1Y9UA

Bordetella ferric binding protein
Total Genus 112
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
112
sequence length
318
structure length
314
Chain Sequence
b'DEVSLYTTREPKLIQPLLDAFAKDSGIKVNTVFVKDGLLERVRAEGDKSPADVLMTVDIGNLIDLVNGGVTQKIQSQTLDSVVPANLRGAEGSWYALSLRDRVLYVEKDLKLDSFRYGDLADPKWKGKVCIRSGQHPYNTALVAAMIAHDGAEATEKWLRGVKANLARKAAGGDRDVARDILGGICDIGLANAYYVGHMKNAEPGTDARKWGDAIKVVRPTFAGGTHVNISGAAVAAHAPNKANAVKLLEYLVSEPAQTLYAQANYEYPVRAGVKLDAVVASFGPLKVDTLPVAEIAKYRKQASELVDKVGFDN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords putative iron binding protein
publication title Anion-independent iron coordination by the Campylobacter jejuni ferric binding protein
pubmed doi rcsb
source organism Bordetella pertussis tohama i
molecule tags Metal binding protein
total genus 112
structure length 314
sequence length 318
ec nomenclature
pdb deposition date 2004-12-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1y9uA02
2O84X 1Y3NA 4U2RA 5CI5A 3TPAA 1I6QA 3QIMA 3C34A 5FHMA 2X7QA 3K01A 2Q2AA 3MP1A 1ANFA 3U8QA 1D9YA 2HZKA 1ZU0A 4NWCA 3DP4A 3O97A 1MRPA 3C9HA 4NF6A 3SEVA 5KCJB 1S50A 2R9JA 4G4PA 4KR5A 3VV5A 2RC9A 1UTBB 3SEUA 3V5AA 3SEYA 3C35A 3OXNA 3TDJA 4YZZA 1ZIUA 1B3GA 2DWHA 3AXFA 3N6TA 4ND9A 3MVXA 4I62A 3MPLA 1NNPA 1P99A 4O3BA 3JYRA 1MPCA 3VVEA 4OWDA 4YB6A 3C36A 2RC8A 3TTRA 1NL5A 5H8QB 4QSEA 1YAEA 3LR1A 3TODA 1FQFA 4U22A 5DVJA 4X1BA 3TTMA 1A8FA 3KOSA 3D4CA 4KYEA 3MAMA 4O3AA 2I3VA 1T0KA 1S7YA 4GFRA 1IUDA 1Z7NE 4DLDA 4F3GA 3CRBA 2O7IA 3PPRA 5TPAB 3G3FA 2I4BA 2DSFA 1MQDA 4RNSA 4UACA 3WAFA 4GOTA 4GL0A 5L9OA 1WODA 3F11A 2P0SA 4JDFA 1PC3A 3C32A 5ITPA 1Y9UA 4OESA 2DXRA 3U92A 3PU5A 5DVFA 3IO6A 5A5XB 4RJZA 1B05A 4THIA 3MVYA 3K4UA 5AA4B 2PMSA 3TCFA 1UTBA 3FVNA 4F29A 4ESWA 2O51A 3I6VA 4XTCQ 3H03A 1VR5A 2UVIA 3MBPA 2CMOA 1URSA 2F7CA 3FIRA 3IOTA 2G93A 3FVGA 1RKMA 4Q30B 1BTJA 2ABHA 3CIJA 3VFJA 1XVYA 3ZKKA 4ISUA 4FATA 3PD8A 4H5FA 1EZOA 3Q27A 2QS4A 3MP6A 3K1NA 3LC8A 5M2VA 4ZEFA 1ZKBA 4OTEA 4PFWA 1SD3A 3MQ9A 3RN8A 4P0IA 2GRVA 3E9XA 5H8SA 2F6PA 2IA4A 3EF7A 1N7WA 3S9EA 1PDAA 1HSEA 1SVXB 2XHDA 2X26A 3PMWA 4PE5B 2UYFA 2ONKE 2D5WA 2O7UA 3PUZE 3MC2A 5TU0A 3V89B 2QS3A 2HQ0A 1UTHB 4R9GA 1UIVA 4TOZA 1DOTA 3IORA 2OLBA 1Y4TA 5I58B 4H1XA 2XXXA 5A5XA 4QFKA 4OERA 2ZYOA 4LZ7A 3MZ1A 2PYYA 3U1OA 2Q88A 2VOZA 2ZNTA 3ZS6A 3OEMA 4XXUA 3FXQA 3C33A 3FV1A 1ZMGA 4EQ9A 4ZZAA 2UVJA 4RPNA 5AA2D 3PUYE 5I57B 5DT6A 1USYE 4YMBA 3RQTA 1HSLA 2Z22A 3T9HB 4LP2B 3BKIB 3EHSA 3N26A 3W9VA 1BIYA 1QULA 1B46A 2V3TA 4F2OA 3TZAA 1JNFA 1LCTA 3B6WA 2KLFA 3DELB 2HFBA 1H44A 4U23A 5I59A 5CBSA 5HM4B 4QFLA 1NFTA 5DYHA 3IJOB 1MPDA 2F6GA 3MZ9A 3OSRA 2B3FA 3RTWB 3ZSFA 1EU8A 1YCJA 4G77A 2XD3A 3Q28A 3V8XB 2NWJA 5CMBA 3HN0A 1AMFA 4BDNA 3FATA 2XXHA 4EQ7A 5BUUA 2UYEA 4R73A 1UQWA 4N6PA 1N3WA 3FJGA 1DPEA 4JB7A 1DTZA 5I58A 4NF5B 4R74A 4P11A 2GFEA 3Q29A 5TP9B 4ECFA 1Z7ME 4QFOA 4RXLA 3FXRA 4C0RA 3W15C 5BWJA 3QK6A 3O6HA 2QMWA 3KEIA 5AE4A 1SYHA 1B5HA 3KJTA 4XKPA 1I6AA 2H98A 1ZJLA 4GVOA 1TWYA 2I48A 3UGWA 2Z23A 4OFJA 1AOVA 3TYHA 4JWOA 1B1XA 4POXA 2F34A 4EF1A 3MW0A 1BP5A 3SEWA 4U4XA 4FORA 5H8NA 1MQGA 5H8HA 2AIXA 5CMKA 2Q89A 2NUVA 3M8UA 3U72A 4C1UA 2XX8A 3PMVA 3HV1A 3CSGA 4OETA 2OCUA 4G2ZA 4FJPA 1PB8A 3OO9A 2REJA 3PUWE 1QKAA 4F3SA 2DVCA 3T9VA 4NF6B 5L9MA 4F22A 3T96B 2DWIA 4QFNA 2XXVA 2QMXA 5FTIA 4QRZA 5B7DA 5I2KB 5B70A 5JTYB 4NF4B 4RK9A 2O6AA 3THIA 1JQFA 3L6HA 1XT8A 4EQBA 2Y7KA 1CB6A 4H6DA 1B4ZA 4NF5A 2Y7IA 3ZKLA 4WEDA 3V83A 1B1HA 3CI8A 4WEPA 4MLVA 5DVIA 3U94A 2YLNA 3FXUA 4XKRA 1MPBA 3DP6A 1F9BA 3IO4A 1Y20A 2Y7PA 3RY3A 1NNKA 4DCXA 5IAIA 1D4NA 2I3WA 3UORA 3K6VA 4QF9A 3FUZA 3O2AA 2I0BA 1XHYA 3CVGA 3OO6A 2H9BA 3C31A 1TXFA 4F2QA 3ONMA 3A09A 2V3QA 4MLQA 3HHGA 4AB5A 3CFZA 4NF8A 1H76A 3A3CA 3TFLA 4ZEIA 3FJMA 4F19A 2GH9A 1SBPA 1B2HA 1NH7A 1EZPA 1MG1A 4PFTA 3CG1A 1URDA 3TCHA 3CSBA 3FASA 2PX1A 4G68B 1B32A 5I2KA 1QUIA 4I8CA 1BLFA 4HCYA 1Q1KA 5JTYA 4NF4A 1AIVA 3PPOA 4KPTA 4TLMB 5I56A 3G7WA 5CMMA 1LAXA 1B0LA 3N94A 4ZEDA 4LUBA 3VLWA 2Q2CA 3KJ7A 3OOAA 3PMXA 2F36A 3G3JA 3M3KA 1R9QA 1QUKA 1MXUA 3SDFA 2D21A 4F31B 4G8MA 3SESA 3A3UA 3TUSA 2YJPA 4ELPA 2OZZA 1A99A 4H5GA 5CMCA 1FTKA 5H8FA 2RKMA 3HO7A 3M3LA 4ZEBA 1US4A 3M3FA 1FTMA 1A40A 4IO2A 1OLCA 1SYIA 2ZNSA 1POY1 1RYXA 1PB9A 1SDXA 3FJ7A 3B6TA 1H45A 1A8EA 3MVWA 1LLSA 2OBGA 1XVXA 3W9WA 3PUXE 4HS7A 1FTOA 4POWA 2VGQA 4G68A 4JWXA 5AA2A 2O1LA 1IXIA 2QS2A 1NNFA 1FQCA 2V3UA 3KOTA 3TMGA 1LBCA 3H06B 2REGA 1KWHA 1GTKA 4FEBA 5L9SA 3TTLA 5DEXB 2ZNUA 1QVSA 2ZYMA 1FQAA 2VP1A 3MUQA 3SETA 4GD5A 2V93A 3VXBA 3GXAA 2QPQA 3K00A 4QFPA 1XC1A 2Z8DA 2RINA 3IAZA 3BFUA 1Y4CA 1LFIA 4KCDA 3T9XB 5I59B 4YKIA 2QJEA 1LAHE 4OZ9A 2Z8EA 3JV9A 3BFTA 4GIZA 4BDQA 1M5CA 4YAHX 2M8CA 3USDA 1IEJA 4R75A 3KSJA 1OLAA 1USYH 1MY2A 4GF8A 1O7TA 3IOVA 2F5XA 2DE2A 3VE1B 1SW5A 1IXCA 1N04A 1OIBA 3S9LC 1DPPA 2DYXA 3H6WA 1IIWA 2GHBA 4TQUQ 2E0SA 4OEVA 1JW5A 5CBRA 3H6UA 3FGSA 1B6HA 1MH3A 3R26A 1TFDA 4LVQA 4LONB 4KI0E 4PQJA 1II5A 1YTVA 3PPQA 4R6YA 1N84A 1VFDA 3LSWA 1QKBA 2XD2A 4MBPA 1FQEA 4YICA 2NOOA 4R2FA 1B3HA 1JVXA 2DP8A 5H8NB 4IY6A 5DEXA 1DTGA 1BKAA 5H8HB 1Y1ZA 3DM0A 4MFIA 2HCAA 4F3PA 2E1SA 3CG3A 4R9FA 4NWDA 1MY4A 1B7UA 3BBRA 4G8HA 2RF1A 1SQYA 2QS1A 2XXRA 3DP8A 3KBRA 5EHSA 4DXCA 5ISUA 1IITA 3K6UA 3S4UA 4R72A 4LZ5A 2UVGA 1POTA 3I3VA 3OSQA 4M4GA 2HAVA 4PP0A 4MF3A 2B3BA 4ZE9A 2I4CA 1LFGA 2V84A 4F3BA 4H65A 1B40A 1I69A 1AL3A 4IO7A 3MPKA 3OMBA 1MM7A 4YB5A 4GLIA 4KD5A 3EHUA 4F1VA 4M1VA 1JW1A 1QUJA 4DIGA 1WDNA 4DXUA 1EH3A 2HXWA 1SI0A 3E3KA 1GGGA 5FHNA 3LSFB 5LOMA 2HAUA 1ATGA 3P7IA 2RC7A 1MS7A 4YB7A 4GXSB 1M5FA 3I5OA 1MQJA 4Z7EA 3GZGA 4ZEKA 1LBBA 2XX9A 5K2YA 1SW1A 2I58A 4OVJA 4DE8A 1B58A 4NF8B 1D9VA 3IL1B 1MXVA 3VXCA 2XXTA 5KZTA 1B3FA 2F7AA 2YPNA 1OVTA 5L8DA 3ECRA 3H3GA 4LA9A 4OEUA 1Y3PA 2DE3A 3VVFA 4ZS9A 1CE2A 3S2VA 2XXIA 1PB7A 4QSDA 3RPWA 4ELRA 3S9NC 1PBQA 4U4SA 4NEDA 4OQOA 5I56B 4XKNA 2DWJA 3MJNA 1A54A 2I6EA 4ESXA 4OMBA 3KN8A 4RK2A 2AYSA 3IOUA 4LQ2A 1TT1A 3ILTB 4RY1A 4F18A 3O66A 1N76A 3HCQA 3VDFA 1PBPA 4U1OA 3KG2A 3TCGA 1EZ9A 3FVKA 4GXAA 2R71A 3PPPA 2BJJX 1DMBA 3GBBA 4EXKA 1RYOA 3KN3A 3IB0A 1N3XA 4X48A 2H99A 1I6BA 3G3IA 5I2NB 3TQLA 2P2AA 5H8FB 1MY0A 2FA7A 2V25A 3OD7A 1YPNA 2UVHA 4DZ1A 4NTLA 4KYSA 1LSTA 1B7ZA 4GRKA 1MM6A 3G3KA 2DS9A 4OXVA 1QJMA 3O28A 1H43A 3OO8A 3PGFA 1ZLQA 5I84A 2P1SA 2QL3A 3T22A 3MP8A 3OENA 2XXQA 2A5TA 2VD2A 3S9MC 3QUJA 2OJTA 4U1ZA 4YU0A 1B51A 4LATA 2XXWA 2UXAA 4E0WA 5ICTA 2DVZA 1A55A 1OQGA 4YKJA 3RUMA 5AA2B 2PBWA 3H6VA 3HPIA 3UIFA 2Y84A 4PFYA 2OWSA 3PD9A 3ILUB 2AL4A 2F78A 3O6IA 3K02A 3CFLA 2DOJA 1N7XA 5AA3A 3OO7A 4MH5A 4YKPA 4QHQA 4RYAA 1UIUA 2DXYA 2ONSA 1OVBA 5IKBA 4NE4A 5KDTA 3TELA 4LQ5A 4FIMA 1WVJA 5ITOA 4N13A 4PFUA 3SERA 3R6UA 3UA8A 2R6GE 3K0VA 1P1OA 2LAOA 4XIGQ 4K3FA 5I2NA 4HCWA 4R6KA 4YKKA 3FD3A 3K6XA 3SEXA 1MXYA 2DWAA 3Q25A 1FW0A 4ELOA 1N0TA 1O64A 2AL5A 1LGBC 2Y7RA 4IO5A 3EHTA 3VLUA 4YMAA 4HTGA 3QUFA 3HHFA 3RT8A 4FEDA 3G3GA 3GBAA 2QSXA 5HBCA 3UK4A 4OFOA 1ZBMA 4DDDA 1TFAA 4LZ8A 2ESNA 1VFEA 2RCAA 2A5SA 1P1NA 4IO6A 1R1NA 2ZYKA 1ZTYA 2XXYA 3JZJA 5ICQA 1MXXA 4KHZE 3KZGA 1URGA 5F7VA 4ONYA 3T93B 1GR2A 4AB6A 5KCJA 3TAJA 2XXUA 3O9PA 1M5BA 4BLAA 1LFHA 1XS5A 3LUYA 2O69A 2NVUB 1OMPA 4N07A 4L17A 3O29A 5FHOA 4H67A 5JEIA 5EYFA 5CM6A 3N6UA 4GL8A 3H4ZA 4OENA 1ELJA 4DXBA 4R2BA 5H8QA 3CFXA 2ANJA 3ODBA 4JSDA 1MQIA 1LAGE 1HSJA 1JW4A 1NKXA 3T9UA 4ZE8A 4HW8A 2PT2A 4KYDA 4H8IA 4BDOA 1SW4A 4GWOA 4UA8A 2OK2A 1JEUA 5FTHA 1GV8A 3R7XA 4IGRA 1S9TA 3OEKA 3L6GA 5TPAA 3RLFE 4Z0IA 2ONRA 3T66A 4EDPA 3K6WA 1B52A 2Y7WA 2HEUA 1Y1MA 4H8JA 4G8NA 2IEEA 3KN7A 3IJXB 2ZXTA 4F1UA 3E4RA 5CRYA 1H3DA 4FE8A 2F7BA 4P0GA 1NH8A 3IX1A 3VVDA 4IO3A 1B0HA 3UN6A 2I49A 4H0WA 4ELQA 3MZBA 2CZLA 2ZMBA 3H7MA 3EQ1A 4I1DA 2Z8FA 3H6TA 4O3CA 2THIA 3B7DA 2F97A 5AA4A 5F1QA 1P1QA 1MXWA 3HSTA 4ZZEA 1LCFA 1B5IA 3O6GA 2ZYNA 1R6ZA 3EPEA 1JVYA 1MY1A 3K2DA 1VE4A 4FAJA 4BDLA 2X7PA 4RPOA 5K2XA 2F35A 3IK6B 3K1MA 3C4MA 1LB8A 2W7YA 3B6QA 1R9LA 1AH5A 3KGCA 2XX7A 1LAFE 1JEVA 1GVCA 1PEBA 3TTNA 3K1PA 4JXIA 3LSXA 1XOCA 3PPNA 2FYIA 2WKYA 3GLBA 4RA1A 1Q35A 3RT6B 1P1UA 2B65A 4FECA 2Q9TA 5ELVA 3RTFB 3DLNA 1MY3A 4ZECA 4Q0CA 2I0CA 1IXHA 1LB9A 2H5YA 2ALUA 1FQBA 1UTHA 1P1WA 2XXPA 4IO4A 3RNNA 4ZDMA 3Q26A 1NNTA 3QYTA 1MDQA 2F8DA 1SW2A 2H4IA 3LBSA 2Q8JA 5JK4A 1B3LA 3KSXA 3KFMA 4IGTA 4F39A 3WAEA 1IZ1A 3TQWA 2VHAA 4DCYA 4AQ4A 1B5JA 5J1DA 1M5EA 2O68A 5CC2A 4TLLB 1FTLA 1FTJA 4G68C 1A7LA 1B9JA 2GHAA 3IB2A 2O1MA 5I57A 2FNCA 3SKPA 3FVOA 1B3EA 4EUOA 2H25A 1B4HA 4U21A 2QRYA 3D4GA 5EHMA 3FV2A 4BDMA 4WXJA 3QXMA 1J1NA 3QAXA 3CR9A 4IB2A 2A5TB 3G3HA 5DTBA 4JWYA 1L5TA 1M5DA 3MVZA 4Q5TA 3EN3A 1Y3QA 4BDRA 1IQ7A 4KFQA 4I9DA 4EF2A 1MH4A 1MQHA 3FZVA 3UP9A 1US5A 3RGYA 4OFLA 1OQHA 2PT1A 3IR1A 4XKQA 3VLVA 1FCKA 2DE4A 2VD3A 3QSLA 3LSLA 2HZLA 5KDTB 4R6HA 1VSOA 3TEPA 1NMUA 1MXZA 3TKDA 5AA1A 5HPQA 1DSNA 1QW0A 3MWBA 4OHNA 5TP9A 1FQDA 1B7HA 4JBZA 2DQVA 1D3KA 4KCCA 2OWTA 2NXOA 4NMYA 2RCBA 3PUVE 4IY5A 4E0XA 3N5LA 4OYVA 4JSOA 3PV0E 2PVUA 4GQOA 4PETA 2D3IA 4F1YA 4Q8RA 1O63A 3IOWA 3OELA 4EXLA 3IB1A 1JETA 3U93A 1MDP1 3E13X 4KQPA 4QSCA 4X9TA 4C1TA 1IXGA 1SI1A 3TTKA 4WKMA 2G29A 4X1DA
chains in the Genus database with same CATH superfamily
2O84X 1Y3NA 4U2RA 2XXKA 5J16A 5CI5A 3TPAA 1I6QA 3QIMA 3C34A 5FHMA 2X7QA 3K01A 2Q2AA 3MP1A 1ANFA 5ESYA 3U8QA 1IMAA 1D9YA 2HZKA 1ZU0A 4NWCA 4DI3D 3DP4A 3O97A 1MRPA 4MEVA 3C9HA 4NF6A 3SEVA 5KCJB 1S50A 2R9JA 4G4PA 4KR5A 3VV5A 2RC9A 1UTBB 3SEUA 3V5AA 3SEYA 3C35A 3OXNA 1G0HA 3TDJA 4YZZA 1ZIUA 1B3GA 2DWHA 3AXFA 3N6TA 4ND9A 3MVXA 4I62A 1DBZA 3MPLA 5EYHA 4QBAA 1NNPA 1P99A 4O3BA 3JYRA 1MPCA 3VVEA 3RPLB 4OWDA 4YB6A 3C36A 2RC8A 3TTRA 1NL5A 5H8QB 4QSEA 1YAEA 3LR1A 1NV0A 3TODA 1FQFA 4U22A 5DVJA 4X1BA 3TTMA 4N81A 1A8FA 2HPGA 3KOSA 3D4CA 4KYEA 3MAMA 4O3AA 2I3VA 1T0KA 1S7YA 4GFRA 1IUDA 1Z7NE 4DLDA 4F3GA 3CRBA 2O7IA 3PPRA 5TPAB 3G3FA 2I4BA 2DSFA 4I40A 1MQDA 4RNSA 4UACA 3WAFA 4GOTA 4GL0A 5L9OA 1WODA 3F11A 2P0SA 4JDFA 1PC3A 3C32A 5ITPA 1Y9UA 4OESA 5DW8A 2DXRA 3U92A 3PU5A 5DVFA 4PGNA 3IO6A 5A5XB 1FBFA 4RJZA 1B05A 4THIA 3MVYA 3K4UA 5AA4B 2PMSA 3TCFA 1UTBA 3FVNA 2P3NA 4F29A 4ESWA 2O51A 3I6VA 1Q9DA 4XTCQ 3H03A 1VR5A 4PCDA 2UVIA 3MBPA 2CMOA 1URSA 2F7CA 3FIRA 3IOTA 2G93A 3FVGA 1RKMA 3MYUA 4Q30B 1BTJA 2ABHA 3CIJA 3VFJA 1XVYA 3ZKKA 4ISUA 5ET7A 4FATA 3PD8A 4H5FA 1EZOA 3Q27A 2QS4A 3MP6A 3K1NA 3LC8A 4JVIA 2QVVA 5M2VA 4ZEFA 1FBCA 1ZKBA 4OTEA 1D9QA 4PFWA 1K9ZA 2FIXA 1SD3A 3MQ9A 3RN8A 4P0IA 2ZZWA 2GRVA 4PGPA 2DDKA 3E9XA 5H8SA 2F6PA 4OVRA 2IA4A 3EF7A 1N7WA 3S9EA 1PDAA 1HSEA 1VDWA 1SVXB 2XHDA 2X26A 3PMWA 1AWBA 4PE5B 2UYFA 2ONKE 2D5WA 2QVUA 1FBHA 2O7UA 3PUZE 3MC2A 5TU0A 3V89B 4MX6A 2QS3A 2HQ0A 1UTHB 4R9GA 1UIVA 4TOZA 1DOTA 3IORA 2OLBA 1Y4TA 2XWVA 5I58B 4H1XA 4N8GA 2FBPA 2XXXA 4QFKA 5A5XA 4OERA 1IMFA 2ZYOA 4LZ7A 3MZ1A 2PYYA 1CNQA 5IM2A 3U1OA 2Q88A 2VOZA 4OVSA 2ZNTA 3ZS6A 3OEMA 4XXUA 3FXQA 3C33A 3FV1A 1ZMGA 4EQ9A 4ZZAA 2UVJA 4RPNA 5AA2D 3PUYE 5I57B 5DT6A 1USYE 4YMBA 3RQTA 1HSLA 2Z22A 3T9HB 4LP2B 3BKIB 3RYDA 3EHSA 3N26A 1JP4A 3W9VA 1BIYA 1QULA 1B46A 2V3TA 4F2OA 3TZAA 1JNFA 1LCTA 3B50A 3B6WA 2KLFA 3DELB 1NUWA 2HFBA 3KC1A 4P1LA 1RDZA 4O8MA 5ET8A 1H44A 4U23A 5I59A 5CBSA 5HM4B 4QFLA 1NFTA 5DYHA 1RDXA 1MPDA 2F6GA 3IJOB 3MZ9A 3OSRA 2B3FA 3RTWB 3ZSFA 1EU8A 5LTCA 1YCJA 4G77A 2XD3A 3Q28A 2PFZA 3V8XB 2NWJA 3MSTA 3HN0A 5CMBA 1AMFA 4BDNA 3FATA 2XXHA 4EQ7A 5BUUA 2UYEA 4R73A 1UQWA 4N6PA 1N3WA 3FJGA 1DPEA 4PFRA 4JB7A 1DTZA 5I58A 4NF5B 4R74A 4P11A 3PTYA 3KC0A 2GFEA 3Q29A 5TP9B 1Z7ME 4ECFA 4QFOA 4RXLA 3FXRA 4C0RA 4GWXA 3W15C 4MNIA 5BWJA 3QK6A 3O6HA 2QMWA 3KEIA 5AE4A 1SYHA 1B5HA 3T1BA 3KJTA 4XKPA 1I6AA 2H98A 1ZJLA 4GVOA 1TWYA 2I48A 3UGWA 2Z23A 4OFJA 1AOVA 2B4LA 3TYHA 4JWOA 1B1XA 4POXA 2F34A 4EF1A 3MW0A 4AS4A 1BP5A 2CEYA 3SEWA 4U4XA 4FORA 5H8NA 1MQGA 5H8HA 2AIXA 5CMKA 2Q89A 2NUVA 2VPNA 3M8UA 3U72A 4C1UA 2XX8A 4XF5A 5EYGA 3PMVA 3HV1A 4P9KA 3CSGA 4OETA 3E79A 4MJOA 2OCUA 4G2ZA 5A5LA 4FJPA 1PB8A 3OO9A 2REJA 5IGAA 1FPKA 3PUWE 1QKAA 4F3SA 2DVCA 3T9VA 4NF6B 5L9MA 4F22A 3T96B 1DCUA 2DWIA 4QFNA 2XXVA 2QMXA 5FTIA 4QRZA 5B7DA 5I2KB 5B70A 5JTYB 4NF4B 1LEVA 2GQ1A 1NUYA 2KR0A 4RK9A 2O6AA 3THIA 4XFEA 1JQFA 4GX4A 3L6HA 1XT8A 1KZ8A 4EQBA 2Y7KA 1CB6A 4H6DA 1B4ZA 4NF5A 2Y7IA 3ZKLA 4WEDA 4FBPA 5IZ3A 1B1HA 3CI8A 4WEPA 3V83A 4MLVA 5DVIA 3U94A 2YLNA 3FXUA 4XKRA 1MPBA 3DP6A 1F9BA 3IO4A 1Y20A 2Y7PA 3RY3A 1NV2A 1NNKA 4DCXA 2FVZA 1D4NA 5IAIA 2I3WA 3UORA 3K6VA 4QF9A 3FUZA 3O2AA 2I0BA 4OVTA 4P47A 1XHYA 3CVGA 3OO6A 1FPLA 1FJ9A 2H9BA 2CEXA 3C31A 2XWOA 1TXFA 4F2QA 3ONMA 3A09A 2V3QA 4MLQA 1EYKA 3HHGA 4AB5A 3CFZA 1EYIA 4NF8A 1H76A 5EQAA 3QMFA 3A3CA 3TFLA 4ZEIA 3FJMA 4F19A 2GH9A 1FTAA 1SBPA 1B2HA 1NH7A 1EZPA 1MG1A 4PFTA 2XWIA 3CG1A 1URDA 3TCHA 3CSBA 3FASA 3BIHA 2PX1A 4G68B 1B32A 5I2KA 1QUIA 4I8CA 1BLFA 4HCYA 1Q1KA 5JTYA 4NF4A 1AIVA 3PPOA 4KPTA 4NN3A 4TLMB 5I56A 3G7WA 4P1EA 2ZZVA 4GWWA 5CMMA 1LAXA 1B0LA 4JVCA 3N94A 4ZEDA 4LUBA 3VLWA 2Q2CA 3KJ7A 4H45A 4N17A 3OOAA 3PMXA 2F36A 3G3JA 3M3KA 1R9QA 1QUKA 1MXUA 3SDFA 2D21A 4F31B 4G8MA 3SESA 3A3UA 3TUSA 2YJPA 4ELPA 4NAPA 2OZZA 1A99A 4H5GA 4GWZA 5CMCA 1FTKA 5H8FA 4PDDA 2RKMA 2OWZA 3HO7A 3M3LA 4GBVA 4ZEBA 1US4A 3M3FA 4GWSA 4OVQA 5T3JA 5IZ1A 1FTMA 1A40A 4IO2A 1OLCA 1SYIA 3FXBA 2ZNSA 1POY1 1RYXA 1PB9A 1SDXA 3FJ7A 3B6TA 1H45A 1A8EA 4X8RA 3MVWA 3HFUA 1LLSA 4G61A 2OBGA 2CZKA 1XVXA 3W9WA 3PUXE 4HS7A 1FTOA 4POWA 2VGQA 4G68A 4JWXA 5AA2A 2O1LA 1IXIA 2WBDA 1IMCA 2QS2A 1NNFA 5I5PA 1FQCA 2V3UA 3KOTA 3TMGA 1LBCA 5FBPA 3H06B 2REGA 1QGXA 1LBWA 1KWHA 1GTKA 4P8BA 4FEBA 4DI4B 5L9SA 3TTLA 5DEXB 2CZIA 2ZNUA 1QVSA 2ZYMA 1FQAA 2VP1A 3MUQA 3SETA 4GD5A 2V93A 4OA4A 3VXBA 3GXAA 2QPQA 3K00A 4QFPA 1XC1A 2Z8DA 2RINA 3IAZA 3E78A 3BFUA 1Y4CA 1LFIA 4KCDA 3T9XB 5I59B 4YKIA 2QJEA 1LAHE 4OZ9A 2Z8EA 5F24A 2PFYA 3JV9A 3BFTA 4GIZA 1FJ6A 4BDQA 2FHYA 1M5CA 4YAHX 4I3EA 1DK4A 2M8CA 3USDA 1IEJA 4R75A 4HE2A 3KSJA 1OLAA 1USYH 1MY2A 4GF8A 1O7TA 1YYZA 3IOVA 4MNPA 2F5XA 4O7IA 2DE2A 3VE1B 1FPGA 1SW5A 1IXCA 1N04A 1OIBA 3S9LC 1DPPA 2DYXA 3H6WA 1IIWA 2GHBA 3BIGA 4TQUQ 2E0SA 4OEVA 1JW5A 5CBRA 3H6UA 3FGSA 1B6HA 1MH3A 3R26A 4NQ8A 5I3SA 1TFDA 4LVQA 4LONB 4KI0E 4PQJA 1II5A 1YTVA 3PPQA 1NV7A 4R6YA 1N84A 1VFDA 3LSWA 1QKBA 2XD2A 4NX1A 4MBPA 1K9YA 2F3BA 1FQEA 4YICA 2NOOA 4R2FA 1B3HA 1JVXA 2DP8A 2VPOA 3D1RA 5H8NB 4IY6A 5DEXA 1DTGA 1BKAA 5H8HB 1Y1ZA 3DM0A 4MFIA 2HCAA 4F3PA 2E1SA 3ISPA 3CG3A 4R9FA 4NWDA 1MY4A 1B7UA 3BBRA 4G8HA 2RF1A 2WEFA 1SQYA 2QS1A 2XXRA 3DP8A 3KBRA 5EHSA 4DXCA 5ISUA 1IITA 3K6UA 3S4UA 4R72A 4LZ5A 2UVGA 4JVDA 2Y5KA 1POTA 3I3VA 3OSQA 4M4GA 4MMPA 2HAVA 1FPBA 4PP0A 2BJIA 4MF3A 4MIJA 2B3BA 4ZE9A 4N6DA 2I4CA 1LFGA 2V84A 4F3BA 4H65A 1B40A 1I69A 1AL3A 4IO7A 3MPKA 3OMBA 1MM7A 5IZ3B 4YB5A 4GLIA 2PCRA 4N4UA 1KA0A 4KD5A 4N6KA 1LBXA 3EHUA 4F1VA 4M1VA 1JW1A 4X04A 1QUJA 3NOHA 4DIGA 4PAIA 2Q74A 1WDNA 4DXUA 1EH3A 2HXWA 1SI0A 3E3KA 1GGGA 5FHNA 3LSFB 5LOMA 2HAUA 1ATGA 3P7IA 1SPIA 2RC7A 1MS7A 4YB7A 4GXSB 3A29A 1M5FA 3I5OA 1MQJA 4Z7EA 3GZGA 4ZEKA 1LBBA 2XX9A 5K2YA 1SW1A 1FSAA 2I58A 4OVJA 4DE8A 5ET5A 1B58A 1G0IA 4NF8B 1D9VA 1NV3A 3IL1B 2QVRA 1MXVA 4NF0A 3VXCA 2XXTA 3B8BA 5KZTA 1B3FA 2F7AA 2YPNA 1OVTA 5L8DA 3H3GA 3ECRA 1FPIA 4LA9A 4OEUA 1Y3PA 2DE3A 3VVFA 4N15A 4ZS9A 1CE2A 3S2VA 2XXIA 1PB7A 4PTKA 4QSDA 3RPWA 1NI9A 4ELRA 3S9NC 1PBQA 4U4SA 4NEDA 4OQOA 5I56B 4XKNA 2DWJA 3MJNA 1A54A 2I6EA 4ESXA 4RK2A 4OMBA 3KN8A 4PF8A 2AYSA 3IOUA 3EKIA 4LQ2A 1TT1A 3ILTB 4RY1A 4F18A 3O66A 1N76A 3HCQA 3VDFA 1PBPA 4U1OA 3KG2A 3TCGA 1EZ9A 3FVKA 4GXAA 2R71A 3PPPA 2BJJX 1IMDA 5EQ8A 1DMBA 3GBBA 1FPJA 4IR8A 4EXKA 1RYOA 3KN3A 3IB0A 2L5VA 4P56A 1N3XA 4X48A 2H99A 1I6BA 3G3IA 5I2NB 3TQLA 2P2AA 5H8FB 1MY0A 2FA7A 4GBWA 2V25A 2HXRA 3OD7A 1YPNA 2UVHA 1FPDA 4DZ1A 2HHMA 4I3YA 4NTLA 4PF6A 4KYSA 1LSTA 1B7ZA 4GRKA 1MM6A 3G3KA 2KQZA 2DS9A 4OXVA 1QJMA 3O28A 1H43A 3OO8A 3PGFA 4H46A 1ZLQA 5I84A 2P1SA 2QL3A 3T22A 3MP8A 3OENA 4HXVA 2XXQA 2A5TA 2VD2A 3S9MC 3QUJA 2OJTA 3GYYA 4U1ZA 4YU0A 1FBDA 1B51A 4LATA 2XWKA 2XXWA 2UXAA 4E0WA 5ICTA 2DVZA 1A55A 1OQGA 4YKJA 3RUMA 5AA2B 2PBWA 3H6VA 3HPIA 3UIFA 2Y84A 4PFYA 2OWSA 3PD9A 2R8TA 3ILUB 2AL4A 2F78A 3O6IA 3K02A 1LBZA 3CFLA 2DOJA 1N7XA 5AA3A 3OO7A 4PAFA 4MH5A 4YKPA 4QHQA 4RYAA 1UIUA 2DXYA 2V4CA 2ONSA 1OVBA 5IKBA 4NE4A 5KDTA 3TELA 4LQ5A 3LV0A 4FIMA 1WVJA 1NV4A 5ITOA 4N13A 2OX3A 5IZZA 4GWYA 4PFUA 3SERA 5I7IA 3R6UA 3UA8A 2R6GE 3K0VA 1P1OA 2LAOA 4XIGQ 4K3FA 5I2NA 1NUZA 4HCWA 4R6KA 4YKKA 1RDYA 3FD3A 3K6XA 3SEXA 1MXYA 2DWAA 2WX9A 3Q25A 1FW0A 4ELOA 1N0TA 1O64A 2AL5A 1LGBC 2Y7RA 4IO5A 3EHTA 2Q8MA 3VLUA 4YMAA 4HTGA 3QUFA 3HHFA 3RT8A 1EYJA 4FEDA 3G3GA 3GBAA 2QSXA 5HBCA 2ZZXA 3UK4A 4OFOA 4MAGA 1ZBMA 4DDDA 1TFAA 2WYPA 4LZ8A 2ESNA 1VFEA 2RCAA 2A5SA 1P1NA 4IO6A 1R1NA 2ZYKA 1ZTYA 2XXYA 3JZJA 5ICQA 1MXXA 4KHZE 3KZGA 1URGA 5F7VA 4ONYA 3T93B 4NGUA 1GR2A 4AB6A 5KCJA 3TAJA 2XXUA 3O9PA 1M5BA 4BLAA 1LFHA 1XS5A 4MCOA 3LUYA 4AS5A 2O69A 2NVUB 1OMPA 4N07A 4L17A 3O29A 5FHOA 4H67A 4UABA 5JEIA 5EYFA 5CM6A 1FBEA 3N6UA 4GL8A 3H4ZA 4OENA 1ELJA 1BK4A 3RPLA 4N91A 4DXBA 4R2BA 5H8QA 4PBHA 4PC9A 3CFXA 2ANJA 3ODBA 4JSDA 1MQIA 1INPA 1LAGE 1HSJA 1JW4A 1NUXA 1NKXA 3T9UA 4ZE8A 4HW8A 2PT2A 4GX6A 4KYDA 2F3DA 4H8IA 4BDOA 1SW4A 4GWOA 4PE3A 4UA8A 2OK2A 2WBBA 4OVPA 1JEUA 5FTHA 1GV8A 3R7XA 4IGRA 1S9TA 3U65A 3OEKA 3L6GA 5TPAA 3RLFE 4Z0IA 2ONRA 3T66A 4EDPA 1YXIA 3K6WA 1B52A 2Y7WA 2HEUA 5EQ7A 1Y1MA 4H8JA 4G8NA 2IEEA 3LUZA 5LDZA 3KN7A 3IJXB 4KXPA 4NHBA 2ZXTA 4F1UA 3E4RA 5CRYA 1H3DA 4FE8A 2F7BA 4P0GA 1NH8A 3IX1A 3KBZA 4P3LA 3VVDA 4IO3A 1B0HA 3UN6A 3IFCA 2I49A 4H0WA 1FBGA 4ELQA 3MZBA 2Y5LA 2CZLA 2ZMBA 3H7MA 3EQ1A 4I1DA 2Z8FA 3H6TA 4O3CA 2THIA 3B7DA 1FRPA 2F97A 5AA4A 4PAKA 5F1QA 1P1QA 1MXWA 3HSTA 4ZZEA 3SZPA 1LCFA 1B5IA 4XEQA 3O6GA 2ZYNA 1R6ZA 3EPEA 1JVYA 1MY1A 3K2DA 4O94A 1VE4A 4FAJA 4BDLA 2X7PA 4RPOA 3IFAA 2F35A 5K2XA 1NV1A 3IK6B 3K1MA 1NV6A 4O7MA 4QXDA 3C4MA 1LB8A 2W7YA 4PBQA 3B6QA 1R9LA 4LN5A 4PFBA 1AH5A 3KGCA 2XX7A 1LAFE 3ROJA 1JEVA 1GVCA 3T0JA 1PEBA 3TTNA 1YZ0A 3K1PA 2VT5A 4JXIA 3LSXA 1XOCA 3PPNA 2FYIA 2WKYA 3GLBA 4RA1A 1Q35A 3RT6B 1P1UA 1IMBA 2B65A 4FECA 2Q9TA 5ELVA 3RTFB 1NV5A 3DLNA 1MY3A 4ZECA 4Q0CA 2I0CA 1IXHA 1LB9A 2H5YA 2ALUA 1FQBA 1UTHA 1P1WA 2XXPA 4IO4A 3RNNA 4ZDMA 5EQ9A 3Q26A 1NNTA 3QYTA 1MDQA 2F8DA 1SW2A 2QFLA 2H4IA 3LBSA 2Q8JA 5JK4A 1B3LA 2JJKA 3KSXA 3KFMA 4IGTA 4F39A 3WAEA 1IZ1A 2P3VA 3TQWA 2VHAA 4DCYA 4AQ4A 1B5JA 5J1DA 1M5EA 2O68A 3FBPA 5CC2A 4TLLB 1FTLA 1FTJA 4G68C 1A7LA 1B9JA 2GHAA 3IB2A 2O1MA 5I57A 2FNCA 3SKPA 3FVOA 1B3EA 4EUOA 2H25A 1B4HA 4U21A 2QRYA 3D4GA 5EHMA 3FV2A 4BDMA 4WXJA 3QXMA 1J1NA 3QAXA 3CR9A 4IB2A 2A5TB 3G3HA 5DTBA 4MHFA 4JWYA 1LBYA 1L5TA 4HE1A 1M5DA 3MVZA 4Q5TA 3EN3A 1Y3QA 4BDRA 2WYKA 1IQ7A 4KFQA 4I9DA 4EF2A 1MH4A 1MQHA 3FZVA 3UP9A 1US5A 2XA5A 3RGYA 4OFLA 1OQHA 2PT1A 3IR1A 4GWUA 4XKQA 3VLVA 1FCKA 2DE4A 2VD3A 3QSLA 3LSLA 2HZLA 5KDTB 4R6HA 1VSOA 1KA1A 4NG7A 3TEPA 1NMUA 4PDHA 4GX3A 1MXZA 4N8YA 3TKDA 5AA1A 5HPQA 1DSNA 1QW0A 3MWBA 4OHNA 5TP9A 1FQDA 1B7HA 4JBZA 2DQVA 1D3KA 4KCCA 2OWTA 1IMEA 2MKZA 2NXOA 4NMYA 2RCBA 3PUVE 4IY5A 4E0XA 3N5LA 4OYVA 4JSOA 3PV0E 2CZHA 2PVUA 4GQOA 4PETA 4HE0A 4MNCA 5ET6A 1FBPA 4PFIA 2D3IA 4F1YA 4Q8RA 1O63A 3IOWA 1FPFA 2FIEA 3OELA 4EXLA 3IB1A 1JETA 1LBVA 1FPEA 3U93A 1MDP1 3E13X 2B4MA 4KQPA 4QSCA 4X9TA 4C1TA 1IXGA 1SI1A 4OANA 3TTKA 4WKMA 2G29A 3CHGA 4X1DA 1XI6A
chains in the Genus database with same CATH topology
2O84X 1Y3NA 4U2RA 5CI5A 3TPAA 1I6QA 3QIMA 3C34A 5FHMA 2X7QA 3K01A 2Q2AA 3MP1A 1ANFA 3U8QA 1D9YA 2HZKA 1ZU0A 4NWCA 3DP4A 3O97A 1MRPA 3C9HA 4NF6A 3SEVA 5KCJB 1S50A 2R9JA 4G4PA 4KR5A 3VV5A 2RC9A 1UTBB 3SEUA 3V5AA 3SEYA 3C35A 3OXNA 3TDJA 4YZZA 1ZIUA 1B3GA 2DWHA 3AXFA 3N6TA 4ND9A 3MVXA 4I62A 3MPLA 1NNPA 1P99A 4O3BA 3JYRA 1MPCA 3VVEA 4OWDA 4YB6A 3C36A 2RC8A 3TTRA 1NL5A 5H8QB 4QSEA 1YAEA 3LR1A 3TODA 1FQFA 4U22A 5DVJA 4X1BA 3TTMA 1A8FA 3KOSA 3D4CA 4KYEA 3MAMA 4O3AA 2I3VA 1T0KA 1S7YA 4GFRA 1IUDA 1Z7NE 4DLDA 4F3GA 3CRBA 2O7IA 3PPRA 5TPAB 3G3FA 2I4BA 2DSFA 1MQDA 4RNSA 4UACA 3WAFA 4GOTA 4GL0A 5L9OA 1WODA 3F11A 2P0SA 4JDFA 1PC3A 3C32A 5ITPA 1Y9UA 4OESA 2DXRA 3U92A 3PU5A 5DVFA 3IO6A 5A5XB 4RJZA 1B05A 4THIA 3MVYA 3K4UA 5AA4B 2PMSA 3TCFA 1UTBA 3FVNA 4F29A 4ESWA 2O51A 3I6VA 4XTCQ 3H03A 1VR5A 2UVIA 3MBPA 2CMOA 1URSA 2F7CA 3FIRA 3IOTA 2G93A 3FVGA 1RKMA 4Q30B 1BTJA 2ABHA 3CIJA 3VFJA 1XVYA 3ZKKA 4ISUA 4FATA 3PD8A 4H5FA 1EZOA 3Q27A 2QS4A 3MP6A 3K1NA 3LC8A 5M2VA 4ZEFA 1ZKBA 4OTEA 4PFWA 1SD3A 3MQ9A 3RN8A 4P0IA 2GRVA 3E9XA 5H8SA 2F6PA 2IA4A 3EF7A 1N7WA 3S9EA 1PDAA 1HSEA 1SVXB 2XHDA 2X26A 3PMWA 4PE5B 2UYFA 2ONKE 2D5WA 2O7UA 3PUZE 3MC2A 5TU0A 3V89B 2QS3A 2HQ0A 1UTHB 4R9GA 1UIVA 4TOZA 1DOTA 3IORA 2OLBA 1Y4TA 5I58B 4H1XA 2XXXA 5A5XA 4QFKA 4OERA 2ZYOA 4LZ7A 3MZ1A 2PYYA 3U1OA 2Q88A 2VOZA 2ZNTA 3ZS6A 3OEMA 4XXUA 3FXQA 3C33A 3FV1A 1ZMGA 4EQ9A 4ZZAA 2UVJA 4RPNA 5AA2D 3PUYE 5I57B 5DT6A 1USYE 4YMBA 3RQTA 1HSLA 2Z22A 3T9HB 4LP2B 3BKIB 3EHSA 3N26A 3W9VA 1BIYA 1QULA 1B46A 2V3TA 4F2OA 3TZAA 1JNFA 1LCTA 3B6WA 2KLFA 3DELB 2HFBA 1H44A 4U23A 5I59A 5CBSA 5HM4B 4QFLA 1NFTA 5DYHA 3IJOB 1MPDA 2F6GA 3MZ9A 3OSRA 2B3FA 3RTWB 3ZSFA 1EU8A 1YCJA 4G77A 2XD3A 3Q28A 3V8XB 2NWJA 5CMBA 3HN0A 1AMFA 4BDNA 3FATA 2XXHA 4EQ7A 5BUUA 2UYEA 4R73A 1UQWA 4N6PA 1N3WA 3FJGA 1DPEA 4JB7A 1DTZA 5I58A 4NF5B 4R74A 4P11A 2GFEA 3Q29A 5TP9B 4ECFA 1Z7ME 4QFOA 4RXLA 3FXRA 4C0RA 3W15C 5BWJA 3QK6A 3O6HA 2QMWA 3KEIA 5AE4A 1SYHA 1B5HA 3KJTA 4XKPA 1I6AA 2H98A 1ZJLA 4GVOA 1TWYA 2I48A 3UGWA 2Z23A 4OFJA 1AOVA 3TYHA 4JWOA 1B1XA 4POXA 2F34A 4EF1A 3MW0A 1BP5A 3SEWA 4U4XA 4FORA 5H8NA 1MQGA 5H8HA 2AIXA 5CMKA 2Q89A 2NUVA 3M8UA 3U72A 4C1UA 2XX8A 3PMVA 3HV1A 3CSGA 4OETA 2OCUA 4G2ZA 4FJPA 1PB8A 3OO9A 2REJA 3PUWE 1QKAA 4F3SA 2DVCA 3T9VA 4NF6B 5L9MA 4F22A 3T96B 2DWIA 4QFNA 2XXVA 2QMXA 5FTIA 4QRZA 5B7DA 5I2KB 5B70A 5JTYB 4NF4B 4RK9A 2O6AA 3THIA 1JQFA 3L6HA 1XT8A 4EQBA 2Y7KA 1CB6A 4H6DA 1B4ZA 4NF5A 2Y7IA 3ZKLA 4WEDA 3V83A 1B1HA 3CI8A 4WEPA 4MLVA 5DVIA 3U94A 2YLNA 3FXUA 4XKRA 1MPBA 3DP6A 1F9BA 3IO4A 1Y20A 2Y7PA 3RY3A 1NNKA 4DCXA 5IAIA 1D4NA 2I3WA 3UORA 3K6VA 4QF9A 3FUZA 3O2AA 2I0BA 1XHYA 3CVGA 3OO6A 2H9BA 3C31A 1TXFA 4F2QA 3ONMA 3A09A 2V3QA 4MLQA 3HHGA 4AB5A 3CFZA 4NF8A 1H76A 3A3CA 3TFLA 4ZEIA 3FJMA 4F19A 2GH9A 1SBPA 1B2HA 1NH7A 1EZPA 1MG1A 4PFTA 3CG1A 1URDA 3TCHA 3CSBA 3FASA 2PX1A 4G68B 1B32A 5I2KA 1QUIA 4I8CA 1BLFA 4HCYA 1Q1KA 5JTYA 4NF4A 1AIVA 3PPOA 4KPTA 4TLMB 5I56A 3G7WA 5CMMA 1LAXA 1B0LA 3N94A 4ZEDA 4LUBA 3VLWA 2Q2CA 3KJ7A 3OOAA 3PMXA 2F36A 3G3JA 3M3KA 1R9QA 1QUKA 1MXUA 3SDFA 2D21A 4F31B 4G8MA 3SESA 3A3UA 3TUSA 2YJPA 4ELPA 2OZZA 1A99A 4H5GA 5CMCA 1FTKA 5H8FA 2RKMA 3HO7A 3M3LA 4ZEBA 1US4A 3M3FA 1FTMA 1A40A 4IO2A 1OLCA 1SYIA 2ZNSA 1POY1 1RYXA 1PB9A 1SDXA 3FJ7A 3B6TA 1H45A 1A8EA 3MVWA 1LLSA 2OBGA 1XVXA 3W9WA 3PUXE 4HS7A 1FTOA 4POWA 2VGQA 4G68A 4JWXA 5AA2A 2O1LA 1IXIA 2QS2A 1NNFA 1FQCA 2V3UA 3KOTA 3TMGA 1LBCA 3H06B 2REGA 1KWHA 1GTKA 4FEBA 5L9SA 3TTLA 5DEXB 2ZNUA 1QVSA 2ZYMA 1FQAA 2VP1A 3MUQA 3SETA 4GD5A 2V93A 3VXBA 3GXAA 2QPQA 3K00A 4QFPA 1XC1A 2Z8DA 2RINA 3IAZA 3BFUA 1Y4CA 1LFIA 4KCDA 3T9XB 5I59B 4YKIA 2QJEA 1LAHE 4OZ9A 2Z8EA 3JV9A 3BFTA 4GIZA 4BDQA 1M5CA 4YAHX 2M8CA 3USDA 1IEJA 4R75A 3KSJA 1OLAA 1USYH 1MY2A 4GF8A 1O7TA 3IOVA 2F5XA 2DE2A 3VE1B 1SW5A 1IXCA 1N04A 1OIBA 3S9LC 1DPPA 2DYXA 3H6WA 1IIWA 2GHBA 4TQUQ 2E0SA 4OEVA 1JW5A 5CBRA 3H6UA 3FGSA 1B6HA 1MH3A 3R26A 1TFDA 4LVQA 4LONB 4KI0E 4PQJA 1II5A 1YTVA 3PPQA 4R6YA 1N84A 1VFDA 3LSWA 1QKBA 2XD2A 4MBPA 1FQEA 4YICA 2NOOA 4R2FA 1B3HA 1JVXA 2DP8A 5H8NB 4IY6A 5DEXA 1DTGA 1BKAA 5H8HB 1Y1ZA 3DM0A 4MFIA 2HCAA 4F3PA 2E1SA 3CG3A 4R9FA 4NWDA 1MY4A 1B7UA 3BBRA 4G8HA 2RF1A 1SQYA 2QS1A 2XXRA 3DP8A 3KBRA 5EHSA 4DXCA 5ISUA 1IITA 3K6UA 3S4UA 4R72A 4LZ5A 2UVGA 1POTA 3I3VA 3OSQA 4M4GA 2HAVA 4PP0A 4MF3A 2B3BA 4ZE9A 2I4CA 1LFGA 2V84A 4F3BA 4H65A 1B40A 1I69A 1AL3A 4IO7A 3MPKA 3OMBA 1MM7A 4YB5A 4GLIA 4KD5A 3EHUA 4F1VA 4M1VA 1JW1A 1QUJA 4DIGA 1WDNA 4DXUA 1EH3A 2HXWA 1SI0A 3E3KA 1GGGA 5FHNA 3LSFB 5LOMA 2HAUA 1ATGA 3P7IA 2RC7A 1MS7A 4YB7A 4GXSB 1M5FA 3I5OA 1MQJA 4Z7EA 3GZGA 4ZEKA 1LBBA 2XX9A 5K2YA 1SW1A 2I58A 4OVJA 4DE8A 1B58A 4NF8B 1D9VA 3IL1B 1MXVA 3VXCA 2XXTA 5KZTA 1B3FA 2F7AA 2YPNA 1OVTA 5L8DA 3ECRA 3H3GA 4LA9A 4OEUA 1Y3PA 2DE3A 3VVFA 4ZS9A 1CE2A 3S2VA 2XXIA 1PB7A 4QSDA 3RPWA 4ELRA 3S9NC 1PBQA 4U4SA 4NEDA 4OQOA 5I56B 4XKNA 2DWJA 3MJNA 1A54A 2I6EA 4ESXA 4OMBA 3KN8A 4RK2A 2AYSA 3IOUA 4LQ2A 1TT1A 3ILTB 4RY1A 4F18A 3O66A 1N76A 3HCQA 3VDFA 1PBPA 4U1OA 3KG2A 3TCGA 1EZ9A 3FVKA 4GXAA 2R71A 3PPPA 2BJJX 1DMBA 3GBBA 4EXKA 1RYOA 3KN3A 3IB0A 1N3XA 4X48A 2H99A 1I6BA 3G3IA 5I2NB 3TQLA 2P2AA 5H8FB 1MY0A 2FA7A 2V25A 3OD7A 1YPNA 2UVHA 4DZ1A 4NTLA 4KYSA 1LSTA 1B7ZA 4GRKA 1MM6A 3G3KA 2DS9A 4OXVA 1QJMA 3O28A 1H43A 3OO8A 3PGFA 1ZLQA 5I84A 2P1SA 2QL3A 3T22A 3MP8A 3OENA 2XXQA 2A5TA 2VD2A 3S9MC 3QUJA 2OJTA 4U1ZA 4YU0A 1B51A 4LATA 2XXWA 2UXAA 4E0WA 5ICTA 2DVZA 1A55A 1OQGA 4YKJA 3RUMA 5AA2B 2PBWA 3H6VA 3HPIA 3UIFA 2Y84A 4PFYA 2OWSA 3PD9A 3ILUB 2AL4A 2F78A 3O6IA 3K02A 3CFLA 2DOJA 1N7XA 5AA3A 3OO7A 4MH5A 4YKPA 4QHQA 4RYAA 1UIUA 2DXYA 2ONSA 1OVBA 5IKBA 4NE4A 5KDTA 3TELA 4LQ5A 4FIMA 1WVJA 5ITOA 4N13A 4PFUA 3SERA 3R6UA 3UA8A 2R6GE 3K0VA 1P1OA 2LAOA 4XIGQ 4K3FA 5I2NA 4HCWA 4R6KA 4YKKA 3FD3A 3K6XA 3SEXA 1MXYA 2DWAA 3Q25A 1FW0A 4ELOA 1N0TA 1O64A 2AL5A 1LGBC 2Y7RA 4IO5A 3EHTA 3VLUA 4YMAA 4HTGA 3QUFA 3HHFA 3RT8A 4FEDA 3G3GA 3GBAA 2QSXA 5HBCA 3UK4A 4OFOA 1ZBMA 4DDDA 1TFAA 4LZ8A 2ESNA 1VFEA 2RCAA 2A5SA 1P1NA 4IO6A 1R1NA 2ZYKA 1ZTYA 2XXYA 3JZJA 5ICQA 1MXXA 4KHZE 3KZGA 1URGA 5F7VA 4ONYA 3T93B 1GR2A 4AB6A 5KCJA 3TAJA 2XXUA 3O9PA 1M5BA 4BLAA 1LFHA 1XS5A 3LUYA 2O69A 2NVUB 1OMPA 4N07A 4L17A 3O29A 5FHOA 4H67A 5JEIA 5EYFA 5CM6A 3N6UA 4GL8A 3H4ZA 4OENA 1ELJA 4DXBA 4R2BA 5H8QA 3CFXA 2ANJA 3ODBA 4JSDA 1MQIA 1LAGE 1HSJA 1JW4A 1NKXA 3T9UA 4ZE8A 4HW8A 2PT2A 4KYDA 4H8IA 4BDOA 1SW4A 4GWOA 4UA8A 2OK2A 1JEUA 5FTHA 1GV8A 3R7XA 4IGRA 1S9TA 3OEKA 3L6GA 5TPAA 3RLFE 4Z0IA 2ONRA 3T66A 4EDPA 3K6WA 1B52A 2Y7WA 2HEUA 1Y1MA 4H8JA 4G8NA 2IEEA 3KN7A 3IJXB 2ZXTA 4F1UA 3E4RA 5CRYA 1H3DA 4FE8A 2F7BA 4P0GA 1NH8A 3IX1A 3VVDA 4IO3A 1B0HA 3UN6A 2I49A 4H0WA 4ELQA 3MZBA 2CZLA 2ZMBA 3H7MA 3EQ1A 4I1DA 2Z8FA 3H6TA 4O3CA 2THIA 3B7DA 2F97A 5AA4A 5F1QA 1P1QA 1MXWA 3HSTA 4ZZEA 1LCFA 1B5IA 3O6GA 2ZYNA 1R6ZA 3EPEA 1JVYA 1MY1A 3K2DA 1VE4A 4FAJA 4BDLA 2X7PA 4RPOA 5K2XA 2F35A 3IK6B 3K1MA 3C4MA 1LB8A 2W7YA 3B6QA 1R9LA 1AH5A 3KGCA 2XX7A 1LAFE 1JEVA 1GVCA 1PEBA 3TTNA 3K1PA 4JXIA 3LSXA 1XOCA 3PPNA 2FYIA 2WKYA 3GLBA 4RA1A 1Q35A 3RT6B 1P1UA 2B65A 4FECA 2Q9TA 5ELVA 3RTFB 3DLNA 1MY3A 4ZECA 4Q0CA 2I0CA 1IXHA 1LB9A 2H5YA 2ALUA 1FQBA 1UTHA 1P1WA 2XXPA 4IO4A 3RNNA 4ZDMA 3Q26A 1NNTA 3QYTA 1MDQA 2F8DA 1SW2A 2H4IA 3LBSA 2Q8JA 5JK4A 1B3LA 3KSXA 3KFMA 4IGTA 4F39A 3WAEA 1IZ1A 3TQWA 2VHAA 4DCYA 4AQ4A 1B5JA 5J1DA 1M5EA 2O68A 5CC2A 4TLLB 1FTLA 1FTJA 4G68C 1A7LA 1B9JA 2GHAA 3IB2A 2O1MA 5I57A 2FNCA 3SKPA 3FVOA 1B3EA 4EUOA 2H25A 1B4HA 4U21A 2QRYA 3D4GA 5EHMA 3FV2A 4BDMA 4WXJA 3QXMA 1J1NA 3QAXA 3CR9A 4IB2A 2A5TB 3G3HA 5DTBA 4JWYA 1L5TA 1M5DA 3MVZA 4Q5TA 3EN3A 1Y3QA 4BDRA 1IQ7A 4KFQA 4I9DA 4EF2A 1MH4A 1MQHA 3FZVA 3UP9A 1US5A 3RGYA 4OFLA 1OQHA 2PT1A 3IR1A 4XKQA 3VLVA 1FCKA 2DE4A 2VD3A 3QSLA 3LSLA 2HZLA 5KDTB 4R6HA 1VSOA 3TEPA 1NMUA 1MXZA 3TKDA 5AA1A 5HPQA 1DSNA 1QW0A 3MWBA 4OHNA 5TP9A 1FQDA 1B7HA 4JBZA 2DQVA 1D3KA 4KCCA 2OWTA 2NXOA 4NMYA 2RCBA 3PUVE 4IY5A 4E0XA 3N5LA 4OYVA 4JSOA 3PV0E 2PVUA 4GQOA 4PETA 2D3IA 4F1YA 4Q8RA 1O63A 3IOWA 3OELA 4EXLA 3IB1A 1JETA 3U93A 1MDP1 3E13X 4KQPA 4QSCA 4X9TA 4C1TA 1IXGA 1SI1A 3TTKA 4WKMA 2G29A 4X1DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O84 X;  1Y3N A;  4U2R A;  5CI5 A;  3TPA A;  1I6Q A;  3QIM A;  3C34 A;  5FHM A;  2X7Q A;  3K01 A;  2Q2A A;  3MP1 A;  1ANF A;  3U8Q A;  1D9Y A;  2HZK A;  1ZU0 A;  4NWC A;  3DP4 A;  3O97 A;  1MRP A;  3C9H A;  4NF6 A;  3SEV A;  5KCJ B;  1S50 A;  2R9J A;  4G4P A;  4KR5 A;  3VV5 A;  2RC9 A;  1UTB B;  3SEU A;  3V5A A;  3SEY A;  3C35 A;  3OXN A;  3TDJ A;  4YZZ A;  1ZIU A;  1B3G A;  2DWH A;  3AXF A;  3N6T A;  4ND9 A;  3MVX A;  4I62 A;  3MPL A;  1NNP A;  1P99 A;  4O3B A;  3JYR A;  1MPC A;  3VVE A;  4OWD A;  4YB6 A;  3C36 A;  2RC8 A;  3TTR A;  1NL5 A;  5H8Q B;  4QSE A;  1YAE A;  3LR1 A;  3TOD A;  1FQF A;  4U22 A;  5DVJ A;  4X1B A;  3TTM A;  1A8F A;  3KOS A;  3D4C A;  4KYE A;  3MAM A;  4O3A A;  2I3V A;  1T0K A;  1S7Y A;  4GFR A;  1IUD A;  1Z7N E;  4DLD A;  4F3G A;  3CRB A;  2O7I A;  3PPR A;  5TPA B;  3G3F A;  2I4B A;  2DSF A;  1MQD A;  4RNS A;  4UAC A;  3WAF A;  4GOT A;  4GL0 A;  5L9O A;  1WOD A;  3F11 A;  2P0S A;  4JDF A;  1PC3 A;  3C32 A;  5ITP A;  1Y9U A;  4OES A;  2DXR A;  3U92 A;  3PU5 A;  5DVF A;  3IO6 A;  5A5X B;  4RJZ A;  1B05 A;  4THI A;  3MVY A;  3K4U A;  5AA4 B;  2PMS A;  3TCF A;  1UTB A;  3FVN A;  4F29 A;  4ESW A;  2O51 A;  3I6V A;  4XTC Q;  3H03 A;  1VR5 A;  2UVI A;  3MBP A;  2CMO A;  1URS A;  2F7C A;  3FIR A;  3IOT A;  2G93 A;  3FVG A;  1RKM A;  4Q30 B;  1BTJ A;  2ABH A;  3CIJ A;  3VFJ A;  1XVY A;  3ZKK A;  4ISU A;  4FAT A;  3PD8 A;  4H5F A;  1EZO A;  3Q27 A;  2QS4 A;  3MP6 A;  3K1N A;  3LC8 A;  5M2V A;  4ZEF A;  1ZKB A;  4OTE A;  4PFW A;  1SD3 A;  3MQ9 A;  3RN8 A;  4P0I A;  2GRV A;  3E9X A;  5H8S A;  2F6P A;  2IA4 A;  3EF7 A;  1N7W A;  3S9E A;  1PDA A;  1HSE A;  1SVX B;  2XHD A;  2X26 A;  3PMW A;  4PE5 B;  2UYF A;  2ONK E;  2D5W A;  2O7U A;  3PUZ E;  3MC2 A;  5TU0 A;  3V89 B;  2QS3 A;  2HQ0 A;  1UTH B;  4R9G A;  1UIV A;  4TOZ A;  1DOT A;  3IOR A;  2OLB A;  1Y4T A;  5I58 B;  4H1X A;  2XXX A;  5A5X A;  4QFK A;  4OER A;  2ZYO A;  4LZ7 A;  3MZ1 A;  2PYY A;  3U1O A;  2Q88 A;  2VOZ A;  2ZNT A;  3ZS6 A;  3OEM A;  4XXU A;  3FXQ A;  3C33 A;  3FV1 A;  1ZMG A;  4EQ9 A;  4ZZA A;  2UVJ A;  4RPN A;  5AA2 D;  3PUY E;  5I57 B;  5DT6 A;  1USY E;  4YMB A;  3RQT A;  1HSL A;  2Z22 A;  3T9H B;  4LP2 B;  3BKI B;  3EHS A;  3N26 A;  3W9V A;  1BIY A;  1QUL A;  1B46 A;  2V3T A;  4F2O A;  3TZA A;  1JNF A;  1LCT A;  3B6W A;  2KLF A;  3DEL B;  2HFB A;  1H44 A;  4U23 A;  5I59 A;  5CBS A;  5HM4 B;  4QFL A;  1NFT A;  5DYH A;  3IJO B;  1MPD A;  2F6G A;  3MZ9 A;  3OSR A;  2B3F A;  3RTW B;  3ZSF A;  1EU8 A;  1YCJ A;  4G77 A;  2XD3 A;  3Q28 A;  3V8X B;  2NWJ A;  5CMB A;  3HN0 A;  1AMF A;  4BDN A;  3FAT A;  2XXH A;  4EQ7 A;  5BUU A;  2UYE A;  4R73 A;  1UQW A;  4N6P A;  1N3W A;  3FJG A;  1DPE A;  4JB7 A;  1DTZ A;  5I58 A;  4NF5 B;  4R74 A;  4P11 A;  2GFE A;  3Q29 A;  5TP9 B;  4ECF A;  1Z7M E;  4QFO A;  4RXL A;  3FXR A;  4C0R A;  3W15 C;  5BWJ A;  3QK6 A;  3O6H A;  2QMW A;  3KEI A;  5AE4 A;  1SYH A;  1B5H A;  3KJT A;  4XKP A;  1I6A A;  2H98 A;  1ZJL A;  4GVO A;  1TWY A;  2I48 A;  3UGW A;  2Z23 A;  4OFJ A;  1AOV A;  3TYH A;  4JWO A;  1B1X A;  4POX A;  2F34 A;  4EF1 A;  3MW0 A;  1BP5 A;  3SEW A;  4U4X A;  4FOR A;  5H8N A;  1MQG A;  5H8H A;  2AIX A;  5CMK A;  2Q89 A;  2NUV A;  3M8U A;  3U72 A;  4C1U A;  2XX8 A;  3PMV A;  3HV1 A;  3CSG A;  4OET A;  2OCU A;  4G2Z A;  4FJP A;  1PB8 A;  3OO9 A;  2REJ A;  3PUW E;  1QKA A;  4F3S A;  2DVC A;  3T9V A;  4NF6 B;  5L9M A;  4F22 A;  3T96 B;  2DWI A;  4QFN A;  2XXV A;  2QMX A;  5FTI A;  4QRZ A;  5B7D A;  5I2K B;  5B70 A;  5JTY B;  4NF4 B;  4RK9 A;  2O6A A;  3THI A;  1JQF A;  3L6H A;  1XT8 A;  4EQB A;  2Y7K A;  1CB6 A;  4H6D A;  1B4Z A;  4NF5 A;  2Y7I A;  3ZKL A;  4WED A;  3V83 A;  1B1H A;  3CI8 A;  4WEP A;  4MLV A;  5DVI A;  3U94 A;  2YLN A;  3FXU A;  4XKR A;  1MPB A;  3DP6 A;  1F9B A;  3IO4 A;  1Y20 A;  2Y7P A;  3RY3 A;  1NNK A;  4DCX A;  5IAI A;  1D4N A;  2I3W A;  3UOR A;  3K6V A;  4QF9 A;  3FUZ A;  3O2A A;  2I0B A;  1XHY A;  3CVG A;  3OO6 A;  2H9B A;  3C31 A;  1TXF A;  4F2Q A;  3ONM A;  3A09 A;  2V3Q A;  4MLQ A;  3HHG A;  4AB5 A;  3CFZ A;  4NF8 A;  1H76 A;  3A3C A;  3TFL A;  4ZEI A;  3FJM A;  4F19 A;  2GH9 A;  1SBP A;  1B2H A;  1NH7 A;  1EZP A;  1MG1 A;  4PFT A;  3CG1 A;  1URD A;  3TCH A;  3CSB A;  3FAS A;  2PX1 A;  4G68 B;  1B32 A;  5I2K A;  1QUI A;  4I8C A;  1BLF A;  4HCY A;  1Q1K A;  5JTY A;  4NF4 A;  1AIV A;  3PPO A;  4KPT A;  4TLM B;  5I56 A;  3G7W A;  5CMM A;  1LAX A;  1B0L A;  3N94 A;  4ZED A;  4LUB A;  3VLW A;  2Q2C A;  3KJ7 A;  3OOA A;  3PMX A;  2F36 A;  3G3J A;  3M3K A;  1R9Q A;  1QUK A;  1MXU A;  3SDF A;  2D21 A;  4F31 B;  4G8M A;  3SES A;  3A3U A;  3TUS A;  2YJP A;  4ELP A;  2OZZ A;  1A99 A;  4H5G A;  5CMC A;  1FTK A;  5H8F A;  2RKM A;  3HO7 A;  3M3L A;  4ZEB A;  1US4 A;  3M3F A;  1FTM A;  1A40 A;  4IO2 A;  1OLC A;  1SYI A;  2ZNS A;  1POY 1;  1RYX A;  1PB9 A;  1SDX A;  3FJ7 A;  3B6T A;  1H45 A;  1A8E A;  3MVW A;  1LLS A;  2OBG A;  1XVX A;  3W9W A;  3PUX E;  4HS7 A;  1FTO A;  4POW A;  2VGQ A;  4G68 A;  4JWX A;  5AA2 A;  2O1L A;  1IXI A;  2QS2 A;  1NNF A;  1FQC A;  2V3U A;  3KOT A;  3TMG A;  1LBC A;  3H06 B;  2REG A;  1KWH A;  1GTK A;  4FEB A;  5L9S A;  3TTL A;  5DEX B;  2ZNU A;  1QVS A;  2ZYM A;  1FQA A;  2VP1 A;  3MUQ A;  3SET A;  4GD5 A;  2V93 A;  3VXB A;  3GXA A;  2QPQ A;  3K00 A;  4QFP A;  1XC1 A;  2Z8D A;  2RIN A;  3IAZ A;  3BFU A;  1Y4C A;  1LFI A;  4KCD A;  3T9X B;  5I59 B;  4YKI A;  2QJE A;  1LAH E;  4OZ9 A;  2Z8E A;  3JV9 A;  3BFT A;  4GIZ A;  4BDQ A;  1M5C A;  4YAH X;  2M8C A;  3USD A;  1IEJ A;  4R75 A;  3KSJ A;  1OLA A;  1USY H;  1MY2 A;  4GF8 A;  1O7T A;  3IOV A;  2F5X A;  2DE2 A;  3VE1 B;  1SW5 A;  1IXC A;  1N04 A;  1OIB A;  3S9L C;  1DPP A;  2DYX A;  3H6W A;  1IIW A;  2GHB A;  4TQU Q;  2E0S A;  4OEV A;  1JW5 A;  5CBR A;  3H6U A;  3FGS A;  1B6H A;  1MH3 A;  3R26 A;  1TFD A;  4LVQ A;  4LON B;  4KI0 E;  4PQJ A;  1II5 A;  1YTV A;  3PPQ A;  4R6Y A;  1N84 A;  1VFD A;  3LSW A;  1QKB A;  2XD2 A;  4MBP A;  1FQE A;  4YIC A;  2NOO A;  4R2F A;  1B3H A;  1JVX A;  2DP8 A;  5H8N B;  4IY6 A;  5DEX A;  1DTG A;  1BKA A;  5H8H B;  1Y1Z A;  3DM0 A;  4MFI A;  2HCA A;  4F3P A;  2E1S A;  3CG3 A;  4R9F A;  4NWD A;  1MY4 A;  1B7U A;  3BBR A;  4G8H A;  2RF1 A;  1SQY A;  2QS1 A;  2XXR A;  3DP8 A;  3KBR A;  5EHS A;  4DXC A;  5ISU A;  1IIT A;  3K6U A;  3S4U A;  4R72 A;  4LZ5 A;  2UVG A;  1POT A;  3I3V A;  3OSQ A;  4M4G A;  2HAV A;  4PP0 A;  4MF3 A;  2B3B A;  4ZE9 A;  2I4C A;  1LFG A;  2V84 A;  4F3B A;  4H65 A;  1B40 A;  1I69 A;  1AL3 A;  4IO7 A;  3MPK A;  3OMB A;  1MM7 A;  4YB5 A;  4GLI A;  4KD5 A;  3EHU A;  4F1V A;  4M1V A;  1JW1 A;  1QUJ A;  4DIG A;  1WDN A;  4DXU A;  1EH3 A;  2HXW A;  1SI0 A;  3E3K A;  1GGG A;  5FHN A;  3LSF B;  5LOM A;  2HAU A;  1ATG A;  3P7I A;  2RC7 A;  1MS7 A;  4YB7 A;  4GXS B;  1M5F A;  3I5O A;  1MQJ A;  4Z7E A;  3GZG A;  4ZEK A;  1LBB A;  2XX9 A;  5K2Y A;  1SW1 A;  2I58 A;  4OVJ A;  4DE8 A;  1B58 A;  4NF8 B;  1D9V A;  3IL1 B;  1MXV A;  3VXC A;  2XXT A;  5KZT A;  1B3F A;  2F7A A;  2YPN A;  1OVT A;  5L8D A;  3ECR A;  3H3G A;  4LA9 A;  4OEU A;  1Y3P A;  2DE3 A;  3VVF A;  4ZS9 A;  1CE2 A;  3S2V A;  2XXI A;  1PB7 A;  4QSD A;  3RPW A;  4ELR A;  3S9N C;  1PBQ A;  4U4S A;  4NED A;  4OQO A;  5I56 B;  4XKN A;  2DWJ A;  3MJN A;  1A54 A;  2I6E A;  4ESX A;  4OMB A;  3KN8 A;  4RK2 A;  2AYS A;  3IOU A;  4LQ2 A;  1TT1 A;  3ILT B;  4RY1 A;  4F18 A;  3O66 A;  1N76 A;  3HCQ A;  3VDF A;  1PBP A;  4U1O A;  3KG2 A;  3TCG A;  1EZ9 A;  3FVK A;  4GXA A;  2R71 A;  3PPP A;  2BJJ X;  1DMB A;  3GBB A;  4EXK A;  1RYO A;  3KN3 A;  3IB0 A;  1N3X A;  4X48 A;  2H99 A;  1I6B A;  3G3I A;  5I2N B;  3TQL A;  2P2A A;  5H8F B;  1MY0 A;  2FA7 A;  2V25 A;  3OD7 A;  1YPN A;  2UVH A;  4DZ1 A;  4NTL A;  4KYS A;  1LST A;  1B7Z A;  4GRK A;  1MM6 A;  3G3K A;  2DS9 A;  4OXV A;  1QJM A;  3O28 A;  1H43 A;  3OO8 A;  3PGF A;  1ZLQ A;  5I84 A;  2P1S A;  2QL3 A;  3T22 A;  3MP8 A;  3OEN A;  2XXQ A;  2A5T A;  2VD2 A;  3S9M C;  3QUJ A;  2OJT A;  4U1Z A;  4YU0 A;  1B51 A;  4LAT A;  2XXW A;  2UXA A;  4E0W A;  5ICT A;  2DVZ A;  1A55 A;  1OQG A;  4YKJ A;  3RUM A;  5AA2 B;  2PBW A;  3H6V A;  3HPI A;  3UIF A;  2Y84 A;  4PFY A;  2OWS A;  3PD9 A;  3ILU B;  2AL4 A;  2F78 A;  3O6I A;  3K02 A;  3CFL A;  2DOJ A;  1N7X A;  5AA3 A;  3OO7 A;  4MH5 A;  4YKP A;  4QHQ A;  4RYA A;  1UIU A;  2DXY A;  2ONS A;  1OVB A;  5IKB A;  4NE4 A;  5KDT A;  3TEL A;  4LQ5 A;  4FIM A;  1WVJ A;  5ITO A;  4N13 A;  4PFU A;  3SER A;  3R6U A;  3UA8 A;  2R6G E;  3K0V A;  1P1O A;  2LAO A;  4XIG Q;  4K3F A;  5I2N A;  4HCW A;  4R6K A;  4YKK A;  3FD3 A;  3K6X A;  3SEX A;  1MXY A;  2DWA A;  3Q25 A;  1FW0 A;  4ELO A;  1N0T A;  1O64 A;  2AL5 A;  1LGB C;  2Y7R A;  4IO5 A;  3EHT A;  3VLU A;  4YMA A;  4HTG A;  3QUF A;  3HHF A;  3RT8 A;  4FED A;  3G3G A;  3GBA A;  2QSX A;  5HBC A;  3UK4 A;  4OFO A;  1ZBM A;  4DDD A;  1TFA A;  4LZ8 A;  2ESN A;  1VFE A;  2RCA A;  2A5S A;  1P1N A;  4IO6 A;  1R1N A;  2ZYK A;  1ZTY A;  2XXY A;  3JZJ A;  5ICQ A;  1MXX A;  4KHZ E;  3KZG A;  1URG A;  5F7V A;  4ONY A;  3T93 B;  1GR2 A;  4AB6 A;  5KCJ A;  3TAJ A;  2XXU A;  3O9P A;  1M5B A;  4BLA A;  1LFH A;  1XS5 A;  3LUY A;  2O69 A;  2NVU B;  1OMP A;  4N07 A;  4L17 A;  3O29 A;  5FHO A;  4H67 A;  5JEI A;  5EYF A;  5CM6 A;  3N6U A;  4GL8 A;  3H4Z A;  4OEN A;  1ELJ A;  4DXB A;  4R2B A;  5H8Q A;  3CFX A;  2ANJ A;  3ODB A;  4JSD A;  1MQI A;  1LAG E;  1HSJ A;  1JW4 A;  1NKX A;  3T9U A;  4ZE8 A;  4HW8 A;  2PT2 A;  4KYD A;  4H8I A;  4BDO A;  1SW4 A;  4GWO A;  4UA8 A;  2OK2 A;  1JEU A;  5FTH A;  1GV8 A;  3R7X A;  4IGR A;  1S9T A;  3OEK A;  3L6G A;  5TPA A;  3RLF E;  4Z0I A;  2ONR A;  3T66 A;  4EDP A;  3K6W A;  1B52 A;  2Y7W A;  2HEU A;  1Y1M A;  4H8J A;  4G8N A;  2IEE A;  3KN7 A;  3IJX B;  2ZXT A;  4F1U A;  3E4R A;  5CRY A;  1H3D A;  4FE8 A;  2F7B A;  4P0G A;  1NH8 A;  3IX1 A;  3VVD A;  4IO3 A;  1B0H A;  3UN6 A;  2I49 A;  4H0W A;  4ELQ A;  3MZB A;  2CZL A;  2ZMB A;  3H7M A;  3EQ1 A;  4I1D A;  2Z8F A;  3H6T A;  4O3C A;  2THI A;  3B7D A;  2F97 A;  5AA4 A;  5F1Q A;  1P1Q A;  1MXW A;  3HST A;  4ZZE A;  1LCF A;  1B5I A;  3O6G A;  2ZYN A;  1R6Z A;  3EPE A;  1JVY A;  1MY1 A;  3K2D A;  1VE4 A;  4FAJ A;  4BDL A;  2X7P A;  4RPO A;  5K2X A;  2F35 A;  3IK6 B;  3K1M A;  3C4M A;  1LB8 A;  2W7Y A;  3B6Q A;  1R9L A;  1AH5 A;  3KGC A;  2XX7 A;  1LAF E;  1JEV A;  1GVC A;  1PEB A;  3TTN A;  3K1P A;  4JXI A;  3LSX A;  1XOC A;  3PPN A;  2FYI A;  2WKY A;  3GLB A;  4RA1 A;  1Q35 A;  3RT6 B;  1P1U A;  2B65 A;  4FEC A;  2Q9T A;  5ELV A;  3RTF B;  3DLN A;  1MY3 A;  4ZEC A;  4Q0C A;  2I0C A;  1IXH A;  1LB9 A;  2H5Y A;  2ALU A;  1FQB A;  1UTH A;  1P1W A;  2XXP A;  4IO4 A;  3RNN A;  4ZDM A;  3Q26 A;  1NNT A;  3QYT A;  1MDQ A;  2F8D A;  1SW2 A;  2H4I A;  3LBS A;  2Q8J A;  5JK4 A;  1B3L A;  3KSX A;  3KFM A;  4IGT A;  4F39 A;  3WAE A;  1IZ1 A;  3TQW A;  2VHA A;  4DCY A;  4AQ4 A;  1B5J A;  5J1D A;  1M5E A;  2O68 A;  5CC2 A;  4TLL B;  1FTL A;  1FTJ A;  4G68 C;  1A7L A;  1B9J A;  2GHA A;  3IB2 A;  2O1M A;  5I57 A;  2FNC A;  3SKP A;  3FVO A;  1B3E A;  4EUO A;  2H25 A;  1B4H A;  4U21 A;  2QRY A;  3D4G A;  5EHM A;  3FV2 A;  4BDM A;  4WXJ A;  3QXM A;  1J1N A;  3QAX A;  3CR9 A;  4IB2 A;  2A5T B;  3G3H A;  5DTB A;  4JWY A;  1L5T A;  1M5D A;  3MVZ A;  4Q5T A;  3EN3 A;  1Y3Q A;  4BDR A;  1IQ7 A;  4KFQ A;  4I9D A;  4EF2 A;  1MH4 A;  1MQH A;  3FZV A;  3UP9 A;  1US5 A;  3RGY A;  4OFL A;  1OQH A;  2PT1 A;  3IR1 A;  4XKQ A;  3VLV A;  1FCK A;  2DE4 A;  2VD3 A;  3QSL A;  3LSL A;  2HZL A;  5KDT B;  4R6H A;  1VSO A;  3TEP A;  1NMU A;  1MXZ A;  3TKD A;  5AA1 A;  5HPQ A;  1DSN A;  1QW0 A;  3MWB A;  4OHN A;  5TP9 A;  1FQD A;  1B7H A;  4JBZ A;  2DQV A;  1D3K A;  4KCC A;  2OWT A;  2NXO A;  4NMY A;  2RCB A;  3PUV E;  4IY5 A;  4E0X A;  3N5L A;  4OYV A;  4JSO A;  3PV0 E;  2PVU A;  4GQO A;  4PET A;  2D3I A;  4F1Y A;  4Q8R A;  1O63 A;  3IOW A;  3OEL A;  4EXL A;  3IB1 A;  1JET A;  3U93 A;  1MDP 1;  3E13 X;  4KQP A;  4QSC A;  4X9T A;  4C1T A;  1IXG A;  1SI1 A;  3TTK A;  4WKM A;  2G29 A;  4X1D A; 
#chains in the Genus database with same CATH topology
 2O84 X;  1Y3N A;  4U2R A;  2XXK A;  5J16 A;  5CI5 A;  3TPA A;  1I6Q A;  3QIM A;  3C34 A;  5FHM A;  2X7Q A;  3K01 A;  2Q2A A;  3MP1 A;  1ANF A;  5ESY A;  3U8Q A;  1IMA A;  1D9Y A;  2HZK A;  1ZU0 A;  4NWC A;  4DI3 D;  3DP4 A;  3O97 A;  1MRP A;  4MEV A;  3C9H A;  4NF6 A;  3SEV A;  5KCJ B;  1S50 A;  2R9J A;  4G4P A;  4KR5 A;  3VV5 A;  2RC9 A;  1UTB B;  3SEU A;  3V5A A;  3SEY A;  3C35 A;  3OXN A;  1G0H A;  3TDJ A;  4YZZ A;  1ZIU A;  1B3G A;  2DWH A;  3AXF A;  3N6T A;  4ND9 A;  3MVX A;  4I62 A;  1DBZ A;  3MPL A;  5EYH A;  4QBA A;  1NNP A;  1P99 A;  4O3B A;  3JYR A;  1MPC A;  3VVE A;  3RPL B;  4OWD A;  4YB6 A;  3C36 A;  2RC8 A;  3TTR A;  1NL5 A;  5H8Q B;  4QSE A;  1YAE A;  3LR1 A;  1NV0 A;  3TOD A;  1FQF A;  4U22 A;  5DVJ A;  4X1B A;  3TTM A;  4N81 A;  1A8F A;  2HPG A;  3KOS A;  3D4C A;  4KYE A;  3MAM A;  4O3A A;  2I3V A;  1T0K A;  1S7Y A;  4GFR A;  1IUD A;  1Z7N E;  4DLD A;  4F3G A;  3CRB A;  2O7I A;  3PPR A;  5TPA B;  3G3F A;  2I4B A;  2DSF A;  4I40 A;  1MQD A;  4RNS A;  4UAC A;  3WAF A;  4GOT A;  4GL0 A;  5L9O A;  1WOD A;  3F11 A;  2P0S A;  4JDF A;  1PC3 A;  3C32 A;  5ITP A;  1Y9U A;  4OES A;  5DW8 A;  2DXR A;  3U92 A;  3PU5 A;  5DVF A;  4PGN A;  3IO6 A;  5A5X B;  1FBF A;  4RJZ A;  1B05 A;  4THI A;  3MVY A;  3K4U A;  5AA4 B;  2PMS A;  3TCF A;  1UTB A;  3FVN A;  2P3N A;  4F29 A;  4ESW A;  2O51 A;  3I6V A;  1Q9D A;  4XTC Q;  3H03 A;  1VR5 A;  4PCD A;  2UVI A;  3MBP A;  2CMO A;  1URS A;  2F7C A;  3FIR A;  3IOT A;  2G93 A;  3FVG A;  1RKM A;  3MYU A;  4Q30 B;  1BTJ A;  2ABH A;  3CIJ A;  3VFJ A;  1XVY A;  3ZKK A;  4ISU A;  5ET7 A;  4FAT A;  3PD8 A;  4H5F A;  1EZO A;  3Q27 A;  2QS4 A;  3MP6 A;  3K1N A;  3LC8 A;  4JVI A;  2QVV A;  5M2V A;  4ZEF A;  1FBC A;  1ZKB A;  4OTE A;  1D9Q A;  4PFW A;  1K9Z A;  2FIX A;  1SD3 A;  3MQ9 A;  3RN8 A;  4P0I A;  2ZZW A;  2GRV A;  4PGP A;  2DDK A;  3E9X A;  5H8S A;  2F6P A;  4OVR A;  2IA4 A;  3EF7 A;  1N7W A;  3S9E A;  1PDA A;  1HSE A;  1VDW A;  1SVX B;  2XHD A;  2X26 A;  3PMW A;  1AWB A;  4PE5 B;  2UYF A;  2ONK E;  2D5W A;  2QVU A;  1FBH A;  2O7U A;  3PUZ E;  3MC2 A;  5TU0 A;  3V89 B;  4MX6 A;  2QS3 A;  2HQ0 A;  1UTH B;  4R9G A;  1UIV A;  4TOZ A;  1DOT A;  3IOR A;  2OLB A;  1Y4T A;  2XWV A;  5I58 B;  4H1X A;  4N8G A;  2FBP A;  2XXX A;  4QFK A;  5A5X A;  4OER A;  1IMF A;  2ZYO A;  4LZ7 A;  3MZ1 A;  2PYY A;  1CNQ A;  5IM2 A;  3U1O A;  2Q88 A;  2VOZ A;  4OVS A;  2ZNT A;  3ZS6 A;  3OEM A;  4XXU A;  3FXQ A;  3C33 A;  3FV1 A;  1ZMG A;  4EQ9 A;  4ZZA A;  2UVJ A;  4RPN A;  5AA2 D;  3PUY E;  5I57 B;  5DT6 A;  1USY E;  4YMB A;  3RQT A;  1HSL A;  2Z22 A;  3T9H B;  4LP2 B;  3BKI B;  3RYD A;  3EHS A;  3N26 A;  1JP4 A;  3W9V A;  1BIY A;  1QUL A;  1B46 A;  2V3T A;  4F2O A;  3TZA A;  1JNF A;  1LCT A;  3B50 A;  3B6W A;  2KLF A;  3DEL B;  1NUW A;  2HFB A;  3KC1 A;  4P1L A;  1RDZ A;  4O8M A;  5ET8 A;  1H44 A;  4U23 A;  5I59 A;  5CBS A;  5HM4 B;  4QFL A;  1NFT A;  5DYH A;  1RDX A;  1MPD A;  2F6G A;  3IJO B;  3MZ9 A;  3OSR A;  2B3F A;  3RTW B;  3ZSF A;  1EU8 A;  5LTC A;  1YCJ A;  4G77 A;  2XD3 A;  3Q28 A;  2PFZ A;  3V8X B;  2NWJ A;  3MST A;  3HN0 A;  5CMB A;  1AMF A;  4BDN A;  3FAT A;  2XXH A;  4EQ7 A;  5BUU A;  2UYE A;  4R73 A;  1UQW A;  4N6P A;  1N3W A;  3FJG A;  1DPE A;  4PFR A;  4JB7 A;  1DTZ A;  5I58 A;  4NF5 B;  4R74 A;  4P11 A;  3PTY A;  3KC0 A;  2GFE A;  3Q29 A;  5TP9 B;  1Z7M E;  4ECF A;  4QFO A;  4RXL A;  3FXR A;  4C0R A;  4GWX A;  3W15 C;  4MNI A;  5BWJ A;  3QK6 A;  3O6H A;  2QMW A;  3KEI A;  5AE4 A;  1SYH A;  1B5H A;  3T1B A;  3KJT A;  4XKP A;  1I6A A;  2H98 A;  1ZJL A;  4GVO A;  1TWY A;  2I48 A;  3UGW A;  2Z23 A;  4OFJ A;  1AOV A;  2B4L A;  3TYH A;  4JWO A;  1B1X A;  4POX A;  2F34 A;  4EF1 A;  3MW0 A;  4AS4 A;  1BP5 A;  2CEY A;  3SEW A;  4U4X A;  4FOR A;  5H8N A;  1MQG A;  5H8H A;  2AIX A;  5CMK A;  2Q89 A;  2NUV A;  2VPN A;  3M8U A;  3U72 A;  4C1U A;  2XX8 A;  4XF5 A;  5EYG A;  3PMV A;  3HV1 A;  4P9K A;  3CSG A;  4OET A;  3E79 A;  4MJO A;  2OCU A;  4G2Z A;  5A5L A;  4FJP A;  1PB8 A;  3OO9 A;  2REJ A;  5IGA A;  1FPK A;  3PUW E;  1QKA A;  4F3S A;  2DVC A;  3T9V A;  4NF6 B;  5L9M A;  4F22 A;  3T96 B;  1DCU A;  2DWI A;  4QFN A;  2XXV A;  2QMX A;  5FTI A;  4QRZ A;  5B7D A;  5I2K B;  5B70 A;  5JTY B;  4NF4 B;  1LEV A;  2GQ1 A;  1NUY A;  2KR0 A;  4RK9 A;  2O6A A;  3THI A;  4XFE A;  1JQF A;  4GX4 A;  3L6H A;  1XT8 A;  1KZ8 A;  4EQB A;  2Y7K A;  1CB6 A;  4H6D A;  1B4Z A;  4NF5 A;  2Y7I A;  3ZKL A;  4WED A;  4FBP A;  5IZ3 A;  1B1H A;  3CI8 A;  4WEP A;  3V83 A;  4MLV A;  5DVI A;  3U94 A;  2YLN A;  3FXU A;  4XKR A;  1MPB A;  3DP6 A;  1F9B A;  3IO4 A;  1Y20 A;  2Y7P A;  3RY3 A;  1NV2 A;  1NNK A;  4DCX A;  2FVZ A;  1D4N A;  5IAI A;  2I3W A;  3UOR A;  3K6V A;  4QF9 A;  3FUZ A;  3O2A A;  2I0B A;  4OVT A;  4P47 A;  1XHY A;  3CVG A;  3OO6 A;  1FPL A;  1FJ9 A;  2H9B A;  2CEX A;  3C31 A;  2XWO A;  1TXF A;  4F2Q A;  3ONM A;  3A09 A;  2V3Q A;  4MLQ A;  1EYK A;  3HHG A;  4AB5 A;  3CFZ A;  1EYI A;  4NF8 A;  1H76 A;  5EQA A;  3QMF A;  3A3C A;  3TFL A;  4ZEI A;  3FJM A;  4F19 A;  2GH9 A;  1FTA A;  1SBP A;  1B2H A;  1NH7 A;  1EZP A;  1MG1 A;  4PFT A;  2XWI A;  3CG1 A;  1URD A;  3TCH A;  3CSB A;  3FAS A;  3BIH A;  2PX1 A;  4G68 B;  1B32 A;  5I2K A;  1QUI A;  4I8C A;  1BLF A;  4HCY A;  1Q1K A;  5JTY A;  4NF4 A;  1AIV A;  3PPO A;  4KPT A;  4NN3 A;  4TLM B;  5I56 A;  3G7W A;  4P1E A;  2ZZV A;  4GWW A;  5CMM A;  1LAX A;  1B0L A;  4JVC A;  3N94 A;  4ZED A;  4LUB A;  3VLW A;  2Q2C A;  3KJ7 A;  4H45 A;  4N17 A;  3OOA A;  3PMX A;  2F36 A;  3G3J A;  3M3K A;  1R9Q A;  1QUK A;  1MXU A;  3SDF A;  2D21 A;  4F31 B;  4G8M A;  3SES A;  3A3U A;  3TUS A;  2YJP A;  4ELP A;  4NAP A;  2OZZ A;  1A99 A;  4H5G A;  4GWZ A;  5CMC A;  1FTK A;  5H8F A;  4PDD A;  2RKM A;  2OWZ A;  3HO7 A;  3M3L A;  4GBV A;  4ZEB A;  1US4 A;  3M3F A;  4GWS A;  4OVQ A;  5T3J A;  5IZ1 A;  1FTM A;  1A40 A;  4IO2 A;  1OLC A;  1SYI A;  3FXB A;  2ZNS A;  1POY 1;  1RYX A;  1PB9 A;  1SDX A;  3FJ7 A;  3B6T A;  1H45 A;  1A8E A;  4X8R A;  3MVW A;  3HFU A;  1LLS A;  4G61 A;  2OBG A;  2CZK A;  1XVX A;  3W9W A;  3PUX E;  4HS7 A;  1FTO A;  4POW A;  2VGQ A;  4G68 A;  4JWX A;  5AA2 A;  2O1L A;  1IXI A;  2WBD A;  1IMC A;  2QS2 A;  1NNF A;  5I5P A;  1FQC A;  2V3U A;  3KOT A;  3TMG A;  1LBC A;  5FBP A;  3H06 B;  2REG A;  1QGX A;  1LBW A;  1KWH A;  1GTK A;  4P8B A;  4FEB A;  4DI4 B;  5L9S A;  3TTL A;  5DEX B;  2CZI A;  2ZNU A;  1QVS A;  2ZYM A;  1FQA A;  2VP1 A;  3MUQ A;  3SET A;  4GD5 A;  2V93 A;  4OA4 A;  3VXB A;  3GXA A;  2QPQ A;  3K00 A;  4QFP A;  1XC1 A;  2Z8D A;  2RIN A;  3IAZ A;  3E78 A;  3BFU A;  1Y4C A;  1LFI A;  4KCD A;  3T9X B;  5I59 B;  4YKI A;  2QJE A;  1LAH E;  4OZ9 A;  2Z8E A;  5F24 A;  2PFY A;  3JV9 A;  3BFT A;  4GIZ A;  1FJ6 A;  4BDQ A;  2FHY A;  1M5C A;  4YAH X;  4I3E A;  1DK4 A;  2M8C A;  3USD A;  1IEJ A;  4R75 A;  4HE2 A;  3KSJ A;  1OLA A;  1USY H;  1MY2 A;  4GF8 A;  1O7T A;  1YYZ A;  3IOV A;  4MNP A;  2F5X A;  4O7I A;  2DE2 A;  3VE1 B;  1FPG A;  1SW5 A;  1IXC A;  1N04 A;  1OIB A;  3S9L C;  1DPP A;  2DYX A;  3H6W A;  1IIW A;  2GHB A;  3BIG A;  4TQU Q;  2E0S A;  4OEV A;  1JW5 A;  5CBR A;  3H6U A;  3FGS A;  1B6H A;  1MH3 A;  3R26 A;  4NQ8 A;  5I3S A;  1TFD A;  4LVQ A;  4LON B;  4KI0 E;  4PQJ A;  1II5 A;  1YTV A;  3PPQ A;  1NV7 A;  4R6Y A;  1N84 A;  1VFD A;  3LSW A;  1QKB A;  2XD2 A;  4NX1 A;  4MBP A;  1K9Y A;  2F3B A;  1FQE A;  4YIC A;  2NOO A;  4R2F A;  1B3H A;  1JVX A;  2DP8 A;  2VPO A;  3D1R A;  5H8N B;  4IY6 A;  5DEX A;  1DTG A;  1BKA A;  5H8H B;  1Y1Z A;  3DM0 A;  4MFI A;  2HCA A;  4F3P A;  2E1S A;  3ISP A;  3CG3 A;  4R9F A;  4NWD A;  1MY4 A;  1B7U A;  3BBR A;  4G8H A;  2RF1 A;  2WEF A;  1SQY A;  2QS1 A;  2XXR A;  3DP8 A;  3KBR A;  5EHS A;  4DXC A;  5ISU A;  1IIT A;  3K6U A;  3S4U A;  4R72 A;  4LZ5 A;  2UVG A;  4JVD A;  2Y5K A;  1POT A;  3I3V A;  3OSQ A;  4M4G A;  4MMP A;  2HAV A;  1FPB A;  4PP0 A;  2BJI A;  4MF3 A;  4MIJ A;  2B3B A;  4ZE9 A;  4N6D A;  2I4C A;  1LFG A;  2V84 A;  4F3B A;  4H65 A;  1B40 A;  1I69 A;  1AL3 A;  4IO7 A;  3MPK A;  3OMB A;  1MM7 A;  5IZ3 B;  4YB5 A;  4GLI A;  2PCR A;  4N4U A;  1KA0 A;  4KD5 A;  4N6K A;  1LBX A;  3EHU A;  4F1V A;  4M1V A;  1JW1 A;  4X04 A;  1QUJ A;  3NOH A;  4DIG A;  4PAI A;  2Q74 A;  1WDN A;  4DXU A;  1EH3 A;  2HXW A;  1SI0 A;  3E3K A;  1GGG A;  5FHN A;  3LSF B;  5LOM A;  2HAU A;  1ATG A;  3P7I A;  1SPI A;  2RC7 A;  1MS7 A;  4YB7 A;  4GXS B;  3A29 A;  1M5F A;  3I5O A;  1MQJ A;  4Z7E A;  3GZG A;  4ZEK A;  1LBB A;  2XX9 A;  5K2Y A;  1SW1 A;  1FSA A;  2I58 A;  4OVJ A;  4DE8 A;  5ET5 A;  1B58 A;  1G0I A;  4NF8 B;  1D9V A;  1NV3 A;  3IL1 B;  2QVR A;  1MXV A;  4NF0 A;  3VXC A;  2XXT A;  3B8B A;  5KZT A;  1B3F A;  2F7A A;  2YPN A;  1OVT A;  5L8D A;  3H3G A;  3ECR A;  1FPI A;  4LA9 A;  4OEU A;  1Y3P A;  2DE3 A;  3VVF A;  4N15 A;  4ZS9 A;  1CE2 A;  3S2V A;  2XXI A;  1PB7 A;  4PTK A;  4QSD A;  3RPW A;  1NI9 A;  4ELR A;  3S9N C;  1PBQ A;  4U4S A;  4NED A;  4OQO A;  5I56 B;  4XKN A;  2DWJ A;  3MJN A;  1A54 A;  2I6E A;  4ESX A;  4RK2 A;  4OMB A;  3KN8 A;  4PF8 A;  2AYS A;  3IOU A;  3EKI A;  4LQ2 A;  1TT1 A;  3ILT B;  4RY1 A;  4F18 A;  3O66 A;  1N76 A;  3HCQ A;  3VDF A;  1PBP A;  4U1O A;  3KG2 A;  3TCG A;  1EZ9 A;  3FVK A;  4GXA A;  2R71 A;  3PPP A;  2BJJ X;  1IMD A;  5EQ8 A;  1DMB A;  3GBB A;  1FPJ A;  4IR8 A;  4EXK A;  1RYO A;  3KN3 A;  3IB0 A;  2L5V A;  4P56 A;  1N3X A;  4X48 A;  2H99 A;  1I6B A;  3G3I A;  5I2N B;  3TQL A;  2P2A A;  5H8F B;  1MY0 A;  2FA7 A;  4GBW A;  2V25 A;  2HXR A;  3OD7 A;  1YPN A;  2UVH A;  1FPD A;  4DZ1 A;  2HHM A;  4I3Y A;  4NTL A;  4PF6 A;  4KYS A;  1LST A;  1B7Z A;  4GRK A;  1MM6 A;  3G3K A;  2KQZ A;  2DS9 A;  4OXV A;  1QJM A;  3O28 A;  1H43 A;  3OO8 A;  3PGF A;  4H46 A;  1ZLQ A;  5I84 A;  2P1S A;  2QL3 A;  3T22 A;  3MP8 A;  3OEN A;  4HXV A;  2XXQ A;  2A5T A;  2VD2 A;  3S9M C;  3QUJ A;  2OJT A;  3GYY A;  4U1Z A;  4YU0 A;  1FBD A;  1B51 A;  4LAT A;  2XWK A;  2XXW A;  2UXA A;  4E0W A;  5ICT A;  2DVZ A;  1A55 A;  1OQG A;  4YKJ A;  3RUM A;  5AA2 B;  2PBW A;  3H6V A;  3HPI A;  3UIF A;  2Y84 A;  4PFY A;  2OWS A;  3PD9 A;  2R8T A;  3ILU B;  2AL4 A;  2F78 A;  3O6I A;  3K02 A;  1LBZ A;  3CFL A;  2DOJ A;  1N7X A;  5AA3 A;  3OO7 A;  4PAF A;  4MH5 A;  4YKP A;  4QHQ A;  4RYA A;  1UIU A;  2DXY A;  2V4C A;  2ONS A;  1OVB A;  5IKB A;  4NE4 A;  5KDT A;  3TEL A;  4LQ5 A;  3LV0 A;  4FIM A;  1WVJ A;  1NV4 A;  5ITO A;  4N13 A;  2OX3 A;  5IZZ A;  4GWY A;  4PFU A;  3SER A;  5I7I A;  3R6U A;  3UA8 A;  2R6G E;  3K0V A;  1P1O A;  2LAO A;  4XIG Q;  4K3F A;  5I2N A;  1NUZ A;  4HCW A;  4R6K A;  4YKK A;  1RDY A;  3FD3 A;  3K6X A;  3SEX A;  1MXY A;  2DWA A;  2WX9 A;  3Q25 A;  1FW0 A;  4ELO A;  1N0T A;  1O64 A;  2AL5 A;  1LGB C;  2Y7R A;  4IO5 A;  3EHT A;  2Q8M A;  3VLU A;  4YMA A;  4HTG A;  3QUF A;  3HHF A;  3RT8 A;  1EYJ A;  4FED A;  3G3G A;  3GBA A;  2QSX A;  5HBC A;  2ZZX A;  3UK4 A;  4OFO A;  4MAG A;  1ZBM A;  4DDD A;  1TFA A;  2WYP A;  4LZ8 A;  2ESN A;  1VFE A;  2RCA A;  2A5S A;  1P1N A;  4IO6 A;  1R1N A;  2ZYK A;  1ZTY A;  2XXY A;  3JZJ A;  5ICQ A;  1MXX A;  4KHZ E;  3KZG A;  1URG A;  5F7V A;  4ONY A;  3T93 B;  4NGU A;  1GR2 A;  4AB6 A;  5KCJ A;  3TAJ A;  2XXU A;  3O9P A;  1M5B A;  4BLA A;  1LFH A;  1XS5 A;  4MCO A;  3LUY A;  4AS5 A;  2O69 A;  2NVU B;  1OMP A;  4N07 A;  4L17 A;  3O29 A;  5FHO A;  4H67 A;  4UAB A;  5JEI A;  5EYF A;  5CM6 A;  1FBE A;  3N6U A;  4GL8 A;  3H4Z A;  4OEN A;  1ELJ A;  1BK4 A;  3RPL A;  4N91 A;  4DXB A;  4R2B A;  5H8Q A;  4PBH A;  4PC9 A;  3CFX A;  2ANJ A;  3ODB A;  4JSD A;  1MQI A;  1INP A;  1LAG E;  1HSJ A;  1JW4 A;  1NUX A;  1NKX A;  3T9U A;  4ZE8 A;  4HW8 A;  2PT2 A;  4GX6 A;  4KYD A;  2F3D A;  4H8I A;  4BDO A;  1SW4 A;  4GWO A;  4PE3 A;  4UA8 A;  2OK2 A;  2WBB A;  4OVP A;  1JEU A;  5FTH A;  1GV8 A;  3R7X A;  4IGR A;  1S9T A;  3U65 A;  3OEK A;  3L6G A;  5TPA A;  3RLF E;  4Z0I A;  2ONR A;  3T66 A;  4EDP A;  1YXI A;  3K6W A;  1B52 A;  2Y7W A;  2HEU A;  5EQ7 A;  1Y1M A;  4H8J A;  4G8N A;  2IEE A;  3LUZ A;  5LDZ A;  3KN7 A;  3IJX B;  4KXP A;  4NHB A;  2ZXT A;  4F1U A;  3E4R A;  5CRY A;  1H3D A;  4FE8 A;  2F7B A;  4P0G A;  1NH8 A;  3IX1 A;  3KBZ A;  4P3L A;  3VVD A;  4IO3 A;  1B0H A;  3UN6 A;  3IFC A;  2I49 A;  4H0W A;  1FBG A;  4ELQ A;  3MZB A;  2Y5L A;  2CZL A;  2ZMB A;  3H7M A;  3EQ1 A;  4I1D A;  2Z8F A;  3H6T A;  4O3C A;  2THI A;  3B7D A;  1FRP A;  2F97 A;  5AA4 A;  4PAK A;  5F1Q A;  1P1Q A;  1MXW A;  3HST A;  4ZZE A;  3SZP A;  1LCF A;  1B5I A;  4XEQ A;  3O6G A;  2ZYN A;  1R6Z A;  3EPE A;  1JVY A;  1MY1 A;  3K2D A;  4O94 A;  1VE4 A;  4FAJ A;  4BDL A;  2X7P A;  4RPO A;  3IFA A;  2F35 A;  5K2X A;  1NV1 A;  3IK6 B;  3K1M A;  1NV6 A;  4O7M A;  4QXD A;  3C4M A;  1LB8 A;  2W7Y A;  4PBQ A;  3B6Q A;  1R9L A;  4LN5 A;  4PFB A;  1AH5 A;  3KGC A;  2XX7 A;  1LAF E;  3ROJ A;  1JEV A;  1GVC A;  3T0J A;  1PEB A;  3TTN A;  1YZ0 A;  3K1P A;  2VT5 A;  4JXI A;  3LSX A;  1XOC A;  3PPN A;  2FYI A;  2WKY A;  3GLB A;  4RA1 A;  1Q35 A;  3RT6 B;  1P1U A;  1IMB A;  2B65 A;  4FEC A;  2Q9T A;  5ELV A;  3RTF B;  1NV5 A;  3DLN A;  1MY3 A;  4ZEC A;  4Q0C A;  2I0C A;  1IXH A;  1LB9 A;  2H5Y A;  2ALU A;  1FQB A;  1UTH A;  1P1W A;  2XXP A;  4IO4 A;  3RNN A;  4ZDM A;  5EQ9 A;  3Q26 A;  1NNT A;  3QYT A;  1MDQ A;  2F8D A;  1SW2 A;  2QFL A;  2H4I A;  3LBS A;  2Q8J A;  5JK4 A;  1B3L A;  2JJK A;  3KSX A;  3KFM A;  4IGT A;  4F39 A;  3WAE A;  1IZ1 A;  2P3V A;  3TQW A;  2VHA A;  4DCY A;  4AQ4 A;  1B5J A;  5J1D A;  1M5E A;  2O68 A;  3FBP A;  5CC2 A;  4TLL B;  1FTL A;  1FTJ A;  4G68 C;  1A7L A;  1B9J A;  2GHA A;  3IB2 A;  2O1M A;  5I57 A;  2FNC A;  3SKP A;  3FVO A;  1B3E A;  4EUO A;  2H25 A;  1B4H A;  4U21 A;  2QRY A;  3D4G A;  5EHM A;  3FV2 A;  4BDM A;  4WXJ A;  3QXM A;  1J1N A;  3QAX A;  3CR9 A;  4IB2 A;  2A5T B;  3G3H A;  5DTB A;  4MHF A;  4JWY A;  1LBY A;  1L5T A;  4HE1 A;  1M5D A;  3MVZ A;  4Q5T A;  3EN3 A;  1Y3Q A;  4BDR A;  2WYK A;  1IQ7 A;  4KFQ A;  4I9D A;  4EF2 A;  1MH4 A;  1MQH A;  3FZV A;  3UP9 A;  1US5 A;  2XA5 A;  3RGY A;  4OFL A;  1OQH A;  2PT1 A;  3IR1 A;  4GWU A;  4XKQ A;  3VLV A;  1FCK A;  2DE4 A;  2VD3 A;  3QSL A;  3LSL A;  2HZL A;  5KDT B;  4R6H A;  1VSO A;  1KA1 A;  4NG7 A;  3TEP A;  1NMU A;  4PDH A;  4GX3 A;  1MXZ A;  4N8Y A;  3TKD A;  5AA1 A;  5HPQ A;  1DSN A;  1QW0 A;  3MWB A;  4OHN A;  5TP9 A;  1FQD A;  1B7H A;  4JBZ A;  2DQV A;  1D3K A;  4KCC A;  2OWT A;  1IME A;  2MKZ A;  2NXO A;  4NMY A;  2RCB A;  3PUV E;  4IY5 A;  4E0X A;  3N5L A;  4OYV A;  4JSO A;  3PV0 E;  2CZH A;  2PVU A;  4GQO A;  4PET A;  4HE0 A;  4MNC A;  5ET6 A;  1FBP A;  4PFI A;  2D3I A;  4F1Y A;  4Q8R A;  1O63 A;  3IOW A;  1FPF A;  2FIE A;  3OEL A;  4EXL A;  3IB1 A;  1JET A;  1LBV A;  1FPE A;  3U93 A;  1MDP 1;  3E13 X;  2B4M A;  4KQP A;  4QSC A;  4X9T A;  4C1T A;  1IXG A;  1SI1 A;  4OAN A;  3TTK A;  4WKM A;  2G29 A;  3CHG A;  4X1D A;  1XI6 A; 
#chains in the Genus database with same CATH homology
 2O84 X;  1Y3N A;  4U2R A;  5CI5 A;  3TPA A;  1I6Q A;  3QIM A;  3C34 A;  5FHM A;  2X7Q A;  3K01 A;  2Q2A A;  3MP1 A;  1ANF A;  3U8Q A;  1D9Y A;  2HZK A;  1ZU0 A;  4NWC A;  3DP4 A;  3O97 A;  1MRP A;  3C9H A;  4NF6 A;  3SEV A;  5KCJ B;  1S50 A;  2R9J A;  4G4P A;  4KR5 A;  3VV5 A;  2RC9 A;  1UTB B;  3SEU A;  3V5A A;  3SEY A;  3C35 A;  3OXN A;  3TDJ A;  4YZZ A;  1ZIU A;  1B3G A;  2DWH A;  3AXF A;  3N6T A;  4ND9 A;  3MVX A;  4I62 A;  3MPL A;  1NNP A;  1P99 A;  4O3B A;  3JYR A;  1MPC A;  3VVE A;  4OWD A;  4YB6 A;  3C36 A;  2RC8 A;  3TTR A;  1NL5 A;  5H8Q B;  4QSE A;  1YAE A;  3LR1 A;  3TOD A;  1FQF A;  4U22 A;  5DVJ A;  4X1B A;  3TTM A;  1A8F A;  3KOS A;  3D4C A;  4KYE A;  3MAM A;  4O3A A;  2I3V A;  1T0K A;  1S7Y A;  4GFR A;  1IUD A;  1Z7N E;  4DLD A;  4F3G A;  3CRB A;  2O7I A;  3PPR A;  5TPA B;  3G3F A;  2I4B A;  2DSF A;  1MQD A;  4RNS A;  4UAC A;  3WAF A;  4GOT A;  4GL0 A;  5L9O A;  1WOD A;  3F11 A;  2P0S A;  4JDF A;  1PC3 A;  3C32 A;  5ITP A;  1Y9U A;  4OES A;  2DXR A;  3U92 A;  3PU5 A;  5DVF A;  3IO6 A;  5A5X B;  4RJZ A;  1B05 A;  4THI A;  3MVY A;  3K4U A;  5AA4 B;  2PMS A;  3TCF A;  1UTB A;  3FVN A;  4F29 A;  4ESW A;  2O51 A;  3I6V A;  4XTC Q;  3H03 A;  1VR5 A;  2UVI A;  3MBP A;  2CMO A;  1URS A;  2F7C A;  3FIR A;  3IOT A;  2G93 A;  3FVG A;  1RKM A;  4Q30 B;  1BTJ A;  2ABH A;  3CIJ A;  3VFJ A;  1XVY A;  3ZKK A;  4ISU A;  4FAT A;  3PD8 A;  4H5F A;  1EZO A;  3Q27 A;  2QS4 A;  3MP6 A;  3K1N A;  3LC8 A;  5M2V A;  4ZEF A;  1ZKB A;  4OTE A;  4PFW A;  1SD3 A;  3MQ9 A;  3RN8 A;  4P0I A;  2GRV A;  3E9X A;  5H8S A;  2F6P A;  2IA4 A;  3EF7 A;  1N7W A;  3S9E A;  1PDA A;  1HSE A;  1SVX B;  2XHD A;  2X26 A;  3PMW A;  4PE5 B;  2UYF A;  2ONK E;  2D5W A;  2O7U A;  3PUZ E;  3MC2 A;  5TU0 A;  3V89 B;  2QS3 A;  2HQ0 A;  1UTH B;  4R9G A;  1UIV A;  4TOZ A;  1DOT A;  3IOR A;  2OLB A;  1Y4T A;  5I58 B;  4H1X A;  2XXX A;  5A5X A;  4QFK A;  4OER A;  2ZYO A;  4LZ7 A;  3MZ1 A;  2PYY A;  3U1O A;  2Q88 A;  2VOZ A;  2ZNT A;  3ZS6 A;  3OEM A;  4XXU A;  3FXQ A;  3C33 A;  3FV1 A;  1ZMG A;  4EQ9 A;  4ZZA A;  2UVJ A;  4RPN A;  5AA2 D;  3PUY E;  5I57 B;  5DT6 A;  1USY E;  4YMB A;  3RQT A;  1HSL A;  2Z22 A;  3T9H B;  4LP2 B;  3BKI B;  3EHS A;  3N26 A;  3W9V A;  1BIY A;  1QUL A;  1B46 A;  2V3T A;  4F2O A;  3TZA A;  1JNF A;  1LCT A;  3B6W A;  2KLF A;  3DEL B;  2HFB A;  1H44 A;  4U23 A;  5I59 A;  5CBS A;  5HM4 B;  4QFL A;  1NFT A;  5DYH A;  3IJO B;  1MPD A;  2F6G A;  3MZ9 A;  3OSR A;  2B3F A;  3RTW B;  3ZSF A;  1EU8 A;  1YCJ A;  4G77 A;  2XD3 A;  3Q28 A;  3V8X B;  2NWJ A;  5CMB A;  3HN0 A;  1AMF A;  4BDN A;  3FAT A;  2XXH A;  4EQ7 A;  5BUU A;  2UYE A;  4R73 A;  1UQW A;  4N6P A;  1N3W A;  3FJG A;  1DPE A;  4JB7 A;  1DTZ A;  5I58 A;  4NF5 B;  4R74 A;  4P11 A;  2GFE A;  3Q29 A;  5TP9 B;  4ECF A;  1Z7M E;  4QFO A;  4RXL A;  3FXR A;  4C0R A;  3W15 C;  5BWJ A;  3QK6 A;  3O6H A;  2QMW A;  3KEI A;  5AE4 A;  1SYH A;  1B5H A;  3KJT A;  4XKP A;  1I6A A;  2H98 A;  1ZJL A;  4GVO A;  1TWY A;  2I48 A;  3UGW A;  2Z23 A;  4OFJ A;  1AOV A;  3TYH A;  4JWO A;  1B1X A;  4POX A;  2F34 A;  4EF1 A;  3MW0 A;  1BP5 A;  3SEW A;  4U4X A;  4FOR A;  5H8N A;  1MQG A;  5H8H A;  2AIX A;  5CMK A;  2Q89 A;  2NUV A;  3M8U A;  3U72 A;  4C1U A;  2XX8 A;  3PMV A;  3HV1 A;  3CSG A;  4OET A;  2OCU A;  4G2Z A;  4FJP A;  1PB8 A;  3OO9 A;  2REJ A;  3PUW E;  1QKA A;  4F3S A;  2DVC A;  3T9V A;  4NF6 B;  5L9M A;  4F22 A;  3T96 B;  2DWI A;  4QFN A;  2XXV A;  2QMX A;  5FTI A;  4QRZ A;  5B7D A;  5I2K B;  5B70 A;  5JTY B;  4NF4 B;  4RK9 A;  2O6A A;  3THI A;  1JQF A;  3L6H A;  1XT8 A;  4EQB A;  2Y7K A;  1CB6 A;  4H6D A;  1B4Z A;  4NF5 A;  2Y7I A;  3ZKL A;  4WED A;  3V83 A;  1B1H A;  3CI8 A;  4WEP A;  4MLV A;  5DVI A;  3U94 A;  2YLN A;  3FXU A;  4XKR A;  1MPB A;  3DP6 A;  1F9B A;  3IO4 A;  1Y20 A;  2Y7P A;  3RY3 A;  1NNK A;  4DCX A;  5IAI A;  1D4N A;  2I3W A;  3UOR A;  3K6V A;  4QF9 A;  3FUZ A;  3O2A A;  2I0B A;  1XHY A;  3CVG A;  3OO6 A;  2H9B A;  3C31 A;  1TXF A;  4F2Q A;  3ONM A;  3A09 A;  2V3Q A;  4MLQ A;  3HHG A;  4AB5 A;  3CFZ A;  4NF8 A;  1H76 A;  3A3C A;  3TFL A;  4ZEI A;  3FJM A;  4F19 A;  2GH9 A;  1SBP A;  1B2H A;  1NH7 A;  1EZP A;  1MG1 A;  4PFT A;  3CG1 A;  1URD A;  3TCH A;  3CSB A;  3FAS A;  2PX1 A;  4G68 B;  1B32 A;  5I2K A;  1QUI A;  4I8C A;  1BLF A;  4HCY A;  1Q1K A;  5JTY A;  4NF4 A;  1AIV A;  3PPO A;  4KPT A;  4TLM B;  5I56 A;  3G7W A;  5CMM A;  1LAX A;  1B0L A;  3N94 A;  4ZED A;  4LUB A;  3VLW A;  2Q2C A;  3KJ7 A;  3OOA A;  3PMX A;  2F36 A;  3G3J A;  3M3K A;  1R9Q A;  1QUK A;  1MXU A;  3SDF A;  2D21 A;  4F31 B;  4G8M A;  3SES A;  3A3U A;  3TUS A;  2YJP A;  4ELP A;  2OZZ A;  1A99 A;  4H5G A;  5CMC A;  1FTK A;  5H8F A;  2RKM A;  3HO7 A;  3M3L A;  4ZEB A;  1US4 A;  3M3F A;  1FTM A;  1A40 A;  4IO2 A;  1OLC A;  1SYI A;  2ZNS A;  1POY 1;  1RYX A;  1PB9 A;  1SDX A;  3FJ7 A;  3B6T A;  1H45 A;  1A8E A;  3MVW A;  1LLS A;  2OBG A;  1XVX A;  3W9W A;  3PUX E;  4HS7 A;  1FTO A;  4POW A;  2VGQ A;  4G68 A;  4JWX A;  5AA2 A;  2O1L A;  1IXI A;  2QS2 A;  1NNF A;  1FQC A;  2V3U A;  3KOT A;  3TMG A;  1LBC A;  3H06 B;  2REG A;  1KWH A;  1GTK A;  4FEB A;  5L9S A;  3TTL A;  5DEX B;  2ZNU A;  1QVS A;  2ZYM A;  1FQA A;  2VP1 A;  3MUQ A;  3SET A;  4GD5 A;  2V93 A;  3VXB A;  3GXA A;  2QPQ A;  3K00 A;  4QFP A;  1XC1 A;  2Z8D A;  2RIN A;  3IAZ A;  3BFU A;  1Y4C A;  1LFI A;  4KCD A;  3T9X B;  5I59 B;  4YKI A;  2QJE A;  1LAH E;  4OZ9 A;  2Z8E A;  3JV9 A;  3BFT A;  4GIZ A;  4BDQ A;  1M5C A;  4YAH X;  2M8C A;  3USD A;  1IEJ A;  4R75 A;  3KSJ A;  1OLA A;  1USY H;  1MY2 A;  4GF8 A;  1O7T A;  3IOV A;  2F5X A;  2DE2 A;  3VE1 B;  1SW5 A;  1IXC A;  1N04 A;  1OIB A;  3S9L C;  1DPP A;  2DYX A;  3H6W A;  1IIW A;  2GHB A;  4TQU Q;  2E0S A;  4OEV A;  1JW5 A;  5CBR A;  3H6U A;  3FGS A;  1B6H A;  1MH3 A;  3R26 A;  1TFD A;  4LVQ A;  4LON B;  4KI0 E;  4PQJ A;  1II5 A;  1YTV A;  3PPQ A;  4R6Y A;  1N84 A;  1VFD A;  3LSW A;  1QKB A;  2XD2 A;  4MBP A;  1FQE A;  4YIC A;  2NOO A;  4R2F A;  1B3H A;  1JVX A;  2DP8 A;  5H8N B;  4IY6 A;  5DEX A;  1DTG A;  1BKA A;  5H8H B;  1Y1Z A;  3DM0 A;  4MFI A;  2HCA A;  4F3P A;  2E1S A;  3CG3 A;  4R9F A;  4NWD A;  1MY4 A;  1B7U A;  3BBR A;  4G8H A;  2RF1 A;  1SQY A;  2QS1 A;  2XXR A;  3DP8 A;  3KBR A;  5EHS A;  4DXC A;  5ISU A;  1IIT A;  3K6U A;  3S4U A;  4R72 A;  4LZ5 A;  2UVG A;  1POT A;  3I3V A;  3OSQ A;  4M4G A;  2HAV A;  4PP0 A;  4MF3 A;  2B3B A;  4ZE9 A;  2I4C A;  1LFG A;  2V84 A;  4F3B A;  4H65 A;  1B40 A;  1I69 A;  1AL3 A;  4IO7 A;  3MPK A;  3OMB A;  1MM7 A;  4YB5 A;  4GLI A;  4KD5 A;  3EHU A;  4F1V A;  4M1V A;  1JW1 A;  1QUJ A;  4DIG A;  1WDN A;  4DXU A;  1EH3 A;  2HXW A;  1SI0 A;  3E3K A;  1GGG A;  5FHN A;  3LSF B;  5LOM A;  2HAU A;  1ATG A;  3P7I A;  2RC7 A;  1MS7 A;  4YB7 A;  4GXS B;  1M5F A;  3I5O A;  1MQJ A;  4Z7E A;  3GZG A;  4ZEK A;  1LBB A;  2XX9 A;  5K2Y A;  1SW1 A;  2I58 A;  4OVJ A;  4DE8 A;  1B58 A;  4NF8 B;  1D9V A;  3IL1 B;  1MXV A;  3VXC A;  2XXT A;  5KZT A;  1B3F A;  2F7A A;  2YPN A;  1OVT A;  5L8D A;  3ECR A;  3H3G A;  4LA9 A;  4OEU A;  1Y3P A;  2DE3 A;  3VVF A;  4ZS9 A;  1CE2 A;  3S2V A;  2XXI A;  1PB7 A;  4QSD A;  3RPW A;  4ELR A;  3S9N C;  1PBQ A;  4U4S A;  4NED A;  4OQO A;  5I56 B;  4XKN A;  2DWJ A;  3MJN A;  1A54 A;  2I6E A;  4ESX A;  4OMB A;  3KN8 A;  4RK2 A;  2AYS A;  3IOU A;  4LQ2 A;  1TT1 A;  3ILT B;  4RY1 A;  4F18 A;  3O66 A;  1N76 A;  3HCQ A;  3VDF A;  1PBP A;  4U1O A;  3KG2 A;  3TCG A;  1EZ9 A;  3FVK A;  4GXA A;  2R71 A;  3PPP A;  2BJJ X;  1DMB A;  3GBB A;  4EXK A;  1RYO A;  3KN3 A;  3IB0 A;  1N3X A;  4X48 A;  2H99 A;  1I6B A;  3G3I A;  5I2N B;  3TQL A;  2P2A A;  5H8F B;  1MY0 A;  2FA7 A;  2V25 A;  3OD7 A;  1YPN A;  2UVH A;  4DZ1 A;  4NTL A;  4KYS A;  1LST A;  1B7Z A;  4GRK A;  1MM6 A;  3G3K A;  2DS9 A;  4OXV A;  1QJM A;  3O28 A;  1H43 A;  3OO8 A;  3PGF A;  1ZLQ A;  5I84 A;  2P1S A;  2QL3 A;  3T22 A;  3MP8 A;  3OEN A;  2XXQ A;  2A5T A;  2VD2 A;  3S9M C;  3QUJ A;  2OJT A;  4U1Z A;  4YU0 A;  1B51 A;  4LAT A;  2XXW A;  2UXA A;  4E0W A;  5ICT A;  2DVZ A;  1A55 A;  1OQG A;  4YKJ A;  3RUM A;  5AA2 B;  2PBW A;  3H6V A;  3HPI A;  3UIF A;  2Y84 A;  4PFY A;  2OWS A;  3PD9 A;  3ILU B;  2AL4 A;  2F78 A;  3O6I A;  3K02 A;  3CFL A;  2DOJ A;  1N7X A;  5AA3 A;  3OO7 A;  4MH5 A;  4YKP A;  4QHQ A;  4RYA A;  1UIU A;  2DXY A;  2ONS A;  1OVB A;  5IKB A;  4NE4 A;  5KDT A;  3TEL A;  4LQ5 A;  4FIM A;  1WVJ A;  5ITO A;  4N13 A;  4PFU A;  3SER A;  3R6U A;  3UA8 A;  2R6G E;  3K0V A;  1P1O A;  2LAO A;  4XIG Q;  4K3F A;  5I2N A;  4HCW A;  4R6K A;  4YKK A;  3FD3 A;  3K6X A;  3SEX A;  1MXY A;  2DWA A;  3Q25 A;  1FW0 A;  4ELO A;  1N0T A;  1O64 A;  2AL5 A;  1LGB C;  2Y7R A;  4IO5 A;  3EHT A;  3VLU A;  4YMA A;  4HTG A;  3QUF A;  3HHF A;  3RT8 A;  4FED A;  3G3G A;  3GBA A;  2QSX A;  5HBC A;  3UK4 A;  4OFO A;  1ZBM A;  4DDD A;  1TFA A;  4LZ8 A;  2ESN A;  1VFE A;  2RCA A;  2A5S A;  1P1N A;  4IO6 A;  1R1N A;  2ZYK A;  1ZTY A;  2XXY A;  3JZJ A;  5ICQ A;  1MXX A;  4KHZ E;  3KZG A;  1URG A;  5F7V A;  4ONY A;  3T93 B;  1GR2 A;  4AB6 A;  5KCJ A;  3TAJ A;  2XXU A;  3O9P A;  1M5B A;  4BLA A;  1LFH A;  1XS5 A;  3LUY A;  2O69 A;  2NVU B;  1OMP A;  4N07 A;  4L17 A;  3O29 A;  5FHO A;  4H67 A;  5JEI A;  5EYF A;  5CM6 A;  3N6U A;  4GL8 A;  3H4Z A;  4OEN A;  1ELJ A;  4DXB A;  4R2B A;  5H8Q A;  3CFX A;  2ANJ A;  3ODB A;  4JSD A;  1MQI A;  1LAG E;  1HSJ A;  1JW4 A;  1NKX A;  3T9U A;  4ZE8 A;  4HW8 A;  2PT2 A;  4KYD A;  4H8I A;  4BDO A;  1SW4 A;  4GWO A;  4UA8 A;  2OK2 A;  1JEU A;  5FTH A;  1GV8 A;  3R7X A;  4IGR A;  1S9T A;  3OEK A;  3L6G A;  5TPA A;  3RLF E;  4Z0I A;  2ONR A;  3T66 A;  4EDP A;  3K6W A;  1B52 A;  2Y7W A;  2HEU A;  1Y1M A;  4H8J A;  4G8N A;  2IEE A;  3KN7 A;  3IJX B;  2ZXT A;  4F1U A;  3E4R A;  5CRY A;  1H3D A;  4FE8 A;  2F7B A;  4P0G A;  1NH8 A;  3IX1 A;  3VVD A;  4IO3 A;  1B0H A;  3UN6 A;  2I49 A;  4H0W A;  4ELQ A;  3MZB A;  2CZL A;  2ZMB A;  3H7M A;  3EQ1 A;  4I1D A;  2Z8F A;  3H6T A;  4O3C A;  2THI A;  3B7D A;  2F97 A;  5AA4 A;  5F1Q A;  1P1Q A;  1MXW A;  3HST A;  4ZZE A;  1LCF A;  1B5I A;  3O6G A;  2ZYN A;  1R6Z A;  3EPE A;  1JVY A;  1MY1 A;  3K2D A;  1VE4 A;  4FAJ A;  4BDL A;  2X7P A;  4RPO A;  5K2X A;  2F35 A;  3IK6 B;  3K1M A;  3C4M A;  1LB8 A;  2W7Y A;  3B6Q A;  1R9L A;  1AH5 A;  3KGC A;  2XX7 A;  1LAF E;  1JEV A;  1GVC A;  1PEB A;  3TTN A;  3K1P A;  4JXI A;  3LSX A;  1XOC A;  3PPN A;  2FYI A;  2WKY A;  3GLB A;  4RA1 A;  1Q35 A;  3RT6 B;  1P1U A;  2B65 A;  4FEC A;  2Q9T A;  5ELV A;  3RTF B;  3DLN A;  1MY3 A;  4ZEC A;  4Q0C A;  2I0C A;  1IXH A;  1LB9 A;  2H5Y A;  2ALU A;  1FQB A;  1UTH A;  1P1W A;  2XXP A;  4IO4 A;  3RNN A;  4ZDM A;  3Q26 A;  1NNT A;  3QYT A;  1MDQ A;  2F8D A;  1SW2 A;  2H4I A;  3LBS A;  2Q8J A;  5JK4 A;  1B3L A;  3KSX A;  3KFM A;  4IGT A;  4F39 A;  3WAE A;  1IZ1 A;  3TQW A;  2VHA A;  4DCY A;  4AQ4 A;  1B5J A;  5J1D A;  1M5E A;  2O68 A;  5CC2 A;  4TLL B;  1FTL A;  1FTJ A;  4G68 C;  1A7L A;  1B9J A;  2GHA A;  3IB2 A;  2O1M A;  5I57 A;  2FNC A;  3SKP A;  3FVO A;  1B3E A;  4EUO A;  2H25 A;  1B4H A;  4U21 A;  2QRY A;  3D4G A;  5EHM A;  3FV2 A;  4BDM A;  4WXJ A;  3QXM A;  1J1N A;  3QAX A;  3CR9 A;  4IB2 A;  2A5T B;  3G3H A;  5DTB A;  4JWY A;  1L5T A;  1M5D A;  3MVZ A;  4Q5T A;  3EN3 A;  1Y3Q A;  4BDR A;  1IQ7 A;  4KFQ A;  4I9D A;  4EF2 A;  1MH4 A;  1MQH A;  3FZV A;  3UP9 A;  1US5 A;  3RGY A;  4OFL A;  1OQH A;  2PT1 A;  3IR1 A;  4XKQ A;  3VLV A;  1FCK A;  2DE4 A;  2VD3 A;  3QSL A;  3LSL A;  2HZL A;  5KDT B;  4R6H A;  1VSO A;  3TEP A;  1NMU A;  1MXZ A;  3TKD A;  5AA1 A;  5HPQ A;  1DSN A;  1QW0 A;  3MWB A;  4OHN A;  5TP9 A;  1FQD A;  1B7H A;  4JBZ A;  2DQV A;  1D3K A;  4KCC A;  2OWT A;  2NXO A;  4NMY A;  2RCB A;  3PUV E;  4IY5 A;  4E0X A;  3N5L A;  4OYV A;  4JSO A;  3PV0 E;  2PVU A;  4GQO A;  4PET A;  2D3I A;  4F1Y A;  4Q8R A;  1O63 A;  3IOW A;  3OEL A;  4EXL A;  3IB1 A;  1JET A;  3U93 A;  1MDP 1;  3E13 X;  4KQP A;  4QSC A;  4X9T A;  4C1T A;  1IXG A;  1SI1 A;  3TTK A;  4WKM A;  2G29 A;  4X1D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...