1BP5A

Human serum transferrin, recombinant n-terminal lobe, apo form
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
328
structure length
328
Chain Sequence
KTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMGGKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords PROTEIN (SERUM TRANSFERRIN)
publication title Ligand-induced conformational change in transferrins: crystal structure of the open form of the N-terminal half-molecule of human transferrin.
pubmed doi rcsb
source organism Homo sapiens
total genus 96
structure length 328
sequence length 328
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 1998-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1bp5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1bp5A02
3C32A 4MFIA 1UIUA 5I57B 4XKQA 2Z8FA 2HZLA 2THIA 4WEPA 3HCQA 4MF3A 3OELA 3U8QA 1XVXA 1MXUA 5CI5A 4GLIA 2Y7IA 4GXSB 4WEDA 3C31A 2RINA 4G8NA 1TXFA 3CFLA 1FTOA 1VE4A 2O84X 1EH3A 4ZEKA 2F97A 4E0WA 4JWOA 4R6YA 1AL3A 3IOWA 4JDFA 4ZEFA 2HXWA 3CG3A 4H5FA 2UVIA 3T9UA 3S2VA 3ODBA 3A09A 2DVZA 1LBCA 3SETA 3KJTA 4XKPA 1LB8A 4EXLA 4XXUA 3R6UA 1B9JA 4NF5B 3QUJA 3K1MA 1L5TA 1SW5A 2UVGA 4ZZEA 5I58B 5KCJB 1WVJA 1JNFA 4LZ5A 3OEKA 3M8UA 1P1NA 4P0GA 4G77A 2NWJA 2A5TA 4NF6B 3TZAA 3W9VA 2Q89A 1FTKA 2PBWA 3OMBA 4G68B 3S4UA 3QIMA 2ABHA 2RC8A 3PPQA 4UACA 4Z0IA 3PUXE 3TPAA 1P1WA 4C0RA 2V25A 4QF9A 4YKIA 4TLLB 3T9HB 2R6GE 2XXUA 2DQVA 2Z23A 3TQWA 1NNTA 1UTBB 2AYSA 3FXQA 4NF4B 2CMOA 3KN8A 3LSWA 2VOZA 5ICQA 5CBRA 3H6WA 3PD9A 3MVZA 1Y1MA 4YB6A 1P1QA 3RPWA 1JQFA 5KDTA 1H3DA 5JK4A 3PV0E 2QS3A 1PBPA 1B4HA 4DCYA 5HM4B 1JVXA 1BIYA 2DE4A 4F2QA 3OENA 3TTLA 3PPOA 1MXVA 4DE8A 1B46A 4NWCA 3HHGA 2H98A 3IOVA 1R9LA 2V93A 3FV2A 3UP9A 3FIRA 4WXJA 4THIA 4NEDA 5J1DA 5I58A 1S7YA 4QHQA 1P1UA 1PDAA 3GBBA 3R26A 4EF2A 4O3AA 1GGGA 4BDQA 3SESA 2F7BA 4NF6A 3UN6A 4XTCQ 4ELRA 3PMWA 1QKBA 4LATA 4BDOA 1IEJA 2H5YA 3UA8A 5A5XB 1EZ9A 3OEMA 3VLWA 3RLFE 2DWJA 1S50A 2F34A 5BWJA 1B58A 1DSNA 4GXAA 5CMKA 4G68C 1BTJA 3S9NC 3PGFA 1H44A 2FNCA 4JBZA 1LCTA 4WKMA 4GIZA 3K2DA 2W7YA 3DM0A 4K3FA 2I48A 3SEYA 2DWHA 3EQ1A 1A99A 3U93A 1FQCA 3CSBA 1MXYA 5AE4A 1JW4A 1Z7NE 4R2FA 4Q8RA 1B7HA 5ITPA 2DXYA 2XX9A 2FYIA 4UA8A 3O28A 1SYIA 2ONRA 1GV8A 2B3FA 2DP8A 2I49A 3SEUA 3G3JA 2UYFA 1O64A 3GLBA 4DCXA 1P1OA 1US4A 4YKPA 1CE2A 1YAEA 1DPPA 1MG1A 3SEWA 4YZZA 4GL8A 2QJEA 4IO6A 2NUVA 5FHOA 5DYHA 2V3QA 1SDXA 2I3VA 1JVYA 5K2XA 3OXNA 1H43A 4OEUA 4I1DA 1RYOA 3RUMA 2QRYA 4MBPA 1ZKBA 4KYEA 1I69A 1MQIA 4R9GA 4N6PA 3HO7A 2OK2A 3N5LA 2I4BA 3EHSA 3W9WA 1SI1A 2F8DA 4F3BA 1NNPA 4ZEBA 4IY6A 3O97A 4QFNA 2KLFA 3O29A 2NOOA 3DELB 4IY5A 1PBQA 4FAJA 1NNKA 3SEXA 3PPNA 5H8FA 1NNFA 2H9BA 1IXCA 4QSDA 3D4GA 4YAHX 5TPAA 2DE3A 3FVKA 3MAMA 4BLAA 2ZYKA 1FCKA 2OCUA 1POY1 1A8FA 1PB8A 4FE8A 4GRKA 5DEXB 1ELJA 4YU0A 4IB2A 3K02A 2Z8EA 3H3GA 3KOSA 1UQWA 3MPLA 3EHUA 1RKMA 1TT1A 3PUVE 5CM6A 1JETA 3SDFA 1LFHA 4U2RA 4L17A 2XXTA 4R74A 1R1NA 2UYEA 3MZBA 5CMCA 1VSOA 1OQHA 5AA2B 4RYAA 3TTNA 3IB1A 4P11A 3A3UA 3D4CA 1XOCA 3PMXA 3THIA 3IR1A 4QFLA 4F2OA 2WKYA 5ICTA 2P1SA 3KN7A 3TYHA 4EXKA 3IO4A 5B70A 3C36A 1AH5A 5FTIA 1NH8A 3B7DA 3IOTA 3Q27A 1I6BA 1ZTYA 4X9TA 2ZNUA 3K6WA 2OZZA 3H03A 2B3BA 4O3CA 5I56B 5IAIA 3B6TA 4U1ZA 4YKKA 3PUZE 3VV5A 2QPQA 1ZMGA 4ZZAA 3JZJA 2DS9A 2RCAA 3U94A 4OMBA 2O1LA 3K00A 4G8MA 3DP4A 4RA1A 1BLFA 2ONKE 4PFWA 4OFJA 1N3XA 5I59B 4BDLA 1ZBMA 1NFTA 1OVTA 4QFPA 4M4GA 3I3VA 1BP5A 1LAFE 4LQ5A 3TTKA 2H99A 3IO6A 1EU8A 1FQFA 5I2KA 3S9MC 3RTWB 3IK6B 1Z7ME 2HEUA 1PC3A 3IOUA 2VGQA 3OO8A 5AA2A 2D5WA 3W15C 3C4MA 3CFXA 4EUOA 1Y3NA 3SKPA 4H5GA 3KBRA 1LFIA 2VP1A 1IITA 3ONMA 3H6UA 3E13X 1JEUA 1LFGA 3TEPA 3GBAA 3VFJA 2XD2A 2HCAA 1A54A 1F9BA 1DTZA 2OWTA 3MZ9A 2F35A 3B6WA 5DVIA 4FEDA 4PFTA 4R6KA 1DOTA 4LP2B 3LSFB 5H8NB 2Q88A 5I56A 1N84A 5L9MA 4JXIA 2RF1A 3FZVA 3KJ7A 4F1UA 5F1QA 4DZ1A 2Q2AA 3PU5A 2F6PA 3DP8A 3ILUB 2V3UA 4ELPA 5CBSA 4ZE8A 3IX1A 4OESA 3FUZA 5M2VA 3K0VA 3H7MA 1B2HA 4LVQA 2I4CA 1TWYA 1M5FA 4OFOA 2O1MA 1KWHA 5I57A 3EF7A 2ANJA 3FVNA 3TKDA 1WDNA 4F3PA 1B5HA 3MP6A 3JYRA 3O6GA 3O2AA 4F3SA 3KEIA 4ISUA 1OLCA 1UIVA 5IKBA 4KD5A 4HS7A 3IAZA 3PPRA 2PMSA 5DVJA 4BDRA 1B52A 3P7IA 5EHSA 2NVUB 4F22A 3U72A 1URDA 2OBGA 2PYYA 3PD8A 2ZYNA 3RY3A 1MXZA 3N94A 2YJPA 4DXBA 3B6QA 1FTJA 2XHDA 4XIGQ 2LAOA 1CB6A 1MS7A 1DTGA 3KGCA 2R71A 1SQYA 1GTKA 5DVFA 3FD3A 2GH9A 3O6IA 3OOAA 1MM7A 5H8NA 2ZYMA 3TUSA 4F39A 4YICA 1SW4A 4NF5A 3H6TA 1AIVA 1B32A 3WAFA 2XXXA 2YLNA 3MC2A 5KCJA 1LB9A 5EYFA 3DP6A 3VE1B 4U23A 1MH4A 4P0IA 4XKNA 3RN8A 4JWYA 3OSQA 2XXHA 2HAUA 3TAJA 4NWDA 3VVFA 1H45A 4G68A 4NF8B 1SI0A 1QULA 2QS4A 3C34A 4RK9A 4M1VA 3K01A 5TP9B 1B1HA 3R7XA 3MVYA 3T96B 3G3HA 3QXMA 3UORA 2XXQA 3BKIB 2ZNSA 2PX1A 1LAHE 3F11A 1UTBA 4NF4A 2XXWA 4DIGA 1D9YA 1LSTA 4C1UA 4RPNA 2RC9A 3ZKLA 1URGA 5H8SA 3IJXB 4RJZA 3MWBA 4JWXA 4F31B 4H6DA 2QMXA 2I0BA 1B05A 1O7TA 2V3TA 4JSOA 1B7UA 3TQLA 4YB7A 3KSXA 3LSLA 4GL0A 2DVCA 4YMBA 1UTHB 1Q1KA 3LR1A 1SYHA 2M8CA 5CMMA 2PT1A 2I58A 4F29A 4PFYA 3V89B 1QUJA 2Y84A 1Y3PA 3BBRA 3TTRA 3VLVA 3FXRA 4IO5A 3K6UA 3U92A 1R9QA 1FQDA 3QUFA 2RKMA 1B3LA 3Q28A 2DYXA 3T9XB 2X7QA 3MUQA 1Y1ZA 3SERA 4GF8A 1HSJA 5JTYB 1M5EA 5A5XA 2P2AA 1RYXA 5TP9A 4FATA 4RK2A 1I6QA 1FTLA 4MLQA 2O51A 3TODA 1J1NA 1O63A 4GWOA 4U4XA 3VXBA 1NH7A 3IB2A 2QSXA 3OSRA 4H0WA 2OLBA 1MDQA 4MLVA 2XXRA 1D3KA 1B1XA 1MXWA 1MY2A 3FJ7A 1PB7A 5H8QB 4R72A 5HBCA 3KFMA 1NKXA 2A5SA 1SVXB 1XT8A 1US5A 1MY1A 1II5A 3FJMA 3G3FA 3QK6A 1YTVA 2B65A 2DWAA 2P0SA 4FIMA 4OQOA 3G3GA 1LAXA 5AA3A 5ISUA 4ZEDA 2DOJA 1MQHA 3Q26A 4GVOA 4HTGA 4BDMA 3EN3A 2O7UA 4F18A 5K2YA 1SBPA 1B0HA 3CFZA 4KR5A 4U22A 4OZ9A 1XC1A 4I8CA 3ZKKA 3E4RA 4FJPA 2XD3A 5FHMA 3LSXA 1PB9A 1MY0A 5ELVA 4IGTA 1VFEA 4EQ9A 2D3IA 4POXA 3MQ9A 1SW1A 1LGBC 4KYDA 4RY1A 1B3EA 4FECA 3CG1A 4KCCA 3I5OA 1ZJLA 1IQ7A 1DMBA 1LAGE 2HFBA 4PQJA 4AQ4A 5DT6A 1M5CA 2QL3A 1OVBA 3GZGA 3C9HA 5AA4B 4I62A 3VLUA 2Q9TA 5TU0A 3FVOA 3VVEA 4H1XA 1P99A 1R6ZA 2F36A 2O68A 3FV1A 4ESXA 4X1DA 4ECFA 2NXOA 4TLMB 1USYH 2I0CA 1D9VA 2VD2A 2DSFA 2AIXA 1IZ1A 4LUBA 3L6HA 2BJJX 3IL1B 5DEXA 1AMFA 5FHNA 4LONB 1YPNA 4U4SA 4POWA 5I2NB 5L9SA 2Y7WA 5B7DA 1IXIA 1USYE 2O7IA 1MQDA 3LC8A 2A5TB 4IO4A 2D21A 1LBBA 2GHAA 4I9DA 3TCGA 2IA4A 3KOTA 4MH5A 3OO7A 2QMWA 1B6HA 4PE5B 4AB5A 4OYVA 4LZ8A 5HPQA 3CRBA 1D4NA 1OLAA 1B51A 4YB5A 3Q25A 3S9LC 2HZKA 3RGYA 3VXCA 5AA4A 3E3KA 2VHAA 5KDTB 3FATA 2REGA 4RPOA 3FVGA 3RNNA 3JV9A 1M5BA 3MP1A 1MDP1 2G29A 4ESWA 2RC7A 1URSA 4RXLA 2CZLA 1OIBA 1XS5A 2ALUA 3FASA 4EQ7A 1Y3QA 4U1OA 1Q35A 3UK4A 1B3FA 1T0KA 3TCHA 1EZPA 1Y4CA 4FEBA 3MP8A 4NMYA 5I59A 4KI0E 3USDA 5I2NA 1IUDA 2Y7RA 5AA1A 3E9XA 2F6GA 1FQBA 4DXUA 5H8HB 5FTHA 2F5XA 4O3BA 2ZXTA 1IXHA 3V8XB 3BFTA 1N0TA 2DE2A 1NL5A 1POTA 2OWSA 2HAVA 4G4PA 4IO3A 1B4ZA 2Y7KA 1AOVA 1YCJA 1BKAA 1OQGA 1ZIUA 4XKRA 2XX8A 3AXFA 2GFEA 2G93A 4ONYA 5I84A 3HV1A 4OXVA 3K6XA 1N3WA 4DDDA 2Z22A 4YMAA 1WODA 4KCDA 1PEBA 3G7WA 2REJA 1MY4A 3I6VA 3N26A 3KG2A 2UVJA 1Y9UA 3O6HA 3FJGA 4C1TA 3PPPA 3T66A 2ESNA 4GFRA 3M3LA 1XHYA 1IIWA 3T9VA 3M3KA 3K4UA 3A3CA 5BUUA 4TQUQ 1A40A 1JW1A 2RCBA 5LOMA 4OFLA 1N76A 3CI8A 4LA9A 1NMUA 3V5AA 1FW0A 4PFUA 5DTBA 2FA7A 4HCYA 4TOZA 4U21A 5CC2A 5L8DA 4KFQA 1ZLQA 2YPNA 1SD3A 4EQBA 3L6GA 3KZGA 2GRVA 3MJNA 1MRPA 4PETA 5H8HA 1Y20A 3FGSA 3K6VA 2X26A 3QSLA 1B0LA 3G3IA 3N6UA 4GOTA 1MM6A 4EF1A 3OO6A 4N07A 1ATGA 1TFAA 4H8IA 3PUWE 2Q2CA 4KHZE 3Q29A 3G3KA 3CSGA 2DXRA 1I6AA 4OEVA 1FQAA 4NTLA 3OO9A 5AA2D 4ZE9A 2PT2A 2E1SA 2F7CA 1LCFA 1MY3A 5H8FB 3RTFB 3O66A 4Q30B 1QJMA 5ITOA 1XVYA 2XXYA 1Y4TA 4QRZA 2X7PA 4H8JA 3ZS6A 2GHBA 4OVJA 3IB0A 5TPAB 3TTMA 3EPEA 1VFDA 4ELOA 1JEVA 2ZMBA 4QFKA 4KQPA 3TMGA 2O6AA 1HSEA 2ZNTA 3MVXA 1B40A 3UIFA 1VR5A 4Q5TA 3PUYE 3ZSFA 3HHFA 1ZU0A 4G2ZA 4IGRA 4F19A 1B7ZA 4NF8A 2H25A 1B5IA 3V83A 3H4ZA 2V84A 1IXGA 1MPBA 3EHTA 4X48A 1LLSA 1A8EA 1N7WA 5EHMA 1S9TA 2AL5A 3CR9A 4R75A 1N7XA 1B3GA 3TDJA 3MW0A 3KSJA 1DPEA 1H76A 4IO7A 1GR2A 1MPCA 4R2BA 3RT6B 4FORA 4LZ7A 4ZEIA 1MH3A 1OMPA 1GVCA 1MPDA 3PMVA 1SW2A 3QAXA 4ZDMA 2XX7A 2ZYOA 3MBPA 3UGWA 1UTHA 3LUYA 3O9PA 3DLNA 1MQGA 1QW0A 3CVGA 4E0XA 2QS2A 5F7VA 4JSDA 4H67A 4F3GA 3HN0A 3BFUA 5KZTA 2Q8JA 2PVUA 3TELA 3C33A 2UVHA 4OWDA 3T93B 3K1NA 4R9FA 4AB6A 1MXXA 4NE4A 1QKAA 1QUKA 4OTEA 2H4IA 2HQ0A 3IORA 3LBSA 1QUIA 4LQ2A 4GQOA 4N13A 1ANFA 2IEEA 3KN3A 4GD5A 3K1PA 4JB7A 4QFOA 3TCFA 4PP0A 3VDFA 4OENA 2QS1A 1B5JA 1FQEA 2F78A 2Z8DA 4ZECA 1JW5A 3H06B 5I2KB 5JTYA 4G8HA 3IJOB 1EZOA 1N04A 4OETA 4YKJA 2O69A 3MZ1A 5JEIA 3HSTA 2I3WA 2XXVA 3N6TA 1FTMA 1HSLA 1TFDA 4QSEA 3ECRA 3TFLA 4KPTA 3OD7A 3MVWA 4ND9A 3C35A 3M3FA 2VD3A 1M5DA 3HPIA 2R9JA 4OERA 4F1YA 2I6EA 4R6HA 3SEVA 5L9OA 3VVDA 1A55A 2XXIA 1MQJA 5CMBA 3ILTB 1B3HA 4ZS9A 3QYTA 5H8QA 4DXCA 3FXUA 4H65A 3MPKA 3T22A 2Y7PA 3WAEA 2DWIA 2OJTA 4R73A 5CRYA 2UXAA 3RT8A 4IO2A 4DLDA 4BDNA 2XXPA 4HCWA 4OHNA 4Q0CA 3S9EA 2E0SA 4RNSA 4ELQA 4Z7EA 3GXAA 4EDPA 2AL4A 4F1VA 4HW8A 3U1OA 3CIJA 2ONSA 2F7AA 4QSCA 4X1BA 3RQTA 3H6VA 4KYSA 1A7LA 1QVSA
chains in the Genus database with same CATH superfamily
3C32A 4MFIA 4QXDA 1LBXA 1UIUA 2HHMA 5I57B 4XKQA 4MNCA 2Q8MA 2Z8FA 2HZLA 2THIA 4WEPA 3HCQA 4MF3A 3OELA 3U8QA 1G0HA 1XVXA 1MXUA 5CI5A 4GLIA 2Y7IA 4GXSB 4WEDA 4O8MA 3C31A 2RINA 4G8NA 1TXFA 3CFLA 1IMFA 1FTOA 1VE4A 2O84X 1EH3A 4ZEKA 2F97A 4E0WA 4JWOA 4R6YA 4OVQA 5LTCA 1AL3A 4GBVA 3IOWA 4JDFA 4ZEFA 2HXWA 3CG3A 4H5FA 2PFZA 2UVIA 1IMBA 1IMDA 3T9UA 3S2VA 3ODBA 3A09A 2DVZA 1LBCA 3SETA 3KJTA 3IFAA 4XKPA 1LB8A 4HE2A 4EXLA 4XXUA 3R6UA 3GYYA 1B9JA 4NF5B 4XEQA 3QUJA 3K1MA 1L5TA 1SW5A 2UVGA 1NV3A 4ZZEA 5I58B 5KCJB 1WVJA 1JNFA 4HE0A 4LZ5A 3OEKA 3M8UA 1P1NA 4P0GA 4G77A 2NWJA 2A5TA 4NF6B 3TZAA 2Y5KA 4N81A 3W9VA 2Q89A 1FTKA 2PBWA 3OMBA 4G68B 3S4UA 3QIMA 2ABHA 2RC8A 3PPQA 4UACA 4Z0IA 3PUXE 3TPAA 1P1WA 4C0RA 2V25A 4QF9A 4GWUA 4YKIA 4TLLB 3T9HB 2R6GE 2XXUA 2DQVA 2Z23A 1FPLA 3TQWA 1Q9DA 2PFYA 1NNTA 1UTBB 2AYSA 3FXQA 4NF4B 1NUZA 2CMOA 3KN8A 3LSWA 2VOZA 2VPNA 5ICQA 5CBRA 3H6WA 3PD9A 3MVZA 1Y1MA 4YB6A 1P1QA 3RPWA 1JQFA 5KDTA 1H3DA 5JK4A 3PV0E 2QS3A 1PBPA 1B4HA 4DCYA 5HM4B 1JVXA 1BIYA 2WX9A 2DE4A 1FBDA 4F2QA 3OENA 3KC1A 3TTLA 3PPOA 1MXVA 4DE8A 1B46A 4NWCA 3KC0A 3HHGA 2H98A 3IOVA 1R9LA 2V93A 3FV2A 3UP9A 3B50A 3FIRA 4WXJA 1NV4A 4THIA 1KA1A 2FHYA 4NEDA 5J1DA 5I58A 4GBWA 5EQAA 4H46A 1S7YA 1FPFA 4QHQA 1P1UA 1EYIA 1PDAA 3GBBA 3R26A 4EF2A 1LBVA 4O3AA 1GGGA 4BDQA 3SESA 2F7BA 4NF6A 3SZPA 3UN6A 4XTCQ 4ELRA 3PMWA 1QKBA 4LATA 4BDOA 1IEJA 2H5YA 3UA8A 5A5XB 1EZ9A 3OEMA 3VLWA 3RLFE 2DWJA 1S50A 2F34A 5BWJA 2P3NA 1B58A 1NV5A 1DSNA 4GXAA 2CEYA 5CMKA 4G68C 1BTJA 3S9NC 1DK4A 3PGFA 1H44A 2FNCA 4JBZA 2F3BA 1LCTA 4WKMA 4GIZA 3K2DA 2W7YA 1INPA 3DM0A 1YXIA 4K3FA 2I48A 3SEYA 2DWHA 3EQ1A 1A99A 3U93A 3D1RA 1FQCA 3CSBA 1MXYA 5AE4A 1JW4A 1Z7NE 4R2FA 4Q8RA 1B7HA 5ITPA 2DXYA 2XX9A 2FYIA 4UA8A 3O28A 1SYIA 2ONRA 1GV8A 2B3FA 4XFEA 2DP8A 2I49A 1FPBA 4NG7A 3G3JA 2UYFA 3SEUA 1O64A 3GLBA 4DCXA 1P1OA 1US4A 2V4CA 4YKPA 1CE2A 1YAEA 1DPPA 4PBQA 1MG1A 4PFBA 3SEWA 1IMAA 4YZZA 2B4LA 4GL8A 1VDWA 2QJEA 4IO6A 2NUVA 2OX3A 5FHOA 5DYHA 2V3QA 1FPGA 4NF0A 1SDXA 2I3VA 1JVYA 5K2XA 3OXNA 1H43A 4OEUA 4I1DA 1RYOA 3RUMA 2QRYA 4MBPA 1ZKBA 4XF5A 4KYEA 1I69A 1MQIA 4R9GA 4N6PA 3HO7A 4HE1A 2OK2A 3N5LA 1DCUA 2I4BA 2HXRA 3EHSA 3W9WA 1SI1A 1NUXA 2F8DA 4F3BA 1NNPA 4ZEBA 4IY6A 3O97A 4QFNA 2WEFA 2KLFA 3O29A 2NOOA 3DELB 4IY5A 1PBQA 4FAJA 1NV7A 3CHGA 1FBFA 1NNKA 3SEXA 4PGPA 3PPNA 5H8FA 4X04A 2ZZWA 1NNFA 2H9BA 1IXCA 4QSDA 3D4GA 4PF6A 4YAHX 5TPAA 2DE3A 3FVKA 3MAMA 4BLAA 2ZYKA 1FCKA 2OCUA 4MIJA 2CZHA 1POY1 1A8FA 1PB8A 4FE8A 4GRKA 5DEXB 1ELJA 4I40A 4YU0A 4IB2A 4UABA 4MX6A 3K02A 2Z8EA 3H3GA 3KOSA 4PDHA 1UQWA 3MPLA 3EHUA 1RKMA 1TT1A 3ISPA 3PUVE 5CM6A 1JETA 3SDFA 1LFHA 4U2RA 4L17A 2XXTA 4R74A 1R1NA 2UYEA 3MZBA 5CMCA 1VSOA 4NN3A 1OQHA 5AA2B 4RYAA 3TTNA 3IB1A 4P11A 3A3UA 3D4CA 1XOCA 3PMXA 3THIA 3IR1A 4QFLA 4F2OA 2WKYA 1NI9A 5ICTA 2P1SA 3KN7A 3TYHA 4EXKA 3IO4A 5B70A 3C36A 1AH5A 5FTIA 1NH8A 3B7DA 3IOTA 3Q27A 4X8RA 4PAKA 1I6BA 1ZTYA 4X9TA 2ZNUA 3K6WA 2OZZA 3H03A 1FBCA 2B4MA 2B3BA 4O3CA 3BIGA 5I56B 5IAIA 3B6TA 4U1ZA 4YKKA 4OA4A 3PUZE 3VV5A 2Q74A 2QPQA 1ZMGA 4ZZAA 5EYGA 3JZJA 2DS9A 2RCAA 3U94A 4OMBA 3BIHA 2O1LA 3K00A 4OVPA 4G8MA 4PDDA 1KA0A 3DP4A 1IMEA 3KBZA 4RA1A 1BLFA 2ONKE 4PFWA 4OFJA 1N3XA 5I59B 4BDLA 1ZBMA 1NFTA 1OVTA 4QFPA 4M4GA 3I3VA 1BP5A 1LAFE 4LQ5A 2WYKA 3TTKA 2H99A 2Y5LA 5EQ9A 3IO6A 1EU8A 1FQFA 5I2KA 3S9MC 1FTAA 3RTWB 3IK6B 1Z7ME 2HEUA 1PC3A 3IOUA 2VGQA 3OO8A 5AA2A 2D5WA 3W15C 1FBHA 3C4MA 3CFXA 4EUOA 1Y3NA 3SKPA 4H5GA 3KBRA 1LFIA 2VP1A 4NHBA 1IITA 3ONMA 3H6UA 3E13X 1JEUA 4N4UA 1FSAA 1K9ZA 1LFGA 3TEPA 1FBPA 4AS4A 4OVRA 3GBAA 3VFJA 2XD2A 2HCAA 1A54A 1F9BA 1LBYA 1DTZA 4P8BA 2OWTA 3MZ9A 2F35A 3B6WA 4P9KA 2ZZXA 5DVIA 4FEDA 3LUZA 4PFTA 4R6KA 1FPKA 1DOTA 4LP2B 4H45A 1AWBA 3LSFB 5H8NB 2Q88A 4P56A 5EQ8A 5I56A 1N84A 5L9MA 4JXIA 1NUYA 2RF1A 3FZVA 3FBPA 3KJ7A 4F1UA 5F1QA 4DZ1A 2FIXA 2Q2AA 3PU5A 2F6PA 3DP8A 3ILUB 2V3UA 4ELPA 5CBSA 4ZE8A 3IX1A 4OESA 2DDKA 3FUZA 2L5VA 5M2VA 3K0VA 3B8BA 3H7MA 1B2HA 4LVQA 2I4CA 1TWYA 1M5FA 4OFOA 2O1MA 1KWHA 5I57A 4N6DA 3E79A 1FBEA 4MJOA 3EF7A 4MAGA 2ANJA 3FVNA 3TKDA 1WDNA 4F3PA 1B5HA 1FJ9A 2PCRA 3MP6A 3JYRA 3O6GA 3O2AA 4F3SA 3KEIA 4PCDA 4ISUA 1OLCA 1IMCA 1UIVA 5IKBA 5ET7A 4O7IA 4KD5A 4HS7A 4PAFA 3IAZA 3PPRA 2PMSA 5DVJA 4BDRA 1B52A 1BK4A 3P7IA 5EHSA 2NVUB 4F22A 3U72A 1URDA 2OBGA 3PD8A 1LBWA 2PYYA 2ZYNA 3RY3A 1MXZA 3N94A 2YJPA 4DXBA 2GQ1A 3B6QA 1FTJA 2XHDA 4XIGQ 2LAOA 1CB6A 1MS7A 1DTGA 3KGCA 2R71A 1SQYA 1GTKA 5DVFA 3FD3A 2GH9A 3T0JA 3O6IA 3OOAA 1MM7A 4KXPA 5H8NA 2ZYMA 3TUSA 4F39A 4YICA 1SW4A 4NGUA 4NF5A 3H6TA 4AS5A 3ROJA 1AIVA 5IZZA 1B32A 3WAFA 2XXXA 1EYJA 2YLNA 3MC2A 5KCJA 1LB9A 5EYHA 5EYFA 3DP6A 3VE1B 4U23A 1MH4A 4P0IA 4XKNA 5DW8A 3RN8A 5T3JA 4JWYA 3OSQA 2XA5A 2XXHA 2HAUA 2P3VA 3TAJA 4NWDA 3VVFA 1H45A 4G68A 4NF8B 1SI0A 1DBZA 1QULA 2QS4A 3C34A 4RK9A 4M1VA 3K01A 1K9YA 5TP9B 1B1HA 3R7XA 2CEXA 4PAIA 3MVYA 3T96B 3G3HA 3QXMA 3UORA 2XXQA 3BKIB 2ZNSA 2PX1A 5J16A 1LAHE 3F11A 1UTBA 4NF4A 2XXWA 4DIGA 1D9YA 1LSTA 4C1UA 4NAPA 4RPNA 2RC9A 3ZKLA 1URGA 5H8SA 3IJXB 4RJZA 3MWBA 4JWXA 2XWVA 4F31B 4H6DA 2QMXA 2I0BA 1B05A 1O7TA 2V3TA 4JSOA 1B7UA 3TQLA 4YB7A 3KSXA 4PFRA 3LSLA 4GL0A 2DVCA 4QBAA 4YMBA 1UTHB 5IZ1A 1Q1KA 3LR1A 1SYHA 2M8CA 5CMMA 2PT1A 4N6KA 2I58A 4F29A 4PFYA 3V89B 4N8GA 1QUJA 2Y84A 1Y3PA 1RDYA 3BBRA 2QVRA 3TTRA 3VLVA 5ET6A 2OWZA 3FXRA 4IO5A 2XXKA 3K6UA 5I3SA 4FBPA 3U92A 1R9QA 4GX6A 1FQDA 3QUFA 2RKMA 1B3LA 4O7MA 2ZZVA 3Q28A 4O94A 2DYXA 3T9XB 4NX1A 2X7QA 3MUQA 4MHFA 1Y1ZA 3SERA 4GF8A 1HSJA 4PGNA 5JTYB 1M5EA 5A5XA 2P2AA 1RYXA 5TP9A 1NV6A 2CZIA 4FATA 4RK2A 1I6QA 3E78A 1FTLA 4MLQA 2O51A 3TODA 1J1NA 1O63A 4GWOA 4P3LA 4U4XA 1FJ6A 3VXBA 2XWIA 1NH7A 3IB2A 2QSXA 3OSRA 4GX3A 4H0WA 2OLBA 1MDQA 4MLVA 2XXRA 4LN5A 1D3KA 1B1XA 1MXWA 1MY2A 3FJ7A 1NV2A 1PB7A 5H8QB 1YYZA 4R72A 5HBCA 3KFMA 1NKXA 1FBGA 2A5SA 2QVUA 1SVXB 1XT8A 4JVCA 1US5A 1MY1A 1II5A 3FJMA 3G3FA 3QK6A 1YTVA 2B65A 2DWAA 2P0SA 4FIMA 4OQOA 3G3GA 1LAXA 5AA3A 5ISUA 4ZEDA 2DOJA 1MQHA 1FPIA 3Q26A 4GVOA 4HTGA 4BDMA 3EN3A 2O7UA 4F18A 5K2YA 1SBPA 1B0HA 3CFZA 4KR5A 4U22A 4OZ9A 4OVTA 1XC1A 4I8CA 3ZKKA 3E4RA 4FJPA 2XD3A 5FHMA 3LSXA 1PB9A 1MY0A 5ELVA 4IGTA 1VFEA 4EQ9A 2D3IA 4POXA 3MQ9A 1SW1A 1LGBC 2WBBA 4KYDA 4RY1A 1B3EA 3U65A 4FECA 5ET5A 3CG1A 4KCCA 3I5OA 1ZJLA 1IQ7A 1DMBA 1LAGE 2HFBA 4I3EA 4PQJA 4AQ4A 5DT6A 1M5CA 2QL3A 1OVBA 3GZGA 3C9HA 4MNIA 5AA4B 4I62A 3VLUA 1LEVA 3QMFA 3RYDA 2Q9TA 5TU0A 3FVOA 3VVEA 4H1XA 1P99A 1R6ZA 2F36A 4PF8A 2O68A 3FV1A 4ESXA 4X1DA 4ECFA 2NXOA 4TLMB 1USYH 2I0CA 1D9VA 5ESYA 2VD2A 3T1BA 2DSFA 2AIXA 1IZ1A 4LUBA 3L6HA 2BJJX 4DI4B 3IL1B 5DEXA 1AMFA 5FHNA 4LONB 1YPNA 4U4SA 4POWA 5I2NB 5L9SA 2Y7WA 5B7DA 1IXIA 1USYE 2O7IA 1MQDA 3LC8A 2A5TB 4IO4A 1NUWA 1LBBA 2D21A 2GHAA 4PC9A 4I9DA 3TCGA 2JJKA 3A29A 2IA4A 3KOTA 4MH5A 3OO7A 1FPJA 2QMWA 1B6HA 4PE5B 5ET8A 2QVVA 4AB5A 4OYVA 4LZ8A 5HPQA 3CRBA 4I3YA 1D4NA 1OLAA 1B51A 4GWWA 3NOHA 4YB5A 3Q25A 3S9LC 2HZKA 3RGYA 3VXCA 4GX4A 5AA4A 4PTKA 3E3KA 2VHAA 5KDTB 3FATA 2REGA 4RPOA 3FVGA 3RNNA 3JV9A 1M5BA 3MP1A 2XWKA 1MDP1 2G29A 4ESWA 2RC7A 1URSA 4IR8A 4RXLA 2CZLA 1OIBA 1XS5A 2ALUA 3FASA 4EQ7A 1Y3QA 4U1OA 1Q35A 4GWYA 3UK4A 1B3FA 1KZ8A 1T0KA 5IM2A 3TCHA 1EZPA 1Y4CA 4FEBA 3MP8A 4NMYA 4P1LA 5I59A 4OANA 4KI0E 3USDA 3RPLB 5I2NA 1IUDA 2Y7RA 5AA1A 3E9XA 2F6GA 1FQBA 4DXUA 3LV0A 5H8HB 5FTHA 1CNQA 2F5XA 4O3BA 2ZXTA 1IXHA 3PTYA 3BFTA 3V8XB 4PE3A 2XWOA 1N0TA 2DE2A 1NL5A 4NQ8A 1POTA 2OWSA 2HAVA 4G4PA 4IO3A 1B4ZA 2Y7KA 1AOVA 1YCJA 1BKAA 1OQGA 4GWSA 1FPDA 1ZIUA 3MYUA 4XKRA 2XX8A 3AXFA 2GFEA 2VT5A 2G93A 4ONYA 5I84A 3HV1A 3HFUA 2FBPA 4OXVA 3K6XA 1N3WA 4DDDA 2Z22A 4YMAA 1WODA 4KCDA 1PEBA 3G7WA 2REJA 1MY4A 3I6VA 3N26A 2KR0A 3KG2A 2UVJA 1Y9UA 2R8TA 3O6HA 3FJGA 4C1TA 3PPPA 3T66A 2ESNA 4N8YA 4GFRA 3M3LA 1XHYA 1IIWA 3T9VA 3M3KA 3K4UA 3A3CA 5BUUA 4TQUQ 1A40A 1JW1A 2RCBA 5LOMA 4OFLA 1N76A 5FBPA 3CI8A 4LA9A 1NMUA 3V5AA 1FW0A 4PFUA 5DTBA 2FA7A 4HCYA 1XI6A 4TOZA 4U21A 5CC2A 5L8DA 4KFQA 5I5PA 1ZLQA 3RPLA 2YPNA 1SD3A 4EQBA 4OVSA 3L6GA 3KZGA 1SPIA 2QFLA 2GRVA 3MJNA 1MRPA 4PETA 5H8HA 1NV1A 2BJIA 1Y20A 3FGSA 3K6VA 2X26A 4MNPA 3QSLA 1B0LA 3G3IA 3N6UA 4GOTA 5I7IA 1MM6A 4EF1A 3OO6A 4N07A 4P1EA 1ATGA 1TFAA 4H8IA 3PUWE 5IGAA 2VPOA 2Q2CA 4KHZE 3Q29A 3G3KA 3CSGA 2DXRA 2MKZA 3FXBA 1I6AA 4OEVA 1FQAA 4NTLA 4N91A 3OO9A 4HXVA 5AA2D 4ZE9A 2PT2A 2E1SA 2F7CA 1LCFA 2KQZA 1MY3A 5H8FB 3RTFB 3O66A 4Q30B 1QJMA 5ITOA 1XVYA 2XXYA 1Y4TA 4QRZA 2X7PA 4H8JA 3ZS6A 2GHBA 4P47A 4OVJA 3IB0A 5TPAB 4GWXA 3TTMA 3EPEA 1VFDA 4ELOA 1JEVA 4QFKA 2ZMBA 4KQPA 3TMGA 2O6AA 4MCOA 1QGXA 1HSEA 2ZNTA 3MVXA 1B40A 3UIFA 1RDZA 1VR5A 4Q5TA 3PUYE 3ZSFA 3HHFA 1ZU0A 4G2ZA 4IGRA 4F19A 1RDXA 1B7ZA 4NF8A 5A5LA 2H25A 1B5IA 3V83A 3H4ZA 2V84A 1IXGA 1MPBA 1FPEA 3EHTA 4X48A 1LLSA 1A8EA 1G0IA 1N7WA 5EHMA 1S9TA 2AL5A 3CR9A 4R75A 1N7XA 5EQ7A 1B3GA 3TDJA 3MW0A 3KSJA 1DPEA 4PBHA 1H76A 4IO7A 1GR2A 1MPCA 1EYKA 4R2BA 3RT6B 4FORA 4PFIA 4LZ7A 4ZEIA 1MH3A 1OMPA 1GVCA 1MPDA 3PMVA 1SW2A 3QAXA 4ZDMA 2XX7A 1NV0A 2ZYOA 3MBPA 3UGWA 1UTHA 3LUYA 3O9PA 3DLNA 1MQGA 1QW0A 3CVGA 4E0XA 2QS2A 5F7VA 4JSDA 1FRPA 2F3DA 2FVZA 4H67A 4F3GA 3HN0A 3BFUA 5KZTA 2WBDA 2Q8JA 4JVDA 2PVUA 3TELA 3C33A 5IZ3B 2UVHA 4OWDA 3T93B 3K1NA 4R9FA 4AB6A 1MXXA 4N17A 4NE4A 1QKAA 1QUKA 1LBZA 4OTEA 2H4IA 2HQ0A 3IORA 3LBSA 3IFCA 1QUIA 4LQ2A 4GQOA 4N13A 1ANFA 2IEEA 3KN3A 4GD5A 3K1PA 4JB7A 4QFOA 3TCFA 4PP0A 3VDFA 4OENA 2QS1A 1B5JA 1FQEA 2F78A 2Z8DA 4ZECA 1JW5A 3H06B 5I2KB 5JTYA 4G8HA 4MMPA 3IJOB 4G61A 1EZOA 1N04A 4OETA 4YKJA 4MEVA 2O69A 3MZ1A 5JEIA 3HSTA 2I3WA 2XXVA 3N6TA 1FTMA 1JP4A 1HSLA 3EKIA 5LDZA 1TFDA 4QSEA 3ECRA 4KPTA 3TFLA 3OD7A 3MVWA 4ND9A 3C35A 3M3FA 2VD3A 1M5DA 3HPIA 2R9JA 4OERA 4DI3D 4F1YA 2WYPA 2I6EA 4R6HA 3SEVA 5L9OA 3VVDA 5F24A 1A55A 2XXIA 1MQJA 5CMBA 3ILTB 3MSTA 1B3HA 4ZS9A 3QYTA 5H8QA 4DXCA 3FXUA 4H65A 3MPKA 3T22A 2Y7PA 3WAEA 2DWIA 2OJTA 4R73A 1D9QA 5CRYA 2UXAA 3RT8A 4IO2A 4DLDA 4BDNA 2XXPA 4HCWA 4OHNA 4Q0CA 3S9EA 2E0SA 4RNSA 5IZ3A 2HPGA 4GWZA 4ELQA 4Z7EA 3GXAA 4EDPA 2AL4A 4JVIA 4F1VA 4HW8A 3U1OA 3CIJA 2ONSA 4N15A 2CZKA 2F7AA 4QSCA 2FIEA 1YZ0A 4X1BA 3RQTA 3H6VA 4KYSA 1A7LA 1QVSA
chains in the Genus database with same CATH topology
3C32A 4MFIA 1UIUA 5I57B 4XKQA 2Z8FA 2HZLA 2THIA 4WEPA 3HCQA 4MF3A 3OELA 3U8QA 1XVXA 1MXUA 5CI5A 4GLIA 2Y7IA 4GXSB 4WEDA 3C31A 2RINA 4G8NA 1TXFA 3CFLA 1FTOA 1VE4A 2O84X 1EH3A 4ZEKA 2F97A 4E0WA 4JWOA 4R6YA 1AL3A 3IOWA 4JDFA 4ZEFA 2HXWA 3CG3A 4H5FA 2UVIA 3T9UA 3S2VA 3ODBA 3A09A 2DVZA 1LBCA 3SETA 3KJTA 4XKPA 1LB8A 4EXLA 4XXUA 3R6UA 1B9JA 4NF5B 3QUJA 3K1MA 1L5TA 1SW5A 2UVGA 4ZZEA 5I58B 5KCJB 1WVJA 1JNFA 4LZ5A 3OEKA 3M8UA 1P1NA 4P0GA 4G77A 2NWJA 2A5TA 4NF6B 3TZAA 3W9VA 2Q89A 1FTKA 2PBWA 3OMBA 4G68B 3S4UA 3QIMA 2ABHA 2RC8A 3PPQA 4UACA 4Z0IA 3PUXE 3TPAA 1P1WA 4C0RA 2V25A 4QF9A 4YKIA 4TLLB 3T9HB 2R6GE 2XXUA 2DQVA 2Z23A 3TQWA 1NNTA 1UTBB 2AYSA 3FXQA 4NF4B 2CMOA 3KN8A 3LSWA 2VOZA 5ICQA 5CBRA 3H6WA 3PD9A 3MVZA 1Y1MA 4YB6A 1P1QA 3RPWA 1JQFA 5KDTA 1H3DA 5JK4A 3PV0E 2QS3A 1PBPA 1B4HA 4DCYA 5HM4B 1JVXA 1BIYA 2DE4A 4F2QA 3OENA 3TTLA 3PPOA 1MXVA 4DE8A 1B46A 4NWCA 3HHGA 2H98A 3IOVA 1R9LA 2V93A 3FV2A 3UP9A 3FIRA 4WXJA 4THIA 4NEDA 5J1DA 5I58A 1S7YA 4QHQA 1P1UA 1PDAA 3GBBA 3R26A 4EF2A 4O3AA 1GGGA 4BDQA 3SESA 2F7BA 4NF6A 3UN6A 4XTCQ 4ELRA 3PMWA 1QKBA 4LATA 4BDOA 1IEJA 2H5YA 3UA8A 5A5XB 1EZ9A 3OEMA 3VLWA 3RLFE 2DWJA 1S50A 2F34A 5BWJA 1B58A 1DSNA 4GXAA 5CMKA 4G68C 1BTJA 3S9NC 3PGFA 1H44A 2FNCA 4JBZA 1LCTA 4WKMA 4GIZA 3K2DA 2W7YA 3DM0A 4K3FA 2I48A 3SEYA 2DWHA 3EQ1A 1A99A 3U93A 1FQCA 3CSBA 1MXYA 5AE4A 1JW4A 1Z7NE 4R2FA 4Q8RA 1B7HA 5ITPA 2DXYA 2XX9A 2FYIA 4UA8A 3O28A 1SYIA 2ONRA 1GV8A 2B3FA 2DP8A 2I49A 3SEUA 3G3JA 2UYFA 1O64A 3GLBA 4DCXA 1P1OA 1US4A 4YKPA 1CE2A 1YAEA 1DPPA 1MG1A 3SEWA 4YZZA 4GL8A 2QJEA 4IO6A 2NUVA 5FHOA 5DYHA 2V3QA 1SDXA 2I3VA 1JVYA 5K2XA 3OXNA 1H43A 4OEUA 4I1DA 1RYOA 3RUMA 2QRYA 4MBPA 1ZKBA 4KYEA 1I69A 1MQIA 4R9GA 4N6PA 3HO7A 2OK2A 3N5LA 2I4BA 3EHSA 3W9WA 1SI1A 2F8DA 4F3BA 1NNPA 4ZEBA 4IY6A 3O97A 4QFNA 2KLFA 3O29A 2NOOA 3DELB 4IY5A 1PBQA 4FAJA 1NNKA 3SEXA 3PPNA 5H8FA 1NNFA 2H9BA 1IXCA 4QSDA 3D4GA 4YAHX 5TPAA 2DE3A 3FVKA 3MAMA 4BLAA 2ZYKA 1FCKA 2OCUA 1POY1 1A8FA 1PB8A 4FE8A 4GRKA 5DEXB 1ELJA 4YU0A 4IB2A 3K02A 2Z8EA 3H3GA 3KOSA 1UQWA 3MPLA 3EHUA 1RKMA 1TT1A 3PUVE 5CM6A 1JETA 3SDFA 1LFHA 4U2RA 4L17A 2XXTA 4R74A 1R1NA 2UYEA 3MZBA 5CMCA 1VSOA 1OQHA 5AA2B 4RYAA 3TTNA 3IB1A 4P11A 3A3UA 3D4CA 1XOCA 3PMXA 3THIA 3IR1A 4QFLA 4F2OA 2WKYA 5ICTA 2P1SA 3KN7A 3TYHA 4EXKA 3IO4A 5B70A 3C36A 1AH5A 5FTIA 1NH8A 3B7DA 3IOTA 3Q27A 1I6BA 1ZTYA 4X9TA 2ZNUA 3K6WA 2OZZA 3H03A 2B3BA 4O3CA 5I56B 5IAIA 3B6TA 4U1ZA 4YKKA 3PUZE 3VV5A 2QPQA 1ZMGA 4ZZAA 3JZJA 2DS9A 2RCAA 3U94A 4OMBA 2O1LA 3K00A 4G8MA 3DP4A 4RA1A 1BLFA 2ONKE 4PFWA 4OFJA 1N3XA 5I59B 4BDLA 1ZBMA 1NFTA 1OVTA 4QFPA 4M4GA 3I3VA 1BP5A 1LAFE 4LQ5A 3TTKA 2H99A 3IO6A 1EU8A 1FQFA 5I2KA 3S9MC 3RTWB 3IK6B 1Z7ME 2HEUA 1PC3A 3IOUA 2VGQA 3OO8A 5AA2A 2D5WA 3W15C 3C4MA 3CFXA 4EUOA 1Y3NA 3SKPA 4H5GA 3KBRA 1LFIA 2VP1A 1IITA 3ONMA 3H6UA 3E13X 1JEUA 1LFGA 3TEPA 3GBAA 3VFJA 2XD2A 2HCAA 1A54A 1F9BA 1DTZA 2OWTA 3MZ9A 2F35A 3B6WA 5DVIA 4FEDA 4PFTA 4R6KA 1DOTA 4LP2B 3LSFB 5H8NB 2Q88A 5I56A 1N84A 5L9MA 4JXIA 2RF1A 3FZVA 3KJ7A 4F1UA 5F1QA 4DZ1A 2Q2AA 3PU5A 2F6PA 3DP8A 3ILUB 2V3UA 4ELPA 5CBSA 4ZE8A 3IX1A 4OESA 3FUZA 5M2VA 3K0VA 3H7MA 1B2HA 4LVQA 2I4CA 1TWYA 1M5FA 4OFOA 2O1MA 1KWHA 5I57A 3EF7A 2ANJA 3FVNA 3TKDA 1WDNA 4F3PA 1B5HA 3MP6A 3JYRA 3O6GA 3O2AA 4F3SA 3KEIA 4ISUA 1OLCA 1UIVA 5IKBA 4KD5A 4HS7A 3IAZA 3PPRA 2PMSA 5DVJA 4BDRA 1B52A 3P7IA 5EHSA 2NVUB 4F22A 3U72A 1URDA 2OBGA 2PYYA 3PD8A 2ZYNA 3RY3A 1MXZA 3N94A 2YJPA 4DXBA 3B6QA 1FTJA 2XHDA 4XIGQ 2LAOA 1CB6A 1MS7A 1DTGA 3KGCA 2R71A 1SQYA 1GTKA 5DVFA 3FD3A 2GH9A 3O6IA 3OOAA 1MM7A 5H8NA 2ZYMA 3TUSA 4F39A 4YICA 1SW4A 4NF5A 3H6TA 1AIVA 1B32A 3WAFA 2XXXA 2YLNA 3MC2A 5KCJA 1LB9A 5EYFA 3DP6A 3VE1B 4U23A 1MH4A 4P0IA 4XKNA 3RN8A 4JWYA 3OSQA 2XXHA 2HAUA 3TAJA 4NWDA 3VVFA 1H45A 4G68A 4NF8B 1SI0A 1QULA 2QS4A 3C34A 4RK9A 4M1VA 3K01A 5TP9B 1B1HA 3R7XA 3MVYA 3T96B 3G3HA 3QXMA 3UORA 2XXQA 3BKIB 2ZNSA 2PX1A 1LAHE 3F11A 1UTBA 4NF4A 2XXWA 4DIGA 1D9YA 1LSTA 4C1UA 4RPNA 2RC9A 3ZKLA 1URGA 5H8SA 3IJXB 4RJZA 3MWBA 4JWXA 4F31B 4H6DA 2QMXA 2I0BA 1B05A 1O7TA 2V3TA 4JSOA 1B7UA 3TQLA 4YB7A 3KSXA 3LSLA 4GL0A 2DVCA 4YMBA 1UTHB 1Q1KA 3LR1A 1SYHA 2M8CA 5CMMA 2PT1A 2I58A 4F29A 4PFYA 3V89B 1QUJA 2Y84A 1Y3PA 3BBRA 3TTRA 3VLVA 3FXRA 4IO5A 3K6UA 3U92A 1R9QA 1FQDA 3QUFA 2RKMA 1B3LA 3Q28A 2DYXA 3T9XB 2X7QA 3MUQA 1Y1ZA 3SERA 4GF8A 1HSJA 5JTYB 1M5EA 5A5XA 2P2AA 1RYXA 5TP9A 4FATA 4RK2A 1I6QA 1FTLA 4MLQA 2O51A 3TODA 1J1NA 1O63A 4GWOA 4U4XA 3VXBA 1NH7A 3IB2A 2QSXA 3OSRA 4H0WA 2OLBA 1MDQA 4MLVA 2XXRA 1D3KA 1B1XA 1MXWA 1MY2A 3FJ7A 1PB7A 5H8QB 4R72A 5HBCA 3KFMA 1NKXA 2A5SA 1SVXB 1XT8A 1US5A 1MY1A 1II5A 3FJMA 3G3FA 3QK6A 1YTVA 2B65A 2DWAA 2P0SA 4FIMA 4OQOA 3G3GA 1LAXA 5AA3A 5ISUA 4ZEDA 2DOJA 1MQHA 3Q26A 4GVOA 4HTGA 4BDMA 3EN3A 2O7UA 4F18A 5K2YA 1SBPA 1B0HA 3CFZA 4KR5A 4U22A 4OZ9A 1XC1A 4I8CA 3ZKKA 3E4RA 4FJPA 2XD3A 5FHMA 3LSXA 1PB9A 1MY0A 5ELVA 4IGTA 1VFEA 4EQ9A 2D3IA 4POXA 3MQ9A 1SW1A 1LGBC 4KYDA 4RY1A 1B3EA 4FECA 3CG1A 4KCCA 3I5OA 1ZJLA 1IQ7A 1DMBA 1LAGE 2HFBA 4PQJA 4AQ4A 5DT6A 1M5CA 2QL3A 1OVBA 3GZGA 3C9HA 5AA4B 4I62A 3VLUA 2Q9TA 5TU0A 3FVOA 3VVEA 4H1XA 1P99A 1R6ZA 2F36A 2O68A 3FV1A 4ESXA 4X1DA 4ECFA 2NXOA 4TLMB 1USYH 2I0CA 1D9VA 2VD2A 2DSFA 2AIXA 1IZ1A 4LUBA 3L6HA 2BJJX 3IL1B 5DEXA 1AMFA 5FHNA 4LONB 1YPNA 4U4SA 4POWA 5I2NB 5L9SA 2Y7WA 5B7DA 1IXIA 1USYE 2O7IA 1MQDA 3LC8A 2A5TB 4IO4A 2D21A 1LBBA 2GHAA 4I9DA 3TCGA 2IA4A 3KOTA 4MH5A 3OO7A 2QMWA 1B6HA 4PE5B 4AB5A 4OYVA 4LZ8A 5HPQA 3CRBA 1D4NA 1OLAA 1B51A 4YB5A 3Q25A 3S9LC 2HZKA 3RGYA 3VXCA 5AA4A 3E3KA 2VHAA 5KDTB 3FATA 2REGA 4RPOA 3FVGA 3RNNA 3JV9A 1M5BA 3MP1A 1MDP1 2G29A 4ESWA 2RC7A 1URSA 4RXLA 2CZLA 1OIBA 1XS5A 2ALUA 3FASA 4EQ7A 1Y3QA 4U1OA 1Q35A 3UK4A 1B3FA 1T0KA 3TCHA 1EZPA 1Y4CA 4FEBA 3MP8A 4NMYA 5I59A 4KI0E 3USDA 5I2NA 1IUDA 2Y7RA 5AA1A 3E9XA 2F6GA 1FQBA 4DXUA 5H8HB 5FTHA 2F5XA 4O3BA 2ZXTA 1IXHA 3V8XB 3BFTA 1N0TA 2DE2A 1NL5A 1POTA 2OWSA 2HAVA 4G4PA 4IO3A 1B4ZA 2Y7KA 1AOVA 1YCJA 1BKAA 1OQGA 1ZIUA 4XKRA 2XX8A 3AXFA 2GFEA 2G93A 4ONYA 5I84A 3HV1A 4OXVA 3K6XA 1N3WA 4DDDA 2Z22A 4YMAA 1WODA 4KCDA 1PEBA 3G7WA 2REJA 1MY4A 3I6VA 3N26A 3KG2A 2UVJA 1Y9UA 3O6HA 3FJGA 4C1TA 3PPPA 3T66A 2ESNA 4GFRA 3M3LA 1XHYA 1IIWA 3T9VA 3M3KA 3K4UA 3A3CA 5BUUA 4TQUQ 1A40A 1JW1A 2RCBA 5LOMA 4OFLA 1N76A 3CI8A 4LA9A 1NMUA 3V5AA 1FW0A 4PFUA 5DTBA 2FA7A 4HCYA 4TOZA 4U21A 5CC2A 5L8DA 4KFQA 1ZLQA 2YPNA 1SD3A 4EQBA 3L6GA 3KZGA 2GRVA 3MJNA 1MRPA 4PETA 5H8HA 1Y20A 3FGSA 3K6VA 2X26A 3QSLA 1B0LA 3G3IA 3N6UA 4GOTA 1MM6A 4EF1A 3OO6A 4N07A 1ATGA 1TFAA 4H8IA 3PUWE 2Q2CA 4KHZE 3Q29A 3G3KA 3CSGA 2DXRA 1I6AA 4OEVA 1FQAA 4NTLA 3OO9A 5AA2D 4ZE9A 2PT2A 2E1SA 2F7CA 1LCFA 1MY3A 5H8FB 3RTFB 3O66A 4Q30B 1QJMA 5ITOA 1XVYA 2XXYA 1Y4TA 4QRZA 2X7PA 4H8JA 3ZS6A 2GHBA 4OVJA 3IB0A 5TPAB 3TTMA 3EPEA 1VFDA 4ELOA 1JEVA 2ZMBA 4QFKA 4KQPA 3TMGA 2O6AA 1HSEA 2ZNTA 3MVXA 1B40A 3UIFA 1VR5A 4Q5TA 3PUYE 3ZSFA 3HHFA 1ZU0A 4G2ZA 4IGRA 4F19A 1B7ZA 4NF8A 2H25A 1B5IA 3V83A 3H4ZA 2V84A 1IXGA 1MPBA 3EHTA 4X48A 1LLSA 1A8EA 1N7WA 5EHMA 1S9TA 2AL5A 3CR9A 4R75A 1N7XA 1B3GA 3TDJA 3MW0A 3KSJA 1DPEA 1H76A 4IO7A 1GR2A 1MPCA 4R2BA 3RT6B 4FORA 4LZ7A 4ZEIA 1MH3A 1OMPA 1GVCA 1MPDA 3PMVA 1SW2A 3QAXA 4ZDMA 2XX7A 2ZYOA 3MBPA 3UGWA 1UTHA 3LUYA 3O9PA 3DLNA 1MQGA 1QW0A 3CVGA 4E0XA 2QS2A 5F7VA 4JSDA 4H67A 4F3GA 3HN0A 3BFUA 5KZTA 2Q8JA 2PVUA 3TELA 3C33A 2UVHA 4OWDA 3T93B 3K1NA 4R9FA 4AB6A 1MXXA 4NE4A 1QKAA 1QUKA 4OTEA 2H4IA 2HQ0A 3IORA 3LBSA 1QUIA 4LQ2A 4GQOA 4N13A 1ANFA 2IEEA 3KN3A 4GD5A 3K1PA 4JB7A 4QFOA 3TCFA 4PP0A 3VDFA 4OENA 2QS1A 1B5JA 1FQEA 2F78A 2Z8DA 4ZECA 1JW5A 3H06B 5I2KB 5JTYA 4G8HA 3IJOB 1EZOA 1N04A 4OETA 4YKJA 2O69A 3MZ1A 5JEIA 3HSTA 2I3WA 2XXVA 3N6TA 1FTMA 1HSLA 1TFDA 4QSEA 3ECRA 3TFLA 4KPTA 3OD7A 3MVWA 4ND9A 3C35A 3M3FA 2VD3A 1M5DA 3HPIA 2R9JA 4OERA 4F1YA 2I6EA 4R6HA 3SEVA 5L9OA 3VVDA 1A55A 2XXIA 1MQJA 5CMBA 3ILTB 1B3HA 4ZS9A 3QYTA 5H8QA 4DXCA 3FXUA 4H65A 3MPKA 3T22A 2Y7PA 3WAEA 2DWIA 2OJTA 4R73A 5CRYA 2UXAA 3RT8A 4IO2A 4DLDA 4BDNA 2XXPA 4HCWA 4OHNA 4Q0CA 3S9EA 2E0SA 4RNSA 4ELQA 4Z7EA 3GXAA 4EDPA 2AL4A 4F1VA 4HW8A 3U1OA 3CIJA 2ONSA 2F7AA 4QSCA 4X1BA 3RQTA 3H6VA 4KYSA 1A7LA 1QVSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3C32 A;  4MFI A;  1UIU A;  5I57 B;  4XKQ A;  2Z8F A;  2HZL A;  2THI A;  4WEP A;  3HCQ A;  4MF3 A;  3OEL A;  3U8Q A;  1XVX A;  1MXU A;  5CI5 A;  4GLI A;  2Y7I A;  4GXS B;  4WED A;  3C31 A;  2RIN A;  4G8N A;  1TXF A;  3CFL A;  1FTO A;  1VE4 A;  2O84 X;  1EH3 A;  4ZEK A;  2F97 A;  4E0W A;  4JWO A;  4R6Y A;  1AL3 A;  3IOW A;  4JDF A;  4ZEF A;  2HXW A;  3CG3 A;  4H5F A;  2UVI A;  3T9U A;  3S2V A;  3ODB A;  3A09 A;  2DVZ A;  1LBC A;  3SET A;  3KJT A;  4XKP A;  1LB8 A;  4EXL A;  4XXU A;  3R6U A;  1B9J A;  4NF5 B;  3QUJ A;  3K1M A;  1L5T A;  1SW5 A;  2UVG A;  4ZZE A;  5I58 B;  5KCJ B;  1WVJ A;  1JNF A;  4LZ5 A;  3OEK A;  3M8U A;  1P1N A;  4P0G A;  4G77 A;  2NWJ A;  2A5T A;  4NF6 B;  3TZA A;  3W9V A;  2Q89 A;  1FTK A;  2PBW A;  3OMB A;  4G68 B;  3S4U A;  3QIM A;  2ABH A;  2RC8 A;  3PPQ A;  4UAC A;  4Z0I A;  3PUX E;  3TPA A;  1P1W A;  4C0R A;  2V25 A;  4QF9 A;  4YKI A;  4TLL B;  3T9H B;  2R6G E;  2XXU A;  2DQV A;  2Z23 A;  3TQW A;  1NNT A;  1UTB B;  2AYS A;  3FXQ A;  4NF4 B;  2CMO A;  3KN8 A;  3LSW A;  2VOZ A;  5ICQ A;  5CBR A;  3H6W A;  3PD9 A;  3MVZ A;  1Y1M A;  4YB6 A;  1P1Q A;  3RPW A;  1JQF A;  5KDT A;  1H3D A;  5JK4 A;  3PV0 E;  2QS3 A;  1PBP A;  1B4H A;  4DCY A;  5HM4 B;  1JVX A;  1BIY A;  2DE4 A;  4F2Q A;  3OEN A;  3TTL A;  3PPO A;  1MXV A;  4DE8 A;  1B46 A;  4NWC A;  3HHG A;  2H98 A;  3IOV A;  1R9L A;  2V93 A;  3FV2 A;  3UP9 A;  3FIR A;  4WXJ A;  4THI A;  4NED A;  5J1D A;  5I58 A;  1S7Y A;  4QHQ A;  1P1U A;  1PDA A;  3GBB A;  3R26 A;  4EF2 A;  4O3A A;  1GGG A;  4BDQ A;  3SES A;  2F7B A;  4NF6 A;  3UN6 A;  4XTC Q;  4ELR A;  3PMW A;  1QKB A;  4LAT A;  4BDO A;  1IEJ A;  2H5Y A;  3UA8 A;  5A5X B;  1EZ9 A;  3OEM A;  3VLW A;  3RLF E;  2DWJ A;  1S50 A;  2F34 A;  5BWJ A;  1B58 A;  1DSN A;  4GXA A;  5CMK A;  4G68 C;  1BTJ A;  3S9N C;  3PGF A;  1H44 A;  2FNC A;  4JBZ A;  1LCT A;  4WKM A;  4GIZ A;  3K2D A;  2W7Y A;  3DM0 A;  4K3F A;  2I48 A;  3SEY A;  2DWH A;  3EQ1 A;  1A99 A;  3U93 A;  1FQC A;  3CSB A;  1MXY A;  5AE4 A;  1JW4 A;  1Z7N E;  4R2F A;  4Q8R A;  1B7H A;  5ITP A;  2DXY A;  2XX9 A;  2FYI A;  4UA8 A;  3O28 A;  1SYI A;  2ONR A;  1GV8 A;  2B3F A;  2DP8 A;  2I49 A;  3SEU A;  3G3J A;  2UYF A;  1O64 A;  3GLB A;  4DCX A;  1P1O A;  1US4 A;  4YKP A;  1CE2 A;  1YAE A;  1DPP A;  1MG1 A;  3SEW A;  4YZZ A;  4GL8 A;  2QJE A;  4IO6 A;  2NUV A;  5FHO A;  5DYH A;  2V3Q A;  1SDX A;  2I3V A;  1JVY A;  5K2X A;  3OXN A;  1H43 A;  4OEU A;  4I1D A;  1RYO A;  3RUM A;  2QRY A;  4MBP A;  1ZKB A;  4KYE A;  1I69 A;  1MQI A;  4R9G A;  4N6P A;  3HO7 A;  2OK2 A;  3N5L A;  2I4B A;  3EHS A;  3W9W A;  1SI1 A;  2F8D A;  4F3B A;  1NNP A;  4ZEB A;  4IY6 A;  3O97 A;  4QFN A;  2KLF A;  3O29 A;  2NOO A;  3DEL B;  4IY5 A;  1PBQ A;  4FAJ A;  1NNK A;  3SEX A;  3PPN A;  5H8F A;  1NNF A;  2H9B A;  1IXC A;  4QSD A;  3D4G A;  4YAH X;  5TPA A;  2DE3 A;  3FVK A;  3MAM A;  4BLA A;  2ZYK A;  1FCK A;  2OCU A;  1POY 1;  1A8F A;  1PB8 A;  4FE8 A;  4GRK A;  5DEX B;  1ELJ A;  4YU0 A;  4IB2 A;  3K02 A;  2Z8E A;  3H3G A;  3KOS A;  1UQW A;  3MPL A;  3EHU A;  1RKM A;  1TT1 A;  3PUV E;  5CM6 A;  1JET A;  3SDF A;  1LFH A;  4U2R A;  4L17 A;  2XXT A;  4R74 A;  1R1N A;  2UYE A;  3MZB A;  5CMC A;  1VSO A;  1OQH A;  5AA2 B;  4RYA A;  3TTN A;  3IB1 A;  4P11 A;  3A3U A;  3D4C A;  1XOC A;  3PMX A;  3THI A;  3IR1 A;  4QFL A;  4F2O A;  2WKY A;  5ICT A;  2P1S A;  3KN7 A;  3TYH A;  4EXK A;  3IO4 A;  5B70 A;  3C36 A;  1AH5 A;  5FTI A;  1NH8 A;  3B7D A;  3IOT A;  3Q27 A;  1I6B A;  1ZTY A;  4X9T A;  2ZNU A;  3K6W A;  2OZZ A;  3H03 A;  2B3B A;  4O3C A;  5I56 B;  5IAI A;  3B6T A;  4U1Z A;  4YKK A;  3PUZ E;  3VV5 A;  2QPQ A;  1ZMG A;  4ZZA A;  3JZJ A;  2DS9 A;  2RCA A;  3U94 A;  4OMB A;  2O1L A;  3K00 A;  4G8M A;  3DP4 A;  4RA1 A;  1BLF A;  2ONK E;  4PFW A;  4OFJ A;  1N3X A;  5I59 B;  4BDL A;  1ZBM A;  1NFT A;  1OVT A;  4QFP A;  4M4G A;  3I3V A;  1BP5 A;  1LAF E;  4LQ5 A;  3TTK A;  2H99 A;  3IO6 A;  1EU8 A;  1FQF A;  5I2K A;  3S9M C;  3RTW B;  3IK6 B;  1Z7M E;  2HEU A;  1PC3 A;  3IOU A;  2VGQ A;  3OO8 A;  5AA2 A;  2D5W A;  3W15 C;  3C4M A;  3CFX A;  4EUO A;  1Y3N A;  3SKP A;  4H5G A;  3KBR A;  1LFI A;  2VP1 A;  1IIT A;  3ONM A;  3H6U A;  3E13 X;  1JEU A;  1LFG A;  3TEP A;  3GBA A;  3VFJ A;  2XD2 A;  2HCA A;  1A54 A;  1F9B A;  1DTZ A;  2OWT A;  3MZ9 A;  2F35 A;  3B6W A;  5DVI A;  4FED A;  4PFT A;  4R6K A;  1DOT A;  4LP2 B;  3LSF B;  5H8N B;  2Q88 A;  5I56 A;  1N84 A;  5L9M A;  4JXI A;  2RF1 A;  3FZV A;  3KJ7 A;  4F1U A;  5F1Q A;  4DZ1 A;  2Q2A A;  3PU5 A;  2F6P A;  3DP8 A;  3ILU B;  2V3U A;  4ELP A;  5CBS A;  4ZE8 A;  3IX1 A;  4OES A;  3FUZ A;  5M2V A;  3K0V A;  3H7M A;  1B2H A;  4LVQ A;  2I4C A;  1TWY A;  1M5F A;  4OFO A;  2O1M A;  1KWH A;  5I57 A;  3EF7 A;  2ANJ A;  3FVN A;  3TKD A;  1WDN A;  4F3P A;  1B5H A;  3MP6 A;  3JYR A;  3O6G A;  3O2A A;  4F3S A;  3KEI A;  4ISU A;  1OLC A;  1UIV A;  5IKB A;  4KD5 A;  4HS7 A;  3IAZ A;  3PPR A;  2PMS A;  5DVJ A;  4BDR A;  1B52 A;  3P7I A;  5EHS A;  2NVU B;  4F22 A;  3U72 A;  1URD A;  2OBG A;  2PYY A;  3PD8 A;  2ZYN A;  3RY3 A;  1MXZ A;  3N94 A;  2YJP A;  4DXB A;  3B6Q A;  1FTJ A;  2XHD A;  4XIG Q;  2LAO A;  1CB6 A;  1MS7 A;  1DTG A;  3KGC A;  2R71 A;  1SQY A;  1GTK A;  5DVF A;  3FD3 A;  2GH9 A;  3O6I A;  3OOA A;  1MM7 A;  5H8N A;  2ZYM A;  3TUS A;  4F39 A;  4YIC A;  1SW4 A;  4NF5 A;  3H6T A;  1AIV A;  1B32 A;  3WAF A;  2XXX A;  2YLN A;  3MC2 A;  5KCJ A;  1LB9 A;  5EYF A;  3DP6 A;  3VE1 B;  4U23 A;  1MH4 A;  4P0I A;  4XKN A;  3RN8 A;  4JWY A;  3OSQ A;  2XXH A;  2HAU A;  3TAJ A;  4NWD A;  3VVF A;  1H45 A;  4G68 A;  4NF8 B;  1SI0 A;  1QUL A;  2QS4 A;  3C34 A;  4RK9 A;  4M1V A;  3K01 A;  5TP9 B;  1B1H A;  3R7X A;  3MVY A;  3T96 B;  3G3H A;  3QXM A;  3UOR A;  2XXQ A;  3BKI B;  2ZNS A;  2PX1 A;  1LAH E;  3F11 A;  1UTB A;  4NF4 A;  2XXW A;  4DIG A;  1D9Y A;  1LST A;  4C1U A;  4RPN A;  2RC9 A;  3ZKL A;  1URG A;  5H8S A;  3IJX B;  4RJZ A;  3MWB A;  4JWX A;  4F31 B;  4H6D A;  2QMX A;  2I0B A;  1B05 A;  1O7T A;  2V3T A;  4JSO A;  1B7U A;  3TQL A;  4YB7 A;  3KSX A;  3LSL A;  4GL0 A;  2DVC A;  4YMB A;  1UTH B;  1Q1K A;  3LR1 A;  1SYH A;  2M8C A;  5CMM A;  2PT1 A;  2I58 A;  4F29 A;  4PFY A;  3V89 B;  1QUJ A;  2Y84 A;  1Y3P A;  3BBR A;  3TTR A;  3VLV A;  3FXR A;  4IO5 A;  3K6U A;  3U92 A;  1R9Q A;  1FQD A;  3QUF A;  2RKM A;  1B3L A;  3Q28 A;  2DYX A;  3T9X B;  2X7Q A;  3MUQ A;  1Y1Z A;  3SER A;  4GF8 A;  1HSJ A;  5JTY B;  1M5E A;  5A5X A;  2P2A A;  1RYX A;  5TP9 A;  4FAT A;  4RK2 A;  1I6Q A;  1FTL A;  4MLQ A;  2O51 A;  3TOD A;  1J1N A;  1O63 A;  4GWO A;  4U4X A;  3VXB A;  1NH7 A;  3IB2 A;  2QSX A;  3OSR A;  4H0W A;  2OLB A;  1MDQ A;  4MLV A;  2XXR A;  1D3K A;  1B1X A;  1MXW A;  1MY2 A;  3FJ7 A;  1PB7 A;  5H8Q B;  4R72 A;  5HBC A;  3KFM A;  1NKX A;  2A5S A;  1SVX B;  1XT8 A;  1US5 A;  1MY1 A;  1II5 A;  3FJM A;  3G3F A;  3QK6 A;  1YTV A;  2B65 A;  2DWA A;  2P0S A;  4FIM A;  4OQO A;  3G3G A;  1LAX A;  5AA3 A;  5ISU A;  4ZED A;  2DOJ A;  1MQH A;  3Q26 A;  4GVO A;  4HTG A;  4BDM A;  3EN3 A;  2O7U A;  4F18 A;  5K2Y A;  1SBP A;  1B0H A;  3CFZ A;  4KR5 A;  4U22 A;  4OZ9 A;  1XC1 A;  4I8C A;  3ZKK A;  3E4R A;  4FJP A;  2XD3 A;  5FHM A;  3LSX A;  1PB9 A;  1MY0 A;  5ELV A;  4IGT A;  1VFE A;  4EQ9 A;  2D3I A;  4POX A;  3MQ9 A;  1SW1 A;  1LGB C;  4KYD A;  4RY1 A;  1B3E A;  4FEC A;  3CG1 A;  4KCC A;  3I5O A;  1ZJL A;  1IQ7 A;  1DMB A;  1LAG E;  2HFB A;  4PQJ A;  4AQ4 A;  5DT6 A;  1M5C A;  2QL3 A;  1OVB A;  3GZG A;  3C9H A;  5AA4 B;  4I62 A;  3VLU A;  2Q9T A;  5TU0 A;  3FVO A;  3VVE A;  4H1X A;  1P99 A;  1R6Z A;  2F36 A;  2O68 A;  3FV1 A;  4ESX A;  4X1D A;  4ECF A;  2NXO A;  4TLM B;  1USY H;  2I0C A;  1D9V A;  2VD2 A;  2DSF A;  2AIX A;  1IZ1 A;  4LUB A;  3L6H A;  2BJJ X;  3IL1 B;  5DEX A;  1AMF A;  5FHN A;  4LON B;  1YPN A;  4U4S A;  4POW A;  5I2N B;  5L9S A;  2Y7W A;  5B7D A;  1IXI A;  1USY E;  2O7I A;  1MQD A;  3LC8 A;  2A5T B;  4IO4 A;  2D21 A;  1LBB A;  2GHA A;  4I9D A;  3TCG A;  2IA4 A;  3KOT A;  4MH5 A;  3OO7 A;  2QMW A;  1B6H A;  4PE5 B;  4AB5 A;  4OYV A;  4LZ8 A;  5HPQ A;  3CRB A;  1D4N A;  1OLA A;  1B51 A;  4YB5 A;  3Q25 A;  3S9L C;  2HZK A;  3RGY A;  3VXC A;  5AA4 A;  3E3K A;  2VHA A;  5KDT B;  3FAT A;  2REG A;  4RPO A;  3FVG A;  3RNN A;  3JV9 A;  1M5B A;  3MP1 A;  1MDP 1;  2G29 A;  4ESW A;  2RC7 A;  1URS A;  4RXL A;  2CZL A;  1OIB A;  1XS5 A;  2ALU A;  3FAS A;  4EQ7 A;  1Y3Q A;  4U1O A;  1Q35 A;  3UK4 A;  1B3F A;  1T0K A;  3TCH A;  1EZP A;  1Y4C A;  4FEB A;  3MP8 A;  4NMY A;  5I59 A;  4KI0 E;  3USD A;  5I2N A;  1IUD A;  2Y7R A;  5AA1 A;  3E9X A;  2F6G A;  1FQB A;  4DXU A;  5H8H B;  5FTH A;  2F5X A;  4O3B A;  2ZXT A;  1IXH A;  3V8X B;  3BFT A;  1N0T A;  2DE2 A;  1NL5 A;  1POT A;  2OWS A;  2HAV A;  4G4P A;  4IO3 A;  1B4Z A;  2Y7K A;  1AOV A;  1YCJ A;  1BKA A;  1OQG A;  1ZIU A;  4XKR A;  2XX8 A;  3AXF A;  2GFE A;  2G93 A;  4ONY A;  5I84 A;  3HV1 A;  4OXV A;  3K6X A;  1N3W A;  4DDD A;  2Z22 A;  4YMA A;  1WOD A;  4KCD A;  1PEB A;  3G7W A;  2REJ A;  1MY4 A;  3I6V A;  3N26 A;  3KG2 A;  2UVJ A;  1Y9U A;  3O6H A;  3FJG A;  4C1T A;  3PPP A;  3T66 A;  2ESN A;  4GFR A;  3M3L A;  1XHY A;  1IIW A;  3T9V A;  3M3K A;  3K4U A;  3A3C A;  5BUU A;  4TQU Q;  1A40 A;  1JW1 A;  2RCB A;  5LOM A;  4OFL A;  1N76 A;  3CI8 A;  4LA9 A;  1NMU A;  3V5A A;  1FW0 A;  4PFU A;  5DTB A;  2FA7 A;  4HCY A;  4TOZ A;  4U21 A;  5CC2 A;  5L8D A;  4KFQ A;  1ZLQ A;  2YPN A;  1SD3 A;  4EQB A;  3L6G A;  3KZG A;  2GRV A;  3MJN A;  1MRP A;  4PET A;  5H8H A;  1Y20 A;  3FGS A;  3K6V A;  2X26 A;  3QSL A;  1B0L A;  3G3I A;  3N6U A;  4GOT A;  1MM6 A;  4EF1 A;  3OO6 A;  4N07 A;  1ATG A;  1TFA A;  4H8I A;  3PUW E;  2Q2C A;  4KHZ E;  3Q29 A;  3G3K A;  3CSG A;  2DXR A;  1I6A A;  4OEV A;  1FQA A;  4NTL A;  3OO9 A;  5AA2 D;  4ZE9 A;  2PT2 A;  2E1S A;  2F7C A;  1LCF A;  1MY3 A;  5H8F B;  3RTF B;  3O66 A;  4Q30 B;  1QJM A;  5ITO A;  1XVY A;  2XXY A;  1Y4T A;  4QRZ A;  2X7P A;  4H8J A;  3ZS6 A;  2GHB A;  4OVJ A;  3IB0 A;  5TPA B;  3TTM A;  3EPE A;  1VFD A;  4ELO A;  1JEV A;  2ZMB A;  4QFK A;  4KQP A;  3TMG A;  2O6A A;  1HSE A;  2ZNT A;  3MVX A;  1B40 A;  3UIF A;  1VR5 A;  4Q5T A;  3PUY E;  3ZSF A;  3HHF A;  1ZU0 A;  4G2Z A;  4IGR A;  4F19 A;  1B7Z A;  4NF8 A;  2H25 A;  1B5I A;  3V83 A;  3H4Z A;  2V84 A;  1IXG A;  1MPB A;  3EHT A;  4X48 A;  1LLS A;  1A8E A;  1N7W A;  5EHM A;  1S9T A;  2AL5 A;  3CR9 A;  4R75 A;  1N7X A;  1B3G A;  3TDJ A;  3MW0 A;  3KSJ A;  1DPE A;  1H76 A;  4IO7 A;  1GR2 A;  1MPC A;  4R2B A;  3RT6 B;  4FOR A;  4LZ7 A;  4ZEI A;  1MH3 A;  1OMP A;  1GVC A;  1MPD A;  3PMV A;  1SW2 A;  3QAX A;  4ZDM A;  2XX7 A;  2ZYO A;  3MBP A;  3UGW A;  1UTH A;  3LUY A;  3O9P A;  3DLN A;  1MQG A;  1QW0 A;  3CVG A;  4E0X A;  2QS2 A;  5F7V A;  4JSD A;  4H67 A;  4F3G A;  3HN0 A;  3BFU A;  5KZT A;  2Q8J A;  2PVU A;  3TEL A;  3C33 A;  2UVH A;  4OWD A;  3T93 B;  3K1N A;  4R9F A;  4AB6 A;  1MXX A;  4NE4 A;  1QKA A;  1QUK A;  4OTE A;  2H4I A;  2HQ0 A;  3IOR A;  3LBS A;  1QUI A;  4LQ2 A;  4GQO A;  4N13 A;  1ANF A;  2IEE A;  3KN3 A;  4GD5 A;  3K1P A;  4JB7 A;  4QFO A;  3TCF A;  4PP0 A;  3VDF A;  4OEN A;  2QS1 A;  1B5J A;  1FQE A;  2F78 A;  2Z8D A;  4ZEC A;  1JW5 A;  3H06 B;  5I2K B;  5JTY A;  4G8H A;  3IJO B;  1EZO A;  1N04 A;  4OET A;  4YKJ A;  2O69 A;  3MZ1 A;  5JEI A;  3HST A;  2I3W A;  2XXV A;  3N6T A;  1FTM A;  1HSL A;  1TFD A;  4QSE A;  3ECR A;  3TFL A;  4KPT A;  3OD7 A;  3MVW A;  4ND9 A;  3C35 A;  3M3F A;  2VD3 A;  1M5D A;  3HPI A;  2R9J A;  4OER A;  4F1Y A;  2I6E A;  4R6H A;  3SEV A;  5L9O A;  3VVD A;  1A55 A;  2XXI A;  1MQJ A;  5CMB A;  3ILT B;  1B3H A;  4ZS9 A;  3QYT A;  5H8Q A;  4DXC A;  3FXU A;  4H65 A;  3MPK A;  3T22 A;  2Y7P A;  3WAE A;  2DWI A;  2OJT A;  4R73 A;  5CRY A;  2UXA A;  3RT8 A;  4IO2 A;  4DLD A;  4BDN A;  2XXP A;  4HCW A;  4OHN A;  4Q0C A;  3S9E A;  2E0S A;  4RNS A;  4ELQ A;  4Z7E A;  3GXA A;  4EDP A;  2AL4 A;  4F1V A;  4HW8 A;  3U1O A;  3CIJ A;  2ONS A;  2F7A A;  4QSC A;  4X1B A;  3RQT A;  3H6V A;  4KYS A;  1A7L A;  1QVS A; 
#chains in the Genus database with same CATH topology
 3C32 A;  4MFI A;  4QXD A;  1LBX A;  1UIU A;  2HHM A;  5I57 B;  4XKQ A;  4MNC A;  2Q8M A;  2Z8F A;  2HZL A;  2THI A;  4WEP A;  3HCQ A;  4MF3 A;  3OEL A;  3U8Q A;  1G0H A;  1XVX A;  1MXU A;  5CI5 A;  4GLI A;  2Y7I A;  4GXS B;  4WED A;  4O8M A;  3C31 A;  2RIN A;  4G8N A;  1TXF A;  3CFL A;  1IMF A;  1FTO A;  1VE4 A;  2O84 X;  1EH3 A;  4ZEK A;  2F97 A;  4E0W A;  4JWO A;  4R6Y A;  4OVQ A;  5LTC A;  1AL3 A;  4GBV A;  3IOW A;  4JDF A;  4ZEF A;  2HXW A;  3CG3 A;  4H5F A;  2PFZ A;  2UVI A;  1IMB A;  1IMD A;  3T9U A;  3S2V A;  3ODB A;  3A09 A;  2DVZ A;  1LBC A;  3SET A;  3KJT A;  3IFA A;  4XKP A;  1LB8 A;  4HE2 A;  4EXL A;  4XXU A;  3R6U A;  3GYY A;  1B9J A;  4NF5 B;  4XEQ A;  3QUJ A;  3K1M A;  1L5T A;  1SW5 A;  2UVG A;  1NV3 A;  4ZZE A;  5I58 B;  5KCJ B;  1WVJ A;  1JNF A;  4HE0 A;  4LZ5 A;  3OEK A;  3M8U A;  1P1N A;  4P0G A;  4G77 A;  2NWJ A;  2A5T A;  4NF6 B;  3TZA A;  2Y5K A;  4N81 A;  3W9V A;  2Q89 A;  1FTK A;  2PBW A;  3OMB A;  4G68 B;  3S4U A;  3QIM A;  2ABH A;  2RC8 A;  3PPQ A;  4UAC A;  4Z0I A;  3PUX E;  3TPA A;  1P1W A;  4C0R A;  2V25 A;  4QF9 A;  4GWU A;  4YKI A;  4TLL B;  3T9H B;  2R6G E;  2XXU A;  2DQV A;  2Z23 A;  1FPL A;  3TQW A;  1Q9D A;  2PFY A;  1NNT A;  1UTB B;  2AYS A;  3FXQ A;  4NF4 B;  1NUZ A;  2CMO A;  3KN8 A;  3LSW A;  2VOZ A;  2VPN A;  5ICQ A;  5CBR A;  3H6W A;  3PD9 A;  3MVZ A;  1Y1M A;  4YB6 A;  1P1Q A;  3RPW A;  1JQF A;  5KDT A;  1H3D A;  5JK4 A;  3PV0 E;  2QS3 A;  1PBP A;  1B4H A;  4DCY A;  5HM4 B;  1JVX A;  1BIY A;  2WX9 A;  2DE4 A;  1FBD A;  4F2Q A;  3OEN A;  3KC1 A;  3TTL A;  3PPO A;  1MXV A;  4DE8 A;  1B46 A;  4NWC A;  3KC0 A;  3HHG A;  2H98 A;  3IOV A;  1R9L A;  2V93 A;  3FV2 A;  3UP9 A;  3B50 A;  3FIR A;  4WXJ A;  1NV4 A;  4THI A;  1KA1 A;  2FHY A;  4NED A;  5J1D A;  5I58 A;  4GBW A;  5EQA A;  4H46 A;  1S7Y A;  1FPF A;  4QHQ A;  1P1U A;  1EYI A;  1PDA A;  3GBB A;  3R26 A;  4EF2 A;  1LBV A;  4O3A A;  1GGG A;  4BDQ A;  3SES A;  2F7B A;  4NF6 A;  3SZP A;  3UN6 A;  4XTC Q;  4ELR A;  3PMW A;  1QKB A;  4LAT A;  4BDO A;  1IEJ A;  2H5Y A;  3UA8 A;  5A5X B;  1EZ9 A;  3OEM A;  3VLW A;  3RLF E;  2DWJ A;  1S50 A;  2F34 A;  5BWJ A;  2P3N A;  1B58 A;  1NV5 A;  1DSN A;  4GXA A;  2CEY A;  5CMK A;  4G68 C;  1BTJ A;  3S9N C;  1DK4 A;  3PGF A;  1H44 A;  2FNC A;  4JBZ A;  2F3B A;  1LCT A;  4WKM A;  4GIZ A;  3K2D A;  2W7Y A;  1INP A;  3DM0 A;  1YXI A;  4K3F A;  2I48 A;  3SEY A;  2DWH A;  3EQ1 A;  1A99 A;  3U93 A;  3D1R A;  1FQC A;  3CSB A;  1MXY A;  5AE4 A;  1JW4 A;  1Z7N E;  4R2F A;  4Q8R A;  1B7H A;  5ITP A;  2DXY A;  2XX9 A;  2FYI A;  4UA8 A;  3O28 A;  1SYI A;  2ONR A;  1GV8 A;  2B3F A;  4XFE A;  2DP8 A;  2I49 A;  1FPB A;  4NG7 A;  3G3J A;  2UYF A;  3SEU A;  1O64 A;  3GLB A;  4DCX A;  1P1O A;  1US4 A;  2V4C A;  4YKP A;  1CE2 A;  1YAE A;  1DPP A;  4PBQ A;  1MG1 A;  4PFB A;  3SEW A;  1IMA A;  4YZZ A;  2B4L A;  4GL8 A;  1VDW A;  2QJE A;  4IO6 A;  2NUV A;  2OX3 A;  5FHO A;  5DYH A;  2V3Q A;  1FPG A;  4NF0 A;  1SDX A;  2I3V A;  1JVY A;  5K2X A;  3OXN A;  1H43 A;  4OEU A;  4I1D A;  1RYO A;  3RUM A;  2QRY A;  4MBP A;  1ZKB A;  4XF5 A;  4KYE A;  1I69 A;  1MQI A;  4R9G A;  4N6P A;  3HO7 A;  4HE1 A;  2OK2 A;  3N5L A;  1DCU A;  2I4B A;  2HXR A;  3EHS A;  3W9W A;  1SI1 A;  1NUX A;  2F8D A;  4F3B A;  1NNP A;  4ZEB A;  4IY6 A;  3O97 A;  4QFN A;  2WEF A;  2KLF A;  3O29 A;  2NOO A;  3DEL B;  4IY5 A;  1PBQ A;  4FAJ A;  1NV7 A;  3CHG A;  1FBF A;  1NNK A;  3SEX A;  4PGP A;  3PPN A;  5H8F A;  4X04 A;  2ZZW A;  1NNF A;  2H9B A;  1IXC A;  4QSD A;  3D4G A;  4PF6 A;  4YAH X;  5TPA A;  2DE3 A;  3FVK A;  3MAM A;  4BLA A;  2ZYK A;  1FCK A;  2OCU A;  4MIJ A;  2CZH A;  1POY 1;  1A8F A;  1PB8 A;  4FE8 A;  4GRK A;  5DEX B;  1ELJ A;  4I40 A;  4YU0 A;  4IB2 A;  4UAB A;  4MX6 A;  3K02 A;  2Z8E A;  3H3G A;  3KOS A;  4PDH A;  1UQW A;  3MPL A;  3EHU A;  1RKM A;  1TT1 A;  3ISP A;  3PUV E;  5CM6 A;  1JET A;  3SDF A;  1LFH A;  4U2R A;  4L17 A;  2XXT A;  4R74 A;  1R1N A;  2UYE A;  3MZB A;  5CMC A;  1VSO A;  4NN3 A;  1OQH A;  5AA2 B;  4RYA A;  3TTN A;  3IB1 A;  4P11 A;  3A3U A;  3D4C A;  1XOC A;  3PMX A;  3THI A;  3IR1 A;  4QFL A;  4F2O A;  2WKY A;  1NI9 A;  5ICT A;  2P1S A;  3KN7 A;  3TYH A;  4EXK A;  3IO4 A;  5B70 A;  3C36 A;  1AH5 A;  5FTI A;  1NH8 A;  3B7D A;  3IOT A;  3Q27 A;  4X8R A;  4PAK A;  1I6B A;  1ZTY A;  4X9T A;  2ZNU A;  3K6W A;  2OZZ A;  3H03 A;  1FBC A;  2B4M A;  2B3B A;  4O3C A;  3BIG A;  5I56 B;  5IAI A;  3B6T A;  4U1Z A;  4YKK A;  4OA4 A;  3PUZ E;  3VV5 A;  2Q74 A;  2QPQ A;  1ZMG A;  4ZZA A;  5EYG A;  3JZJ A;  2DS9 A;  2RCA A;  3U94 A;  4OMB A;  3BIH A;  2O1L A;  3K00 A;  4OVP A;  4G8M A;  4PDD A;  1KA0 A;  3DP4 A;  1IME A;  3KBZ A;  4RA1 A;  1BLF A;  2ONK E;  4PFW A;  4OFJ A;  1N3X A;  5I59 B;  4BDL A;  1ZBM A;  1NFT A;  1OVT A;  4QFP A;  4M4G A;  3I3V A;  1BP5 A;  1LAF E;  4LQ5 A;  2WYK A;  3TTK A;  2H99 A;  2Y5L A;  5EQ9 A;  3IO6 A;  1EU8 A;  1FQF A;  5I2K A;  3S9M C;  1FTA A;  3RTW B;  3IK6 B;  1Z7M E;  2HEU A;  1PC3 A;  3IOU A;  2VGQ A;  3OO8 A;  5AA2 A;  2D5W A;  3W15 C;  1FBH A;  3C4M A;  3CFX A;  4EUO A;  1Y3N A;  3SKP A;  4H5G A;  3KBR A;  1LFI A;  2VP1 A;  4NHB A;  1IIT A;  3ONM A;  3H6U A;  3E13 X;  1JEU A;  4N4U A;  1FSA A;  1K9Z A;  1LFG A;  3TEP A;  1FBP A;  4AS4 A;  4OVR A;  3GBA A;  3VFJ A;  2XD2 A;  2HCA A;  1A54 A;  1F9B A;  1LBY A;  1DTZ A;  4P8B A;  2OWT A;  3MZ9 A;  2F35 A;  3B6W A;  4P9K A;  2ZZX A;  5DVI A;  4FED A;  3LUZ A;  4PFT A;  4R6K A;  1FPK A;  1DOT A;  4LP2 B;  4H45 A;  1AWB A;  3LSF B;  5H8N B;  2Q88 A;  4P56 A;  5EQ8 A;  5I56 A;  1N84 A;  5L9M A;  4JXI A;  1NUY A;  2RF1 A;  3FZV A;  3FBP A;  3KJ7 A;  4F1U A;  5F1Q A;  4DZ1 A;  2FIX A;  2Q2A A;  3PU5 A;  2F6P A;  3DP8 A;  3ILU B;  2V3U A;  4ELP A;  5CBS A;  4ZE8 A;  3IX1 A;  4OES A;  2DDK A;  3FUZ A;  2L5V A;  5M2V A;  3K0V A;  3B8B A;  3H7M A;  1B2H A;  4LVQ A;  2I4C A;  1TWY A;  1M5F A;  4OFO A;  2O1M A;  1KWH A;  5I57 A;  4N6D A;  3E79 A;  1FBE A;  4MJO A;  3EF7 A;  4MAG A;  2ANJ A;  3FVN A;  3TKD A;  1WDN A;  4F3P A;  1B5H A;  1FJ9 A;  2PCR A;  3MP6 A;  3JYR A;  3O6G A;  3O2A A;  4F3S A;  3KEI A;  4PCD A;  4ISU A;  1OLC A;  1IMC A;  1UIV A;  5IKB A;  5ET7 A;  4O7I A;  4KD5 A;  4HS7 A;  4PAF A;  3IAZ A;  3PPR A;  2PMS A;  5DVJ A;  4BDR A;  1B52 A;  1BK4 A;  3P7I A;  5EHS A;  2NVU B;  4F22 A;  3U72 A;  1URD A;  2OBG A;  3PD8 A;  1LBW A;  2PYY A;  2ZYN A;  3RY3 A;  1MXZ A;  3N94 A;  2YJP A;  4DXB A;  2GQ1 A;  3B6Q A;  1FTJ A;  2XHD A;  4XIG Q;  2LAO A;  1CB6 A;  1MS7 A;  1DTG A;  3KGC A;  2R71 A;  1SQY A;  1GTK A;  5DVF A;  3FD3 A;  2GH9 A;  3T0J A;  3O6I A;  3OOA A;  1MM7 A;  4KXP A;  5H8N A;  2ZYM A;  3TUS A;  4F39 A;  4YIC A;  1SW4 A;  4NGU A;  4NF5 A;  3H6T A;  4AS5 A;  3ROJ A;  1AIV A;  5IZZ A;  1B32 A;  3WAF A;  2XXX A;  1EYJ A;  2YLN A;  3MC2 A;  5KCJ A;  1LB9 A;  5EYH A;  5EYF A;  3DP6 A;  3VE1 B;  4U23 A;  1MH4 A;  4P0I A;  4XKN A;  5DW8 A;  3RN8 A;  5T3J A;  4JWY A;  3OSQ A;  2XA5 A;  2XXH A;  2HAU A;  2P3V A;  3TAJ A;  4NWD A;  3VVF A;  1H45 A;  4G68 A;  4NF8 B;  1SI0 A;  1DBZ A;  1QUL A;  2QS4 A;  3C34 A;  4RK9 A;  4M1V A;  3K01 A;  1K9Y A;  5TP9 B;  1B1H A;  3R7X A;  2CEX A;  4PAI A;  3MVY A;  3T96 B;  3G3H A;  3QXM A;  3UOR A;  2XXQ A;  3BKI B;  2ZNS A;  2PX1 A;  5J16 A;  1LAH E;  3F11 A;  1UTB A;  4NF4 A;  2XXW A;  4DIG A;  1D9Y A;  1LST A;  4C1U A;  4NAP A;  4RPN A;  2RC9 A;  3ZKL A;  1URG A;  5H8S A;  3IJX B;  4RJZ A;  3MWB A;  4JWX A;  2XWV A;  4F31 B;  4H6D A;  2QMX A;  2I0B A;  1B05 A;  1O7T A;  2V3T A;  4JSO A;  1B7U A;  3TQL A;  4YB7 A;  3KSX A;  4PFR A;  3LSL A;  4GL0 A;  2DVC A;  4QBA A;  4YMB A;  1UTH B;  5IZ1 A;  1Q1K A;  3LR1 A;  1SYH A;  2M8C A;  5CMM A;  2PT1 A;  4N6K A;  2I58 A;  4F29 A;  4PFY A;  3V89 B;  4N8G A;  1QUJ A;  2Y84 A;  1Y3P A;  1RDY A;  3BBR A;  2QVR A;  3TTR A;  3VLV A;  5ET6 A;  2OWZ A;  3FXR A;  4IO5 A;  2XXK A;  3K6U A;  5I3S A;  4FBP A;  3U92 A;  1R9Q A;  4GX6 A;  1FQD A;  3QUF A;  2RKM A;  1B3L A;  4O7M A;  2ZZV A;  3Q28 A;  4O94 A;  2DYX A;  3T9X B;  4NX1 A;  2X7Q A;  3MUQ A;  4MHF A;  1Y1Z A;  3SER A;  4GF8 A;  1HSJ A;  4PGN A;  5JTY B;  1M5E A;  5A5X A;  2P2A A;  1RYX A;  5TP9 A;  1NV6 A;  2CZI A;  4FAT A;  4RK2 A;  1I6Q A;  3E78 A;  1FTL A;  4MLQ A;  2O51 A;  3TOD A;  1J1N A;  1O63 A;  4GWO A;  4P3L A;  4U4X A;  1FJ6 A;  3VXB A;  2XWI A;  1NH7 A;  3IB2 A;  2QSX A;  3OSR A;  4GX3 A;  4H0W A;  2OLB A;  1MDQ A;  4MLV A;  2XXR A;  4LN5 A;  1D3K A;  1B1X A;  1MXW A;  1MY2 A;  3FJ7 A;  1NV2 A;  1PB7 A;  5H8Q B;  1YYZ A;  4R72 A;  5HBC A;  3KFM A;  1NKX A;  1FBG A;  2A5S A;  2QVU A;  1SVX B;  1XT8 A;  4JVC A;  1US5 A;  1MY1 A;  1II5 A;  3FJM A;  3G3F A;  3QK6 A;  1YTV A;  2B65 A;  2DWA A;  2P0S A;  4FIM A;  4OQO A;  3G3G A;  1LAX A;  5AA3 A;  5ISU A;  4ZED A;  2DOJ A;  1MQH A;  1FPI A;  3Q26 A;  4GVO A;  4HTG A;  4BDM A;  3EN3 A;  2O7U A;  4F18 A;  5K2Y A;  1SBP A;  1B0H A;  3CFZ A;  4KR5 A;  4U22 A;  4OZ9 A;  4OVT A;  1XC1 A;  4I8C A;  3ZKK A;  3E4R A;  4FJP A;  2XD3 A;  5FHM A;  3LSX A;  1PB9 A;  1MY0 A;  5ELV A;  4IGT A;  1VFE A;  4EQ9 A;  2D3I A;  4POX A;  3MQ9 A;  1SW1 A;  1LGB C;  2WBB A;  4KYD A;  4RY1 A;  1B3E A;  3U65 A;  4FEC A;  5ET5 A;  3CG1 A;  4KCC A;  3I5O A;  1ZJL A;  1IQ7 A;  1DMB A;  1LAG E;  2HFB A;  4I3E A;  4PQJ A;  4AQ4 A;  5DT6 A;  1M5C A;  2QL3 A;  1OVB A;  3GZG A;  3C9H A;  4MNI A;  5AA4 B;  4I62 A;  3VLU A;  1LEV A;  3QMF A;  3RYD A;  2Q9T A;  5TU0 A;  3FVO A;  3VVE A;  4H1X A;  1P99 A;  1R6Z A;  2F36 A;  4PF8 A;  2O68 A;  3FV1 A;  4ESX A;  4X1D A;  4ECF A;  2NXO A;  4TLM B;  1USY H;  2I0C A;  1D9V A;  5ESY A;  2VD2 A;  3T1B A;  2DSF A;  2AIX A;  1IZ1 A;  4LUB A;  3L6H A;  2BJJ X;  4DI4 B;  3IL1 B;  5DEX A;  1AMF A;  5FHN A;  4LON B;  1YPN A;  4U4S A;  4POW A;  5I2N B;  5L9S A;  2Y7W A;  5B7D A;  1IXI A;  1USY E;  2O7I A;  1MQD A;  3LC8 A;  2A5T B;  4IO4 A;  1NUW A;  1LBB A;  2D21 A;  2GHA A;  4PC9 A;  4I9D A;  3TCG A;  2JJK A;  3A29 A;  2IA4 A;  3KOT A;  4MH5 A;  3OO7 A;  1FPJ A;  2QMW A;  1B6H A;  4PE5 B;  5ET8 A;  2QVV A;  4AB5 A;  4OYV A;  4LZ8 A;  5HPQ A;  3CRB A;  4I3Y A;  1D4N A;  1OLA A;  1B51 A;  4GWW A;  3NOH A;  4YB5 A;  3Q25 A;  3S9L C;  2HZK A;  3RGY A;  3VXC A;  4GX4 A;  5AA4 A;  4PTK A;  3E3K A;  2VHA A;  5KDT B;  3FAT A;  2REG A;  4RPO A;  3FVG A;  3RNN A;  3JV9 A;  1M5B A;  3MP1 A;  2XWK A;  1MDP 1;  2G29 A;  4ESW A;  2RC7 A;  1URS A;  4IR8 A;  4RXL A;  2CZL A;  1OIB A;  1XS5 A;  2ALU A;  3FAS A;  4EQ7 A;  1Y3Q A;  4U1O A;  1Q35 A;  4GWY A;  3UK4 A;  1B3F A;  1KZ8 A;  1T0K A;  5IM2 A;  3TCH A;  1EZP A;  1Y4C A;  4FEB A;  3MP8 A;  4NMY A;  4P1L A;  5I59 A;  4OAN A;  4KI0 E;  3USD A;  3RPL B;  5I2N A;  1IUD A;  2Y7R A;  5AA1 A;  3E9X A;  2F6G A;  1FQB A;  4DXU A;  3LV0 A;  5H8H B;  5FTH A;  1CNQ A;  2F5X A;  4O3B A;  2ZXT A;  1IXH A;  3PTY A;  3BFT A;  3V8X B;  4PE3 A;  2XWO A;  1N0T A;  2DE2 A;  1NL5 A;  4NQ8 A;  1POT A;  2OWS A;  2HAV A;  4G4P A;  4IO3 A;  1B4Z A;  2Y7K A;  1AOV A;  1YCJ A;  1BKA A;  1OQG A;  4GWS A;  1FPD A;  1ZIU A;  3MYU A;  4XKR A;  2XX8 A;  3AXF A;  2GFE A;  2VT5 A;  2G93 A;  4ONY A;  5I84 A;  3HV1 A;  3HFU A;  2FBP A;  4OXV A;  3K6X A;  1N3W A;  4DDD A;  2Z22 A;  4YMA A;  1WOD A;  4KCD A;  1PEB A;  3G7W A;  2REJ A;  1MY4 A;  3I6V A;  3N26 A;  2KR0 A;  3KG2 A;  2UVJ A;  1Y9U A;  2R8T A;  3O6H A;  3FJG A;  4C1T A;  3PPP A;  3T66 A;  2ESN A;  4N8Y A;  4GFR A;  3M3L A;  1XHY A;  1IIW A;  3T9V A;  3M3K A;  3K4U A;  3A3C A;  5BUU A;  4TQU Q;  1A40 A;  1JW1 A;  2RCB A;  5LOM A;  4OFL A;  1N76 A;  5FBP A;  3CI8 A;  4LA9 A;  1NMU A;  3V5A A;  1FW0 A;  4PFU A;  5DTB A;  2FA7 A;  4HCY A;  1XI6 A;  4TOZ A;  4U21 A;  5CC2 A;  5L8D A;  4KFQ A;  5I5P A;  1ZLQ A;  3RPL A;  2YPN A;  1SD3 A;  4EQB A;  4OVS A;  3L6G A;  3KZG A;  1SPI A;  2QFL A;  2GRV A;  3MJN A;  1MRP A;  4PET A;  5H8H A;  1NV1 A;  2BJI A;  1Y20 A;  3FGS A;  3K6V A;  2X26 A;  4MNP A;  3QSL A;  1B0L A;  3G3I A;  3N6U A;  4GOT A;  5I7I A;  1MM6 A;  4EF1 A;  3OO6 A;  4N07 A;  4P1E A;  1ATG A;  1TFA A;  4H8I A;  3PUW E;  5IGA A;  2VPO A;  2Q2C A;  4KHZ E;  3Q29 A;  3G3K A;  3CSG A;  2DXR A;  2MKZ A;  3FXB A;  1I6A A;  4OEV A;  1FQA A;  4NTL A;  4N91 A;  3OO9 A;  4HXV A;  5AA2 D;  4ZE9 A;  2PT2 A;  2E1S A;  2F7C A;  1LCF A;  2KQZ A;  1MY3 A;  5H8F B;  3RTF B;  3O66 A;  4Q30 B;  1QJM A;  5ITO A;  1XVY A;  2XXY A;  1Y4T A;  4QRZ A;  2X7P A;  4H8J A;  3ZS6 A;  2GHB A;  4P47 A;  4OVJ A;  3IB0 A;  5TPA B;  4GWX A;  3TTM A;  3EPE A;  1VFD A;  4ELO A;  1JEV A;  4QFK A;  2ZMB A;  4KQP A;  3TMG A;  2O6A A;  4MCO A;  1QGX A;  1HSE A;  2ZNT A;  3MVX A;  1B40 A;  3UIF A;  1RDZ A;  1VR5 A;  4Q5T A;  3PUY E;  3ZSF A;  3HHF A;  1ZU0 A;  4G2Z A;  4IGR A;  4F19 A;  1RDX A;  1B7Z A;  4NF8 A;  5A5L A;  2H25 A;  1B5I A;  3V83 A;  3H4Z A;  2V84 A;  1IXG A;  1MPB A;  1FPE A;  3EHT A;  4X48 A;  1LLS A;  1A8E A;  1G0I A;  1N7W A;  5EHM A;  1S9T A;  2AL5 A;  3CR9 A;  4R75 A;  1N7X A;  5EQ7 A;  1B3G A;  3TDJ A;  3MW0 A;  3KSJ A;  1DPE A;  4PBH A;  1H76 A;  4IO7 A;  1GR2 A;  1MPC A;  1EYK A;  4R2B A;  3RT6 B;  4FOR A;  4PFI A;  4LZ7 A;  4ZEI A;  1MH3 A;  1OMP A;  1GVC A;  1MPD A;  3PMV A;  1SW2 A;  3QAX A;  4ZDM A;  2XX7 A;  1NV0 A;  2ZYO A;  3MBP A;  3UGW A;  1UTH A;  3LUY A;  3O9P A;  3DLN A;  1MQG A;  1QW0 A;  3CVG A;  4E0X A;  2QS2 A;  5F7V A;  4JSD A;  1FRP A;  2F3D A;  2FVZ A;  4H67 A;  4F3G A;  3HN0 A;  3BFU A;  5KZT A;  2WBD A;  2Q8J A;  4JVD A;  2PVU A;  3TEL A;  3C33 A;  5IZ3 B;  2UVH A;  4OWD A;  3T93 B;  3K1N A;  4R9F A;  4AB6 A;  1MXX A;  4N17 A;  4NE4 A;  1QKA A;  1QUK A;  1LBZ A;  4OTE A;  2H4I A;  2HQ0 A;  3IOR A;  3LBS A;  3IFC A;  1QUI A;  4LQ2 A;  4GQO A;  4N13 A;  1ANF A;  2IEE A;  3KN3 A;  4GD5 A;  3K1P A;  4JB7 A;  4QFO A;  3TCF A;  4PP0 A;  3VDF A;  4OEN A;  2QS1 A;  1B5J A;  1FQE A;  2F78 A;  2Z8D A;  4ZEC A;  1JW5 A;  3H06 B;  5I2K B;  5JTY A;  4G8H A;  4MMP A;  3IJO B;  4G61 A;  1EZO A;  1N04 A;  4OET A;  4YKJ A;  4MEV A;  2O69 A;  3MZ1 A;  5JEI A;  3HST A;  2I3W A;  2XXV A;  3N6T A;  1FTM A;  1JP4 A;  1HSL A;  3EKI A;  5LDZ A;  1TFD A;  4QSE A;  3ECR A;  4KPT A;  3TFL A;  3OD7 A;  3MVW A;  4ND9 A;  3C35 A;  3M3F A;  2VD3 A;  1M5D A;  3HPI A;  2R9J A;  4OER A;  4DI3 D;  4F1Y A;  2WYP A;  2I6E A;  4R6H A;  3SEV A;  5L9O A;  3VVD A;  5F24 A;  1A55 A;  2XXI A;  1MQJ A;  5CMB A;  3ILT B;  3MST A;  1B3H A;  4ZS9 A;  3QYT A;  5H8Q A;  4DXC A;  3FXU A;  4H65 A;  3MPK A;  3T22 A;  2Y7P A;  3WAE A;  2DWI A;  2OJT A;  4R73 A;  1D9Q A;  5CRY A;  2UXA A;  3RT8 A;  4IO2 A;  4DLD A;  4BDN A;  2XXP A;  4HCW A;  4OHN A;  4Q0C A;  3S9E A;  2E0S A;  4RNS A;  5IZ3 A;  2HPG A;  4GWZ A;  4ELQ A;  4Z7E A;  3GXA A;  4EDP A;  2AL4 A;  4JVI A;  4F1V A;  4HW8 A;  3U1O A;  3CIJ A;  2ONS A;  4N15 A;  2CZK A;  2F7A A;  4QSC A;  2FIE A;  1YZ0 A;  4X1B A;  3RQT A;  3H6V A;  4KYS A;  1A7L A;  1QVS A; 
#chains in the Genus database with same CATH homology
 3C32 A;  4MFI A;  1UIU A;  5I57 B;  4XKQ A;  2Z8F A;  2HZL A;  2THI A;  4WEP A;  3HCQ A;  4MF3 A;  3OEL A;  3U8Q A;  1XVX A;  1MXU A;  5CI5 A;  4GLI A;  2Y7I A;  4GXS B;  4WED A;  3C31 A;  2RIN A;  4G8N A;  1TXF A;  3CFL A;  1FTO A;  1VE4 A;  2O84 X;  1EH3 A;  4ZEK A;  2F97 A;  4E0W A;  4JWO A;  4R6Y A;  1AL3 A;  3IOW A;  4JDF A;  4ZEF A;  2HXW A;  3CG3 A;  4H5F A;  2UVI A;  3T9U A;  3S2V A;  3ODB A;  3A09 A;  2DVZ A;  1LBC A;  3SET A;  3KJT A;  4XKP A;  1LB8 A;  4EXL A;  4XXU A;  3R6U A;  1B9J A;  4NF5 B;  3QUJ A;  3K1M A;  1L5T A;  1SW5 A;  2UVG A;  4ZZE A;  5I58 B;  5KCJ B;  1WVJ A;  1JNF A;  4LZ5 A;  3OEK A;  3M8U A;  1P1N A;  4P0G A;  4G77 A;  2NWJ A;  2A5T A;  4NF6 B;  3TZA A;  3W9V A;  2Q89 A;  1FTK A;  2PBW A;  3OMB A;  4G68 B;  3S4U A;  3QIM A;  2ABH A;  2RC8 A;  3PPQ A;  4UAC A;  4Z0I A;  3PUX E;  3TPA A;  1P1W A;  4C0R A;  2V25 A;  4QF9 A;  4YKI A;  4TLL B;  3T9H B;  2R6G E;  2XXU A;  2DQV A;  2Z23 A;  3TQW A;  1NNT A;  1UTB B;  2AYS A;  3FXQ A;  4NF4 B;  2CMO A;  3KN8 A;  3LSW A;  2VOZ A;  5ICQ A;  5CBR A;  3H6W A;  3PD9 A;  3MVZ A;  1Y1M A;  4YB6 A;  1P1Q A;  3RPW A;  1JQF A;  5KDT A;  1H3D A;  5JK4 A;  3PV0 E;  2QS3 A;  1PBP A;  1B4H A;  4DCY A;  5HM4 B;  1JVX A;  1BIY A;  2DE4 A;  4F2Q A;  3OEN A;  3TTL A;  3PPO A;  1MXV A;  4DE8 A;  1B46 A;  4NWC A;  3HHG A;  2H98 A;  3IOV A;  1R9L A;  2V93 A;  3FV2 A;  3UP9 A;  3FIR A;  4WXJ A;  4THI A;  4NED A;  5J1D A;  5I58 A;  1S7Y A;  4QHQ A;  1P1U A;  1PDA A;  3GBB A;  3R26 A;  4EF2 A;  4O3A A;  1GGG A;  4BDQ A;  3SES A;  2F7B A;  4NF6 A;  3UN6 A;  4XTC Q;  4ELR A;  3PMW A;  1QKB A;  4LAT A;  4BDO A;  1IEJ A;  2H5Y A;  3UA8 A;  5A5X B;  1EZ9 A;  3OEM A;  3VLW A;  3RLF E;  2DWJ A;  1S50 A;  2F34 A;  5BWJ A;  1B58 A;  1DSN A;  4GXA A;  5CMK A;  4G68 C;  1BTJ A;  3S9N C;  3PGF A;  1H44 A;  2FNC A;  4JBZ A;  1LCT A;  4WKM A;  4GIZ A;  3K2D A;  2W7Y A;  3DM0 A;  4K3F A;  2I48 A;  3SEY A;  2DWH A;  3EQ1 A;  1A99 A;  3U93 A;  1FQC A;  3CSB A;  1MXY A;  5AE4 A;  1JW4 A;  1Z7N E;  4R2F A;  4Q8R A;  1B7H A;  5ITP A;  2DXY A;  2XX9 A;  2FYI A;  4UA8 A;  3O28 A;  1SYI A;  2ONR A;  1GV8 A;  2B3F A;  2DP8 A;  2I49 A;  3SEU A;  3G3J A;  2UYF A;  1O64 A;  3GLB A;  4DCX A;  1P1O A;  1US4 A;  4YKP A;  1CE2 A;  1YAE A;  1DPP A;  1MG1 A;  3SEW A;  4YZZ A;  4GL8 A;  2QJE A;  4IO6 A;  2NUV A;  5FHO A;  5DYH A;  2V3Q A;  1SDX A;  2I3V A;  1JVY A;  5K2X A;  3OXN A;  1H43 A;  4OEU A;  4I1D A;  1RYO A;  3RUM A;  2QRY A;  4MBP A;  1ZKB A;  4KYE A;  1I69 A;  1MQI A;  4R9G A;  4N6P A;  3HO7 A;  2OK2 A;  3N5L A;  2I4B A;  3EHS A;  3W9W A;  1SI1 A;  2F8D A;  4F3B A;  1NNP A;  4ZEB A;  4IY6 A;  3O97 A;  4QFN A;  2KLF A;  3O29 A;  2NOO A;  3DEL B;  4IY5 A;  1PBQ A;  4FAJ A;  1NNK A;  3SEX A;  3PPN A;  5H8F A;  1NNF A;  2H9B A;  1IXC A;  4QSD A;  3D4G A;  4YAH X;  5TPA A;  2DE3 A;  3FVK A;  3MAM A;  4BLA A;  2ZYK A;  1FCK A;  2OCU A;  1POY 1;  1A8F A;  1PB8 A;  4FE8 A;  4GRK A;  5DEX B;  1ELJ A;  4YU0 A;  4IB2 A;  3K02 A;  2Z8E A;  3H3G A;  3KOS A;  1UQW A;  3MPL A;  3EHU A;  1RKM A;  1TT1 A;  3PUV E;  5CM6 A;  1JET A;  3SDF A;  1LFH A;  4U2R A;  4L17 A;  2XXT A;  4R74 A;  1R1N A;  2UYE A;  3MZB A;  5CMC A;  1VSO A;  1OQH A;  5AA2 B;  4RYA A;  3TTN A;  3IB1 A;  4P11 A;  3A3U A;  3D4C A;  1XOC A;  3PMX A;  3THI A;  3IR1 A;  4QFL A;  4F2O A;  2WKY A;  5ICT A;  2P1S A;  3KN7 A;  3TYH A;  4EXK A;  3IO4 A;  5B70 A;  3C36 A;  1AH5 A;  5FTI A;  1NH8 A;  3B7D A;  3IOT A;  3Q27 A;  1I6B A;  1ZTY A;  4X9T A;  2ZNU A;  3K6W A;  2OZZ A;  3H03 A;  2B3B A;  4O3C A;  5I56 B;  5IAI A;  3B6T A;  4U1Z A;  4YKK A;  3PUZ E;  3VV5 A;  2QPQ A;  1ZMG A;  4ZZA A;  3JZJ A;  2DS9 A;  2RCA A;  3U94 A;  4OMB A;  2O1L A;  3K00 A;  4G8M A;  3DP4 A;  4RA1 A;  1BLF A;  2ONK E;  4PFW A;  4OFJ A;  1N3X A;  5I59 B;  4BDL A;  1ZBM A;  1NFT A;  1OVT A;  4QFP A;  4M4G A;  3I3V A;  1BP5 A;  1LAF E;  4LQ5 A;  3TTK A;  2H99 A;  3IO6 A;  1EU8 A;  1FQF A;  5I2K A;  3S9M C;  3RTW B;  3IK6 B;  1Z7M E;  2HEU A;  1PC3 A;  3IOU A;  2VGQ A;  3OO8 A;  5AA2 A;  2D5W A;  3W15 C;  3C4M A;  3CFX A;  4EUO A;  1Y3N A;  3SKP A;  4H5G A;  3KBR A;  1LFI A;  2VP1 A;  1IIT A;  3ONM A;  3H6U A;  3E13 X;  1JEU A;  1LFG A;  3TEP A;  3GBA A;  3VFJ A;  2XD2 A;  2HCA A;  1A54 A;  1F9B A;  1DTZ A;  2OWT A;  3MZ9 A;  2F35 A;  3B6W A;  5DVI A;  4FED A;  4PFT A;  4R6K A;  1DOT A;  4LP2 B;  3LSF B;  5H8N B;  2Q88 A;  5I56 A;  1N84 A;  5L9M A;  4JXI A;  2RF1 A;  3FZV A;  3KJ7 A;  4F1U A;  5F1Q A;  4DZ1 A;  2Q2A A;  3PU5 A;  2F6P A;  3DP8 A;  3ILU B;  2V3U A;  4ELP A;  5CBS A;  4ZE8 A;  3IX1 A;  4OES A;  3FUZ A;  5M2V A;  3K0V A;  3H7M A;  1B2H A;  4LVQ A;  2I4C A;  1TWY A;  1M5F A;  4OFO A;  2O1M A;  1KWH A;  5I57 A;  3EF7 A;  2ANJ A;  3FVN A;  3TKD A;  1WDN A;  4F3P A;  1B5H A;  3MP6 A;  3JYR A;  3O6G A;  3O2A A;  4F3S A;  3KEI A;  4ISU A;  1OLC A;  1UIV A;  5IKB A;  4KD5 A;  4HS7 A;  3IAZ A;  3PPR A;  2PMS A;  5DVJ A;  4BDR A;  1B52 A;  3P7I A;  5EHS A;  2NVU B;  4F22 A;  3U72 A;  1URD A;  2OBG A;  2PYY A;  3PD8 A;  2ZYN A;  3RY3 A;  1MXZ A;  3N94 A;  2YJP A;  4DXB A;  3B6Q A;  1FTJ A;  2XHD A;  4XIG Q;  2LAO A;  1CB6 A;  1MS7 A;  1DTG A;  3KGC A;  2R71 A;  1SQY A;  1GTK A;  5DVF A;  3FD3 A;  2GH9 A;  3O6I A;  3OOA A;  1MM7 A;  5H8N A;  2ZYM A;  3TUS A;  4F39 A;  4YIC A;  1SW4 A;  4NF5 A;  3H6T A;  1AIV A;  1B32 A;  3WAF A;  2XXX A;  2YLN A;  3MC2 A;  5KCJ A;  1LB9 A;  5EYF A;  3DP6 A;  3VE1 B;  4U23 A;  1MH4 A;  4P0I A;  4XKN A;  3RN8 A;  4JWY A;  3OSQ A;  2XXH A;  2HAU A;  3TAJ A;  4NWD A;  3VVF A;  1H45 A;  4G68 A;  4NF8 B;  1SI0 A;  1QUL A;  2QS4 A;  3C34 A;  4RK9 A;  4M1V A;  3K01 A;  5TP9 B;  1B1H A;  3R7X A;  3MVY A;  3T96 B;  3G3H A;  3QXM A;  3UOR A;  2XXQ A;  3BKI B;  2ZNS A;  2PX1 A;  1LAH E;  3F11 A;  1UTB A;  4NF4 A;  2XXW A;  4DIG A;  1D9Y A;  1LST A;  4C1U A;  4RPN A;  2RC9 A;  3ZKL A;  1URG A;  5H8S A;  3IJX B;  4RJZ A;  3MWB A;  4JWX A;  4F31 B;  4H6D A;  2QMX A;  2I0B A;  1B05 A;  1O7T A;  2V3T A;  4JSO A;  1B7U A;  3TQL A;  4YB7 A;  3KSX A;  3LSL A;  4GL0 A;  2DVC A;  4YMB A;  1UTH B;  1Q1K A;  3LR1 A;  1SYH A;  2M8C A;  5CMM A;  2PT1 A;  2I58 A;  4F29 A;  4PFY A;  3V89 B;  1QUJ A;  2Y84 A;  1Y3P A;  3BBR A;  3TTR A;  3VLV A;  3FXR A;  4IO5 A;  3K6U A;  3U92 A;  1R9Q A;  1FQD A;  3QUF A;  2RKM A;  1B3L A;  3Q28 A;  2DYX A;  3T9X B;  2X7Q A;  3MUQ A;  1Y1Z A;  3SER A;  4GF8 A;  1HSJ A;  5JTY B;  1M5E A;  5A5X A;  2P2A A;  1RYX A;  5TP9 A;  4FAT A;  4RK2 A;  1I6Q A;  1FTL A;  4MLQ A;  2O51 A;  3TOD A;  1J1N A;  1O63 A;  4GWO A;  4U4X A;  3VXB A;  1NH7 A;  3IB2 A;  2QSX A;  3OSR A;  4H0W A;  2OLB A;  1MDQ A;  4MLV A;  2XXR A;  1D3K A;  1B1X A;  1MXW A;  1MY2 A;  3FJ7 A;  1PB7 A;  5H8Q B;  4R72 A;  5HBC A;  3KFM A;  1NKX A;  2A5S A;  1SVX B;  1XT8 A;  1US5 A;  1MY1 A;  1II5 A;  3FJM A;  3G3F A;  3QK6 A;  1YTV A;  2B65 A;  2DWA A;  2P0S A;  4FIM A;  4OQO A;  3G3G A;  1LAX A;  5AA3 A;  5ISU A;  4ZED A;  2DOJ A;  1MQH A;  3Q26 A;  4GVO A;  4HTG A;  4BDM A;  3EN3 A;  2O7U A;  4F18 A;  5K2Y A;  1SBP A;  1B0H A;  3CFZ A;  4KR5 A;  4U22 A;  4OZ9 A;  1XC1 A;  4I8C A;  3ZKK A;  3E4R A;  4FJP A;  2XD3 A;  5FHM A;  3LSX A;  1PB9 A;  1MY0 A;  5ELV A;  4IGT A;  1VFE A;  4EQ9 A;  2D3I A;  4POX A;  3MQ9 A;  1SW1 A;  1LGB C;  4KYD A;  4RY1 A;  1B3E A;  4FEC A;  3CG1 A;  4KCC A;  3I5O A;  1ZJL A;  1IQ7 A;  1DMB A;  1LAG E;  2HFB A;  4PQJ A;  4AQ4 A;  5DT6 A;  1M5C A;  2QL3 A;  1OVB A;  3GZG A;  3C9H A;  5AA4 B;  4I62 A;  3VLU A;  2Q9T A;  5TU0 A;  3FVO A;  3VVE A;  4H1X A;  1P99 A;  1R6Z A;  2F36 A;  2O68 A;  3FV1 A;  4ESX A;  4X1D A;  4ECF A;  2NXO A;  4TLM B;  1USY H;  2I0C A;  1D9V A;  2VD2 A;  2DSF A;  2AIX A;  1IZ1 A;  4LUB A;  3L6H A;  2BJJ X;  3IL1 B;  5DEX A;  1AMF A;  5FHN A;  4LON B;  1YPN A;  4U4S A;  4POW A;  5I2N B;  5L9S A;  2Y7W A;  5B7D A;  1IXI A;  1USY E;  2O7I A;  1MQD A;  3LC8 A;  2A5T B;  4IO4 A;  2D21 A;  1LBB A;  2GHA A;  4I9D A;  3TCG A;  2IA4 A;  3KOT A;  4MH5 A;  3OO7 A;  2QMW A;  1B6H A;  4PE5 B;  4AB5 A;  4OYV A;  4LZ8 A;  5HPQ A;  3CRB A;  1D4N A;  1OLA A;  1B51 A;  4YB5 A;  3Q25 A;  3S9L C;  2HZK A;  3RGY A;  3VXC A;  5AA4 A;  3E3K A;  2VHA A;  5KDT B;  3FAT A;  2REG A;  4RPO A;  3FVG A;  3RNN A;  3JV9 A;  1M5B A;  3MP1 A;  1MDP 1;  2G29 A;  4ESW A;  2RC7 A;  1URS A;  4RXL A;  2CZL A;  1OIB A;  1XS5 A;  2ALU A;  3FAS A;  4EQ7 A;  1Y3Q A;  4U1O A;  1Q35 A;  3UK4 A;  1B3F A;  1T0K A;  3TCH A;  1EZP A;  1Y4C A;  4FEB A;  3MP8 A;  4NMY A;  5I59 A;  4KI0 E;  3USD A;  5I2N A;  1IUD A;  2Y7R A;  5AA1 A;  3E9X A;  2F6G A;  1FQB A;  4DXU A;  5H8H B;  5FTH A;  2F5X A;  4O3B A;  2ZXT A;  1IXH A;  3V8X B;  3BFT A;  1N0T A;  2DE2 A;  1NL5 A;  1POT A;  2OWS A;  2HAV A;  4G4P A;  4IO3 A;  1B4Z A;  2Y7K A;  1AOV A;  1YCJ A;  1BKA A;  1OQG A;  1ZIU A;  4XKR A;  2XX8 A;  3AXF A;  2GFE A;  2G93 A;  4ONY A;  5I84 A;  3HV1 A;  4OXV A;  3K6X A;  1N3W A;  4DDD A;  2Z22 A;  4YMA A;  1WOD A;  4KCD A;  1PEB A;  3G7W A;  2REJ A;  1MY4 A;  3I6V A;  3N26 A;  3KG2 A;  2UVJ A;  1Y9U A;  3O6H A;  3FJG A;  4C1T A;  3PPP A;  3T66 A;  2ESN A;  4GFR A;  3M3L A;  1XHY A;  1IIW A;  3T9V A;  3M3K A;  3K4U A;  3A3C A;  5BUU A;  4TQU Q;  1A40 A;  1JW1 A;  2RCB A;  5LOM A;  4OFL A;  1N76 A;  3CI8 A;  4LA9 A;  1NMU A;  3V5A A;  1FW0 A;  4PFU A;  5DTB A;  2FA7 A;  4HCY A;  4TOZ A;  4U21 A;  5CC2 A;  5L8D A;  4KFQ A;  1ZLQ A;  2YPN A;  1SD3 A;  4EQB A;  3L6G A;  3KZG A;  2GRV A;  3MJN A;  1MRP A;  4PET A;  5H8H A;  1Y20 A;  3FGS A;  3K6V A;  2X26 A;  3QSL A;  1B0L A;  3G3I A;  3N6U A;  4GOT A;  1MM6 A;  4EF1 A;  3OO6 A;  4N07 A;  1ATG A;  1TFA A;  4H8I A;  3PUW E;  2Q2C A;  4KHZ E;  3Q29 A;  3G3K A;  3CSG A;  2DXR A;  1I6A A;  4OEV A;  1FQA A;  4NTL A;  3OO9 A;  5AA2 D;  4ZE9 A;  2PT2 A;  2E1S A;  2F7C A;  1LCF A;  1MY3 A;  5H8F B;  3RTF B;  3O66 A;  4Q30 B;  1QJM A;  5ITO A;  1XVY A;  2XXY A;  1Y4T A;  4QRZ A;  2X7P A;  4H8J A;  3ZS6 A;  2GHB A;  4OVJ A;  3IB0 A;  5TPA B;  3TTM A;  3EPE A;  1VFD A;  4ELO A;  1JEV A;  2ZMB A;  4QFK A;  4KQP A;  3TMG A;  2O6A A;  1HSE A;  2ZNT A;  3MVX A;  1B40 A;  3UIF A;  1VR5 A;  4Q5T A;  3PUY E;  3ZSF A;  3HHF A;  1ZU0 A;  4G2Z A;  4IGR A;  4F19 A;  1B7Z A;  4NF8 A;  2H25 A;  1B5I A;  3V83 A;  3H4Z A;  2V84 A;  1IXG A;  1MPB A;  3EHT A;  4X48 A;  1LLS A;  1A8E A;  1N7W A;  5EHM A;  1S9T A;  2AL5 A;  3CR9 A;  4R75 A;  1N7X A;  1B3G A;  3TDJ A;  3MW0 A;  3KSJ A;  1DPE A;  1H76 A;  4IO7 A;  1GR2 A;  1MPC A;  4R2B A;  3RT6 B;  4FOR A;  4LZ7 A;  4ZEI A;  1MH3 A;  1OMP A;  1GVC A;  1MPD A;  3PMV A;  1SW2 A;  3QAX A;  4ZDM A;  2XX7 A;  2ZYO A;  3MBP A;  3UGW A;  1UTH A;  3LUY A;  3O9P A;  3DLN A;  1MQG A;  1QW0 A;  3CVG A;  4E0X A;  2QS2 A;  5F7V A;  4JSD A;  4H67 A;  4F3G A;  3HN0 A;  3BFU A;  5KZT A;  2Q8J A;  2PVU A;  3TEL A;  3C33 A;  2UVH A;  4OWD A;  3T93 B;  3K1N A;  4R9F A;  4AB6 A;  1MXX A;  4NE4 A;  1QKA A;  1QUK A;  4OTE A;  2H4I A;  2HQ0 A;  3IOR A;  3LBS A;  1QUI A;  4LQ2 A;  4GQO A;  4N13 A;  1ANF A;  2IEE A;  3KN3 A;  4GD5 A;  3K1P A;  4JB7 A;  4QFO A;  3TCF A;  4PP0 A;  3VDF A;  4OEN A;  2QS1 A;  1B5J A;  1FQE A;  2F78 A;  2Z8D A;  4ZEC A;  1JW5 A;  3H06 B;  5I2K B;  5JTY A;  4G8H A;  3IJO B;  1EZO A;  1N04 A;  4OET A;  4YKJ A;  2O69 A;  3MZ1 A;  5JEI A;  3HST A;  2I3W A;  2XXV A;  3N6T A;  1FTM A;  1HSL A;  1TFD A;  4QSE A;  3ECR A;  3TFL A;  4KPT A;  3OD7 A;  3MVW A;  4ND9 A;  3C35 A;  3M3F A;  2VD3 A;  1M5D A;  3HPI A;  2R9J A;  4OER A;  4F1Y A;  2I6E A;  4R6H A;  3SEV A;  5L9O A;  3VVD A;  1A55 A;  2XXI A;  1MQJ A;  5CMB A;  3ILT B;  1B3H A;  4ZS9 A;  3QYT A;  5H8Q A;  4DXC A;  3FXU A;  4H65 A;  3MPK A;  3T22 A;  2Y7P A;  3WAE A;  2DWI A;  2OJT A;  4R73 A;  5CRY A;  2UXA A;  3RT8 A;  4IO2 A;  4DLD A;  4BDN A;  2XXP A;  4HCW A;  4OHN A;  4Q0C A;  3S9E A;  2E0S A;  4RNS A;  4ELQ A;  4Z7E A;  3GXA A;  4EDP A;  2AL4 A;  4F1V A;  4HW8 A;  3U1O A;  3CIJ A;  2ONS A;  2F7A A;  4QSC A;  4X1B A;  3RQT A;  3H6V A;  4KYS A;  1A7L A;  1QVS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...