1BP5A

Human serum transferrin, recombinant n-terminal lobe, apo form
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
328
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (SERUM TRANSFERRIN)
publication title Ligand-induced conformational change in transferrins: crystal structure of the open form of the N-terminal half-molecule of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 96
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1bp5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1bp5A02
2DP8A 3QUFA 5DEXB 5CMBA 1EH3A 2O1LA 3B7DA 2CMOA 3CIJA 3T9XB 4OERA 2THIA 1B3HA 5CMKA 2HQ0A 1RYXA 4OYVA 4G68B 1US5A 1I6QA 4R73A 4ECFA 4Q8RA 1JQFA 2O7UA 3MVYA 1MY4A 2I4CA 4X1DA 2NVUB 4QRZA 3U72A 3LR1A 4JB7A 2ONKE 5AA2A 3OO8A 2F97A 3DP4A 1LBCA 4EQBA 5ITPA 3S9LC 1ATGA 4U21A 4KFQA 4NTLA 4R6HA 3DELB 3SEWA 2B3BA 1NMUA 3Q29A 5AE4A 2NOOA 4M1VA 2UVIA 1FCKA 4IY6A 5M2VA 5AA4A 3KSJA 4HTGA 1OMPA 1S9TA 4F1YA 1LSTA 1R9LA 1UTHB 1H43A 4EXLA 2ZYNA 1QJMA 2XXPA 3FJMA 3IO4A 2VP1A 4JWOA 1ZMGA 2VD2A 1FTJA 3SKPA 1SD3A 1LGBC 3OENA 1NNKA 4NF6A 3K1PA 4M4GA 1URDA 3M3LA 1DPEA 3MWBA 3PMVA 1M5DA 5DVJA 1WVJA 5KDTA 4U1ZA 2REGA 3TQWA 1B0HA 1FQBA 3FV2A 4BDLA 1O7TA 1FTLA 3N94A 3MP8A 3N6TA 5H8NA 4ONYA 2F6PA 2ALUA 4OQOA 4YU0A 4F2QA 2R9JA 2DWAA 4F3SA 2DE2A 4RK2A 4F3BA 2I0CA 5I2KA 1AMFA 3GBAA 1B32A 3RGYA 1XVYA 2PT2A 2PVUA 2ONRA 2F35A 4WKMA 1SDXA 1SVXB 2PMSA 3MP6A 1B51A 3RN8A 1SYIA 3VLVA 4PP0A 1BIYA 1ZKBA 4F39A 4ESWA 3S4UA 1P1NA 3KG2A 3VFJA 1T0KA 5EYFA 5CI5A 1ZU0A 2R6GE 3Q25A 4NF5A 1IIWA 4BDQA 3EHUA 4DZ1A 3KGCA 1B7UA 4O3BA 3KOTA 1Y9UA 4QFOA 3S9EA 4DXUA 3G3HA 2Q8JA 2RC9A 4ZZEA 1A55A 3G3FA 2H99A 1PB7A 4TLMB 4KQPA 4POXA 1N3WA 1HSLA 4KR5A 4G8MA 2V3QA 3B6QA 3PUWE 4NWDA 3G3IA 4FJPA 1MQGA 2OZZA 1I6BA 3T9UA 2DWIA 1JVYA 1AL3A 5I59B 2XXHA 4YKPA 1LFHA 4ELQA 2Y7IA 3THIA 1LCTA 3K4UA 4RA1A 3HPIA 3KSXA 3EF7A 3UGWA 2RC8A 3TAJA 2O7IA 1FQEA 1MY0A 1YPNA 3FGSA 4YB6A 1B3GA 1UIVA 3N26A 2DE4A 5L9OA 3ILTB 3DM0A 2OJTA 3HV1A 4GL0A 4NE4A 4U22A 4U23A 2HZLA 4R72A 5A5XB 2YPNA 5H8SA 4ZECA 3TEPA 3TTLA 4XIGQ 3UP9A 4P11A 1R6ZA 1TWYA 1XVXA 4F18A 5EHSA 4AB5A 3FJGA 5I56A 3G3KA 3TODA 4OHNA 1UQWA 1VE4A 2RC7A 2OWTA 4RPOA 4AB6A 3E3KA 1LB9A 2FA7A 2HAVA 1A8EA 4JSOA 4PFTA 3HO7A 5FTHA 3TQLA 3KBRA 1S50A 1B7ZA 2O68A 4EF1A 1MDP1 3TFLA 1B2HA 4RXLA 4XXUA 4YKKA 4BLAA 1B5IA 5JTYB 5EHMA 5I57A 4QSEA 5F1QA 5ICTA 2ONSA 5DVFA 4G8HA 4C0RA 2QJEA 4IO4A 2V3UA 4Q30B 2H98A 3G7WA 4O3AA 2ZMBA 4U4SA 1QVSA 1TFAA 1ZBMA 4R75A 5CC2A 4IO3A 4RYAA 3FZVA 1PBQA 2XX9A 3LUYA 1IUDA 3ZS6A 1IXHA 3LSWA 3PGFA 2VD3A 4YB7A 2DOJA 1H3DA 1MH3A 1Y4TA 1OQGA 3H6VA 1DMBA 3K1NA 1B1XA 2F34A 3MVXA 3DP6A 1OVBA 3VVDA 3QAXA 2Z8DA 3A09A 5FHMA 2ESNA 3VVFA 4G77A 4EUOA 4G68C 4FEDA 3CSGA 4R9GA 3KN8A 1N7WA 3C36A 5I2NA 3OO6A 3MZ9A 3ILUB 4LP2B 3KZGA 2V93A 4GF8A 3O6GA 5I58B 4C1TA 3FVOA 1IITA 3O2AA 1FTMA 1BKAA 1OVTA 2D3IA 1NH7A 4NF8A 3N6UA 3H6TA 3D4GA 4UA8A 1MXXA 3RY3A 5DTBA 2XX7A 1NFTA 3IJXB 1USYH 3I5OA 3TMGA 4F1VA 5CRYA 3O97A 3M3KA 3OO7A 2DSFA 4U4XA 2OCUA 1VFDA 2A5TB 4GVOA 3H06B 4OFLA 4OVJA 1JW4A 4H67A 3UA8A 3Q27A 4R9FA 3IX1A 3KOSA 3KFMA 5H8HB 2HFBA 4FIMA 3K2DA 1MH4A 4DXCA 3P7IA 2QS3A 1ZLQA 3K01A 3PU5A 2F5XA 4LQ5A 1PB9A 4OFOA 4F19A 2Y7PA 2ZNSA 3CSBA 3JV9A 3IL1B 5H8FA 4KYEA 4HS7A 3T93B 1MY2A 5CBSA 1UTBB 2RINA 1Q35A 4WXJA 3SESA 2D21A 1QW0A 5ITOA 4TQUQ 1LFGA 3TTNA 3I6VA 1Y1MA 1WODA 1OLAA 4GOTA 5H8QA 3EQ1A 3T9HB 3EHSA 4G2ZA 4GD5A 3O66A 1B0LA 1O63A 3ODBA 1PBPA 3TCHA 4XKRA 4LATA 1H45A 1POTA 1PEBA 3M3FA 5L9SA 3CVGA 1MXYA 3K6WA 2I0BA 4H8IA 2R71A 2ZNUA 4GFRA 2GRVA 4KPTA 2XXUA 4BDRA 2Q89A 4OETA 4NEDA 4YKIA 2A5SA 3SEXA 1B58A 3Q28A 5TU0A 1B05A 3ONMA 3OELA 3QK6A 4XKNA 1OLCA 4YMAA 1P1WA 1B5HA 1SW2A 3H7MA 3TTMA 4MBPA 5HM4B 2Q2CA 4OESA 1A40A 5L8DA 3U93A 1B9JA 2X7PA 1DTZA 1B5JA 2I58A 1L5TA 3CI8A 5KCJA 2I3WA 3MZ1A 1TFDA 4KD5A 3PUZE 5HPQA 1D9YA 3MPKA 1N84A 2O51A 4H8JA 4FEBA 1QULA 3VXCA 4DXBA 4NF4A 5I57B 3HHFA 3K6VA 1QUIA 5AA1A 2F78A 3OEMA 3T66A 3DP8A 4K3FA 1B52A 2DWHA 3H3GA 5TP9B 3MQ9A 2XXTA 4P0GA 1Y3QA 1MS7A 3MP1A 1D9VA 1LAGE 1PC3A 3K02A 5FTIA 5TPAA 3E9XA 4N07A 4PFWA 1SW5A 2VHAA 4WEPA 1TXFA 1FTOA 2GFEA 3CFLA 2XXQA 4LVQA 4QFNA 1GGGA 3R6UA 5DVIA 1MDQA 1O64A 1ZIUA 3LSXA 2DVZA 4IGTA 3U92A 1P1QA 3MUQA 3MC2A 1USYE 5IAIA 5IKBA 1JNFA 3FUZA 3F11A 2DYXA 1N0TA 1LCFA 5JK4A 2FYIA 2RCBA 4KCDA 1BTJA 4EXKA 1FQDA 1H44A 3TKDA 1FTKA 3TUSA 4DCYA 3O29A 2QL3A 3BFUA 3VE1B 3V89B 5DEXA 3RUMA 3IO6A 3N5LA 3KN3A 3H6UA 2XXWA 4QSCA 1P99A 2P1SA 3C4MA 3FXQA 1HSEA 4G68A 2ZYKA 5K2XA 2I4BA 3EPEA 3SEYA 1PDAA 4F3PA 2O84X 3B6WA 4DIGA 4I8CA 1A8FA 4G8NA 3E4RA 1N04A 1POY1 3RNNA 3O6IA 3UIFA 1JVXA 4PETA 1Z7NE 3G3GA 2ABHA 3T22A 1LLSA 2V3TA 4DDDA 1F9BA 3TPAA 2HZKA 2X26A 4LZ8A 2OWSA 3CR9A 3ZKKA 1FQCA 1MXZA 2F6GA 1B40A 1QUKA 1OIBA 1UTHA 3RPWA 1B4HA 4RK9A 1R9QA 4YZZA 3A3CA 4QFPA 3UN6A 5HBCA 3VV5A 4N13A 4GLIA 3EN3A 1IQ7A 1URSA 4GWOA 4TLLB 3MW0A 1J1NA 2FNCA 3H4ZA 4ZEBA 2ZXTA 3QXMA 4LUBA 5F7VA 2B65A 2DE3A 2XD3A 2F7AA 4ZE9A 4GXSB 4XKPA 3U94A 5AA2B 3USDA 3PD9A 2UXAA 2QS1A 2XHDA 2YLNA 2NUVA 2Z8EA 1AOVA 5FHOA 3QSLA 4PFUA 1MY3A 1YTVA 2PT1A 1B6HA 1MRPA 5BWJA 3IOTA 4YKJA 4DCXA 4ZDMA 3H03A 2UYFA 1P1OA 1H76A 1URGA 1N7XA 2P0SA 4P0IA 4IGRA 5AA4B 5B7DA 1GV8A 2O6AA 3QIMA 2QSXA 1NNFA 1MPCA 2F7CA 5FHNA 1B3LA 3GXAA 3OSRA 4HCYA 1NNPA 2OLBA 2XXYA 3CG3A 3VVEA 4U1OA 3ZKLA 4F31B 4NF6B 1M5EA 1JW5A 4ZEIA 3QUJA 3D4CA 1DSNA 4MLQA 2DXRA 3IJOB 4OFJA 5KDTB 3Q26A 3C31A 5ELVA 1RYOA 2ZYMA 3TELA 1MQDA 3MVZA 3GLBA 5H8NB 3SEUA 1D4NA 3RLFE 3HN0A 1JETA 3FJ7A 1ELJA 2D5WA 1Y4CA 3KEIA 4MLVA 2F36A 1A54A 5I59A 5AA2D 1FQFA 3JYRA 4O3CA 1Y1ZA 1I69A 5I2KB 3PMXA 4RY1A 2O69A 1II5A 5AA3A 4GRKA 1NNTA 4EQ9A 5TPAB 4L17A 3M8UA 4HCWA 2O1MA 3IB1A 1R1NA 2H9BA 2QS2A 3PV0E 4XTCQ 5A5XA 1Q1KA 1MQHA 1B1HA 3SDFA 5KZTA 1GR2A 4LZ7A 4ELRA 4OTEA 4N6PA 3G3JA 1IXIA 4F29A 4NF5B 3MVWA 4RJZA 1SBPA 4F2OA 2ZYOA 4GQOA 3V5AA 3OO9A 3C35A 1EZOA 2DQVA 3AXFA 2W7YA 4U2RA 2ANJA 4AQ4A 1LFIA 1LAHE 1OQHA 3CG1A 4IO6A 2X7QA 2F8DA 2UVHA 2BJJX 4ZS9A 4LQ2A 1D3KA 2P2AA 1M5BA 4MF3A 4ND9A 3R7XA 1B3FA 2AIXA 1EU8A 3IOVA 3IOWA 3FVNA 4OWDA 1HSJA 5JTYA 2CZLA 4IY5A 3PPOA 4X48A 4Z7EA 4RNSA 1IEJA 4F3GA 1SYHA 2E1SA 4H6DA 3RT6B 1US4A 1JW1A 4TOZA 2PYYA 1M5CA 3V83A 5CM6A 2Y7KA 2XXXA 4KYSA 1QKBA 4LA9A 2I48A 1Z7ME 3K6XA 3W15C 3C34A 3C9HA 5I56B 1CE2A 3LBSA 3E13X 2I49A 2G93A 3MZBA 1UIUA 4R2BA 3WAEA 2Z8FA 3FVKA 2Z23A 3CRBA 3GBBA 4YB5A 3U8QA 3S2VA 3K6UA 1SI1A 3FATA 5DT6A 4FE8A 1XHYA 3LSFB 4ZZAA 3B6TA 1XC1A 2OBGA 4LONB 3H6WA 4ISUA 4XKQA 2KLFA 2XXIA 2XXVA 1EZPA 4YMBA 2XX8A 5I58A 1MXVA 3L6GA 5CMMA 2HEUA 3SERA 3TTRA 1IZ1A 3IR1A 3PUXE 4Q5TA 3RT8A 1RKMA 1MY1A 3CFXA 3MPLA 4H65A 1FW0A 4BDMA 1QKAA 2H25A 4ELOA 1LB8A 5DYHA 4FATA 1SW4A 3HSTA 4WEDA 2A5TA 4PQJA 2NXOA 4IB2A 3ZSFA 4GXAA 4Z0IA 3FIRA 2IEEA 1MQJA 3HCQA 2DWJA 4JWYA 1ANFA 3T96B 1MPDA 2DVCA 4H5GA 1B4ZA 4EDPA 4QSDA 1GVCA 2Q2AA 4F1UA 1MM7A 5H8HA 2Y84A 4YAHX 1LAXA 1LAFE 3VDFA 5ICQA 2HXWA 1XOCA 1JEVA 4OZ9A 5J1DA 2F7BA 4HW8A 4NMYA 3RQTA 2AYSA 4EQ7A 2YJPA 5JEIA 5I2NB 1YCJA 3IB0A 1LBBA 3JZJA 4MH5A 5CMCA 1UTBA 3PUYE 1I6AA 2UVGA 4H0WA 1MPBA 1QUJA 4Q0CA 4NF8B 4C1UA 1B46A 3KJTA 4I9DA 1VR5A 2HCAA 3PUVE 2PBWA 1N76A 1YAEA 2HAUA 3S9MC 4GIZA 4OXVA 1Y3NA 4THIA 3PPQA 1AIVA 3FVGA 4ELPA 1GTKA 1TT1A 4H5FA 2QPQA 4F22A 2V25A 3O28A 4QF9A 3T9VA 2Q88A 4FECA 1A7LA 2RKMA 4IO5A 2NWJA 4KCCA 4X9TA 2AL4A 4MFIA 1S7YA 1PB8A 3IOUA 3KJ7A 2GH9A 2DXYA 3ECRA 2RCAA 4YICA 3W9WA 3L6HA 3DLNA 3FV1A 3QYTA 5LOMA 3R26A 2Q9TA 3BFTA 5ISUA 4IO2A 2WKYA 1B7HA 3OOAA 5H8FB 1DPPA 1XT8A 4FAJA 5I84A 3U1OA 1NL5A 4E0XA 4OENA 2LAOA 3EHTA 3HHGA 3KN7A 3MAMA 3IB2A 4QHQA 4DE8A 3TZAA 4IO7A 5CBRA 2I6EA 5BUUA 1VFEA 2RF1A 5H8QB 1ZTYA 4JDFA 3TCGA 4POWA 3IORA 3GZGA 1P1UA 2DS9A 4PFYA 1B3EA 4NWCA 5K2YA 3BKIB 2XXRA 5L9MA 3SETA 4X1BA 4ZE8A 3S9NC 5TP9A 1Y3PA 4R6KA 3PPPA 2H5YA 2Z22A 4ZEKA 1MXWA 1MM6A 3RTWB 2QMWA 3IAZA 2XD2A 2Y7WA 2H4IA 1SW1A 3MJNA 3TTKA 3LC8A 3A3UA 3K00A 3FASA 3PMWA 3VXBA 1M5FA 1N3XA 4KHZE 5KCJB 2GHBA 1BP5A 3IK6B 2ZNTA 3OSQA 4QFLA 1SI0A 3V8XB 3VLWA 4FORA 2M8CA 1A99A 4BDOA 1VSOA 2E0SA 1CB6A 4UACA 2OK2A 4BDNA 2VGQA 1NH8A 4ZEDA 3BBRA 1EZ9A 1ZJLA 4G4PA 4R6YA 3UORA 1JEUA 4JXIA 4I62A 3RTFB 4JWXA 2B3FA 4OEVA 4NF4B 2UVJA 1IXCA 4ZEFA 3TDJA 3OXNA 3CFZA 2QS4A 2GHAA 3MBPA 4R74A 1MXUA 3SEVA 3PPRA 1XS5A 4ESXA 3C32A 4QFKA 3OMBA 2AL5A 4EF2A 1IXGA 1Y20A 3FD3A 4OMBA 2PX1A 2I3VA 3C33A 1KWHA 3K1MA 1DTGA 3OEKA 2QMXA 3OD7A 4JBZA 3W9VA 1FQAA 1DOTA 4DLDA 1AH5A 4R2FA 3FXUA 4PE5B 3TCFA 4RPNA 3PPNA 3O9PA 3VLUA 1NKXA 4KYDA 4I1DA 2V84A 3UK4A 3PD8A 3O6HA 1MQIA 2VOZA 4OEUA 3FXRA 2QRYA 3LSLA 2UYEA 5B70A 2G29A 2IA4A 4GL8A 2REJA 3I3VA 4H1XA 3WAFA 3K0VA 1WDNA 1SQYA 3TYHA 1MG1A 2Y7RA 1BLFA 4LZ5A 4JSDA 4KI0E 4E0WA
chains in the Genus database with same CATH superfamily
2DP8A 3QUFA 5DEXB 5CMBA 1EH3A 2O1LA 3B7DA 2CMOA 3CIJA 5EQ8A 3T9XB 4OERA 2THIA 1B3HA 5CMKA 2HQ0A 1RYXA 4OYVA 4G68B 1US5A 1I6QA 4R73A 4NF0A 4ECFA 4Q8RA 1JQFA 2O7UA 3MVYA 1MY4A 2I4CA 4X1DA 2NVUB 4QRZA 3FBPA 3U72A 3LR1A 4JB7A 2ONKE 5AA2A 3OO8A 2F97A 3DP4A 4LN5A 1FRPA 4PE3A 1LBCA 3MYUA 4EQBA 5ITPA 3S9LC 1ATGA 4U21A 4HE2A 4KFQA 5F24A 4NTLA 4R6HA 2QFLA 3DELB 3SEWA 2B3BA 1NMUA 4GWUA 3Q29A 3GYYA 5AE4A 2NOOA 4M1VA 2UVIA 1FCKA 4PAKA 4IY6A 5M2VA 5AA4A 3KSJA 4HTGA 1OMPA 1YYZA 1S9TA 4F1YA 4GWWA 1LSTA 2HXRA 4KXPA 1R9LA 1UTHB 1H43A 4EXLA 2ZYNA 1QJMA 2XXPA 4MNCA 3FJMA 3IO4A 2VP1A 2B4MA 4JWOA 1ZMGA 2VD2A 1FTJA 3SKPA 1SD3A 4MX6A 1LGBC 3OENA 1NNKA 4NF6A 3K1PA 4M4GA 1URDA 3M3LA 1DPEA 3MWBA 3PMVA 4UABA 1M5DA 4HE0A 5DVJA 1WVJA 5KDTA 4U1ZA 2REGA 3TQWA 1B0HA 1FQBA 3FV2A 4BDLA 1O7TA 1FTLA 3N94A 3MP8A 3N6TA 5H8NA 4ONYA 2F6PA 2ALUA 2XWVA 3QMFA 4I40A 4MMPA 2CZKA 4OQOA 4YU0A 4F2QA 2R9JA 2DWAA 4F3SA 2DE2A 4RK2A 4F3BA 2I0CA 5I2KA 1AMFA 3GBAA 1B32A 3E78A 3RGYA 1XVYA 2PT2A 2PVUA 3B50A 2ONRA 2F35A 4WKMA 1SDXA 1SVXB 2WYPA 2PMSA 3MP6A 1B51A 3RN8A 2Q74A 1SYIA 3VLVA 4PP0A 1BIYA 1KZ8A 1ZKBA 4F39A 4ESWA 3S4UA 1IMCA 1P1NA 2CZIA 3KG2A 3VFJA 1T0KA 4DI4B 5EYFA 5CI5A 1ZU0A 2R6GE 3Q25A 4NF5A 1IIWA 4BDQA 4IR8A 3EHUA 4DZ1A 3KGCA 1B7UA 4O3BA 3KOTA 1NUWA 1Y9UA 4QFOA 3S9EA 4DXUA 1NI9A 3G3HA 2Q8JA 2RC9A 4N6DA 4ZZEA 1A55A 2CZHA 2H99A 3G3FA 1PB7A 4TLMB 4KQPA 4POXA 1N3WA 1HSLA 4KR5A 4G8MA 5J16A 2V3QA 3B6QA 3PUWE 4NWDA 4MAGA 3G3IA 4FJPA 1MQGA 2OZZA 1I6BA 3T9UA 2DWIA 3LV0A 1JVYA 1AL3A 5I59B 2XXHA 4YKPA 1LFHA 4ELQA 2Y7IA 3THIA 1LCTA 3K4UA 1EYJA 2FBPA 4RA1A 3HPIA 3KSXA 3EF7A 3UGWA 2RC8A 1LBZA 3TAJA 2O7IA 1FQEA 1MY0A 1YPNA 3FGSA 4YB6A 1B3GA 1UIVA 3N26A 2DE4A 5L9OA 3ILTB 3DM0A 2OJTA 3HV1A 4GL0A 4NE4A 4U22A 4U23A 2HZLA 4R72A 5LDZA 5A5XB 2YPNA 4O94A 5H8SA 4ZECA 3TEPA 3TTLA 4XIGQ 3UP9A 1XI6A 4P11A 1LBYA 1R6ZA 1TWYA 1XVXA 4F18A 5EHSA 4AB5A 3FJGA 5I56A 3G3KA 3TODA 4OHNA 4OA4A 1UQWA 1VE4A 2RC7A 2OWTA 4RPOA 4AB6A 3E3KA 1LB9A 2FA7A 2HAVA 1A8EA 1BK4A 4JSOA 4PFTA 3HO7A 5FTHA 3TQLA 3KBRA 1S50A 1B7ZA 3IFCA 2O68A 3KBZA 4EF1A 4PBHA 1MDP1 3TFLA 1B2HA 1NV3A 4RXLA 4XXUA 4YKKA 1FBEA 4BLAA 1B5IA 5JTYB 5EHMA 5I57A 4G61A 4QSEA 3RPLA 5F1QA 1LBVA 5ICTA 2ONSA 5DVFA 4G8HA 4C0RA 2QJEA 4IO4A 2V3UA 4Q30B 2H98A 3G7WA 4O3AA 2ZMBA 4U4SA 1QVSA 1TFAA 1ZBMA 4R75A 5CC2A 1LBWA 4IO3A 4RYAA 3FZVA 4N81A 1PBQA 2XX9A 2XWOA 3LUYA 1IUDA 3ZS6A 1IXHA 3LSWA 3PGFA 2VD3A 4YB7A 2DOJA 1H3DA 2PFYA 1MH3A 1Y4TA 4JVIA 1OQGA 3H6VA 1DMBA 3K1NA 1B1XA 2F34A 3MVXA 3DP6A 1OVBA 3VVDA 3QAXA 2Z8DA 3A09A 5FHMA 2FIEA 2ESNA 3VVFA 4G77A 4EUOA 4G68C 4FEDA 3CSGA 4R9GA 3KN8A 1N7WA 3C36A 2Q8MA 5I2NA 3OO6A 3MZ9A 3ILUB 4LP2B 3KZGA 2V93A 4GF8A 4OVSA 3O6GA 5I58B 4C1TA 3FVOA 2QVVA 1IITA 3O2AA 1FTMA 1BKAA 1NV6A 1OVTA 2D3IA 1NH7A 2P3NA 4NF8A 5IZ1A 3N6UA 3H6TA 4PF8A 3D4GA 4UA8A 1MXXA 3RY3A 5DTBA 2XX7A 1NFTA 3IJXB 1USYH 3I5OA 3TMGA 4F1VA 3EKIA 5CRYA 3O97A 3M3KA 4AS4A 3OO7A 2DSFA 4U4XA 2OCUA 1VFDA 2A5TB 4GVOA 3H06B 1FBCA 4OFLA 4OVJA 1JW4A 4H67A 4OVPA 3UA8A 3Q27A 4R9FA 3IX1A 3KOSA 3KFMA 2HHMA 5H8HB 3PTYA 2HFBA 4FIMA 3K2DA 2OWZA 1MH4A 4DXCA 3P7IA 2QS3A 1ZLQA 3K01A 3PU5A 4HE1A 2F5XA 4LQ5A 1PB9A 4OFOA 5EQ7A 4F19A 2Y7PA 2ZNSA 3CSBA 4XF5A 5LTCA 3JV9A 3IL1B 5H8FA 4KYEA 4HS7A 3T93B 1MY2A 1NV1A 5CBSA 1UTBB 2CEXA 2RINA 1Q35A 4GWZA 4WXJA 3SESA 2D21A 1QW0A 5ITOA 4X04A 4TQUQ 1LFGA 3TTNA 3I6VA 1Y1MA 3U65A 1WODA 1OLAA 4GOTA 5H8QA 3EQ1A 3T9HB 3EHSA 4G2ZA 4GD5A 3O66A 2XXKA 4NQ8A 4GWYA 2XWKA 1B0LA 1O63A 4PFRA 3ODBA 1PBPA 1IMDA 3TCHA 4XKRA 4LATA 1H45A 1POTA 1PEBA 3M3FA 5L9SA 3CVGA 1MXYA 3K6WA 2I0BA 4H8IA 2R71A 2ZNUA 4GFRA 2GRVA 4KPTA 2XXUA 4BDRA 2Q89A 5IZ3B 4OETA 4NEDA 4YKIA 1RDXA 2A5SA 3SEXA 1B58A 3Q28A 5TU0A 1FPBA 1B05A 1EYIA 3ONMA 3OELA 3QK6A 4XKNA 1OLCA 4YMAA 1P1WA 2Y5LA 1B5HA 1SW2A 3H7MA 3TTMA 5I3SA 4MBPA 5HM4B 2Q2CA 4OESA 1A40A 2MKZA 5L8DA 3U93A 1B9JA 2X7PA 1DTZA 1B5JA 2I58A 1L5TA 3CI8A 5KCJA 2I3WA 1LBXA 3MZ1A 1TFDA 1EYKA 4KD5A 3PUZE 1IMAA 5HPQA 1D9YA 3MPKA 1N84A 1SPIA 3BIHA 2O51A 4H8JA 4FEBA 1QULA 3VXCA 4DXBA 4NF4A 4QXDA 5I57B 5I5PA 3HHFA 3K6VA 1QUIA 5AA1A 2F78A 3OEMA 3T66A 4P9KA 3DP8A 5EQAA 4K3FA 1B52A 2DWHA 3H3GA 5TP9B 3MQ9A 2XXTA 4P0GA 5EYGA 3E79A 4NX1A 1Y3QA 1MS7A 3MP1A 1D9VA 1LAGE 4PCDA 1PC3A 3K02A 1NUZA 5FTIA 4FBPA 1DBZA 5TPAA 2WEFA 3E9XA 4N07A 1NUXA 4PFWA 4PTKA 4NAPA 1SW5A 2VHAA 2KQZA 3CHGA 4WEPA 1TXFA 1FTOA 2GFEA 3CFLA 2XXQA 4LVQA 4QFNA 1GGGA 3R6UA 3SZPA 5DVIA 1MDQA 1O64A 1ZIUA 3LSXA 2DVZA 1NV7A 4IGTA 3U92A 1P1QA 3MUQA 3MC2A 1USYE 4XFEA 5IAIA 5IKBA 1JNFA 3FUZA 3B8BA 3F11A 2DYXA 1N0TA 1LCFA 5JK4A 2FYIA 1K9YA 2RCBA 4KCDA 1BTJA 3T0JA 4EXKA 1FBHA 1FQDA 1H44A 3TKDA 1FTKA 1FTAA 3TUSA 4DCYA 3O29A 2QL3A 3BFUA 1DK4A 3VE1B 3V89B 1RDYA 5DEXA 5EQ9A 3RUMA 3IO6A 3N5LA 4OANA 3KN3A 3H6UA 2XXWA 4QSCA 1P99A 2FHYA 2P1SA 3C4MA 3IFAA 3FXQA 1HSEA 4G68A 4PAFA 1DCUA 2ZYKA 5K2XA 2I4BA 3EPEA 3SEYA 1PDAA 3D1RA 4F3PA 2O84X 3B6WA 4DIGA 4I8CA 1A8FA 5ET6A 4G8NA 3E4RA 5ESYA 1CNQA 1N04A 1POY1 3RNNA 4MHFA 3O6IA 3UIFA 3LUZA 1JVXA 4PETA 1Z7NE 2CEYA 3G3GA 2ABHA 3T22A 1LLSA 2V3TA 4DDDA 1F9BA 3TPAA 2HZKA 2X26A 4LZ8A 2OWSA 3CR9A 3ZKKA 1FQCA 4N8GA 1MXZA 2F6GA 2OX3A 1B40A 1QUKA 1OIBA 4GX6A 1UTHA 3RPWA 1B4HA 4RK9A 1R9QA 4YZZA 3A3CA 4QFPA 4QBAA 3UN6A 5HBCA 2FIXA 4N15A 5ET7A 3VV5A 2HPGA 4N13A 4GLIA 3EN3A 1IQ7A 1URSA 4GWOA 4TLLB 3MW0A 2P3VA 1J1NA 2JJKA 2FNCA 3H4ZA 4ZEBA 2ZXTA 3QXMA 4LUBA 4GX4A 4N6KA 1NV0A 5F7VA 2B65A 1K9ZA 2DE3A 2XD3A 2F7AA 4OVRA 4ZE9A 4GXSB 4XKPA 3U94A 5AA2B 3USDA 3PD9A 2UXAA 2QS1A 1KA0A 2XHDA 2YLNA 2NUVA 2Z8EA 1AOVA 3NOHA 5FHOA 3QSLA 4PFUA 2F3BA 1MY3A 1YTVA 2PT1A 1B6HA 1MRPA 2QVUA 5BWJA 3IOTA 4YKJA 4DCXA 1IMEA 4ZDMA 3H03A 2UYFA 3HFUA 1P1OA 1AWBA 1H76A 1URGA 1N7XA 5ET5A 2P0SA 4P0IA 4IGRA 5AA4B 3T1BA 5B7DA 1GV8A 4H46A 2O6AA 3QIMA 2ZZXA 2QSXA 1NNFA 1MPCA 2F7CA 5FHNA 1B3LA 3GXAA 3OSRA 4HCYA 1NNPA 2OLBA 2XXYA 3CG3A 3VVEA 2V4CA 4U1OA 3ZKLA 4F31B 4NF6B 1M5EA 1JW5A 4ZEIA 3QUJA 1FPJA 3D4CA 1DSNA 4MLQA 4PF6A 2DXRA 3IJOB 4OFJA 5KDTB 3Q26A 1FJ9A 3C31A 5ELVA 1RYOA 4PAIA 4OVTA 2ZYMA 3TELA 1MQDA 4XEQA 3MVZA 3GLBA 5H8NB 3SEUA 1D4NA 3RLFE 2KR0A 3HN0A 1JETA 3FJ7A 4NHBA 1ELJA 2D5WA 1Y4CA 3KEIA 4MLVA 2F36A 1A54A 5I59A 5AA2D 1FQFA 3JYRA 4O3CA 1Y1ZA 1I69A 4JVCA 5I2KB 3PMXA 4RY1A 5T3JA 2O69A 1II5A 3MSTA 5AA3A 4GRKA 1NNTA 4EQ9A 4AS5A 5TPAB 2WX9A 4L17A 3M8UA 4HCWA 2O1MA 3IB1A 1R1NA 2H9BA 5IM2A 2QS2A 1VDWA 3A29A 2R8TA 3PV0E 4XTCQ 5A5XA 1Q1KA 1MQHA 1B1HA 5DW8A 3SDFA 1FSAA 5KZTA 1GR2A 4LZ7A 4PFIA 4ELRA 4OTEA 4N6PA 3G3JA 1IXIA 4F29A 2XWIA 4NF5B 3MVWA 4P1LA 5FBPA 4RJZA 1SBPA 1QGXA 4F2OA 2ZYOA 4GQOA 3BIGA 3V5AA 3OO9A 3C35A 1EZOA 2DQVA 3AXFA 2W7YA 4MNPA 4U2RA 2ANJA 4AQ4A 1LFIA 1LAHE 1OQHA 3CG1A 4IO6A 2X7QA 4HXVA 1FBDA 2F8DA 2UVHA 4JVDA 2BJJX 4ZS9A 4LQ2A 1D3KA 2P2AA 1M5BA 4MF3A 4ND9A 3R7XA 1B3FA 2AIXA 1EU8A 3IOVA 3IOWA 3RYDA 3FVNA 4OWDA 1FPDA 1HSJA 5JTYA 2CZLA 4MJOA 4H45A 4IY5A 3PPOA 4X48A 1FPKA 4Z7EA 4RNSA 1IEJA 4F3GA 1SYHA 2E1SA 4H6DA 3RT6B 1Q9DA 1US4A 1JW1A 4TOZA 1FPFA 2F3DA 2PYYA 1M5CA 3V83A 5CM6A 2Y7KA 2XXXA 4KYSA 1QKBA 4N17A 4LA9A 2I48A 1Z7ME 3K6XA 3W15C 3C34A 2VPOA 3C9HA 5I56B 1CE2A 4PGPA 3LBSA 3E13X 2I49A 2G93A 3MZBA 1UIUA 4R2BA 3WAEA 4NG7A 2Z8FA 3FVKA 2Z23A 3CRBA 3GBBA 4YB5A 3U8QA 3S2VA 3K6UA 1JP4A 4GWXA 1SI1A 3FATA 5DT6A 1FPEA 1XHYA 4FE8A 3LSFB 4ZZAA 3B6TA 1XC1A 2OBGA 4PFBA 4LONB 3H6WA 4ISUA 2B4LA 4XKQA 2KLFA 2XXIA 2XXVA 1EZPA 4GX3A 4YMBA 2XX8A 3RPLB 4PGNA 5I58A 1MXVA 3L6GA 5CMMA 2HEUA 3SERA 3TTRA 1IZ1A 4NGUA 3IR1A 3PUXE 4Q5TA 3RT8A 1RKMA 1MY1A 3CFXA 3MPLA 4GBWA 4H65A 1FW0A 4BDMA 1QKAA 2H25A 4ELOA 1LB8A 5DYHA 4FATA 1SW4A 3HSTA 4WEDA 2A5TA 1FBGA 2NXOA 4IB2A 4PQJA 4GXAA 4Z0IA 3ZSFA 3FIRA 2IEEA 1MQJA 3HCQA 2DWJA 4JWYA 1ANFA 3T96B 1MPDA 4O7MA 2DVCA 4H5GA 1B4ZA 4EDPA 4QSDA 1GVCA 2Q2AA 4F1UA 1MM7A 5H8HA 2Y84A 4YAHX 2WYKA 4P3LA 1LAXA 1LAFE 3VDFA 5ICQA 2HXWA 1XOCA 5I7IA 1JEVA 4I3EA 4OZ9A 5J1DA 2F7BA 4HW8A 4NMYA 3RQTA 2AYSA 4EQ7A 2YJPA 5JEIA 4MCOA 5I2NB 1YCJA 4PBQA 3IB0A 4OVQA 1LBBA 3JZJA 4MH5A 5CMCA 1UTBA 1FPLA 3PUYE 4PDHA 1I6AA 1NV2A 2UVGA 4H0WA 1MPBA 1KA1A 1QUJA 1G0IA 4Q0CA 4NF8B 4PDDA 4C1UA 1B46A 3KJTA 4I9DA 1VR5A 4N4UA 4GBVA 2HCAA 3PUVE 2PBWA 1N76A 1YAEA 2HAUA 3S9MC 4GIZA 4OXVA 1Y3NA 4THIA 3PPQA 1AIVA 3FVGA 4N8YA 4ELPA 4P8BA 4P56A 1GTKA 1TT1A 4H5FA 2QPQA 4F22A 2V25A 5IGAA 3O28A 4QF9A 3T9VA 2Q88A 4FECA 3ROJA 1A7LA 2RKMA 4IO5A 2NWJA 4KCCA 5IZ3A 4P47A 4X9TA 2AL4A 4MFIA 1S7YA 1NV5A 1PB8A 3IOUA 3KJ7A 2GH9A 2DXYA 3ECRA 2RCAA 4MNIA 1D9QA 4YICA 3W9WA 3L6HA 3DLNA 3FV1A 3QYTA 1INPA 2PFZA 5LOMA 3R26A 2Q9TA 3BFTA 5ISUA 4IO2A 2WKYA 1B7HA 3OOAA 5H8FB 1DPPA 1XT8A 4FAJA 5I84A 1G0HA 3U1OA 1NL5A 1FJ6A 4E0XA 4OENA 2LAOA 3EHTA 3HHGA 3KN7A 2GQ1A 3MAMA 3IB2A 4QHQA 4DE8A 3TZAA 4IO7A 5CBRA 2I6EA 5EYHA 5BUUA 4X8RA 1VFEA 2RF1A 5H8QB 1ZTYA 4NN3A 4JDFA 3TCGA 4POWA 3IORA 1FPIA 3GZGA 4DI3D 1P1UA 2DS9A 2PCRA 4PFYA 1B3EA 2BJIA 4NWCA 5K2YA 3BKIB 2XXRA 5L9MA 3SETA 4X1BA 4ZE8A 3S9NC 5TP9A 4MEVA 5ET8A 1FBPA 1Y3PA 4R6KA 3PPPA 2H5YA 2Z22A 4ZEKA 1MXWA 1MM6A 3RTWB 1RDZA 2QMWA 3IAZA 1YXIA 5IZZA 2XD2A 2Y7WA 2H4IA 1SW1A 3MJNA 3TTKA 4N91A 3LC8A 3A3UA 3K00A 3FASA 3PMWA 3VXBA 1M5FA 1N3XA 4KHZE 2L5VA 5KCJB 2GHBA 1BP5A 3IK6B 2ZNTA 3OSQA 4QFLA 1SI0A 3V8XB 3ISPA 3VLWA 4FORA 1IMFA 2M8CA 1A99A 4BDOA 1VSOA 5A5LA 2E0SA 1CB6A 4UACA 2OK2A 4BDNA 2VGQA 1NH8A 4ZEDA 3BBRA 1EZ9A 1ZJLA 2ZZVA 4G4PA 2XA5A 4R6YA 3UORA 1JEUA 4JXIA 4I62A 3RTFB 4JWXA 2B3FA 4OEVA 3KC1A 4NF4B 2UVJA 1IXCA 4ZEFA 3TDJA 3KC0A 3OXNA 3CFZA 2QS4A 2GHAA 3MBPA 4R74A 2WBDA 2Y5KA 1MXUA 3SEVA 3PPRA 1XS5A 4ESXA 4PC9A 3FXBA 3C32A 4QFKA 2DDKA 3OMBA 2AL5A 4EF2A 1IXGA 1Y20A 3FD3A 4OMBA 2PX1A 2I3VA 3C33A 1KWHA 3K1MA 1DTGA 3OEKA 2QVRA 2QMXA 3OD7A 4JBZA 1FBFA 3W9VA 1FQAA 1DOTA 2VPNA 4DLDA 1AH5A 4R2FA 3FXUA 4PE5B 3TCFA 4RPNA 3PPNA 3O9PA 4I3YA 3VLUA 1NKXA 4KYDA 4I1DA 2V84A 3UK4A 3PD8A 3O6HA 1MQIA 2VOZA 4OEUA 3FXRA 1NUYA 2ZZWA 2QRYA 4GWSA 3LSLA 2UYEA 1YZ0A 4P1EA 2WBBA 5B70A 2G29A 2FVZA 1NV4A 2IA4A 1IMBA 4GL8A 2REJA 3I3VA 4H1XA 4O8MA 1FPGA 4O7IA 1LEVA 3WAFA 3K0VA 1WDNA 1SQYA 4MIJA 3TYHA 1MG1A 2Y7RA 1BLFA 4LZ5A 2VT5A 4JSDA 4KI0E 4E0WA
chains in the Genus database with same CATH topology
2DP8A 3QUFA 5DEXB 5CMBA 1EH3A 2O1LA 3B7DA 2CMOA 3CIJA 3T9XB 4OERA 2THIA 1B3HA 5CMKA 2HQ0A 1RYXA 4OYVA 4G68B 1US5A 1I6QA 4R73A 4ECFA 4Q8RA 1JQFA 2O7UA 3MVYA 1MY4A 2I4CA 4X1DA 2NVUB 4QRZA 3U72A 3LR1A 4JB7A 2ONKE 5AA2A 3OO8A 2F97A 3DP4A 1LBCA 4EQBA 5ITPA 3S9LC 1ATGA 4U21A 4KFQA 4NTLA 4R6HA 3DELB 3SEWA 2B3BA 1NMUA 3Q29A 5AE4A 2NOOA 4M1VA 2UVIA 1FCKA 4IY6A 5M2VA 5AA4A 3KSJA 4HTGA 1OMPA 1S9TA 4F1YA 1LSTA 1R9LA 1UTHB 1H43A 4EXLA 2ZYNA 1QJMA 2XXPA 3FJMA 3IO4A 2VP1A 4JWOA 1ZMGA 2VD2A 1FTJA 3SKPA 1SD3A 1LGBC 3OENA 1NNKA 4NF6A 3K1PA 4M4GA 1URDA 3M3LA 1DPEA 3MWBA 3PMVA 1M5DA 5DVJA 1WVJA 5KDTA 4U1ZA 2REGA 3TQWA 1B0HA 1FQBA 3FV2A 4BDLA 1O7TA 1FTLA 3N94A 3MP8A 3N6TA 5H8NA 4ONYA 2F6PA 2ALUA 4OQOA 4YU0A 4F2QA 2R9JA 2DWAA 4F3SA 2DE2A 4RK2A 4F3BA 2I0CA 5I2KA 1AMFA 3GBAA 1B32A 3RGYA 1XVYA 2PT2A 2PVUA 2ONRA 2F35A 4WKMA 1SDXA 1SVXB 2PMSA 3MP6A 1B51A 3RN8A 1SYIA 3VLVA 4PP0A 1BIYA 1ZKBA 4F39A 4ESWA 3S4UA 1P1NA 3KG2A 3VFJA 1T0KA 5EYFA 5CI5A 1ZU0A 2R6GE 3Q25A 4NF5A 1IIWA 4BDQA 3EHUA 4DZ1A 3KGCA 1B7UA 4O3BA 3KOTA 1Y9UA 4QFOA 3S9EA 4DXUA 3G3HA 2Q8JA 2RC9A 4ZZEA 1A55A 3G3FA 2H99A 1PB7A 4TLMB 4KQPA 4POXA 1N3WA 1HSLA 4KR5A 4G8MA 2V3QA 3B6QA 3PUWE 4NWDA 3G3IA 4FJPA 1MQGA 2OZZA 1I6BA 3T9UA 2DWIA 1JVYA 1AL3A 5I59B 2XXHA 4YKPA 1LFHA 4ELQA 2Y7IA 3THIA 1LCTA 3K4UA 4RA1A 3HPIA 3KSXA 3EF7A 3UGWA 2RC8A 3TAJA 2O7IA 1FQEA 1MY0A 1YPNA 3FGSA 4YB6A 1B3GA 1UIVA 3N26A 2DE4A 5L9OA 3ILTB 3DM0A 2OJTA 3HV1A 4GL0A 4NE4A 4U22A 4U23A 2HZLA 4R72A 5A5XB 2YPNA 5H8SA 4ZECA 3TEPA 3TTLA 4XIGQ 3UP9A 4P11A 1R6ZA 1TWYA 1XVXA 4F18A 5EHSA 4AB5A 3FJGA 5I56A 3G3KA 3TODA 4OHNA 1UQWA 1VE4A 2RC7A 2OWTA 4RPOA 4AB6A 3E3KA 1LB9A 2FA7A 2HAVA 1A8EA 4JSOA 4PFTA 3HO7A 5FTHA 3TQLA 3KBRA 1S50A 1B7ZA 2O68A 4EF1A 1MDP1 3TFLA 1B2HA 4RXLA 4XXUA 4YKKA 4BLAA 1B5IA 5JTYB 5EHMA 5I57A 4QSEA 5F1QA 5ICTA 2ONSA 5DVFA 4G8HA 4C0RA 2QJEA 4IO4A 2V3UA 4Q30B 2H98A 3G7WA 4O3AA 2ZMBA 4U4SA 1QVSA 1TFAA 1ZBMA 4R75A 5CC2A 4IO3A 4RYAA 3FZVA 1PBQA 2XX9A 3LUYA 1IUDA 3ZS6A 1IXHA 3LSWA 3PGFA 2VD3A 4YB7A 2DOJA 1H3DA 1MH3A 1Y4TA 1OQGA 3H6VA 1DMBA 3K1NA 1B1XA 2F34A 3MVXA 3DP6A 1OVBA 3VVDA 3QAXA 2Z8DA 3A09A 5FHMA 2ESNA 3VVFA 4G77A 4EUOA 4G68C 4FEDA 3CSGA 4R9GA 3KN8A 1N7WA 3C36A 5I2NA 3OO6A 3MZ9A 3ILUB 4LP2B 3KZGA 2V93A 4GF8A 3O6GA 5I58B 4C1TA 3FVOA 1IITA 3O2AA 1FTMA 1BKAA 1OVTA 2D3IA 1NH7A 4NF8A 3N6UA 3H6TA 3D4GA 4UA8A 1MXXA 3RY3A 5DTBA 2XX7A 1NFTA 3IJXB 1USYH 3I5OA 3TMGA 4F1VA 5CRYA 3O97A 3M3KA 3OO7A 2DSFA 4U4XA 2OCUA 1VFDA 2A5TB 4GVOA 3H06B 4OFLA 4OVJA 1JW4A 4H67A 3UA8A 3Q27A 4R9FA 3IX1A 3KOSA 3KFMA 5H8HB 2HFBA 4FIMA 3K2DA 1MH4A 4DXCA 3P7IA 2QS3A 1ZLQA 3K01A 3PU5A 2F5XA 4LQ5A 1PB9A 4OFOA 4F19A 2Y7PA 2ZNSA 3CSBA 3JV9A 3IL1B 5H8FA 4KYEA 4HS7A 3T93B 1MY2A 5CBSA 1UTBB 2RINA 1Q35A 4WXJA 3SESA 2D21A 1QW0A 5ITOA 4TQUQ 1LFGA 3TTNA 3I6VA 1Y1MA 1WODA 1OLAA 4GOTA 5H8QA 3EQ1A 3T9HB 3EHSA 4G2ZA 4GD5A 3O66A 1B0LA 1O63A 3ODBA 1PBPA 3TCHA 4XKRA 4LATA 1H45A 1POTA 1PEBA 3M3FA 5L9SA 3CVGA 1MXYA 3K6WA 2I0BA 4H8IA 2R71A 2ZNUA 4GFRA 2GRVA 4KPTA 2XXUA 4BDRA 2Q89A 4OETA 4NEDA 4YKIA 2A5SA 3SEXA 1B58A 3Q28A 5TU0A 1B05A 3ONMA 3OELA 3QK6A 4XKNA 1OLCA 4YMAA 1P1WA 1B5HA 1SW2A 3H7MA 3TTMA 4MBPA 5HM4B 2Q2CA 4OESA 1A40A 5L8DA 3U93A 1B9JA 2X7PA 1DTZA 1B5JA 2I58A 1L5TA 3CI8A 5KCJA 2I3WA 3MZ1A 1TFDA 4KD5A 3PUZE 5HPQA 1D9YA 3MPKA 1N84A 2O51A 4H8JA 4FEBA 1QULA 3VXCA 4DXBA 4NF4A 5I57B 3HHFA 3K6VA 1QUIA 5AA1A 2F78A 3OEMA 3T66A 3DP8A 4K3FA 1B52A 2DWHA 3H3GA 5TP9B 3MQ9A 2XXTA 4P0GA 1Y3QA 1MS7A 3MP1A 1D9VA 1LAGE 1PC3A 3K02A 5FTIA 5TPAA 3E9XA 4N07A 4PFWA 1SW5A 2VHAA 4WEPA 1TXFA 1FTOA 2GFEA 3CFLA 2XXQA 4LVQA 4QFNA 1GGGA 3R6UA 5DVIA 1MDQA 1O64A 1ZIUA 3LSXA 2DVZA 4IGTA 3U92A 1P1QA 3MUQA 3MC2A 1USYE 5IAIA 5IKBA 1JNFA 3FUZA 3F11A 2DYXA 1N0TA 1LCFA 5JK4A 2FYIA 2RCBA 4KCDA 1BTJA 4EXKA 1FQDA 1H44A 3TKDA 1FTKA 3TUSA 4DCYA 3O29A 2QL3A 3BFUA 3VE1B 3V89B 5DEXA 3RUMA 3IO6A 3N5LA 3KN3A 3H6UA 2XXWA 4QSCA 1P99A 2P1SA 3C4MA 3FXQA 1HSEA 4G68A 2ZYKA 5K2XA 2I4BA 3EPEA 3SEYA 1PDAA 4F3PA 2O84X 3B6WA 4DIGA 4I8CA 1A8FA 4G8NA 3E4RA 1N04A 1POY1 3RNNA 3O6IA 3UIFA 1JVXA 4PETA 1Z7NE 3G3GA 2ABHA 3T22A 1LLSA 2V3TA 4DDDA 1F9BA 3TPAA 2HZKA 2X26A 4LZ8A 2OWSA 3CR9A 3ZKKA 1FQCA 1MXZA 2F6GA 1B40A 1QUKA 1OIBA 1UTHA 3RPWA 1B4HA 4RK9A 1R9QA 4YZZA 3A3CA 4QFPA 3UN6A 5HBCA 3VV5A 4N13A 4GLIA 3EN3A 1IQ7A 1URSA 4GWOA 4TLLB 3MW0A 1J1NA 2FNCA 3H4ZA 4ZEBA 2ZXTA 3QXMA 4LUBA 5F7VA 2B65A 2DE3A 2XD3A 2F7AA 4ZE9A 4GXSB 4XKPA 3U94A 5AA2B 3USDA 3PD9A 2UXAA 2QS1A 2XHDA 2YLNA 2NUVA 2Z8EA 1AOVA 5FHOA 3QSLA 4PFUA 1MY3A 1YTVA 2PT1A 1B6HA 1MRPA 5BWJA 3IOTA 4YKJA 4DCXA 4ZDMA 3H03A 2UYFA 1P1OA 1H76A 1URGA 1N7XA 2P0SA 4P0IA 4IGRA 5AA4B 5B7DA 1GV8A 2O6AA 3QIMA 2QSXA 1NNFA 1MPCA 2F7CA 5FHNA 1B3LA 3GXAA 3OSRA 4HCYA 1NNPA 2OLBA 2XXYA 3CG3A 3VVEA 4U1OA 3ZKLA 4F31B 4NF6B 1M5EA 1JW5A 4ZEIA 3QUJA 3D4CA 1DSNA 4MLQA 2DXRA 3IJOB 4OFJA 5KDTB 3Q26A 3C31A 5ELVA 1RYOA 2ZYMA 3TELA 1MQDA 3MVZA 3GLBA 5H8NB 3SEUA 1D4NA 3RLFE 3HN0A 1JETA 3FJ7A 1ELJA 2D5WA 1Y4CA 3KEIA 4MLVA 2F36A 1A54A 5I59A 5AA2D 1FQFA 3JYRA 4O3CA 1Y1ZA 1I69A 5I2KB 3PMXA 4RY1A 2O69A 1II5A 5AA3A 4GRKA 1NNTA 4EQ9A 5TPAB 4L17A 3M8UA 4HCWA 2O1MA 3IB1A 1R1NA 2H9BA 2QS2A 3PV0E 4XTCQ 5A5XA 1Q1KA 1MQHA 1B1HA 3SDFA 5KZTA 1GR2A 4LZ7A 4ELRA 4OTEA 4N6PA 3G3JA 1IXIA 4F29A 4NF5B 3MVWA 4RJZA 1SBPA 4F2OA 2ZYOA 4GQOA 3V5AA 3OO9A 3C35A 1EZOA 2DQVA 3AXFA 2W7YA 4U2RA 2ANJA 4AQ4A 1LFIA 1LAHE 1OQHA 3CG1A 4IO6A 2X7QA 2F8DA 2UVHA 2BJJX 4ZS9A 4LQ2A 1D3KA 2P2AA 1M5BA 4MF3A 4ND9A 3R7XA 1B3FA 2AIXA 1EU8A 3IOVA 3IOWA 3FVNA 4OWDA 1HSJA 5JTYA 2CZLA 4IY5A 3PPOA 4X48A 4Z7EA 4RNSA 1IEJA 4F3GA 1SYHA 2E1SA 4H6DA 3RT6B 1US4A 1JW1A 4TOZA 2PYYA 1M5CA 3V83A 5CM6A 2Y7KA 2XXXA 4KYSA 1QKBA 4LA9A 2I48A 1Z7ME 3K6XA 3W15C 3C34A 3C9HA 5I56B 1CE2A 3LBSA 3E13X 2I49A 2G93A 3MZBA 1UIUA 4R2BA 3WAEA 2Z8FA 3FVKA 2Z23A 3CRBA 3GBBA 4YB5A 3U8QA 3S2VA 3K6UA 1SI1A 3FATA 5DT6A 4FE8A 1XHYA 3LSFB 4ZZAA 3B6TA 1XC1A 2OBGA 4LONB 3H6WA 4ISUA 4XKQA 2KLFA 2XXIA 2XXVA 1EZPA 4YMBA 2XX8A 5I58A 1MXVA 3L6GA 5CMMA 2HEUA 3SERA 3TTRA 1IZ1A 3IR1A 3PUXE 4Q5TA 3RT8A 1RKMA 1MY1A 3CFXA 3MPLA 4H65A 1FW0A 4BDMA 1QKAA 2H25A 4ELOA 1LB8A 5DYHA 4FATA 1SW4A 3HSTA 4WEDA 2A5TA 4PQJA 2NXOA 4IB2A 3ZSFA 4GXAA 4Z0IA 3FIRA 2IEEA 1MQJA 3HCQA 2DWJA 4JWYA 1ANFA 3T96B 1MPDA 2DVCA 4H5GA 1B4ZA 4EDPA 4QSDA 1GVCA 2Q2AA 4F1UA 1MM7A 5H8HA 2Y84A 4YAHX 1LAXA 1LAFE 3VDFA 5ICQA 2HXWA 1XOCA 1JEVA 4OZ9A 5J1DA 2F7BA 4HW8A 4NMYA 3RQTA 2AYSA 4EQ7A 2YJPA 5JEIA 5I2NB 1YCJA 3IB0A 1LBBA 3JZJA 4MH5A 5CMCA 1UTBA 3PUYE 1I6AA 2UVGA 4H0WA 1MPBA 1QUJA 4Q0CA 4NF8B 4C1UA 1B46A 3KJTA 4I9DA 1VR5A 2HCAA 3PUVE 2PBWA 1N76A 1YAEA 2HAUA 3S9MC 4GIZA 4OXVA 1Y3NA 4THIA 3PPQA 1AIVA 3FVGA 4ELPA 1GTKA 1TT1A 4H5FA 2QPQA 4F22A 2V25A 3O28A 4QF9A 3T9VA 2Q88A 4FECA 1A7LA 2RKMA 4IO5A 2NWJA 4KCCA 4X9TA 2AL4A 4MFIA 1S7YA 1PB8A 3IOUA 3KJ7A 2GH9A 2DXYA 3ECRA 2RCAA 4YICA 3W9WA 3L6HA 3DLNA 3FV1A 3QYTA 5LOMA 3R26A 2Q9TA 3BFTA 5ISUA 4IO2A 2WKYA 1B7HA 3OOAA 5H8FB 1DPPA 1XT8A 4FAJA 5I84A 3U1OA 1NL5A 4E0XA 4OENA 2LAOA 3EHTA 3HHGA 3KN7A 3MAMA 3IB2A 4QHQA 4DE8A 3TZAA 4IO7A 5CBRA 2I6EA 5BUUA 1VFEA 2RF1A 5H8QB 1ZTYA 4JDFA 3TCGA 4POWA 3IORA 3GZGA 1P1UA 2DS9A 4PFYA 1B3EA 4NWCA 5K2YA 3BKIB 2XXRA 5L9MA 3SETA 4X1BA 4ZE8A 3S9NC 5TP9A 1Y3PA 4R6KA 3PPPA 2H5YA 2Z22A 4ZEKA 1MXWA 1MM6A 3RTWB 2QMWA 3IAZA 2XD2A 2Y7WA 2H4IA 1SW1A 3MJNA 3TTKA 3LC8A 3A3UA 3K00A 3FASA 3PMWA 3VXBA 1M5FA 1N3XA 4KHZE 5KCJB 2GHBA 1BP5A 3IK6B 2ZNTA 3OSQA 4QFLA 1SI0A 3V8XB 3VLWA 4FORA 2M8CA 1A99A 4BDOA 1VSOA 2E0SA 1CB6A 4UACA 2OK2A 4BDNA 2VGQA 1NH8A 4ZEDA 3BBRA 1EZ9A 1ZJLA 4G4PA 4R6YA 3UORA 1JEUA 4JXIA 4I62A 3RTFB 4JWXA 2B3FA 4OEVA 4NF4B 2UVJA 1IXCA 4ZEFA 3TDJA 3OXNA 3CFZA 2QS4A 2GHAA 3MBPA 4R74A 1MXUA 3SEVA 3PPRA 1XS5A 4ESXA 3C32A 4QFKA 3OMBA 2AL5A 4EF2A 1IXGA 1Y20A 3FD3A 4OMBA 2PX1A 2I3VA 3C33A 1KWHA 3K1MA 1DTGA 3OEKA 2QMXA 3OD7A 4JBZA 3W9VA 1FQAA 1DOTA 4DLDA 1AH5A 4R2FA 3FXUA 4PE5B 3TCFA 4RPNA 3PPNA 3O9PA 3VLUA 1NKXA 4KYDA 4I1DA 2V84A 3UK4A 3PD8A 3O6HA 1MQIA 2VOZA 4OEUA 3FXRA 2QRYA 3LSLA 2UYEA 5B70A 2G29A 2IA4A 4GL8A 2REJA 3I3VA 4H1XA 3WAFA 3K0VA 1WDNA 1SQYA 3TYHA 1MG1A 2Y7RA 1BLFA 4LZ5A 4JSDA 4KI0E 4E0WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DP8 A;  3QUF A;  5DEX B;  5CMB A;  1EH3 A;  2O1L A;  3B7D A;  2CMO A;  3CIJ A;  3T9X B;  4OER A;  2THI A;  1B3H A;  5CMK A;  2HQ0 A;  1RYX A;  4OYV A;  4G68 B;  1US5 A;  1I6Q A;  4R73 A;  4ECF A;  4Q8R A;  1JQF A;  2O7U A;  3MVY A;  1MY4 A;  2I4C A;  4X1D A;  2NVU B;  4QRZ A;  3U72 A;  3LR1 A;  4JB7 A;  2ONK E;  5AA2 A;  3OO8 A;  2F97 A;  3DP4 A;  1LBC A;  4EQB A;  5ITP A;  3S9L C;  1ATG A;  4U21 A;  4KFQ A;  4NTL A;  4R6H A;  3DEL B;  3SEW A;  2B3B A;  1NMU A;  3Q29 A;  5AE4 A;  2NOO A;  4M1V A;  2UVI A;  1FCK A;  4IY6 A;  5M2V A;  5AA4 A;  3KSJ A;  4HTG A;  1OMP A;  1S9T A;  4F1Y A;  1LST A;  1R9L A;  1UTH B;  1H43 A;  4EXL A;  2ZYN A;  1QJM A;  2XXP A;  3FJM A;  3IO4 A;  2VP1 A;  4JWO A;  1ZMG A;  2VD2 A;  1FTJ A;  3SKP A;  1SD3 A;  1LGB C;  3OEN A;  1NNK A;  4NF6 A;  3K1P A;  4M4G A;  1URD A;  3M3L A;  1DPE A;  3MWB A;  3PMV A;  1M5D A;  5DVJ A;  1WVJ A;  5KDT A;  4U1Z A;  2REG A;  3TQW A;  1B0H A;  1FQB A;  3FV2 A;  4BDL A;  1O7T A;  1FTL A;  3N94 A;  3MP8 A;  3N6T A;  5H8N A;  4ONY A;  2F6P A;  2ALU A;  4OQO A;  4YU0 A;  4F2Q A;  2R9J A;  2DWA A;  4F3S A;  2DE2 A;  4RK2 A;  4F3B A;  2I0C A;  5I2K A;  1AMF A;  3GBA A;  1B32 A;  3RGY A;  1XVY A;  2PT2 A;  2PVU A;  2ONR A;  2F35 A;  4WKM A;  1SDX A;  1SVX B;  2PMS A;  3MP6 A;  1B51 A;  3RN8 A;  1SYI A;  3VLV A;  4PP0 A;  1BIY A;  1ZKB A;  4F39 A;  4ESW A;  3S4U A;  1P1N A;  3KG2 A;  3VFJ A;  1T0K A;  5EYF A;  5CI5 A;  1ZU0 A;  2R6G E;  3Q25 A;  4NF5 A;  1IIW A;  4BDQ A;  3EHU A;  4DZ1 A;  3KGC A;  1B7U A;  4O3B A;  3KOT A;  1Y9U A;  4QFO A;  3S9E A;  4DXU A;  3G3H A;  2Q8J A;  2RC9 A;  4ZZE A;  1A55 A;  3G3F A;  2H99 A;  1PB7 A;  4TLM B;  4KQP A;  4POX A;  1N3W A;  1HSL A;  4KR5 A;  4G8M A;  2V3Q A;  3B6Q A;  3PUW E;  4NWD A;  3G3I A;  4FJP A;  1MQG A;  2OZZ A;  1I6B A;  3T9U A;  2DWI A;  1JVY A;  1AL3 A;  5I59 B;  2XXH A;  4YKP A;  1LFH A;  4ELQ A;  2Y7I A;  3THI A;  1LCT A;  3K4U A;  4RA1 A;  3HPI A;  3KSX A;  3EF7 A;  3UGW A;  2RC8 A;  3TAJ A;  2O7I A;  1FQE A;  1MY0 A;  1YPN A;  3FGS A;  4YB6 A;  1B3G A;  1UIV A;  3N26 A;  2DE4 A;  5L9O A;  3ILT B;  3DM0 A;  2OJT A;  3HV1 A;  4GL0 A;  4NE4 A;  4U22 A;  4U23 A;  2HZL A;  4R72 A;  5A5X B;  2YPN A;  5H8S A;  4ZEC A;  3TEP A;  3TTL A;  4XIG Q;  3UP9 A;  4P11 A;  1R6Z A;  1TWY A;  1XVX A;  4F18 A;  5EHS A;  4AB5 A;  3FJG A;  5I56 A;  3G3K A;  3TOD A;  4OHN A;  1UQW A;  1VE4 A;  2RC7 A;  2OWT A;  4RPO A;  4AB6 A;  3E3K A;  1LB9 A;  2FA7 A;  2HAV A;  1A8E A;  4JSO A;  4PFT A;  3HO7 A;  5FTH A;  3TQL A;  3KBR A;  1S50 A;  1B7Z A;  2O68 A;  4EF1 A;  1MDP 1;  3TFL A;  1B2H A;  4RXL A;  4XXU A;  4YKK A;  4BLA A;  1B5I A;  5JTY B;  5EHM A;  5I57 A;  4QSE A;  5F1Q A;  5ICT A;  2ONS A;  5DVF A;  4G8H A;  4C0R A;  2QJE A;  4IO4 A;  2V3U A;  4Q30 B;  2H98 A;  3G7W A;  4O3A A;  2ZMB A;  4U4S A;  1QVS A;  1TFA A;  1ZBM A;  4R75 A;  5CC2 A;  4IO3 A;  4RYA A;  3FZV A;  1PBQ A;  2XX9 A;  3LUY A;  1IUD A;  3ZS6 A;  1IXH A;  3LSW A;  3PGF A;  2VD3 A;  4YB7 A;  2DOJ A;  1H3D A;  1MH3 A;  1Y4T A;  1OQG A;  3H6V A;  1DMB A;  3K1N A;  1B1X A;  2F34 A;  3MVX A;  3DP6 A;  1OVB A;  3VVD A;  3QAX A;  2Z8D A;  3A09 A;  5FHM A;  2ESN A;  3VVF A;  4G77 A;  4EUO A;  4G68 C;  4FED A;  3CSG A;  4R9G A;  3KN8 A;  1N7W A;  3C36 A;  5I2N A;  3OO6 A;  3MZ9 A;  3ILU B;  4LP2 B;  3KZG A;  2V93 A;  4GF8 A;  3O6G A;  5I58 B;  4C1T A;  3FVO A;  1IIT A;  3O2A A;  1FTM A;  1BKA A;  1OVT A;  2D3I A;  1NH7 A;  4NF8 A;  3N6U A;  3H6T A;  3D4G A;  4UA8 A;  1MXX A;  3RY3 A;  5DTB A;  2XX7 A;  1NFT A;  3IJX B;  1USY H;  3I5O A;  3TMG A;  4F1V A;  5CRY A;  3O97 A;  3M3K A;  3OO7 A;  2DSF A;  4U4X A;  2OCU A;  1VFD A;  2A5T B;  4GVO A;  3H06 B;  4OFL A;  4OVJ A;  1JW4 A;  4H67 A;  3UA8 A;  3Q27 A;  4R9F A;  3IX1 A;  3KOS A;  3KFM A;  5H8H B;  2HFB A;  4FIM A;  3K2D A;  1MH4 A;  4DXC A;  3P7I A;  2QS3 A;  1ZLQ A;  3K01 A;  3PU5 A;  2F5X A;  4LQ5 A;  1PB9 A;  4OFO A;  4F19 A;  2Y7P A;  2ZNS A;  3CSB A;  3JV9 A;  3IL1 B;  5H8F A;  4KYE A;  4HS7 A;  3T93 B;  1MY2 A;  5CBS A;  1UTB B;  2RIN A;  1Q35 A;  4WXJ A;  3SES A;  2D21 A;  1QW0 A;  5ITO A;  4TQU Q;  1LFG A;  3TTN A;  3I6V A;  1Y1M A;  1WOD A;  1OLA A;  4GOT A;  5H8Q A;  3EQ1 A;  3T9H B;  3EHS A;  4G2Z A;  4GD5 A;  3O66 A;  1B0L A;  1O63 A;  3ODB A;  1PBP A;  3TCH A;  4XKR A;  4LAT A;  1H45 A;  1POT A;  1PEB A;  3M3F A;  5L9S A;  3CVG A;  1MXY A;  3K6W A;  2I0B A;  4H8I A;  2R71 A;  2ZNU A;  4GFR A;  2GRV A;  4KPT A;  2XXU A;  4BDR A;  2Q89 A;  4OET A;  4NED A;  4YKI A;  2A5S A;  3SEX A;  1B58 A;  3Q28 A;  5TU0 A;  1B05 A;  3ONM A;  3OEL A;  3QK6 A;  4XKN A;  1OLC A;  4YMA A;  1P1W A;  1B5H A;  1SW2 A;  3H7M A;  3TTM A;  4MBP A;  5HM4 B;  2Q2C A;  4OES A;  1A40 A;  5L8D A;  3U93 A;  1B9J A;  2X7P A;  1DTZ A;  1B5J A;  2I58 A;  1L5T A;  3CI8 A;  5KCJ A;  2I3W A;  3MZ1 A;  1TFD A;  4KD5 A;  3PUZ E;  5HPQ A;  1D9Y A;  3MPK A;  1N84 A;  2O51 A;  4H8J A;  4FEB A;  1QUL A;  3VXC A;  4DXB A;  4NF4 A;  5I57 B;  3HHF A;  3K6V A;  1QUI A;  5AA1 A;  2F78 A;  3OEM A;  3T66 A;  3DP8 A;  4K3F A;  1B52 A;  2DWH A;  3H3G A;  5TP9 B;  3MQ9 A;  2XXT A;  4P0G A;  1Y3Q A;  1MS7 A;  3MP1 A;  1D9V A;  1LAG E;  1PC3 A;  3K02 A;  5FTI A;  5TPA A;  3E9X A;  4N07 A;  4PFW A;  1SW5 A;  2VHA A;  4WEP A;  1TXF A;  1FTO A;  2GFE A;  3CFL A;  2XXQ A;  4LVQ A;  4QFN A;  1GGG A;  3R6U A;  5DVI A;  1MDQ A;  1O64 A;  1ZIU A;  3LSX A;  2DVZ A;  4IGT A;  3U92 A;  1P1Q A;  3MUQ A;  3MC2 A;  1USY E;  5IAI A;  5IKB A;  1JNF A;  3FUZ A;  3F11 A;  2DYX A;  1N0T A;  1LCF A;  5JK4 A;  2FYI A;  2RCB A;  4KCD A;  1BTJ A;  4EXK A;  1FQD A;  1H44 A;  3TKD A;  1FTK A;  3TUS A;  4DCY A;  3O29 A;  2QL3 A;  3BFU A;  3VE1 B;  3V89 B;  5DEX A;  3RUM A;  3IO6 A;  3N5L A;  3KN3 A;  3H6U A;  2XXW A;  4QSC A;  1P99 A;  2P1S A;  3C4M A;  3FXQ A;  1HSE A;  4G68 A;  2ZYK A;  5K2X A;  2I4B A;  3EPE A;  3SEY A;  1PDA A;  4F3P A;  2O84 X;  3B6W A;  4DIG A;  4I8C A;  1A8F A;  4G8N A;  3E4R A;  1N04 A;  1POY 1;  3RNN A;  3O6I A;  3UIF A;  1JVX A;  4PET A;  1Z7N E;  3G3G A;  2ABH A;  3T22 A;  1LLS A;  2V3T A;  4DDD A;  1F9B A;  3TPA A;  2HZK A;  2X26 A;  4LZ8 A;  2OWS A;  3CR9 A;  3ZKK A;  1FQC A;  1MXZ A;  2F6G A;  1B40 A;  1QUK A;  1OIB A;  1UTH A;  3RPW A;  1B4H A;  4RK9 A;  1R9Q A;  4YZZ A;  3A3C A;  4QFP A;  3UN6 A;  5HBC A;  3VV5 A;  4N13 A;  4GLI A;  3EN3 A;  1IQ7 A;  1URS A;  4GWO A;  4TLL B;  3MW0 A;  1J1N A;  2FNC A;  3H4Z A;  4ZEB A;  2ZXT A;  3QXM A;  4LUB A;  5F7V A;  2B65 A;  2DE3 A;  2XD3 A;  2F7A A;  4ZE9 A;  4GXS B;  4XKP A;  3U94 A;  5AA2 B;  3USD A;  3PD9 A;  2UXA A;  2QS1 A;  2XHD A;  2YLN A;  2NUV A;  2Z8E A;  1AOV A;  5FHO A;  3QSL A;  4PFU A;  1MY3 A;  1YTV A;  2PT1 A;  1B6H A;  1MRP A;  5BWJ A;  3IOT A;  4YKJ A;  4DCX A;  4ZDM A;  3H03 A;  2UYF A;  1P1O A;  1H76 A;  1URG A;  1N7X A;  2P0S A;  4P0I A;  4IGR A;  5AA4 B;  5B7D A;  1GV8 A;  2O6A A;  3QIM A;  2QSX A;  1NNF A;  1MPC A;  2F7C A;  5FHN A;  1B3L A;  3GXA A;  3OSR A;  4HCY A;  1NNP A;  2OLB A;  2XXY A;  3CG3 A;  3VVE A;  4U1O A;  3ZKL A;  4F31 B;  4NF6 B;  1M5E A;  1JW5 A;  4ZEI A;  3QUJ A;  3D4C A;  1DSN A;  4MLQ A;  2DXR A;  3IJO B;  4OFJ A;  5KDT B;  3Q26 A;  3C31 A;  5ELV A;  1RYO A;  2ZYM A;  3TEL A;  1MQD A;  3MVZ A;  3GLB A;  5H8N B;  3SEU A;  1D4N A;  3RLF E;  3HN0 A;  1JET A;  3FJ7 A;  1ELJ A;  2D5W A;  1Y4C A;  3KEI A;  4MLV A;  2F36 A;  1A54 A;  5I59 A;  5AA2 D;  1FQF A;  3JYR A;  4O3C A;  1Y1Z A;  1I69 A;  5I2K B;  3PMX A;  4RY1 A;  2O69 A;  1II5 A;  5AA3 A;  4GRK A;  1NNT A;  4EQ9 A;  5TPA B;  4L17 A;  3M8U A;  4HCW A;  2O1M A;  3IB1 A;  1R1N A;  2H9B A;  2QS2 A;  3PV0 E;  4XTC Q;  5A5X A;  1Q1K A;  1MQH A;  1B1H A;  3SDF A;  5KZT A;  1GR2 A;  4LZ7 A;  4ELR A;  4OTE A;  4N6P A;  3G3J A;  1IXI A;  4F29 A;  4NF5 B;  3MVW A;  4RJZ A;  1SBP A;  4F2O A;  2ZYO A;  4GQO A;  3V5A A;  3OO9 A;  3C35 A;  1EZO A;  2DQV A;  3AXF A;  2W7Y A;  4U2R A;  2ANJ A;  4AQ4 A;  1LFI A;  1LAH E;  1OQH A;  3CG1 A;  4IO6 A;  2X7Q A;  2F8D A;  2UVH A;  2BJJ X;  4ZS9 A;  4LQ2 A;  1D3K A;  2P2A A;  1M5B A;  4MF3 A;  4ND9 A;  3R7X A;  1B3F A;  2AIX A;  1EU8 A;  3IOV A;  3IOW A;  3FVN A;  4OWD A;  1HSJ A;  5JTY A;  2CZL A;  4IY5 A;  3PPO A;  4X48 A;  4Z7E A;  4RNS A;  1IEJ A;  4F3G A;  1SYH A;  2E1S A;  4H6D A;  3RT6 B;  1US4 A;  1JW1 A;  4TOZ A;  2PYY A;  1M5C A;  3V83 A;  5CM6 A;  2Y7K A;  2XXX A;  4KYS A;  1QKB A;  4LA9 A;  2I48 A;  1Z7M E;  3K6X A;  3W15 C;  3C34 A;  3C9H A;  5I56 B;  1CE2 A;  3LBS A;  3E13 X;  2I49 A;  2G93 A;  3MZB A;  1UIU A;  4R2B A;  3WAE A;  2Z8F A;  3FVK A;  2Z23 A;  3CRB A;  3GBB A;  4YB5 A;  3U8Q A;  3S2V A;  3K6U A;  1SI1 A;  3FAT A;  5DT6 A;  4FE8 A;  1XHY A;  3LSF B;  4ZZA A;  3B6T A;  1XC1 A;  2OBG A;  4LON B;  3H6W A;  4ISU A;  4XKQ A;  2KLF A;  2XXI A;  2XXV A;  1EZP A;  4YMB A;  2XX8 A;  5I58 A;  1MXV A;  3L6G A;  5CMM A;  2HEU A;  3SER A;  3TTR A;  1IZ1 A;  3IR1 A;  3PUX E;  4Q5T A;  3RT8 A;  1RKM A;  1MY1 A;  3CFX A;  3MPL A;  4H65 A;  1FW0 A;  4BDM A;  1QKA A;  2H25 A;  4ELO A;  1LB8 A;  5DYH A;  4FAT A;  1SW4 A;  3HST A;  4WED A;  2A5T A;  4PQJ A;  2NXO A;  4IB2 A;  3ZSF A;  4GXA A;  4Z0I A;  3FIR A;  2IEE A;  1MQJ A;  3HCQ A;  2DWJ A;  4JWY A;  1ANF A;  3T96 B;  1MPD A;  2DVC A;  4H5G A;  1B4Z A;  4EDP A;  4QSD A;  1GVC A;  2Q2A A;  4F1U A;  1MM7 A;  5H8H A;  2Y84 A;  4YAH X;  1LAX A;  1LAF E;  3VDF A;  5ICQ A;  2HXW A;  1XOC A;  1JEV A;  4OZ9 A;  5J1D A;  2F7B A;  4HW8 A;  4NMY A;  3RQT A;  2AYS A;  4EQ7 A;  2YJP A;  5JEI A;  5I2N B;  1YCJ A;  3IB0 A;  1LBB A;  3JZJ A;  4MH5 A;  5CMC A;  1UTB A;  3PUY E;  1I6A A;  2UVG A;  4H0W A;  1MPB A;  1QUJ A;  4Q0C A;  4NF8 B;  4C1U A;  1B46 A;  3KJT A;  4I9D A;  1VR5 A;  2HCA A;  3PUV E;  2PBW A;  1N76 A;  1YAE A;  2HAU A;  3S9M C;  4GIZ A;  4OXV A;  1Y3N A;  4THI A;  3PPQ A;  1AIV A;  3FVG A;  4ELP A;  1GTK A;  1TT1 A;  4H5F A;  2QPQ A;  4F22 A;  2V25 A;  3O28 A;  4QF9 A;  3T9V A;  2Q88 A;  4FEC A;  1A7L A;  2RKM A;  4IO5 A;  2NWJ A;  4KCC A;  4X9T A;  2AL4 A;  4MFI A;  1S7Y A;  1PB8 A;  3IOU A;  3KJ7 A;  2GH9 A;  2DXY A;  3ECR A;  2RCA A;  4YIC A;  3W9W A;  3L6H A;  3DLN A;  3FV1 A;  3QYT A;  5LOM A;  3R26 A;  2Q9T A;  3BFT A;  5ISU A;  4IO2 A;  2WKY A;  1B7H A;  3OOA A;  5H8F B;  1DPP A;  1XT8 A;  4FAJ A;  5I84 A;  3U1O A;  1NL5 A;  4E0X A;  4OEN A;  2LAO A;  3EHT A;  3HHG A;  3KN7 A;  3MAM A;  3IB2 A;  4QHQ A;  4DE8 A;  3TZA A;  4IO7 A;  5CBR A;  2I6E A;  5BUU A;  1VFE A;  2RF1 A;  5H8Q B;  1ZTY A;  4JDF A;  3TCG A;  4POW A;  3IOR A;  3GZG A;  1P1U A;  2DS9 A;  4PFY A;  1B3E A;  4NWC A;  5K2Y A;  3BKI B;  2XXR A;  5L9M A;  3SET A;  4X1B A;  4ZE8 A;  3S9N C;  5TP9 A;  1Y3P A;  4R6K A;  3PPP A;  2H5Y A;  2Z22 A;  4ZEK A;  1MXW A;  1MM6 A;  3RTW B;  2QMW A;  3IAZ A;  2XD2 A;  2Y7W A;  2H4I A;  1SW1 A;  3MJN A;  3TTK A;  3LC8 A;  3A3U A;  3K00 A;  3FAS A;  3PMW A;  3VXB A;  1M5F A;  1N3X A;  4KHZ E;  5KCJ B;  2GHB A;  1BP5 A;  3IK6 B;  2ZNT A;  3OSQ A;  4QFL A;  1SI0 A;  3V8X B;  3VLW A;  4FOR A;  2M8C A;  1A99 A;  4BDO A;  1VSO A;  2E0S A;  1CB6 A;  4UAC A;  2OK2 A;  4BDN A;  2VGQ A;  1NH8 A;  4ZED A;  3BBR A;  1EZ9 A;  1ZJL A;  4G4P A;  4R6Y A;  3UOR A;  1JEU A;  4JXI A;  4I62 A;  3RTF B;  4JWX A;  2B3F A;  4OEV A;  4NF4 B;  2UVJ A;  1IXC A;  4ZEF A;  3TDJ A;  3OXN A;  3CFZ A;  2QS4 A;  2GHA A;  3MBP A;  4R74 A;  1MXU A;  3SEV A;  3PPR A;  1XS5 A;  4ESX A;  3C32 A;  4QFK A;  3OMB A;  2AL5 A;  4EF2 A;  1IXG A;  1Y20 A;  3FD3 A;  4OMB A;  2PX1 A;  2I3V A;  3C33 A;  1KWH A;  3K1M A;  1DTG A;  3OEK A;  2QMX A;  3OD7 A;  4JBZ A;  3W9V A;  1FQA A;  1DOT A;  4DLD A;  1AH5 A;  4R2F A;  3FXU A;  4PE5 B;  3TCF A;  4RPN A;  3PPN A;  3O9P A;  3VLU A;  1NKX A;  4KYD A;  4I1D A;  2V84 A;  3UK4 A;  3PD8 A;  3O6H A;  1MQI A;  2VOZ A;  4OEU A;  3FXR A;  2QRY A;  3LSL A;  2UYE A;  5B70 A;  2G29 A;  2IA4 A;  4GL8 A;  2REJ A;  3I3V A;  4H1X A;  3WAF A;  3K0V A;  1WDN A;  1SQY A;  3TYH A;  1MG1 A;  2Y7R A;  1BLF A;  4LZ5 A;  4JSD A;  4KI0 E;  4E0W A; 
#chains in the Genus database with same CATH topology
 2DP8 A;  3QUF A;  5DEX B;  5CMB A;  1EH3 A;  2O1L A;  3B7D A;  2CMO A;  3CIJ A;  5EQ8 A;  3T9X B;  4OER A;  2THI A;  1B3H A;  5CMK A;  2HQ0 A;  1RYX A;  4OYV A;  4G68 B;  1US5 A;  1I6Q A;  4R73 A;  4NF0 A;  4ECF A;  4Q8R A;  1JQF A;  2O7U A;  3MVY A;  1MY4 A;  2I4C A;  4X1D A;  2NVU B;  4QRZ A;  3FBP A;  3U72 A;  3LR1 A;  4JB7 A;  2ONK E;  5AA2 A;  3OO8 A;  2F97 A;  3DP4 A;  4LN5 A;  1FRP A;  4PE3 A;  1LBC A;  3MYU A;  4EQB A;  5ITP A;  3S9L C;  1ATG A;  4U21 A;  4HE2 A;  4KFQ A;  5F24 A;  4NTL A;  4R6H A;  2QFL A;  3DEL B;  3SEW A;  2B3B A;  1NMU A;  4GWU A;  3Q29 A;  3GYY A;  5AE4 A;  2NOO A;  4M1V A;  2UVI A;  1FCK A;  4PAK A;  4IY6 A;  5M2V A;  5AA4 A;  3KSJ A;  4HTG A;  1OMP A;  1YYZ A;  1S9T A;  4F1Y A;  4GWW A;  1LST A;  2HXR A;  4KXP A;  1R9L A;  1UTH B;  1H43 A;  4EXL A;  2ZYN A;  1QJM A;  2XXP A;  4MNC A;  3FJM A;  3IO4 A;  2VP1 A;  2B4M A;  4JWO A;  1ZMG A;  2VD2 A;  1FTJ A;  3SKP A;  1SD3 A;  4MX6 A;  1LGB C;  3OEN A;  1NNK A;  4NF6 A;  3K1P A;  4M4G A;  1URD A;  3M3L A;  1DPE A;  3MWB A;  3PMV A;  4UAB A;  1M5D A;  4HE0 A;  5DVJ A;  1WVJ A;  5KDT A;  4U1Z A;  2REG A;  3TQW A;  1B0H A;  1FQB A;  3FV2 A;  4BDL A;  1O7T A;  1FTL A;  3N94 A;  3MP8 A;  3N6T A;  5H8N A;  4ONY A;  2F6P A;  2ALU A;  2XWV A;  3QMF A;  4I40 A;  4MMP A;  2CZK A;  4OQO A;  4YU0 A;  4F2Q A;  2R9J A;  2DWA A;  4F3S A;  2DE2 A;  4RK2 A;  4F3B A;  2I0C A;  5I2K A;  1AMF A;  3GBA A;  1B32 A;  3E78 A;  3RGY A;  1XVY A;  2PT2 A;  2PVU A;  3B50 A;  2ONR A;  2F35 A;  4WKM A;  1SDX A;  1SVX B;  2WYP A;  2PMS A;  3MP6 A;  1B51 A;  3RN8 A;  2Q74 A;  1SYI A;  3VLV A;  4PP0 A;  1BIY A;  1KZ8 A;  1ZKB A;  4F39 A;  4ESW A;  3S4U A;  1IMC A;  1P1N A;  2CZI A;  3KG2 A;  3VFJ A;  1T0K A;  4DI4 B;  5EYF A;  5CI5 A;  1ZU0 A;  2R6G E;  3Q25 A;  4NF5 A;  1IIW A;  4BDQ A;  4IR8 A;  3EHU A;  4DZ1 A;  3KGC A;  1B7U A;  4O3B A;  3KOT A;  1NUW A;  1Y9U A;  4QFO A;  3S9E A;  4DXU A;  1NI9 A;  3G3H A;  2Q8J A;  2RC9 A;  4N6D A;  4ZZE A;  1A55 A;  2CZH A;  2H99 A;  3G3F A;  1PB7 A;  4TLM B;  4KQP A;  4POX A;  1N3W A;  1HSL A;  4KR5 A;  4G8M A;  5J16 A;  2V3Q A;  3B6Q A;  3PUW E;  4NWD A;  4MAG A;  3G3I A;  4FJP A;  1MQG A;  2OZZ A;  1I6B A;  3T9U A;  2DWI A;  3LV0 A;  1JVY A;  1AL3 A;  5I59 B;  2XXH A;  4YKP A;  1LFH A;  4ELQ A;  2Y7I A;  3THI A;  1LCT A;  3K4U A;  1EYJ A;  2FBP A;  4RA1 A;  3HPI A;  3KSX A;  3EF7 A;  3UGW A;  2RC8 A;  1LBZ A;  3TAJ A;  2O7I A;  1FQE A;  1MY0 A;  1YPN A;  3FGS A;  4YB6 A;  1B3G A;  1UIV A;  3N26 A;  2DE4 A;  5L9O A;  3ILT B;  3DM0 A;  2OJT A;  3HV1 A;  4GL0 A;  4NE4 A;  4U22 A;  4U23 A;  2HZL A;  4R72 A;  5LDZ A;  5A5X B;  2YPN A;  4O94 A;  5H8S A;  4ZEC A;  3TEP A;  3TTL A;  4XIG Q;  3UP9 A;  1XI6 A;  4P11 A;  1LBY A;  1R6Z A;  1TWY A;  1XVX A;  4F18 A;  5EHS A;  4AB5 A;  3FJG A;  5I56 A;  3G3K A;  3TOD A;  4OHN A;  4OA4 A;  1UQW A;  1VE4 A;  2RC7 A;  2OWT A;  4RPO A;  4AB6 A;  3E3K A;  1LB9 A;  2FA7 A;  2HAV A;  1A8E A;  1BK4 A;  4JSO A;  4PFT A;  3HO7 A;  5FTH A;  3TQL A;  3KBR A;  1S50 A;  1B7Z A;  3IFC A;  2O68 A;  3KBZ A;  4EF1 A;  4PBH A;  1MDP 1;  3TFL A;  1B2H A;  1NV3 A;  4RXL A;  4XXU A;  4YKK A;  1FBE A;  4BLA A;  1B5I A;  5JTY B;  5EHM A;  5I57 A;  4G61 A;  4QSE A;  3RPL A;  5F1Q A;  1LBV A;  5ICT A;  2ONS A;  5DVF A;  4G8H A;  4C0R A;  2QJE A;  4IO4 A;  2V3U A;  4Q30 B;  2H98 A;  3G7W A;  4O3A A;  2ZMB A;  4U4S A;  1QVS A;  1TFA A;  1ZBM A;  4R75 A;  5CC2 A;  1LBW A;  4IO3 A;  4RYA A;  3FZV A;  4N81 A;  1PBQ A;  2XX9 A;  2XWO A;  3LUY A;  1IUD A;  3ZS6 A;  1IXH A;  3LSW A;  3PGF A;  2VD3 A;  4YB7 A;  2DOJ A;  1H3D A;  2PFY A;  1MH3 A;  1Y4T A;  4JVI A;  1OQG A;  3H6V A;  1DMB A;  3K1N A;  1B1X A;  2F34 A;  3MVX A;  3DP6 A;  1OVB A;  3VVD A;  3QAX A;  2Z8D A;  3A09 A;  5FHM A;  2FIE A;  2ESN A;  3VVF A;  4G77 A;  4EUO A;  4G68 C;  4FED A;  3CSG A;  4R9G A;  3KN8 A;  1N7W A;  3C36 A;  2Q8M A;  5I2N A;  3OO6 A;  3MZ9 A;  3ILU B;  4LP2 B;  3KZG A;  2V93 A;  4GF8 A;  4OVS A;  3O6G A;  5I58 B;  4C1T A;  3FVO A;  2QVV A;  1IIT A;  3O2A A;  1FTM A;  1BKA A;  1NV6 A;  1OVT A;  2D3I A;  1NH7 A;  2P3N A;  4NF8 A;  5IZ1 A;  3N6U A;  3H6T A;  4PF8 A;  3D4G A;  4UA8 A;  1MXX A;  3RY3 A;  5DTB A;  2XX7 A;  1NFT A;  3IJX B;  1USY H;  3I5O A;  3TMG A;  4F1V A;  3EKI A;  5CRY A;  3O97 A;  3M3K A;  4AS4 A;  3OO7 A;  2DSF A;  4U4X A;  2OCU A;  1VFD A;  2A5T B;  4GVO A;  3H06 B;  1FBC A;  4OFL A;  4OVJ A;  1JW4 A;  4H67 A;  4OVP A;  3UA8 A;  3Q27 A;  4R9F A;  3IX1 A;  3KOS A;  3KFM A;  2HHM A;  5H8H B;  3PTY A;  2HFB A;  4FIM A;  3K2D A;  2OWZ A;  1MH4 A;  4DXC A;  3P7I A;  2QS3 A;  1ZLQ A;  3K01 A;  3PU5 A;  4HE1 A;  2F5X A;  4LQ5 A;  1PB9 A;  4OFO A;  5EQ7 A;  4F19 A;  2Y7P A;  2ZNS A;  3CSB A;  4XF5 A;  5LTC A;  3JV9 A;  3IL1 B;  5H8F A;  4KYE A;  4HS7 A;  3T93 B;  1MY2 A;  1NV1 A;  5CBS A;  1UTB B;  2CEX A;  2RIN A;  1Q35 A;  4GWZ A;  4WXJ A;  3SES A;  2D21 A;  1QW0 A;  5ITO A;  4X04 A;  4TQU Q;  1LFG A;  3TTN A;  3I6V A;  1Y1M A;  3U65 A;  1WOD A;  1OLA A;  4GOT A;  5H8Q A;  3EQ1 A;  3T9H B;  3EHS A;  4G2Z A;  4GD5 A;  3O66 A;  2XXK A;  4NQ8 A;  4GWY A;  2XWK A;  1B0L A;  1O63 A;  4PFR A;  3ODB A;  1PBP A;  1IMD A;  3TCH A;  4XKR A;  4LAT A;  1H45 A;  1POT A;  1PEB A;  3M3F A;  5L9S A;  3CVG A;  1MXY A;  3K6W A;  2I0B A;  4H8I A;  2R71 A;  2ZNU A;  4GFR A;  2GRV A;  4KPT A;  2XXU A;  4BDR A;  2Q89 A;  5IZ3 B;  4OET A;  4NED A;  4YKI A;  1RDX A;  2A5S A;  3SEX A;  1B58 A;  3Q28 A;  5TU0 A;  1FPB A;  1B05 A;  1EYI A;  3ONM A;  3OEL A;  3QK6 A;  4XKN A;  1OLC A;  4YMA A;  1P1W A;  2Y5L A;  1B5H A;  1SW2 A;  3H7M A;  3TTM A;  5I3S A;  4MBP A;  5HM4 B;  2Q2C A;  4OES A;  1A40 A;  2MKZ A;  5L8D A;  3U93 A;  1B9J A;  2X7P A;  1DTZ A;  1B5J A;  2I58 A;  1L5T A;  3CI8 A;  5KCJ A;  2I3W A;  1LBX A;  3MZ1 A;  1TFD A;  1EYK A;  4KD5 A;  3PUZ E;  1IMA A;  5HPQ A;  1D9Y A;  3MPK A;  1N84 A;  1SPI A;  3BIH A;  2O51 A;  4H8J A;  4FEB A;  1QUL A;  3VXC A;  4DXB A;  4NF4 A;  4QXD A;  5I57 B;  5I5P A;  3HHF A;  3K6V A;  1QUI A;  5AA1 A;  2F78 A;  3OEM A;  3T66 A;  4P9K A;  3DP8 A;  5EQA A;  4K3F A;  1B52 A;  2DWH A;  3H3G A;  5TP9 B;  3MQ9 A;  2XXT A;  4P0G A;  5EYG A;  3E79 A;  4NX1 A;  1Y3Q A;  1MS7 A;  3MP1 A;  1D9V A;  1LAG E;  4PCD A;  1PC3 A;  3K02 A;  1NUZ A;  5FTI A;  4FBP A;  1DBZ A;  5TPA A;  2WEF A;  3E9X A;  4N07 A;  1NUX A;  4PFW A;  4PTK A;  4NAP A;  1SW5 A;  2VHA A;  2KQZ A;  3CHG A;  4WEP A;  1TXF A;  1FTO A;  2GFE A;  3CFL A;  2XXQ A;  4LVQ A;  4QFN A;  1GGG A;  3R6U A;  3SZP A;  5DVI A;  1MDQ A;  1O64 A;  1ZIU A;  3LSX A;  2DVZ A;  1NV7 A;  4IGT A;  3U92 A;  1P1Q A;  3MUQ A;  3MC2 A;  1USY E;  4XFE A;  5IAI A;  5IKB A;  1JNF A;  3FUZ A;  3B8B A;  3F11 A;  2DYX A;  1N0T A;  1LCF A;  5JK4 A;  2FYI A;  1K9Y A;  2RCB A;  4KCD A;  1BTJ A;  3T0J A;  4EXK A;  1FBH A;  1FQD A;  1H44 A;  3TKD A;  1FTK A;  1FTA A;  3TUS A;  4DCY A;  3O29 A;  2QL3 A;  3BFU A;  1DK4 A;  3VE1 B;  3V89 B;  1RDY A;  5DEX A;  5EQ9 A;  3RUM A;  3IO6 A;  3N5L A;  4OAN A;  3KN3 A;  3H6U A;  2XXW A;  4QSC A;  1P99 A;  2FHY A;  2P1S A;  3C4M A;  3IFA A;  3FXQ A;  1HSE A;  4G68 A;  4PAF A;  1DCU A;  2ZYK A;  5K2X A;  2I4B A;  3EPE A;  3SEY A;  1PDA A;  3D1R A;  4F3P A;  2O84 X;  3B6W A;  4DIG A;  4I8C A;  1A8F A;  5ET6 A;  4G8N A;  3E4R A;  5ESY A;  1CNQ A;  1N04 A;  1POY 1;  3RNN A;  4MHF A;  3O6I A;  3UIF A;  3LUZ A;  1JVX A;  4PET A;  1Z7N E;  2CEY A;  3G3G A;  2ABH A;  3T22 A;  1LLS A;  2V3T A;  4DDD A;  1F9B A;  3TPA A;  2HZK A;  2X26 A;  4LZ8 A;  2OWS A;  3CR9 A;  3ZKK A;  1FQC A;  4N8G A;  1MXZ A;  2F6G A;  2OX3 A;  1B40 A;  1QUK A;  1OIB A;  4GX6 A;  1UTH A;  3RPW A;  1B4H A;  4RK9 A;  1R9Q A;  4YZZ A;  3A3C A;  4QFP A;  4QBA A;  3UN6 A;  5HBC A;  2FIX A;  4N15 A;  5ET7 A;  3VV5 A;  2HPG A;  4N13 A;  4GLI A;  3EN3 A;  1IQ7 A;  1URS A;  4GWO A;  4TLL B;  3MW0 A;  2P3V A;  1J1N A;  2JJK A;  2FNC A;  3H4Z A;  4ZEB A;  2ZXT A;  3QXM A;  4LUB A;  4GX4 A;  4N6K A;  1NV0 A;  5F7V A;  2B65 A;  1K9Z A;  2DE3 A;  2XD3 A;  2F7A A;  4OVR A;  4ZE9 A;  4GXS B;  4XKP A;  3U94 A;  5AA2 B;  3USD A;  3PD9 A;  2UXA A;  2QS1 A;  1KA0 A;  2XHD A;  2YLN A;  2NUV A;  2Z8E A;  1AOV A;  3NOH A;  5FHO A;  3QSL A;  4PFU A;  2F3B A;  1MY3 A;  1YTV A;  2PT1 A;  1B6H A;  1MRP A;  2QVU A;  5BWJ A;  3IOT A;  4YKJ A;  4DCX A;  1IME A;  4ZDM A;  3H03 A;  2UYF A;  3HFU A;  1P1O A;  1AWB A;  1H76 A;  1URG A;  1N7X A;  5ET5 A;  2P0S A;  4P0I A;  4IGR A;  5AA4 B;  3T1B A;  5B7D A;  1GV8 A;  4H46 A;  2O6A A;  3QIM A;  2ZZX A;  2QSX A;  1NNF A;  1MPC A;  2F7C A;  5FHN A;  1B3L A;  3GXA A;  3OSR A;  4HCY A;  1NNP A;  2OLB A;  2XXY A;  3CG3 A;  3VVE A;  2V4C A;  4U1O A;  3ZKL A;  4F31 B;  4NF6 B;  1M5E A;  1JW5 A;  4ZEI A;  3QUJ A;  1FPJ A;  3D4C A;  1DSN A;  4MLQ A;  4PF6 A;  2DXR A;  3IJO B;  4OFJ A;  5KDT B;  3Q26 A;  1FJ9 A;  3C31 A;  5ELV A;  1RYO A;  4PAI A;  4OVT A;  2ZYM A;  3TEL A;  1MQD A;  4XEQ A;  3MVZ A;  3GLB A;  5H8N B;  3SEU A;  1D4N A;  3RLF E;  2KR0 A;  3HN0 A;  1JET A;  3FJ7 A;  4NHB A;  1ELJ A;  2D5W A;  1Y4C A;  3KEI A;  4MLV A;  2F36 A;  1A54 A;  5I59 A;  5AA2 D;  1FQF A;  3JYR A;  4O3C A;  1Y1Z A;  1I69 A;  4JVC A;  5I2K B;  3PMX A;  4RY1 A;  5T3J A;  2O69 A;  1II5 A;  3MST A;  5AA3 A;  4GRK A;  1NNT A;  4EQ9 A;  4AS5 A;  5TPA B;  2WX9 A;  4L17 A;  3M8U A;  4HCW A;  2O1M A;  3IB1 A;  1R1N A;  2H9B A;  5IM2 A;  2QS2 A;  1VDW A;  3A29 A;  2R8T A;  3PV0 E;  4XTC Q;  5A5X A;  1Q1K A;  1MQH A;  1B1H A;  5DW8 A;  3SDF A;  1FSA A;  5KZT A;  1GR2 A;  4LZ7 A;  4PFI A;  4ELR A;  4OTE A;  4N6P A;  3G3J A;  1IXI A;  4F29 A;  2XWI A;  4NF5 B;  3MVW A;  4P1L A;  5FBP A;  4RJZ A;  1SBP A;  1QGX A;  4F2O A;  2ZYO A;  4GQO A;  3BIG A;  3V5A A;  3OO9 A;  3C35 A;  1EZO A;  2DQV A;  3AXF A;  2W7Y A;  4MNP A;  4U2R A;  2ANJ A;  4AQ4 A;  1LFI A;  1LAH E;  1OQH A;  3CG1 A;  4IO6 A;  2X7Q A;  4HXV A;  1FBD A;  2F8D A;  2UVH A;  4JVD A;  2BJJ X;  4ZS9 A;  4LQ2 A;  1D3K A;  2P2A A;  1M5B A;  4MF3 A;  4ND9 A;  3R7X A;  1B3F A;  2AIX A;  1EU8 A;  3IOV A;  3IOW A;  3RYD A;  3FVN A;  4OWD A;  1FPD A;  1HSJ A;  5JTY A;  2CZL A;  4MJO A;  4H45 A;  4IY5 A;  3PPO A;  4X48 A;  1FPK A;  4Z7E A;  4RNS A;  1IEJ A;  4F3G A;  1SYH A;  2E1S A;  4H6D A;  3RT6 B;  1Q9D A;  1US4 A;  1JW1 A;  4TOZ A;  1FPF A;  2F3D A;  2PYY A;  1M5C A;  3V83 A;  5CM6 A;  2Y7K A;  2XXX A;  4KYS A;  1QKB A;  4N17 A;  4LA9 A;  2I48 A;  1Z7M E;  3K6X A;  3W15 C;  3C34 A;  2VPO A;  3C9H A;  5I56 B;  1CE2 A;  4PGP A;  3LBS A;  3E13 X;  2I49 A;  2G93 A;  3MZB A;  1UIU A;  4R2B A;  3WAE A;  4NG7 A;  2Z8F A;  3FVK A;  2Z23 A;  3CRB A;  3GBB A;  4YB5 A;  3U8Q A;  3S2V A;  3K6U A;  1JP4 A;  4GWX A;  1SI1 A;  3FAT A;  5DT6 A;  1FPE A;  1XHY A;  4FE8 A;  3LSF B;  4ZZA A;  3B6T A;  1XC1 A;  2OBG A;  4PFB A;  4LON B;  3H6W A;  4ISU A;  2B4L A;  4XKQ A;  2KLF A;  2XXI A;  2XXV A;  1EZP A;  4GX3 A;  4YMB A;  2XX8 A;  3RPL B;  4PGN A;  5I58 A;  1MXV A;  3L6G A;  5CMM A;  2HEU A;  3SER A;  3TTR A;  1IZ1 A;  4NGU A;  3IR1 A;  3PUX E;  4Q5T A;  3RT8 A;  1RKM A;  1MY1 A;  3CFX A;  3MPL A;  4GBW A;  4H65 A;  1FW0 A;  4BDM A;  1QKA A;  2H25 A;  4ELO A;  1LB8 A;  5DYH A;  4FAT A;  1SW4 A;  3HST A;  4WED A;  2A5T A;  1FBG A;  2NXO A;  4IB2 A;  4PQJ A;  4GXA A;  4Z0I A;  3ZSF A;  3FIR A;  2IEE A;  1MQJ A;  3HCQ A;  2DWJ A;  4JWY A;  1ANF A;  3T96 B;  1MPD A;  4O7M A;  2DVC A;  4H5G A;  1B4Z A;  4EDP A;  4QSD A;  1GVC A;  2Q2A A;  4F1U A;  1MM7 A;  5H8H A;  2Y84 A;  4YAH X;  2WYK A;  4P3L A;  1LAX A;  1LAF E;  3VDF A;  5ICQ A;  2HXW A;  1XOC A;  5I7I A;  1JEV A;  4I3E A;  4OZ9 A;  5J1D A;  2F7B A;  4HW8 A;  4NMY A;  3RQT A;  2AYS A;  4EQ7 A;  2YJP A;  5JEI A;  4MCO A;  5I2N B;  1YCJ A;  4PBQ A;  3IB0 A;  4OVQ A;  1LBB A;  3JZJ A;  4MH5 A;  5CMC A;  1UTB A;  1FPL A;  3PUY E;  4PDH A;  1I6A A;  1NV2 A;  2UVG A;  4H0W A;  1MPB A;  1KA1 A;  1QUJ A;  1G0I A;  4Q0C A;  4NF8 B;  4PDD A;  4C1U A;  1B46 A;  3KJT A;  4I9D A;  1VR5 A;  4N4U A;  4GBV A;  2HCA A;  3PUV E;  2PBW A;  1N76 A;  1YAE A;  2HAU A;  3S9M C;  4GIZ A;  4OXV A;  1Y3N A;  4THI A;  3PPQ A;  1AIV A;  3FVG A;  4N8Y A;  4ELP A;  4P8B A;  4P56 A;  1GTK A;  1TT1 A;  4H5F A;  2QPQ A;  4F22 A;  2V25 A;  5IGA A;  3O28 A;  4QF9 A;  3T9V A;  2Q88 A;  4FEC A;  3ROJ A;  1A7L A;  2RKM A;  4IO5 A;  2NWJ A;  4KCC A;  5IZ3 A;  4P47 A;  4X9T A;  2AL4 A;  4MFI A;  1S7Y A;  1NV5 A;  1PB8 A;  3IOU A;  3KJ7 A;  2GH9 A;  2DXY A;  3ECR A;  2RCA A;  4MNI A;  1D9Q A;  4YIC A;  3W9W A;  3L6H A;  3DLN A;  3FV1 A;  3QYT A;  1INP A;  2PFZ A;  5LOM A;  3R26 A;  2Q9T A;  3BFT A;  5ISU A;  4IO2 A;  2WKY A;  1B7H A;  3OOA A;  5H8F B;  1DPP A;  1XT8 A;  4FAJ A;  5I84 A;  1G0H A;  3U1O A;  1NL5 A;  1FJ6 A;  4E0X A;  4OEN A;  2LAO A;  3EHT A;  3HHG A;  3KN7 A;  2GQ1 A;  3MAM A;  3IB2 A;  4QHQ A;  4DE8 A;  3TZA A;  4IO7 A;  5CBR A;  2I6E A;  5EYH A;  5BUU A;  4X8R A;  1VFE A;  2RF1 A;  5H8Q B;  1ZTY A;  4NN3 A;  4JDF A;  3TCG A;  4POW A;  3IOR A;  1FPI A;  3GZG A;  4DI3 D;  1P1U A;  2DS9 A;  2PCR A;  4PFY A;  1B3E A;  2BJI A;  4NWC A;  5K2Y A;  3BKI B;  2XXR A;  5L9M A;  3SET A;  4X1B A;  4ZE8 A;  3S9N C;  5TP9 A;  4MEV A;  5ET8 A;  1FBP A;  1Y3P A;  4R6K A;  3PPP A;  2H5Y A;  2Z22 A;  4ZEK A;  1MXW A;  1MM6 A;  3RTW B;  1RDZ A;  2QMW A;  3IAZ A;  1YXI A;  5IZZ A;  2XD2 A;  2Y7W A;  2H4I A;  1SW1 A;  3MJN A;  3TTK A;  4N91 A;  3LC8 A;  3A3U A;  3K00 A;  3FAS A;  3PMW A;  3VXB A;  1M5F A;  1N3X A;  4KHZ E;  2L5V A;  5KCJ B;  2GHB A;  1BP5 A;  3IK6 B;  2ZNT A;  3OSQ A;  4QFL A;  1SI0 A;  3V8X B;  3ISP A;  3VLW A;  4FOR A;  1IMF A;  2M8C A;  1A99 A;  4BDO A;  1VSO A;  5A5L A;  2E0S A;  1CB6 A;  4UAC A;  2OK2 A;  4BDN A;  2VGQ A;  1NH8 A;  4ZED A;  3BBR A;  1EZ9 A;  1ZJL A;  2ZZV A;  4G4P A;  2XA5 A;  4R6Y A;  3UOR A;  1JEU A;  4JXI A;  4I62 A;  3RTF B;  4JWX A;  2B3F A;  4OEV A;  3KC1 A;  4NF4 B;  2UVJ A;  1IXC A;  4ZEF A;  3TDJ A;  3KC0 A;  3OXN A;  3CFZ A;  2QS4 A;  2GHA A;  3MBP A;  4R74 A;  2WBD A;  2Y5K A;  1MXU A;  3SEV A;  3PPR A;  1XS5 A;  4ESX A;  4PC9 A;  3FXB A;  3C32 A;  4QFK A;  2DDK A;  3OMB A;  2AL5 A;  4EF2 A;  1IXG A;  1Y20 A;  3FD3 A;  4OMB A;  2PX1 A;  2I3V A;  3C33 A;  1KWH A;  3K1M A;  1DTG A;  3OEK A;  2QVR A;  2QMX A;  3OD7 A;  4JBZ A;  1FBF A;  3W9V A;  1FQA A;  1DOT A;  2VPN A;  4DLD A;  1AH5 A;  4R2F A;  3FXU A;  4PE5 B;  3TCF A;  4RPN A;  3PPN A;  3O9P A;  4I3Y A;  3VLU A;  1NKX A;  4KYD A;  4I1D A;  2V84 A;  3UK4 A;  3PD8 A;  3O6H A;  1MQI A;  2VOZ A;  4OEU A;  3FXR A;  1NUY A;  2ZZW A;  2QRY A;  4GWS A;  3LSL A;  2UYE A;  1YZ0 A;  4P1E A;  2WBB A;  5B70 A;  2G29 A;  2FVZ A;  1NV4 A;  2IA4 A;  1IMB A;  4GL8 A;  2REJ A;  3I3V A;  4H1X A;  4O8M A;  1FPG A;  4O7I A;  1LEV A;  3WAF A;  3K0V A;  1WDN A;  1SQY A;  4MIJ A;  3TYH A;  1MG1 A;  2Y7R A;  1BLF A;  4LZ5 A;  2VT5 A;  4JSD A;  4KI0 E;  4E0W A; 
#chains in the Genus database with same CATH homology
 2DP8 A;  3QUF A;  5DEX B;  5CMB A;  1EH3 A;  2O1L A;  3B7D A;  2CMO A;  3CIJ A;  3T9X B;  4OER A;  2THI A;  1B3H A;  5CMK A;  2HQ0 A;  1RYX A;  4OYV A;  4G68 B;  1US5 A;  1I6Q A;  4R73 A;  4ECF A;  4Q8R A;  1JQF A;  2O7U A;  3MVY A;  1MY4 A;  2I4C A;  4X1D A;  2NVU B;  4QRZ A;  3U72 A;  3LR1 A;  4JB7 A;  2ONK E;  5AA2 A;  3OO8 A;  2F97 A;  3DP4 A;  1LBC A;  4EQB A;  5ITP A;  3S9L C;  1ATG A;  4U21 A;  4KFQ A;  4NTL A;  4R6H A;  3DEL B;  3SEW A;  2B3B A;  1NMU A;  3Q29 A;  5AE4 A;  2NOO A;  4M1V A;  2UVI A;  1FCK A;  4IY6 A;  5M2V A;  5AA4 A;  3KSJ A;  4HTG A;  1OMP A;  1S9T A;  4F1Y A;  1LST A;  1R9L A;  1UTH B;  1H43 A;  4EXL A;  2ZYN A;  1QJM A;  2XXP A;  3FJM A;  3IO4 A;  2VP1 A;  4JWO A;  1ZMG A;  2VD2 A;  1FTJ A;  3SKP A;  1SD3 A;  1LGB C;  3OEN A;  1NNK A;  4NF6 A;  3K1P A;  4M4G A;  1URD A;  3M3L A;  1DPE A;  3MWB A;  3PMV A;  1M5D A;  5DVJ A;  1WVJ A;  5KDT A;  4U1Z A;  2REG A;  3TQW A;  1B0H A;  1FQB A;  3FV2 A;  4BDL A;  1O7T A;  1FTL A;  3N94 A;  3MP8 A;  3N6T A;  5H8N A;  4ONY A;  2F6P A;  2ALU A;  4OQO A;  4YU0 A;  4F2Q A;  2R9J A;  2DWA A;  4F3S A;  2DE2 A;  4RK2 A;  4F3B A;  2I0C A;  5I2K A;  1AMF A;  3GBA A;  1B32 A;  3RGY A;  1XVY A;  2PT2 A;  2PVU A;  2ONR A;  2F35 A;  4WKM A;  1SDX A;  1SVX B;  2PMS A;  3MP6 A;  1B51 A;  3RN8 A;  1SYI A;  3VLV A;  4PP0 A;  1BIY A;  1ZKB A;  4F39 A;  4ESW A;  3S4U A;  1P1N A;  3KG2 A;  3VFJ A;  1T0K A;  5EYF A;  5CI5 A;  1ZU0 A;  2R6G E;  3Q25 A;  4NF5 A;  1IIW A;  4BDQ A;  3EHU A;  4DZ1 A;  3KGC A;  1B7U A;  4O3B A;  3KOT A;  1Y9U A;  4QFO A;  3S9E A;  4DXU A;  3G3H A;  2Q8J A;  2RC9 A;  4ZZE A;  1A55 A;  3G3F A;  2H99 A;  1PB7 A;  4TLM B;  4KQP A;  4POX A;  1N3W A;  1HSL A;  4KR5 A;  4G8M A;  2V3Q A;  3B6Q A;  3PUW E;  4NWD A;  3G3I A;  4FJP A;  1MQG A;  2OZZ A;  1I6B A;  3T9U A;  2DWI A;  1JVY A;  1AL3 A;  5I59 B;  2XXH A;  4YKP A;  1LFH A;  4ELQ A;  2Y7I A;  3THI A;  1LCT A;  3K4U A;  4RA1 A;  3HPI A;  3KSX A;  3EF7 A;  3UGW A;  2RC8 A;  3TAJ A;  2O7I A;  1FQE A;  1MY0 A;  1YPN A;  3FGS A;  4YB6 A;  1B3G A;  1UIV A;  3N26 A;  2DE4 A;  5L9O A;  3ILT B;  3DM0 A;  2OJT A;  3HV1 A;  4GL0 A;  4NE4 A;  4U22 A;  4U23 A;  2HZL A;  4R72 A;  5A5X B;  2YPN A;  5H8S A;  4ZEC A;  3TEP A;  3TTL A;  4XIG Q;  3UP9 A;  4P11 A;  1R6Z A;  1TWY A;  1XVX A;  4F18 A;  5EHS A;  4AB5 A;  3FJG A;  5I56 A;  3G3K A;  3TOD A;  4OHN A;  1UQW A;  1VE4 A;  2RC7 A;  2OWT A;  4RPO A;  4AB6 A;  3E3K A;  1LB9 A;  2FA7 A;  2HAV A;  1A8E A;  4JSO A;  4PFT A;  3HO7 A;  5FTH A;  3TQL A;  3KBR A;  1S50 A;  1B7Z A;  2O68 A;  4EF1 A;  1MDP 1;  3TFL A;  1B2H A;  4RXL A;  4XXU A;  4YKK A;  4BLA A;  1B5I A;  5JTY B;  5EHM A;  5I57 A;  4QSE A;  5F1Q A;  5ICT A;  2ONS A;  5DVF A;  4G8H A;  4C0R A;  2QJE A;  4IO4 A;  2V3U A;  4Q30 B;  2H98 A;  3G7W A;  4O3A A;  2ZMB A;  4U4S A;  1QVS A;  1TFA A;  1ZBM A;  4R75 A;  5CC2 A;  4IO3 A;  4RYA A;  3FZV A;  1PBQ A;  2XX9 A;  3LUY A;  1IUD A;  3ZS6 A;  1IXH A;  3LSW A;  3PGF A;  2VD3 A;  4YB7 A;  2DOJ A;  1H3D A;  1MH3 A;  1Y4T A;  1OQG A;  3H6V A;  1DMB A;  3K1N A;  1B1X A;  2F34 A;  3MVX A;  3DP6 A;  1OVB A;  3VVD A;  3QAX A;  2Z8D A;  3A09 A;  5FHM A;  2ESN A;  3VVF A;  4G77 A;  4EUO A;  4G68 C;  4FED A;  3CSG A;  4R9G A;  3KN8 A;  1N7W A;  3C36 A;  5I2N A;  3OO6 A;  3MZ9 A;  3ILU B;  4LP2 B;  3KZG A;  2V93 A;  4GF8 A;  3O6G A;  5I58 B;  4C1T A;  3FVO A;  1IIT A;  3O2A A;  1FTM A;  1BKA A;  1OVT A;  2D3I A;  1NH7 A;  4NF8 A;  3N6U A;  3H6T A;  3D4G A;  4UA8 A;  1MXX A;  3RY3 A;  5DTB A;  2XX7 A;  1NFT A;  3IJX B;  1USY H;  3I5O A;  3TMG A;  4F1V A;  5CRY A;  3O97 A;  3M3K A;  3OO7 A;  2DSF A;  4U4X A;  2OCU A;  1VFD A;  2A5T B;  4GVO A;  3H06 B;  4OFL A;  4OVJ A;  1JW4 A;  4H67 A;  3UA8 A;  3Q27 A;  4R9F A;  3IX1 A;  3KOS A;  3KFM A;  5H8H B;  2HFB A;  4FIM A;  3K2D A;  1MH4 A;  4DXC A;  3P7I A;  2QS3 A;  1ZLQ A;  3K01 A;  3PU5 A;  2F5X A;  4LQ5 A;  1PB9 A;  4OFO A;  4F19 A;  2Y7P A;  2ZNS A;  3CSB A;  3JV9 A;  3IL1 B;  5H8F A;  4KYE A;  4HS7 A;  3T93 B;  1MY2 A;  5CBS A;  1UTB B;  2RIN A;  1Q35 A;  4WXJ A;  3SES A;  2D21 A;  1QW0 A;  5ITO A;  4TQU Q;  1LFG A;  3TTN A;  3I6V A;  1Y1M A;  1WOD A;  1OLA A;  4GOT A;  5H8Q A;  3EQ1 A;  3T9H B;  3EHS A;  4G2Z A;  4GD5 A;  3O66 A;  1B0L A;  1O63 A;  3ODB A;  1PBP A;  3TCH A;  4XKR A;  4LAT A;  1H45 A;  1POT A;  1PEB A;  3M3F A;  5L9S A;  3CVG A;  1MXY A;  3K6W A;  2I0B A;  4H8I A;  2R71 A;  2ZNU A;  4GFR A;  2GRV A;  4KPT A;  2XXU A;  4BDR A;  2Q89 A;  4OET A;  4NED A;  4YKI A;  2A5S A;  3SEX A;  1B58 A;  3Q28 A;  5TU0 A;  1B05 A;  3ONM A;  3OEL A;  3QK6 A;  4XKN A;  1OLC A;  4YMA A;  1P1W A;  1B5H A;  1SW2 A;  3H7M A;  3TTM A;  4MBP A;  5HM4 B;  2Q2C A;  4OES A;  1A40 A;  5L8D A;  3U93 A;  1B9J A;  2X7P A;  1DTZ A;  1B5J A;  2I58 A;  1L5T A;  3CI8 A;  5KCJ A;  2I3W A;  3MZ1 A;  1TFD A;  4KD5 A;  3PUZ E;  5HPQ A;  1D9Y A;  3MPK A;  1N84 A;  2O51 A;  4H8J A;  4FEB A;  1QUL A;  3VXC A;  4DXB A;  4NF4 A;  5I57 B;  3HHF A;  3K6V A;  1QUI A;  5AA1 A;  2F78 A;  3OEM A;  3T66 A;  3DP8 A;  4K3F A;  1B52 A;  2DWH A;  3H3G A;  5TP9 B;  3MQ9 A;  2XXT A;  4P0G A;  1Y3Q A;  1MS7 A;  3MP1 A;  1D9V A;  1LAG E;  1PC3 A;  3K02 A;  5FTI A;  5TPA A;  3E9X A;  4N07 A;  4PFW A;  1SW5 A;  2VHA A;  4WEP A;  1TXF A;  1FTO A;  2GFE A;  3CFL A;  2XXQ A;  4LVQ A;  4QFN A;  1GGG A;  3R6U A;  5DVI A;  1MDQ A;  1O64 A;  1ZIU A;  3LSX A;  2DVZ A;  4IGT A;  3U92 A;  1P1Q A;  3MUQ A;  3MC2 A;  1USY E;  5IAI A;  5IKB A;  1JNF A;  3FUZ A;  3F11 A;  2DYX A;  1N0T A;  1LCF A;  5JK4 A;  2FYI A;  2RCB A;  4KCD A;  1BTJ A;  4EXK A;  1FQD A;  1H44 A;  3TKD A;  1FTK A;  3TUS A;  4DCY A;  3O29 A;  2QL3 A;  3BFU A;  3VE1 B;  3V89 B;  5DEX A;  3RUM A;  3IO6 A;  3N5L A;  3KN3 A;  3H6U A;  2XXW A;  4QSC A;  1P99 A;  2P1S A;  3C4M A;  3FXQ A;  1HSE A;  4G68 A;  2ZYK A;  5K2X A;  2I4B A;  3EPE A;  3SEY A;  1PDA A;  4F3P A;  2O84 X;  3B6W A;  4DIG A;  4I8C A;  1A8F A;  4G8N A;  3E4R A;  1N04 A;  1POY 1;  3RNN A;  3O6I A;  3UIF A;  1JVX A;  4PET A;  1Z7N E;  3G3G A;  2ABH A;  3T22 A;  1LLS A;  2V3T A;  4DDD A;  1F9B A;  3TPA A;  2HZK A;  2X26 A;  4LZ8 A;  2OWS A;  3CR9 A;  3ZKK A;  1FQC A;  1MXZ A;  2F6G A;  1B40 A;  1QUK A;  1OIB A;  1UTH A;  3RPW A;  1B4H A;  4RK9 A;  1R9Q A;  4YZZ A;  3A3C A;  4QFP A;  3UN6 A;  5HBC A;  3VV5 A;  4N13 A;  4GLI A;  3EN3 A;  1IQ7 A;  1URS A;  4GWO A;  4TLL B;  3MW0 A;  1J1N A;  2FNC A;  3H4Z A;  4ZEB A;  2ZXT A;  3QXM A;  4LUB A;  5F7V A;  2B65 A;  2DE3 A;  2XD3 A;  2F7A A;  4ZE9 A;  4GXS B;  4XKP A;  3U94 A;  5AA2 B;  3USD A;  3PD9 A;  2UXA A;  2QS1 A;  2XHD A;  2YLN A;  2NUV A;  2Z8E A;  1AOV A;  5FHO A;  3QSL A;  4PFU A;  1MY3 A;  1YTV A;  2PT1 A;  1B6H A;  1MRP A;  5BWJ A;  3IOT A;  4YKJ A;  4DCX A;  4ZDM A;  3H03 A;  2UYF A;  1P1O A;  1H76 A;  1URG A;  1N7X A;  2P0S A;  4P0I A;  4IGR A;  5AA4 B;  5B7D A;  1GV8 A;  2O6A A;  3QIM A;  2QSX A;  1NNF A;  1MPC A;  2F7C A;  5FHN A;  1B3L A;  3GXA A;  3OSR A;  4HCY A;  1NNP A;  2OLB A;  2XXY A;  3CG3 A;  3VVE A;  4U1O A;  3ZKL A;  4F31 B;  4NF6 B;  1M5E A;  1JW5 A;  4ZEI A;  3QUJ A;  3D4C A;  1DSN A;  4MLQ A;  2DXR A;  3IJO B;  4OFJ A;  5KDT B;  3Q26 A;  3C31 A;  5ELV A;  1RYO A;  2ZYM A;  3TEL A;  1MQD A;  3MVZ A;  3GLB A;  5H8N B;  3SEU A;  1D4N A;  3RLF E;  3HN0 A;  1JET A;  3FJ7 A;  1ELJ A;  2D5W A;  1Y4C A;  3KEI A;  4MLV A;  2F36 A;  1A54 A;  5I59 A;  5AA2 D;  1FQF A;  3JYR A;  4O3C A;  1Y1Z A;  1I69 A;  5I2K B;  3PMX A;  4RY1 A;  2O69 A;  1II5 A;  5AA3 A;  4GRK A;  1NNT A;  4EQ9 A;  5TPA B;  4L17 A;  3M8U A;  4HCW A;  2O1M A;  3IB1 A;  1R1N A;  2H9B A;  2QS2 A;  3PV0 E;  4XTC Q;  5A5X A;  1Q1K A;  1MQH A;  1B1H A;  3SDF A;  5KZT A;  1GR2 A;  4LZ7 A;  4ELR A;  4OTE A;  4N6P A;  3G3J A;  1IXI A;  4F29 A;  4NF5 B;  3MVW A;  4RJZ A;  1SBP A;  4F2O A;  2ZYO A;  4GQO A;  3V5A A;  3OO9 A;  3C35 A;  1EZO A;  2DQV A;  3AXF A;  2W7Y A;  4U2R A;  2ANJ A;  4AQ4 A;  1LFI A;  1LAH E;  1OQH A;  3CG1 A;  4IO6 A;  2X7Q A;  2F8D A;  2UVH A;  2BJJ X;  4ZS9 A;  4LQ2 A;  1D3K A;  2P2A A;  1M5B A;  4MF3 A;  4ND9 A;  3R7X A;  1B3F A;  2AIX A;  1EU8 A;  3IOV A;  3IOW A;  3FVN A;  4OWD A;  1HSJ A;  5JTY A;  2CZL A;  4IY5 A;  3PPO A;  4X48 A;  4Z7E A;  4RNS A;  1IEJ A;  4F3G A;  1SYH A;  2E1S A;  4H6D A;  3RT6 B;  1US4 A;  1JW1 A;  4TOZ A;  2PYY A;  1M5C A;  3V83 A;  5CM6 A;  2Y7K A;  2XXX A;  4KYS A;  1QKB A;  4LA9 A;  2I48 A;  1Z7M E;  3K6X A;  3W15 C;  3C34 A;  3C9H A;  5I56 B;  1CE2 A;  3LBS A;  3E13 X;  2I49 A;  2G93 A;  3MZB A;  1UIU A;  4R2B A;  3WAE A;  2Z8F A;  3FVK A;  2Z23 A;  3CRB A;  3GBB A;  4YB5 A;  3U8Q A;  3S2V A;  3K6U A;  1SI1 A;  3FAT A;  5DT6 A;  4FE8 A;  1XHY A;  3LSF B;  4ZZA A;  3B6T A;  1XC1 A;  2OBG A;  4LON B;  3H6W A;  4ISU A;  4XKQ A;  2KLF A;  2XXI A;  2XXV A;  1EZP A;  4YMB A;  2XX8 A;  5I58 A;  1MXV A;  3L6G A;  5CMM A;  2HEU A;  3SER A;  3TTR A;  1IZ1 A;  3IR1 A;  3PUX E;  4Q5T A;  3RT8 A;  1RKM A;  1MY1 A;  3CFX A;  3MPL A;  4H65 A;  1FW0 A;  4BDM A;  1QKA A;  2H25 A;  4ELO A;  1LB8 A;  5DYH A;  4FAT A;  1SW4 A;  3HST A;  4WED A;  2A5T A;  4PQJ A;  2NXO A;  4IB2 A;  3ZSF A;  4GXA A;  4Z0I A;  3FIR A;  2IEE A;  1MQJ A;  3HCQ A;  2DWJ A;  4JWY A;  1ANF A;  3T96 B;  1MPD A;  2DVC A;  4H5G A;  1B4Z A;  4EDP A;  4QSD A;  1GVC A;  2Q2A A;  4F1U A;  1MM7 A;  5H8H A;  2Y84 A;  4YAH X;  1LAX A;  1LAF E;  3VDF A;  5ICQ A;  2HXW A;  1XOC A;  1JEV A;  4OZ9 A;  5J1D A;  2F7B A;  4HW8 A;  4NMY A;  3RQT A;  2AYS A;  4EQ7 A;  2YJP A;  5JEI A;  5I2N B;  1YCJ A;  3IB0 A;  1LBB A;  3JZJ A;  4MH5 A;  5CMC A;  1UTB A;  3PUY E;  1I6A A;  2UVG A;  4H0W A;  1MPB A;  1QUJ A;  4Q0C A;  4NF8 B;  4C1U A;  1B46 A;  3KJT A;  4I9D A;  1VR5 A;  2HCA A;  3PUV E;  2PBW A;  1N76 A;  1YAE A;  2HAU A;  3S9M C;  4GIZ A;  4OXV A;  1Y3N A;  4THI A;  3PPQ A;  1AIV A;  3FVG A;  4ELP A;  1GTK A;  1TT1 A;  4H5F A;  2QPQ A;  4F22 A;  2V25 A;  3O28 A;  4QF9 A;  3T9V A;  2Q88 A;  4FEC A;  1A7L A;  2RKM A;  4IO5 A;  2NWJ A;  4KCC A;  4X9T A;  2AL4 A;  4MFI A;  1S7Y A;  1PB8 A;  3IOU A;  3KJ7 A;  2GH9 A;  2DXY A;  3ECR A;  2RCA A;  4YIC A;  3W9W A;  3L6H A;  3DLN A;  3FV1 A;  3QYT A;  5LOM A;  3R26 A;  2Q9T A;  3BFT A;  5ISU A;  4IO2 A;  2WKY A;  1B7H A;  3OOA A;  5H8F B;  1DPP A;  1XT8 A;  4FAJ A;  5I84 A;  3U1O A;  1NL5 A;  4E0X A;  4OEN A;  2LAO A;  3EHT A;  3HHG A;  3KN7 A;  3MAM A;  3IB2 A;  4QHQ A;  4DE8 A;  3TZA A;  4IO7 A;  5CBR A;  2I6E A;  5BUU A;  1VFE A;  2RF1 A;  5H8Q B;  1ZTY A;  4JDF A;  3TCG A;  4POW A;  3IOR A;  3GZG A;  1P1U A;  2DS9 A;  4PFY A;  1B3E A;  4NWC A;  5K2Y A;  3BKI B;  2XXR A;  5L9M A;  3SET A;  4X1B A;  4ZE8 A;  3S9N C;  5TP9 A;  1Y3P A;  4R6K A;  3PPP A;  2H5Y A;  2Z22 A;  4ZEK A;  1MXW A;  1MM6 A;  3RTW B;  2QMW A;  3IAZ A;  2XD2 A;  2Y7W A;  2H4I A;  1SW1 A;  3MJN A;  3TTK A;  3LC8 A;  3A3U A;  3K00 A;  3FAS A;  3PMW A;  3VXB A;  1M5F A;  1N3X A;  4KHZ E;  5KCJ B;  2GHB A;  1BP5 A;  3IK6 B;  2ZNT A;  3OSQ A;  4QFL A;  1SI0 A;  3V8X B;  3VLW A;  4FOR A;  2M8C A;  1A99 A;  4BDO A;  1VSO A;  2E0S A;  1CB6 A;  4UAC A;  2OK2 A;  4BDN A;  2VGQ A;  1NH8 A;  4ZED A;  3BBR A;  1EZ9 A;  1ZJL A;  4G4P A;  4R6Y A;  3UOR A;  1JEU A;  4JXI A;  4I62 A;  3RTF B;  4JWX A;  2B3F A;  4OEV A;  4NF4 B;  2UVJ A;  1IXC A;  4ZEF A;  3TDJ A;  3OXN A;  3CFZ A;  2QS4 A;  2GHA A;  3MBP A;  4R74 A;  1MXU A;  3SEV A;  3PPR A;  1XS5 A;  4ESX A;  3C32 A;  4QFK A;  3OMB A;  2AL5 A;  4EF2 A;  1IXG A;  1Y20 A;  3FD3 A;  4OMB A;  2PX1 A;  2I3V A;  3C33 A;  1KWH A;  3K1M A;  1DTG A;  3OEK A;  2QMX A;  3OD7 A;  4JBZ A;  3W9V A;  1FQA A;  1DOT A;  4DLD A;  1AH5 A;  4R2F A;  3FXU A;  4PE5 B;  3TCF A;  4RPN A;  3PPN A;  3O9P A;  3VLU A;  1NKX A;  4KYD A;  4I1D A;  2V84 A;  3UK4 A;  3PD8 A;  3O6H A;  1MQI A;  2VOZ A;  4OEU A;  3FXR A;  2QRY A;  3LSL A;  2UYE A;  5B70 A;  2G29 A;  2IA4 A;  4GL8 A;  2REJ A;  3I3V A;  4H1X A;  3WAF A;  3K0V A;  1WDN A;  1SQY A;  3TYH A;  1MG1 A;  2Y7R A;  1BLF A;  4LZ5 A;  4JSD A;  4KI0 E;  4E0W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...