZA 4Q30B 3FV1A 4QFPA 4ZS9A 4F1UA 3G3JA 5H8FA 2PYYA 2DSFA 1MY1A 4LUBA 4YB6A 2DWAA 4FIMA 4F1VA 2F8DA 5AA4B 4OYVA 2RC9A 5B7DA 2YLNA 3ILUB 2D21A 1YTVA 2OWTA 2X7PA 3PMXA 3QK6A 1M5EA 5H8FB 5AE4A 4NEDA 1Z7ME 1SDXA 4YMAA 1BTJA 2Z23A 4F3GA 1FQFA 4GVOA 4DCYA 2QS1A 4R6HA 5DVIA 4DXCA 2ZNUA 1B51A 3M8UA 3O9PA 1SW4A 4POWA 2D3IA 3IOWA 2I48A 5CBRA 5CBSA 1JVYA 3FJMA 4G68C 3TMGA 1MY2A 3IAZA 1B4ZA 2DE4A 1NNKA 1B9JA 3KOTA 3CI8A 3USDA 3W9WA 4G8MA 4XKRA 3IB2A 1HSLA 4YICA 1B3EA 3DELB 3ILTB 4OFJA 2O68A 2F7BA 3QSLA 4RK2A 4R2FA 4F22A 2XXPA 5B70A 4U23A 2H5YA 4NF5B 5I59B 5JK4A 3KN3A 4JBZA 5H8QA 4P11A 1M5FA 1CE2A 4OEVA 1N3XA 1NH8A 2F7CA 4KYSA 4HCWA 4MH5A 3RGYA 4ZEDA 4I1DA 4GD5A 3S9MC 4X1DA 3TFLA 4DIGA 3VFJA 4FJPA 4U4SA 1MS7A 1AMFA 1DTGA 4R2BA 5DYHA 3QUFA 3SETA 5KDTA 4XXUA 2XXUA 4H8JA 5L9SA 3TCFA 1WDNA 4PFUA 3PD8A 1P1WA 3T22A 4EXKA 4ECFA 3CVGA 1JETA 3P7IA 1Q35A 4LZ8A 1II5A 1MDP1 5CM6A 1B52A 2NUVA 4LQ2A 3S4UA 4QSDA 1B58A 4NF5A 2REJA 3FZVA 1MM7A 4YU0A 1B3GA 1FTKA 2D5WA 3GXAA 5I84A 2CZLA 2Z8FA 1LFIA 1H76A 3K02A 3MP6A 4IO5A 4K3FA 4R72A 1OQGA 2XXVA 3HHFA 3TTKA 4NF4A 4EQ7A 3Q28A 4HCYA 1WODA 3G3IA 1B7UA 3EHSA 3F11A 1MQDA 3MVXA 2HCAA 3Q27A 3L6HA 5TP9A 1MM6A 3OENA 3GBAA 3OSRA 5A5XA 5DT6A 4AB5A 1P1UA 3C33A 2NOOA 2F6GA 1FQDA 1H43A 1IUDA 2QS4A 3MP1A 3TQLA 4EF2A 1B40A 2PX1A 2F34A 3PUWE 3O28A 1QW0A 3CSGA 2B3BA 3K01A 4U1ZA 1YAEA 4EQ9A 2Y84A 5I56B 3E3KA 1VFEA 2PBWA 2Z8DA 3PPOA 4GOTA 2Z8EA 3CG3A 3ONMA 4I8CA 3IO4A 3CRBA 4ZEBA 4XTCQ 3FV2A 3U94A 3THIA 4I9DA 4EF1A 1H3DA 4ZZEA 1H44A 2UVGA 2RCBA 1FQBA 3RTWB 2P2AA 5JTYB 1Y3PA 3VLUA 3IJXB 4YAHX 4YMBA 2VGQA 4GRKA 2B3FA 4IGTA 4F3SA 4R73A 4YB5A 4LVQA 3V5AA 3KG2A 2H25A 1LAGE 3DM0A 4Z0IA 5H8HA 3OELA 1D9VA 4HW8A 1QKAA 3K0VA 1FW0A 4IGRA 2ZYNA 4IY5A 1QVSA 1NFTA 1Y1MA 3HO7A 3LR1A 5DTBA 2O7UA 4H1XA 4P0GA 4E0XA 2UVJA 4ONYA 2XXTA 4GQOA 4ZEKA 4ND9A 3FASA 1B5JA 4X9TA 4G77A 1GR2A 3IX1A 4QF9A 4GLIA 3K4UA 1A99A 3PPQA 5IKBA 5L8DA 4RPNA 5CI5A 2Q9TA 3W9VA 1PDAA 3C4MA 3SEWA 1MDQA 2IEEA 4G4PA 4GXSB 1PB7A 1N76A 1QKBA 4AB6A 2E0SA 3RPWA 3FXUA 3ZKKA 1N84A 2X7QA 4IO6A 3RQTA 2P1SA 3E13X 4ELOA 2ONKE 4NF4B 3OOAA 3T96B 2R71A 5I2NB 1ZKBA 1QUJA 4OFLA 3C32A 2QSXA 1Y4CA 3IOUA 4KR5A 1M5CA 4MF3A 4XIGQ 1LFHA 1BKAA 4ELPA 3TZAA 3UN6A 5LOMA 1B7HA 2XD3A 3IO6A 1IZ1A 2DWJA 2HAUA 4NF8A 1TFAA 2LAOA 3N5LA 1IITA 1TWYA 2H99A 3IB0A 3T9HB 4PFWA 3Q26A 4EUOA 3MVZA 3D4CA 1MH3A 1LAFE 4R9GA 3K6UA 3ODBA 1MXZA 2HEUA 4R74A 1B0LA 5DEXA 1XT8A 3GLBA 4U1OA 1O64A 1RYXA 5F7VA 4OQOA 5I2KB 4TLMB 3L6GA 1NH7A 1FQCA 4FORA 4KHZE 2O84X 2I4BA 3SDFA 4MBPA 1IIWA 5H8HB 2V3QA 1MXXA 4RXLA 3TEPA 4FECA 1I6AA 1PEBA 2RC7A 5ICTA 3PMWA 2I0BA 3T9UA 3FVKA 1O63A 2XXIA 5I58B 3T9VA 1LFGA 5FHOA 4C1TA 4OHNA 1OVBA 3OEKA 3M3LA 3TYHA 4BDQA 4N13A 2O7IA 2O1MA 4NE4A 2I6EA 2UXAA 4NWDA 3MC2A 2XX8A 4ISUA 3H6VA 1ZMGA 3UK4A 2Q8JA 1I69A 2Y7WA 2V3TA 1POTA 4F1YA 3RTFB 2VD2A 2QS2A 2HZLA 4IO4A 4FEBA 1SW5A 3DP8A 4AQ4A 1LGBC 3SESA 3KGCA 4F2QA 3C31A 1A54A 3OO8A 2HAVA 3MUQA 2F6PA 3QAXA 4MFIA 1PC3A 4ZZAA 1USYE 3I5OA 1LAHE 2XX7A 1B46A 3MAMA 3OD7A 1FTJA 4WXJA 4KPTA 4XKPA 4DXBA 3ECRA 1XVXA 3CFZA 3VLVA 5FTIA 4U22A 1Y4TA 3CIJA 3KJTA 3LSWA 1P99A 3KN7A 4THIA 1PBQA 2I4CA 3IORA 4G8NA 1URGA 1M5DA 2B65A 3BBRA 3N26A 3FATA 1B0HA 1S7YA 1FQAA 2QL3A 4OETA 4ELRA 3HCQA 2I58A 4FE8A 4YZZA 1IEJA 2AL4A 3BKIB 4JSDA 3TKDA 2ONRA 4H6DA 4G2ZA 2I49A 3DP6A 4IO7A 4X1BA 2V3UA 4OZ9A 3K6WA 5AA2B 2FNCA 5I2KA 4NF6A 1H45A 2I0CA 1QUIA 4TOZA 4YKKA 1GV8A 3VDFA 4EDPA 5I59A 3BFUA 4Q8RA 1UTBB 5EYFA 4JXIA 3G3GA 3KOSA 3WAEA 2ZXTA 3K6XA 1US4A 3OSQA 1LCTA 4TQUQ 3HSTA 3UIFA 4IB2A 3ZSFA 4BLAA 3LUYA 2Q88A 3N6UA 4H5GA 3RNNA 1BP5A 1S9TA 1XC1A 1POY1 1JEVA 2FYIA 3FJGA 3PPPA 3TODA 2DYXA 1MXUA 4R75A 3U1OA 5I2NA 4GFRA 4ESXA 2XXRA 4F29A 2F7AA 3EPEA 4BDNA 3RT8A 1Q1KA 3H6UA 1S50A 4LZ7A 1FTOA 5CMCA 1USYH 2Q89A 2UVIA 5TU0A 5AA4A 3SEYA 2XXXA 1B05A 2XXHA 4XKNA 1Y20A 1Y3NA 1MPDA 2F78A 4GWOA 2OJTA 3R26A 1QUKA 2XD2A 4R6YA 2DE2A 2R6GE 1PB9A 2UYFA 3B6TA 4OTEA 2NVUB 3EN3A 4JWYA 1R9LA 1CB6A 4QSCA 1UIUA 4DCXA 1MPBA 4G68B 4NWCA 1SW1A 3K1PA 1WVJA 2XXYA 2Y7IA 2Z22A 4LA9A 2PT2A 3C34A 3FUZA 1VR5A 1D4NA 2DVZA 3PUYE 2E1SA 1ZU0A 1OLAA 1L5TA 2ZYOA 3E4RA 1EU8A 3QIMA 4H67A 4ZECA 1SD3A 1FQEA 1MXWA 5KDTB 1Y9UA 1JNFA 3KSXA 1IXIA 3R6UA 4X48A 5CMMA 3EHTA 4WEPA 4WEDA 2REGA 4G8HA 1EH3A 5FTHA 4PE5B 4ZDMA 2V25A 4DE8A 1B5IA 5ICQA 3HN0A 1FTMA 1XHYA 3H6TA 3TAJA 2R9JA 3O6IA 1VE4A 1DTZA 1Y1ZA 2AYSA 4JSOA 4LZ5A 3MZ1A 4M4GA 4QSEA 4POXA 4I62A 1ZLQA 1OLCA 2A5TB 3CG1A 3G3FA 5KZTA 1MY4A 1QULA 1T0KA 3I3VA 5L9MA 2M8CA 4ZE8A 3RLFE 3OMBA 1A7LA 3U72A 4U21A 4Z7EA 3OXNA 3PMVA 3T66A 5HBCA 3KFMA 1A40A 2Q2AA 2G93A 1JW1A 3LC8A 2OZZA 2OWSA 2RCAA 5AA3A 4PP0A 1URSA 4NTLA 1LSTA 2F36A 1B4HA 3LBSA 3IB1A 1VFDA 2HFBA 1R6ZA 2OK2A 1YPNA 3V8XB 4F19A 1LAXA 1MY3A 3PD9A 1SI0A 3DP4A 3O29A 3H4ZA 1AH5A 3S9NC 4RK9A 1IXGA 2WKYA 5ELVA 3FIRA 4H65A 3PUXE 3S2VA 4BDRA 2ZYMA 1AOVA 1LCFA 1DMBA 4KI0E 4RY1A 5K2YA 4KCDA 1B6HA 3FXQA 4LP2B 5CMKA 5IAIA 1GGGA 2F35A 3LSFB 1NNFA 1VSOA 2HXWA 4KYDA 2HQ0A 3FD3A 1D3KA 4Q5TA 3A3CA 1B3FA 1NL5A 3E9XA 3KZGA 2I3WA 4G68A 3VVFA 2VP1A 2AIXA 2ZNTA 2X26A 4U4XA 5JTYA 2RC8A 5ISUA 2DOJA 3RT6B 3UORA 2AL5A 3FGSA 4OMBA 5AA1A 3W15C 1US5A 1B1HA 1HSEA 1RYOA 3DLNA 3G7WA 4OERA 2DWIA 4UA8A 5M2VA 1GVCA 3Q29A 4R9FA 1Y3QA 3OEMA 3MZ9A 3PV0E 2PT1A 3IK6B 1MQJA 3PGFA 3H06B 1NMUA 2V93A 2A5TA 1MH4A 1MXVA 3SKPA 3TUSA 3IOTA 1EZPA 5K2XA 4R6KA 3BFTA 2NXOA 4RJZA 3VV5A 2GH9A 4KCCA 4QFLA 4YB7A 1MPCA 2ABHA 2O6AA 1UQWA 2QS3A 1BIYA 4TLLB 1I6BA 3TCHA 2OCUA 2VD3A 3UP9A 4UACA 2G29A 4P0IA 1N04A 1UIVA 3H03A 3M3FA 1J1NA 1FCKA 1GTKA 3MVWA 1SYHA 3TDJA 3JYRA 3CFXA 2OBGA 4JWOA 4DXUA 3HPIA 3R7XA 3O2AA 2GHBA 3QUJA 3PUZE 5HPQA 1N7WA 2HZKA 3IL1B 4QFNA 2XX9A 3CFLA 1IXHA 3Q25A 4H8IA 1AIVA 3TPAA 3O6HA 4OESA 4MLQA 1ZIUA 3U93A 3MQ9A 4YKJA 1QJMA 5KCJB 2O69A 4ESWA 1N0TA 1B32A 1MQHA 4F3BA 1B2HA 1N3WA 4LATA 1MQIA 3V89B 4RYAA 1DPEA 4RA1A 5DVFA 5H8QB 3JV9A 1MRPA 1ELJA 3K2DA 1AL3A 2THIA 4N07A 3WAFA 3MPKA 3O6GA 3SEXA 3RN8A 4ZEIA 1N7XA 2A5SA 2BJJX 3MP8A 4PFYA 2KLFA 4L17A 4C1UA 4DZ1A 1BLFA 4GL8A 1SW2A 1NNTA 3QYTA 2H98A 1B3LA 2QMWA 1ZBMA 2DS9A 3JZJA 1TFDA 3KN8A 4QRZA 5FHMA 1A55A 2XHDA 4E0WA 3MWBA 3TTRA 1IXCA 3VE1B 4NF8B 3M3KA 3K00A 3VVEA 4ZE9A 5JEIA 1SVXB 4RPOA 3ZKLA 1P1QA 2ZNSA 3TTLA 1I6QA 4JDFA 3S9LC 3GZGA 5I56A 1LLSA 1YCJA 4F31B 1UTBA 3FVGA 4YKPA 1KWHA 1FTLA 3O66A 1A8FA 1SQYA 3PPRA 4OFOA 4C0RA 2Y7RA 3IOVA 1P1OA 2DP8A 4HTGA 2RF1A 3VLWA 3SEUA 1ZJLA 2F97A 3LSXA 4KYEA 4ZEFA 2UYEA 5EHMA 4F2OA 1LB9A 4GF8A 3N94A 4KQPA 3C35A 2PMSA 5BUUA 5TPAB 4ELQA 5L9OA 3OO9A 1MXYA 1ATGA 3KSJA 3FXRA 4IY6A 2OLBA 1MG1A 3OO6A 4F3PA 1EZOA 1TXFA 3TTNA 4GL0A 3EHUA 1B5HA 2I3VA 3CSBA 3TCGA 5I58A 5KCJA 3EQ1A 4KD5A 1Z7NE 1LBCA 3MZBA 3MW0A 3TTMA 4XKQA 5HM4B 2ANJA 5J1DA 2ALUA 5FHNA 3IJOB 1OMPA 4M1VA 4PQJA 3I6VA 5H8NA 4DLDA 1D9YA 1SBPA 3KJ7A 3TELA 2YPNA 1TT1A 1R1NA 4QFKA 5BWJA 1UTHA 2GFEA 5EHSA 3SEVA 4N6PA 3B7DA 5DEXB 1EZ9A 3PPNA 4IO2A 4QFOA 1P1NA 1MQGA 2H4IA 4RNSA 3AXFA 3UGWA 3A09A 5A5XB 1F9BA 1OQHA 3VXBA 1PB8A 2O51A 4HS7A 2VHAA 1NKXA 2W7YA 5CC2A 3VVDA 3T93B 1PBPA 3B6WA 4EXLA 2NWJA 1DSNA 3K1MA 3PU5A 3H6WA 2ZYKA 3K6VA 4PETA 3FVOA 5H8NB 3PUVE 2RKMA 1M5BA 3EF7A 4BDLA 3IR1A 3C36A 2ZMBA 4NMYA 5ITPA 4JB7A 3ZS6A 3U8QA 5CMBA 3TQWA 2QJEA 2XXWA 3FVNA 4OEUA 4LQ5A 4WKMA 1OIBA 1JW4A 4O3AA 5AA2D 3G3HA 3B6QA 2ESNA 1B3HA 1NNPA 5CRYA 3KBRA 3U92A 3S9EA 1OVTA 2IA4A 2FA7A 4LONB 1JEUA 4OENA 5H8SA 4H5FA 5TPAA 3T9XB 3A3UA 3MJNA 3FJ7A 3K1NA 3OO7A 4KFQA 4MLVA 3N6TA 2UVHA 4H0WA 2CMOA 4QHQA 2GRVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O97 A;  1DPP A;  4U2R A;  3V83 A;  3KEI A;  1SYI A;  4YKI A;  5ITO A;  4F18 A;  4FAJ A;  3RUM A;  3H3G A;  4DDD A;  1B1X A;  2VOZ A;  4GXA A;  4PFT A;  1ZTY A;  1SI1 A;  3CR9 A;  2P0S A;  4FED A;  4IO3 A;  3MVY A;  2DXR A;  4F39 A;  3MBP A;  3H7M A;  3G3K A;  4Q0C A;  5I57 A;  2DE3 A;  2QRY A;  4OXV A;  5F1Q A;  5DVJ A;  1RKM A;  2GHA A;  4O3C A;  5TP9 B;  2ONS A;  1LBB A;  2RIN A;  1A8E A;  2DXY A;  3RY3 A;  3VXC A;  1XOC A;  3D4G A;  4OVJ A;  2DVC A;  4BDM A;  1IQ7 A;  1JW5 A;  1O7T A;  2QPQ A;  3C9H A;  3HV1 A;  1JQF A;  2DQV A;  2QMX A;  2YJP A;  1DOT A;  2Y7K A;  1XVY A;  1XS5 A;  2H9B A;  1JVX A;  4NF6 B;  4GIZ A;  1LB8 A;  2Y7P A;  5AA2 A;  1UTH B;  1URD A;  1HSJ A;  2XXQ A;  4O3B A;  3MPL A;  4BDO A;  2V84 A;  2DWH A;  5I57 B;  2F5X A;  4OWD A;  1R9Q A;  4EQB A;  2O1L A;  3GBB A;  3SER A;  4FAT A;  1ANF A;  3QXM A;  4JWX A;  2Q2C A;  3HHG A;  1MY0 A;  3UA8 A;  3LSL A;  2PVU A;  1B7Z A;  4Q30 B;  3FV1 A;  4QFP A;  4ZS9 A;  4F1U A;  3G3J A;  5H8F A;  2PYY A;  2DSF A;  1MY1 A;  4LUB A;  4YB6 A;  2DWA A;  4FIM A;  4F1V A;  2F8D A;  5AA4 B;  4OYV A;  2RC9 A;  5B7D A;  2YLN A;  3ILU B;  2D21 A;  1YTV A;  2OWT A;  2X7P A;  3PMX A;  3QK6 A;  1M5E A;  5H8F B;  5AE4 A;  4NED A;  1Z7M E;  1SDX A;  4YMA A;  1BTJ A;  2Z23 A;  4F3G A;  1FQF A;  4GVO A;  4DCY A;  2QS1 A;  4R6H A;  5DVI A;  4DXC A;  2ZNU A;  1B51 A;  3M8U A;  3O9P A;  1SW4 A;  4POW A;  2D3I A;  3IOW A;  2I48 A;  5CBR A;  5CBS A;  1JVY A;  3FJM A;  4G68 C;  3TMG A;  1MY2 A;  3IAZ A;  1B4Z A;  2DE4 A;  1NNK A;  1B9J A;  3KOT A;  3CI8 A;  3USD A;  3W9W A;  4G8M A;  4XKR A;  3IB2 A;  1HSL A;  4YIC A;  1B3E A;  3DEL B;  3ILT B;  4OFJ A;  2O68 A;  2F7B A;  3QSL A;  4RK2 A;  4R2F A;  4F22 A;  2XXP A;  5B70 A;  4U23 A;  2H5Y A;  4NF5 B;  5I59 B;  5JK4 A;  3KN3 A;  4JBZ A;  5H8Q A;  4P11 A;  1M5F A;  1CE2 A;  4OEV A;  1N3X A;  1NH8 A;  2F7C A;  4KYS A;  4HCW A;  4MH5 A;  3RGY A;  4ZED A;  4I1D A;  4GD5 A;  3S9M C;  4X1D A;  3TFL A;  4DIG A;  3VFJ A;  4FJP A;  4U4S A;  1MS7 A;  1AMF A;  1DTG A;  4R2B A;  5DYH A;  3QUF A;  3SET A;  5KDT A;  4XXU A;  2XXU A;  4H8J A;  5L9S A;  3TCF A;  1WDN A;  4PFU A;  3PD8 A;  1P1W A;  3T22 A;  4EXK A;  4ECF A;  3CVG A;  1JET A;  3P7I A;  1Q35 A;  4LZ8 A;  1II5 A;  1MDP 1;  5CM6 A;  1B52 A;  2NUV A;  4LQ2 A;  3S4U A;  4QSD A;  1B58 A;  4NF5 A;  2REJ A;  3FZV A;  1MM7 A;  4YU0 A;  1B3G A;  1FTK A;  2D5W A;  3GXA A;  5I84 A;  2CZL A;  2Z8F A;  1LFI A;  1H76 A;  3K02 A;  3MP6 A;  4IO5 A;  4K3F A;  4R72 A;  1OQG A;  2XXV A;  3HHF A;  3TTK A;  4NF4 A;  4EQ7 A;  3Q28 A;  4HCY A;  1WOD A;  3G3I A;  1B7U A;  3EHS A;  3F11 A;  1MQD A;  3MVX A;  2HCA A;  3Q27 A;  3L6H A;  5TP9 A;  1MM6 A;  3OEN A;  3GBA A;  3OSR A;  5A5X A;  5DT6 A;  4AB5 A;  1P1U A;  3C33 A;  2NOO A;  2F6G A;  1FQD A;  1H43 A;  1IUD A;  2QS4 A;  3MP1 A;  3TQL A;  4EF2 A;  1B40 A;  2PX1 A;  2F34 A;  3PUW E;  3O28 A;  1QW0 A;  3CSG A;  2B3B A;  3K01 A;  4U1Z A;  1YAE A;  4EQ9 A;  2Y84 A;  5I56 B;  3E3K A;  1VFE A;  2PBW A;  2Z8D A;  3PPO A;  4GOT A;  2Z8E A;  3CG3 A;  3ONM A;  4I8C A;  3IO4 A;  3CRB A;  4ZEB A;  4XTC Q;  3FV2 A;  3U94 A;  3THI A;  4I9D A;  4EF1 A;  1H3D A;  4ZZE A;  1H44 A;  2UVG A;  2RCB A;  1FQB A;  3RTW B;  2P2A A;  5JTY B;  1Y3P A;  3VLU A;  3IJX B;  4YAH X;  4YMB A;  2VGQ A;  4GRK A;  2B3F A;  4IGT A;  4F3S A;  4R73 A;  4YB5 A;  4LVQ A;  3V5A A;  3KG2 A;  2H25 A;  1LAG E;  3DM0 A;  4Z0I A;  5H8H A;  3OEL A;  1D9V A;  4HW8 A;  1QKA A;  3K0V A;  1FW0 A;  4IGR A;  2ZYN A;  4IY5 A;  1QVS A;  1NFT A;  1Y1M A;  3HO7 A;  3LR1 A;  5DTB A;  2O7U A;  4H1X A;  4P0G A;  4E0X A;  2UVJ A;  4ONY A;  2XXT A;  4GQO A;  4ZEK A;  4ND9 A;  3FAS A;  1B5J A;  4X9T A;  4G77 A;  1GR2 A;  3IX1 A;  4QF9 A;  4GLI A;  3K4U A;  1A99 A;  3PPQ A;  5IKB A;  5L8D A;  4RPN A;  5CI5 A;  2Q9T A;  3W9V A;  1PDA A;  3C4M A;  3SEW A;  1MDQ A;  2IEE A;  4G4P A;  4GXS B;  1PB7 A;  1N76 A;  1QKB A;  4AB6 A;  2E0S A;  3RPW A;  3FXU A;  3ZKK A;  1N84 A;  2X7Q A;  4IO6 A;  3RQT A;  2P1S A;  3E13 X;  4ELO A;  2ONK E;  4NF4 B;  3OOA A;  3T96 B;  2R71 A;  5I2N B;  1ZKB A;  1QUJ A;  4OFL A;  3C32 A;  2QSX A;  1Y4C A;  3IOU A;  4KR5 A;  1M5C A;  4MF3 A;  4XIG Q;  1LFH A;  1BKA A;  4ELP A;  3TZA A;  3UN6 A;  5LOM A;  1B7H A;  2XD3 A;  3IO6 A;  1IZ1 A;  2DWJ A;  2HAU A;  4NF8 A;  1TFA A;  2LAO A;  3N5L A;  1IIT A;  1TWY A;  2H99 A;  3IB0 A;  3T9H B;  4PFW A;  3Q26 A;  4EUO A;  3MVZ A;  3D4C A;  1MH3 A;  1LAF E;  4R9G A;  3K6U A;  3ODB A;  1MXZ A;  2HEU A;  4R74 A;  1B0L A;  5DEX A;  1XT8 A;  3GLB A;  4U1O A;  1O64 A;  1RYX A;  5F7V A;  4OQO A;  5I2K B;  4TLM B;  3L6G A;  1NH7 A;  1FQC A;  4FOR A;  4KHZ E;  2O84 X;  2I4B A;  3SDF A;  4MBP A;  1IIW A;  5H8H B;  2V3Q A;  1MXX A;  4RXL A;  3TEP A;  4FEC A;  1I6A A;  1PEB A;  2RC7 A;  5ICT A;  3PMW A;  2I0B A;  3T9U A;  3FVK A;  1O63 A;  2XXI A;  5I58 B;  3T9V A;  1LFG A;  5FHO A;  4C1T A;  4OHN A;  1OVB A;  3OEK A;  3M3L A;  3TYH A;  4BDQ A;  4N13 A;  2O7I A;  2O1M A;  4NE4 A;  2I6E A;  2UXA A;  4NWD A;  3MC2 A;  2XX8 A;  4ISU A;  3H6V A;  1ZMG A;  3UK4 A;  2Q8J A;  1I69 A;  2Y7W A;  2V3T A;  1POT A;  4F1Y A;  3RTF B;  2VD2 A;  2QS2 A;  2HZL A;  4IO4 A;  4FEB A;  1SW5 A;  3DP8 A;  4AQ4 A;  1LGB C;  3SES A;  3KGC A;  4F2Q A;  3C31 A;  1A54 A;  3OO8 A;  2HAV A;  3MUQ A;  2F6P A;  3QAX A;  4MFI A;  1PC3 A;  4ZZA A;  1USY E;  3I5O A;  1LAH E;  2XX7 A;  1B46 A;  3MAM A;  3OD7 A;  1FTJ A;  4WXJ A;  4KPT A;  4XKP A;  4DXB A;  3ECR A;  1XVX A;  3CFZ A;  3VLV A;  5FTI A;  4U22 A;  1Y4T A;  3CIJ A;  3KJT A;  3LSW A;  1P99 A;  3KN7 A;  4THI A;  1PBQ A;  2I4C A;  3IOR A;  4G8N A;  1URG A;  1M5D A;  2B65 A;  3BBR A;  3N26 A;  3FAT A;  1B0H A;  1S7Y A;  1FQA A;  2QL3 A;  4OET A;  4ELR A;  3HCQ A;  2I58 A;  4FE8 A;  4YZZ A;  1IEJ A;  2AL4 A;  3BKI B;  4JSD A;  3TKD A;  2ONR A;  4H6D A;  4G2Z A;  2I49 A;  3DP6 A;  4IO7 A;  4X1B A;  2V3U A;  4OZ9 A;  3K6W A;  5AA2 B;  2FNC A;  5I2K A;  4NF6 A;  1H45 A;  2I0C A;  1QUI A;  4TOZ A;  4YKK A;  1GV8 A;  3VDF A;  4EDP A;  5I59 A;  3BFU A;  4Q8R A;  1UTB B;  5EYF A;  4JXI A;  3G3G A;  3KOS A;  3WAE A;  2ZXT A;  3K6X A;  1US4 A;  3OSQ A;  1LCT A;  4TQU Q;  3HST A;  3UIF A;  4IB2 A;  3ZSF A;  4BLA A;  3LUY A;  2Q88 A;  3N6U A;  4H5G A;  3RNN A;  1BP5 A;  1S9T A;  1XC1 A;  1POY 1;  1JEV A;  2FYI A;  3FJG A;  3PPP A;  3TOD A;  2DYX A;  1MXU A;  4R75 A;  3U1O A;  5I2N A;  4GFR A;  4ESX A;  2XXR A;  4F29 A;  2F7A A;  3EPE A;  4BDN A;  3RT8 A;  1Q1K A;  3H6U A;  1S50 A;  4LZ7 A;  1FTO A;  5CMC A;  1USY H;  2Q89 A;  2UVI A;  5TU0 A;  5AA4 A;  3SEY A;  2XXX A;  1B05 A;  2XXH A;  4XKN A;  1Y20 A;  1Y3N A;  1MPD A;  2F78 A;  4GWO A;  2OJT A;  3R26 A;  1QUK A;  2XD2 A;  4R6Y A;  2DE2 A;  2R6G E;  1PB9 A;  2UYF A;  3B6T A;  4OTE A;  2NVU B;  3EN3 A;  4JWY A;  1R9L A;  1CB6 A;  4QSC A;  1UIU A;  4DCX A;  1MPB A;  4G68 B;  4NWC A;  1SW1 A;  3K1P A;  1WVJ A;  2XXY A;  2Y7I A;  2Z22 A;  4LA9 A;  2PT2 A;  3C34 A;  3FUZ A;  1VR5 A;  1D4N A;  2DVZ A;  3PUY E;  2E1S A;  1ZU0 A;  1OLA A;  1L5T A;  2ZYO A;  3E4R A;  1EU8 A;  3QIM A;  4H67 A;  4ZEC A;  1SD3 A;  1FQE A;  1MXW A;  5KDT B;  1Y9U A;  1JNF A;  3KSX A;  1IXI A;  3R6U A;  4X48 A;  5CMM A;  3EHT A;  4WEP A;  4WED A;  2REG A;  4G8H A;  1EH3 A;  5FTH A;  4PE5 B;  4ZDM A;  2V25 A;  4DE8 A;  1B5I A;  5ICQ A;  3HN0 A;  1FTM A;  1XHY A;  3H6T A;  3TAJ A;  2R9J A;  3O6I A;  1VE4 A;  1DTZ A;  1Y1Z A;  2AYS A;  4JSO A;  4LZ5 A;  3MZ1 A;  4M4G A;  4QSE A;  4POX A;  4I62 A;  1ZLQ A;  1OLC A;  2A5T B;  3CG1 A;  3G3F A;  5KZT A;  1MY4 A;  1QUL A;  1T0K A;  3I3V A;  5L9M A;  2M8C A;  4ZE8 A;  3RLF E;  3OMB A;  1A7L A;  3U72 A;  4U21 A;  4Z7E A;  3OXN A;  3PMV A;  3T66 A;  5HBC A;  3KFM A;  1A40 A;  2Q2A A;  2G93 A;  1JW1 A;  3LC8 A;  2OZZ A;  2OWS A;  2RCA A;  5AA3 A;  4PP0 A;  1URS A;  4NTL A;  1LST A;  2F36 A;  1B4H A;  3LBS A;  3IB1 A;  1VFD A;  2HFB A;  1R6Z A;  2OK2 A;  1YPN A;  3V8X B;  4F19 A;  1LAX A;  1MY3 A;  3PD9 A;  1SI0 A;  3DP4 A;  3O29 A;  3H4Z A;  1AH5 A;  3S9N C;  4RK9 A;  1IXG A;  2WKY A;  5ELV A;  3FIR A;  4H65 A;  3PUX E;  3S2V A;  4BDR A;  2ZYM A;  1AOV A;  1LCF A;  1DMB A;  4KI0 E;  4RY1 A;  5K2Y A;  4KCD A;  1B6H A;  3FXQ A;  4LP2 B;  5CMK A;  5IAI A;  1GGG A;  2F35 A;  3LSF B;  1NNF A;  1VSO A;  2HXW A;  4KYD A;  2HQ0 A;  3FD3 A;  1D3K A;  4Q5T A;  3A3C A;  1B3F A;  1NL5 A;  3E9X A;  3KZG A;  2I3W A;  4G68 A;  3VVF A;  2VP1 A;  2AIX A;  2ZNT A;  2X26 A;  4U4X A;  5JTY A;  2RC8 A;  5ISU A;  2DOJ A;  3RT6 B;  3UOR A;  2AL5 A;  3FGS A;  4OMB A;  5AA1 A;  3W15 C;  1US5 A;  1B1H A;  1HSE A;  1RYO A;  3DLN A;  3G7W A;  4OER A;  2DWI A;  4UA8 A;  5M2V A;  1GVC A;  3Q29 A;  4R9F A;  1Y3Q A;  3OEM A;  3MZ9 A;  3PV0 E;  2PT1 A;  3IK6 B;  1MQJ A;  3PGF A;  3H06 B;  1NMU A;  2V93 A;  2A5T A;  1MH4 A;  1MXV A;  3SKP A;  3TUS A;  3IOT A;  1EZP A;  5K2X A;  4R6K A;  3BFT A;  2NXO A;  4RJZ A;  3VV5 A;  2GH9 A;  4KCC A;  4QFL A;  4YB7 A;  1MPC A;  2ABH A;  2O6A A;  1UQW A;  2QS3 A;  1BIY A;  4TLL B;  1I6B A;  3TCH A;  2OCU A;  2VD3 A;  3UP9 A;  4UAC A;  2G29 A;  4P0I A;  1N04 A;  1UIV A;  3H03 A;  3M3F A;  1J1N A;  1FCK A;  1GTK A;  3MVW A;  1SYH A;  3TDJ A;  3JYR A;  3CFX A;  2OBG A;  4JWO A;  4DXU A;  3HPI A;  3R7X A;  3O2A A;  2GHB A;  3QUJ A;  3PUZ E;  5HPQ A;  1N7W A;  2HZK A;  3IL1 B;  4QFN A;  2XX9 A;  3CFL A;  1IXH A;  3Q25 A;  4H8I A;  1AIV A;  3TPA A;  3O6H A;  4OES A;  4MLQ A;  1ZIU A;  3U93 A;  3MQ9 A;  4YKJ A;  1QJM A;  5KCJ B;  2O69 A;  4ESW A;  1N0T A;  1B32 A;  1MQH A;  4F3B A;  1B2H A;  1N3W A;  4LAT A;  1MQI A;  3V89 B;  4RYA A;  1DPE A;  4RA1 A;  5DVF A;  5H8Q B;  3JV9 A;  1MRP A;  1ELJ A;  3K2D A;  1AL3 A;  2THI A;  4N07 A;  3WAF A;  3MPK A;  3O6G A;  3SEX A;  3RN8 A;  4ZEI A;  1N7X A;  2A5S A;  2BJJ X;  3MP8 A;  4PFY A;  2KLF A;  4L17 A;  4C1U A;  4DZ1 A;  1BLF A;  4GL8 A;  1SW2 A;  1NNT A;  3QYT A;  2H98 A;  1B3L A;  2QMW A;  1ZBM A;  2DS9 A;  3JZJ A;  1TFD A;  3KN8 A;  4QRZ A;  5FHM A;  1A55 A;  2XHD A;  4E0W A;  3MWB A;  3TTR A;  1IXC A;  3VE1 B;  4NF8 B;  3M3K A;  3K00 A;  3VVE A;  4ZE9 A;  5JEI A;  1SVX B;  4RPO A;  3ZKL A;  1P1Q A;  2ZNS A;  3TTL A;  1I6Q A;  4JDF A;  3S9L C;  3GZG A;  5I56 A;  1LLS A;  1YCJ A;  4F31 B;  1UTB A;  3FVG A;  4YKP A;  1KWH A;  1FTL A;  3O66 A;  1A8F A;  1SQY A;  3PPR A;  4OFO A;  4C0R A;  2Y7R A;  3IOV A;  1P1O A;  2DP8 A;  4HTG A;  2RF1 A;  3VLW A;  3SEU A;  1ZJL A;  2F97 A;  3LSX A;  4KYE A;  4ZEF A;  2UYE A;  5EHM A;  4F2O A;  1LB9 A;  4GF8 A;  3N94 A;  4KQP A;  3C35 A;  2PMS A;  5BUU A;  5TPA B;  4ELQ A;  5L9O A;  3OO9 A;  1MXY A;  1ATG A;  3KSJ A;  3FXR A;  4IY6 A;  2OLB A;  1MG1 A;  3OO6 A;  4F3P A;  1EZO A;  1TXF A;  3TTN A;  4GL0 A;  3EHU A;  1B5H A;  2I3V A;  3CSB A;  3TCG A;  5I58 A;  5KCJ A;  3EQ1 A;  4KD5 A;  1Z7N E;  1LBC A;  3MZB A;  3MW0 A;  3TTM A;  4XKQ A;  5HM4 B;  2ANJ A;  5J1D A;  2ALU A;  5FHN A;  3IJO B;  1OMP A;  4M1V A;  4PQJ A;  3I6V A;  5H8N A;  4DLD A;  1D9Y A;  1SBP A;  3KJ7 A;  3TEL A;  2YPN A;  1TT1 A;  1R1N A;  4QFK A;  5BWJ A;  1UTH A;  2GFE A;  5EHS A;  3SEV A;  4N6P A;  3B7D A;  5DEX B;  1EZ9 A;  3PPN A;  4IO2 A;  4QFO A;  1P1N A;  1MQG A;  2H4I A;  4RNS A;  3AXF A;  3UGW A;  3A09 A;  5A5X B;  1F9B A;  1OQH A;  3VXB A;  1PB8 A;  2O51 A;  4HS7 A;  2VHA A;  1NKX A;  2W7Y A;  5CC2 A;  3VVD A;  3T93 B;  1PBP A;  3B6W A;  4EXL A;  2NWJ A;  1DSN A;  3K1M A;  3PU5 A;  3H6W A;  2ZYK A;  3K6V A;  4PET A;  3FVO A;  5H8N B;  3PUV E;  2RKM A;  1M5B A;  3EF7 A;  4BDL A;  3IR1 A;  3C36 A;  2ZMB A;  4NMY A;  5ITP A;  4JB7 A;  3ZS6 A;  3U8Q A;  5CMB A;  3TQW A;  2QJE A;  2XXW A;  3FVN A;  4OEU A;  4LQ5 A;  4WKM A;  1OIB A;  1JW4 A;  4O3A A;  5AA2 D;  3G3H A;  3B6Q A;  2ESN A;  1B3H A;  1NNP A;  5CRY A;  3KBR A;  3U92 A;  3S9E A;  1OVT A;  2IA4 A;  2FA7 A;  4LON B;  1JEU A;  4OEN A;  5H8S A;  4H5F A;  5TPA A;  3T9X B;  3A3U A;  3MJN A;  3FJ7 A;  3K1N A;  3OO7 A;  4KFQ A;  4MLV A;  3N6T A;  2UVH A;  4H0W A;  2CMO A;  4QHQ A;  2GRV A; 
#chains in the Genus database with same CATH topology
 3V83 A;  4YKI A;  1SYI A;  5ITO A;  4O8M A;  3RPL A;  3H3G A;  4PFT A;  1ZTY A;  1SI1 A;  3CR9 A;  2P0S A;  3MVY A;  2DXR A;  4F39 A;  5EQ9 A;  2QRY A;  2QVU A;  2RIN A;  2DXY A;  3D4G A;  2DVC A;  1JQF A;  2QMX A;  1XVY A;  1LB8 A;  1HSJ A;  2XXQ A;  3MPL A;  2Q2C A;  3FV1 A;  1MY1 A;  2RC9 A;  2YLN A;  2D21 A;  3PMX A;  1Z7M E;  1SDX A;  2Z23 A;  1SW4 A;  5CBR A;  2QVR A;  1NNK A;  3LV0 A;  3IB2 A;  1HSL A;  4YIC A;  2O68 A;  4F22 A;  2XXP A;  2H5Y A;  3KN3 A;  1M5F A;  1NH8 A;  4KYS A;  4HCW A;  4ZED A;  3S9M C;  4DIG A;  4U4S A;  1MS7 A;  1AMF A;  5KDT A;  4PFU A;  3PD8 A;  1P1W A;  3T22 A;  3P7I A;  4LZ8 A;  5ISU A;  1MDP 1;  1B58 A;  4NF5 A;  2D5W A;  3GXA A;  2CZL A;  1H76 A;  3K02 A;  4EQ7 A;  2XXV A;  4NF4 A;  3Q28 A;  1WOD A;  3G3I A;  4N81 A;  1B7U A;  2HCA A;  1LBX A;  3L6H A;  3OSR A;  1P1U A;  3C33 A;  2F6G A;  4GBV A;  1IUD A;  4EQ9 A;  2ZZV A;  3CSG A;  2B3B A;  2Y84 A;  4I8C A;  5ET8 A;  4ZZE A;  3IJX B;  4YMB A;  3OEL A;  1QKA A;  2ZYN A;  1NFT A;  1BK4 A;  1IMB A;  4ND9 A;  4G77 A;  1GR2 A;  2FVZ A;  4GLI A;  5IKB A;  4RPN A;  2Q9T A;  3W9V A;  3C4M A;  2IEE A;  1PB7 A;  4AB6 A;  4ELO A;  2X7Q A;  4IO6 A;  3E13 X;  3OOA A;  5I2N B;  4OFL A;  2Y5L A;  1M5C A;  3BIG A;  3UN6 A;  1IZ1 A;  3N5L A;  4OAN A;  3T9H B;  4EUO A;  1MH3 A;  4R9G A;  5DEX A;  1XT8 A;  1RYX A;  4OQO A;  1NH7 A;  1FQC A;  2I4B A;  5EYG A;  5H8H B;  1I6A A;  1PEB A;  5I58 B;  2XXI A;  1LFG A;  5FHO A;  1NV3 A;  1SPI A;  4NWD A;  1K9Y A;  2V3T A;  4PGN A;  1LGB C;  1A54 A;  2HAV A;  4MAG A;  1PC3 A;  4ZZA A;  2XX7 A;  1B46 A;  3MAM A;  4WXJ A;  4KPT A;  5FTI A;  4THI A;  3KN7 A;  4NG7 A;  2XWI A;  3IOR A;  2B65 A;  4OET A;  3BBR A;  1S7Y A;  3HCQ A;  4YZZ A;  2ONR A;  4IO7 A;  1NV7 A;  4NF6 A;  3VDF A;  4YKK A;  4TOZ A;  4EDP A;  5A5L A;  4HXV A;  1LBV A;  1US4 A;  3HST A;  3UIF A;  3LUY A;  3N6U A;  4H5G A;  1POY 1;  1JEV A;  3PPP A;  5I2N A;  1MXU A;  2F7A A;  1USY H;  2Q89 A;  2XXH A;  1Y20 A;  1Y3N A;  1FPJ A;  1LBW A;  1MPD A;  3R26 A;  1QUK A;  2XD2 A;  2DE2 A;  1PB9 A;  2UYF A;  3EN3 A;  1R9L A;  4QSC A;  4NWC A;  2Y7I A;  4LA9 A;  2VT5 A;  4AS5 A;  5KDT B;  4GX6 A;  1JNF A;  2P3V A;  5CMM A;  2REG A;  5FTH A;  4ZDM A;  2V25 A;  4DE8 A;  1B5I A;  2HPG A;  3TAJ A;  2AYS A;  4JSO A;  4LZ5 A;  4M4G A;  4I62 A;  3CG1 A;  1QUL A;  3PMV A;  1A40 A;  1B4H A;  4MNP A;  1YPN A;  4F19 A;  1SI0 A;  3O29 A;  1AH5 A;  4RK9 A;  3FIR A;  3S2V A;  4OVS A;  4BDR A;  1AOV A;  4KCD A;  3FXQ A;  4LP2 B;  5CMK A;  1GGG A;  1FBE A;  2F35 A;  2HQ0 A;  1K9Z A;  3A3C A;  1B3F A;  1NL5 A;  3VVF A;  1US5 A;  1HSE A;  4UA8 A;  5M2V A;  3RUM A;  1Y3Q A;  1NI9 A;  1MQJ A;  3H06 B;  1NMU A;  1EZP A;  3BFT A;  4RJZ A;  2GH9 A;  4YB7 A;  2OWZ A;  1MPC A;  1I6B A;  5I7I A;  4FBP A;  2VD3 A;  2XXK A;  1LBZ A;  2CEY A;  3H03 A;  3M3F A;  1J1N A;  1FCK A;  1SYH A;  4JWO A;  4X04 A;  4DXU A;  1N7W A;  1IXH A;  4H8I A;  4PDH A;  1JP4 A;  4H46 A;  1ZIU A;  1FPD A;  3MQ9 A;  1FSA A;  4F3B A;  3V89 B;  2FBP A;  5ET6 A;  2JJK A;  3JV9 A;  1ELJ A;  4PFR A;  3MP8 A;  4C1U A;  1BLF A;  4GL8 A;  1SW2 A;  1ZBM A;  4I3E A;  3MWB A;  3VE1 B;  4NF8 B;  3M3K A;  3K00 A;  4ZE9 A;  4RPO A;  3ZKL A;  1P1Q A;  2ZNS A;  1I6Q A;  4F31 B;  1KWH A;  1A8F A;  3PPR A;  5IZ3 A;  1P1O A;  1ZJL A;  4XEQ A;  3LSX A;  4KYE A;  2UYE A;  3C35 A;  5TPA B;  4ELQ A;  4F3P A;  5KCJ A;  3MZB A;  2ALU A;  1OMP A;  4M1V A;  4PQJ A;  4DLD A;  1UTH A;  1EZ9 A;  4QFO A;  3A09 A;  3VVD A;  3FVO A;  5J16 A;  3EF7 A;  3IR1 A;  4JB7 A;  2DDK A;  2P3N A;  1JW4 A;  5AA2 D;  3FXB A;  3U92 A;  3KBR A;  1FPE A;  2KR0 A;  3K1N A;  4HE1 A;  4H0W A;  4QHQ A;  2GRV A;  3O97 A;  1DPP A;  4U2R A;  3KEI A;  4FAJ A;  4DDD A;  4GXA A;  4IO3 A;  4OXV A;  4O3C A;  5TP9 B;  3RY3 A;  1O7T A;  3HV1 A;  2YJP A;  4H45 A;  4NF6 B;  4GIZ A;  1DBZ A;  2HHM A;  1URD A;  3E79 A;  2DWH A;  2O1L A;  3GBB A;  3SER A;  4FAT A;  1ANF A;  4JWX A;  1MY0 A;  4ZS9 A;  4F1U A;  2PYY A;  2DSF A;  2DWA A;  4KXP A;  5B7D A;  1YTV A;  3QK6 A;  5H8F B;  1KZ8 A;  2QS1 A;  4R6H A;  5DVI A;  1B51 A;  3O9P A;  4MHF A;  4POW A;  2D3I A;  3IOW A;  2I48 A;  1JVY A;  4G68 C;  3TMG A;  1B4Z A;  1B9J A;  4JVD A;  4DI4 B;  1KA0 A;  4XKR A;  4OFJ A;  1DK4 A;  4RK2 A;  4NF5 B;  5I59 B;  4OEV A;  1N3X A;  3RGY A;  4I1D A;  3TFL A;  4R2B A;  3SET A;  5L9S A;  4XXU A;  2XXU A;  3TCF A;  5I56 B;  1B3G A;  2WYK A;  2Z8F A;  4IO5 A;  4R72 A;  3F11 A;  3Q27 A;  5A5X A;  3OEN A;  3GBA A;  4AB5 A;  2NOO A;  1H43 A;  3TQL A;  4EF2 A;  4U1Z A;  3K01 A;  1VFE A;  2PBW A;  4GOT A;  3MST A;  3ONM A;  3CRB A;  4I9D A;  2UVG A;  2RCB A;  1FQB A;  3V5A A;  4E0X A;  2O7U A;  2XWK A;  4ZEK A;  1B5J A;  4QF9 A;  3KC1 A;  3IFA A;  3K4U A;  5L8D A;  3KBZ A;  4GXS B;  1INP A;  1FPF A;  1QKB A;  3RPW A;  3FXU A;  4PFB A;  1N84 A;  4MMP A;  2P1S A;  4NF4 B;  3T96 B;  3C32 A;  3IOU A;  4MF3 A;  2WBB A;  4ELP A;  3TZA A;  2DWJ A;  2LAO A;  2OX3 A;  2H99 A;  3D4C A;  1MXZ A;  4R74 A;  1B0L A;  4MEV A;  3GLB A;  4U1O A;  1DCU A;  5F7V A;  5I2K B;  1NV4 A;  3TEP A;  4XFE A;  1MXX A;  4RXL A;  5ICT A;  3A29 A;  2I0B A;  3FVK A;  3U65 A;  4C1T A;  2QVV A;  3OEK A;  3M3L A;  4N13 A;  2I6E A;  3MC2 A;  2HXR A;  4ISU A;  2Y7W A;  1SW5 A;  3DP8 A;  5IZ3 B;  3KGC A;  3OO8 A;  1QGX A;  4GWS A;  4MFI A;  3RYD A;  1FRP A;  1LAH E;  3OD7 A;  3CFZ A;  4U22 A;  1Y4T A;  4IR8 A;  2L5V A;  4P1L A;  1FQA A;  2I58 A;  2AL4 A;  4JSD A;  4NAP A;  2I49 A;  3DP6 A;  2V3U A;  1H45 A;  1UTB B;  4JXI A;  3G3G A;  5ESY A;  1BP5 A;  1XC1 A;  5AA3 A;  3TOD A;  4LN5 A;  4R75 A;  4P56 A;  2XXR A;  3EPE A;  3RT8 A;  3H6U A;  1S50 A;  5CMC A;  2UVI A;  3IFC A;  4JWY A;  1UIU A;  4DCX A;  1MPB A;  3K1P A;  2XXY A;  4MIJ A;  2PT2 A;  3C34 A;  3FUZ A;  1VR5 A;  1D4N A;  3E4R A;  1FBD A;  3QIM A;  1SD3 A;  1NUY A;  3KSX A;  1IMC A;  4WEP A;  4PAK A;  1EH3 A;  3D1R A;  5I5P A;  2R9J A;  1VE4 A;  3LUZ A;  1Y1Z A;  1IME A;  4QSE A;  2A5T B;  1MY4 A;  2VPO A;  3I3V A;  2M8C A;  4ZE8 A;  1A7L A;  3U72 A;  3T66 A;  5HBC A;  2Q2A A;  1IMD A;  5EYH A;  3FBP A;  2OWS A;  2F36 A;  3LBS A;  1FPK A;  1LAX A;  5ET5 A;  3H4Z A;  2WKY A;  1YXI A;  4H65 A;  4N17 A;  4KI0 E;  5K2Y A;  4RY1 A;  1NNF A;  4KYD A;  2HXW A;  1D3K A;  2F3D A;  2I3W A;  4P8B A;  2AIX A;  2ZNT A;  5JTY A;  2DOJ A;  2V4C A;  5AA1 A;  4R9F A;  3MZ9 A;  5ET7 A;  5K2X A;  4OVR A;  4QFL A;  1BIY A;  3UP9 A;  4P0I A;  1N04 A;  2XWO A;  3TDJ A;  3CFX A;  3HPI A;  2GHB A;  2CEX A;  3QUJ A;  1RDX A;  2HZK A;  3IL1 B;  2XX9 A;  4N4U A;  4N91 A;  3U93 A;  1FPB A;  2O69 A;  1MQH A;  3ISP A;  1N3W A;  3HFU A;  5H8Q B;  5DVF A;  1MRP A;  3WAF A;  3O6G A;  3RN8 A;  1N7X A;  4DZ1 A;  4PE3 A;  3VLV A;  1B3L A;  2QMW A;  2DS9 A;  2XHD A;  4N8G A;  5JEI A;  3S9L C;  4UAB A;  1UTB A;  4YKP A;  4O7M A;  2Y7R A;  3VLW A;  2DP8 A;  4ZEF A;  4F2O A;  5EHM A;  4GF8 A;  3N94 A;  4KQP A;  5BUU A;  5L9O A;  3OO9 A;  1MXY A;  1ATG A;  3KSJ A;  4N6K A;  2I3V A;  5I58 A;  3TTM A;  3MW0 A;  5J1D A;  1FBF A;  3TEL A;  4N6P A;  3PPN A;  4O7I A;  1MQG A;  4RNS A;  4QXD A;  4N15 A;  3VXB A;  5CC2 A;  4GBW A;  1PBP A;  1NV6 A;  1LEV A;  3PU5 A;  2ZYK A;  4PFI A;  3PUV E;  3C36 A;  2ZMB A;  5ITP A;  2QJE A;  4OEU A;  4LQ5 A;  3G3H A;  1OVT A;  2FA7 A;  4LON B;  3T9X B;  3OO7 A;  2CMO A;  4F18 A;  4NN3 A;  1B1X A;  4FED A;  3H7M A;  4JVC A;  4Q0C A;  2DE3 A;  5F1Q A;  1RKM A;  1LBB A;  1A8E A;  1XOC A;  1JW5 A;  2QPQ A;  1DOT A;  1JVX A;  3CHG A;  4BDO A;  2V84 A;  2F5X A;  1R9Q A;  4EQB A;  4MX6 A;  3PTY A;  3QXM A;  3HHG A;  4HE0 A;  3LSL A;  4QFP A;  5H8F A;  4FIM A;  4OYV A;  3ILU B;  2OWT A;  4NED A;  3BIH A;  4YMA A;  4F3G A;  1FQF A;  4DXC A;  2ZNU A;  5CBS A;  1IMA A;  1MY2 A;  3IAZ A;  3CI8 A;  4G8M A;  3DEL B;  3ILT B;  2F7B A;  3QSL A;  5B70 A;  4U23 A;  5JK4 A;  4JBZ A;  5H8Q A;  4NX1 A;  1CE2 A;  2F7C A;  4MH5 A;  4GD5 A;  4X1D A;  1DTG A;  3QUF A;  2F3B A;  4H8J A;  1WDN A;  4ECF A;  5CM6 A;  1B52 A;  2WYP A;  4QSD A;  1FTK A;  1LFI A;  1NUW A;  4PCD A;  3TTK A;  4PGP A;  5TP9 A;  5DT6 A;  3MP1 A;  2QS4 A;  3PUW E;  1YAE A;  4GWW A;  3KC0 A;  3E3K A;  2Z8E A;  3IO4 A;  3FV2 A;  3THI A;  1H3D A;  3RTW B;  2P2A A;  5JTY B;  1Y3P A;  2VGQ A;  2B3F A;  4IGT A;  4LVQ A;  3KG2 A;  2H25 A;  1LAG E;  3DM0 A;  4Z0I A;  2WX9 A;  4IGR A;  4IY5 A;  1Y1M A;  5DTB A;  4P0G A;  3T0J A;  4X9T A;  3IX1 A;  1MDQ A;  4G4P A;  2PFZ A;  1N76 A;  2E0S A;  3ZKK A;  2ONK E;  1ZKB A;  2QSX A;  4XIG Q;  3NOH A;  1BKA A;  3IO6 A;  4NF8 A;  1TWY A;  4PFW A;  3ODB A;  1NV0 A;  2HEU A;  1O64 A;  4TLM B;  3L6G A;  4FOR A;  4MBP A;  1IIW A;  4XF5 A;  4PF8 A;  1O63 A;  3T9V A;  2CZH A;  3GYY A;  2WBD A;  4BDQ A;  2XX8 A;  2KQZ A;  3H6V A;  3UK4 A;  1I69 A;  2QS2 A;  4AQ4 A;  3SES A;  4F2Q A;  3C31 A;  3MUQ A;  1USY E;  3I5O A;  4DXB A;  1FTJ A;  4QBA A;  3ECR A;  1PBQ A;  1FBG A;  4P1E A;  4G8N A;  1URG A;  1M5D A;  3N26 A;  4ELR A;  4N8Y A;  2QL3 A;  1IEJ A;  3BKI B;  4G2Z A;  4I3Y A;  4OZ9 A;  5AA2 B;  5I2K A;  3SZP A;  1GV8 A;  1QUI A;  5I59 A;  3BFU A;  5EYF A;  3WAE A;  2ZXT A;  3K6X A;  3OSQ A;  4IB2 A;  3ZSF A;  3RNN A;  4GWX A;  3FJG A;  3U1O A;  2DYX A;  3T1B A;  4GFR A;  4ESX A;  4F29 A;  4LZ7 A;  1FTO A;  4XKN A;  4GWO A;  2OJT A;  4R6Y A;  2R6G E;  4OTE A;  3B6T A;  5EQA A;  4X8R A;  1CB6 A;  4G68 B;  2Z22 A;  1G0I A;  4PF6 A;  1FBC A;  1OLA A;  2ZYO A;  1MXW A;  1Y9U A;  3EHT A;  4WED A;  4G8H A;  4PDD A;  4PE5 B;  5ICQ A;  1FTM A;  1XHY A;  2ZZW A;  1DTZ A;  4MNC A;  4POX A;  1OLC A;  5KZT A;  1T0K A;  5L9M A;  3OMB A;  4Z7E A;  5EQ8 A;  4U21 A;  3KFM A;  4PAF A;  2BJI A;  2G93 A;  1JW1 A;  3LC8 A;  2FHY A;  2RCA A;  4NTL A;  1LST A;  1D9Q A;  1VFD A;  1R6Z A;  3PD9 A;  1MY3 A;  3DP4 A;  3S9N C;  5ELV A;  2ZYM A;  1EZO A;  1LCF A;  3FD3 A;  4Q5T A;  3KZG A;  2VP1 A;  2X26 A;  2RC8 A;  3UOR A;  2AL5 A;  3FGS A;  3G7W A;  1RYO A;  3DLN A;  2DWI A;  1GVC A;  2PFY A;  2PT1 A;  3IK6 B;  2V93 A;  1FTA A;  5LTC A;  3SKP A;  3IOT A;  2NXO A;  2Q74 A;  4KCC A;  2O6A A;  5EQ7 A;  2QS3 A;  4TLL B;  3MYU A;  1RDY A;  2G29 A;  2FIX A;  4NF0 A;  3MVW A;  3JYR A;  1NUZ A;  3PUZ E;  5HPQ A;  3Q25 A;  1AIV A;  3O6H A;  4OES A;  1IMF A;  4YKJ A;  4ESW A;  1N0T A;  1Q9D A;  1B2H A;  1DPE A;  3K2D A;  4N07 A;  3MPK A;  2BJJ X;  4L17 A;  3QYT A;  3JZJ A;  3KN8 A;  4OVQ A;  4E0W A;  3TTR A;  5T3J A;  4GWU A;  3FVG A;  1FTL A;  4OFO A;  4HTG A;  3SEU A;  1LB9 A;  1AWB A;  4I40 A;  2FIE A;  4IY6 A;  1MG1 A;  1TXF A;  4GL0 A;  3EHU A;  1B5H A;  3ROJ A;  3TCG A;  3EQ1 A;  4AS4 A;  4XKQ A;  3IJO B;  3I6V A;  5H8N A;  1D9Y A;  1SBP A;  4N6D A;  2XA5 A;  1R1N A;  4QFK A;  3SEV A;  3B7D A;  4IO2 A;  2H4I A;  2GQ1 A;  5A5X B;  1OQH A;  2O51 A;  4HS7 A;  2VHA A;  1NKX A;  3T93 B;  3B6W A;  1DSN A;  5H8N B;  3H6W A;  2RKM A;  4BDL A;  3ZS6 A;  3U8Q A;  5IZ1 A;  3FVN A;  4WKM A;  1OIB A;  3B6Q A;  2ESN A;  5CRY A;  2IA4 A;  4OEN A;  5TPA A;  1JEU A;  5F24 A;  5H8S A;  4H5F A;  3FJ7 A;  3N6T A;  2UVH A;  5FBP A;  4PBH A;  2Q8M A;  2VOZ A;  3MBP A;  3G3K A;  5I57 A;  5DW8 A;  5DVJ A;  2GHA A;  2ONS A;  3VXC A;  4OVJ A;  4BDM A;  1IQ7 A;  3C9H A;  2DQV A;  2Y7K A;  1XS5 A;  2H9B A;  2Y7P A;  5AA2 A;  1UTH B;  4O3B A;  5I57 B;  4OWD A;  1YYZ A;  3UA8 A;  2PVU A;  1B7Z A;  4Q30 B;  3G3J A;  4LUB A;  4GWZ A;  4YB6 A;  4F1V A;  2F8D A;  5AA4 B;  2X7P A;  1M5E A;  5AE4 A;  1BTJ A;  4DCY A;  4GVO A;  3M8U A;  3FJM A;  3KOT A;  2DE4 A;  3USD A;  3W9W A;  2CZK A;  1B3E A;  4R2F A;  4P11 A;  4MCO A;  3VFJ A;  4FJP A;  5DYH A;  4EXK A;  3CVG A;  1JET A;  1EYI A;  1Q35 A;  1II5 A;  2CZI A;  2NUV A;  4LQ2 A;  3S4U A;  2REJ A;  3FZV A;  1MM7 A;  4YU0 A;  5I84 A;  3MP6 A;  4K3F A;  1OQG A;  3HHF A;  4HCY A;  3EHS A;  1MQD A;  3MVX A;  1MM6 A;  1EYK A;  1NUX A;  1FQD A;  1B40 A;  2PX1 A;  2F34 A;  3O28 A;  1QW0 A;  3PPO A;  2Z8D A;  3CG3 A;  4ZEB A;  4XTC Q;  3U94 A;  4EF1 A;  4P47 A;  1H44 A;  3VLU A;  1YZ0 A;  4YAH X;  4GRK A;  1FJ6 A;  4F3S A;  4R73 A;  4YB5 A;  5H8H A;  2MKZ A;  1D9V A;  3K0V A;  1FW0 A;  1QVS A;  3HO7 A;  3LR1 A;  4H1X A;  2UVJ A;  4ONY A;  2XXT A;  4GQO A;  3FAS A;  3E78 A;  1A99 A;  3PPQ A;  5CI5 A;  1PDA A;  3SEW A;  3RQT A;  1NV1 A;  2Y5K A;  2R71 A;  1QUJ A;  1Y4C A;  4KR5 A;  1LFH A;  5LOM A;  1B7H A;  2XD3 A;  2HAU A;  1TFA A;  1FPL A;  1IIT A;  3IB0 A;  2B4L A;  3Q26 A;  3MVZ A;  1NV2 A;  1LAF E;  3K6U A;  5IGA A;  1FPI A;  4KHZ E;  3SDF A;  2O84 X;  2V3Q A;  4FEC A;  2RC7 A;  3PMW A;  3T9U A;  4OHN A;  1OVB A;  3TYH A;  2O7I A;  2O1M A;  4NE4 A;  2UXA A;  1ZMG A;  2Q8J A;  1KA1 A;  1POT A;  4F1Y A;  3RTF B;  2VD2 A;  2HZL A;  4IO4 A;  4FEB A;  4PTK A;  2XWV A;  4PBQ A;  3QAX A;  2F6P A;  4GX4 A;  4XKP A;  1XVX A;  4HW8 A;  3CIJ A;  3KJT A;  3LSW A;  1P99 A;  2I4C A;  3FAT A;  1B0H A;  4FE8 A;  3TKD A;  4H6D A;  4X1B A;  3K6W A;  2VPN A;  2FNC A;  2I0C A;  2R8T A;  4Q8R A;  3KOS A;  4TQU Q;  1LCT A;  4BLA A;  2Q88 A;  1S9T A;  2FYI A;  4BDN A;  1Q1K A;  5TU0 A;  5AA4 A;  3SEY A;  3B50 A;  2XXX A;  1B05 A;  2F78 A;  5LDZ A;  2NVU B;  1SW1 A;  1WVJ A;  2DVZ A;  3PUY E;  1XI6 A;  2E1S A;  1ZU0 A;  2QFL A;  1L5T A;  4H67 A;  1EU8 A;  4ZEC A;  1FQE A;  1G0H A;  4HE2 A;  1IXI A;  3R6U A;  4X48 A;  4G61 A;  3HN0 A;  3H6T A;  3O6I A;  3MZ1 A;  1ZLQ A;  3G3F A;  3RLF E;  3OXN A;  4OVT A;  2OZZ A;  4OVP A;  4PP0 A;  1URS A;  3EKI A;  3IB1 A;  2HFB A;  2OK2 A;  3V8X B;  2ZZX A;  1IXG A;  3PUX E;  3QMF A;  1DMB A;  5IAI A;  4GX3 A;  1B6H A;  1EYJ A;  5IM2 A;  3LSF B;  1VSO A;  3E9X A;  1FBH A;  4G68 A;  4U4X A;  3RT6 B;  4OMB A;  3W15 C;  4OER A;  1B1H A;  3Q29 A;  3OEM A;  3PV0 E;  3PGF A;  2A5T A;  4NQ8 A;  1MH4 A;  1MXV A;  3TUS A;  1NV5 A;  4R6K A;  3VV5 A;  4MJO A;  2ABH A;  1UQW A;  4GWY A;  5I3S A;  4NGU A;  3TCH A;  2OCU A;  4UAC A;  1UIV A;  1GTK A;  2OBG A;  3R7X A;  3O2A A;  4OA4 A;  4QFN A;  3CFL A;  3TPA A;  4MLQ A;  4NHB A;  1FBP A;  5KCJ B;  1QJM A;  1B32 A;  4LAT A;  1MQI A;  4RYA A;  4RA1 A;  1AL3 A;  2THI A;  3SEX A;  4ZEI A;  1CNQ A;  2A5S A;  4PFY A;  2KLF A;  1NNT A;  2H98 A;  5FHM A;  4QRZ A;  1TFD A;  1A55 A;  5IZZ A;  1IXC A;  3VVE A;  1SVX B;  3TTL A;  1FJ9 A;  4JDF A;  3GZG A;  5I56 A;  1LLS A;  1YCJ A;  4C0R A;  3O66 A;  1SQY A;  3IOV A;  2RF1 A;  4P9K A;  2F97 A;  2WEF A;  2PMS A;  3FXR A;  2OLB A;  3OO6 A;  4JVI A;  3TTN A;  3CSB A;  4KD5 A;  1FPG A;  4O94 A;  1Z7N E;  1LBC A;  1VDW A;  2ANJ A;  5HM4 B;  5FHN A;  3KJ7 A;  2YPN A;  1TT1 A;  4DI3 D;  5BWJ A;  2GFE A;  4PAI A;  5EHS A;  5DEX B;  1P1N A;  2PCR A;  4P3L A;  3AXF A;  3UGW A;  1F9B A;  1PB8 A;  2W7Y A;  4EXL A;  2NWJ A;  3K1M A;  4PET A;  4PC9 A;  3K6V A;  1M5B A;  4NMY A;  5CMB A;  3TQW A;  2XXW A;  3RPL B;  4MNI A;  4O3A A;  1B3H A;  1NNP A;  3S9E A;  1RDZ A;  1LBY A;  3MJN A;  3B8B A;  4KFQ A;  4MLV A;  2B4M A;  3A3U A; 
#chains in the Genus database with same CATH homology
 3O97 A;  1DPP A;  4U2R A;  3V83 A;  3KEI A;  1SYI A;  4YKI A;  5ITO A;  4F18 A;  4FAJ A;  3RUM A;  3H3G A;  4DDD A;  1B1X A;  2VOZ A;  4GXA A;  4PFT A;  1ZTY A;  1SI1 A;  3CR9 A;  2P0S A;  4FED A;  4IO3 A;  3MVY A;  2DXR A;  4F39 A;  3MBP A;  3H7M A;  3G3K A;  4Q0C A;  5I57 A;  2DE3 A;  2QRY A;  4OXV A;  5F1Q A;  5DVJ A;  1RKM A;  2GHA A;  4O3C A;  5TP9 B;  2ONS A;  1LBB A;  2RIN A;  1A8E A;  2DXY A;  3RY3 A;  3VXC A;  1XOC A;  3D4G A;  4OVJ A;  2DVC A;  4BDM A;  1IQ7 A;  1JW5 A;  1O7T A;  2QPQ A;  3C9H A;  3HV1 A;  1JQF A;  2DQV A;  2QMX A;  2YJP A;  1DOT A;  2Y7K A;  1XVY A;  1XS5 A;  2H9B A;  1JVX A;  4NF6 B;  4GIZ A;  1LB8 A;  2Y7P A;  5AA2 A;  1UTH B;  1URD A;  1HSJ A;  2XXQ A;  4O3B A;  3MPL A;  4BDO A;  2V84 A;  2DWH A;  5I57 B;  2F5X A;  4OWD A;  1R9Q A;  4EQB A;  2O1L A;  3GBB A;  3SER A;  4FAT A;  1ANF A;  3QXM A;  4JWX A;  2Q2C A;  3HHG A;  1MY0 A;  3UA8 A;  3LSL A;  2PVU A;  1B7Z A;  4Q30 B;  3FV1 A;  4QFP A;  4ZS9 A;  4F1U A;  3G3J A;  5H8F A;  2PYY A;  2DSF A;  1MY1 A;  4LUB A;  4YB6 A;  2DWA A;  4FIM A;  4F1V A;  2F8D A;  5AA4 B;  4OYV A;  2RC9 A;  5B7D A;  2YLN A;  3ILU B;  2D21 A;  1YTV A;  2OWT A;  2X7P A;  3PMX A;  3QK6 A;  1M5E A;  5H8F B;  5AE4 A;  4NED A;  1Z7M E;  1SDX A;  4YMA A;  1BTJ A;  2Z23 A;  4F3G A;  1FQF A;  4GVO A;  4DCY A;  2QS1 A;  4R6H A;  5DVI A;  4DXC A;  2ZNU A;  1B51 A;  3M8U A;  3O9P A;  1SW4 A;  4POW A;  2D3I A;  3IOW A;  2I48 A;  5CBR A;  5CBS A;  1JVY A;  3FJM A;  4G68 C;  3TMG A;  1MY2 A;  3IAZ A;  1B4Z A;  2DE4 A;  1NNK A;  1B9J A;  3KOT A;  3CI8 A;  3USD A;  3W9W A;  4G8M A;  4XKR A;  3IB2 A;  1HSL A;  4YIC A;  1B3E A;  3DEL B;  3ILT B;  4OFJ A;  2O68 A;  2F7B A;  3QSL A;  4RK2 A;  4R2F A;  4F22 A;  2XXP A;  5B70 A;  4U23 A;  2H5Y A;  4NF5 B;  5I59 B;  5JK4 A;  3KN3 A;  4JBZ A;  5H8Q A;  4P11 A;  1M5F A;  1CE2 A;  4OEV A;  1N3X A;  1NH8 A;  2F7C A;  4KYS A;  4HCW A;  4MH5 A;  3RGY A;  4ZED A;  4I1D A;  4GD5 A;  3S9M C;  4X1D A;  3TFL A;  4DIG A;  3VFJ A;  4FJP A;  4U4S A;  1MS7 A;  1AMF A;  1DTG A;  4R2B A;  5DYH A;  3QUF A;  3SET A;  5KDT A;  4XXU A;  2XXU A;  4H8J A;  5L9S A;  3TCF A;  1WDN A;  4PFU A;  3PD8 A;  1P1W A;  3T22 A;  4EXK A;  4ECF A;  3CVG A;  1JET A;  3P7I A;  1Q35 A;  4LZ8 A;  1II5 A;  1MDP 1;  5CM6 A;  1B52 A;  2NUV A;  4LQ2 A;  3S4U A;  4QSD A;  1B58 A;  4NF5 A;  2REJ A;  3FZV A;  1MM7 A;  4YU0 A;  1B3G A;  1FTK A;  2D5W A;  3GXA A;  5I84 A;  2CZL A;  2Z8F A;  1LFI A;  1H76 A;  3K02 A;  3MP6 A;  4IO5 A;  4K3F A;  4R72 A;  1OQG A;  2XXV A;  3HHF A;  3TTK A;  4NF4 A;  4EQ7 A;  3Q28 A;  4HCY A;  1WOD A;  3G3I A;  1B7U A;  3EHS A;  3F11 A;  1MQD A;  3MVX A;  2HCA A;  3Q27 A;  3L6H A;  5TP9 A;  1MM6 A;  3OEN A;  3GBA A;  3OSR A;  5A5X A;  5DT6 A;  4AB5 A;  1P1U A;  3C33 A;  2NOO A;  2F6G A;  1FQD A;  1H43 A;  1IUD A;  2QS4 A;  3MP1 A;  3TQL A;  4EF2 A;  1B40 A;  2PX1 A;  2F34 A;  3PUW E;  3O28 A;  1QW0 A;  3CSG A;  2B3B A;  3K01 A;  4U1Z A;  1YAE A;  4EQ9 A;  2Y84 A;  5I56 B;  3E3K A;  1VFE A;  2PBW A;  2Z8D A;  3PPO A;  4GOT A;  2Z8E A;  3CG3 A;  3ONM A;  4I8C A;  3IO4 A;  3CRB A;  4ZEB A;  4XTC Q;  3FV2 A;  3U94 A;  3THI A;  4I9D A;  4EF1 A;  1H3D A;  4ZZE A;  1H44 A;  2UVG A;  2RCB A;  1FQB A;  3RTW B;  2P2A A;  5JTY B;  1Y3P A;  3VLU A;  3IJX B;  4YAH X;  4YMB A;  2VGQ A;  4GRK A;  2B3F A;  4IGT A;  4F3S A;  4R73 A;  4YB5 A;  4LVQ A;  3V5A A;  3KG2 A;  2H25 A;  1LAG E;  3DM0 A;  4Z0I A;  5H8H A;  3OEL A;  1D9V A;  4HW8 A;  1QKA A;  3K0V A;  1FW0 A;  4IGR A;  2ZYN A;  4IY5 A;  1QVS A;  1NFT A;  1Y1M A;  3HO7 A;  3LR1 A;  5DTB A;  2O7U A;  4H1X A;  4P0G A;  4E0X A;  2UVJ A;  4ONY A;  2XXT A;  4GQO A;  4ZEK A;  4ND9 A;  3FAS A;  1B5J A;  4X9T A;  4G77 A;  1GR2 A;  3IX1 A;  4QF9 A;  4GLI A;  3K4U A;  1A99 A;  3PPQ A;  5IKB A;  5L8D A;  4RPN A;  5CI5 A;  2Q9T A;  3W9V A;  1PDA A;  3C4M A;  3SEW A;  1MDQ A;  2IEE A;  4G4P A;  4GXS B;  1PB7 A;  1N76 A;  1QKB A;  4AB6 A;  2E0S A;  3RPW A;  3FXU A;  3ZKK A;  1N84 A;  2X7Q A;  4IO6 A;  3RQT A;  2P1S A;  3E13 X;  4ELO A;  2ONK E;  4NF4 B;  3OOA A;  3T96 B;  2R71 A;  5I2N B;  1ZKB A;  1QUJ A;  4OFL A;  3C32 A;  2QSX A;  1Y4C A;  3IOU A;  4KR5 A;  1M5C A;  4MF3 A;  4XIG Q;  1LFH A;  1BKA A;  4ELP A;  3TZA A;  3UN6 A;  5LOM A;  1B7H A;  2XD3 A;  3IO6 A;  1IZ1 A;  2DWJ A;  2HAU A;  4NF8 A;  1TFA A;  2LAO A;  3N5L A;  1IIT A;  1TWY A;  2H99 A;  3IB0 A;  3T9H B;  4PFW A;  3Q26 A;  4EUO A;  3MVZ A;  3D4C A;  1MH3 A;  1LAF E;  4R9G A;  3K6U A;  3ODB A;  1MXZ A;  2HEU A;  4R74 A;  1B0L A;  5DEX A;  1XT8 A;  3GLB A;  4U1O A;  1O64 A;  1RYX A;  5F7V A;  4OQO A;  5I2K B;  4TLM B;  3L6G A;  1NH7 A;  1FQC A;  4FOR A;  4KHZ E;  2O84 X;  2I4B A;  3SDF A;  4MBP A;  1IIW A;  5H8H B;  2V3Q A;  1MXX A;  4RXL A;  3TEP A;  4FEC A;  1I6A A;  1PEB A;  2RC7 A;  5ICT A;  3PMW A;  2I0B A;  3T9U A;  3FVK A;  1O63 A;  2XXI A;  5I58 B;  3T9V A;  1LFG A;  5FHO A;  4C1T A;  4OHN A;  1OVB A;  3OEK A;  3M3L A;  3TYH A;  4BDQ A;  4N13 A;  2O7I A;  2O1M A;  4NE4 A;  2I6E A;  2UXA A;  4NWD A;  3MC2 A;  2XX8 A;  4ISU A;  3H6V A;  1ZMG A;  3UK4 A;  2Q8J A;  1I69 A;  2Y7W A;  2V3T A;  1POT A;  4F1Y A;  3RTF B;  2VD2 A;  2QS2 A;  2HZL A;  4IO4 A;  4FEB A;  1SW5 A;  3DP8 A;  4AQ4 A;  1LGB C;  3SES A;  3KGC A;  4F2Q A;  3C31 A;  1A54 A;  3OO8 A;  2HAV A;  3MUQ A;  2F6P A;  3QAX A;  4MFI A;  1PC3 A;  4ZZA A;  1USY E;  3I5O A;  1LAH E;  2XX7 A;  1B46 A;  3MAM A;  3OD7 A;  1FTJ A;  4WXJ A;  4KPT A;  4XKP A;  4DXB A;  3ECR A;  1XVX A;  3CFZ A;  3VLV A;  5FTI A;  4U22 A;  1Y4T A;  3CIJ A;  3KJT A;  3LSW A;  1P99 A;  3KN7 A;  4THI A;  1PBQ A;  2I4C A;  3IOR A;  4G8N A;  1URG A;  1M5D A;  2B65 A;  3BBR A;  3N26 A;  3FAT A;  1B0H A;  1S7Y A;  1FQA A;  2QL3 A;  4OET A;  4ELR A;  3HCQ A;  2I58 A;  4FE8 A;  4YZZ A;  1IEJ A;  2AL4 A;  3BKI B;  4JSD A;  3TKD A;  2ONR A;  4H6D A;  4G2Z A;  2I49 A;  3DP6 A;  4IO7 A;  4X1B A;  2V3U A;  4OZ9 A;  3K6W A;  5AA2 B;  2FNC A;  5I2K A;  4NF6 A;  1H45 A;  2I0C A;  1QUI A;  4TOZ A;  4YKK A;  1GV8 A;  3VDF A;  4EDP A;  5I59 A;  3BFU A;  4Q8R A;  1UTB B;  5EYF A;  4JXI A;  3G3G A;  3KOS A;  3WAE A;  2ZXT A;  3K6X A;  1US4 A;  3OSQ A;  1LCT A;  4TQU Q;  3HST A;  3UIF A;  4IB2 A;  3ZSF A;  4BLA A;  3LUY A;  2Q88 A;  3N6U A;  4H5G A;  3RNN A;  1BP5 A;  1S9T A;  1XC1 A;  1POY 1;  1JEV A;  2FYI A;  3FJG A;  3PPP A;  3TOD A;  2DYX A;  1MXU A;  4R75 A;  3U1O A;  5I2N A;  4GFR A;  4ESX A;  2XXR A;  4F29 A;  2F7A A;  3EPE A;  4BDN A;  3RT8 A;  1Q1K A;  3H6U A;  1S50 A;  4LZ7 A;  1FTO A;  5CMC A;  1USY H;  2Q89 A;  2UVI A;  5TU0 A;  5AA4 A;  3SEY A;  2XXX A;  1B05 A;  2XXH A;  4XKN A;  1Y20 A;  1Y3N A;  1MPD A;  2F78 A;  4GWO A;  2OJT A;  3R26 A;  1QUK A;  2XD2 A;  4R6Y A;  2DE2 A;  2R6G E;  1PB9 A;  2UYF A;  3B6T A;  4OTE A;  2NVU B;  3EN3 A;  4JWY A;  1R9L A;  1CB6 A;  4QSC A;  1UIU A;  4DCX A;  1MPB A;  4G68 B;  4NWC A;  1SW1 A;  3K1P A;  1WVJ A;  2XXY A;  2Y7I A;  2Z22 A;  4LA9 A;  2PT2 A;  3C34 A;  3FUZ A;  1VR5 A;  1D4N A;  2DVZ A;  3PUY E;  2E1S A;  1ZU0 A;  1OLA A;  1L5T A;  2ZYO A;  3E4R A;  1EU8 A;  3QIM A;  4H67 A;  4ZEC A;  1SD3 A;  1FQE A;  1MXW A;  5KDT B;  1Y9U A;  1JNF A;  3KSX A;  1IXI A;  3R6U A;  4X48 A;  5CMM A;  3EHT A;  4WEP A;  4WED A;  2REG A;  4G8H A;  1EH3 A;  5FTH A;  4PE5 B;  4ZDM A;  2V25 A;  4DE8 A;  1B5I A;  5ICQ A;  3HN0 A;  1FTM A;  1XHY A;  3H6T A;  3TAJ A;  2R9J A;  3O6I A;  1VE4 A;  1DTZ A;  1Y1Z A;  2AYS A;  4JSO A;  4LZ5 A;  3MZ1 A;  4M4G A;  4QSE A;  4POX A;  4I62 A;  1ZLQ A;  1OLC A;  2A5T B;  3CG1 A;  3G3F A;  5KZT A;  1MY4 A;  1QUL A;  1T0K A;  3I3V A;  5L9M A;  2M8C A;  4ZE8 A;  3RLF E;  3OMB A;  1A7L A;  3U72 A;  4U21 A;  4Z7E A;  3OXN A;  3PMV A;  3T66 A;  5HBC A;  3KFM A;  1A40 A;  2Q2A A;  2G93 A;  1JW1 A;  3LC8 A;  2OZZ A;  2OWS A;  2RCA A;  5AA3 A;  4PP0 A;  1URS A;  4NTL A;  1LST A;  2F36 A;  1B4H A;  3LBS A;  3IB1 A;  1VFD A;  2HFB A;  1R6Z A;  2OK2 A;  1YPN A;  3V8X B;  4F19 A;  1LAX A;  1MY3 A;  3PD9 A;  1SI0 A;  3DP4 A;  3O29 A;  3H4Z A;  1AH5 A;  3S9N C;  4RK9 A;  1IXG A;  2WKY A;  5ELV A;  3FIR A;  4H65 A;  3PUX E;  3S2V A;  4BDR A;  2ZYM A;  1AOV A;  1LCF A;  1DMB A;  4KI0 E;  4RY1 A;  5K2Y A;  4KCD A;  1B6H A;  3FXQ A;  4LP2 B;  5CMK A;  5IAI A;  1GGG A;  2F35 A;  3LSF B;  1NNF A;  1VSO A;  2HXW A;  4KYD A;  2HQ0 A;  3FD3 A;  1D3K A;  4Q5T A;  3A3C A;  1B3F A;  1NL5 A;  3E9X A;  3KZG A;  2I3W A;  4G68 A;  3VVF A;  2VP1 A;  2AIX A;  2ZNT A;  2X26 A;  4U4X A;  5JTY A;  2RC8 A;  5ISU A;  2DOJ A;  3RT6 B;  3UOR A;  2AL5 A;  3FGS A;  4OMB A;  5AA1 A;  3W15 C;  1US5 A;  1B1H A;  1HSE A;  1RYO A;  3DLN A;  3G7W A;  4OER A;  2DWI A;  4UA8 A;  5M2V A;  1GVC A;  3Q29 A;  4R9F A;  1Y3Q A;  3OEM A;  3MZ9 A;  3PV0 E;  2PT1 A;  3IK6 B;  1MQJ A;  3PGF A;  3H06 B;  1NMU A;  2V93 A;  2A5T A;  1MH4 A;  1MXV A;  3SKP A;  3TUS A;  3IOT A;  1EZP A;  5K2X A;  4R6K A;  3BFT A;  2NXO A;  4RJZ A;  3VV5 A;  2GH9 A;  4KCC A;  4QFL A;  4YB7 A;  1MPC A;  2ABH A;  2O6A A;  1UQW A;  2QS3 A;  1BIY A;  4TLL B;  1I6B A;  3TCH A;  2OCU A;  2VD3 A;  3UP9 A;  4UAC A;  2G29 A;  4P0I A;  1N04 A;  1UIV A;  3H03 A;  3M3F A;  1J1N A;  1FCK A;  1GTK A;  3MVW A;  1SYH A;  3TDJ A;  3JYR A;  3CFX A;  2OBG A;  4JWO A;  4DXU A;  3HPI A;  3R7X A;  3O2A A;  2GHB A;  3QUJ A;  3PUZ E;  5HPQ A;  1N7W A;  2HZK A;  3IL1 B;  4QFN A;  2XX9 A;  3CFL A;  1IXH A;  3Q25 A;  4H8I A;  1AIV A;  3TPA A;  3O6H A;  4OES A;  4MLQ A;  1ZIU A;  3U93 A;  3MQ9 A;  4YKJ A;  1QJM A;  5KCJ B;  2O69 A;  4ESW A;  1N0T A;  1B32 A;  1MQH A;  4F3B A;  1B2H A;  1N3W A;  4LAT A;  1MQI A;  3V89 B;  4RYA A;  1DPE A;  4RA1 A;  5DVF A;  5H8Q B;  3JV9 A;  1MRP A;  1ELJ A;  3K2D A;  1AL3 A;  2THI A;  4N07 A;  3WAF A;  3MPK A;  3O6G A;  3SEX A;  3RN8 A;  4ZEI A;  1N7X A;  2A5S A;  2BJJ X;  3MP8 A;  4PFY A;  2KLF A;  4L17 A;  4C1U A;  4DZ1 A;  1BLF A;  4GL8 A;  1SW2 A;  1NNT A;  3QYT A;  2H98 A;  1B3L A;  2QMW A;  1ZBM A;  2DS9 A;  3JZJ A;  1TFD A;  3KN8 A;  4QRZ A;  5FHM A;  1A55 A;  2XHD A;  4E0W A;  3MWB A;  3TTR A;  1IXC A;  3VE1 B;  4NF8 B;  3M3K A;  3K00 A;  3VVE A;  4ZE9 A;  5JEI A;  1SVX B;  4RPO A;  3ZKL A;  1P1Q A;  2ZNS A;  3TTL A;  1I6Q A;  4JDF A;  3S9L C;  3GZG A;  5I56 A;  1LLS A;  1YCJ A;  4F31 B;  1UTB A;  3FVG A;  4YKP A;  1KWH A;  1FTL A;  3O66 A;  1A8F A;  1SQY A;  3PPR A;  4OFO A;  4C0R A;  2Y7R A;  3IOV A;  1P1O A;  2DP8 A;  4HTG A;  2RF1 A;  3VLW A;  3SEU A;  1ZJL A;  2F97 A;  3LSX A;  4KYE A;  4ZEF A;  2UYE A;  5EHM A;  4F2O A;  1LB9 A;  4GF8 A;  3N94 A;  4KQP A;  3C35 A;  2PMS A;  5BUU A;  5TPA B;  4ELQ A;  5L9O A;  3OO9 A;  1MXY A;  1ATG A;  3KSJ A;  3FXR A;  4IY6 A;  2OLB A;  1MG1 A;  3OO6 A;  4F3P A;  1EZO A;  1TXF A;  3TTN A;  4GL0 A;  3EHU A;  1B5H A;  2I3V A;  3CSB A;  3TCG A;  5I58 A;  5KCJ A;  3EQ1 A;  4KD5 A;  1Z7N E;  1LBC A;  3MZB A;  3MW0 A;  3TTM A;  4XKQ A;  5HM4 B;  2ANJ A;  5J1D A;  2ALU A;  5FHN A;  3IJO B;  1OMP A;  4M1V A;  4PQJ A;  3I6V A;  5H8N A;  4DLD A;  1D9Y A;  1SBP A;  3KJ7 A;  3TEL A;  2YPN A;  1TT1 A;  1R1N A;  4QFK A;  5BWJ A;  1UTH A;  2GFE A;  5EHS A;  3SEV A;  4N6P A;  3B7D A;  5DEX B;  1EZ9 A;  3PPN A;  4IO2 A;  4QFO A;  1P1N A;  1MQG A;  2H4I A;  4RNS A;  3AXF A;  3UGW A;  3A09 A;  5A5X B;  1F9B A;  1OQH A;  3VXB A;  1PB8 A;  2O51 A;  4HS7 A;  2VHA A;  1NKX A;  2W7Y A;  5CC2 A;  3VVD A;  3T93 B;  1PBP A;  3B6W A;  4EXL A;  2NWJ A;  1DSN A;  3K1M A;  3PU5 A;  3H6W A;  2ZYK A;  3K6V A;  4PET A;  3FVO A;  5H8N B;  3PUV E;  2RKM A;  1M5B A;  3EF7 A;  4BDL A;  3IR1 A;  3C36 A;  2ZMB A;  4NMY A;  5ITP A;  4JB7 A;  3ZS6 A;  3U8Q A;  5CMB A;  3TQW A;  2QJE A;  2XXW A;  3FVN A;  4OEU A;  4LQ5 A;  4WKM A;  1OIB A;  1JW4 A;  4O3A A;  5AA2 D;  3G3H A;  3B6Q A;  2ESN A;  1B3H A;  1NNP A;  5CRY A;  3KBR A;  3U92 A;  3S9E A;  1OVT A;  2IA4 A;  2FA7 A;  4LON B;  1JEU A;  4OEN A;  5H8S A;  4H5F A;  5TPA A;  3T9X B;  3A3U A;  3MJN A;  3FJ7 A;  3K1N A;  3OO7 A;  4KFQ A;  4MLV A;  3N6T A;  2UVH A;  4H0W A;  2CMO A;  4QHQ A;  2GRV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...