4H65A

Crystal structure of semet derivative of hmp synthase thi5 from s. cerevisiae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
315
Chain Sequence
DKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDMAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWSGYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEATRLMAIHQEKCRQEGTFKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Last Piece in the Vitamin B1 Biosynthesis Puzzle: STRUCTURAL AND FUNCTIONAL INSIGHT INTO YEAST 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE PHOSPHATE (HMP-P) SYNTHASE.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transferase
molecule keywords Pyrimidine precursor biosynthesis enzyme THI5
total genus 98
structure length 315
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h65A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h65A01
3FXQA 3FVNA 5H8NA 1JW4A 4JDFA 4ZEKA 1P1WA 1UQWA 3RNNA 2DWJA 2FA7A 4AB5A 4EQ9A 3HHFA 3PD8A 3KN7A 4F2OA 4ZE8A 2I49A 2Z8DA 3IB0A 1LBCA 3Q25A 3PPQA 1LFHA 1BIYA 1FQBA 3FVKA 2Q88A 1F9BA 4FECA 5H8QB 3W9VA 5EHMA 3N6TA 3OELA 4NEDA 3MWBA 3SETA 1PBPA 1QJMA 3B7DA 4WEDA 4GVOA 2RF1A 4F31B 3TEPA 4DCYA 3PUYE 4WXJA 4NWDA 1BP5A 3GZGA 4QRZA 4M1VA 2DS9A 3FZVA 4OESA 1LSTA 1B6HA 3OO8A 1FCKA 4G77A 1N84A 4LUBA 2QL3A 2D5WA 1AL3A 1S50A 3OEKA 5AA4A 5CRYA 4G68A 3FD3A 5HPQA 1QUKA 3OXNA 1B2HA 4POWA 3CG1A 4ZZEA 5AA1A 5CBSA 3IORA 3HN0A 3EQ1A 3K6XA 3MVZA 1ZJLA 2H4IA 4LATA 4NF5B 3PPRA 1HSJA 4PETA 3UK4A 1MQHA 3K6VA 1XC1A 4F2QA 5I56B 4IGTA 4GOTA 4WEPA 1XOCA 3I6VA 3MVYA 3H6TA 1I6BA 4KR5A 1FQDA 1SI0A 2PX1A 2QMXA 1XVXA 2XD2A 3IOVA 4JWYA 2NWJA 1WDNA 4HS7A 2Y7KA 3D4GA 1O7TA 3E13X 5TP9A 3TQLA 4FAJA 3R6UA 3G3KA 1PB9A 2DVCA 4NTLA 1M5CA 1VFDA 1PDAA 4H8IA 1Y1ZA 1FQEA 4POXA 2XXHA 4RNSA 5CMBA 5TPAA 1B51A 3K4UA 4KD5A 4QSCA 5EHSA 3PU5A 4QFLA 4IB2A 3UP9A 3UORA 3VLUA 4ZE9A 5I2NB 2NVUB 2W7YA 1S7YA 2UVGA 3CFXA 3GLBA 2F6PA 3L6GA 5H8SA 1LAFE 4OHNA 3O97A 3H7MA 2VP1A 3RTFB 2O1MA 2OCUA 3KOSA 3QUFA 1LFGA 4KI0E 3THIA 4R75A 4MH5A 1DTZA 1FTKA 1JW5A 4QFOA 3RLFE 3B6QA 4GLIA 3RQTA 1Q35A 2DSFA 3T9XB 3FIRA 3CFZA 3IB2A 3N26A 1ATGA 1EZOA 1IXCA 1MXYA 3U72A 5B70A 1B0HA 2A5TB 3KZGA 4O3BA 2RC8A 4WKMA 4N6PA 4JBZA 4JSOA 3P7IA 5HBCA 4EDPA 1Z7NE 4ESXA 5AA3A 3QXMA 5JTYB 1UTHB 4DZ1A 4RK2A 5ICQA 3K6WA 3RT8A 1Y9UA 2DWAA 3ZS6A 3TAJA 1JEUA 3IOTA 3OSRA 1ZIUA 1B5HA 3T96B 3TODA 2UXAA 2H99A 4OFJA 5AA4B 2PBWA 3M3FA 1MXUA 3MAMA 1ELJA 4MFIA 5J1DA 1SYHA 4LZ5A 3VXCA 5DEXA 3HO7A 5I58A 3LR1A 5ITOA 4GD5A 1MQIA 1MY3A 4ELQA 3IK6B 1B1HA 3K00A 1IXIA 2Z8FA 4GRKA 1YTVA 5DVFA 5AA2D 4H0WA 3H03A 3HV1A 3IX1A 2QPQA 3HSTA 1URGA 1TXFA 4XKQA 1NFTA 1VFEA 3KN8A 3S4UA 4F1UA 1B05A 1B4HA 1OIBA 2QSXA 3C32A 3D4CA 2P0SA 3FJ7A 2O84X 5H8FB 1N7XA 2XXTA 5CM6A 3WAEA 2F36A 5TPAB 1JVXA 3LBSA 1Y3NA 4IO5A 1M5FA 2H98A 4OWDA 2HZLA 1EU8A 1JEVA 3FGSA 4JWOA 3TFLA 3K0VA 2I48A 4KQPA 3U92A 5ITPA 2DXYA 3IOUA 2RINA 1GVCA 2YLNA 1B3GA 3TELA 1SVXB 5DTBA 3VVEA 1DTGA 3GBAA 3IO6A 1H76A 2HCAA 3CG3A 4G68C 4GQOA 3T66A 3UN6A 2HZKA 4C0RA 4EF2A 1MXVA 2F7BA 4QFPA 3FV1A 5IAIA 1JW1A 1RYXA 1LAXA 5A5XB 4G68B 1OLCA 2V84A 3VLWA 5DYHA 4DCXA 2Q2AA 1PEBA 4LZ7A 4Z0IA 2E0SA 3JYRA 3PPPA 2XXXA 5I57B 1ANFA 3S9NC 4PFUA 4UACA 4XKPA 5CMCA 1LB9A 1ZKBA 4OEUA 4BDLA 4AB6A 1D3KA 2XXIA 4H5GA 3K1NA 3SKPA 4XTCQ 3EF7A 3G3HA 3K02A 1IEJA 5AA2A 1US4A 3SEXA 5KDTA 3MZ1A 2Z22A 3ILTB 1P1UA 1R1NA 4FJPA 4ELOA 3QAXA 5H8QA 1MPCA 2A5TA 4TLMB 3TTLA 2Y7PA 1AOVA 4OEVA 4M4GA 2QS3A 3CSBA 1B7ZA 4X9TA 4BDOA 2OWTA 1JQFA 2DOJA 3DP6A 4LZ8A 2XX9A 4ZEIA 3PUXE 2I3VA 4RPOA 4DIGA 1N3XA 2UVIA 3MZ9A 4NF4A 2OLBA 1MPDA 3RT6B 1H45A 4IY5A 4FE8A 4ZEFA 1M5EA 3B6TA 1SW4A 4KYEA 1SD3A 1DMBA 2RKMA 4OZ9A 4EXLA 1FTLA 3A09A 1YCJA 3OO7A 1NNKA 4F3BA 3C31A 4RXLA 4QHQA 4FIMA 2OK2A 3G3JA 2DP8A 4X48A 4FATA 3V89B 1DSNA 1TT1A 2I4CA 2R71A 1IUDA 1Z7ME 3HPIA 1SYIA 4F19A 1NL5A 3CI8A 1B32A 1NMUA 2DWIA 1I6AA 3KBRA 3FXRA 3MUQA 4O3AA 3TUSA 3KJTA 5KCJB 3KN3A 1QUIA 3VVFA 3V8XB 4IY6A 1NH8A 2I3WA 4QFKA 5FHNA 3PV0E 3O29A 1FTOA 1MXWA 2F34A 3H6VA 1D9YA 4UA8A 5BUUA 3PMXA 1QUJA 1MM6A 5K2XA 1Q1KA 1R9QA 4YMBA 3DP4A 5KZTA 3BKIB 3BBRA 1HSLA 4R6KA 4ND9A 2DE4A 3LC8A 4H65A 1EZ9A 2RC9A 2ZNSA 2RCBA 4N13A 3PPNA 5KDTB 1O63A 3H6WA 1B5IA 1URDA 4MBPA 1B1XA 3E3KA 3DLNA 1OVTA 3FXUA 1HSEA 2PMSA 5CC2A 4ZEDA 3H06B 3RN8A 2P1SA 2I0CA 3KFMA 4HCWA 4RJZA 3T9HB 1B3LA 3LUYA 3EHTA 3QIMA 3SEUA 2QRYA 5I2KA 4R2FA 3O6HA 4XKRA 2NXOA 1B0LA 4X1DA 2IEEA 5L8DA 4EXKA 2REGA 3O66A 5L9SA 2O7UA 2ZXTA 2Q8JA 5JEIA 1IXGA 3IL1B 4KCCA 3R7XA 1PB8A 5H8HA 1Y4CA 2I6EA 4EUOA 3IAZA 2V3TA 3SERA 2B65A 3AXFA 4YB5A 3N5LA 4ELRA 3VLVA 1J1NA 2FNCA 2HEUA 1IITA 3QSLA 1FTMA 3G3IA 2V93A 3L6HA 2VHAA 4G8MA 1SW5A 3K2DA 3TTMA 2UYFA 1L5TA 1ZMGA 3ZKLA 3ILUB 2HAUA 3MPKA 4F3PA 2DQVA 2DVZA 4BDQA 4KFQA 4X1BA 3VFJA 5JK4A 4N07A 3M8UA 5H8FA 3A3UA 4XKNA 1LBBA 2X7PA 1P99A 3K1MA 4Z7EA 2OWSA 3U1OA 3V5AA 1MRPA 4DXUA 5IKBA 2OZZA 2PYYA 1YPNA 3RUMA 3FJMA 4IO2A 3O9PA 1VR5A 4KPTA 1EH3A 1M5DA 3MVWA 4LA9A 3VXBA 5F1QA 1XS5A 3CSGA 3PUVE 4ELPA 1LLSA 3EHSA 3SESA 2O6AA 5FTHA 1MDP1 4P0IA 4NWCA 1JVYA 1N3WA 3E9XA 3H4ZA 5F7VA 3MJNA 4C1TA 3TTNA 4OERA 3VV5A 3MVXA 4U1OA 1ZTYA 3CFLA 3TTRA 3K6UA 4OETA 3PGFA 1UIUA 2IA4A 2B3BA 2KLFA 1DPEA 2O69A 3EHUA 3KJ7A 3Q28A 4YKKA 4R73A 1OQHA 4KYDA 4R72A 4LVQA 3A3CA 1US5A 1JNFA 4JXIA 2NUVA 4LP2B 1USYE 4THIA 2R6GE 1MDQA 1NNPA 3KGCA 4BDMA 1Y20A 3C4MA 1S9TA 2XXPA 1GV8A 3TTKA 2V3UA 1B46A 1H44A 2LAOA 3G3FA 3KEIA 3UA8A 1P1QA 2D21A 4U22A 4E0XA 1FQFA 3TPAA 1NNFA 3U94A 3WAFA 4U4SA 4YKIA 1P1OA 2F35A 3PD9A 5ISUA 4Q5TA 1IIWA 3H6UA 1H43A 2HAVA 3PUWE 1A40A 2ZNUA 2VD3A 4LONB 1A8EA 2V25A 1MY2A 4OFOA 4PP0A 4Q30B 4ZZAA 3USDA 3PPOA 4RA1A 4DXBA 2PT1A 1B3EA 5DVJA 2I0BA 4ZEBA 1H3DA 1MH4A 2P2AA 3OENA 1VSOA 4ZECA 2FYIA 1M5BA 5JTYA 1OVBA 2HFBA 2Q89A 3CRBA 4JB7A 4GXAA 4XXUA 4YZZA 3SEWA 3ZKKA 2THIA 5I84A 1D4NA 2GRVA 1R9LA 1SI1A 3IOWA 3PMVA 4ISUA 4PFTA 5I2KB 5K2YA 4G8HA 3MP1A 1BKAA 4EQ7A 1O64A 3I3VA 4OYVA 3TYHA 1XHYA 1B4ZA 1B52A 2F7CA 4YKJA 1RYOA 3V83A 4GIZA 2DXRA 5AA2B 2AIXA 2F6GA 2I4BA 1QULA 3CIJA 4QSDA 1EZPA 1N0TA 3ECRA 2VOZA 3TDJA 5I59B 1DOTA 2M8CA 2PT2A 3EPEA 3KSXA 4IO6A 4R74A 1MXZA 2ONKE 5I2NA 4F1VA 5I57A 1IQ7A 2XX8A 3BFUA 2REJA 4H67A 4OENA 4RYAA 1DPPA 3U93A 2Q9TA 3N94A 3GBBA 1N04A 2XXYA 2ABHA 2B3FA 4NE4A 4EQBA 1OMPA 5LOMA 2NOOA 3MW0A 5TP9B 4NMYA 1FW0A 3S9LC 1WVJA 3DELB 3M3LA 1D9VA 4KCDA 4JWXA 2ONRA 4EF1A 3BFTA 5CBRA 1A54A 3JZJA 3C9HA 4I8CA 3FUZA 4F3SA 4Q0CA 5I56A 3OD7A 4PFYA 3O2AA 3RTWB 4F39A 4L17A 3LSFB 4BDRA 4YB7A 4PE5B 4K3FA 3EN3A 4DE8A 1PC3A 2ALUA 3ODBA 4R2BA 3FATA 1IXHA 1RKMA 1LGBC 3KOTA 3TZAA 3LSWA 5L9OA 4GFRA 5I59A 4TOZA 3LSXA 3PUZE 1B7HA 1AIVA 3MC2A 4HTGA 3RY3A 1B3FA 2O1LA 5A5XA 1MY0A 3B6WA 3Q27A 5B7DA 1KWHA 2XXVA 2Y7IA 2G29A 2V3QA 2AL5A 2VGQA 5L9MA 3T22A 2XXQA 1POTA 1B5JA 1Y4TA 4G8NA 4OFLA 4ZS9A 1FQCA 4JSDA 1NNTA 2QJEA 3UIFA 3QUJA 2G93A 2Q2CA 4YB6A 1OQGA 3O6IA 2ESNA 2OBGA 1QKBA 4NF6A 2I58A 4OQOA 3HCQA 3MZBA 3IO4A 2DE3A 3GXAA 1MM7A 2E1SA 2ZMBA 1XVYA 1BLFA 2AYSA 3IR1A 3TCGA 2DE2A 4BDNA 3HHGA 3OOAA 2DYXA 1ZU0A 2F97A 3W9WA 4I1DA 1FTJA 4DDDA 1LB8A 3TCFA 2H5YA 5DVIA 5AE4A 2ANJA 1GR2A 1TWYA 2F8DA 1SQYA 2Y7RA 3VE1B 2ZYMA 2QS2A 5TU0A 3FVGA 4R9GA 4IO4A 3G7WA 3F11A 2ZYOA 3TMGA 5BWJA 4BLAA 5DT6A 1B40A 2HQ0A 4I9DA 5DEXB 4MF3A 3FJGA 3T9UA 3TQWA 1MXXA 1UTBB 2CMOA 1NH7A 2BJJX 2XD3A 4U23A 3OEMA 1A8FA 3C36A 4H8JA 1MQJA 3PMWA 3G3GA 4C1UA 4F18A 3O6GA 1TFDA 2VD2A 1SW2A 1ZLQA 3OMBA 4NF4B 4OVJA 5FHMA 2O68A 1SDXA 3W15C 1P1NA 2QS1A 3LSLA 2ZYKA 3U8QA 1I6QA 2QS4A 3K01A 1QVSA 1QKAA 1LCFA 3MP8A 2DWHA 1MH3A 3MPLA 5EYFA 3FVOA 1YAEA 3I5OA 2QMWA 3MP6A 3M3KA 2RC7A 2Y7WA 4MLQA 4FEDA 1LAHE 2F78A 4R6YA 2GHAA 2H9BA 4ECFA 1UIVA 3OO9A 3QYTA 3ZSFA 3KG2A 3FV2A 1B3HA 1I69A 4IGRA 4NF6B 4NF8B 2D3IA 4QSEA 3TKDA 3VVDA 5ICTA 1MY4A 4RK9A 4PQJA 4F22A 4R9FA 3E4RA 3C35A 1R6ZA 2YJPA 2RCAA 1CB6A 4DLDA 1Y3QA 2GFEA 4YAHX 4G4PA 4ONYA 4G2ZA 4Q8RA 2UVJA 5HM4B 2A5SA 3IB1A 2HXWA 1GGGA 4IO7A 3DM0A 4OTEA 5I58B 1MPBA 5ELVA 3S9MC 4HCYA 4YKPA 1UTHA 1UTBA 4FEBA 5FHOA 2O7IA 1QW0A 4HW8A 2Z8EA 1VE4A 4QF9A 1LCTA 4PFWA 5FTIA 2R9JA 1A7LA 4GL8A 4O3CA 3H3GA 1LAGE 1B58A 4NF8A 1CE2A 4FORA 3T93B 5CI5A 2Z23A 3N6UA 3CVGA 3C33A 2XHDA 4XIGQ 1ZBMA 1B9JA 4H6DA 1SW1A 2XXRA 4F1YA 4KYSA 1Y3PA 2CZLA 2OJTA 1LFIA 3MQ9A 4OMBA 4OXVA 1URSA 3SEYA 3S9EA 2F7AA 4YICA 1MS7A 3ONMA 1JETA 2Y84A 2H25A 3Q29A 3K1PA 4U4XA 4LQ2A 3UGWA 1PB7A 1IZ1A 4H5FA 4RPNA 4GF8A 1POY1 4P11A 4TQUQ 4F3GA 1T0KA 1NKXA 2GH9A 3OO6A 3JV9A 4F29A 3IJOB 4I62A 4U21A 4GWOA 5H8HB 4E0WA 3IJXB 3O28A 4RY1A 1N7WA 4DXCA 1MY1A 4TLLB 1MG1A 4AQ4A 1AH5A 3CR9A 1A55A 2WKYA 3RPWA 1BTJA 2XX7A 1AMFA 1TFAA 4GL0A 4U1ZA 1XT8A 3T9VA 2ZNTA 3TCHA 4ESWA 1WODA 5H8NB 2ZYNA 3DP8A 4MLVA 1GTKA 1A99A 3Q26A 1MQGA 1USYH 2F5XA 2AL4A 2O51A 2XXUA 2YPNA 4P0GA 1MQDA 5M2VA 5CMKA 3FASA 2UYEA 1Y1MA 4KHZE 4R6HA 4QFNA 3S2VA 3MBPA 5KCJA 2PVUA 3QK6A 3VDFA 1B7UA 4U2RA 3SEVA 3SDFA 3C34A 3OSQA 1OLAA 2X7QA 4YU0A 2X26A 1II5A 2GHBA 3R26A 1FQAA 4LQ5A 3KSJA 4NF5A 5CMMA 4ZDMA 2XXWA 2ONSA 1N76A 1SBPA 1PBQA 4GXSB 4H1XA 3RGYA 4IO3A 2UVHA 4YMAA
chains in the Genus database with same CATH superfamily
3FXQA 1JW4A 2XWVA 2DWJA 4ZE8A 1FQBA 3W9VA 2CZHA 3OELA 3MWBA 1QJMA 2CEYA 4NWDA 3GZGA 2DS9A 1B6HA 4G77A 1N84A 2QL3A 2D5WA 3OEKA 5HPQA 1QUKA 3CG1A 4ZZEA 3IORA 1BK4A 3EQ1A 1ZJLA 4LATA 2QVUA 3K6VA 1XC1A 1XOCA 1I6BA 4KR5A 2NWJA 2XD2A 3D4GA 3IFCA 4NTLA 4HE0A 1PDAA 2FVZA 1B51A 3UP9A 3VLUA 3E78A 2UVGA 3L6GA 4OHNA 2VP1A 1G0IA 2O1MA 4R75A 3RQTA 1FTKA 3B6QA 3T9XB 3IB2A 4HE2A 1IXCA 4P9KA 1B0HA 4WKMA 3P7IA 5HBCA 5ICQA 4RK2A 3K6WA 3RT8A 1Y9UA 3TAJA 3IOTA 4N4UA 1ZIUA 2UXAA 5AA4B 5J1DA 3VXCA 3HO7A 5ITOA 4ELQA 1IXIA 1YTVA 3H03A 2WBBA 3HV1A 3IX1A 5ITPA 1NFTA 3KN8A 1B05A 1B4HA 2O84X 5CM6A 3WAEA 4F2QA 4GWUA 3MSTA 1DTGA 2XWKA 3RPLA 2VT5A 3T66A 4I40A 2BJIA 2V84A 5DYHA 3PPPA 5I57B 2XXXA 4UACA 5CMCA 1LB9A 4AB6A 1D3KA 2F3BA 3K02A 4MNPA 1R1NA 4FJPA 1FBFA 4PAIA 1NUYA 4TLMB 1AOVA 2Y7PA 3DP6A 2WX9A 2XX9A 2V4CA 1N3XA 4FE8A 1DMBA 3A09A 4F3BA 3C31A 4O7IA 3G3JA 3HPIA 1NL5A 3FXRA 5ESYA 2R8TA 5KCJB 3KN3A 4IY6A 1NH8A 4QFKA 3O29A 1MXWA 1D9YA 4UA8A 4PAFA 4G61A 4H65A 1O63A 1B5IA 4HE1A 1OVTA 1HSEA 4ZEDA 3H06B 3RN8A 3IFAA 2L5VA 1B3LA 4O94A 3LUYA 1FPKA 3EHTA 5L8DA 1B0LA 3O66A 5JEIA 1IXGA 4KCCA 2CZIA 3IAZA 3SERA 4YB5A 4ELRA 3QSLA 2V93A 4G8MA 2UYFA 1ZMGA 4GWXA 4BDQA 2X7PA 3U1OA 3RUMA 4IO2A 3O9PA 1VR5A 1EH3A 4LA9A 1XS5A 3PUVE 3PTYA 1MDP1 4P0IA 3E9XA 3MVXA 4U1OA 1ZTYA 2O69A 4KYDA 1US5A 1USYE 3C4MA 1S9TA 5I3SA 1B46A 3UA8A 2D21A 4E0XA 4U4SA 2HAVA 4Q30B 3USDA 2I0BA 4ZEBA 2P2AA 2FYIA 3SEWA 4YZZA 4GXAA 4XXUA 4G8HA 4GIZA 2DXRA 3U65A 2AIXA 4NN3A 2F6GA 1N0TA 5I59B 2PT2A 3EPEA 1MXZA 2ONKE 3N94A 4I3YA 4N6KA 2B3FA 5TP9B 3S9LC 1IMCA 4GX3A 3KC0A 5I56A 4YB7A 1LBVA 3EN3A 1PC3A 3ODBA 5L9OA 1RKMA 4P1LA 3LSWA 4GFRA 1B7HA 1FQCA 3O6IA 2OBGA 3HCQA 1MM7A 4BDNA 3W9WA 2ANJA 1YYZA 2ZYMA 3F11A 2ZYOA 3TMGA 2XD3A 1A8FA 3C36A 3G3GA 1FRPA 1SW2A 1SDXA 2QS1A 3LSLA 2DWHA 5IGAA 2RC7A 3A29A 2H9BA 4ECFA 3VVDA 2PCRA 4PBHA 3C35A 2YJPA 4G4PA 4ONYA 4I3EA 5HM4B 3IB1A 1GGGA 3S9MC 4HCYA 4FEBA 1QW0A 3HFUA 4QF9A 4PFWA 2R9JA 4GL8A 1LAGE 4FORA 5CI5A 2Z23A 3C33A 2XHDA 2Y5LA 1ZBMA 4H6DA 4F1YA 4OMBA 5DW8A 3S9EA 1URSA 2F7AA 1JETA 1NUWA 2Y84A 1FPDA 1FBPA 4RPNA 4GF8A 1POY1 4IR8A 3JV9A 3O28A 1N7WA 4TLLB 1A55A 2XX7A 3KC1A 4U1ZA 1XT8A 3TCHA 1NUZA 2DDKA 4ESWA 4KHZE 3MBPA 1FSAA 1OLAA 2X26A 2XXWA 5ET8A 1PBQA 2UVHA 3FVNA 4ZEKA 3NOHA 1P1WA 4AB5A 3HHFA 3KN7A 2Z8DA 1LBCA 3FVKA 1F9BA 5EHMA 4WEDA 4GVOA 2RF1A 4F31B 3TEPA 3PUYE 2WBDA 4LUBA 1NUXA 1AL3A 1S50A 5AA1A 3UK4A 1MQHA 4GOTA 1AWBA 1EYIA 3IOVA 4HS7A 2Y7KA 3E13X 5TP9A 4FAJA 5I5PA 4PE3A 5EHSA 4QSCA 4KD5A 3PU5A 2NVUB 2W7YA 3GLBA 3O97A 4X8RA 1LFGA 4KI0E 1DTZA 1JW5A 2DSFA 3N26A 4N6PA 4ESXA 5JTYB 1FBHA 2DWAA 5LDZA 3TODA 1FTAA 3MAMA 4MFIA 4LZ5A 5DEXA 5I58A 4GD5A 1D9QA 1MQIA 1B1HA 3K00A 2Z8FA 4MEVA 5IM2A 4H0WA 4F1UA 1DCUA 3D4CA 2P0SA 1N7XA 2F36A 4IO5A 2HZLA 1EU8A 1JEVA 3FGSA 3TFLA 2I48A 1YXIA 2RINA 1GVCA 4DI4B 4PDHA 1SVXB 3GBAA 2B4LA 4G68C 2F7BA 3FV1A 5IAIA 5A5XB 4G68B 3VLWA 2Q2AA 3ROJA 2E0SA 3JYRA 4MCOA 3S9NC 2P3VA 3EF7A 3G3HA 5AA2A 1YZ0A 4ELOA 1FPLA 5IZ3A 4M4GA 1LBZA 2QS3A 4X9TA 2OWTA 2DOJA 4LZ8A 2OWZA 4DIGA 3RT6B 2OLBA 1M5EA 3B6TA 1SW4A 4KYEA 1SD3A 2RKMA 1NV3A 1DK4A 1NNKA 1NV5A 4FIMA 2I4CA 2R71A 1SYIA 4F19A 3MUQA 3KJTA 3B50A 3H6VA 3PMXA 2ZZWA 4P3LA 5K2XA 1Q1KA 4YMBA 2DE4A 2RC9A 1B1XA 4GBWA 3FXUA 2I0CA 3KFMA 2O7UA 3IL1B 2I6EA 4EUOA 2V3TA 2B65A 1J1NA 5IZ3B 2VHAA 3K2DA 3ZKLA 2HAUA 4F3PA 5JK4A 4X1BA 5H8FA 3A3UA 4XEQA 2OWSA 3V5AA 1LEVA 4NAPA 2PYYA 1YPNA 4PF8A 1M5DA 3MVWA 2ZZVA 3VXBA 5F1QA 4ELPA 5FTHA 4NWCA 4C1TA 3MJNA 3LV0A 1UIUA 4YKKA 1DPEA 4R72A 4LVQA 1JNFA 4JXIA 2NUVA 4LP2B 2R6GE 1NNPA 2QVVA 1H44A 1IMAA 3WAFA 4YKIA 3ISPA 2F35A 3PD9A 4NQ8A 4Q5TA 1A40A 4ZZAA 4RA1A 4PTKA 5DVJA 4ZECA 1M5BA 5JTYA 2HFBA 3EKIA 3CRBA 2THIA 2GRVA 1R9LA 3PMVA 4ISUA 3MP1A 1BKAA 4EQ7A 3I3VA 4OYVA 3V83A 1XHYA 1B52A 2F7CA 4YKJA 1DOTA 5I2NA 4F1VA 5I57A 2XX8A 3BFUA 2Q9TA 1INPA 4NE4A 4EQBA 1OMPA 4NMYA 3E79A 1FW0A 3DELB 4JWXA 4AS4A 4EF1A 4NGUA 5CBRA 4MX6A 4I8CA 4F3SA 3FUZA 2QVRA 4F39A 4L17A 3LSFB 2ALUA 3FATA 1EYJA 1LGBC 5I59A 3LSXA 3PUZE 3MC2A 2GQ1A 3RY3A 1B3FA 2O1LA 1MY0A 4OVQA 2XXVA 2Y7IA 5L9MA 2XXQA 1POTA 4G8NA 4OFLA 4JSDA 2QJEA 4O8MA 1NV6A 4NF6A 4HXVA 2DE3A 3GXAA 1XVYA 3IR1A 2F97A 4I1DA 1RDZA 1FTJA 1LB8A 2FHYA 3TCFA 2H5YA 5DVIA 1SQYA 2Y7RA 3VE1B 3FVGA 4R9GA 4IO4A 1JP4A 1IMBA 5BWJA 4BLAA 5A5LA 3T9UA 5J16A 1MQJA 3PMWA 4C1UA 2KR0A 1ZLQA 3W15C 4X04A 1I6QA 5I7IA 3K01A 4P8BA 1QVSA 1QKAA 1LCFA 3T0JA 5EYFA 3FVOA 2VPNA 4FEDA 2F78A 1UIVA 3OO9A 1B3HA 4IGRA 4NF6B 3TKDA 5ICTA 4RK9A 1R6ZA 2RCAA 2GFEA 4YAHX 4G2ZA 4IO7A 3DM0A 4OTEA 5I58B 1MPBA 1FPEA 2FIXA 1LCTA 5FTIA 1A7LA 3H3GA 4PGNA 4NF8A 3T93B 3N6UA 4OANA 4XIGQ 1B9JA 2CZLA 4OXVA 4YICA 3ONMA 3K1PA 3UGWA 4H5FA 1IZ1A 1T0KA 1NKXA 2GH9A 4I62A 4U21A 5H8HB 3IJXB 4AQ4A 1AH5A 4OA4A 3RPWA 1FPGA 4GL0A 4OVSA 2ZNTA 5H8NB 2ZYNA 4H45A 1GTKA 1A99A 2YPNA 5M2VA 3MYUA 3FASA 2UYEA 4R6HA 2PVUA 1B7UA 1FBEA 3SDFA 2X7QA 2P3NA 1FQAA 4LQ5A 4ZDMA 1SBPA 4GXSB 4OVRA 4H1XA 4YMAA 1UQWA 4EQ9A 3IB0A 3Q25A 2Q88A 4GBVA 4NEDA 4FBPA 4DCYA 4WXJA 1BP5A 4QRZA 4M1VA 3FZVA 4OESA 5CRYA 4G68A 3D1RA 4POWA 3HN0A 3MVZA 4NF5B 4PETA 3PPRA 1HSJA 5I56B 3KBZA 4IGTA 4WEPA 3I6VA 5ET5A 1SI0A 4JWYA 3R6UA 1PB9A 2DVCA 1M5CA 5TPAA 1VFDA 2HHMA 4IB2A 4ZE9A 1NV0A 1S7YA 3CFXA 5H8SA 2F6PA 1LAFE 3H7MA 3RTFB 2OCUA 3KOSA 3QUFA 3THIA 4QBAA 4QFOA 1Q35A 3FIRA 3CFZA 2CZKA 1K9ZA 1MXYA 3U72A 1Q9DA 2HXRA 2RC8A 4O3BA 4EDPA 5AA3A 1Z7NE 3QXMA 1UTHB 4DZ1A 1FBGA 3ZS6A 3OSRA 3T96B 4MHFA 4PFBA 4OFJA 3M3FA 3FBPA 4MJOA 4GRKA 5AA2D 2QPQA 3HSTA 1TXFA 1VFEA 2QSXA 3C32A 3FJ7A 4JVIA 5H8FB 2XXTA 4OWDA 3LBSA 1Y3NA 3TYHA 4JWOA 2DXYA 3IOUA 1FPBA 4GWWA 1B3GA 1FJ9A 1H76A 2HCAA 3UN6A 4GQOA 4EF2A 2HZKA 1NV1A 4QFPA 1JW1A 1LAXA 1OLCA 4DCXA 1PEBA 4Z0IA 4PAKA 4PFUA 1ZKBA 4OEUA 4BDLA 2OX3A 3CHGA 2XXIA 4H5GA 4XTCQ 5KDTA 3MZ1A 2Z22A 1P1UA 3QAXA 5H8QA 1MPCA 2A5TA 1B7ZA 4UABA 4ZEIA 3PUXE 2UVIA 4NF4A 1MPDA 3FXBA 1FTLA 4MIJA 3OO7A 4RXLA 4QHQA 4XF5A 4X48A 4FATA 3V89B 1DSNA 1IUDA 4AS5A 3CI8A 1B32A 2DWIA 3KBRA 4O3AA 3VVFA 4O7MA 1FTOA 2F34A 5BUUA 1MM6A 2QFLA 1IMFA 1R9QA 3BKIB 4N8GA 4GWYA 4ND9A 3LC8A 1EZ9A 2ZNSA 4PFIA 4N13A 3PPNA 3H6WA 1URDA 3DLNA 2PMSA 5CC2A 2P1SA 1VDWA 4RJZA 3T9HB 3QIMA 2QRYA 4X1DA 2IEEA 4PDDA 5L9SA 2ZXTA 3R7XA 5H8HA 5EYGA 4P56A 3AXFA 3N5LA 2FNCA 2HEUA 1IITA 1FTMA 3G3IA 3L6HA 3SZPA 1QGXA 1KA0A 3ILUB 2DQVA 4KFQA 3VFJA 4N07A 3M8UA 4XKNA 2F3DA 4DXUA 1MRPA 2XXKA 5IKBA 2OZZA 3FJMA 3RYDA 4PFRA 4NF0A 2PFZA 1LLSA 2O6AA 5F7VA 1JVYA 1N3WA 3H4ZA 1CNQA 3K6UA 4OETA 2IA4A 2B3BA 3Q28A 3KJ7A 2KQZA 2HPGA 3A3CA 4GWSA 1MDQA 4BDMA 1GV8A 2XXPA 3TTKA 5IZZA 2V3UA 3G3FA 3KEIA 1P1QA 1FQFA 3TPAA 1NNFA 1P1OA 2XA5A 3H6UA 1H43A 3PUWE 4LONB 2VD3A 4OFOA 2V25A 1EYKA 3PPOA 4N8YA 4N17A 1MH4A 3OENA 1VSOA 4JB7A 3ZKKA 4P1EA 1D4NA 3IOWA 1LBXA 1RYOA 1QULA 3CIJA 1EZPA 5LTCA 3ECRA 2VOZA 3KSXA 4R74A 4H67A 2REJA 3MW0A 1WVJA 3M3LA 1D9VA 4KCDA 2ONRA 2XWOA 3O2AA 4NG7A 3RTWB 4BDRA 1LBWA 4R2BA 5IZ1A 4HTGA 2WYPA 5A5XA 3B6WA 3Q27A 1KWHA 3LUZA 5FBPA 2Q8MA 1NNTA 3QUJA 2G93A 2Q2CA 2Q74A 1QKBA 4OQOA 3IO4A 2E1SA 3HHGA 3OOAA 4DDDA 5AE4A 1GR2A 1TWYA 3G7WA 5DT6A 1B40A 4MF3A 1UTBB 1NH7A 2BJJX 4U23A 4H8JA 1TFDA 4NF4B 2CEXA 1LBYA 2ZYKA 3U8QA 3RPLB 4JVDA 3MPLA 2Y5KA 1YAEA 2QMWA 3MP6A 4MLQA 1LAHE 1FPFA 4R6YA 2GHAA 3QYTA 3ZSFA 3KG2A 1NI9A 1I69A 4PQJA 4F22A 4R9FA 3E4RA 2B4MA 2HXWA 5ELVA 4YKPA 1UTBA 2O7IA 4O3CA 1B58A 4KXPA 4KYSA 1Y3PA 3SEYA 2OJTA 1LFIA 1NV7A 4U4XA 5F24A 4F3GA 3OO6A 4GWOA 4E0WA 4DXCA 3CR9A 2WKYA 1AMFA 3T9VA 1K9YA 1MQGA 2F5XA 2AL4A 1MQDA 5CMKA 3S2VA 1Y1MA 4QFNA 3C34A 4YU0A 5CMMA 2GHBA 3R26A 3KSJA 2ONSA 1N76A 4IO3A 5H8NA 4JDFA 3RNNA 2FA7A 3PD8A 4F2OA 2I49A 3PPQA 1LFHA 1BIYA 5H8QB 1FPIA 4FECA 1G0HA 3N6TA 2WEFA 3SETA 1PBPA 3B7DA 4P47A 1LSTA 3OO8A 1FCKA 5AA4A 3FD3A 3OXNA 1B2HA 5CBSA 2FBPA 3K6XA 4H46A 2H4IA 4EXKA 3MVYA 3H6TA 3QMFA 1FQDA 2PX1A 2QMXA 1XVXA 4LN5A 1WDNA 1O7TA 3G3KA 4H8IA 4RNSA 4POXA 5CMBA 1Y1ZA 1FQEA 3TQLA 2XXHA 3K4UA 4QFLA 3UORA 5I2NB 4PC9A 4MH5A 3RLFE 4GLIA 1ATGA 1EZOA 5B70A 2A5TB 3KZGA 4JBZA 4JSOA 1JEUA 1B5HA 2H99A 2PBWA 1MXUA 4OVTA 1ELJA 5EYHA 1SYHA 1NV4A 2MKZA 3LR1A 1MY3A 3IK6B 1FBDA 5DVFA 4XKQA 1URGA 1OIBA 3B8BA 4PBQA 5TPAB 1JVXA 1M5FA 2H98A 3K0VA 4KQPA 3U92A 1FPJA 2YLNA 3TELA 5DTBA 3VVEA 3IO6A 4NX1A 3CG3A 1NV2A 4C0RA 1MXVA 1RYXA 4LZ7A 1ANFA 4XKPA 4OVPA 4GWZA 3SKPA 3K1NA 4NHBA 1IEJA 1US4A 3SEXA 3ILTB 5EQ9A 3TTLA 4OEVA 3CSBA 4BDOA 1JQFA 2I3VA 4RPOA 3MZ9A 1H45A 4IY5A 4MMPA 4ZEFA 4EXLA 4OZ9A 1YCJA 2OK2A 2DP8A 1TT1A 1Z7ME 5T3JA 1NMUA 1I6AA 3TUSA 1QUIA 3V8XB 2WYKA 2I3WA 5FHNA 3PV0E 1QUJA 5KZTA 3DP4A 3BBRA 1HSLA 4R6KA 4QXDA 2RCBA 5KDTB 4MBPA 3E3KA 4HCWA 3SEUA 5I2KA 4R2FA 3O6HA 4XKRA 2NXOA 2REGA 2Q8JA 1PB8A 1Y4CA 3VLVA 2JJKA 4PF6A 1SW5A 3TTMA 1L5TA 3MPKA 2DVZA 1LBBA 1P99A 3K1MA 4Z7EA 1KA1A 4KPTA 5ET7A 3CSGA 1SPIA 3EHSA 3SESA 3TTNA 4OERA 3VV5A 3TTRA 3CFLA 3PGFA 2KLFA 3EHUA 4R73A 1OQHA 4MAGA 4GX4A 4THIA 3KGCA 1Y20A 1IMEA 2LAOA 4U22A 5ET6A 3U94A 2XWIA 5ISUA 1IIWA 4GX6A 2ZNUA 1A8EA 1MY2A 4PP0A 4N15A 4DXBA 2PT1A 1B3EA 1H3DA 1OVBA 2Q89A 5I84A 5I2KB 4PFTA 1SI1A 5K2YA 4JVCA 1O64A 3T1BA 1B4ZA 5AA2B 2I4BA 4QSDA 1DBZA 3TDJA 2M8CA 4IO6A 1IQ7A 4OENA 4RYAA 1DPPA 3U93A 3GBBA 1N04A 2XXYA 2ABHA 5LOMA 2NOOA 3BFTA 1A54A 3JZJA 3C9HA 4Q0CA 3OD7A 4PFYA 4PCDA 4PE5B 4K3FA 4DE8A 1FBCA 3KOTA 1IXHA 4MNCA 3TZAA 4TOZA 1AIVA 5B7DA 3BIGA 2G29A 2V3QA 1XI6A 2AL5A 2VGQA 3T22A 5EQ7A 1B5JA 1Y4TA 4ZS9A 3UIFA 4YB6A 1OQGA 2ESNA 2I58A 4DI3D 3MZBA 2ZMBA 1BLFA 2AYSA 3TCGA 2DE2A 2DYXA 1ZU0A 4XFEA 2FIEA 2F8DA 2QS2A 5TU0A 2HQ0A 4I9DA 5DEXB 3FJGA 3TQWA 1MXXA 2CMOA 3OEMA 1FJ6A 4F18A 3O6GA 2VD2A 3OMBA 5FHMA 4OVJA 2ZZXA 2O68A 1P1NA 2QS4A 3MP8A 1MH3A 1RDYA 3I5OA 5EQ8A 3M3KA 2Y7WA 2VPOA 1KZ8A 4N6DA 3FV2A 4NF8B 4QSEA 2D3IA 1MY4A 1IMDA 3GYYA 1CB6A 4DLDA 1Y3QA 4Q8RA 2UVJA 2A5SA 1UTHA 5EQAA 4HW8A 5FHOA 2Z8EA 1VE4A 4PGPA 1CE2A 3CVGA 2PFYA 1SW1A 2XXRA 3MQ9A 1MS7A 3Q29A 2H25A 4LQ2A 1PB7A 4P11A 4TQUQ 4F29A 3IJOB 1RDXA 4RY1A 1MY1A 1MG1A 1BTJA 3BIHA 1TFAA 1WODA 4MNIA 3DP8A 4MLVA 3Q26A 1USYH 4P0GA 2O51A 2XXUA 5KCJA 3QK6A 3SEVA 4U2RA 3OSQA 1II5A 3S4UA 4NF5A 4N91A 3RGYA 4N81A 3VDFA
chains in the Genus database with same CATH topology
3FXQA 3FVNA 5H8NA 1JW4A 4JDFA 4ZEKA 1P1WA 1UQWA 3RNNA 2DWJA 2FA7A 4AB5A 4EQ9A 3HHFA 3PD8A 3KN7A 4F2OA 4ZE8A 2I49A 2Z8DA 3IB0A 1LBCA 3Q25A 3PPQA 1LFHA 1BIYA 1FQBA 3FVKA 2Q88A 1F9BA 4FECA 5H8QB 3W9VA 5EHMA 3N6TA 3OELA 4NEDA 3MWBA 3SETA 1PBPA 1QJMA 3B7DA 4WEDA 4GVOA 2RF1A 4F31B 3TEPA 4DCYA 3PUYE 4WXJA 4NWDA 1BP5A 3GZGA 4QRZA 4M1VA 2DS9A 3FZVA 4OESA 1LSTA 1B6HA 3OO8A 1FCKA 4G77A 1N84A 4LUBA 2QL3A 2D5WA 1AL3A 1S50A 3OEKA 5AA4A 5CRYA 4G68A 3FD3A 5HPQA 1QUKA 3OXNA 1B2HA 4POWA 3CG1A 4ZZEA 5AA1A 5CBSA 3IORA 3HN0A 3EQ1A 3K6XA 3MVZA 1ZJLA 2H4IA 4LATA 4NF5B 3PPRA 1HSJA 4PETA 3UK4A 1MQHA 3K6VA 1XC1A 4F2QA 5I56B 4IGTA 4GOTA 4WEPA 1XOCA 3I6VA 3MVYA 3H6TA 1I6BA 4KR5A 1FQDA 1SI0A 2PX1A 2QMXA 1XVXA 2XD2A 3IOVA 4JWYA 2NWJA 1WDNA 4HS7A 2Y7KA 3D4GA 1O7TA 3E13X 5TP9A 3TQLA 4FAJA 3R6UA 3G3KA 1PB9A 2DVCA 4NTLA 1M5CA 1VFDA 1PDAA 4H8IA 1Y1ZA 1FQEA 4POXA 2XXHA 4RNSA 5CMBA 5TPAA 1B51A 3K4UA 4KD5A 4QSCA 5EHSA 3PU5A 4QFLA 4IB2A 3UP9A 3UORA 3VLUA 4ZE9A 5I2NB 2NVUB 2W7YA 1S7YA 2UVGA 3CFXA 3GLBA 2F6PA 3L6GA 5H8SA 1LAFE 4OHNA 3O97A 3H7MA 2VP1A 3RTFB 2O1MA 2OCUA 3KOSA 3QUFA 1LFGA 4KI0E 3THIA 4R75A 4MH5A 1DTZA 1FTKA 1JW5A 4QFOA 3RLFE 3B6QA 4GLIA 3RQTA 1Q35A 2DSFA 3T9XB 3FIRA 3CFZA 3IB2A 3N26A 1ATGA 1EZOA 1IXCA 1MXYA 3U72A 5B70A 1B0HA 2A5TB 3KZGA 4O3BA 2RC8A 4WKMA 4N6PA 4JBZA 4JSOA 3P7IA 5HBCA 4EDPA 1Z7NE 4ESXA 5AA3A 3QXMA 5JTYB 1UTHB 4DZ1A 4RK2A 5ICQA 3K6WA 3RT8A 1Y9UA 2DWAA 3ZS6A 3TAJA 1JEUA 3IOTA 3OSRA 1ZIUA 1B5HA 3T96B 3TODA 2UXAA 2H99A 4OFJA 5AA4B 2PBWA 3M3FA 1MXUA 3MAMA 1ELJA 4MFIA 5J1DA 1SYHA 4LZ5A 3VXCA 5DEXA 3HO7A 5I58A 3LR1A 5ITOA 4GD5A 1MQIA 1MY3A 4ELQA 3IK6B 1B1HA 3K00A 1IXIA 2Z8FA 4GRKA 1YTVA 5DVFA 5AA2D 4H0WA 3H03A 3HV1A 3IX1A 2QPQA 3HSTA 1URGA 1TXFA 4XKQA 1NFTA 1VFEA 3KN8A 3S4UA 4F1UA 1B05A 1B4HA 1OIBA 2QSXA 3C32A 3D4CA 2P0SA 3FJ7A 2O84X 5H8FB 1N7XA 2XXTA 5CM6A 3WAEA 2F36A 5TPAB 1JVXA 3LBSA 1Y3NA 4IO5A 1M5FA 2H98A 4OWDA 2HZLA 1EU8A 1JEVA 3FGSA 4JWOA 3TFLA 3K0VA 2I48A 4KQPA 3U92A 5ITPA 2DXYA 3IOUA 2RINA 1GVCA 2YLNA 1B3GA 3TELA 1SVXB 5DTBA 3VVEA 1DTGA 3GBAA 3IO6A 1H76A 2HCAA 3CG3A 4G68C 4GQOA 3T66A 3UN6A 2HZKA 4C0RA 4EF2A 1MXVA 2F7BA 4QFPA 3FV1A 5IAIA 1JW1A 1RYXA 1LAXA 5A5XB 4G68B 1OLCA 2V84A 3VLWA 5DYHA 4DCXA 2Q2AA 1PEBA 4LZ7A 4Z0IA 2E0SA 3JYRA 3PPPA 2XXXA 5I57B 1ANFA 3S9NC 4PFUA 4UACA 4XKPA 5CMCA 1LB9A 1ZKBA 4OEUA 4BDLA 4AB6A 1D3KA 2XXIA 4H5GA 3K1NA 3SKPA 4XTCQ 3EF7A 3G3HA 3K02A 1IEJA 5AA2A 1US4A 3SEXA 5KDTA 3MZ1A 2Z22A 3ILTB 1P1UA 1R1NA 4FJPA 4ELOA 3QAXA 5H8QA 1MPCA 2A5TA 4TLMB 3TTLA 2Y7PA 1AOVA 4OEVA 4M4GA 2QS3A 3CSBA 1B7ZA 4X9TA 4BDOA 2OWTA 1JQFA 2DOJA 3DP6A 4LZ8A 2XX9A 4ZEIA 3PUXE 2I3VA 4RPOA 4DIGA 1N3XA 2UVIA 3MZ9A 4NF4A 2OLBA 1MPDA 3RT6B 1H45A 4IY5A 4FE8A 4ZEFA 1M5EA 3B6TA 1SW4A 4KYEA 1SD3A 1DMBA 2RKMA 4OZ9A 4EXLA 1FTLA 3A09A 1YCJA 3OO7A 1NNKA 4F3BA 3C31A 4RXLA 4QHQA 4FIMA 2OK2A 3G3JA 2DP8A 4X48A 4FATA 3V89B 1DSNA 1TT1A 2I4CA 2R71A 1IUDA 1Z7ME 3HPIA 1SYIA 4F19A 1NL5A 3CI8A 1B32A 1NMUA 2DWIA 1I6AA 3KBRA 3FXRA 3MUQA 4O3AA 3TUSA 3KJTA 5KCJB 3KN3A 1QUIA 3VVFA 3V8XB 4IY6A 1NH8A 2I3WA 4QFKA 5FHNA 3PV0E 3O29A 1FTOA 1MXWA 2F34A 3H6VA 1D9YA 4UA8A 5BUUA 3PMXA 1QUJA 1MM6A 5K2XA 1Q1KA 1R9QA 4YMBA 3DP4A 5KZTA 3BKIB 3BBRA 1HSLA 4R6KA 4ND9A 2DE4A 3LC8A 4H65A 1EZ9A 2RC9A 2ZNSA 2RCBA 4N13A 3PPNA 5KDTB 1O63A 3H6WA 1B5IA 1URDA 4MBPA 1B1XA 3E3KA 3DLNA 1OVTA 3FXUA 1HSEA 2PMSA 5CC2A 4ZEDA 3H06B 3RN8A 2P1SA 2I0CA 3KFMA 4HCWA 4RJZA 3T9HB 1B3LA 3LUYA 3EHTA 3QIMA 3SEUA 2QRYA 5I2KA 4R2FA 3O6HA 4XKRA 2NXOA 1B0LA 4X1DA 2IEEA 5L8DA 4EXKA 2REGA 3O66A 5L9SA 2O7UA 2ZXTA 2Q8JA 5JEIA 1IXGA 3IL1B 4KCCA 3R7XA 1PB8A 5H8HA 1Y4CA 2I6EA 4EUOA 3IAZA 2V3TA 3SERA 2B65A 3AXFA 4YB5A 3N5LA 4ELRA 3VLVA 1J1NA 2FNCA 2HEUA 1IITA 3QSLA 1FTMA 3G3IA 2V93A 3L6HA 2VHAA 4G8MA 1SW5A 3K2DA 3TTMA 2UYFA 1L5TA 1ZMGA 3ZKLA 3ILUB 2HAUA 3MPKA 4F3PA 2DQVA 2DVZA 4BDQA 4KFQA 4X1BA 3VFJA 5JK4A 4N07A 3M8UA 5H8FA 3A3UA 4XKNA 1LBBA 2X7PA 1P99A 3K1MA 4Z7EA 2OWSA 3U1OA 3V5AA 1MRPA 4DXUA 5IKBA 2OZZA 2PYYA 1YPNA 3RUMA 3FJMA 4IO2A 3O9PA 1VR5A 4KPTA 1EH3A 1M5DA 3MVWA 4LA9A 3VXBA 5F1QA 1XS5A 3CSGA 3PUVE 4ELPA 1LLSA 3EHSA 3SESA 2O6AA 5FTHA 1MDP1 4P0IA 4NWCA 1JVYA 1N3WA 3E9XA 3H4ZA 5F7VA 3MJNA 4C1TA 3TTNA 4OERA 3VV5A 3MVXA 4U1OA 1ZTYA 3CFLA 3TTRA 3K6UA 4OETA 3PGFA 1UIUA 2IA4A 2B3BA 2KLFA 1DPEA 2O69A 3EHUA 3KJ7A 3Q28A 4YKKA 4R73A 1OQHA 4KYDA 4R72A 4LVQA 3A3CA 1US5A 1JNFA 4JXIA 2NUVA 4LP2B 1USYE 4THIA 2R6GE 1MDQA 1NNPA 3KGCA 4BDMA 1Y20A 3C4MA 1S9TA 2XXPA 1GV8A 3TTKA 2V3UA 1B46A 1H44A 2LAOA 3G3FA 3KEIA 3UA8A 1P1QA 2D21A 4U22A 4E0XA 1FQFA 3TPAA 1NNFA 3U94A 3WAFA 4U4SA 4YKIA 1P1OA 2F35A 3PD9A 5ISUA 4Q5TA 1IIWA 3H6UA 1H43A 2HAVA 3PUWE 1A40A 2ZNUA 2VD3A 4LONB 1A8EA 2V25A 1MY2A 4OFOA 4PP0A 4Q30B 4ZZAA 3USDA 3PPOA 4RA1A 4DXBA 2PT1A 1B3EA 5DVJA 2I0BA 4ZEBA 1H3DA 1MH4A 2P2AA 3OENA 1VSOA 4ZECA 2FYIA 1M5BA 5JTYA 1OVBA 2HFBA 2Q89A 3CRBA 4JB7A 4GXAA 4XXUA 4YZZA 3SEWA 3ZKKA 2THIA 5I84A 1D4NA 2GRVA 1R9LA 1SI1A 3IOWA 3PMVA 4ISUA 4PFTA 5I2KB 5K2YA 4G8HA 3MP1A 1BKAA 4EQ7A 1O64A 3I3VA 4OYVA 3TYHA 1XHYA 1B4ZA 1B52A 2F7CA 4YKJA 1RYOA 3V83A 4GIZA 2DXRA 5AA2B 2AIXA 2F6GA 2I4BA 1QULA 3CIJA 4QSDA 1EZPA 1N0TA 3ECRA 2VOZA 3TDJA 5I59B 1DOTA 2M8CA 2PT2A 3EPEA 3KSXA 4IO6A 4R74A 1MXZA 2ONKE 5I2NA 4F1VA 5I57A 1IQ7A 2XX8A 3BFUA 2REJA 4H67A 4OENA 4RYAA 1DPPA 3U93A 2Q9TA 3N94A 3GBBA 1N04A 2XXYA 2ABHA 2B3FA 4NE4A 4EQBA 1OMPA 5LOMA 2NOOA 3MW0A 5TP9B 4NMYA 1FW0A 3S9LC 1WVJA 3DELB 3M3LA 1D9VA 4KCDA 4JWXA 2ONRA 4EF1A 3BFTA 5CBRA 1A54A 3JZJA 3C9HA 4I8CA 3FUZA 4F3SA 4Q0CA 5I56A 3OD7A 4PFYA 3O2AA 3RTWB 4F39A 4L17A 3LSFB 4BDRA 4YB7A 4PE5B 4K3FA 3EN3A 4DE8A 1PC3A 2ALUA 3ODBA 4R2BA 3FATA 1IXHA 1RKMA 1LGBC 3KOTA 3TZAA 3LSWA 5L9OA 4GFRA 5I59A 4TOZA 3LSXA 3PUZE 1B7HA 1AIVA 3MC2A 4HTGA 3RY3A 1B3FA 2O1LA 5A5XA 1MY0A 3B6WA 3Q27A 5B7DA 1KWHA 2XXVA 2Y7IA 2G29A 2V3QA 2AL5A 2VGQA 5L9MA 3T22A 2XXQA 1POTA 1B5JA 1Y4TA 4G8NA 4OFLA 4ZS9A 1FQCA 4JSDA 1NNTA 2QJEA 3UIFA 3QUJA 2G93A 2Q2CA 4YB6A 1OQGA 3O6IA 2ESNA 2OBGA 1QKBA 4NF6A 2I58A 4OQOA 3HCQA 3MZBA 3IO4A 2DE3A 3GXAA 1MM7A 2E1SA 2ZMBA 1XVYA 1BLFA 2AYSA 3IR1A 3TCGA 2DE2A 4BDNA 3HHGA 3OOAA 2DYXA 1ZU0A 2F97A 3W9WA 4I1DA 1FTJA 4DDDA 1LB8A 3TCFA 2H5YA 5DVIA 5AE4A 2ANJA 1GR2A 1TWYA 2F8DA 1SQYA 2Y7RA 3VE1B 2ZYMA 2QS2A 5TU0A 3FVGA 4R9GA 4IO4A 3G7WA 3F11A 2ZYOA 3TMGA 5BWJA 4BLAA 5DT6A 1B40A 2HQ0A 4I9DA 5DEXB 4MF3A 3FJGA 3T9UA 3TQWA 1MXXA 1UTBB 2CMOA 1NH7A 2BJJX 2XD3A 4U23A 3OEMA 1A8FA 3C36A 4H8JA 1MQJA 3PMWA 3G3GA 4C1UA 4F18A 3O6GA 1TFDA 2VD2A 1SW2A 1ZLQA 3OMBA 4NF4B 4OVJA 5FHMA 2O68A 1SDXA 3W15C 1P1NA 2QS1A 3LSLA 2ZYKA 3U8QA 1I6QA 2QS4A 3K01A 1QVSA 1QKAA 1LCFA 3MP8A 2DWHA 1MH3A 3MPLA 5EYFA 3FVOA 1YAEA 3I5OA 2QMWA 3MP6A 3M3KA 2RC7A 2Y7WA 4MLQA 4FEDA 1LAHE 2F78A 4R6YA 2GHAA 2H9BA 4ECFA 1UIVA 3OO9A 3QYTA 3ZSFA 3KG2A 3FV2A 1B3HA 1I69A 4IGRA 4NF6B 4NF8B 2D3IA 4QSEA 3TKDA 3VVDA 5ICTA 1MY4A 4RK9A 4PQJA 4F22A 4R9FA 3E4RA 3C35A 1R6ZA 2YJPA 2RCAA 1CB6A 4DLDA 1Y3QA 2GFEA 4YAHX 4G4PA 4ONYA 4G2ZA 4Q8RA 2UVJA 5HM4B 2A5SA 3IB1A 2HXWA 1GGGA 4IO7A 3DM0A 4OTEA 5I58B 1MPBA 5ELVA 3S9MC 4HCYA 4YKPA 1UTHA 1UTBA 4FEBA 5FHOA 2O7IA 1QW0A 4HW8A 2Z8EA 1VE4A 4QF9A 1LCTA 4PFWA 5FTIA 2R9JA 1A7LA 4GL8A 4O3CA 3H3GA 1LAGE 1B58A 4NF8A 1CE2A 4FORA 3T93B 5CI5A 2Z23A 3N6UA 3CVGA 3C33A 2XHDA 4XIGQ 1ZBMA 1B9JA 4H6DA 1SW1A 2XXRA 4F1YA 4KYSA 1Y3PA 2CZLA 2OJTA 1LFIA 3MQ9A 4OMBA 4OXVA 1URSA 3SEYA 3S9EA 2F7AA 4YICA 1MS7A 3ONMA 1JETA 2Y84A 2H25A 3Q29A 3K1PA 4U4XA 4LQ2A 3UGWA 1PB7A 1IZ1A 4H5FA 4RPNA 4GF8A 1POY1 4P11A 4TQUQ 4F3GA 1T0KA 1NKXA 2GH9A 3OO6A 3JV9A 4F29A 3IJOB 4I62A 4U21A 4GWOA 5H8HB 4E0WA 3IJXB 3O28A 4RY1A 1N7WA 4DXCA 1MY1A 4TLLB 1MG1A 4AQ4A 1AH5A 3CR9A 1A55A 2WKYA 3RPWA 1BTJA 2XX7A 1AMFA 1TFAA 4GL0A 4U1ZA 1XT8A 3T9VA 2ZNTA 3TCHA 4ESWA 1WODA 5H8NB 2ZYNA 3DP8A 4MLVA 1GTKA 1A99A 3Q26A 1MQGA 1USYH 2F5XA 2AL4A 2O51A 2XXUA 2YPNA 4P0GA 1MQDA 5M2VA 5CMKA 3FASA 2UYEA 1Y1MA 4KHZE 4R6HA 4QFNA 3S2VA 3MBPA 5KCJA 2PVUA 3QK6A 3VDFA 1B7UA 4U2RA 3SEVA 3SDFA 3C34A 3OSQA 1OLAA 2X7QA 4YU0A 2X26A 1II5A 2GHBA 3R26A 1FQAA 4LQ5A 3KSJA 4NF5A 5CMMA 4ZDMA 2XXWA 2ONSA 1N76A 1SBPA 1PBQA 4GXSB 4H1XA 3RGYA 4IO3A 2UVHA 4YMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FXQ A;  3FVN A;  5H8N A;  1JW4 A;  4JDF A;  4ZEK A;  1P1W A;  1UQW A;  3RNN A;  2DWJ A;  2FA7 A;  4AB5 A;  4EQ9 A;  3HHF A;  3PD8 A;  3KN7 A;  4F2O A;  4ZE8 A;  2I49 A;  2Z8D A;  3IB0 A;  1LBC A;  3Q25 A;  3PPQ A;  1LFH A;  1BIY A;  1FQB A;  3FVK A;  2Q88 A;  1F9B A;  4FEC A;  5H8Q B;  3W9V A;  5EHM A;  3N6T A;  3OEL A;  4NED A;  3MWB A;  3SET A;  1PBP A;  1QJM A;  3B7D A;  4WED A;  4GVO A;  2RF1 A;  4F31 B;  3TEP A;  4DCY A;  3PUY E;  4WXJ A;  4NWD A;  1BP5 A;  3GZG A;  4QRZ A;  4M1V A;  2DS9 A;  3FZV A;  4OES A;  1LST A;  1B6H A;  3OO8 A;  1FCK A;  4G77 A;  1N84 A;  4LUB A;  2QL3 A;  2D5W A;  1AL3 A;  1S50 A;  3OEK A;  5AA4 A;  5CRY A;  4G68 A;  3FD3 A;  5HPQ A;  1QUK A;  3OXN A;  1B2H A;  4POW A;  3CG1 A;  4ZZE A;  5AA1 A;  5CBS A;  3IOR A;  3HN0 A;  3EQ1 A;  3K6X A;  3MVZ A;  1ZJL A;  2H4I A;  4LAT A;  4NF5 B;  3PPR A;  1HSJ A;  4PET A;  3UK4 A;  1MQH A;  3K6V A;  1XC1 A;  4F2Q A;  5I56 B;  4IGT A;  4GOT A;  4WEP A;  1XOC A;  3I6V A;  3MVY A;  3H6T A;  1I6B A;  4KR5 A;  1FQD A;  1SI0 A;  2PX1 A;  2QMX A;  1XVX A;  2XD2 A;  3IOV A;  4JWY A;  2NWJ A;  1WDN A;  4HS7 A;  2Y7K A;  3D4G A;  1O7T A;  3E13 X;  5TP9 A;  3TQL A;  4FAJ A;  3R6U A;  3G3K A;  1PB9 A;  2DVC A;  4NTL A;  1M5C A;  1VFD A;  1PDA A;  4H8I A;  1Y1Z A;  1FQE A;  4POX A;  2XXH A;  4RNS A;  5CMB A;  5TPA A;  1B51 A;  3K4U A;  4KD5 A;  4QSC A;  5EHS A;  3PU5 A;  4QFL A;  4IB2 A;  3UP9 A;  3UOR A;  3VLU A;  4ZE9 A;  5I2N B;  2NVU B;  2W7Y A;  1S7Y A;  2UVG A;  3CFX A;  3GLB A;  2F6P A;  3L6G A;  5H8S A;  1LAF E;  4OHN A;  3O97 A;  3H7M A;  2VP1 A;  3RTF B;  2O1M A;  2OCU A;  3KOS A;  3QUF A;  1LFG A;  4KI0 E;  3THI A;  4R75 A;  4MH5 A;  1DTZ A;  1FTK A;  1JW5 A;  4QFO A;  3RLF E;  3B6Q A;  4GLI A;  3RQT A;  1Q35 A;  2DSF A;  3T9X B;  3FIR A;  3CFZ A;  3IB2 A;  3N26 A;  1ATG A;  1EZO A;  1IXC A;  1MXY A;  3U72 A;  5B70 A;  1B0H A;  2A5T B;  3KZG A;  4O3B A;  2RC8 A;  4WKM A;  4N6P A;  4JBZ A;  4JSO A;  3P7I A;  5HBC A;  4EDP A;  1Z7N E;  4ESX A;  5AA3 A;  3QXM A;  5JTY B;  1UTH B;  4DZ1 A;  4RK2 A;  5ICQ A;  3K6W A;  3RT8 A;  1Y9U A;  2DWA A;  3ZS6 A;  3TAJ A;  1JEU A;  3IOT A;  3OSR A;  1ZIU A;  1B5H A;  3T96 B;  3TOD A;  2UXA A;  2H99 A;  4OFJ A;  5AA4 B;  2PBW A;  3M3F A;  1MXU A;  3MAM A;  1ELJ A;  4MFI A;  5J1D A;  1SYH A;  4LZ5 A;  3VXC A;  5DEX A;  3HO7 A;  5I58 A;  3LR1 A;  5ITO A;  4GD5 A;  1MQI A;  1MY3 A;  4ELQ A;  3IK6 B;  1B1H A;  3K00 A;  1IXI A;  2Z8F A;  4GRK A;  1YTV A;  5DVF A;  5AA2 D;  4H0W A;  3H03 A;  3HV1 A;  3IX1 A;  2QPQ A;  3HST A;  1URG A;  1TXF A;  4XKQ A;  1NFT A;  1VFE A;  3KN8 A;  3S4U A;  4F1U A;  1B05 A;  1B4H A;  1OIB A;  2QSX A;  3C32 A;  3D4C A;  2P0S A;  3FJ7 A;  2O84 X;  5H8F B;  1N7X A;  2XXT A;  5CM6 A;  3WAE A;  2F36 A;  5TPA B;  1JVX A;  3LBS A;  1Y3N A;  4IO5 A;  1M5F A;  2H98 A;  4OWD A;  2HZL A;  1EU8 A;  1JEV A;  3FGS A;  4JWO A;  3TFL A;  3K0V A;  2I48 A;  4KQP A;  3U92 A;  5ITP A;  2DXY A;  3IOU A;  2RIN A;  1GVC A;  2YLN A;  1B3G A;  3TEL A;  1SVX B;  5DTB A;  3VVE A;  1DTG A;  3GBA A;  3IO6 A;  1H76 A;  2HCA A;  3CG3 A;  4G68 C;  4GQO A;  3T66 A;  3UN6 A;  2HZK A;  4C0R A;  4EF2 A;  1MXV A;  2F7B A;  4QFP A;  3FV1 A;  5IAI A;  1JW1 A;  1RYX A;  1LAX A;  5A5X B;  4G68 B;  1OLC A;  2V84 A;  3VLW A;  5DYH A;  4DCX A;  2Q2A A;  1PEB A;  4LZ7 A;  4Z0I A;  2E0S A;  3JYR A;  3PPP A;  2XXX A;  5I57 B;  1ANF A;  3S9N C;  4PFU A;  4UAC A;  4XKP A;  5CMC A;  1LB9 A;  1ZKB A;  4OEU A;  4BDL A;  4AB6 A;  1D3K A;  2XXI A;  4H5G A;  3K1N A;  3SKP A;  4XTC Q;  3EF7 A;  3G3H A;  3K02 A;  1IEJ A;  5AA2 A;  1US4 A;  3SEX A;  5KDT A;  3MZ1 A;  2Z22 A;  3ILT B;  1P1U A;  1R1N A;  4FJP A;  4ELO A;  3QAX A;  5H8Q A;  1MPC A;  2A5T A;  4TLM B;  3TTL A;  2Y7P A;  1AOV A;  4OEV A;  4M4G A;  2QS3 A;  3CSB A;  1B7Z A;  4X9T A;  4BDO A;  2OWT A;  1JQF A;  2DOJ A;  3DP6 A;  4LZ8 A;  2XX9 A;  4ZEI A;  3PUX E;  2I3V A;  4RPO A;  4DIG A;  1N3X A;  2UVI A;  3MZ9 A;  4NF4 A;  2OLB A;  1MPD A;  3RT6 B;  1H45 A;  4IY5 A;  4FE8 A;  4ZEF A;  1M5E A;  3B6T A;  1SW4 A;  4KYE A;  1SD3 A;  1DMB A;  2RKM A;  4OZ9 A;  4EXL A;  1FTL A;  3A09 A;  1YCJ A;  3OO7 A;  1NNK A;  4F3B A;  3C31 A;  4RXL A;  4QHQ A;  4FIM A;  2OK2 A;  3G3J A;  2DP8 A;  4X48 A;  4FAT A;  3V89 B;  1DSN A;  1TT1 A;  2I4C A;  2R71 A;  1IUD A;  1Z7M E;  3HPI A;  1SYI A;  4F19 A;  1NL5 A;  3CI8 A;  1B32 A;  1NMU A;  2DWI A;  1I6A A;  3KBR A;  3FXR A;  3MUQ A;  4O3A A;  3TUS A;  3KJT A;  5KCJ B;  3KN3 A;  1QUI A;  3VVF A;  3V8X B;  4IY6 A;  1NH8 A;  2I3W A;  4QFK A;  5FHN A;  3PV0 E;  3O29 A;  1FTO A;  1MXW A;  2F34 A;  3H6V A;  1D9Y A;  4UA8 A;  5BUU A;  3PMX A;  1QUJ A;  1MM6 A;  5K2X A;  1Q1K A;  1R9Q A;  4YMB A;  3DP4 A;  5KZT A;  3BKI B;  3BBR A;  1HSL A;  4R6K A;  4ND9 A;  2DE4 A;  3LC8 A;  4H65 A;  1EZ9 A;  2RC9 A;  2ZNS A;  2RCB A;  4N13 A;  3PPN A;  5KDT B;  1O63 A;  3H6W A;  1B5I A;  1URD A;  4MBP A;  1B1X A;  3E3K A;  3DLN A;  1OVT A;  3FXU A;  1HSE A;  2PMS A;  5CC2 A;  4ZED A;  3H06 B;  3RN8 A;  2P1S A;  2I0C A;  3KFM A;  4HCW A;  4RJZ A;  3T9H B;  1B3L A;  3LUY A;  3EHT A;  3QIM A;  3SEU A;  2QRY A;  5I2K A;  4R2F A;  3O6H A;  4XKR A;  2NXO A;  1B0L A;  4X1D A;  2IEE A;  5L8D A;  4EXK A;  2REG A;  3O66 A;  5L9S A;  2O7U A;  2ZXT A;  2Q8J A;  5JEI A;  1IXG A;  3IL1 B;  4KCC A;  3R7X A;  1PB8 A;  5H8H A;  1Y4C A;  2I6E A;  4EUO A;  3IAZ A;  2V3T A;  3SER A;  2B65 A;  3AXF A;  4YB5 A;  3N5L A;  4ELR A;  3VLV A;  1J1N A;  2FNC A;  2HEU A;  1IIT A;  3QSL A;  1FTM A;  3G3I A;  2V93 A;  3L6H A;  2VHA A;  4G8M A;  1SW5 A;  3K2D A;  3TTM A;  2UYF A;  1L5T A;  1ZMG A;  3ZKL A;  3ILU B;  2HAU A;  3MPK A;  4F3P A;  2DQV A;  2DVZ A;  4BDQ A;  4KFQ A;  4X1B A;  3VFJ A;  5JK4 A;  4N07 A;  3M8U A;  5H8F A;  3A3U A;  4XKN A;  1LBB A;  2X7P A;  1P99 A;  3K1M A;  4Z7E A;  2OWS A;  3U1O A;  3V5A A;  1MRP A;  4DXU A;  5IKB A;  2OZZ A;  2PYY A;  1YPN A;  3RUM A;  3FJM A;  4IO2 A;  3O9P A;  1VR5 A;  4KPT A;  1EH3 A;  1M5D A;  3MVW A;  4LA9 A;  3VXB A;  5F1Q A;  1XS5 A;  3CSG A;  3PUV E;  4ELP A;  1LLS A;  3EHS A;  3SES A;  2O6A A;  5FTH A;  1MDP 1;  4P0I A;  4NWC A;  1JVY A;  1N3W A;  3E9X A;  3H4Z A;  5F7V A;  3MJN A;  4C1T A;  3TTN A;  4OER A;  3VV5 A;  3MVX A;  4U1O A;  1ZTY A;  3CFL A;  3TTR A;  3K6U A;  4OET A;  3PGF A;  1UIU A;  2IA4 A;  2B3B A;  2KLF A;  1DPE A;  2O69 A;  3EHU A;  3KJ7 A;  3Q28 A;  4YKK A;  4R73 A;  1OQH A;  4KYD A;  4R72 A;  4LVQ A;  3A3C A;  1US5 A;  1JNF A;  4JXI A;  2NUV A;  4LP2 B;  1USY E;  4THI A;  2R6G E;  1MDQ A;  1NNP A;  3KGC A;  4BDM A;  1Y20 A;  3C4M A;  1S9T A;  2XXP A;  1GV8 A;  3TTK A;  2V3U A;  1B46 A;  1H44 A;  2LAO A;  3G3F A;  3KEI A;  3UA8 A;  1P1Q A;  2D21 A;  4U22 A;  4E0X A;  1FQF A;  3TPA A;  1NNF A;  3U94 A;  3WAF A;  4U4S A;  4YKI A;  1P1O A;  2F35 A;  3PD9 A;  5ISU A;  4Q5T A;  1IIW A;  3H6U A;  1H43 A;  2HAV A;  3PUW E;  1A40 A;  2ZNU A;  2VD3 A;  4LON B;  1A8E A;  2V25 A;  1MY2 A;  4OFO A;  4PP0 A;  4Q30 B;  4ZZA A;  3USD A;  3PPO A;  4RA1 A;  4DXB A;  2PT1 A;  1B3E A;  5DVJ A;  2I0B A;  4ZEB A;  1H3D A;  1MH4 A;  2P2A A;  3OEN A;  1VSO A;  4ZEC A;  2FYI A;  1M5B A;  5JTY A;  1OVB A;  2HFB A;  2Q89 A;  3CRB A;  4JB7 A;  4GXA A;  4XXU A;  4YZZ A;  3SEW A;  3ZKK A;  2THI A;  5I84 A;  1D4N A;  2GRV A;  1R9L A;  1SI1 A;  3IOW A;  3PMV A;  4ISU A;  4PFT A;  5I2K B;  5K2Y A;  4G8H A;  3MP1 A;  1BKA A;  4EQ7 A;  1O64 A;  3I3V A;  4OYV A;  3TYH A;  1XHY A;  1B4Z A;  1B52 A;  2F7C A;  4YKJ A;  1RYO A;  3V83 A;  4GIZ A;  2DXR A;  5AA2 B;  2AIX A;  2F6G A;  2I4B A;  1QUL A;  3CIJ A;  4QSD A;  1EZP A;  1N0T A;  3ECR A;  2VOZ A;  3TDJ A;  5I59 B;  1DOT A;  2M8C A;  2PT2 A;  3EPE A;  3KSX A;  4IO6 A;  4R74 A;  1MXZ A;  2ONK E;  5I2N A;  4F1V A;  5I57 A;  1IQ7 A;  2XX8 A;  3BFU A;  2REJ A;  4H67 A;  4OEN A;  4RYA A;  1DPP A;  3U93 A;  2Q9T A;  3N94 A;  3GBB A;  1N04 A;  2XXY A;  2ABH A;  2B3F A;  4NE4 A;  4EQB A;  1OMP A;  5LOM A;  2NOO A;  3MW0 A;  5TP9 B;  4NMY A;  1FW0 A;  3S9L C;  1WVJ A;  3DEL B;  3M3L A;  1D9V A;  4KCD A;  4JWX A;  2ONR A;  4EF1 A;  3BFT A;  5CBR A;  1A54 A;  3JZJ A;  3C9H A;  4I8C A;  3FUZ A;  4F3S A;  4Q0C A;  5I56 A;  3OD7 A;  4PFY A;  3O2A A;  3RTW B;  4F39 A;  4L17 A;  3LSF B;  4BDR A;  4YB7 A;  4PE5 B;  4K3F A;  3EN3 A;  4DE8 A;  1PC3 A;  2ALU A;  3ODB A;  4R2B A;  3FAT A;  1IXH A;  1RKM A;  1LGB C;  3KOT A;  3TZA A;  3LSW A;  5L9O A;  4GFR A;  5I59 A;  4TOZ A;  3LSX A;  3PUZ E;  1B7H A;  1AIV A;  3MC2 A;  4HTG A;  3RY3 A;  1B3F A;  2O1L A;  5A5X A;  1MY0 A;  3B6W A;  3Q27 A;  5B7D A;  1KWH A;  2XXV A;  2Y7I A;  2G29 A;  2V3Q A;  2AL5 A;  2VGQ A;  5L9M A;  3T22 A;  2XXQ A;  1POT A;  1B5J A;  1Y4T A;  4G8N A;  4OFL A;  4ZS9 A;  1FQC A;  4JSD A;  1NNT A;  2QJE A;  3UIF A;  3QUJ A;  2G93 A;  2Q2C A;  4YB6 A;  1OQG A;  3O6I A;  2ESN A;  2OBG A;  1QKB A;  4NF6 A;  2I58 A;  4OQO A;  3HCQ A;  3MZB A;  3IO4 A;  2DE3 A;  3GXA A;  1MM7 A;  2E1S A;  2ZMB A;  1XVY A;  1BLF A;  2AYS A;  3IR1 A;  3TCG A;  2DE2 A;  4BDN A;  3HHG A;  3OOA A;  2DYX A;  1ZU0 A;  2F97 A;  3W9W A;  4I1D A;  1FTJ A;  4DDD A;  1LB8 A;  3TCF A;  2H5Y A;  5DVI A;  5AE4 A;  2ANJ A;  1GR2 A;  1TWY A;  2F8D A;  1SQY A;  2Y7R A;  3VE1 B;  2ZYM A;  2QS2 A;  5TU0 A;  3FVG A;  4R9G A;  4IO4 A;  3G7W A;  3F11 A;  2ZYO A;  3TMG A;  5BWJ A;  4BLA A;  5DT6 A;  1B40 A;  2HQ0 A;  4I9D A;  5DEX B;  4MF3 A;  3FJG A;  3T9U A;  3TQW A;  1MXX A;  1UTB B;  2CMO A;  1NH7 A;  2BJJ X;  2XD3 A;  4U23 A;  3OEM A;  1A8F A;  3C36 A;  4H8J A;  1MQJ A;  3PMW A;  3G3G A;  4C1U A;  4F18 A;  3O6G A;  1TFD A;  2VD2 A;  1SW2 A;  1ZLQ A;  3OMB A;  4NF4 B;  4OVJ A;  5FHM A;  2O68 A;  1SDX A;  3W15 C;  1P1N A;  2QS1 A;  3LSL A;  2ZYK A;  3U8Q A;  1I6Q A;  2QS4 A;  3K01 A;  1QVS A;  1QKA A;  1LCF A;  3MP8 A;  2DWH A;  1MH3 A;  3MPL A;  5EYF A;  3FVO A;  1YAE A;  3I5O A;  2QMW A;  3MP6 A;  3M3K A;  2RC7 A;  2Y7W A;  4MLQ A;  4FED A;  1LAH E;  2F78 A;  4R6Y A;  2GHA A;  2H9B A;  4ECF A;  1UIV A;  3OO9 A;  3QYT A;  3ZSF A;  3KG2 A;  3FV2 A;  1B3H A;  1I69 A;  4IGR A;  4NF6 B;  4NF8 B;  2D3I A;  4QSE A;  3TKD A;  3VVD A;  5ICT A;  1MY4 A;  4RK9 A;  4PQJ A;  4F22 A;  4R9F A;  3E4R A;  3C35 A;  1R6Z A;  2YJP A;  2RCA A;  1CB6 A;  4DLD A;  1Y3Q A;  2GFE A;  4YAH X;  4G4P A;  4ONY A;  4G2Z A;  4Q8R A;  2UVJ A;  5HM4 B;  2A5S A;  3IB1 A;  2HXW A;  1GGG A;  4IO7 A;  3DM0 A;  4OTE A;  5I58 B;  1MPB A;  5ELV A;  3S9M C;  4HCY A;  4YKP A;  1UTH A;  1UTB A;  4FEB A;  5FHO A;  2O7I A;  1QW0 A;  4HW8 A;  2Z8E A;  1VE4 A;  4QF9 A;  1LCT A;  4PFW A;  5FTI A;  2R9J A;  1A7L A;  4GL8 A;  4O3C A;  3H3G A;  1LAG E;  1B58 A;  4NF8 A;  1CE2 A;  4FOR A;  3T93 B;  5CI5 A;  2Z23 A;  3N6U A;  3CVG A;  3C33 A;  2XHD A;  4XIG Q;  1ZBM A;  1B9J A;  4H6D A;  1SW1 A;  2XXR A;  4F1Y A;  4KYS A;  1Y3P A;  2CZL A;  2OJT A;  1LFI A;  3MQ9 A;  4OMB A;  4OXV A;  1URS A;  3SEY A;  3S9E A;  2F7A A;  4YIC A;  1MS7 A;  3ONM A;  1JET A;  2Y84 A;  2H25 A;  3Q29 A;  3K1P A;  4U4X A;  4LQ2 A;  3UGW A;  1PB7 A;  1IZ1 A;  4H5F A;  4RPN A;  4GF8 A;  1POY 1;  4P11 A;  4TQU Q;  4F3G A;  1T0K A;  1NKX A;  2GH9 A;  3OO6 A;  3JV9 A;  4F29 A;  3IJO B;  4I62 A;  4U21 A;  4GWO A;  5H8H B;  4E0W A;  3IJX B;  3O28 A;  4RY1 A;  1N7W A;  4DXC A;  1MY1 A;  4TLL B;  1MG1 A;  4AQ4 A;  1AH5 A;  3CR9 A;  1A55 A;  2WKY A;  3RPW A;  1BTJ A;  2XX7 A;  1AMF A;  1TFA A;  4GL0 A;  4U1Z A;  1XT8 A;  3T9V A;  2ZNT A;  3TCH A;  4ESW A;  1WOD A;  5H8N B;  2ZYN A;  3DP8 A;  4MLV A;  1GTK A;  1A99 A;  3Q26 A;  1MQG A;  1USY H;  2F5X A;  2AL4 A;  2O51 A;  2XXU A;  2YPN A;  4P0G A;  1MQD A;  5M2V A;  5CMK A;  3FAS A;  2UYE A;  1Y1M A;  4KHZ E;  4R6H A;  4QFN A;  3S2V A;  3MBP A;  5KCJ A;  2PVU A;  3QK6 A;  3VDF A;  1B7U A;  4U2R A;  3SEV A;  3SDF A;  3C34 A;  3OSQ A;  1OLA A;  2X7Q A;  4YU0 A;  2X26 A;  1II5 A;  2GHB A;  3R26 A;  1FQA A;  4LQ5 A;  3KSJ A;  4NF5 A;  5CMM A;  4ZDM A;  2XXW A;  2ONS A;  1N76 A;  1SBP A;  1PBQ A;  4GXS B;  4H1X A;  3RGY A;  4IO3 A;  2UVH A;  4YMA A; 
#chains in the Genus database with same CATH topology
 3FXQ A;  1JW4 A;  2XWV A;  2DWJ A;  4ZE8 A;  1FQB A;  3W9V A;  2CZH A;  3OEL A;  3MWB A;  1QJM A;  2CEY A;  4NWD A;  3GZG A;  2DS9 A;  1B6H A;  4G77 A;  1N84 A;  2QL3 A;  2D5W A;  3OEK A;  5HPQ A;  1QUK A;  3CG1 A;  4ZZE A;  3IOR A;  1BK4 A;  3EQ1 A;  1ZJL A;  4LAT A;  2QVU A;  3K6V A;  1XC1 A;  1XOC A;  1I6B A;  4KR5 A;  2NWJ A;  2XD2 A;  3D4G A;  3IFC A;  4NTL A;  4HE0 A;  1PDA A;  2FVZ A;  1B51 A;  3UP9 A;  3VLU A;  3E78 A;  2UVG A;  3L6G A;  4OHN A;  2VP1 A;  1G0I A;  2O1M A;  4R75 A;  3RQT A;  1FTK A;  3B6Q A;  3T9X B;  3IB2 A;  4HE2 A;  1IXC A;  4P9K A;  1B0H A;  4WKM A;  3P7I A;  5HBC A;  5ICQ A;  4RK2 A;  3K6W A;  3RT8 A;  1Y9U A;  3TAJ A;  3IOT A;  4N4U A;  1ZIU A;  2UXA A;  5AA4 B;  5J1D A;  3VXC A;  3HO7 A;  5ITO A;  4ELQ A;  1IXI A;  1YTV A;  3H03 A;  2WBB A;  3HV1 A;  3IX1 A;  5ITP A;  1NFT A;  3KN8 A;  1B05 A;  1B4H A;  2O84 X;  5CM6 A;  3WAE A;  4F2Q A;  4GWU A;  3MST A;  1DTG A;  2XWK A;  3RPL A;  2VT5 A;  3T66 A;  4I40 A;  2BJI A;  2V84 A;  5DYH A;  3PPP A;  5I57 B;  2XXX A;  4UAC A;  5CMC A;  1LB9 A;  4AB6 A;  1D3K A;  2F3B A;  3K02 A;  4MNP A;  1R1N A;  4FJP A;  1FBF A;  4PAI A;  1NUY A;  4TLM B;  1AOV A;  2Y7P A;  3DP6 A;  2WX9 A;  2XX9 A;  2V4C A;  1N3X A;  4FE8 A;  1DMB A;  3A09 A;  4F3B A;  3C31 A;  4O7I A;  3G3J A;  3HPI A;  1NL5 A;  3FXR A;  5ESY A;  2R8T A;  5KCJ B;  3KN3 A;  4IY6 A;  1NH8 A;  4QFK A;  3O29 A;  1MXW A;  1D9Y A;  4UA8 A;  4PAF A;  4G61 A;  4H65 A;  1O63 A;  1B5I A;  4HE1 A;  1OVT A;  1HSE A;  4ZED A;  3H06 B;  3RN8 A;  3IFA A;  2L5V A;  1B3L A;  4O94 A;  3LUY A;  1FPK A;  3EHT A;  5L8D A;  1B0L A;  3O66 A;  5JEI A;  1IXG A;  4KCC A;  2CZI A;  3IAZ A;  3SER A;  4YB5 A;  4ELR A;  3QSL A;  2V93 A;  4G8M A;  2UYF A;  1ZMG A;  4GWX A;  4BDQ A;  2X7P A;  3U1O A;  3RUM A;  4IO2 A;  3O9P A;  1VR5 A;  1EH3 A;  4LA9 A;  1XS5 A;  3PUV E;  3PTY A;  1MDP 1;  4P0I A;  3E9X A;  3MVX A;  4U1O A;  1ZTY A;  2O69 A;  4KYD A;  1US5 A;  1USY E;  3C4M A;  1S9T A;  5I3S A;  1B46 A;  3UA8 A;  2D21 A;  4E0X A;  4U4S A;  2HAV A;  4Q30 B;  3USD A;  2I0B A;  4ZEB A;  2P2A A;  2FYI A;  3SEW A;  4YZZ A;  4GXA A;  4XXU A;  4G8H A;  4GIZ A;  2DXR A;  3U65 A;  2AIX A;  4NN3 A;  2F6G A;  1N0T A;  5I59 B;  2PT2 A;  3EPE A;  1MXZ A;  2ONK E;  3N94 A;  4I3Y A;  4N6K A;  2B3F A;  5TP9 B;  3S9L C;  1IMC A;  4GX3 A;  3KC0 A;  5I56 A;  4YB7 A;  1LBV A;  3EN3 A;  1PC3 A;  3ODB A;  5L9O A;  1RKM A;  4P1L A;  3LSW A;  4GFR A;  1B7H A;  1FQC A;  3O6I A;  2OBG A;  3HCQ A;  1MM7 A;  4BDN A;  3W9W A;  2ANJ A;  1YYZ A;  2ZYM A;  3F11 A;  2ZYO A;  3TMG A;  2XD3 A;  1A8F A;  3C36 A;  3G3G A;  1FRP A;  1SW2 A;  1SDX A;  2QS1 A;  3LSL A;  2DWH A;  5IGA A;  2RC7 A;  3A29 A;  2H9B A;  4ECF A;  3VVD A;  2PCR A;  4PBH A;  3C35 A;  2YJP A;  4G4P A;  4ONY A;  4I3E A;  5HM4 B;  3IB1 A;  1GGG A;  3S9M C;  4HCY A;  4FEB A;  1QW0 A;  3HFU A;  4QF9 A;  4PFW A;  2R9J A;  4GL8 A;  1LAG E;  4FOR A;  5CI5 A;  2Z23 A;  3C33 A;  2XHD A;  2Y5L A;  1ZBM A;  4H6D A;  4F1Y A;  4OMB A;  5DW8 A;  3S9E A;  1URS A;  2F7A A;  1JET A;  1NUW A;  2Y84 A;  1FPD A;  1FBP A;  4RPN A;  4GF8 A;  1POY 1;  4IR8 A;  3JV9 A;  3O28 A;  1N7W A;  4TLL B;  1A55 A;  2XX7 A;  3KC1 A;  4U1Z A;  1XT8 A;  3TCH A;  1NUZ A;  2DDK A;  4ESW A;  4KHZ E;  3MBP A;  1FSA A;  1OLA A;  2X26 A;  2XXW A;  5ET8 A;  1PBQ A;  2UVH A;  3FVN A;  4ZEK A;  3NOH A;  1P1W A;  4AB5 A;  3HHF A;  3KN7 A;  2Z8D A;  1LBC A;  3FVK A;  1F9B A;  5EHM A;  4WED A;  4GVO A;  2RF1 A;  4F31 B;  3TEP A;  3PUY E;  2WBD A;  4LUB A;  1NUX A;  1AL3 A;  1S50 A;  5AA1 A;  3UK4 A;  1MQH A;  4GOT A;  1AWB A;  1EYI A;  3IOV A;  4HS7 A;  2Y7K A;  3E13 X;  5TP9 A;  4FAJ A;  5I5P A;  4PE3 A;  5EHS A;  4QSC A;  4KD5 A;  3PU5 A;  2NVU B;  2W7Y A;  3GLB A;  3O97 A;  4X8R A;  1LFG A;  4KI0 E;  1DTZ A;  1JW5 A;  2DSF A;  3N26 A;  4N6P A;  4ESX A;  5JTY B;  1FBH A;  2DWA A;  5LDZ A;  3TOD A;  1FTA A;  3MAM A;  4MFI A;  4LZ5 A;  5DEX A;  5I58 A;  4GD5 A;  1D9Q A;  1MQI A;  1B1H A;  3K00 A;  2Z8F A;  4MEV A;  5IM2 A;  4H0W A;  4F1U A;  1DCU A;  3D4C A;  2P0S A;  1N7X A;  2F36 A;  4IO5 A;  2HZL A;  1EU8 A;  1JEV A;  3FGS A;  3TFL A;  2I48 A;  1YXI A;  2RIN A;  1GVC A;  4DI4 B;  4PDH A;  1SVX B;  3GBA A;  2B4L A;  4G68 C;  2F7B A;  3FV1 A;  5IAI A;  5A5X B;  4G68 B;  3VLW A;  2Q2A A;  3ROJ A;  2E0S A;  3JYR A;  4MCO A;  3S9N C;  2P3V A;  3EF7 A;  3G3H A;  5AA2 A;  1YZ0 A;  4ELO A;  1FPL A;  5IZ3 A;  4M4G A;  1LBZ A;  2QS3 A;  4X9T A;  2OWT A;  2DOJ A;  4LZ8 A;  2OWZ A;  4DIG A;  3RT6 B;  2OLB A;  1M5E A;  3B6T A;  1SW4 A;  4KYE A;  1SD3 A;  2RKM A;  1NV3 A;  1DK4 A;  1NNK A;  1NV5 A;  4FIM A;  2I4C A;  2R71 A;  1SYI A;  4F19 A;  3MUQ A;  3KJT A;  3B50 A;  3H6V A;  3PMX A;  2ZZW A;  4P3L A;  5K2X A;  1Q1K A;  4YMB A;  2DE4 A;  2RC9 A;  1B1X A;  4GBW A;  3FXU A;  2I0C A;  3KFM A;  2O7U A;  3IL1 B;  2I6E A;  4EUO A;  2V3T A;  2B65 A;  1J1N A;  5IZ3 B;  2VHA A;  3K2D A;  3ZKL A;  2HAU A;  4F3P A;  5JK4 A;  4X1B A;  5H8F A;  3A3U A;  4XEQ A;  2OWS A;  3V5A A;  1LEV A;  4NAP A;  2PYY A;  1YPN A;  4PF8 A;  1M5D A;  3MVW A;  2ZZV A;  3VXB A;  5F1Q A;  4ELP A;  5FTH A;  4NWC A;  4C1T A;  3MJN A;  3LV0 A;  1UIU A;  4YKK A;  1DPE A;  4R72 A;  4LVQ A;  1JNF A;  4JXI A;  2NUV A;  4LP2 B;  2R6G E;  1NNP A;  2QVV A;  1H44 A;  1IMA A;  3WAF A;  4YKI A;  3ISP A;  2F35 A;  3PD9 A;  4NQ8 A;  4Q5T A;  1A40 A;  4ZZA A;  4RA1 A;  4PTK A;  5DVJ A;  4ZEC A;  1M5B A;  5JTY A;  2HFB A;  3EKI A;  3CRB A;  2THI A;  2GRV A;  1R9L A;  3PMV A;  4ISU A;  3MP1 A;  1BKA A;  4EQ7 A;  3I3V A;  4OYV A;  3V83 A;  1XHY A;  1B52 A;  2F7C A;  4YKJ A;  1DOT A;  5I2N A;  4F1V A;  5I57 A;  2XX8 A;  3BFU A;  2Q9T A;  1INP A;  4NE4 A;  4EQB A;  1OMP A;  4NMY A;  3E79 A;  1FW0 A;  3DEL B;  4JWX A;  4AS4 A;  4EF1 A;  4NGU A;  5CBR A;  4MX6 A;  4I8C A;  4F3S A;  3FUZ A;  2QVR A;  4F39 A;  4L17 A;  3LSF B;  2ALU A;  3FAT A;  1EYJ A;  1LGB C;  5I59 A;  3LSX A;  3PUZ E;  3MC2 A;  2GQ1 A;  3RY3 A;  1B3F A;  2O1L A;  1MY0 A;  4OVQ A;  2XXV A;  2Y7I A;  5L9M A;  2XXQ A;  1POT A;  4G8N A;  4OFL A;  4JSD A;  2QJE A;  4O8M A;  1NV6 A;  4NF6 A;  4HXV A;  2DE3 A;  3GXA A;  1XVY A;  3IR1 A;  2F97 A;  4I1D A;  1RDZ A;  1FTJ A;  1LB8 A;  2FHY A;  3TCF A;  2H5Y A;  5DVI A;  1SQY A;  2Y7R A;  3VE1 B;  3FVG A;  4R9G A;  4IO4 A;  1JP4 A;  1IMB A;  5BWJ A;  4BLA A;  5A5L A;  3T9U A;  5J16 A;  1MQJ A;  3PMW A;  4C1U A;  2KR0 A;  1ZLQ A;  3W15 C;  4X04 A;  1I6Q A;  5I7I A;  3K01 A;  4P8B A;  1QVS A;  1QKA A;  1LCF A;  3T0J A;  5EYF A;  3FVO A;  2VPN A;  4FED A;  2F78 A;  1UIV A;  3OO9 A;  1B3H A;  4IGR A;  4NF6 B;  3TKD A;  5ICT A;  4RK9 A;  1R6Z A;  2RCA A;  2GFE A;  4YAH X;  4G2Z A;  4IO7 A;  3DM0 A;  4OTE A;  5I58 B;  1MPB A;  1FPE A;  2FIX A;  1LCT A;  5FTI A;  1A7L A;  3H3G A;  4PGN A;  4NF8 A;  3T93 B;  3N6U A;  4OAN A;  4XIG Q;  1B9J A;  2CZL A;  4OXV A;  4YIC A;  3ONM A;  3K1P A;  3UGW A;  4H5F A;  1IZ1 A;  1T0K A;  1NKX A;  2GH9 A;  4I62 A;  4U21 A;  5H8H B;  3IJX B;  4AQ4 A;  1AH5 A;  4OA4 A;  3RPW A;  1FPG A;  4GL0 A;  4OVS A;  2ZNT A;  5H8N B;  2ZYN A;  4H45 A;  1GTK A;  1A99 A;  2YPN A;  5M2V A;  3MYU A;  3FAS A;  2UYE A;  4R6H A;  2PVU A;  1B7U A;  1FBE A;  3SDF A;  2X7Q A;  2P3N A;  1FQA A;  4LQ5 A;  4ZDM A;  1SBP A;  4GXS B;  4OVR A;  4H1X A;  4YMA A;  1UQW A;  4EQ9 A;  3IB0 A;  3Q25 A;  2Q88 A;  4GBV A;  4NED A;  4FBP A;  4DCY A;  4WXJ A;  1BP5 A;  4QRZ A;  4M1V A;  3FZV A;  4OES A;  5CRY A;  4G68 A;  3D1R A;  4POW A;  3HN0 A;  3MVZ A;  4NF5 B;  4PET A;  3PPR A;  1HSJ A;  5I56 B;  3KBZ A;  4IGT A;  4WEP A;  3I6V A;  5ET5 A;  1SI0 A;  4JWY A;  3R6U A;  1PB9 A;  2DVC A;  1M5C A;  5TPA A;  1VFD A;  2HHM A;  4IB2 A;  4ZE9 A;  1NV0 A;  1S7Y A;  3CFX A;  5H8S A;  2F6P A;  1LAF E;  3H7M A;  3RTF B;  2OCU A;  3KOS A;  3QUF A;  3THI A;  4QBA A;  4QFO A;  1Q35 A;  3FIR A;  3CFZ A;  2CZK A;  1K9Z A;  1MXY A;  3U72 A;  1Q9D A;  2HXR A;  2RC8 A;  4O3B A;  4EDP A;  5AA3 A;  1Z7N E;  3QXM A;  1UTH B;  4DZ1 A;  1FBG A;  3ZS6 A;  3OSR A;  3T96 B;  4MHF A;  4PFB A;  4OFJ A;  3M3F A;  3FBP A;  4MJO A;  4GRK A;  5AA2 D;  2QPQ A;  3HST A;  1TXF A;  1VFE A;  2QSX A;  3C32 A;  3FJ7 A;  4JVI A;  5H8F B;  2XXT A;  4OWD A;  3LBS A;  1Y3N A;  3TYH A;  4JWO A;  2DXY A;  3IOU A;  1FPB A;  4GWW A;  1B3G A;  1FJ9 A;  1H76 A;  2HCA A;  3UN6 A;  4GQO A;  4EF2 A;  2HZK A;  1NV1 A;  4QFP A;  1JW1 A;  1LAX A;  1OLC A;  4DCX A;  1PEB A;  4Z0I A;  4PAK A;  4PFU A;  1ZKB A;  4OEU A;  4BDL A;  2OX3 A;  3CHG A;  2XXI A;  4H5G A;  4XTC Q;  5KDT A;  3MZ1 A;  2Z22 A;  1P1U A;  3QAX A;  5H8Q A;  1MPC A;  2A5T A;  1B7Z A;  4UAB A;  4ZEI A;  3PUX E;  2UVI A;  4NF4 A;  1MPD A;  3FXB A;  1FTL A;  4MIJ A;  3OO7 A;  4RXL A;  4QHQ A;  4XF5 A;  4X48 A;  4FAT A;  3V89 B;  1DSN A;  1IUD A;  4AS5 A;  3CI8 A;  1B32 A;  2DWI A;  3KBR A;  4O3A A;  3VVF A;  4O7M A;  1FTO A;  2F34 A;  5BUU A;  1MM6 A;  2QFL A;  1IMF A;  1R9Q A;  3BKI B;  4N8G A;  4GWY A;  4ND9 A;  3LC8 A;  1EZ9 A;  2ZNS A;  4PFI A;  4N13 A;  3PPN A;  3H6W A;  1URD A;  3DLN A;  2PMS A;  5CC2 A;  2P1S A;  1VDW A;  4RJZ A;  3T9H B;  3QIM A;  2QRY A;  4X1D A;  2IEE A;  4PDD A;  5L9S A;  2ZXT A;  3R7X A;  5H8H A;  5EYG A;  4P56 A;  3AXF A;  3N5L A;  2FNC A;  2HEU A;  1IIT A;  1FTM A;  3G3I A;  3L6H A;  3SZP A;  1QGX A;  1KA0 A;  3ILU B;  2DQV A;  4KFQ A;  3VFJ A;  4N07 A;  3M8U A;  4XKN A;  2F3D A;  4DXU A;  1MRP A;  2XXK A;  5IKB A;  2OZZ A;  3FJM A;  3RYD A;  4PFR A;  4NF0 A;  2PFZ A;  1LLS A;  2O6A A;  5F7V A;  1JVY A;  1N3W A;  3H4Z A;  1CNQ A;  3K6U A;  4OET A;  2IA4 A;  2B3B A;  3Q28 A;  3KJ7 A;  2KQZ A;  2HPG A;  3A3C A;  4GWS A;  1MDQ A;  4BDM A;  1GV8 A;  2XXP A;  3TTK A;  5IZZ A;  2V3U A;  3G3F A;  3KEI A;  1P1Q A;  1FQF A;  3TPA A;  1NNF A;  1P1O A;  2XA5 A;  3H6U A;  1H43 A;  3PUW E;  4LON B;  2VD3 A;  4OFO A;  2V25 A;  1EYK A;  3PPO A;  4N8Y A;  4N17 A;  1MH4 A;  3OEN A;  1VSO A;  4JB7 A;  3ZKK A;  4P1E A;  1D4N A;  3IOW A;  1LBX A;  1RYO A;  1QUL A;  3CIJ A;  1EZP A;  5LTC A;  3ECR A;  2VOZ A;  3KSX A;  4R74 A;  4H67 A;  2REJ A;  3MW0 A;  1WVJ A;  3M3L A;  1D9V A;  4KCD A;  2ONR A;  2XWO A;  3O2A A;  4NG7 A;  3RTW B;  4BDR A;  1LBW A;  4R2B A;  5IZ1 A;  4HTG A;  2WYP A;  5A5X A;  3B6W A;  3Q27 A;  1KWH A;  3LUZ A;  5FBP A;  2Q8M A;  1NNT A;  3QUJ A;  2G93 A;  2Q2C A;  2Q74 A;  1QKB A;  4OQO A;  3IO4 A;  2E1S A;  3HHG A;  3OOA A;  4DDD A;  5AE4 A;  1GR2 A;  1TWY A;  3G7W A;  5DT6 A;  1B40 A;  4MF3 A;  1UTB B;  1NH7 A;  2BJJ X;  4U23 A;  4H8J A;  1TFD A;  4NF4 B;  2CEX A;  1LBY A;  2ZYK A;  3U8Q A;  3RPL B;  4JVD A;  3MPL A;  2Y5K A;  1YAE A;  2QMW A;  3MP6 A;  4MLQ A;  1LAH E;  1FPF A;  4R6Y A;  2GHA A;  3QYT A;  3ZSF A;  3KG2 A;  1NI9 A;  1I69 A;  4PQJ A;  4F22 A;  4R9F A;  3E4R A;  2B4M A;  2HXW A;  5ELV A;  4YKP A;  1UTB A;  2O7I A;  4O3C A;  1B58 A;  4KXP A;  4KYS A;  1Y3P A;  3SEY A;  2OJT A;  1LFI A;  1NV7 A;  4U4X A;  5F24 A;  4F3G A;  3OO6 A;  4GWO A;  4E0W A;  4DXC A;  3CR9 A;  2WKY A;  1AMF A;  3T9V A;  1K9Y A;  1MQG A;  2F5X A;  2AL4 A;  1MQD A;  5CMK A;  3S2V A;  1Y1M A;  4QFN A;  3C34 A;  4YU0 A;  5CMM A;  2GHB A;  3R26 A;  3KSJ A;  2ONS A;  1N76 A;  4IO3 A;  5H8N A;  4JDF A;  3RNN A;  2FA7 A;  3PD8 A;  4F2O A;  2I49 A;  3PPQ A;  1LFH A;  1BIY A;  5H8Q B;  1FPI A;  4FEC A;  1G0H A;  3N6T A;  2WEF A;  3SET A;  1PBP A;  3B7D A;  4P47 A;  1LST A;  3OO8 A;  1FCK A;  5AA4 A;  3FD3 A;  3OXN A;  1B2H A;  5CBS A;  2FBP A;  3K6X A;  4H46 A;  2H4I A;  4EXK A;  3MVY A;  3H6T A;  3QMF A;  1FQD A;  2PX1 A;  2QMX A;  1XVX A;  4LN5 A;  1WDN A;  1O7T A;  3G3K A;  4H8I A;  4RNS A;  4POX A;  5CMB A;  1Y1Z A;  1FQE A;  3TQL A;  2XXH A;  3K4U A;  4QFL A;  3UOR A;  5I2N B;  4PC9 A;  4MH5 A;  3RLF E;  4GLI A;  1ATG A;  1EZO A;  5B70 A;  2A5T B;  3KZG A;  4JBZ A;  4JSO A;  1JEU A;  1B5H A;  2H99 A;  2PBW A;  1MXU A;  4OVT A;  1ELJ A;  5EYH A;  1SYH A;  1NV4 A;  2MKZ A;  3LR1 A;  1MY3 A;  3IK6 B;  1FBD A;  5DVF A;  4XKQ A;  1URG A;  1OIB A;  3B8B A;  4PBQ A;  5TPA B;  1JVX A;  1M5F A;  2H98 A;  3K0V A;  4KQP A;  3U92 A;  1FPJ A;  2YLN A;  3TEL A;  5DTB A;  3VVE A;  3IO6 A;  4NX1 A;  3CG3 A;  1NV2 A;  4C0R A;  1MXV A;  1RYX A;  4LZ7 A;  1ANF A;  4XKP A;  4OVP A;  4GWZ A;  3SKP A;  3K1N A;  4NHB A;  1IEJ A;  1US4 A;  3SEX A;  3ILT B;  5EQ9 A;  3TTL A;  4OEV A;  3CSB A;  4BDO A;  1JQF A;  2I3V A;  4RPO A;  3MZ9 A;  1H45 A;  4IY5 A;  4MMP A;  4ZEF A;  4EXL A;  4OZ9 A;  1YCJ A;  2OK2 A;  2DP8 A;  1TT1 A;  1Z7M E;  5T3J A;  1NMU A;  1I6A A;  3TUS A;  1QUI A;  3V8X B;  2WYK A;  2I3W A;  5FHN A;  3PV0 E;  1QUJ A;  5KZT A;  3DP4 A;  3BBR A;  1HSL A;  4R6K A;  4QXD A;  2RCB A;  5KDT B;  4MBP A;  3E3K A;  4HCW A;  3SEU A;  5I2K A;  4R2F A;  3O6H A;  4XKR A;  2NXO A;  2REG A;  2Q8J A;  1PB8 A;  1Y4C A;  3VLV A;  2JJK A;  4PF6 A;  1SW5 A;  3TTM A;  1L5T A;  3MPK A;  2DVZ A;  1LBB A;  1P99 A;  3K1M A;  4Z7E A;  1KA1 A;  4KPT A;  5ET7 A;  3CSG A;  1SPI A;  3EHS A;  3SES A;  3TTN A;  4OER A;  3VV5 A;  3TTR A;  3CFL A;  3PGF A;  2KLF A;  3EHU A;  4R73 A;  1OQH A;  4MAG A;  4GX4 A;  4THI A;  3KGC A;  1Y20 A;  1IME A;  2LAO A;  4U22 A;  5ET6 A;  3U94 A;  2XWI A;  5ISU A;  1IIW A;  4GX6 A;  2ZNU A;  1A8E A;  1MY2 A;  4PP0 A;  4N15 A;  4DXB A;  2PT1 A;  1B3E A;  1H3D A;  1OVB A;  2Q89 A;  5I84 A;  5I2K B;  4PFT A;  1SI1 A;  5K2Y A;  4JVC A;  1O64 A;  3T1B A;  1B4Z A;  5AA2 B;  2I4B A;  4QSD A;  1DBZ A;  3TDJ A;  2M8C A;  4IO6 A;  1IQ7 A;  4OEN A;  4RYA A;  1DPP A;  3U93 A;  3GBB A;  1N04 A;  2XXY A;  2ABH A;  5LOM A;  2NOO A;  3BFT A;  1A54 A;  3JZJ A;  3C9H A;  4Q0C A;  3OD7 A;  4PFY A;  4PCD A;  4PE5 B;  4K3F A;  4DE8 A;  1FBC A;  3KOT A;  1IXH A;  4MNC A;  3TZA A;  4TOZ A;  1AIV A;  5B7D A;  3BIG A;  2G29 A;  2V3Q A;  1XI6 A;  2AL5 A;  2VGQ A;  3T22 A;  5EQ7 A;  1B5J A;  1Y4T A;  4ZS9 A;  3UIF A;  4YB6 A;  1OQG A;  2ESN A;  2I58 A;  4DI3 D;  3MZB A;  2ZMB A;  1BLF A;  2AYS A;  3TCG A;  2DE2 A;  2DYX A;  1ZU0 A;  4XFE A;  2FIE A;  2F8D A;  2QS2 A;  5TU0 A;  2HQ0 A;  4I9D A;  5DEX B;  3FJG A;  3TQW A;  1MXX A;  2CMO A;  3OEM A;  1FJ6 A;  4F18 A;  3O6G A;  2VD2 A;  3OMB A;  5FHM A;  4OVJ A;  2ZZX A;  2O68 A;  1P1N A;  2QS4 A;  3MP8 A;  1MH3 A;  1RDY A;  3I5O A;  5EQ8 A;  3M3K A;  2Y7W A;  2VPO A;  1KZ8 A;  4N6D A;  3FV2 A;  4NF8 B;  4QSE A;  2D3I A;  1MY4 A;  1IMD A;  3GYY A;  1CB6 A;  4DLD A;  1Y3Q A;  4Q8R A;  2UVJ A;  2A5S A;  1UTH A;  5EQA A;  4HW8 A;  5FHO A;  2Z8E A;  1VE4 A;  4PGP A;  1CE2 A;  3CVG A;  2PFY A;  1SW1 A;  2XXR A;  3MQ9 A;  1MS7 A;  3Q29 A;  2H25 A;  4LQ2 A;  1PB7 A;  4P11 A;  4TQU Q;  4F29 A;  3IJO B;  1RDX A;  4RY1 A;  1MY1 A;  1MG1 A;  1BTJ A;  3BIH A;  1TFA A;  1WOD A;  4MNI A;  3DP8 A;  4MLV A;  3Q26 A;  1USY H;  4P0G A;  2O51 A;  2XXU A;  5KCJ A;  3QK6 A;  3SEV A;  4U2R A;  3OSQ A;  1II5 A;  3S4U A;  4NF5 A;  4N91 A;  3RGY A;  4N81 A;  3VDF A; 
#chains in the Genus database with same CATH homology
 3FXQ A;  3FVN A;  5H8N A;  1JW4 A;  4JDF A;  4ZEK A;  1P1W A;  1UQW A;  3RNN A;  2DWJ A;  2FA7 A;  4AB5 A;  4EQ9 A;  3HHF A;  3PD8 A;  3KN7 A;  4F2O A;  4ZE8 A;  2I49 A;  2Z8D A;  3IB0 A;  1LBC A;  3Q25 A;  3PPQ A;  1LFH A;  1BIY A;  1FQB A;  3FVK A;  2Q88 A;  1F9B A;  4FEC A;  5H8Q B;  3W9V A;  5EHM A;  3N6T A;  3OEL A;  4NED A;  3MWB A;  3SET A;  1PBP A;  1QJM A;  3B7D A;  4WED A;  4GVO A;  2RF1 A;  4F31 B;  3TEP A;  4DCY A;  3PUY E;  4WXJ A;  4NWD A;  1BP5 A;  3GZG A;  4QRZ A;  4M1V A;  2DS9 A;  3FZV A;  4OES A;  1LST A;  1B6H A;  3OO8 A;  1FCK A;  4G77 A;  1N84 A;  4LUB A;  2QL3 A;  2D5W A;  1AL3 A;  1S50 A;  3OEK A;  5AA4 A;  5CRY A;  4G68 A;  3FD3 A;  5HPQ A;  1QUK A;  3OXN A;  1B2H A;  4POW A;  3CG1 A;  4ZZE A;  5AA1 A;  5CBS A;  3IOR A;  3HN0 A;  3EQ1 A;  3K6X A;  3MVZ A;  1ZJL A;  2H4I A;  4LAT A;  4NF5 B;  3PPR A;  1HSJ A;  4PET A;  3UK4 A;  1MQH A;  3K6V A;  1XC1 A;  4F2Q A;  5I56 B;  4IGT A;  4GOT A;  4WEP A;  1XOC A;  3I6V A;  3MVY A;  3H6T A;  1I6B A;  4KR5 A;  1FQD A;  1SI0 A;  2PX1 A;  2QMX A;  1XVX A;  2XD2 A;  3IOV A;  4JWY A;  2NWJ A;  1WDN A;  4HS7 A;  2Y7K A;  3D4G A;  1O7T A;  3E13 X;  5TP9 A;  3TQL A;  4FAJ A;  3R6U A;  3G3K A;  1PB9 A;  2DVC A;  4NTL A;  1M5C A;  1VFD A;  1PDA A;  4H8I A;  1Y1Z A;  1FQE A;  4POX A;  2XXH A;  4RNS A;  5CMB A;  5TPA A;  1B51 A;  3K4U A;  4KD5 A;  4QSC A;  5EHS A;  3PU5 A;  4QFL A;  4IB2 A;  3UP9 A;  3UOR A;  3VLU A;  4ZE9 A;  5I2N B;  2NVU B;  2W7Y A;  1S7Y A;  2UVG A;  3CFX A;  3GLB A;  2F6P A;  3L6G A;  5H8S A;  1LAF E;  4OHN A;  3O97 A;  3H7M A;  2VP1 A;  3RTF B;  2O1M A;  2OCU A;  3KOS A;  3QUF A;  1LFG A;  4KI0 E;  3THI A;  4R75 A;  4MH5 A;  1DTZ A;  1FTK A;  1JW5 A;  4QFO A;  3RLF E;  3B6Q A;  4GLI A;  3RQT A;  1Q35 A;  2DSF A;  3T9X B;  3FIR A;  3CFZ A;  3IB2 A;  3N26 A;  1ATG A;  1EZO A;  1IXC A;  1MXY A;  3U72 A;  5B70 A;  1B0H A;  2A5T B;  3KZG A;  4O3B A;  2RC8 A;  4WKM A;  4N6P A;  4JBZ A;  4JSO A;  3P7I A;  5HBC A;  4EDP A;  1Z7N E;  4ESX A;  5AA3 A;  3QXM A;  5JTY B;  1UTH B;  4DZ1 A;  4RK2 A;  5ICQ A;  3K6W A;  3RT8 A;  1Y9U A;  2DWA A;  3ZS6 A;  3TAJ A;  1JEU A;  3IOT A;  3OSR A;  1ZIU A;  1B5H A;  3T96 B;  3TOD A;  2UXA A;  2H99 A;  4OFJ A;  5AA4 B;  2PBW A;  3M3F A;  1MXU A;  3MAM A;  1ELJ A;  4MFI A;  5J1D A;  1SYH A;  4LZ5 A;  3VXC A;  5DEX A;  3HO7 A;  5I58 A;  3LR1 A;  5ITO A;  4GD5 A;  1MQI A;  1MY3 A;  4ELQ A;  3IK6 B;  1B1H A;  3K00 A;  1IXI A;  2Z8F A;  4GRK A;  1YTV A;  5DVF A;  5AA2 D;  4H0W A;  3H03 A;  3HV1 A;  3IX1 A;  2QPQ A;  3HST A;  1URG A;  1TXF A;  4XKQ A;  1NFT A;  1VFE A;  3KN8 A;  3S4U A;  4F1U A;  1B05 A;  1B4H A;  1OIB A;  2QSX A;  3C32 A;  3D4C A;  2P0S A;  3FJ7 A;  2O84 X;  5H8F B;  1N7X A;  2XXT A;  5CM6 A;  3WAE A;  2F36 A;  5TPA B;  1JVX A;  3LBS A;  1Y3N A;  4IO5 A;  1M5F A;  2H98 A;  4OWD A;  2HZL A;  1EU8 A;  1JEV A;  3FGS A;  4JWO A;  3TFL A;  3K0V A;  2I48 A;  4KQP A;  3U92 A;  5ITP A;  2DXY A;  3IOU A;  2RIN A;  1GVC A;  2YLN A;  1B3G A;  3TEL A;  1SVX B;  5DTB A;  3VVE A;  1DTG A;  3GBA A;  3IO6 A;  1H76 A;  2HCA A;  3CG3 A;  4G68 C;  4GQO A;  3T66 A;  3UN6 A;  2HZK A;  4C0R A;  4EF2 A;  1MXV A;  2F7B A;  4QFP A;  3FV1 A;  5IAI A;  1JW1 A;  1RYX A;  1LAX A;  5A5X B;  4G68 B;  1OLC A;  2V84 A;  3VLW A;  5DYH A;  4DCX A;  2Q2A A;  1PEB A;  4LZ7 A;  4Z0I A;  2E0S A;  3JYR A;  3PPP A;  2XXX A;  5I57 B;  1ANF A;  3S9N C;  4PFU A;  4UAC A;  4XKP A;  5CMC A;  1LB9 A;  1ZKB A;  4OEU A;  4BDL A;  4AB6 A;  1D3K A;  2XXI A;  4H5G A;  3K1N A;  3SKP A;  4XTC Q;  3EF7 A;  3G3H A;  3K02 A;  1IEJ A;  5AA2 A;  1US4 A;  3SEX A;  5KDT A;  3MZ1 A;  2Z22 A;  3ILT B;  1P1U A;  1R1N A;  4FJP A;  4ELO A;  3QAX A;  5H8Q A;  1MPC A;  2A5T A;  4TLM B;  3TTL A;  2Y7P A;  1AOV A;  4OEV A;  4M4G A;  2QS3 A;  3CSB A;  1B7Z A;  4X9T A;  4BDO A;  2OWT A;  1JQF A;  2DOJ A;  3DP6 A;  4LZ8 A;  2XX9 A;  4ZEI A;  3PUX E;  2I3V A;  4RPO A;  4DIG A;  1N3X A;  2UVI A;  3MZ9 A;  4NF4 A;  2OLB A;  1MPD A;  3RT6 B;  1H45 A;  4IY5 A;  4FE8 A;  4ZEF A;  1M5E A;  3B6T A;  1SW4 A;  4KYE A;  1SD3 A;  1DMB A;  2RKM A;  4OZ9 A;  4EXL A;  1FTL A;  3A09 A;  1YCJ A;  3OO7 A;  1NNK A;  4F3B A;  3C31 A;  4RXL A;  4QHQ A;  4FIM A;  2OK2 A;  3G3J A;  2DP8 A;  4X48 A;  4FAT A;  3V89 B;  1DSN A;  1TT1 A;  2I4C A;  2R71 A;  1IUD A;  1Z7M E;  3HPI A;  1SYI A;  4F19 A;  1NL5 A;  3CI8 A;  1B32 A;  1NMU A;  2DWI A;  1I6A A;  3KBR A;  3FXR A;  3MUQ A;  4O3A A;  3TUS A;  3KJT A;  5KCJ B;  3KN3 A;  1QUI A;  3VVF A;  3V8X B;  4IY6 A;  1NH8 A;  2I3W A;  4QFK A;  5FHN A;  3PV0 E;  3O29 A;  1FTO A;  1MXW A;  2F34 A;  3H6V A;  1D9Y A;  4UA8 A;  5BUU A;  3PMX A;  1QUJ A;  1MM6 A;  5K2X A;  1Q1K A;  1R9Q A;  4YMB A;  3DP4 A;  5KZT A;  3BKI B;  3BBR A;  1HSL A;  4R6K A;  4ND9 A;  2DE4 A;  3LC8 A;  4H65 A;  1EZ9 A;  2RC9 A;  2ZNS A;  2RCB A;  4N13 A;  3PPN A;  5KDT B;  1O63 A;  3H6W A;  1B5I A;  1URD A;  4MBP A;  1B1X A;  3E3K A;  3DLN A;  1OVT A;  3FXU A;  1HSE A;  2PMS A;  5CC2 A;  4ZED A;  3H06 B;  3RN8 A;  2P1S A;  2I0C A;  3KFM A;  4HCW A;  4RJZ A;  3T9H B;  1B3L A;  3LUY A;  3EHT A;  3QIM A;  3SEU A;  2QRY A;  5I2K A;  4R2F A;  3O6H A;  4XKR A;  2NXO A;  1B0L A;  4X1D A;  2IEE A;  5L8D A;  4EXK A;  2REG A;  3O66 A;  5L9S A;  2O7U A;  2ZXT A;  2Q8J A;  5JEI A;  1IXG A;  3IL1 B;  4KCC A;  3R7X A;  1PB8 A;  5H8H A;  1Y4C A;  2I6E A;  4EUO A;  3IAZ A;  2V3T A;  3SER A;  2B65 A;  3AXF A;  4YB5 A;  3N5L A;  4ELR A;  3VLV A;  1J1N A;  2FNC A;  2HEU A;  1IIT A;  3QSL A;  1FTM A;  3G3I A;  2V93 A;  3L6H A;  2VHA A;  4G8M A;  1SW5 A;  3K2D A;  3TTM A;  2UYF A;  1L5T A;  1ZMG A;  3ZKL A;  3ILU B;  2HAU A;  3MPK A;  4F3P A;  2DQV A;  2DVZ A;  4BDQ A;  4KFQ A;  4X1B A;  3VFJ A;  5JK4 A;  4N07 A;  3M8U A;  5H8F A;  3A3U A;  4XKN A;  1LBB A;  2X7P A;  1P99 A;  3K1M A;  4Z7E A;  2OWS A;  3U1O A;  3V5A A;  1MRP A;  4DXU A;  5IKB A;  2OZZ A;  2PYY A;  1YPN A;  3RUM A;  3FJM A;  4IO2 A;  3O9P A;  1VR5 A;  4KPT A;  1EH3 A;  1M5D A;  3MVW A;  4LA9 A;  3VXB A;  5F1Q A;  1XS5 A;  3CSG A;  3PUV E;  4ELP A;  1LLS A;  3EHS A;  3SES A;  2O6A A;  5FTH A;  1MDP 1;  4P0I A;  4NWC A;  1JVY A;  1N3W A;  3E9X A;  3H4Z A;  5F7V A;  3MJN A;  4C1T A;  3TTN A;  4OER A;  3VV5 A;  3MVX A;  4U1O A;  1ZTY A;  3CFL A;  3TTR A;  3K6U A;  4OET A;  3PGF A;  1UIU A;  2IA4 A;  2B3B A;  2KLF A;  1DPE A;  2O69 A;  3EHU A;  3KJ7 A;  3Q28 A;  4YKK A;  4R73 A;  1OQH A;  4KYD A;  4R72 A;  4LVQ A;  3A3C A;  1US5 A;  1JNF A;  4JXI A;  2NUV A;  4LP2 B;  1USY E;  4THI A;  2R6G E;  1MDQ A;  1NNP A;  3KGC A;  4BDM A;  1Y20 A;  3C4M A;  1S9T A;  2XXP A;  1GV8 A;  3TTK A;  2V3U A;  1B46 A;  1H44 A;  2LAO A;  3G3F A;  3KEI A;  3UA8 A;  1P1Q A;  2D21 A;  4U22 A;  4E0X A;  1FQF A;  3TPA A;  1NNF A;  3U94 A;  3WAF A;  4U4S A;  4YKI A;  1P1O A;  2F35 A;  3PD9 A;  5ISU A;  4Q5T A;  1IIW A;  3H6U A;  1H43 A;  2HAV A;  3PUW E;  1A40 A;  2ZNU A;  2VD3 A;  4LON B;  1A8E A;  2V25 A;  1MY2 A;  4OFO A;  4PP0 A;  4Q30 B;  4ZZA A;  3USD A;  3PPO A;  4RA1 A;  4DXB A;  2PT1 A;  1B3E A;  5DVJ A;  2I0B A;  4ZEB A;  1H3D A;  1MH4 A;  2P2A A;  3OEN A;  1VSO A;  4ZEC A;  2FYI A;  1M5B A;  5JTY A;  1OVB A;  2HFB A;  2Q89 A;  3CRB A;  4JB7 A;  4GXA A;  4XXU A;  4YZZ A;  3SEW A;  3ZKK A;  2THI A;  5I84 A;  1D4N A;  2GRV A;  1R9L A;  1SI1 A;  3IOW A;  3PMV A;  4ISU A;  4PFT A;  5I2K B;  5K2Y A;  4G8H A;  3MP1 A;  1BKA A;  4EQ7 A;  1O64 A;  3I3V A;  4OYV A;  3TYH A;  1XHY A;  1B4Z A;  1B52 A;  2F7C A;  4YKJ A;  1RYO A;  3V83 A;  4GIZ A;  2DXR A;  5AA2 B;  2AIX A;  2F6G A;  2I4B A;  1QUL A;  3CIJ A;  4QSD A;  1EZP A;  1N0T A;  3ECR A;  2VOZ A;  3TDJ A;  5I59 B;  1DOT A;  2M8C A;  2PT2 A;  3EPE A;  3KSX A;  4IO6 A;  4R74 A;  1MXZ A;  2ONK E;  5I2N A;  4F1V A;  5I57 A;  1IQ7 A;  2XX8 A;  3BFU A;  2REJ A;  4H67 A;  4OEN A;  4RYA A;  1DPP A;  3U93 A;  2Q9T A;  3N94 A;  3GBB A;  1N04 A;  2XXY A;  2ABH A;  2B3F A;  4NE4 A;  4EQB A;  1OMP A;  5LOM A;  2NOO A;  3MW0 A;  5TP9 B;  4NMY A;  1FW0 A;  3S9L C;  1WVJ A;  3DEL B;  3M3L A;  1D9V A;  4KCD A;  4JWX A;  2ONR A;  4EF1 A;  3BFT A;  5CBR A;  1A54 A;  3JZJ A;  3C9H A;  4I8C A;  3FUZ A;  4F3S A;  4Q0C A;  5I56 A;  3OD7 A;  4PFY A;  3O2A A;  3RTW B;  4F39 A;  4L17 A;  3LSF B;  4BDR A;  4YB7 A;  4PE5 B;  4K3F A;  3EN3 A;  4DE8 A;  1PC3 A;  2ALU A;  3ODB A;  4R2B A;  3FAT A;  1IXH A;  1RKM A;  1LGB C;  3KOT A;  3TZA A;  3LSW A;  5L9O A;  4GFR A;  5I59 A;  4TOZ A;  3LSX A;  3PUZ E;  1B7H A;  1AIV A;  3MC2 A;  4HTG A;  3RY3 A;  1B3F A;  2O1L A;  5A5X A;  1MY0 A;  3B6W A;  3Q27 A;  5B7D A;  1KWH A;  2XXV A;  2Y7I A;  2G29 A;  2V3Q A;  2AL5 A;  2VGQ A;  5L9M A;  3T22 A;  2XXQ A;  1POT A;  1B5J A;  1Y4T A;  4G8N A;  4OFL A;  4ZS9 A;  1FQC A;  4JSD A;  1NNT A;  2QJE A;  3UIF A;  3QUJ A;  2G93 A;  2Q2C A;  4YB6 A;  1OQG A;  3O6I A;  2ESN A;  2OBG A;  1QKB A;  4NF6 A;  2I58 A;  4OQO A;  3HCQ A;  3MZB A;  3IO4 A;  2DE3 A;  3GXA A;  1MM7 A;  2E1S A;  2ZMB A;  1XVY A;  1BLF A;  2AYS A;  3IR1 A;  3TCG A;  2DE2 A;  4BDN A;  3HHG A;  3OOA A;  2DYX A;  1ZU0 A;  2F97 A;  3W9W A;  4I1D A;  1FTJ A;  4DDD A;  1LB8 A;  3TCF A;  2H5Y A;  5DVI A;  5AE4 A;  2ANJ A;  1GR2 A;  1TWY A;  2F8D A;  1SQY A;  2Y7R A;  3VE1 B;  2ZYM A;  2QS2 A;  5TU0 A;  3FVG A;  4R9G A;  4IO4 A;  3G7W A;  3F11 A;  2ZYO A;  3TMG A;  5BWJ A;  4BLA A;  5DT6 A;  1B40 A;  2HQ0 A;  4I9D A;  5DEX B;  4MF3 A;  3FJG A;  3T9U A;  3TQW A;  1MXX A;  1UTB B;  2CMO A;  1NH7 A;  2BJJ X;  2XD3 A;  4U23 A;  3OEM A;  1A8F A;  3C36 A;  4H8J A;  1MQJ A;  3PMW A;  3G3G A;  4C1U A;  4F18 A;  3O6G A;  1TFD A;  2VD2 A;  1SW2 A;  1ZLQ A;  3OMB A;  4NF4 B;  4OVJ A;  5FHM A;  2O68 A;  1SDX A;  3W15 C;  1P1N A;  2QS1 A;  3LSL A;  2ZYK A;  3U8Q A;  1I6Q A;  2QS4 A;  3K01 A;  1QVS A;  1QKA A;  1LCF A;  3MP8 A;  2DWH A;  1MH3 A;  3MPL A;  5EYF A;  3FVO A;  1YAE A;  3I5O A;  2QMW A;  3MP6 A;  3M3K A;  2RC7 A;  2Y7W A;  4MLQ A;  4FED A;  1LAH E;  2F78 A;  4R6Y A;  2GHA A;  2H9B A;  4ECF A;  1UIV A;  3OO9 A;  3QYT A;  3ZSF A;  3KG2 A;  3FV2 A;  1B3H A;  1I69 A;  4IGR A;  4NF6 B;  4NF8 B;  2D3I A;  4QSE A;  3TKD A;  3VVD A;  5ICT A;  1MY4 A;  4RK9 A;  4PQJ A;  4F22 A;  4R9F A;  3E4R A;  3C35 A;  1R6Z A;  2YJP A;  2RCA A;  1CB6 A;  4DLD A;  1Y3Q A;  2GFE A;  4YAH X;  4G4P A;  4ONY A;  4G2Z A;  4Q8R A;  2UVJ A;  5HM4 B;  2A5S A;  3IB1 A;  2HXW A;  1GGG A;  4IO7 A;  3DM0 A;  4OTE A;  5I58 B;  1MPB A;  5ELV A;  3S9M C;  4HCY A;  4YKP A;  1UTH A;  1UTB A;  4FEB A;  5FHO A;  2O7I A;  1QW0 A;  4HW8 A;  2Z8E A;  1VE4 A;  4QF9 A;  1LCT A;  4PFW A;  5FTI A;  2R9J A;  1A7L A;  4GL8 A;  4O3C A;  3H3G A;  1LAG E;  1B58 A;  4NF8 A;  1CE2 A;  4FOR A;  3T93 B;  5CI5 A;  2Z23 A;  3N6U A;  3CVG A;  3C33 A;  2XHD A;  4XIG Q;  1ZBM A;  1B9J A;  4H6D A;  1SW1 A;  2XXR A;  4F1Y A;  4KYS A;  1Y3P A;  2CZL A;  2OJT A;  1LFI A;  3MQ9 A;  4OMB A;  4OXV A;  1URS A;  3SEY A;  3S9E A;  2F7A A;  4YIC A;  1MS7 A;  3ONM A;  1JET A;  2Y84 A;  2H25 A;  3Q29 A;  3K1P A;  4U4X A;  4LQ2 A;  3UGW A;  1PB7 A;  1IZ1 A;  4H5F A;  4RPN A;  4GF8 A;  1POY 1;  4P11 A;  4TQU Q;  4F3G A;  1T0K A;  1NKX A;  2GH9 A;  3OO6 A;  3JV9 A;  4F29 A;  3IJO B;  4I62 A;  4U21 A;  4GWO A;  5H8H B;  4E0W A;  3IJX B;  3O28 A;  4RY1 A;  1N7W A;  4DXC A;  1MY1 A;  4TLL B;  1MG1 A;  4AQ4 A;  1AH5 A;  3CR9 A;  1A55 A;  2WKY A;  3RPW A;  1BTJ A;  2XX7 A;  1AMF A;  1TFA A;  4GL0 A;  4U1Z A;  1XT8 A;  3T9V A;  2ZNT A;  3TCH A;  4ESW A;  1WOD A;  5H8N B;  2ZYN A;  3DP8 A;  4MLV A;  1GTK A;  1A99 A;  3Q26 A;  1MQG A;  1USY H;  2F5X A;  2AL4 A;  2O51 A;  2XXU A;  2YPN A;  4P0G A;  1MQD A;  5M2V A;  5CMK A;  3FAS A;  2UYE A;  1Y1M A;  4KHZ E;  4R6H A;  4QFN A;  3S2V A;  3MBP A;  5KCJ A;  2PVU A;  3QK6 A;  3VDF A;  1B7U A;  4U2R A;  3SEV A;  3SDF A;  3C34 A;  3OSQ A;  1OLA A;  2X7Q A;  4YU0 A;  2X26 A;  1II5 A;  2GHB A;  3R26 A;  1FQA A;  4LQ5 A;  3KSJ A;  4NF5 A;  5CMM A;  4ZDM A;  2XXW A;  2ONS A;  1N76 A;  1SBP A;  1PBQ A;  4GXS B;  4H1X A;  3RGY A;  4IO3 A;  2UVH A;  4YMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...