4H65A

Crystal structure of semet derivative of hmp synthase thi5 from s. cerevisiae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
315
Chain Sequence
DKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDMAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWSGYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEATRLMAIHQEKCRQEGTFKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pyrimidine precursor biosynthesis enzyme THI5
publication title The Last Piece in the Vitamin B1 Biosynthesis Puzzle: STRUCTURAL AND FUNCTIONAL INSIGHT INTO YEAST 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE PHOSPHATE (HMP-P) SYNTHASE.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
total genus 98
structure length 315
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h65A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h65A01
1PBPA 1FQFA 4R6KA 3LSWA 3A3CA 4BDLA 3PV0E 4KHZE 4OFJA 2NWJA 2I4BA 1FW0A 3UA8A 4POWA 5CMKA 4P11A 5I59B 5I58A 1LFHA 4GF8A 2RCAA 3BBRA 1FQDA 5FHOA 3IO6A 2I4CA 3N26A 4DE8A 2DOJA 1R9LA 3DM0A 4NEDA 1B5IA 3FVOA 3TAJA 4FECA 4R6YA 2I3WA 1T0KA 1QULA 2IEEA 3VV5A 3TTKA 4TLLB 1PBQA 2HZLA 4BDQA 4ELPA 3N6UA 4O3AA 4ZEFA 4QHQA 2PBWA 2O6AA 3LSFB 4GXSB 2PVUA 4ZDMA 4OZ9A 3V83A 3EN3A 1LAXA 1B7ZA 2VGQA 2I48A 5CMMA 1BTJA 3V5AA 3TCHA 1DOTA 3H06B 5TP9B 3MVYA 3QK6A 4BDOA 4NF4A 1ZJLA 5EHSA 4IO4A 4KYSA 3N5LA 4OXVA 1SDXA 1MPDA 5A5XB 4BDNA 2UVJA 4GIZA 4G2ZA 4F18A 4KPTA 1IITA 3VVDA 3ILTB 1FTKA 4PP0A 3OO8A 4KYEA 1Y4TA 2I6EA 2DVCA 1US4A 4LP2B 1MXYA 3LSXA 1B05A 1GVCA 4MFIA 4HCYA 2ONSA 3RPWA 3VLUA 1B3FA 1JNFA 1ZKBA 2VHAA 3MPLA 4LA9A 3G3FA 3Q27A 1OVTA 2VD2A 2QS2A 4ZE9A 1L5TA 1B3EA 1OLCA 3LC8A 1FQCA 1LSTA 4C0RA 2ZYOA 4F1YA 4F1VA 2FYIA 3T9UA 5DEXB 2NOOA 1QKBA 4H0WA 3LR1A 1ZU0A 1M5EA 4E0WA 1B9JA 4Q0CA 3UN6A 5JEIA 3MC2A 1FTJA 5FHMA 3O6GA 3WAEA 3RNNA 1JETA 1II5A 3P7IA 3K1MA 2D3IA 1R6ZA 5F1QA 1SW5A 4DXUA 1MY3A 3ZSFA 4QSCA 3TTRA 4YMBA 4QFOA 2Y84A 3L6GA 1Z7ME 1BIYA 3ZKKA 1QKAA 4JWOA 1URSA 1SW1A 3OOAA 3ECRA 4G77A 4EXKA 1O64A 2PT1A 2Y7WA 2RC9A 3O28A 4BDMA 2RF1A 2O7UA 2W7YA 3CG1A 4ELRA 1S50A 3OMBA 4MH5A 4I9DA 4IGTA 3PPPA 3MVZA 1MM7A 3PUYE 3QSLA 4RXLA 1P1OA 3DLNA 1EZPA 1YPNA 4F39A 2VP1A 4L17A 1LGBC 1JW4A 1TWYA 2XD2A 3K6XA 1DSNA 5DT6A 3E13X 2KLFA 4TQUQ 1MY4A 1B2HA 1USYE 5B7DA 4Q5TA 4NF5B 1SYIA 4XTCQ 1IIWA 2DWIA 2AIXA 4F22A 4KD5A 4C1TA 5H8FA 4AQ4A 4ZEIA 5I2NA 3VLVA 1ZBMA 5H8QB 2B3FA 3K02A 1A40A 4NF6A 3TZAA 3OXNA 1FQAA 3JYRA 4NWDA 4PETA 5CRYA 1OIBA 2R9JA 1GV8A 3B6TA 1M5DA 4JWYA 3S9EA 1YCJA 2DYXA 3KN7A 1MG1A 5TU0A 4BLAA 5CC2A 1FQEA 2G29A 4F31B 3E9XA 4QSEA 5J1DA 2PT2A 5H8NB 3O66A 4RPOA 3K01A 2REJA 1MY2A 4YKKA 4NTLA 1SVXB 3C34A 3PU5A 4QFLA 1FTLA 3FGSA 3LBSA 1MQHA 2P0SA 3EHUA 3KJTA 3SEWA 1XVYA 1I6AA 4LZ5A 1HSLA 2O69A 4NF8A 5H8FB 2F35A 5L9SA 3C4MA 1BP5A 1Y9UA 4I62A 5CMCA 1Y3NA 3HPIA 4P0GA 3IK6B 1GR2A 5M2VA 1UQWA 3TODA 1ANFA 5H8HB 3G7WA 4PFTA 1LFIA 1O63A 1B6HA 2XHDA 1B46A 4MLVA 1SYHA 4F3PA 1PEBA 3M3KA 1MXXA 3D4CA 3S4UA 4EQBA 3HN0A 4IO6A 3N6TA 2QL3A 3IAZA 4GLIA 3PPRA 3PUZE 3RTFB 3EHSA 1MDP1 2QS4A 1D9VA 1OQGA 1Z7NE 3LSLA 4Q30B 2HFBA 3MPKA 1LBBA 1ZLQA 4FJPA 4F3GA 1JEVA 2I3VA 1MY0A 3IJOB 5K2YA 4NF8B 3FJMA 4R75A 3U72A 4K3FA 3IX1A 2XX7A 1IXIA 4F19A 1QVSA 4YKJA 3TEPA 2ZNUA 2H5YA 4R6HA 4E0XA 3O97A 1HSJA 3MVWA 2UVIA 5I56B 1SW4A 3T96B 4LQ5A 5LOMA 4O3CA 1MS7A 3FVGA 4GL8A 4DCYA 1US5A 4Z7EA 3KOSA 3RY3A 4H1XA 3H3GA 3M3FA 4ZEDA 5KCJB 4G68C 1AL3A 2HXWA 3EF7A 5TP9A 2D5WA 2BJJX 1P1WA 1MPCA 3O9PA 5I84A 3RTWB 3C31A 4HW8A 5AA4B 1Y1MA 4XXUA 4R74A 3FASA 3PUXE 2O1LA 5CMBA 5I2KA 5A5XA 3SESA 1WODA 1A8FA 2Q89A 1DTZA 2DXRA 3TQLA 2ZNTA 4QFNA 3MP6A 3IOWA 1H76A 1JVYA 2O7IA 2THIA 4F2OA 3K6WA 1DPEA 4U1ZA 2ZYKA 1USYH 3ONMA 5BWJA 4XKRA 5TPAB 4M4GA 4MBPA 3HHFA 3GZGA 5I57B 3R26A 4GVOA 3IOTA 3TTNA 1BLFA 4OEUA 3SERA 4KI0E 4TOZA 4OQOA 4IY6A 2YJPA 3ZKLA 3VXCA 2GH9A 3H6VA 3FZVA 4ISUA 3S9NC 3C36A 2I49A 3AXFA 3MZ9A 2P1SA 2B3BA 2V84A 4U23A 2O68A 5I2KB 4PQJA 1VE4A 5DEXA 2Q2CA 2XX9A 4YICA 4ZE8A 1B3HA 1MQJA 5F7VA 3FVNA 2DSFA 5EHMA 3K1PA 4FIMA 4IB2A 3OO6A 2CZLA 2NXOA 1NNPA 4QFKA 4H5GA 3CFXA 2XXUA 1OMPA 2ESNA 4KCDA 2E1SA 1I6QA 5CI5A 3T9VA 4U4XA 3RGYA 2DWAA 5AA2A 4IO7A 1EU8A 2QJEA 1MQGA 1JQFA 4FATA 2FNCA 1EZOA 4GWOA 3QUFA 1JEUA 4RJZA 1A7LA 2X7QA 2I0CA 3WAFA 2AL4A 1ZTYA 4XKNA 3QUJA 4FORA 2OCUA 3TELA 4IO5A 3PMWA 2F7CA 3IL1B 3F11A 4NMYA 1LB9A 1LLSA 3KG2A 1MH4A 3MZ1A 1JW1A 2Q88A 3CVGA 1DTGA 3V8XB 5DVJA 4O3BA 3TUSA 3FXQA 1Q1KA 1XC1A 3ODBA 3PMXA 1SBPA 3O6HA 1XT8A 3HHGA 3L6HA 1POY1 2XXHA 3K2DA 3K6UA 4KYDA 5L9MA 1IZ1A 1UIVA 1TXFA 4GQOA 2A5TA 4RNSA 4NF5A 1P1QA 3W9WA 3QAXA 5AA2B 1NKXA 5CBRA 3PUVE 2YLNA 3QYTA 3G3JA 5H8QA 2OLBA 4YKIA 1BKAA 1MXUA 3IOUA 5KDTA 2PX1A 1GGGA 2DE4A 1A8EA 4EUOA 2OBGA 3K4UA 4F1UA 2ZNSA 3KOTA 4RYAA 5FTHA 3UK4A 2F34A 3KFMA 3OSRA 1N3XA 2HAUA 2QS1A 3CFLA 1CB6A 4WXJA 4RK2A 1LCFA 3FV2A 4NWCA 4YB5A 1O7TA 4IGRA 3OO7A 1SI0A 3VVEA 5JK4A 4I1DA 1RYXA 1UTHB 2RC8A 4DLDA 1MDQA 2ABHA 2F8DA 5H8NA 4DIGA 1XVXA 3UORA 4YB6A 3THIA 4WKMA 4QFPA 4LONB 2A5TB 2O51A 2G93A 5IAIA 4GFRA 4DCXA 2Z23A 5HPQA 3MBPA 3KN3A 1HSEA 4AB6A 1I69A 3IORA 3C32A 2H25A 3OO9A 5KDTB 4RA1A 3U93A 1B1XA 2Q2AA 4DXBA 5H8HA 3DP8A 1B7HA 3M3LA 1B32A 3S9LC 3MQ9A 4X48A 3PPOA 1IQ7A 2F78A 5AA3A 5CBSA 1N84A 4LVQA 1D9YA 1LCTA 4THIA 5BUUA 1S9TA 5L8DA 3SEXA 2R6GE 3A3UA 2H99A 4GOTA 3TDJA 2PYYA 3G3GA 3M8UA 5ITPA 1LB8A 1N7WA 2XX8A 1A55A 2REGA 1B4ZA 3OD7A 3RT6B 3JZJA 4RK9A 5ICQA 4JSDA 2Q9TA 4XKQA 3RT8A 1PC3A 2DWHA 3PPQA 4X1DA 3VFJA 1VSOA 1EH3A 1Q35A 4JWXA 2Y7PA 4N07A 2VOZA 4FE8A 4U22A 1Y3PA 5CM6A 1IXCA 4OESA 2YPNA 4LUBA 4HCWA 1B1HA 1YTVA 2H98A 4U2RA 5I56A 3D4GA 3CSBA 2QPQA 1JW5A 1JVXA 4DZ1A 4H5FA 2ZXTA 3KEIA 2XXWA 2HEUA 3OEMA 3E4RA 1N76A 3FV1A 4EQ9A 5KCJA 4OYVA 3UIFA 3B6QA 2XXPA 1M5CA 4QRZA 2X26A 1MXZA 2M8CA 2DE2A 3K6VA 1PB8A 1KWHA 1MH3A 1ZMGA 4POXA 5AA4A 1LBCA 1D4NA 3MJNA 1AH5A 2Z8DA 1B4HA 3B6WA 4ONYA 2HZKA 3IR1A 4GXAA 2V93A 4OFLA 1TFAA 4YZZA 1LFGA 4N13A 3TTMA 3KGCA 2QSXA 4G68B 5FHNA 1Y4CA 1SI1A 2OZZA 3IB1A 1A99A 2OJTA 4TLMB 3EQ1A 1H43A 3MUQA 1MXWA 2OK2A 2I58A 4PFWA 4OWDA 5TPAA 4UA8A 5KZTA 4GRKA 2F7AA 3CSGA 3HO7A 3BFUA 4R73A 5I57A 3KSXA 3RLFE 1Y3QA 5ISUA 1SW2A 3FXUA 2R71A 1NL5A 3FVKA 3SDFA 1NNTA 3BKIB 1FCKA 1OLAA 2UVGA 4OHNA 1CE2A 2Y7KA 1XOCA 3ILUB 3MAMA 1QUIA 2GFEA 1P1NA 4NE4A 2ONKE 5ITOA 1POTA 3S9MC 3IJXB 2XD3A 3R7XA 3T9HB 3IB2A 5H8SA 3E3KA 1N0TA 2F6PA 2F97A 1VFEA 2ALUA 1B0LA 3K00A 2AL5A 4OMBA 4C1UA 3TKDA 3CR9A 1MM6A 4ELQA 3T93B 1Y20A 1MXVA 5K2XA 5L9OA 1OQHA 4IO2A 4ZECA 2DVZA 5JTYA 3K0VA 1TFDA 4WEDA 3IOVA 3CFZA 1B52A 4FEBA 3PD9A 3IO4A 3LUYA 4M1VA 4ELOA 3FD3A 1PDAA 2UVHA 1UTBB 3RQTA 5AA1A 2H9BA 4YKPA 2O1MA 3JV9A 2D21A 1DMBA 4Q8RA 3CG3A 2ZMBA 4JDFA 3FIRA 2XXIA 3RUMA 5I58B 2WKYA 2Y7IA 1I6BA 1IXGA 4OERA 3K1NA 4U21A 2DE3A 2GHBA 4KFQA 3I5OA 1LAGE 1B5JA 1NFTA 2Z8FA 3VE1B 1NH8A 5JTYB 1NMUA 4DXCA 4XKPA 1GTKA 4H6DA 1OVBA 1EZ9A 1FTOA 4U1OA 4EF2A 2X7PA 3MWBA 2FA7A 2Z8EA 1PB7A 5DVIA 3DP4A 1XHYA 2ZYMA 3ZS6A 1R9QA 3TTLA 1N3WA 4H8IA 3MVXA 4I8CA 2UXAA 1IXHA 4MF3A 1P99A 2V3QA 2ONRA 2RCBA 1YAEA 2B65A 4R72A 3TMGA 3G3KA 4NF4B 3TCFA 4FEDA 2DQVA 4ZEKA 1MQDA 2V3UA 3FATA 4R2BA 1URGA 1AIVA 1IUDA 2OWTA 4H67A 3PPNA 3OSQA 1H44A 1UTHA 3H6WA 4ND9A 4OETA 2UYEA 2I0BA 4ZZEA 3R6UA 4F3SA 4MLQA 1B51A 3G3IA 4EF1A 3UP9A 3SETA 4G8NA 2XXRA 2DP8A 1QW0A 1MY1A 1MPBA 4H8JA 3DP6A 3FXRA 1MRPA 1H3DA 3KBRA 3EPEA 3W15C 1ELJA 4QF9A 4EXLA 4XIGQ 2HAVA 3TCGA 3Q25A 2F6GA 1B7UA 3CIJA 3IB0A 4KR5A 4JB7A 3HCQA 4P0IA 3KJ7A 1XS5A 1LAFE 3C9HA 1B40A 3U8QA 3TYHA 3OELA 4GD5A 4YMAA 1QUJA 3CRBA 3RN8A 4IY5A 2F5XA 4ZZAA 4JBZA 2Q8JA 4JXIA 2AYSA 2LAOA 3T9XB 3Q28A 3H7MA 5ELVA 3DELB 3B7DA 2ANJA 3QXMA 3VVFA 2RC7A 2A5SA 5AE4A 3C33A 3PMVA 1QJMA 3TQWA 4X9TA 5ICTA 3SKPA 1QUKA 3GLBA 4RPNA 4EQ7A 1SD3A 4OEVA 2V25A 4OTEA 4G8HA 1A54A 4KCCA 2QS3A 1IEJA 4LATA 1FQBA 1P1UA 4YU0A 1RKMA 4PFYA 1VFDA 3TFLA 1SQYA 1B58A 3H6UA 2P2AA 3FJ7A 3MW0A 3CI8A 3SEVA 3N94A 2CMOA 2V3TA 4QSDA 2GRVA 1WVJA 4G8MA 3PD8A 4UACA 5FTIA 2QRYA 4DDDA 5EYFA 3GBAA 1M5FA 4ECFA 1B0HA 2XXYA 1J1NA 3KN8A 4LZ7A 3SEYA 4LZ8A 1D3KA 3VXBA 4IO3A 1F9BA 3BFTA 4ZS9A 3FUZA 4ZEBA 4WEPA 1AMFA 2IA4A 2Y7RA 1AOVA 2OWSA 1B5HA 3Q26A 1H45A 3T66A 1NH7A 2GHAA 4G68A 1PB9A 1B3GA 2F36A 5I2NB 5IKBA 2XXTA 4AB5A 4F29A 3EHTA 3FJGA 3VDFA 3V89B 2RKMA 4NF6B 3OEKA 2DS9A 4U4SA 4Z0IA 2RINA 1FTMA 3TPAA 3O6IA 2DWJA 5DYHA 3HV1A 3I6VA 2XXVA 4OVJA 4KQPA 2HCAA 3HSTA 3H4ZA 3U92A 4YAHX 5DTBA 4BDRA 2DXYA 3O29A 5HBCA 4OENA 1VR5A 2XXQA 5HM4B 3H6TA 3MZBA 3UGWA 1ATGA 1N7XA 2NUVA 1B3LA 4EDPA 4PFUA 3S2VA 3SEUA 1NNKA 5AA2D 3MP8A 3QIMA 4X1BA 3I3VA 2F7BA 4OFOA 1MQIA 3GXAA 3MP1A 1M5BA 4ESWA 3U94A 4LQ2A 3G3HA 4ESXA 4PE5B 4JSOA 5I59A 1LAHE 2PMSA 3H03A 4R2FA 3U1OA 4G4PA 1NNFA 3KZGA 4F2QA 1Y1ZA 2NVUB 3A09A 2H4IA 3PGFA 1URDA 1RYOA 3O2AA 1N04A 3GBBA 3T22A 2Z22A 1TT1A 4RY1A 2XXXA 3Q29A 1S7YA 2QMWA 1UIUA 5DVFA 2QMXA 2ZYNA 4R9GA 4HTGA 4N6PA 4R9FA 4FAJA 3C35A 4HS7A 3PUWE 2E0SA 4YB7A 5B70A 4GL0A 3KSJA 1R1NA 2HQ0A 3USDA 2UYFA 1UTBA 1DPPA 4H65A 3W9VA 2VD3A 3VLWA 2O84X 1WDNA 4F3BA 3OENA 1ZIUA
chains in the Genus database with same CATH superfamily
5FBPA 1PBPA 1JP4A 1FQFA 4R6KA 3LSWA 3A3CA 3RPLA 3PV0E 4BDLA 4KHZE 2WEFA 4OFJA 2NWJA 2I4BA 1FW0A 3UA8A 4POWA 5CMKA 4P11A 1NV5A 5I59B 5I58A 4P1EA 1LFHA 4GF8A 2RCAA 3BBRA 1FQDA 5FHOA 2KQZA 3IO6A 2I4CA 3N26A 4DE8A 2DOJA 1R9LA 3DM0A 4NEDA 1B5IA 3FVOA 4OVTA 4GX6A 3TAJA 4FECA 4R6YA 2I3WA 1T0KA 1QULA 2IEEA 3VV5A 3TTKA 4TLLB 1PBQA 2HZLA 4BDQA 4ELPA 3N6UA 4O3AA 4ZEFA 2DDKA 4QHQA 2PBWA 2O6AA 2KR0A 3LSFB 4GXSB 2PVUA 1FPJA 4ZDMA 1NV4A 4OZ9A 4NG7A 3V83A 3EN3A 1LAXA 1B7ZA 1FRPA 2VGQA 2I48A 5CMMA 1BTJA 3V5AA 3TCHA 1DOTA 3H06B 5TP9B 3MVYA 3QK6A 1EYJA 4BDOA 4NF4A 4JVCA 1ZJLA 5EHSA 4IO4A 4KYSA 3N5LA 4OXVA 1SDXA 1MPDA 5A5XB 1FJ6A 4BDNA 2P3VA 2UVJA 4GIZA 4G2ZA 4F18A 2FIEA 3D1RA 4KPTA 4GWWA 1IITA 3VVDA 3ILTB 1FTKA 2B4MA 4PP0A 3OO8A 4KYEA 4GWSA 4MIJA 1Y4TA 2I6EA 2DVCA 1US4A 4LP2B 1MXYA 3LSXA 1B05A 1GVCA 4MFIA 4HCYA 1NV2A 2ONSA 4QBAA 3RPWA 3VLUA 1B3FA 1JNFA 5I5PA 1ZKBA 2VHAA 4N81A 3MPLA 4PFIA 4LA9A 3G3FA 3Q27A 1OVTA 2VD2A 2QS2A 3NOHA 4ZE9A 5A5LA 1L5TA 1B3EA 1OLCA 3RYDA 3LC8A 1FQCA 1LSTA 4C0RA 2ZYOA 4F1YA 4F1VA 2FYIA 3T9UA 5DEXB 2NOOA 1FBDA 1QKBA 1LBVA 4H0WA 3FXBA 3LR1A 1ZU0A 1M5EA 4UABA 4I3YA 4E0WA 1B9JA 4Q0CA 3UN6A 5JEIA 3MC2A 1FTJA 2QVVA 5FHMA 3O6GA 3WAEA 3RNNA 1JETA 1II5A 3P7IA 4X04A 3K1MA 2D3IA 1R6ZA 1RDXA 3KC0A 5F1QA 1SW5A 4DXUA 1MY3A 3ZSFA 4QSCA 3TTRA 1G0HA 4YMBA 4QFOA 2Y84A 3L6GA 1Z7ME 1BIYA 3ZKKA 1QKAA 4I40A 4JWOA 1URSA 4IR8A 1SW1A 3OOAA 3ECRA 4G77A 4EXKA 1O64A 2PT1A 2Y7WA 4HE0A 2RC9A 3O28A 4BDMA 4MNIA 2RF1A 2O7UA 2W7YA 3CG1A 4ELRA 1S50A 3OMBA 4MH5A 4I9DA 1IMCA 1FPGA 4IGTA 4O7IA 3PPPA 3MVZA 4GBVA 1MM7A 3PUYE 3QSLA 4RXLA 1P1OA 3DLNA 1EZPA 1YPNA 2Q8MA 4F39A 2VP1A 4L17A 1LGBC 1JW4A 1XI6A 1TWYA 2XD2A 3K6XA 1FBHA 4I3EA 1DSNA 5DT6A 1K9YA 3E13X 2KLFA 4TQUQ 1MY4A 1B2HA 1USYE 5B7DA 4OVPA 3BIGA 4Q5TA 4NF5B 1SYIA 4XTCQ 1IIWA 2ZZWA 2DWIA 2AIXA 4F22A 4KD5A 4C1TA 5H8FA 4AQ4A 4ZEIA 5I2NA 3VLVA 1ZBMA 5H8QB 3ISPA 2B3FA 3K02A 1A40A 4NF6A 2B4LA 3TZAA 3OXNA 1FQAA 3JYRA 4NWDA 4PETA 5CRYA 1OIBA 2R9JA 1LEVA 1GV8A 3B6TA 1M5DA 4JWYA 3S9EA 1YCJA 2DYXA 3KN7A 1MG1A 4PFRA 5TU0A 4BLAA 5CC2A 1FQEA 2G29A 4F31B 1FPFA 3E9XA 4QSEA 4NAPA 5J1DA 2PT2A 5H8NB 3O66A 4RPOA 3K01A 2REJA 1MY2A 4YKKA 1D9QA 4NTLA 1FPIA 1SVXB 3C34A 3PU5A 4QFLA 1FTLA 3FGSA 3LBSA 1MQHA 1IMFA 4DI3D 2P0SA 4N17A 3EHUA 3KBZA 4H46A 3KJTA 3SEWA 1XVYA 1I6AA 4LZ5A 1HSLA 2O69A 4NF8A 5H8FB 2F35A 2CZKA 5L9SA 1NV6A 3C4MA 1BP5A 1AWBA 1Y9UA 5ET7A 4I62A 1NUXA 5CMCA 1Y3NA 3HPIA 2QVUA 4P0GA 3IK6B 1GR2A 5M2VA 1UQWA 3TODA 1ANFA 5H8HB 3G7WA 4PFTA 1LFIA 1O63A 1B6HA 3E79A 4XFEA 2XHDA 1B46A 4MLVA 1SYHA 4F3PA 1PEBA 3M3KA 4NQ8A 1MXXA 3D4CA 3S4UA 4EQBA 3HN0A 4IO6A 3N6TA 2QL3A 3IAZA 4GLIA 3PPRA 3PUZE 3RTFB 3EHSA 1MDP1 2QS4A 1D9VA 1OQGA 1FBGA 1Z7NE 3IFAA 3LSLA 4Q30B 2HFBA 4HXVA 3MPKA 1LBBA 1ZLQA 4FJPA 4F3GA 1JEVA 2I3VA 1MY0A 3IJOB 5K2YA 4NF8B 3FJMA 4R75A 3U72A 5ET8A 4K3FA 3IX1A 2XX7A 1IXIA 4F19A 1QVSA 4YKJA 3TEPA 2ZNUA 2H5YA 4R6HA 4E0XA 3O97A 1HSJA 3MVWA 2UVIA 5I56B 2WBDA 1SW4A 3T96B 4LQ5A 5LOMA 4O3CA 1MS7A 3FVGA 4GL8A 3T0JA 2HXRA 4DCYA 1US5A 4Z7EA 3KOSA 3RY3A 4H1XA 3H3GA 3M3FA 1IMEA 2OX3A 4ZEDA 4N8YA 1QGXA 5KCJB 3CHGA 4G68C 1AL3A 2HXWA 3EF7A 5TP9A 2D5WA 2BJJX 1P1WA 1MPCA 3O9PA 5I84A 3RTWB 3C31A 4JVIA 4HW8A 1IMAA 5AA4B 1Y1MA 4XXUA 4R74A 3FASA 3PUXE 2O1LA 5CMBA 2JJKA 5I2KA 4LN5A 5A5XA 3SESA 4OVQA 1WODA 1A8FA 2Q89A 5F24A 1DTZA 2DXRA 2VT5A 3TQLA 2ZNTA 4QFNA 3MP6A 3IOWA 4KXPA 1H76A 1JVYA 1LBWA 2O7IA 2THIA 4F2OA 1NV1A 3K6WA 1DPEA 4U1ZA 2ZYKA 1USYH 3ONMA 5BWJA 4XKRA 5TPAB 4M4GA 4MBPA 3HHFA 3GZGA 5I57B 3R26A 4GVOA 3IOTA 3TTNA 1BLFA 4OEUA 3SERA 4KI0E 4TOZA 4OQOA 4IY6A 2YJPA 3ZKLA 3VXCA 2GH9A 3H6VA 3FZVA 4ISUA 3S9NC 3C36A 2I49A 3AXFA 3MZ9A 2P1SA 2B3BA 2V84A 4U23A 2O68A 5I2KB 4PQJA 4GWXA 1VE4A 5DEXA 5DW8A 2Q2CA 2XX9A 4JVDA 4YICA 4ZE8A 5EQ9A 1B3HA 2XXKA 1MQJA 5F7VA 2XWIA 3FVNA 2DSFA 5EHMA 3K1PA 4FIMA 4P47A 4IB2A 3OO6A 2CZLA 2NXOA 1NNPA 4PDHA 4H5GA 4QFKA 3CFXA 2XXUA 1FJ9A 1OMPA 2ESNA 5EYHA 4KCDA 2E1SA 1I6QA 5CI5A 3T9VA 4U4XA 4NX1A 1SPIA 5EYGA 3RGYA 2DWAA 5AA2A 4IO7A 1EU8A 2QJEA 1MQGA 1JQFA 4FATA 2FNCA 5I7IA 1EZOA 4GWOA 3B8BA 3QUFA 1JEUA 4RJZA 1A7LA 2X7QA 2I0CA 3WAFA 4G61A 2AL4A 4P9KA 1ZTYA 4XKNA 3QUJA 4FORA 2OCUA 1KA1A 3TELA 4IO5A 3PMWA 4PDDA 2F7CA 3IL1B 2OWZA 3F11A 4NMYA 1LB9A 1LLSA 3KG2A 1MH4A 3MZ1A 4P8BA 1JW1A 2Q88A 1FBCA 3CVGA 1DTGA 3V8XB 5DVJA 4O3BA 3TUSA 1K9ZA 3FXQA 4N8GA 1Q1KA 1XC1A 3ODBA 3PMXA 1SBPA 4XEQA 3O6HA 1XT8A 3HHGA 4PGPA 3L6HA 1NV7A 1POY1 2XXHA 3K2DA 3K6UA 4KYDA 5L9MA 1IZ1A 1UIVA 1TXFA 4GQOA 2A5TA 4RNSA 4NF5A 1P1QA 3U65A 3W9WA 3QAXA 5AA2B 1NKXA 5CBRA 3PUVE 2YLNA 3QYTA 3G3JA 5H8QA 2OLBA 4YKIA 1BKAA 1MXUA 3IOUA 5KDTA 2PX1A 3PTYA 4GBWA 2XWKA 4PAFA 1GGGA 2DE4A 1A8EA 4EUOA 2OBGA 3K4UA 4F1UA 2ZNSA 4O7MA 3KOTA 4RYAA 5FTHA 3UK4A 2L5VA 2F34A 4O8MA 3KFMA 3OSRA 1N3XA 2HAUA 2QS1A 3CFLA 1CB6A 4WXJA 4RK2A 1LBXA 1LCFA 4FBPA 3FV2A 1IMBA 1NUWA 1RDZA 2VPOA 4X8RA 4NWCA 4YB5A 1O7TA 4IGRA 3OO7A 1SI0A 3VVEA 5JK4A 5LDZA 4I1DA 1RYXA 1UTHB 2RC8A 4DLDA 1MDQA 4PC9A 2ABHA 2F8DA 5H8NA 4DIGA 1XVXA 3UORA 4YB6A 3THIA 4WKMA 4QFPA 2CZHA 5IZZA 1DK4A 4LONB 2A5TB 2O51A 2G93A 3SZPA 4GFRA 4DCXA 5IAIA 2Z23A 5HPQA 3MBPA 3KN3A 1HSEA 4AB6A 1I69A 3IORA 2XA5A 4NN3A 3C32A 2H25A 1FPBA 3OO9A 5KDTB 4RA1A 3U93A 1B1XA 4PF6A 2Q2AA 4DXBA 5H8HA 3DP8A 1B7HA 3M3LA 1B32A 3S9LC 4MJOA 3MQ9A 4X48A 1FBPA 3PPOA 1IQ7A 2F78A 5AA3A 5CBSA 1N84A 4LVQA 1D9YA 1LCTA 4THIA 5BUUA 1S9TA 5L8DA 3SEXA 2R6GE 3A3UA 3ROJA 2H99A 4GOTA 3TDJA 2PYYA 3G3GA 3M8UA 5ITPA 1LB8A 1N7WA 2XX8A 1A55A 2REGA 1B4ZA 3OD7A 4OANA 3RT6B 3JZJA 4RK9A 4XF5A 5ICQA 2XWVA 4JSDA 2Q9TA 4XKQA 3RT8A 1PC3A 2DWHA 3PPQA 4X1DA 3VFJA 1VSOA 1EH3A 1Q35A 4JWXA 4GWZA 2Y7PA 4N07A 2VOZA 4FE8A 1FPLA 2ZZVA 4U22A 1Y3PA 5CM6A 1IXCA 4OESA 2YPNA 4LUBA 1EYIA 1CNQA 4HCWA 1B1HA 1YTVA 2H98A 5LTCA 4U2RA 5I56A 3D4GA 3HFUA 2BJIA 3CSBA 2QPQA 1JW5A 3MYUA 3QMFA 1JVXA 4DZ1A 4OVRA 4H5FA 2ZXTA 3KEIA 2XXWA 2HEUA 3E78A 3OEMA 3E4RA 1N76A 3FV1A 1BK4A 4EQ9A 5EQ8A 4PGNA 5KCJA 4OYVA 3UIFA 3EKIA 3B6QA 2XXPA 1M5CA 4QRZA 2CZIA 2X26A 1MXZA 2M8CA 2DE2A 5IZ3B 3K6VA 1PB8A 4N6KA 1KWHA 1MH3A 2QVRA 1ZMGA 4POXA 5AA4A 1LBCA 3GYYA 4OVSA 1D4NA 4GX4A 3MJNA 1AH5A 2Z8DA 1B4HA 3B6WA 4ONYA 1YXIA 2HZKA 3IR1A 4GXAA 2V93A 2V4CA 4OFLA 1TFAA 4YZZA 1FTAA 1LFGA 4N13A 3TTMA 2CEXA 3KGCA 2QSXA 4G68B 5FHNA 1Y4CA 1SI1A 2OZZA 3IB1A 1A99A 2OJTA 4TLMB 3EQ1A 1NI9A 1H43A 3MUQA 1MXWA 2OK2A 2I58A 4PFWA 4OWDA 5TPAA 1LBYA 4UA8A 5KZTA 4GRKA 2F7AA 3CSGA 3HO7A 3BFUA 4R73A 5I57A 3KSXA 3RLFE 1Y3QA 5ISUA 1SW2A 3FXUA 2R71A 1NL5A 3FVKA 3SDFA 1NNTA 3BKIB 1FCKA 1OLAA 2UVGA 3BIHA 4OHNA 1CE2A 2Y7KA 1XOCA 4N4UA 5T3JA 3ILUB 3MAMA 1QUIA 2FIXA 2GFEA 4MNCA 1P1NA 4NE4A 2ONKE 1IMDA 1RDYA 5ITOA 2WYKA 2Y5LA 1POTA 3S9MC 3IJXB 1YZ0A 2XD3A 3KC1A 3R7XA 3IB2A 3T9HB 5H8SA 3E3KA 1N0TA 2F6PA 2F97A 1VFEA 5ET5A 2ALUA 1B0LA 3K00A 2WBBA 2AL5A 4OMBA 4C1UA 3TKDA 3CR9A 1MM6A 4ELQA 4P3LA 3T93B 5ET6A 2HPGA 1Y20A 1MXVA 5K2XA 5L9OA 1OQHA 4GWYA 4IO2A 4ZECA 2DVZA 5JTYA 3K0VA 5EQAA 1NV0A 4MCOA 1TFDA 1NV3A 4WEDA 3IOVA 2HHMA 3CFZA 4PBQA 4GWUA 1B52A 4FEBA 3PD9A 3IO4A 3LUYA 4M1VA 4ELOA 3FD3A 4PCDA 1PDAA 2UVHA 1YYZA 1UTBB 3RQTA 1EYKA 5AA1A 2H9BA 5IZ1A 4YKPA 2O1MA 4PBHA 3JV9A 2D21A 1DMBA 4Q8RA 3CG3A 2ZMBA 3RPLB 1DCUA 4JDFA 3FIRA 2XXIA 2P3NA 3RUMA 5I58B 2WKYA 2Y7IA 1I6BA 1IXGA 4OERA 3K1NA 4U21A 5J16A 2DE3A 2GHBA 4KFQA 3I5OA 1LAGE 1B5JA 1NFTA 2Z8FA 3VE1B 1NH8A 4N15A 5JTYB 1NMUA 4DXCA 4XKPA 1GTKA 4H6DA 2FBPA 1OVBA 1EZ9A 1FTOA 4U1OA 4EF2A 1LBZA 2X7PA 3MWBA 2FA7A 2Z8EA 4P56A 1PB7A 5DVIA 3DP4A 1XHYA 2ZYMA 3ZS6A 1Q9DA 1R9QA 3TTLA 2WX9A 1N3WA 4H8IA 3MVXA 4I8CA 2UXAA 1IXHA 4MF3A 1P99A 2V3QA 2ONRA 2RCBA 1YAEA 2B65A 4R72A 3TMGA 3G3KA 4DI4B 4NF4B 3TCFA 4FEDA 2DQVA 4ZEKA 1MQDA 2FHYA 2V3UA 2PFYA 3FATA 4R2BA 1URGA 1AIVA 2PFZA 1IUDA 1G0IA 1FPDA 2OWTA 4H67A 2ZZXA 3PPNA 3OSQA 1H44A 1UTHA 3H6WA 4ND9A 4OETA 2UYEA 3MSTA 4AS5A 2I0BA 4ZZEA 3R6UA 4F3SA 2F3BA 4P1LA 4MLQA 1B51A 1VDWA 4QXDA 3G3IA 1FPEA 4EF1A 3UP9A 3SETA 4G8NA 2XXRA 2Q74A 2DP8A 1QW0A 4N6DA 1MY1A 1MPBA 4H8JA 3DP6A 3FXRA 1DBZA 4H45A 1MRPA 1H3DA 3KBRA 3EPEA 3W15C 1ELJA 4QF9A 4EXLA 4XIGQ 2HAVA 3TCGA 3Q25A 1KZ8A 3LV0A 2F6GA 1B7UA 3CIJA 3IB0A 4KR5A 4JB7A 3HCQA 4P0IA 3KJ7A 1XS5A 1LAFE 3C9HA 1B40A 3U8QA 3TYHA 1FSAA 3OELA 4HE1A 4GD5A 4HE2A 4YMAA 1QUJA 3CRBA 3RN8A 4IY5A 2F5XA 4ZZAA 4JBZA 2Q8JA 4JXIA 2AYSA 2LAOA 3T9XB 3Q28A 3H7MA 5ELVA 3DELB 3B7DA 2ANJA 3QXMA 3VVFA 2CEYA 5I3SA 2RC7A 2A5SA 5AE4A 3C33A 2FVZA 3PMVA 1FBEA 1QJMA 2Y5KA 3TQWA 4X9TA 5ICTA 3SKPA 1QUKA 3GLBA 2QFLA 4PAIA 4RPNA 4EQ7A 1SD3A 2XWOA 4OEVA 4MX6A 2MKZA 4MNPA 2V25A 4PFBA 5IM2A 4OTEA 4G8HA 1A54A 4KCCA 2QS3A 1IEJA 4LATA 1FQBA 1P1UA 4YU0A 1RKMA 4PFYA 1VFDA 3TFLA 1B58A 1SQYA 5IGAA 3H6UA 2P2AA 3FJ7A 3MW0A 4NHBA 3CI8A 3SEVA 3N94A 2CMOA 2V3TA 1FPKA 4QSDA 2GRVA 1WVJA 2GQ1A 4G8MA 4MHFA 3PD8A 4MMPA 4UACA 5FTIA 1NUYA 2QRYA 4DDDA 5EYFA 3GBAA 4PE3A 5IZ3A 1M5FA 4ECFA 3B50A 1B0HA 2XXYA 1J1NA 3KN8A 4LZ7A 3SEYA 5ESYA 4LZ8A 1D3KA 3VXBA 4IO3A 1F9BA 3BFTA 4ZS9A 3FUZA 4ZEBA 4WEPA 1AMFA 2IA4A 2Y7RA 1AOVA 2OWSA 1B5HA 3Q26A 1H45A 3T66A 1NH7A 2GHAA 4G68A 1PB9A 1B3GA 2F36A 5I2NB 5IKBA 2XXTA 4MEVA 4AB5A 4F29A 3EHTA 3FJGA 3VDFA 5EQ7A 3V89B 2RKMA 2VPNA 4NF6B 3OEKA 2DS9A 4U4SA 4Z0IA 2RINA 4MAGA 1FTMA 3TPAA 1NUZA 3O6IA 2DWJA 5DYHA 3HV1A 3I6VA 2XXVA 4OVJA 4KQPA 2HCAA 3HSTA 3H4ZA 3U92A 4YAHX 5DTBA 4NF0A 4BDRA 2DXYA 2F3DA 3O29A 3LUZA 5HBCA 4OENA 1VR5A 2XXQA 5HM4B 3H6TA 3MZBA 3UGWA 1ATGA 4PTKA 1N7XA 3T1BA 2NUVA 1B3LA 4EDPA 4PFUA 3S2VA 4AS4A 3SEUA 1NNKA 5AA2D 3MP8A 2PCRA 3QIMA 4X1BA 3A29A 3I3VA 1KA0A 2F7BA 4OFOA 1MQIA 3GXAA 3MP1A 1M5BA 3U94A 4ESWA 4LQ2A 3G3HA 4ESXA 4PE5B 4JSOA 5I59A 1LAHE 2PMSA 3FBPA 4GX3A 4OA4A 3H03A 4R2FA 3IFCA 3U1OA 4G4PA 1NNFA 3KZGA 1Y1ZA 4F2QA 2NVUB 3A09A 2H4IA 3PGFA 1URDA 1RYOA 3O2AA 1N04A 3GBBA 3T22A 2Z22A 1TT1A 4RY1A 4PAKA 2XXXA 3Q29A 1INPA 1S7YA 2QMWA 1UIUA 5DVFA 2QMXA 2ZYNA 4R9GA 2R8TA 4HTGA 4N6PA 4R9FA 1FBFA 4FAJA 3C35A 4HS7A 3PUWE 2E0SA 4YB7A 5B70A 4O94A 4GL0A 4NGUA 3KSJA 1R1NA 2HQ0A 3USDA 2UYFA 4PF8A 1UTBA 1DPPA 4H65A 3W9VA 2VD3A 4N91A 2WYPA 3VLWA 2O84X 1WDNA 4F3BA 3OENA 1ZIUA
chains in the Genus database with same CATH topology
1PBPA 1FQFA 4R6KA 3LSWA 3A3CA 4BDLA 3PV0E 4KHZE 4OFJA 2NWJA 2I4BA 1FW0A 3UA8A 4POWA 5CMKA 4P11A 5I59B 5I58A 1LFHA 4GF8A 2RCAA 3BBRA 1FQDA 5FHOA 3IO6A 2I4CA 3N26A 4DE8A 2DOJA 1R9LA 3DM0A 4NEDA 1B5IA 3FVOA 3TAJA 4FECA 4R6YA 2I3WA 1T0KA 1QULA 2IEEA 3VV5A 3TTKA 4TLLB 1PBQA 2HZLA 4BDQA 4ELPA 3N6UA 4O3AA 4ZEFA 4QHQA 2PBWA 2O6AA 3LSFB 4GXSB 2PVUA 4ZDMA 4OZ9A 3V83A 3EN3A 1LAXA 1B7ZA 2VGQA 2I48A 5CMMA 1BTJA 3V5AA 3TCHA 1DOTA 3H06B 5TP9B 3MVYA 3QK6A 4BDOA 4NF4A 1ZJLA 5EHSA 4IO4A 4KYSA 3N5LA 4OXVA 1SDXA 1MPDA 5A5XB 4BDNA 2UVJA 4GIZA 4G2ZA 4F18A 4KPTA 1IITA 3VVDA 3ILTB 1FTKA 4PP0A 3OO8A 4KYEA 1Y4TA 2I6EA 2DVCA 1US4A 4LP2B 1MXYA 3LSXA 1B05A 1GVCA 4MFIA 4HCYA 2ONSA 3RPWA 3VLUA 1B3FA 1JNFA 1ZKBA 2VHAA 3MPLA 4LA9A 3G3FA 3Q27A 1OVTA 2VD2A 2QS2A 4ZE9A 1L5TA 1B3EA 1OLCA 3LC8A 1FQCA 1LSTA 4C0RA 2ZYOA 4F1YA 4F1VA 2FYIA 3T9UA 5DEXB 2NOOA 1QKBA 4H0WA 3LR1A 1ZU0A 1M5EA 4E0WA 1B9JA 4Q0CA 3UN6A 5JEIA 3MC2A 1FTJA 5FHMA 3O6GA 3WAEA 3RNNA 1JETA 1II5A 3P7IA 3K1MA 2D3IA 1R6ZA 5F1QA 1SW5A 4DXUA 1MY3A 3ZSFA 4QSCA 3TTRA 4YMBA 4QFOA 2Y84A 3L6GA 1Z7ME 1BIYA 3ZKKA 1QKAA 4JWOA 1URSA 1SW1A 3OOAA 3ECRA 4G77A 4EXKA 1O64A 2PT1A 2Y7WA 2RC9A 3O28A 4BDMA 2RF1A 2O7UA 2W7YA 3CG1A 4ELRA 1S50A 3OMBA 4MH5A 4I9DA 4IGTA 3PPPA 3MVZA 1MM7A 3PUYE 3QSLA 4RXLA 1P1OA 3DLNA 1EZPA 1YPNA 4F39A 2VP1A 4L17A 1LGBC 1JW4A 1TWYA 2XD2A 3K6XA 1DSNA 5DT6A 3E13X 2KLFA 4TQUQ 1MY4A 1B2HA 1USYE 5B7DA 4Q5TA 4NF5B 1SYIA 4XTCQ 1IIWA 2DWIA 2AIXA 4F22A 4KD5A 4C1TA 5H8FA 4AQ4A 4ZEIA 5I2NA 3VLVA 1ZBMA 5H8QB 2B3FA 3K02A 1A40A 4NF6A 3TZAA 3OXNA 1FQAA 3JYRA 4NWDA 4PETA 5CRYA 1OIBA 2R9JA 1GV8A 3B6TA 1M5DA 4JWYA 3S9EA 1YCJA 2DYXA 3KN7A 1MG1A 5TU0A 4BLAA 5CC2A 1FQEA 2G29A 4F31B 3E9XA 4QSEA 5J1DA 2PT2A 5H8NB 3O66A 4RPOA 3K01A 2REJA 1MY2A 4YKKA 4NTLA 1SVXB 3C34A 3PU5A 4QFLA 1FTLA 3FGSA 3LBSA 1MQHA 2P0SA 3EHUA 3KJTA 3SEWA 1XVYA 1I6AA 4LZ5A 1HSLA 2O69A 4NF8A 5H8FB 2F35A 5L9SA 3C4MA 1BP5A 1Y9UA 4I62A 5CMCA 1Y3NA 3HPIA 4P0GA 3IK6B 1GR2A 5M2VA 1UQWA 3TODA 1ANFA 5H8HB 3G7WA 4PFTA 1LFIA 1O63A 1B6HA 2XHDA 1B46A 4MLVA 1SYHA 4F3PA 1PEBA 3M3KA 1MXXA 3D4CA 3S4UA 4EQBA 3HN0A 4IO6A 3N6TA 2QL3A 3IAZA 4GLIA 3PPRA 3PUZE 3RTFB 3EHSA 1MDP1 2QS4A 1D9VA 1OQGA 1Z7NE 3LSLA 4Q30B 2HFBA 3MPKA 1LBBA 1ZLQA 4FJPA 4F3GA 1JEVA 2I3VA 1MY0A 3IJOB 5K2YA 4NF8B 3FJMA 4R75A 3U72A 4K3FA 3IX1A 2XX7A 1IXIA 4F19A 1QVSA 4YKJA 3TEPA 2ZNUA 2H5YA 4R6HA 4E0XA 3O97A 1HSJA 3MVWA 2UVIA 5I56B 1SW4A 3T96B 4LQ5A 5LOMA 4O3CA 1MS7A 3FVGA 4GL8A 4DCYA 1US5A 4Z7EA 3KOSA 3RY3A 4H1XA 3H3GA 3M3FA 4ZEDA 5KCJB 4G68C 1AL3A 2HXWA 3EF7A 5TP9A 2D5WA 2BJJX 1P1WA 1MPCA 3O9PA 5I84A 3RTWB 3C31A 4HW8A 5AA4B 1Y1MA 4XXUA 4R74A 3FASA 3PUXE 2O1LA 5CMBA 5I2KA 5A5XA 3SESA 1WODA 1A8FA 2Q89A 1DTZA 2DXRA 3TQLA 2ZNTA 4QFNA 3MP6A 3IOWA 1H76A 1JVYA 2O7IA 2THIA 4F2OA 3K6WA 1DPEA 4U1ZA 2ZYKA 1USYH 3ONMA 5BWJA 4XKRA 5TPAB 4M4GA 4MBPA 3HHFA 3GZGA 5I57B 3R26A 4GVOA 3IOTA 3TTNA 1BLFA 4OEUA 3SERA 4KI0E 4TOZA 4OQOA 4IY6A 2YJPA 3ZKLA 3VXCA 2GH9A 3H6VA 3FZVA 4ISUA 3S9NC 3C36A 2I49A 3AXFA 3MZ9A 2P1SA 2B3BA 2V84A 4U23A 2O68A 5I2KB 4PQJA 1VE4A 5DEXA 2Q2CA 2XX9A 4YICA 4ZE8A 1B3HA 1MQJA 5F7VA 3FVNA 2DSFA 5EHMA 3K1PA 4FIMA 4IB2A 3OO6A 2CZLA 2NXOA 1NNPA 4QFKA 4H5GA 3CFXA 2XXUA 1OMPA 2ESNA 4KCDA 2E1SA 1I6QA 5CI5A 3T9VA 4U4XA 3RGYA 2DWAA 5AA2A 4IO7A 1EU8A 2QJEA 1MQGA 1JQFA 4FATA 2FNCA 1EZOA 4GWOA 3QUFA 1JEUA 4RJZA 1A7LA 2X7QA 2I0CA 3WAFA 2AL4A 1ZTYA 4XKNA 3QUJA 4FORA 2OCUA 3TELA 4IO5A 3PMWA 2F7CA 3IL1B 3F11A 4NMYA 1LB9A 1LLSA 3KG2A 1MH4A 3MZ1A 1JW1A 2Q88A 3CVGA 1DTGA 3V8XB 5DVJA 4O3BA 3TUSA 3FXQA 1Q1KA 1XC1A 3ODBA 3PMXA 1SBPA 3O6HA 1XT8A 3HHGA 3L6HA 1POY1 2XXHA 3K2DA 3K6UA 4KYDA 5L9MA 1IZ1A 1UIVA 1TXFA 4GQOA 2A5TA 4RNSA 4NF5A 1P1QA 3W9WA 3QAXA 5AA2B 1NKXA 5CBRA 3PUVE 2YLNA 3QYTA 3G3JA 5H8QA 2OLBA 4YKIA 1BKAA 1MXUA 3IOUA 5KDTA 2PX1A 1GGGA 2DE4A 1A8EA 4EUOA 2OBGA 3K4UA 4F1UA 2ZNSA 3KOTA 4RYAA 5FTHA 3UK4A 2F34A 3KFMA 3OSRA 1N3XA 2HAUA 2QS1A 3CFLA 1CB6A 4WXJA 4RK2A 1LCFA 3FV2A 4NWCA 4YB5A 1O7TA 4IGRA 3OO7A 1SI0A 3VVEA 5JK4A 4I1DA 1RYXA 1UTHB 2RC8A 4DLDA 1MDQA 2ABHA 2F8DA 5H8NA 4DIGA 1XVXA 3UORA 4YB6A 3THIA 4WKMA 4QFPA 4LONB 2A5TB 2O51A 2G93A 5IAIA 4GFRA 4DCXA 2Z23A 5HPQA 3MBPA 3KN3A 1HSEA 4AB6A 1I69A 3IORA 3C32A 2H25A 3OO9A 5KDTB 4RA1A 3U93A 1B1XA 2Q2AA 4DXBA 5H8HA 3DP8A 1B7HA 3M3LA 1B32A 3S9LC 3MQ9A 4X48A 3PPOA 1IQ7A 2F78A 5AA3A 5CBSA 1N84A 4LVQA 1D9YA 1LCTA 4THIA 5BUUA 1S9TA 5L8DA 3SEXA 2R6GE 3A3UA 2H99A 4GOTA 3TDJA 2PYYA 3G3GA 3M8UA 5ITPA 1LB8A 1N7WA 2XX8A 1A55A 2REGA 1B4ZA 3OD7A 3RT6B 3JZJA 4RK9A 5ICQA 4JSDA 2Q9TA 4XKQA 3RT8A 1PC3A 2DWHA 3PPQA 4X1DA 3VFJA 1VSOA 1EH3A 1Q35A 4JWXA 2Y7PA 4N07A 2VOZA 4FE8A 4U22A 1Y3PA 5CM6A 1IXCA 4OESA 2YPNA 4LUBA 4HCWA 1B1HA 1YTVA 2H98A 4U2RA 5I56A 3D4GA 3CSBA 2QPQA 1JW5A 1JVXA 4DZ1A 4H5FA 2ZXTA 3KEIA 2XXWA 2HEUA 3OEMA 3E4RA 1N76A 3FV1A 4EQ9A 5KCJA 4OYVA 3UIFA 3B6QA 2XXPA 1M5CA 4QRZA 2X26A 1MXZA 2M8CA 2DE2A 3K6VA 1PB8A 1KWHA 1MH3A 1ZMGA 4POXA 5AA4A 1LBCA 1D4NA 3MJNA 1AH5A 2Z8DA 1B4HA 3B6WA 4ONYA 2HZKA 3IR1A 4GXAA 2V93A 4OFLA 1TFAA 4YZZA 1LFGA 4N13A 3TTMA 3KGCA 2QSXA 4G68B 5FHNA 1Y4CA 1SI1A 2OZZA 3IB1A 1A99A 2OJTA 4TLMB 3EQ1A 1H43A 3MUQA 1MXWA 2OK2A 2I58A 4PFWA 4OWDA 5TPAA 4UA8A 5KZTA 4GRKA 2F7AA 3CSGA 3HO7A 3BFUA 4R73A 5I57A 3KSXA 3RLFE 1Y3QA 5ISUA 1SW2A 3FXUA 2R71A 1NL5A 3FVKA 3SDFA 1NNTA 3BKIB 1FCKA 1OLAA 2UVGA 4OHNA 1CE2A 2Y7KA 1XOCA 3ILUB 3MAMA 1QUIA 2GFEA 1P1NA 4NE4A 2ONKE 5ITOA 1POTA 3S9MC 3IJXB 2XD3A 3R7XA 3T9HB 3IB2A 5H8SA 3E3KA 1N0TA 2F6PA 2F97A 1VFEA 2ALUA 1B0LA 3K00A 2AL5A 4OMBA 4C1UA 3TKDA 3CR9A 1MM6A 4ELQA 3T93B 1Y20A 1MXVA 5K2XA 5L9OA 1OQHA 4IO2A 4ZECA 2DVZA 5JTYA 3K0VA 1TFDA 4WEDA 3IOVA 3CFZA 1B52A 4FEBA 3PD9A 3IO4A 3LUYA 4M1VA 4ELOA 3FD3A 1PDAA 2UVHA 1UTBB 3RQTA 5AA1A 2H9BA 4YKPA 2O1MA 3JV9A 2D21A 1DMBA 4Q8RA 3CG3A 2ZMBA 4JDFA 3FIRA 2XXIA 3RUMA 5I58B 2WKYA 2Y7IA 1I6BA 1IXGA 4OERA 3K1NA 4U21A 2DE3A 2GHBA 4KFQA 3I5OA 1LAGE 1B5JA 1NFTA 2Z8FA 3VE1B 1NH8A 5JTYB 1NMUA 4DXCA 4XKPA 1GTKA 4H6DA 1OVBA 1EZ9A 1FTOA 4U1OA 4EF2A 2X7PA 3MWBA 2FA7A 2Z8EA 1PB7A 5DVIA 3DP4A 1XHYA 2ZYMA 3ZS6A 1R9QA 3TTLA 1N3WA 4H8IA 3MVXA 4I8CA 2UXAA 1IXHA 4MF3A 1P99A 2V3QA 2ONRA 2RCBA 1YAEA 2B65A 4R72A 3TMGA 3G3KA 4NF4B 3TCFA 4FEDA 2DQVA 4ZEKA 1MQDA 2V3UA 3FATA 4R2BA 1URGA 1AIVA 1IUDA 2OWTA 4H67A 3PPNA 3OSQA 1H44A 1UTHA 3H6WA 4ND9A 4OETA 2UYEA 2I0BA 4ZZEA 3R6UA 4F3SA 4MLQA 1B51A 3G3IA 4EF1A 3UP9A 3SETA 4G8NA 2XXRA 2DP8A 1QW0A 1MY1A 1MPBA 4H8JA 3DP6A 3FXRA 1MRPA 1H3DA 3KBRA 3EPEA 3W15C 1ELJA 4QF9A 4EXLA 4XIGQ 2HAVA 3TCGA 3Q25A 2F6GA 1B7UA 3CIJA 3IB0A 4KR5A 4JB7A 3HCQA 4P0IA 3KJ7A 1XS5A 1LAFE 3C9HA 1B40A 3U8QA 3TYHA 3OELA 4GD5A 4YMAA 1QUJA 3CRBA 3RN8A 4IY5A 2F5XA 4ZZAA 4JBZA 2Q8JA 4JXIA 2AYSA 2LAOA 3T9XB 3Q28A 3H7MA 5ELVA 3DELB 3B7DA 2ANJA 3QXMA 3VVFA 2RC7A 2A5SA 5AE4A 3C33A 3PMVA 1QJMA 3TQWA 4X9TA 5ICTA 3SKPA 1QUKA 3GLBA 4RPNA 4EQ7A 1SD3A 4OEVA 2V25A 4OTEA 4G8HA 1A54A 4KCCA 2QS3A 1IEJA 4LATA 1FQBA 1P1UA 4YU0A 1RKMA 4PFYA 1VFDA 3TFLA 1SQYA 1B58A 3H6UA 2P2AA 3FJ7A 3MW0A 3CI8A 3SEVA 3N94A 2CMOA 2V3TA 4QSDA 2GRVA 1WVJA 4G8MA 3PD8A 4UACA 5FTIA 2QRYA 4DDDA 5EYFA 3GBAA 1M5FA 4ECFA 1B0HA 2XXYA 1J1NA 3KN8A 4LZ7A 3SEYA 4LZ8A 1D3KA 3VXBA 4IO3A 1F9BA 3BFTA 4ZS9A 3FUZA 4ZEBA 4WEPA 1AMFA 2IA4A 2Y7RA 1AOVA 2OWSA 1B5HA 3Q26A 1H45A 3T66A 1NH7A 2GHAA 4G68A 1PB9A 1B3GA 2F36A 5I2NB 5IKBA 2XXTA 4AB5A 4F29A 3EHTA 3FJGA 3VDFA 3V89B 2RKMA 4NF6B 3OEKA 2DS9A 4U4SA 4Z0IA 2RINA 1FTMA 3TPAA 3O6IA 2DWJA 5DYHA 3HV1A 3I6VA 2XXVA 4OVJA 4KQPA 2HCAA 3HSTA 3H4ZA 3U92A 4YAHX 5DTBA 4BDRA 2DXYA 3O29A 5HBCA 4OENA 1VR5A 2XXQA 5HM4B 3H6TA 3MZBA 3UGWA 1ATGA 1N7XA 2NUVA 1B3LA 4EDPA 4PFUA 3S2VA 3SEUA 1NNKA 5AA2D 3MP8A 3QIMA 4X1BA 3I3VA 2F7BA 4OFOA 1MQIA 3GXAA 3MP1A 1M5BA 4ESWA 3U94A 4LQ2A 3G3HA 4ESXA 4PE5B 4JSOA 5I59A 1LAHE 2PMSA 3H03A 4R2FA 3U1OA 4G4PA 1NNFA 3KZGA 4F2QA 1Y1ZA 2NVUB 3A09A 2H4IA 3PGFA 1URDA 1RYOA 3O2AA 1N04A 3GBBA 3T22A 2Z22A 1TT1A 4RY1A 2XXXA 3Q29A 1S7YA 2QMWA 1UIUA 5DVFA 2QMXA 2ZYNA 4R9GA 4HTGA 4N6PA 4R9FA 4FAJA 3C35A 4HS7A 3PUWE 2E0SA 4YB7A 5B70A 4GL0A 3KSJA 1R1NA 2HQ0A 3USDA 2UYFA 1UTBA 1DPPA 4H65A 3W9VA 2VD3A 3VLWA 2O84X 1WDNA 4F3BA 3OENA 1ZIUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PBP A;  1FQF A;  4R6K A;  3LSW A;  3A3C A;  4BDL A;  3PV0 E;  4KHZ E;  4OFJ A;  2NWJ A;  2I4B A;  1FW0 A;  3UA8 A;  4POW A;  5CMK A;  4P11 A;  5I59 B;  5I58 A;  1LFH A;  4GF8 A;  2RCA A;  3BBR A;  1FQD A;  5FHO A;  3IO6 A;  2I4C A;  3N26 A;  4DE8 A;  2DOJ A;  1R9L A;  3DM0 A;  4NED A;  1B5I A;  3FVO A;  3TAJ A;  4FEC A;  4R6Y A;  2I3W A;  1T0K A;  1QUL A;  2IEE A;  3VV5 A;  3TTK A;  4TLL B;  1PBQ A;  2HZL A;  4BDQ A;  4ELP A;  3N6U A;  4O3A A;  4ZEF A;  4QHQ A;  2PBW A;  2O6A A;  3LSF B;  4GXS B;  2PVU A;  4ZDM A;  4OZ9 A;  3V83 A;  3EN3 A;  1LAX A;  1B7Z A;  2VGQ A;  2I48 A;  5CMM A;  1BTJ A;  3V5A A;  3TCH A;  1DOT A;  3H06 B;  5TP9 B;  3MVY A;  3QK6 A;  4BDO A;  4NF4 A;  1ZJL A;  5EHS A;  4IO4 A;  4KYS A;  3N5L A;  4OXV A;  1SDX A;  1MPD A;  5A5X B;  4BDN A;  2UVJ A;  4GIZ A;  4G2Z A;  4F18 A;  4KPT A;  1IIT A;  3VVD A;  3ILT B;  1FTK A;  4PP0 A;  3OO8 A;  4KYE A;  1Y4T A;  2I6E A;  2DVC A;  1US4 A;  4LP2 B;  1MXY A;  3LSX A;  1B05 A;  1GVC A;  4MFI A;  4HCY A;  2ONS A;  3RPW A;  3VLU A;  1B3F A;  1JNF A;  1ZKB A;  2VHA A;  3MPL A;  4LA9 A;  3G3F A;  3Q27 A;  1OVT A;  2VD2 A;  2QS2 A;  4ZE9 A;  1L5T A;  1B3E A;  1OLC A;  3LC8 A;  1FQC A;  1LST A;  4C0R A;  2ZYO A;  4F1Y A;  4F1V A;  2FYI A;  3T9U A;  5DEX B;  2NOO A;  1QKB A;  4H0W A;  3LR1 A;  1ZU0 A;  1M5E A;  4E0W A;  1B9J A;  4Q0C A;  3UN6 A;  5JEI A;  3MC2 A;  1FTJ A;  5FHM A;  3O6G A;  3WAE A;  3RNN A;  1JET A;  1II5 A;  3P7I A;  3K1M A;  2D3I A;  1R6Z A;  5F1Q A;  1SW5 A;  4DXU A;  1MY3 A;  3ZSF A;  4QSC A;  3TTR A;  4YMB A;  4QFO A;  2Y84 A;  3L6G A;  1Z7M E;  1BIY A;  3ZKK A;  1QKA A;  4JWO A;  1URS A;  1SW1 A;  3OOA A;  3ECR A;  4G77 A;  4EXK A;  1O64 A;  2PT1 A;  2Y7W A;  2RC9 A;  3O28 A;  4BDM A;  2RF1 A;  2O7U A;  2W7Y A;  3CG1 A;  4ELR A;  1S50 A;  3OMB A;  4MH5 A;  4I9D A;  4IGT A;  3PPP A;  3MVZ A;  1MM7 A;  3PUY E;  3QSL A;  4RXL A;  1P1O A;  3DLN A;  1EZP A;  1YPN A;  4F39 A;  2VP1 A;  4L17 A;  1LGB C;  1JW4 A;  1TWY A;  2XD2 A;  3K6X A;  1DSN A;  5DT6 A;  3E13 X;  2KLF A;  4TQU Q;  1MY4 A;  1B2H A;  1USY E;  5B7D A;  4Q5T A;  4NF5 B;  1SYI A;  4XTC Q;  1IIW A;  2DWI A;  2AIX A;  4F22 A;  4KD5 A;  4C1T A;  5H8F A;  4AQ4 A;  4ZEI A;  5I2N A;  3VLV A;  1ZBM A;  5H8Q B;  2B3F A;  3K02 A;  1A40 A;  4NF6 A;  3TZA A;  3OXN A;  1FQA A;  3JYR A;  4NWD A;  4PET A;  5CRY A;  1OIB A;  2R9J A;  1GV8 A;  3B6T A;  1M5D A;  4JWY A;  3S9E A;  1YCJ A;  2DYX A;  3KN7 A;  1MG1 A;  5TU0 A;  4BLA A;  5CC2 A;  1FQE A;  2G29 A;  4F31 B;  3E9X A;  4QSE A;  5J1D A;  2PT2 A;  5H8N B;  3O66 A;  4RPO A;  3K01 A;  2REJ A;  1MY2 A;  4YKK A;  4NTL A;  1SVX B;  3C34 A;  3PU5 A;  4QFL A;  1FTL A;  3FGS A;  3LBS A;  1MQH A;  2P0S A;  3EHU A;  3KJT A;  3SEW A;  1XVY A;  1I6A A;  4LZ5 A;  1HSL A;  2O69 A;  4NF8 A;  5H8F B;  2F35 A;  5L9S A;  3C4M A;  1BP5 A;  1Y9U A;  4I62 A;  5CMC A;  1Y3N A;  3HPI A;  4P0G A;  3IK6 B;  1GR2 A;  5M2V A;  1UQW A;  3TOD A;  1ANF A;  5H8H B;  3G7W A;  4PFT A;  1LFI A;  1O63 A;  1B6H A;  2XHD A;  1B46 A;  4MLV A;  1SYH A;  4F3P A;  1PEB A;  3M3K A;  1MXX A;  3D4C A;  3S4U A;  4EQB A;  3HN0 A;  4IO6 A;  3N6T A;  2QL3 A;  3IAZ A;  4GLI A;  3PPR A;  3PUZ E;  3RTF B;  3EHS A;  1MDP 1;  2QS4 A;  1D9V A;  1OQG A;  1Z7N E;  3LSL A;  4Q30 B;  2HFB A;  3MPK A;  1LBB A;  1ZLQ A;  4FJP A;  4F3G A;  1JEV A;  2I3V A;  1MY0 A;  3IJO B;  5K2Y A;  4NF8 B;  3FJM A;  4R75 A;  3U72 A;  4K3F A;  3IX1 A;  2XX7 A;  1IXI A;  4F19 A;  1QVS A;  4YKJ A;  3TEP A;  2ZNU A;  2H5Y A;  4R6H A;  4E0X A;  3O97 A;  1HSJ A;  3MVW A;  2UVI A;  5I56 B;  1SW4 A;  3T96 B;  4LQ5 A;  5LOM A;  4O3C A;  1MS7 A;  3FVG A;  4GL8 A;  4DCY A;  1US5 A;  4Z7E A;  3KOS A;  3RY3 A;  4H1X A;  3H3G A;  3M3F A;  4ZED A;  5KCJ B;  4G68 C;  1AL3 A;  2HXW A;  3EF7 A;  5TP9 A;  2D5W A;  2BJJ X;  1P1W A;  1MPC A;  3O9P A;  5I84 A;  3RTW B;  3C31 A;  4HW8 A;  5AA4 B;  1Y1M A;  4XXU A;  4R74 A;  3FAS A;  3PUX E;  2O1L A;  5CMB A;  5I2K A;  5A5X A;  3SES A;  1WOD A;  1A8F A;  2Q89 A;  1DTZ A;  2DXR A;  3TQL A;  2ZNT A;  4QFN A;  3MP6 A;  3IOW A;  1H76 A;  1JVY A;  2O7I A;  2THI A;  4F2O A;  3K6W A;  1DPE A;  4U1Z A;  2ZYK A;  1USY H;  3ONM A;  5BWJ A;  4XKR A;  5TPA B;  4M4G A;  4MBP A;  3HHF A;  3GZG A;  5I57 B;  3R26 A;  4GVO A;  3IOT A;  3TTN A;  1BLF A;  4OEU A;  3SER A;  4KI0 E;  4TOZ A;  4OQO A;  4IY6 A;  2YJP A;  3ZKL A;  3VXC A;  2GH9 A;  3H6V A;  3FZV A;  4ISU A;  3S9N C;  3C36 A;  2I49 A;  3AXF A;  3MZ9 A;  2P1S A;  2B3B A;  2V84 A;  4U23 A;  2O68 A;  5I2K B;  4PQJ A;  1VE4 A;  5DEX A;  2Q2C A;  2XX9 A;  4YIC A;  4ZE8 A;  1B3H A;  1MQJ A;  5F7V A;  3FVN A;  2DSF A;  5EHM A;  3K1P A;  4FIM A;  4IB2 A;  3OO6 A;  2CZL A;  2NXO A;  1NNP A;  4QFK A;  4H5G A;  3CFX A;  2XXU A;  1OMP A;  2ESN A;  4KCD A;  2E1S A;  1I6Q A;  5CI5 A;  3T9V A;  4U4X A;  3RGY A;  2DWA A;  5AA2 A;  4IO7 A;  1EU8 A;  2QJE A;  1MQG A;  1JQF A;  4FAT A;  2FNC A;  1EZO A;  4GWO A;  3QUF A;  1JEU A;  4RJZ A;  1A7L A;  2X7Q A;  2I0C A;  3WAF A;  2AL4 A;  1ZTY A;  4XKN A;  3QUJ A;  4FOR A;  2OCU A;  3TEL A;  4IO5 A;  3PMW A;  2F7C A;  3IL1 B;  3F11 A;  4NMY A;  1LB9 A;  1LLS A;  3KG2 A;  1MH4 A;  3MZ1 A;  1JW1 A;  2Q88 A;  3CVG A;  1DTG A;  3V8X B;  5DVJ A;  4O3B A;  3TUS A;  3FXQ A;  1Q1K A;  1XC1 A;  3ODB A;  3PMX A;  1SBP A;  3O6H A;  1XT8 A;  3HHG A;  3L6H A;  1POY 1;  2XXH A;  3K2D A;  3K6U A;  4KYD A;  5L9M A;  1IZ1 A;  1UIV A;  1TXF A;  4GQO A;  2A5T A;  4RNS A;  4NF5 A;  1P1Q A;  3W9W A;  3QAX A;  5AA2 B;  1NKX A;  5CBR A;  3PUV E;  2YLN A;  3QYT A;  3G3J A;  5H8Q A;  2OLB A;  4YKI A;  1BKA A;  1MXU A;  3IOU A;  5KDT A;  2PX1 A;  1GGG A;  2DE4 A;  1A8E A;  4EUO A;  2OBG A;  3K4U A;  4F1U A;  2ZNS A;  3KOT A;  4RYA A;  5FTH A;  3UK4 A;  2F34 A;  3KFM A;  3OSR A;  1N3X A;  2HAU A;  2QS1 A;  3CFL A;  1CB6 A;  4WXJ A;  4RK2 A;  1LCF A;  3FV2 A;  4NWC A;  4YB5 A;  1O7T A;  4IGR A;  3OO7 A;  1SI0 A;  3VVE A;  5JK4 A;  4I1D A;  1RYX A;  1UTH B;  2RC8 A;  4DLD A;  1MDQ A;  2ABH A;  2F8D A;  5H8N A;  4DIG A;  1XVX A;  3UOR A;  4YB6 A;  3THI A;  4WKM A;  4QFP A;  4LON B;  2A5T B;  2O51 A;  2G93 A;  5IAI A;  4GFR A;  4DCX A;  2Z23 A;  5HPQ A;  3MBP A;  3KN3 A;  1HSE A;  4AB6 A;  1I69 A;  3IOR A;  3C32 A;  2H25 A;  3OO9 A;  5KDT B;  4RA1 A;  3U93 A;  1B1X A;  2Q2A A;  4DXB A;  5H8H A;  3DP8 A;  1B7H A;  3M3L A;  1B32 A;  3S9L C;  3MQ9 A;  4X48 A;  3PPO A;  1IQ7 A;  2F78 A;  5AA3 A;  5CBS A;  1N84 A;  4LVQ A;  1D9Y A;  1LCT A;  4THI A;  5BUU A;  1S9T A;  5L8D A;  3SEX A;  2R6G E;  3A3U A;  2H99 A;  4GOT A;  3TDJ A;  2PYY A;  3G3G A;  3M8U A;  5ITP A;  1LB8 A;  1N7W A;  2XX8 A;  1A55 A;  2REG A;  1B4Z A;  3OD7 A;  3RT6 B;  3JZJ A;  4RK9 A;  5ICQ A;  4JSD A;  2Q9T A;  4XKQ A;  3RT8 A;  1PC3 A;  2DWH A;  3PPQ A;  4X1D A;  3VFJ A;  1VSO A;  1EH3 A;  1Q35 A;  4JWX A;  2Y7P A;  4N07 A;  2VOZ A;  4FE8 A;  4U22 A;  1Y3P A;  5CM6 A;  1IXC A;  4OES A;  2YPN A;  4LUB A;  4HCW A;  1B1H A;  1YTV A;  2H98 A;  4U2R A;  5I56 A;  3D4G A;  3CSB A;  2QPQ A;  1JW5 A;  1JVX A;  4DZ1 A;  4H5F A;  2ZXT A;  3KEI A;  2XXW A;  2HEU A;  3OEM A;  3E4R A;  1N76 A;  3FV1 A;  4EQ9 A;  5KCJ A;  4OYV A;  3UIF A;  3B6Q A;  2XXP A;  1M5C A;  4QRZ A;  2X26 A;  1MXZ A;  2M8C A;  2DE2 A;  3K6V A;  1PB8 A;  1KWH A;  1MH3 A;  1ZMG A;  4POX A;  5AA4 A;  1LBC A;  1D4N A;  3MJN A;  1AH5 A;  2Z8D A;  1B4H A;  3B6W A;  4ONY A;  2HZK A;  3IR1 A;  4GXA A;  2V93 A;  4OFL A;  1TFA A;  4YZZ A;  1LFG A;  4N13 A;  3TTM A;  3KGC A;  2QSX A;  4G68 B;  5FHN A;  1Y4C A;  1SI1 A;  2OZZ A;  3IB1 A;  1A99 A;  2OJT A;  4TLM B;  3EQ1 A;  1H43 A;  3MUQ A;  1MXW A;  2OK2 A;  2I58 A;  4PFW A;  4OWD A;  5TPA A;  4UA8 A;  5KZT A;  4GRK A;  2F7A A;  3CSG A;  3HO7 A;  3BFU A;  4R73 A;  5I57 A;  3KSX A;  3RLF E;  1Y3Q A;  5ISU A;  1SW2 A;  3FXU A;  2R71 A;  1NL5 A;  3FVK A;  3SDF A;  1NNT A;  3BKI B;  1FCK A;  1OLA A;  2UVG A;  4OHN A;  1CE2 A;  2Y7K A;  1XOC A;  3ILU B;  3MAM A;  1QUI A;  2GFE A;  1P1N A;  4NE4 A;  2ONK E;  5ITO A;  1POT A;  3S9M C;  3IJX B;  2XD3 A;  3R7X A;  3T9H B;  3IB2 A;  5H8S A;  3E3K A;  1N0T A;  2F6P A;  2F97 A;  1VFE A;  2ALU A;  1B0L A;  3K00 A;  2AL5 A;  4OMB A;  4C1U A;  3TKD A;  3CR9 A;  1MM6 A;  4ELQ A;  3T93 B;  1Y20 A;  1MXV A;  5K2X A;  5L9O A;  1OQH A;  4IO2 A;  4ZEC A;  2DVZ A;  5JTY A;  3K0V A;  1TFD A;  4WED A;  3IOV A;  3CFZ A;  1B52 A;  4FEB A;  3PD9 A;  3IO4 A;  3LUY A;  4M1V A;  4ELO A;  3FD3 A;  1PDA A;  2UVH A;  1UTB B;  3RQT A;  5AA1 A;  2H9B A;  4YKP A;  2O1M A;  3JV9 A;  2D21 A;  1DMB A;  4Q8R A;  3CG3 A;  2ZMB A;  4JDF A;  3FIR A;  2XXI A;  3RUM A;  5I58 B;  2WKY A;  2Y7I A;  1I6B A;  1IXG A;  4OER A;  3K1N A;  4U21 A;  2DE3 A;  2GHB A;  4KFQ A;  3I5O A;  1LAG E;  1B5J A;  1NFT A;  2Z8F A;  3VE1 B;  1NH8 A;  5JTY B;  1NMU A;  4DXC A;  4XKP A;  1GTK A;  4H6D A;  1OVB A;  1EZ9 A;  1FTO A;  4U1O A;  4EF2 A;  2X7P A;  3MWB A;  2FA7 A;  2Z8E A;  1PB7 A;  5DVI A;  3DP4 A;  1XHY A;  2ZYM A;  3ZS6 A;  1R9Q A;  3TTL A;  1N3W A;  4H8I A;  3MVX A;  4I8C A;  2UXA A;  1IXH A;  4MF3 A;  1P99 A;  2V3Q A;  2ONR A;  2RCB A;  1YAE A;  2B65 A;  4R72 A;  3TMG A;  3G3K A;  4NF4 B;  3TCF A;  4FED A;  2DQV A;  4ZEK A;  1MQD A;  2V3U A;  3FAT A;  4R2B A;  1URG A;  1AIV A;  1IUD A;  2OWT A;  4H67 A;  3PPN A;  3OSQ A;  1H44 A;  1UTH A;  3H6W A;  4ND9 A;  4OET A;  2UYE A;  2I0B A;  4ZZE A;  3R6U A;  4F3S A;  4MLQ A;  1B51 A;  3G3I A;  4EF1 A;  3UP9 A;  3SET A;  4G8N A;  2XXR A;  2DP8 A;  1QW0 A;  1MY1 A;  1MPB A;  4H8J A;  3DP6 A;  3FXR A;  1MRP A;  1H3D A;  3KBR A;  3EPE A;  3W15 C;  1ELJ A;  4QF9 A;  4EXL A;  4XIG Q;  2HAV A;  3TCG A;  3Q25 A;  2F6G A;  1B7U A;  3CIJ A;  3IB0 A;  4KR5 A;  4JB7 A;  3HCQ A;  4P0I A;  3KJ7 A;  1XS5 A;  1LAF E;  3C9H A;  1B40 A;  3U8Q A;  3TYH A;  3OEL A;  4GD5 A;  4YMA A;  1QUJ A;  3CRB A;  3RN8 A;  4IY5 A;  2F5X A;  4ZZA A;  4JBZ A;  2Q8J A;  4JXI A;  2AYS A;  2LAO A;  3T9X B;  3Q28 A;  3H7M A;  5ELV A;  3DEL B;  3B7D A;  2ANJ A;  3QXM A;  3VVF A;  2RC7 A;  2A5S A;  5AE4 A;  3C33 A;  3PMV A;  1QJM A;  3TQW A;  4X9T A;  5ICT A;  3SKP A;  1QUK A;  3GLB A;  4RPN A;  4EQ7 A;  1SD3 A;  4OEV A;  2V25 A;  4OTE A;  4G8H A;  1A54 A;  4KCC A;  2QS3 A;  1IEJ A;  4LAT A;  1FQB A;  1P1U A;  4YU0 A;  1RKM A;  4PFY A;  1VFD A;  3TFL A;  1SQY A;  1B58 A;  3H6U A;  2P2A A;  3FJ7 A;  3MW0 A;  3CI8 A;  3SEV A;  3N94 A;  2CMO A;  2V3T A;  4QSD A;  2GRV A;  1WVJ A;  4G8M A;  3PD8 A;  4UAC A;  5FTI A;  2QRY A;  4DDD A;  5EYF A;  3GBA A;  1M5F A;  4ECF A;  1B0H A;  2XXY A;  1J1N A;  3KN8 A;  4LZ7 A;  3SEY A;  4LZ8 A;  1D3K A;  3VXB A;  4IO3 A;  1F9B A;  3BFT A;  4ZS9 A;  3FUZ A;  4ZEB A;  4WEP A;  1AMF A;  2IA4 A;  2Y7R A;  1AOV A;  2OWS A;  1B5H A;  3Q26 A;  1H45 A;  3T66 A;  1NH7 A;  2GHA A;  4G68 A;  1PB9 A;  1B3G A;  2F36 A;  5I2N B;  5IKB A;  2XXT A;  4AB5 A;  4F29 A;  3EHT A;  3FJG A;  3VDF A;  3V89 B;  2RKM A;  4NF6 B;  3OEK A;  2DS9 A;  4U4S A;  4Z0I A;  2RIN A;  1FTM A;  3TPA A;  3O6I A;  2DWJ A;  5DYH A;  3HV1 A;  3I6V A;  2XXV A;  4OVJ A;  4KQP A;  2HCA A;  3HST A;  3H4Z A;  3U92 A;  4YAH X;  5DTB A;  4BDR A;  2DXY A;  3O29 A;  5HBC A;  4OEN A;  1VR5 A;  2XXQ A;  5HM4 B;  3H6T A;  3MZB A;  3UGW A;  1ATG A;  1N7X A;  2NUV A;  1B3L A;  4EDP A;  4PFU A;  3S2V A;  3SEU A;  1NNK A;  5AA2 D;  3MP8 A;  3QIM A;  4X1B A;  3I3V A;  2F7B A;  4OFO A;  1MQI A;  3GXA A;  3MP1 A;  1M5B A;  4ESW A;  3U94 A;  4LQ2 A;  3G3H A;  4ESX A;  4PE5 B;  4JSO A;  5I59 A;  1LAH E;  2PMS A;  3H03 A;  4R2F A;  3U1O A;  4G4P A;  1NNF A;  3KZG A;  4F2Q A;  1Y1Z A;  2NVU B;  3A09 A;  2H4I A;  3PGF A;  1URD A;  1RYO A;  3O2A A;  1N04 A;  3GBB A;  3T22 A;  2Z22 A;  1TT1 A;  4RY1 A;  2XXX A;  3Q29 A;  1S7Y A;  2QMW A;  1UIU A;  5DVF A;  2QMX A;  2ZYN A;  4R9G A;  4HTG A;  4N6P A;  4R9F A;  4FAJ A;  3C35 A;  4HS7 A;  3PUW E;  2E0S A;  4YB7 A;  5B70 A;  4GL0 A;  3KSJ A;  1R1N A;  2HQ0 A;  3USD A;  2UYF A;  1UTB A;  1DPP A;  4H65 A;  3W9V A;  2VD3 A;  3VLW A;  2O84 X;  1WDN A;  4F3B A;  3OEN A;  1ZIU A; 
#chains in the Genus database with same CATH topology
 5FBP A;  1PBP A;  1JP4 A;  1FQF A;  4R6K A;  3LSW A;  3A3C A;  3RPL A;  3PV0 E;  4BDL A;  4KHZ E;  2WEF A;  4OFJ A;  2NWJ A;  2I4B A;  1FW0 A;  3UA8 A;  4POW A;  5CMK A;  4P11 A;  1NV5 A;  5I59 B;  5I58 A;  4P1E A;  1LFH A;  4GF8 A;  2RCA A;  3BBR A;  1FQD A;  5FHO A;  2KQZ A;  3IO6 A;  2I4C A;  3N26 A;  4DE8 A;  2DOJ A;  1R9L A;  3DM0 A;  4NED A;  1B5I A;  3FVO A;  4OVT A;  4GX6 A;  3TAJ A;  4FEC A;  4R6Y A;  2I3W A;  1T0K A;  1QUL A;  2IEE A;  3VV5 A;  3TTK A;  4TLL B;  1PBQ A;  2HZL A;  4BDQ A;  4ELP A;  3N6U A;  4O3A A;  4ZEF A;  2DDK A;  4QHQ A;  2PBW A;  2O6A A;  2KR0 A;  3LSF B;  4GXS B;  2PVU A;  1FPJ A;  4ZDM A;  1NV4 A;  4OZ9 A;  4NG7 A;  3V83 A;  3EN3 A;  1LAX A;  1B7Z A;  1FRP A;  2VGQ A;  2I48 A;  5CMM A;  1BTJ A;  3V5A A;  3TCH A;  1DOT A;  3H06 B;  5TP9 B;  3MVY A;  3QK6 A;  1EYJ A;  4BDO A;  4NF4 A;  4JVC A;  1ZJL A;  5EHS A;  4IO4 A;  4KYS A;  3N5L A;  4OXV A;  1SDX A;  1MPD A;  5A5X B;  1FJ6 A;  4BDN A;  2P3V A;  2UVJ A;  4GIZ A;  4G2Z A;  4F18 A;  2FIE A;  3D1R A;  4KPT A;  4GWW A;  1IIT A;  3VVD A;  3ILT B;  1FTK A;  2B4M A;  4PP0 A;  3OO8 A;  4KYE A;  4GWS A;  4MIJ A;  1Y4T A;  2I6E A;  2DVC A;  1US4 A;  4LP2 B;  1MXY A;  3LSX A;  1B05 A;  1GVC A;  4MFI A;  4HCY A;  1NV2 A;  2ONS A;  4QBA A;  3RPW A;  3VLU A;  1B3F A;  1JNF A;  5I5P A;  1ZKB A;  2VHA A;  4N81 A;  3MPL A;  4PFI A;  4LA9 A;  3G3F A;  3Q27 A;  1OVT A;  2VD2 A;  2QS2 A;  3NOH A;  4ZE9 A;  5A5L A;  1L5T A;  1B3E A;  1OLC A;  3RYD A;  3LC8 A;  1FQC A;  1LST A;  4C0R A;  2ZYO A;  4F1Y A;  4F1V A;  2FYI A;  3T9U A;  5DEX B;  2NOO A;  1FBD A;  1QKB A;  1LBV A;  4H0W A;  3FXB A;  3LR1 A;  1ZU0 A;  1M5E A;  4UAB A;  4I3Y A;  4E0W A;  1B9J A;  4Q0C A;  3UN6 A;  5JEI A;  3MC2 A;  1FTJ A;  2QVV A;  5FHM A;  3O6G A;  3WAE A;  3RNN A;  1JET A;  1II5 A;  3P7I A;  4X04 A;  3K1M A;  2D3I A;  1R6Z A;  1RDX A;  3KC0 A;  5F1Q A;  1SW5 A;  4DXU A;  1MY3 A;  3ZSF A;  4QSC A;  3TTR A;  1G0H A;  4YMB A;  4QFO A;  2Y84 A;  3L6G A;  1Z7M E;  1BIY A;  3ZKK A;  1QKA A;  4I40 A;  4JWO A;  1URS A;  4IR8 A;  1SW1 A;  3OOA A;  3ECR A;  4G77 A;  4EXK A;  1O64 A;  2PT1 A;  2Y7W A;  4HE0 A;  2RC9 A;  3O28 A;  4BDM A;  4MNI A;  2RF1 A;  2O7U A;  2W7Y A;  3CG1 A;  4ELR A;  1S50 A;  3OMB A;  4MH5 A;  4I9D A;  1IMC A;  1FPG A;  4IGT A;  4O7I A;  3PPP A;  3MVZ A;  4GBV A;  1MM7 A;  3PUY E;  3QSL A;  4RXL A;  1P1O A;  3DLN A;  1EZP A;  1YPN A;  2Q8M A;  4F39 A;  2VP1 A;  4L17 A;  1LGB C;  1JW4 A;  1XI6 A;  1TWY A;  2XD2 A;  3K6X A;  1FBH A;  4I3E A;  1DSN A;  5DT6 A;  1K9Y A;  3E13 X;  2KLF A;  4TQU Q;  1MY4 A;  1B2H A;  1USY E;  5B7D A;  4OVP A;  3BIG A;  4Q5T A;  4NF5 B;  1SYI A;  4XTC Q;  1IIW A;  2ZZW A;  2DWI A;  2AIX A;  4F22 A;  4KD5 A;  4C1T A;  5H8F A;  4AQ4 A;  4ZEI A;  5I2N A;  3VLV A;  1ZBM A;  5H8Q B;  3ISP A;  2B3F A;  3K02 A;  1A40 A;  4NF6 A;  2B4L A;  3TZA A;  3OXN A;  1FQA A;  3JYR A;  4NWD A;  4PET A;  5CRY A;  1OIB A;  2R9J A;  1LEV A;  1GV8 A;  3B6T A;  1M5D A;  4JWY A;  3S9E A;  1YCJ A;  2DYX A;  3KN7 A;  1MG1 A;  4PFR A;  5TU0 A;  4BLA A;  5CC2 A;  1FQE A;  2G29 A;  4F31 B;  1FPF A;  3E9X A;  4QSE A;  4NAP A;  5J1D A;  2PT2 A;  5H8N B;  3O66 A;  4RPO A;  3K01 A;  2REJ A;  1MY2 A;  4YKK A;  1D9Q A;  4NTL A;  1FPI A;  1SVX B;  3C34 A;  3PU5 A;  4QFL A;  1FTL A;  3FGS A;  3LBS A;  1MQH A;  1IMF A;  4DI3 D;  2P0S A;  4N17 A;  3EHU A;  3KBZ A;  4H46 A;  3KJT A;  3SEW A;  1XVY A;  1I6A A;  4LZ5 A;  1HSL A;  2O69 A;  4NF8 A;  5H8F B;  2F35 A;  2CZK A;  5L9S A;  1NV6 A;  3C4M A;  1BP5 A;  1AWB A;  1Y9U A;  5ET7 A;  4I62 A;  1NUX A;  5CMC A;  1Y3N A;  3HPI A;  2QVU A;  4P0G A;  3IK6 B;  1GR2 A;  5M2V A;  1UQW A;  3TOD A;  1ANF A;  5H8H B;  3G7W A;  4PFT A;  1LFI A;  1O63 A;  1B6H A;  3E79 A;  4XFE A;  2XHD A;  1B46 A;  4MLV A;  1SYH A;  4F3P A;  1PEB A;  3M3K A;  4NQ8 A;  1MXX A;  3D4C A;  3S4U A;  4EQB A;  3HN0 A;  4IO6 A;  3N6T A;  2QL3 A;  3IAZ A;  4GLI A;  3PPR A;  3PUZ E;  3RTF B;  3EHS A;  1MDP 1;  2QS4 A;  1D9V A;  1OQG A;  1FBG A;  1Z7N E;  3IFA A;  3LSL A;  4Q30 B;  2HFB A;  4HXV A;  3MPK A;  1LBB A;  1ZLQ A;  4FJP A;  4F3G A;  1JEV A;  2I3V A;  1MY0 A;  3IJO B;  5K2Y A;  4NF8 B;  3FJM A;  4R75 A;  3U72 A;  5ET8 A;  4K3F A;  3IX1 A;  2XX7 A;  1IXI A;  4F19 A;  1QVS A;  4YKJ A;  3TEP A;  2ZNU A;  2H5Y A;  4R6H A;  4E0X A;  3O97 A;  1HSJ A;  3MVW A;  2UVI A;  5I56 B;  2WBD A;  1SW4 A;  3T96 B;  4LQ5 A;  5LOM A;  4O3C A;  1MS7 A;  3FVG A;  4GL8 A;  3T0J A;  2HXR A;  4DCY A;  1US5 A;  4Z7E A;  3KOS A;  3RY3 A;  4H1X A;  3H3G A;  3M3F A;  1IME A;  2OX3 A;  4ZED A;  4N8Y A;  1QGX A;  5KCJ B;  3CHG A;  4G68 C;  1AL3 A;  2HXW A;  3EF7 A;  5TP9 A;  2D5W A;  2BJJ X;  1P1W A;  1MPC A;  3O9P A;  5I84 A;  3RTW B;  3C31 A;  4JVI A;  4HW8 A;  1IMA A;  5AA4 B;  1Y1M A;  4XXU A;  4R74 A;  3FAS A;  3PUX E;  2O1L A;  5CMB A;  2JJK A;  5I2K A;  4LN5 A;  5A5X A;  3SES A;  4OVQ A;  1WOD A;  1A8F A;  2Q89 A;  5F24 A;  1DTZ A;  2DXR A;  2VT5 A;  3TQL A;  2ZNT A;  4QFN A;  3MP6 A;  3IOW A;  4KXP A;  1H76 A;  1JVY A;  1LBW A;  2O7I A;  2THI A;  4F2O A;  1NV1 A;  3K6W A;  1DPE A;  4U1Z A;  2ZYK A;  1USY H;  3ONM A;  5BWJ A;  4XKR A;  5TPA B;  4M4G A;  4MBP A;  3HHF A;  3GZG A;  5I57 B;  3R26 A;  4GVO A;  3IOT A;  3TTN A;  1BLF A;  4OEU A;  3SER A;  4KI0 E;  4TOZ A;  4OQO A;  4IY6 A;  2YJP A;  3ZKL A;  3VXC A;  2GH9 A;  3H6V A;  3FZV A;  4ISU A;  3S9N C;  3C36 A;  2I49 A;  3AXF A;  3MZ9 A;  2P1S A;  2B3B A;  2V84 A;  4U23 A;  2O68 A;  5I2K B;  4PQJ A;  4GWX A;  1VE4 A;  5DEX A;  5DW8 A;  2Q2C A;  2XX9 A;  4JVD A;  4YIC A;  4ZE8 A;  5EQ9 A;  1B3H A;  2XXK A;  1MQJ A;  5F7V A;  2XWI A;  3FVN A;  2DSF A;  5EHM A;  3K1P A;  4FIM A;  4P47 A;  4IB2 A;  3OO6 A;  2CZL A;  2NXO A;  1NNP A;  4PDH A;  4H5G A;  4QFK A;  3CFX A;  2XXU A;  1FJ9 A;  1OMP A;  2ESN A;  5EYH A;  4KCD A;  2E1S A;  1I6Q A;  5CI5 A;  3T9V A;  4U4X A;  4NX1 A;  1SPI A;  5EYG A;  3RGY A;  2DWA A;  5AA2 A;  4IO7 A;  1EU8 A;  2QJE A;  1MQG A;  1JQF A;  4FAT A;  2FNC A;  5I7I A;  1EZO A;  4GWO A;  3B8B A;  3QUF A;  1JEU A;  4RJZ A;  1A7L A;  2X7Q A;  2I0C A;  3WAF A;  4G61 A;  2AL4 A;  4P9K A;  1ZTY A;  4XKN A;  3QUJ A;  4FOR A;  2OCU A;  1KA1 A;  3TEL A;  4IO5 A;  3PMW A;  4PDD A;  2F7C A;  3IL1 B;  2OWZ A;  3F11 A;  4NMY A;  1LB9 A;  1LLS A;  3KG2 A;  1MH4 A;  3MZ1 A;  4P8B A;  1JW1 A;  2Q88 A;  1FBC A;  3CVG A;  1DTG A;  3V8X B;  5DVJ A;  4O3B A;  3TUS A;  1K9Z A;  3FXQ A;  4N8G A;  1Q1K A;  1XC1 A;  3ODB A;  3PMX A;  1SBP A;  4XEQ A;  3O6H A;  1XT8 A;  3HHG A;  4PGP A;  3L6H A;  1NV7 A;  1POY 1;  2XXH A;  3K2D A;  3K6U A;  4KYD A;  5L9M A;  1IZ1 A;  1UIV A;  1TXF A;  4GQO A;  2A5T A;  4RNS A;  4NF5 A;  1P1Q A;  3U65 A;  3W9W A;  3QAX A;  5AA2 B;  1NKX A;  5CBR A;  3PUV E;  2YLN A;  3QYT A;  3G3J A;  5H8Q A;  2OLB A;  4YKI A;  1BKA A;  1MXU A;  3IOU A;  5KDT A;  2PX1 A;  3PTY A;  4GBW A;  2XWK A;  4PAF A;  1GGG A;  2DE4 A;  1A8E A;  4EUO A;  2OBG A;  3K4U A;  4F1U A;  2ZNS A;  4O7M A;  3KOT A;  4RYA A;  5FTH A;  3UK4 A;  2L5V A;  2F34 A;  4O8M A;  3KFM A;  3OSR A;  1N3X A;  2HAU A;  2QS1 A;  3CFL A;  1CB6 A;  4WXJ A;  4RK2 A;  1LBX A;  1LCF A;  4FBP A;  3FV2 A;  1IMB A;  1NUW A;  1RDZ A;  2VPO A;  4X8R A;  4NWC A;  4YB5 A;  1O7T A;  4IGR A;  3OO7 A;  1SI0 A;  3VVE A;  5JK4 A;  5LDZ A;  4I1D A;  1RYX A;  1UTH B;  2RC8 A;  4DLD A;  1MDQ A;  4PC9 A;  2ABH A;  2F8D A;  5H8N A;  4DIG A;  1XVX A;  3UOR A;  4YB6 A;  3THI A;  4WKM A;  4QFP A;  2CZH A;  5IZZ A;  1DK4 A;  4LON B;  2A5T B;  2O51 A;  2G93 A;  3SZP A;  4GFR A;  4DCX A;  5IAI A;  2Z23 A;  5HPQ A;  3MBP A;  3KN3 A;  1HSE A;  4AB6 A;  1I69 A;  3IOR A;  2XA5 A;  4NN3 A;  3C32 A;  2H25 A;  1FPB A;  3OO9 A;  5KDT B;  4RA1 A;  3U93 A;  1B1X A;  4PF6 A;  2Q2A A;  4DXB A;  5H8H A;  3DP8 A;  1B7H A;  3M3L A;  1B32 A;  3S9L C;  4MJO A;  3MQ9 A;  4X48 A;  1FBP A;  3PPO A;  1IQ7 A;  2F78 A;  5AA3 A;  5CBS A;  1N84 A;  4LVQ A;  1D9Y A;  1LCT A;  4THI A;  5BUU A;  1S9T A;  5L8D A;  3SEX A;  2R6G E;  3A3U A;  3ROJ A;  2H99 A;  4GOT A;  3TDJ A;  2PYY A;  3G3G A;  3M8U A;  5ITP A;  1LB8 A;  1N7W A;  2XX8 A;  1A55 A;  2REG A;  1B4Z A;  3OD7 A;  4OAN A;  3RT6 B;  3JZJ A;  4RK9 A;  4XF5 A;  5ICQ A;  2XWV A;  4JSD A;  2Q9T A;  4XKQ A;  3RT8 A;  1PC3 A;  2DWH A;  3PPQ A;  4X1D A;  3VFJ A;  1VSO A;  1EH3 A;  1Q35 A;  4JWX A;  4GWZ A;  2Y7P A;  4N07 A;  2VOZ A;  4FE8 A;  1FPL A;  2ZZV A;  4U22 A;  1Y3P A;  5CM6 A;  1IXC A;  4OES A;  2YPN A;  4LUB A;  1EYI A;  1CNQ A;  4HCW A;  1B1H A;  1YTV A;  2H98 A;  5LTC A;  4U2R A;  5I56 A;  3D4G A;  3HFU A;  2BJI A;  3CSB A;  2QPQ A;  1JW5 A;  3MYU A;  3QMF A;  1JVX A;  4DZ1 A;  4OVR A;  4H5F A;  2ZXT A;  3KEI A;  2XXW A;  2HEU A;  3E78 A;  3OEM A;  3E4R A;  1N76 A;  3FV1 A;  1BK4 A;  4EQ9 A;  5EQ8 A;  4PGN A;  5KCJ A;  4OYV A;  3UIF A;  3EKI A;  3B6Q A;  2XXP A;  1M5C A;  4QRZ A;  2CZI A;  2X26 A;  1MXZ A;  2M8C A;  2DE2 A;  5IZ3 B;  3K6V A;  1PB8 A;  4N6K A;  1KWH A;  1MH3 A;  2QVR A;  1ZMG A;  4POX A;  5AA4 A;  1LBC A;  3GYY A;  4OVS A;  1D4N A;  4GX4 A;  3MJN A;  1AH5 A;  2Z8D A;  1B4H A;  3B6W A;  4ONY A;  1YXI A;  2HZK A;  3IR1 A;  4GXA A;  2V93 A;  2V4C A;  4OFL A;  1TFA A;  4YZZ A;  1FTA A;  1LFG A;  4N13 A;  3TTM A;  2CEX A;  3KGC A;  2QSX A;  4G68 B;  5FHN A;  1Y4C A;  1SI1 A;  2OZZ A;  3IB1 A;  1A99 A;  2OJT A;  4TLM B;  3EQ1 A;  1NI9 A;  1H43 A;  3MUQ A;  1MXW A;  2OK2 A;  2I58 A;  4PFW A;  4OWD A;  5TPA A;  1LBY A;  4UA8 A;  5KZT A;  4GRK A;  2F7A A;  3CSG A;  3HO7 A;  3BFU A;  4R73 A;  5I57 A;  3KSX A;  3RLF E;  1Y3Q A;  5ISU A;  1SW2 A;  3FXU A;  2R71 A;  1NL5 A;  3FVK A;  3SDF A;  1NNT A;  3BKI B;  1FCK A;  1OLA A;  2UVG A;  3BIH A;  4OHN A;  1CE2 A;  2Y7K A;  1XOC A;  4N4U A;  5T3J A;  3ILU B;  3MAM A;  1QUI A;  2FIX A;  2GFE A;  4MNC A;  1P1N A;  4NE4 A;  2ONK E;  1IMD A;  1RDY A;  5ITO A;  2WYK A;  2Y5L A;  1POT A;  3S9M C;  3IJX B;  1YZ0 A;  2XD3 A;  3KC1 A;  3R7X A;  3IB2 A;  3T9H B;  5H8S A;  3E3K A;  1N0T A;  2F6P A;  2F97 A;  1VFE A;  5ET5 A;  2ALU A;  1B0L A;  3K00 A;  2WBB A;  2AL5 A;  4OMB A;  4C1U A;  3TKD A;  3CR9 A;  1MM6 A;  4ELQ A;  4P3L A;  3T93 B;  5ET6 A;  2HPG A;  1Y20 A;  1MXV A;  5K2X A;  5L9O A;  1OQH A;  4GWY A;  4IO2 A;  4ZEC A;  2DVZ A;  5JTY A;  3K0V A;  5EQA A;  1NV0 A;  4MCO A;  1TFD A;  1NV3 A;  4WED A;  3IOV A;  2HHM A;  3CFZ A;  4PBQ A;  4GWU A;  1B52 A;  4FEB A;  3PD9 A;  3IO4 A;  3LUY A;  4M1V A;  4ELO A;  3FD3 A;  4PCD A;  1PDA A;  2UVH A;  1YYZ A;  1UTB B;  3RQT A;  1EYK A;  5AA1 A;  2H9B A;  5IZ1 A;  4YKP A;  2O1M A;  4PBH A;  3JV9 A;  2D21 A;  1DMB A;  4Q8R A;  3CG3 A;  2ZMB A;  3RPL B;  1DCU A;  4JDF A;  3FIR A;  2XXI A;  2P3N A;  3RUM A;  5I58 B;  2WKY A;  2Y7I A;  1I6B A;  1IXG A;  4OER A;  3K1N A;  4U21 A;  5J16 A;  2DE3 A;  2GHB A;  4KFQ A;  3I5O A;  1LAG E;  1B5J A;  1NFT A;  2Z8F A;  3VE1 B;  1NH8 A;  4N15 A;  5JTY B;  1NMU A;  4DXC A;  4XKP A;  1GTK A;  4H6D A;  2FBP A;  1OVB A;  1EZ9 A;  1FTO A;  4U1O A;  4EF2 A;  1LBZ A;  2X7P A;  3MWB A;  2FA7 A;  2Z8E A;  4P56 A;  1PB7 A;  5DVI A;  3DP4 A;  1XHY A;  2ZYM A;  3ZS6 A;  1Q9D A;  1R9Q A;  3TTL A;  2WX9 A;  1N3W A;  4H8I A;  3MVX A;  4I8C A;  2UXA A;  1IXH A;  4MF3 A;  1P99 A;  2V3Q A;  2ONR A;  2RCB A;  1YAE A;  2B65 A;  4R72 A;  3TMG A;  3G3K A;  4DI4 B;  4NF4 B;  3TCF A;  4FED A;  2DQV A;  4ZEK A;  1MQD A;  2FHY A;  2V3U A;  2PFY A;  3FAT A;  4R2B A;  1URG A;  1AIV A;  2PFZ A;  1IUD A;  1G0I A;  1FPD A;  2OWT A;  4H67 A;  2ZZX A;  3PPN A;  3OSQ A;  1H44 A;  1UTH A;  3H6W A;  4ND9 A;  4OET A;  2UYE A;  3MST A;  4AS5 A;  2I0B A;  4ZZE A;  3R6U A;  4F3S A;  2F3B A;  4P1L A;  4MLQ A;  1B51 A;  1VDW A;  4QXD A;  3G3I A;  1FPE A;  4EF1 A;  3UP9 A;  3SET A;  4G8N A;  2XXR A;  2Q74 A;  2DP8 A;  1QW0 A;  4N6D A;  1MY1 A;  1MPB A;  4H8J A;  3DP6 A;  3FXR A;  1DBZ A;  4H45 A;  1MRP A;  1H3D A;  3KBR A;  3EPE A;  3W15 C;  1ELJ A;  4QF9 A;  4EXL A;  4XIG Q;  2HAV A;  3TCG A;  3Q25 A;  1KZ8 A;  3LV0 A;  2F6G A;  1B7U A;  3CIJ A;  3IB0 A;  4KR5 A;  4JB7 A;  3HCQ A;  4P0I A;  3KJ7 A;  1XS5 A;  1LAF E;  3C9H A;  1B40 A;  3U8Q A;  3TYH A;  1FSA A;  3OEL A;  4HE1 A;  4GD5 A;  4HE2 A;  4YMA A;  1QUJ A;  3CRB A;  3RN8 A;  4IY5 A;  2F5X A;  4ZZA A;  4JBZ A;  2Q8J A;  4JXI A;  2AYS A;  2LAO A;  3T9X B;  3Q28 A;  3H7M A;  5ELV A;  3DEL B;  3B7D A;  2ANJ A;  3QXM A;  3VVF A;  2CEY A;  5I3S A;  2RC7 A;  2A5S A;  5AE4 A;  3C33 A;  2FVZ A;  3PMV A;  1FBE A;  1QJM A;  2Y5K A;  3TQW A;  4X9T A;  5ICT A;  3SKP A;  1QUK A;  3GLB A;  2QFL A;  4PAI A;  4RPN A;  4EQ7 A;  1SD3 A;  2XWO A;  4OEV A;  4MX6 A;  2MKZ A;  4MNP A;  2V25 A;  4PFB A;  5IM2 A;  4OTE A;  4G8H A;  1A54 A;  4KCC A;  2QS3 A;  1IEJ A;  4LAT A;  1FQB A;  1P1U A;  4YU0 A;  1RKM A;  4PFY A;  1VFD A;  3TFL A;  1B58 A;  1SQY A;  5IGA A;  3H6U A;  2P2A A;  3FJ7 A;  3MW0 A;  4NHB A;  3CI8 A;  3SEV A;  3N94 A;  2CMO A;  2V3T A;  1FPK A;  4QSD A;  2GRV A;  1WVJ A;  2GQ1 A;  4G8M A;  4MHF A;  3PD8 A;  4MMP A;  4UAC A;  5FTI A;  1NUY A;  2QRY A;  4DDD A;  5EYF A;  3GBA A;  4PE3 A;  5IZ3 A;  1M5F A;  4ECF A;  3B50 A;  1B0H A;  2XXY A;  1J1N A;  3KN8 A;  4LZ7 A;  3SEY A;  5ESY A;  4LZ8 A;  1D3K A;  3VXB A;  4IO3 A;  1F9B A;  3BFT A;  4ZS9 A;  3FUZ A;  4ZEB A;  4WEP A;  1AMF A;  2IA4 A;  2Y7R A;  1AOV A;  2OWS A;  1B5H A;  3Q26 A;  1H45 A;  3T66 A;  1NH7 A;  2GHA A;  4G68 A;  1PB9 A;  1B3G A;  2F36 A;  5I2N B;  5IKB A;  2XXT A;  4MEV A;  4AB5 A;  4F29 A;  3EHT A;  3FJG A;  3VDF A;  5EQ7 A;  3V89 B;  2RKM A;  2VPN A;  4NF6 B;  3OEK A;  2DS9 A;  4U4S A;  4Z0I A;  2RIN A;  4MAG A;  1FTM A;  3TPA A;  1NUZ A;  3O6I A;  2DWJ A;  5DYH A;  3HV1 A;  3I6V A;  2XXV A;  4OVJ A;  4KQP A;  2HCA A;  3HST A;  3H4Z A;  3U92 A;  4YAH X;  5DTB A;  4NF0 A;  4BDR A;  2DXY A;  2F3D A;  3O29 A;  3LUZ A;  5HBC A;  4OEN A;  1VR5 A;  2XXQ A;  5HM4 B;  3H6T A;  3MZB A;  3UGW A;  1ATG A;  4PTK A;  1N7X A;  3T1B A;  2NUV A;  1B3L A;  4EDP A;  4PFU A;  3S2V A;  4AS4 A;  3SEU A;  1NNK A;  5AA2 D;  3MP8 A;  2PCR A;  3QIM A;  4X1B A;  3A29 A;  3I3V A;  1KA0 A;  2F7B A;  4OFO A;  1MQI A;  3GXA A;  3MP1 A;  1M5B A;  3U94 A;  4ESW A;  4LQ2 A;  3G3H A;  4ESX A;  4PE5 B;  4JSO A;  5I59 A;  1LAH E;  2PMS A;  3FBP A;  4GX3 A;  4OA4 A;  3H03 A;  4R2F A;  3IFC A;  3U1O A;  4G4P A;  1NNF A;  3KZG A;  1Y1Z A;  4F2Q A;  2NVU B;  3A09 A;  2H4I A;  3PGF A;  1URD A;  1RYO A;  3O2A A;  1N04 A;  3GBB A;  3T22 A;  2Z22 A;  1TT1 A;  4RY1 A;  4PAK A;  2XXX A;  3Q29 A;  1INP A;  1S7Y A;  2QMW A;  1UIU A;  5DVF A;  2QMX A;  2ZYN A;  4R9G A;  2R8T A;  4HTG A;  4N6P A;  4R9F A;  1FBF A;  4FAJ A;  3C35 A;  4HS7 A;  3PUW E;  2E0S A;  4YB7 A;  5B70 A;  4O94 A;  4GL0 A;  4NGU A;  3KSJ A;  1R1N A;  2HQ0 A;  3USD A;  2UYF A;  4PF8 A;  1UTB A;  1DPP A;  4H65 A;  3W9V A;  2VD3 A;  4N91 A;  2WYP A;  3VLW A;  2O84 X;  1WDN A;  4F3B A;  3OEN A;  1ZIU A; 
#chains in the Genus database with same CATH homology
 1PBP A;  1FQF A;  4R6K A;  3LSW A;  3A3C A;  4BDL A;  3PV0 E;  4KHZ E;  4OFJ A;  2NWJ A;  2I4B A;  1FW0 A;  3UA8 A;  4POW A;  5CMK A;  4P11 A;  5I59 B;  5I58 A;  1LFH A;  4GF8 A;  2RCA A;  3BBR A;  1FQD A;  5FHO A;  3IO6 A;  2I4C A;  3N26 A;  4DE8 A;  2DOJ A;  1R9L A;  3DM0 A;  4NED A;  1B5I A;  3FVO A;  3TAJ A;  4FEC A;  4R6Y A;  2I3W A;  1T0K A;  1QUL A;  2IEE A;  3VV5 A;  3TTK A;  4TLL B;  1PBQ A;  2HZL A;  4BDQ A;  4ELP A;  3N6U A;  4O3A A;  4ZEF A;  4QHQ A;  2PBW A;  2O6A A;  3LSF B;  4GXS B;  2PVU A;  4ZDM A;  4OZ9 A;  3V83 A;  3EN3 A;  1LAX A;  1B7Z A;  2VGQ A;  2I48 A;  5CMM A;  1BTJ A;  3V5A A;  3TCH A;  1DOT A;  3H06 B;  5TP9 B;  3MVY A;  3QK6 A;  4BDO A;  4NF4 A;  1ZJL A;  5EHS A;  4IO4 A;  4KYS A;  3N5L A;  4OXV A;  1SDX A;  1MPD A;  5A5X B;  4BDN A;  2UVJ A;  4GIZ A;  4G2Z A;  4F18 A;  4KPT A;  1IIT A;  3VVD A;  3ILT B;  1FTK A;  4PP0 A;  3OO8 A;  4KYE A;  1Y4T A;  2I6E A;  2DVC A;  1US4 A;  4LP2 B;  1MXY A;  3LSX A;  1B05 A;  1GVC A;  4MFI A;  4HCY A;  2ONS A;  3RPW A;  3VLU A;  1B3F A;  1JNF A;  1ZKB A;  2VHA A;  3MPL A;  4LA9 A;  3G3F A;  3Q27 A;  1OVT A;  2VD2 A;  2QS2 A;  4ZE9 A;  1L5T A;  1B3E A;  1OLC A;  3LC8 A;  1FQC A;  1LST A;  4C0R A;  2ZYO A;  4F1Y A;  4F1V A;  2FYI A;  3T9U A;  5DEX B;  2NOO A;  1QKB A;  4H0W A;  3LR1 A;  1ZU0 A;  1M5E A;  4E0W A;  1B9J A;  4Q0C A;  3UN6 A;  5JEI A;  3MC2 A;  1FTJ A;  5FHM A;  3O6G A;  3WAE A;  3RNN A;  1JET A;  1II5 A;  3P7I A;  3K1M A;  2D3I A;  1R6Z A;  5F1Q A;  1SW5 A;  4DXU A;  1MY3 A;  3ZSF A;  4QSC A;  3TTR A;  4YMB A;  4QFO A;  2Y84 A;  3L6G A;  1Z7M E;  1BIY A;  3ZKK A;  1QKA A;  4JWO A;  1URS A;  1SW1 A;  3OOA A;  3ECR A;  4G77 A;  4EXK A;  1O64 A;  2PT1 A;  2Y7W A;  2RC9 A;  3O28 A;  4BDM A;  2RF1 A;  2O7U A;  2W7Y A;  3CG1 A;  4ELR A;  1S50 A;  3OMB A;  4MH5 A;  4I9D A;  4IGT A;  3PPP A;  3MVZ A;  1MM7 A;  3PUY E;  3QSL A;  4RXL A;  1P1O A;  3DLN A;  1EZP A;  1YPN A;  4F39 A;  2VP1 A;  4L17 A;  1LGB C;  1JW4 A;  1TWY A;  2XD2 A;  3K6X A;  1DSN A;  5DT6 A;  3E13 X;  2KLF A;  4TQU Q;  1MY4 A;  1B2H A;  1USY E;  5B7D A;  4Q5T A;  4NF5 B;  1SYI A;  4XTC Q;  1IIW A;  2DWI A;  2AIX A;  4F22 A;  4KD5 A;  4C1T A;  5H8F A;  4AQ4 A;  4ZEI A;  5I2N A;  3VLV A;  1ZBM A;  5H8Q B;  2B3F A;  3K02 A;  1A40 A;  4NF6 A;  3TZA A;  3OXN A;  1FQA A;  3JYR A;  4NWD A;  4PET A;  5CRY A;  1OIB A;  2R9J A;  1GV8 A;  3B6T A;  1M5D A;  4JWY A;  3S9E A;  1YCJ A;  2DYX A;  3KN7 A;  1MG1 A;  5TU0 A;  4BLA A;  5CC2 A;  1FQE A;  2G29 A;  4F31 B;  3E9X A;  4QSE A;  5J1D A;  2PT2 A;  5H8N B;  3O66 A;  4RPO A;  3K01 A;  2REJ A;  1MY2 A;  4YKK A;  4NTL A;  1SVX B;  3C34 A;  3PU5 A;  4QFL A;  1FTL A;  3FGS A;  3LBS A;  1MQH A;  2P0S A;  3EHU A;  3KJT A;  3SEW A;  1XVY A;  1I6A A;  4LZ5 A;  1HSL A;  2O69 A;  4NF8 A;  5H8F B;  2F35 A;  5L9S A;  3C4M A;  1BP5 A;  1Y9U A;  4I62 A;  5CMC A;  1Y3N A;  3HPI A;  4P0G A;  3IK6 B;  1GR2 A;  5M2V A;  1UQW A;  3TOD A;  1ANF A;  5H8H B;  3G7W A;  4PFT A;  1LFI A;  1O63 A;  1B6H A;  2XHD A;  1B46 A;  4MLV A;  1SYH A;  4F3P A;  1PEB A;  3M3K A;  1MXX A;  3D4C A;  3S4U A;  4EQB A;  3HN0 A;  4IO6 A;  3N6T A;  2QL3 A;  3IAZ A;  4GLI A;  3PPR A;  3PUZ E;  3RTF B;  3EHS A;  1MDP 1;  2QS4 A;  1D9V A;  1OQG A;  1Z7N E;  3LSL A;  4Q30 B;  2HFB A;  3MPK A;  1LBB A;  1ZLQ A;  4FJP A;  4F3G A;  1JEV A;  2I3V A;  1MY0 A;  3IJO B;  5K2Y A;  4NF8 B;  3FJM A;  4R75 A;  3U72 A;  4K3F A;  3IX1 A;  2XX7 A;  1IXI A;  4F19 A;  1QVS A;  4YKJ A;  3TEP A;  2ZNU A;  2H5Y A;  4R6H A;  4E0X A;  3O97 A;  1HSJ A;  3MVW A;  2UVI A;  5I56 B;  1SW4 A;  3T96 B;  4LQ5 A;  5LOM A;  4O3C A;  1MS7 A;  3FVG A;  4GL8 A;  4DCY A;  1US5 A;  4Z7E A;  3KOS A;  3RY3 A;  4H1X A;  3H3G A;  3M3F A;  4ZED A;  5KCJ B;  4G68 C;  1AL3 A;  2HXW A;  3EF7 A;  5TP9 A;  2D5W A;  2BJJ X;  1P1W A;  1MPC A;  3O9P A;  5I84 A;  3RTW B;  3C31 A;  4HW8 A;  5AA4 B;  1Y1M A;  4XXU A;  4R74 A;  3FAS A;  3PUX E;  2O1L A;  5CMB A;  5I2K A;  5A5X A;  3SES A;  1WOD A;  1A8F A;  2Q89 A;  1DTZ A;  2DXR A;  3TQL A;  2ZNT A;  4QFN A;  3MP6 A;  3IOW A;  1H76 A;  1JVY A;  2O7I A;  2THI A;  4F2O A;  3K6W A;  1DPE A;  4U1Z A;  2ZYK A;  1USY H;  3ONM A;  5BWJ A;  4XKR A;  5TPA B;  4M4G A;  4MBP A;  3HHF A;  3GZG A;  5I57 B;  3R26 A;  4GVO A;  3IOT A;  3TTN A;  1BLF A;  4OEU A;  3SER A;  4KI0 E;  4TOZ A;  4OQO A;  4IY6 A;  2YJP A;  3ZKL A;  3VXC A;  2GH9 A;  3H6V A;  3FZV A;  4ISU A;  3S9N C;  3C36 A;  2I49 A;  3AXF A;  3MZ9 A;  2P1S A;  2B3B A;  2V84 A;  4U23 A;  2O68 A;  5I2K B;  4PQJ A;  1VE4 A;  5DEX A;  2Q2C A;  2XX9 A;  4YIC A;  4ZE8 A;  1B3H A;  1MQJ A;  5F7V A;  3FVN A;  2DSF A;  5EHM A;  3K1P A;  4FIM A;  4IB2 A;  3OO6 A;  2CZL A;  2NXO A;  1NNP A;  4QFK A;  4H5G A;  3CFX A;  2XXU A;  1OMP A;  2ESN A;  4KCD A;  2E1S A;  1I6Q A;  5CI5 A;  3T9V A;  4U4X A;  3RGY A;  2DWA A;  5AA2 A;  4IO7 A;  1EU8 A;  2QJE A;  1MQG A;  1JQF A;  4FAT A;  2FNC A;  1EZO A;  4GWO A;  3QUF A;  1JEU A;  4RJZ A;  1A7L A;  2X7Q A;  2I0C A;  3WAF A;  2AL4 A;  1ZTY A;  4XKN A;  3QUJ A;  4FOR A;  2OCU A;  3TEL A;  4IO5 A;  3PMW A;  2F7C A;  3IL1 B;  3F11 A;  4NMY A;  1LB9 A;  1LLS A;  3KG2 A;  1MH4 A;  3MZ1 A;  1JW1 A;  2Q88 A;  3CVG A;  1DTG A;  3V8X B;  5DVJ A;  4O3B A;  3TUS A;  3FXQ A;  1Q1K A;  1XC1 A;  3ODB A;  3PMX A;  1SBP A;  3O6H A;  1XT8 A;  3HHG A;  3L6H A;  1POY 1;  2XXH A;  3K2D A;  3K6U A;  4KYD A;  5L9M A;  1IZ1 A;  1UIV A;  1TXF A;  4GQO A;  2A5T A;  4RNS A;  4NF5 A;  1P1Q A;  3W9W A;  3QAX A;  5AA2 B;  1NKX A;  5CBR A;  3PUV E;  2YLN A;  3QYT A;  3G3J A;  5H8Q A;  2OLB A;  4YKI A;  1BKA A;  1MXU A;  3IOU A;  5KDT A;  2PX1 A;  1GGG A;  2DE4 A;  1A8E A;  4EUO A;  2OBG A;  3K4U A;  4F1U A;  2ZNS A;  3KOT A;  4RYA A;  5FTH A;  3UK4 A;  2F34 A;  3KFM A;  3OSR A;  1N3X A;  2HAU A;  2QS1 A;  3CFL A;  1CB6 A;  4WXJ A;  4RK2 A;  1LCF A;  3FV2 A;  4NWC A;  4YB5 A;  1O7T A;  4IGR A;  3OO7 A;  1SI0 A;  3VVE A;  5JK4 A;  4I1D A;  1RYX A;  1UTH B;  2RC8 A;  4DLD A;  1MDQ A;  2ABH A;  2F8D A;  5H8N A;  4DIG A;  1XVX A;  3UOR A;  4YB6 A;  3THI A;  4WKM A;  4QFP A;  4LON B;  2A5T B;  2O51 A;  2G93 A;  5IAI A;  4GFR A;  4DCX A;  2Z23 A;  5HPQ A;  3MBP A;  3KN3 A;  1HSE A;  4AB6 A;  1I69 A;  3IOR A;  3C32 A;  2H25 A;  3OO9 A;  5KDT B;  4RA1 A;  3U93 A;  1B1X A;  2Q2A A;  4DXB A;  5H8H A;  3DP8 A;  1B7H A;  3M3L A;  1B32 A;  3S9L C;  3MQ9 A;  4X48 A;  3PPO A;  1IQ7 A;  2F78 A;  5AA3 A;  5CBS A;  1N84 A;  4LVQ A;  1D9Y A;  1LCT A;  4THI A;  5BUU A;  1S9T A;  5L8D A;  3SEX A;  2R6G E;  3A3U A;  2H99 A;  4GOT A;  3TDJ A;  2PYY A;  3G3G A;  3M8U A;  5ITP A;  1LB8 A;  1N7W A;  2XX8 A;  1A55 A;  2REG A;  1B4Z A;  3OD7 A;  3RT6 B;  3JZJ A;  4RK9 A;  5ICQ A;  4JSD A;  2Q9T A;  4XKQ A;  3RT8 A;  1PC3 A;  2DWH A;  3PPQ A;  4X1D A;  3VFJ A;  1VSO A;  1EH3 A;  1Q35 A;  4JWX A;  2Y7P A;  4N07 A;  2VOZ A;  4FE8 A;  4U22 A;  1Y3P A;  5CM6 A;  1IXC A;  4OES A;  2YPN A;  4LUB A;  4HCW A;  1B1H A;  1YTV A;  2H98 A;  4U2R A;  5I56 A;  3D4G A;  3CSB A;  2QPQ A;  1JW5 A;  1JVX A;  4DZ1 A;  4H5F A;  2ZXT A;  3KEI A;  2XXW A;  2HEU A;  3OEM A;  3E4R A;  1N76 A;  3FV1 A;  4EQ9 A;  5KCJ A;  4OYV A;  3UIF A;  3B6Q A;  2XXP A;  1M5C A;  4QRZ A;  2X26 A;  1MXZ A;  2M8C A;  2DE2 A;  3K6V A;  1PB8 A;  1KWH A;  1MH3 A;  1ZMG A;  4POX A;  5AA4 A;  1LBC A;  1D4N A;  3MJN A;  1AH5 A;  2Z8D A;  1B4H A;  3B6W A;  4ONY A;  2HZK A;  3IR1 A;  4GXA A;  2V93 A;  4OFL A;  1TFA A;  4YZZ A;  1LFG A;  4N13 A;  3TTM A;  3KGC A;  2QSX A;  4G68 B;  5FHN A;  1Y4C A;  1SI1 A;  2OZZ A;  3IB1 A;  1A99 A;  2OJT A;  4TLM B;  3EQ1 A;  1H43 A;  3MUQ A;  1MXW A;  2OK2 A;  2I58 A;  4PFW A;  4OWD A;  5TPA A;  4UA8 A;  5KZT A;  4GRK A;  2F7A A;  3CSG A;  3HO7 A;  3BFU A;  4R73 A;  5I57 A;  3KSX A;  3RLF E;  1Y3Q A;  5ISU A;  1SW2 A;  3FXU A;  2R71 A;  1NL5 A;  3FVK A;  3SDF A;  1NNT A;  3BKI B;  1FCK A;  1OLA A;  2UVG A;  4OHN A;  1CE2 A;  2Y7K A;  1XOC A;  3ILU B;  3MAM A;  1QUI A;  2GFE A;  1P1N A;  4NE4 A;  2ONK E;  5ITO A;  1POT A;  3S9M C;  3IJX B;  2XD3 A;  3R7X A;  3T9H B;  3IB2 A;  5H8S A;  3E3K A;  1N0T A;  2F6P A;  2F97 A;  1VFE A;  2ALU A;  1B0L A;  3K00 A;  2AL5 A;  4OMB A;  4C1U A;  3TKD A;  3CR9 A;  1MM6 A;  4ELQ A;  3T93 B;  1Y20 A;  1MXV A;  5K2X A;  5L9O A;  1OQH A;  4IO2 A;  4ZEC A;  2DVZ A;  5JTY A;  3K0V A;  1TFD A;  4WED A;  3IOV A;  3CFZ A;  1B52 A;  4FEB A;  3PD9 A;  3IO4 A;  3LUY A;  4M1V A;  4ELO A;  3FD3 A;  1PDA A;  2UVH A;  1UTB B;  3RQT A;  5AA1 A;  2H9B A;  4YKP A;  2O1M A;  3JV9 A;  2D21 A;  1DMB A;  4Q8R A;  3CG3 A;  2ZMB A;  4JDF A;  3FIR A;  2XXI A;  3RUM A;  5I58 B;  2WKY A;  2Y7I A;  1I6B A;  1IXG A;  4OER A;  3K1N A;  4U21 A;  2DE3 A;  2GHB A;  4KFQ A;  3I5O A;  1LAG E;  1B5J A;  1NFT A;  2Z8F A;  3VE1 B;  1NH8 A;  5JTY B;  1NMU A;  4DXC A;  4XKP A;  1GTK A;  4H6D A;  1OVB A;  1EZ9 A;  1FTO A;  4U1O A;  4EF2 A;  2X7P A;  3MWB A;  2FA7 A;  2Z8E A;  1PB7 A;  5DVI A;  3DP4 A;  1XHY A;  2ZYM A;  3ZS6 A;  1R9Q A;  3TTL A;  1N3W A;  4H8I A;  3MVX A;  4I8C A;  2UXA A;  1IXH A;  4MF3 A;  1P99 A;  2V3Q A;  2ONR A;  2RCB A;  1YAE A;  2B65 A;  4R72 A;  3TMG A;  3G3K A;  4NF4 B;  3TCF A;  4FED A;  2DQV A;  4ZEK A;  1MQD A;  2V3U A;  3FAT A;  4R2B A;  1URG A;  1AIV A;  1IUD A;  2OWT A;  4H67 A;  3PPN A;  3OSQ A;  1H44 A;  1UTH A;  3H6W A;  4ND9 A;  4OET A;  2UYE A;  2I0B A;  4ZZE A;  3R6U A;  4F3S A;  4MLQ A;  1B51 A;  3G3I A;  4EF1 A;  3UP9 A;  3SET A;  4G8N A;  2XXR A;  2DP8 A;  1QW0 A;  1MY1 A;  1MPB A;  4H8J A;  3DP6 A;  3FXR A;  1MRP A;  1H3D A;  3KBR A;  3EPE A;  3W15 C;  1ELJ A;  4QF9 A;  4EXL A;  4XIG Q;  2HAV A;  3TCG A;  3Q25 A;  2F6G A;  1B7U A;  3CIJ A;  3IB0 A;  4KR5 A;  4JB7 A;  3HCQ A;  4P0I A;  3KJ7 A;  1XS5 A;  1LAF E;  3C9H A;  1B40 A;  3U8Q A;  3TYH A;  3OEL A;  4GD5 A;  4YMA A;  1QUJ A;  3CRB A;  3RN8 A;  4IY5 A;  2F5X A;  4ZZA A;  4JBZ A;  2Q8J A;  4JXI A;  2AYS A;  2LAO A;  3T9X B;  3Q28 A;  3H7M A;  5ELV A;  3DEL B;  3B7D A;  2ANJ A;  3QXM A;  3VVF A;  2RC7 A;  2A5S A;  5AE4 A;  3C33 A;  3PMV A;  1QJM A;  3TQW A;  4X9T A;  5ICT A;  3SKP A;  1QUK A;  3GLB A;  4RPN A;  4EQ7 A;  1SD3 A;  4OEV A;  2V25 A;  4OTE A;  4G8H A;  1A54 A;  4KCC A;  2QS3 A;  1IEJ A;  4LAT A;  1FQB A;  1P1U A;  4YU0 A;  1RKM A;  4PFY A;  1VFD A;  3TFL A;  1SQY A;  1B58 A;  3H6U A;  2P2A A;  3FJ7 A;  3MW0 A;  3CI8 A;  3SEV A;  3N94 A;  2CMO A;  2V3T A;  4QSD A;  2GRV A;  1WVJ A;  4G8M A;  3PD8 A;  4UAC A;  5FTI A;  2QRY A;  4DDD A;  5EYF A;  3GBA A;  1M5F A;  4ECF A;  1B0H A;  2XXY A;  1J1N A;  3KN8 A;  4LZ7 A;  3SEY A;  4LZ8 A;  1D3K A;  3VXB A;  4IO3 A;  1F9B A;  3BFT A;  4ZS9 A;  3FUZ A;  4ZEB A;  4WEP A;  1AMF A;  2IA4 A;  2Y7R A;  1AOV A;  2OWS A;  1B5H A;  3Q26 A;  1H45 A;  3T66 A;  1NH7 A;  2GHA A;  4G68 A;  1PB9 A;  1B3G A;  2F36 A;  5I2N B;  5IKB A;  2XXT A;  4AB5 A;  4F29 A;  3EHT A;  3FJG A;  3VDF A;  3V89 B;  2RKM A;  4NF6 B;  3OEK A;  2DS9 A;  4U4S A;  4Z0I A;  2RIN A;  1FTM A;  3TPA A;  3O6I A;  2DWJ A;  5DYH A;  3HV1 A;  3I6V A;  2XXV A;  4OVJ A;  4KQP A;  2HCA A;  3HST A;  3H4Z A;  3U92 A;  4YAH X;  5DTB A;  4BDR A;  2DXY A;  3O29 A;  5HBC A;  4OEN A;  1VR5 A;  2XXQ A;  5HM4 B;  3H6T A;  3MZB A;  3UGW A;  1ATG A;  1N7X A;  2NUV A;  1B3L A;  4EDP A;  4PFU A;  3S2V A;  3SEU A;  1NNK A;  5AA2 D;  3MP8 A;  3QIM A;  4X1B A;  3I3V A;  2F7B A;  4OFO A;  1MQI A;  3GXA A;  3MP1 A;  1M5B A;  4ESW A;  3U94 A;  4LQ2 A;  3G3H A;  4ESX A;  4PE5 B;  4JSO A;  5I59 A;  1LAH E;  2PMS A;  3H03 A;  4R2F A;  3U1O A;  4G4P A;  1NNF A;  3KZG A;  4F2Q A;  1Y1Z A;  2NVU B;  3A09 A;  2H4I A;  3PGF A;  1URD A;  1RYO A;  3O2A A;  1N04 A;  3GBB A;  3T22 A;  2Z22 A;  1TT1 A;  4RY1 A;  2XXX A;  3Q29 A;  1S7Y A;  2QMW A;  1UIU A;  5DVF A;  2QMX A;  2ZYN A;  4R9G A;  4HTG A;  4N6P A;  4R9F A;  4FAJ A;  3C35 A;  4HS7 A;  3PUW E;  2E0S A;  4YB7 A;  5B70 A;  4GL0 A;  3KSJ A;  1R1N A;  2HQ0 A;  3USD A;  2UYF A;  1UTB A;  1DPP A;  4H65 A;  3W9V A;  2VD3 A;  3VLW A;  2O84 X;  1WDN A;  4F3B A;  3OEN A;  1ZIU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...