4H65A

Crystal structure of semet derivative of hmp synthase thi5 from s. cerevisiae
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
333
structure length
315
Chain Sequence
DKITFLLNWQPTPYHIPIFLAQTKGYFKEQGLDMAILEPTNPSDVTELIGSGKVDMGLKAMIHTLAAKARGFPVTSVASLLDEPFTGVLYLKGSGITEDFQSLKGKKIGYVGEFGKIKPEDYTAVRCGMNVAKYIIEGKIDAGIGIECMQQVELEEYLAKQGRPASDAKMLRIDCCFCTVLYICNDEFLKKNPEKVRKFLKAIKKATDYVLADPVKAWSGYIDFKPQLNNDLSYKQYQRCYAYFSSSLYNVHRDWKKVTGYGKRLAILPPDYVSNYTNEYLSWPEPEEVSDPLEATRLMAIHQEKCRQEGTFKRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords Pyrimidine precursor biosynthesis enzyme THI5
publication title The Last Piece in the Vitamin B1 Biosynthesis Puzzle: STRUCTURAL AND FUNCTIONAL INSIGHT INTO YEAST 4-AMINO-5-HYDROXYMETHYL-2-METHYLPYRIMIDINE PHOSPHATE (HMP-P) SYNTHASE.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 98
structure length 315
sequence length 333
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09084 NMT1 NMT1/THI5 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h65A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4h65A01
4KD5A 1P1OA 3QUFA 4O3AA 2F7BA 2XXWA 3MP8A 4EF1A 3K01A 2R6GE 4LATA 4BDLA 5J1DA 3SERA 3PGFA 3LSXA 1LGBC 2R71A 2Y7KA 2XXRA 3PUXE 3CIJA 4G68B 1N7XA 4C1TA 2X7QA 1MXWA 2DWIA 3CI8A 4IY5A 4OERA 4P11A 3IB2A 1T0KA 3A3CA 5H8HA 3T9UA 2YJPA 1H45A 3IOUA 2XXPA 5AA2B 1MY0A 1JVXA 5DT6A 3D4CA 4LZ8A 4DE8A 1ZMGA 1L5TA 2H5YA 3OEKA 4I9DA 3SDFA 3USDA 2V84A 1D9VA 5FHMA 3SEUA 2AYSA 3Q26A 3KJTA 4ZEFA 1QUKA 4JSDA 4NF4A 3DP4A 4KYDA 4R74A 4DIGA 2NOOA 4OYVA 5H8FA 4YB5A 1AOVA 4FECA 2WKYA 3FIRA 2PX1A 3H6TA 4JXIA 3E4RA 1LAHE 5CC2A 3HN0A 2OWSA 1B2HA 4ELRA 3IJXB 1N7WA 3C35A 3EHSA 3KOSA 5AA3A 3EHTA 5I2KB 1TT1A 1VFEA 1UTBA 4GVOA 3FXRA 1MQJA 3KGCA 2D21A 4OESA 3EN3A 3U1OA 3T96B 3VE1B 2VHAA 1NH8A 2Y7WA 5FHOA 4ZZAA 5EHMA 3TCHA 4DXCA 2OBGA 1I6QA 3KN3A 3GZGA 5JK4A 5DVIA 4KFQA 3H4ZA 1XS5A 3TODA 2GHAA 1MDQA 3C31A 3FASA 5K2YA 3PUVE 4FE8A 5AA4A 3MWBA 2UVHA 1VFDA 3HSTA 1NNPA 4TQUQ 3MZ9A 5I57B 2OCUA 3TUSA 4DZ1A 3C36A 3ZKLA 2HQ0A 4GFRA 1OIBA 2GRVA 1A40A 4FEBA 1EZPA 3OO7A 1Y1MA 3UA8A 1A54A 4BDMA 3TAJA 1NFTA 4FAJA 4NE4A 2Z8EA 3Q25A 4EQ9A 3K6XA 4KCCA 4EF2A 4KHZE 4ESXA 2YLNA 4R6YA 1QW0A 1EZOA 4I8CA 4IGRA 1VSOA 3IB1A 4U4XA 2I48A 1AL3A 2P2AA 4DCXA 2W7YA 3OXNA 5TP9A 5JTYA 3T9VA 1N04A 4BDQA 1H76A 3OSRA 1FQCA 3CRBA 1MY2A 2VD3A 1B40A 3HPIA 5CMCA 2UYEA 1Y4CA 1IEJA 2ZXTA 3MC2A 3LUYA 1M5EA 4ZS9A 4R9GA 2ESNA 1NNKA 4YB7A 4C1UA 4MFIA 3E13X 3I3VA 4X9TA 3B6WA 4POWA 2NVUB 3B6TA 5L9MA 4NF8B 1I69A 5I2NB 4RNSA 4U4SA 3KG2A 3W9WA 2I3WA 4ELOA 2HAVA 4R6KA 4QF9A 3VLWA 1GGGA 4PP0A 1F9BA 3H06B 3HO7A 5HM4B 3FZVA 4XIGQ 4XKQA 3G3KA 3RN8A 5B7DA 3WAEA 5IKBA 4OXVA 1SQYA 3FD3A 3PD9A 3D4GA 2UVGA 2F35A 5HPQA 3W9VA 2A5TB 4GL8A 4UA8A 1M5DA 2Z22A 3F11A 4NF4B 2I6EA 1I6AA 4QFPA 1GVCA 1B3HA 1AIVA 1LCFA 1AH5A 1Q1KA 3K02A 4F2OA 3G3GA 3O97A 4MH5A 4THIA 3DM0A 2V3UA 2ZMBA 4NEDA 3V83A 1P1UA 2RINA 3TKDA 1B4ZA 4XKNA 4QFKA 4RPOA 4I1DA 3OO6A 5AE4A 3OEMA 3SEVA 4AQ4A 1IXCA 1NNFA 2OLBA 1HSJA 1IITA 4RJZA 4LZ5A 3KSJA 3K0VA 4NF6A 2X26A 1MPBA 3ILUB 1A99A 4X1DA 3MVZA 1MH4A 4RA1A 3RQTA 3IJOB 4EUOA 3T66A 1LAFE 4G68C 4PFTA 2RCAA 3K6VA 3K1MA 4R75A 2ZYNA 5DYHA 2XX8A 1B52A 2O84X 3PUZE 4JWXA 3HCQA 1PB8A 1B46A 4LA9A 1S7YA 4QSCA 1LSTA 4KR5A 4FIMA 3SEYA 4F1VA 4LUBA 1POY1 1DPPA 5I84A 3TYHA 4TLMB 4XKPA 4F3GA 4K3FA 1ZBMA 3KOTA 4WEDA 4HW8A 1QULA 1BLFA 2Q2CA 3M3FA 3U8QA 4IY6A 1JW4A 3LSWA 4DDDA 2V3TA 3DLNA 4IB2A 1FQAA 2AL5A 4IGTA 1HSLA 4YU0A 3S4UA 1MM7A 3DP6A 1LLSA 3T9XB 1A55A 3O2AA 4OTEA 3UORA 3TDJA 1USYH 1WODA 3CFLA 4ONYA 4PETA 2P1SA 3SETA 4YMAA 4L17A 1PBQA 2F78A 4PQJA 4HCWA 2XX7A 1EH3A 4YKKA 3C9HA 5TP9B 1RYOA 3CFZA 3JZJA 1LFIA 4YKIA 2O68A 1MPCA 3E3KA 2QMWA 3QIMA 4RPNA 1S50A 2F8DA 4BDNA 1XT8A 1HSEA 1B7HA 4RK2A 3VVFA 1BIYA 1IIWA 2F36A 1R9QA 3H03A 1XOCA 2PYYA 1FTJA 1Y1ZA 4H6DA 3K00A 4IO7A 4EXLA 1OVBA 2Z8DA 1P99A 1II5A 1ZLQA 4LVQA 2QS4A 3FUZA 3U92A 1B3GA 5FHNA 3U94A 1MM6A 3Q29A 1ZIUA 3MZ1A 4JSOA 4QFOA 2F6PA 3R26A 2DSFA 1S9TA 1M5FA 4U1ZA 4NF5B 3GXAA 4MBPA 2M8CA 3VDFA 3TFLA 3LSFB 1MPDA 2I0CA 5ICQA 3EPEA 3PPNA 1LAXA 2OWTA 4WXJA 5I59A 3VVEA 2B65A 3E9XA 1B0HA 3GBBA 1SYHA 2ZYOA 3PU5A 4PFYA 5DTBA 1B7ZA 2Q2AA 3O9PA 4R73A 2RC7A 3L6GA 2I49A 2Q88A 4Z7EA 2DXRA 1LFHA 3MVWA 3V89B 1CE2A 5ITPA 4OHNA 1RKMA 1DOTA 5A5XB 3K4UA 3OO8A 1SBPA 3O66A 4Q0CA 1N0TA 1XC1A 4IO2A 2DVZA 1NH7A 4FEDA 2XXVA 1SVXB 2QPQA 4Q30B 1JETA 2IEEA 4ZEKA 1UTHA 1IXHA 4GLIA 2DXYA 4F1UA 4ZECA 1A7LA 4LONB 1VE4A 4LZ7A 5KCJB 5TPAA 2XHDA 1R9LA 4F39A 4F22A 2ZNUA 3EF7A 5I58A 2YPNA 3TCGA 3U93A 4MLVA 1POTA 3M3KA 4JWYA 1XHYA 5ICTA 2CZLA 2PBWA 4OENA 3CSBA 3G3IA 3MPKA 4KQPA 1DTGA 4Z0IA 2P0SA 2DQVA 2XD2A 4QRZA 3KBRA 3IO6A 4ZZEA 1ZU0A 4POXA 2AIXA 2RCBA 3MQ9A 2Z23A 4DXBA 2UYFA 4JWOA 3MAMA 4G77A 3C34A 1N3WA 3MW0A 1B4HA 2G29A 4N07A 3SESA 1LBBA 2Q8JA 5FTIA 2CMOA 1IXIA 3N26A 1I6BA 3VLUA 1JEUA 2O51A 5CM6A 1MQHA 3ONMA 2Y7PA 1Z7NE 3S9EA 3KSXA 1ZJLA 3PUWE 1QUIA 4OQOA 1OLCA 3VXBA 1B9JA 5CBRA 1JNFA 3UP9A 3WAFA 1B32A 3LSLA 3FVNA 3UN6A 1UIVA 1MRPA 3O29A 2PT2A 5H8QB 1D4NA 4H1XA 1B3EA 3H3GA 4U22A 3GBAA 3RNNA 1LAGE 3JV9A 1FQEA 3K6UA 1SW1A 4ZE9A 1DPEA 4GF8A 3S9MC 2DE4A 3C4MA 4O3BA 1JW1A 2I4CA 1TWYA 1DMBA 1URGA 3N94A 3L6HA 1Y3NA 5CBSA 2RC8A 3IOVA 4ELQA 3O6IA 3VVDA 1YPNA 1B0LA 3CG1A 3G3HA 5H8HB 4XXUA 2HXWA 1Y20A 1SD3A 2D3IA 1FW0A 1ZTYA 4H0WA 4RXLA 3FXUA 5I59B 1FTKA 3FJ7A 1FTLA 3RTWB 1Y3QA 5L9SA 4DXUA 4Q5TA 3TEPA 2V93A 2ZYKA 4G68A 3ODBA 3T93B 2XXYA 5AA1A 1WVJA 1GTKA 1YCJA 2I3VA 2DWAA 3MP1A 4U1OA 2DP8A 3PV0E 4EQ7A 2O69A 5H8FB 4H5GA 4WEPA 1MQGA 1PBPA 4GQOA 3FVOA 2XXXA 2F7CA 1LBCA 3VV5A 1DSNA 5CMKA 1D9YA 3IO4A 2PVUA 1B3FA 2E1SA 1UTHB 4QSDA 2OK2A 2QS3A 1XVXA 2Y84A 2Z8FA 4HTGA 2VGQA 4OMBA 2QRYA 5M2VA 1O63A 1IUDA 2G93A 4IO4A 4AB6A 1UTBB 3PPRA 2KLFA 5ELVA 3FJGA 1FQDA 4JBZA 3BBRA 3S9NC 3FV2A 3QXMA 3IOWA 1EZ9A 3Q27A 4P0IA 4OWDA 3K1NA 1MG1A 4HS7A 3IX1A 2X7PA 4DLDA 2I4BA 4E0XA 3CFXA 1YTVA 5CI5A 3BFUA 3H7MA 4NWCA 4NWDA 1Z7ME 5I2KA 5F7VA 5AA4B 4MLQA 1JEVA 5I56A 1P1NA 5H8NA 3IR1A 1M5CA 1FQBA 4ELPA 2XXIA 1B51A 4KYSA 1CB6A 3OOAA 2LAOA 4UACA 4YAHX 1VR5A 4F3BA 1IZ1A 1MS7A 3IOTA 4YZZA 1B1XA 4F1YA 3K1PA 4OEVA 3EHUA 1ANFA 1P1QA 4R2BA 3PUYE 4H65A 1OQGA 2F7AA 1MXXA 1B58A 4JB7A 4OETA 3RTFB 2QL3A 3B6QA 3A3UA 3RPWA 1OQHA 3PPPA 5I57A 2GH9A 3I5OA 1LB8A 2UVJA 1IXGA 3G3FA 3OMBA 4EQBA 1AMFA 2RC9A 5JTYB 4PE5B 1H43A 3OO9A 5CMBA 1A8EA 4F29A 3FXQA 5AA2D 2PT1A 4H5FA 1BKAA 2VP1A 4R2FA 1SI1A 4OEUA 4OFJA 3ECRA 4GL0A 2HAUA 5L8DA 2O1LA 2I58A 4M4GA 3MZBA 2AL4A 1J1NA 2QMXA 1B6HA 5FTHA 5IAIA 4M1VA 2NXOA 4NTLA 5DEXA 4HCYA 2DWJA 1URDA 3MVXA 3C32A 3MBPA 4KI0E 3IORA 3VXCA 3DP8A 4G4PA 2XXHA 1MXYA 3TTLA 1N76A 5ISUA 4ECFA 4IO3A 4RYAA 2O6AA 4F2QA 3PMXA 4RY1A 4GWOA 4NF8A 1MY4A 5I2NA 3A09A 1MY1A 2ONKE 3ZS6A 1US5A 1OMPA 2UVIA 4QHQA 4N6PA 3KEIA 3G7WA 2F97A 4TLLB 4YICA 1SW4A 4YKPA 1MXZA 1B3LA 1SYIA 3R7XA 1N84A 3OENA 1LCTA 2REGA 4RK9A 1PB7A 1ZKBA 4GRKA 1YAEA 3SEXA 2BJJX 4KCDA 3H6WA 3N5LA 3LC8A 3BKIB 1B7UA 4U21A 5EHSA 2A5TA 4FATA 4G2ZA 3AXFA 2H98A 1N3XA 3B7DA 3TPAA 5TU0A 1JW5A 4NF6B 3KJ7A 1QJMA 1URSA 3ILTB 4MF3A 3MP6A 1H44A 2Q9TA 5H8SA 1QUJA 4BLAA 3CR9A 4NMYA 2ZYMA 2REJA 1MXVA 2H99A 3PPQA 4KYEA 3ZSFA 4F19A 1FTMA 4C0RA 2HCAA 3SEWA 3V5AA 3TMGA 4YMBA 2FA7A 1NL5A 3HV1A 2XX9A 2OJTA 3CSGA 1TFAA 3EQ1A 2A5SA 2DOJA 3JYRA 1OLAA 1TXFA 2ABHA 5I56B 2XXUA 4TOZA 5H8NB 1LB9A 4F3PA 5KDTA 3N6TA 3T22A 4BDOA 3IAZA 2DWHA 4ND9A 2DE3A 1KWHA 2HFBA 3O6HA 1DTZA 4ZEIA 3W15C 2F5XA 1D3KA 3N6UA 1BTJA 2B3BA 3UGWA 4WKMA 1LFGA 1ELJA 1Y3PA 3T9HB 3PMVA 2FYIA 3V8XB 3H6VA 4LP2B 3VFJA 1UIUA 4XTCQ 3G3JA 1NNTA 3TQLA 3HHFA 3FATA 3BFTA 5DVFA 1SI0A 4ZEDA 4ZDMA 1R6ZA 1PB9A 3FVGA 4FJPA 4P0GA 2Y7RA 4F3SA 5BWJA 3IB0A 3GLBA 4EXKA 2DVCA 4R9FA 2PMSA 3S2VA 2ANJA 2FNCA 2O1MA 3MUQA 5JEIA 1GR2A 3RT6B 1TFDA 1QKAA 3KZGA 1MQDA 3RUMA 3TCFA 3K2DA 2GHBA 3QK6A 3IK6B 4ZEBA 3QUJA 4LQ2A 5ITOA 5DEXB 2VD2A 3FVKA 1GV8A 1FCKA 5B70A 2F6GA 3TQWA 1FQFA 3O6GA 2H9BA 2HEUA 3UIFA 2ONSA 1WDNA 3FV1A 1NMUA 2XD3A 3PMWA 1ATGA 3TELA 3M8UA 2E0SA 1PC3A 2RF1A 1RYXA 3QYTA 5DVJA 3OSQA 1QKBA 5CRYA 4X1BA 4YB6A 1Y9UA 2O7UA 3P7IA 1SW2A 2UXAA 3ZKKA 1R1NA 3MPLA 3TTRA 1B1HA 3TTNA 1PEBA 4JDFA 2I0BA 3CG3A 3FGSA 1QVSA 3OD7A 5K2XA 4XKRA 4KPTA 4OFLA 4O3CA 3MJNA 1O64A 4FORA 4GIZA 4NF5A 2DE2A 4QFNA 2ALUA 3HHGA 3SKPA 2B3FA 3H6UA 5AA2A 1MH3A 2XXTA 4ESWA 2QS2A 1B5IA 1O7TA 2F34A 2Q89A 1US4A 4GD5A 5F1QA 3O28A 2H4IA 1JVYA 3RLFE 4QSEA 4GXSB 1FTOA 2NWJA 1B05A 5EYFA 3QAXA 1EU8A 1USYE 5BUUA 5TPAB 1Q35A 1SW5A 3UK4A 2R9JA 3PD8A 4N13A 3TTKA 5I58B 2XXQA 4H67A 4YKJA 2THIA 1SDXA 1XVYA 5A5XA 4GXAA 4PFWA 1UQWA 1B5JA 4OVJA 4U2RA 3TZAA 2RKMA 2QSXA 2HZKA 5KDTB 4X48A 3CVGA 4H8IA 1IQ7A 3K6WA 5LOMA 1P1WA 4BDRA 4Q8RA 4R6HA 4H8JA 1M5BA 5KCJA 3S9LC 3R6UA 2OZZA 4R72A 2D5WA 1PDAA 2QJEA 1MY3A 3MVYA 1OVTA 3RT8A 2ONRA 4EDPA 3RGYA 1MXUA 1BP5A 1B5HA 2HZLA 1JQFA 4G8NA 2ZNSA 2H25A 2IA4A 2NUVA 3VLVA 3RY3A 4AB5A 3PPOA 3IL1B 1MDP1 4I62A 1A8FA 2DS9A 2GFEA 2O7IA 2QS1A 4QFLA 4OFOA 4OZ9A 4E0WA 1MQIA 2V3QA 2V25A 4F18A 4IO6A 1NKXA 3THIA 2DYXA 3KN7A 3U72A 3TTMA 1Y4TA 3KN8A 4ZE8A 4F31B 3OELA 4U23A 4ISUA 5CMMA 3M3LA 3QSLA 4G8MA 4DCYA 2Y7IA 3KFMA 3LBSA 4LQ5A 3FJMA 5L9OA 3C33A 3LR1A 5KZTA 2VOZA 4IO5A 2ZNTA 4PFUA 3DELB 5H8QA 4G8HA 1H3DA 3I6VA 3Q28A 5HBCA 4GOTA
chains in the Genus database with same CATH superfamily
4KD5A 1P1OA 3QUFA 4O3AA 2F7BA 2XXWA 3MP8A 4EF1A 3K01A 2R6GE 3GYYA 4LATA 4BDLA 5J1DA 3SERA 3PGFA 3LSXA 2PCRA 1LGBC 3MSTA 2R71A 2Y7KA 2XXRA 3PUXE 3CIJA 1CNQA 4G68B 1N7XA 4C1TA 2X7QA 1MXWA 2DWIA 3CI8A 4IY5A 4GX3A 4OERA 4P11A 3IB2A 1T0KA 3A3CA 2GQ1A 3EKIA 5H8HA 3T9UA 2YJPA 1H45A 3IOUA 2XXPA 5DW8A 5AA2B 2QVRA 1MY0A 1JVXA 5DT6A 3D4CA 4JVCA 4LZ8A 4DE8A 2P3VA 1ZMGA 1L5TA 1K9YA 2H5YA 3OEKA 4I9DA 3SDFA 3USDA 2V84A 1D9VA 5FHMA 3SEUA 2Y5KA 2AYSA 3Q26A 5IGAA 3KJTA 1G0HA 4ZEFA 1QUKA 4JSDA 1DK4A 4NF4A 3DP4A 4KYDA 4MNPA 4R74A 4DIGA 2BJIA 4MIJA 2NOOA 4OYVA 5H8FA 4YB5A 4OVQA 1AOVA 4FECA 2WKYA 3FIRA 2PX1A 3H6TA 4JXIA 3E4RA 2CZKA 1LAHE 4NHBA 5CC2A 3HN0A 5FBPA 2OWSA 1B2HA 4ELRA 3IJXB 1N7WA 2HHMA 4MX6A 3C35A 3EHSA 3KOSA 5AA3A 5EYHA 3EHTA 5I2KB 1TT1A 5IZ3A 4MAGA 2B4LA 1VFEA 1UTBA 4PDHA 4GVOA 4GWWA 3FXRA 4X8RA 4P3LA 1MQJA 3KGCA 2D21A 4OESA 3EN3A 4MMPA 4H46A 3U1OA 3T96B 3VE1B 2VHAA 1NH8A 1FPFA 2Y7WA 5FHOA 4ZZAA 5EHMA 3TCHA 4DXCA 2OBGA 1I6QA 4N4UA 3KN3A 3GZGA 4PBQA 5JK4A 1YYZA 1KA1A 5DVIA 4KFQA 3B8BA 3H4ZA 1INPA 1XS5A 3TODA 2GHAA 1MDQA 3C31A 3FASA 5K2YA 1EYJA 3PUVE 4FE8A 4N91A 5AA4A 3MWBA 2UVHA 2HXRA 1VFDA 3HSTA 1NNPA 4TQUQ 3MZ9A 4AS4A 5I57B 2OCUA 3TUSA 4DZ1A 3C36A 3ZKLA 2HQ0A 4GFRA 1OIBA 2GRVA 2F3BA 1A40A 4FEBA 1EZPA 2B4MA 4MHFA 3IFAA 3RYDA 3OO7A 1Y1MA 3BIHA 1A54A 3UA8A 4BDMA 1FPDA 3TAJA 1NFTA 3T1BA 4FAJA 1NUXA 4NE4A 2Z8EA 3Q25A 5ET7A 4EQ9A 3K6XA 4KCCA 4EF2A 4KHZE 4R6YA 2YLNA 4ESXA 1QW0A 1EZOA 4I8CA 4IGRA 1VSOA 3IB1A 4U4XA 2I48A 1AL3A 2P2AA 4DCXA 2W7YA 3OXNA 5TP9A 5JTYA 3T9VA 1N04A 4BDQA 1H76A 3OSRA 1FQCA 1NI9A 1Q9DA 3CRBA 1MY2A 2VD3A 1B40A 3HPIA 4XF5A 5CMCA 2CZHA 2UYEA 1Y4CA 1IEJA 4GBVA 2ZXTA 2F3DA 3MC2A 4QBAA 3LUYA 1M5EA 4ZS9A 4R9GA 2ESNA 3U65A 1QGXA 1NNKA 4YB7A 1YXIA 4C1UA 4MFIA 3E13X 3I3VA 4X9TA 3B6WA 4POWA 2NVUB 3B6TA 5L9MA 4NF8B 1I69A 5I2NB 4RNSA 4U4SA 3KG2A 2XA5A 3W9WA 4X04A 2I3WA 4ELOA 2HAVA 4R6KA 4QF9A 3VLWA 1GGGA 4PP0A 1F9BA 3H06B 4MCOA 3HO7A 5HM4B 3FZVA 5IZZA 4XIGQ 4XKQA 3G3KA 3RN8A 5B7DA 3WAEA 5IKBA 4OXVA 1SQYA 3FD3A 3PD9A 3D4GA 2UVGA 2F35A 4XFEA 5HPQA 4I40A 5LDZA 3W9VA 4PC9A 2A5TB 4GL8A 4OVSA 4UA8A 1M5DA 2Z22A 3F11A 4NF4B 2I6EA 1I6AA 4QFPA 1GVCA 1B3HA 1AIVA 4PFRA 1LCFA 1AH5A 1Q1KA 3K02A 4F2OA 3G3GA 3O97A 4MH5A 4THIA 3DM0A 4DI4B 4XEQA 1FRPA 2FIEA 2V3UA 2ZMBA 4NEDA 3V83A 4PE3A 1P1UA 2RINA 1D9QA 4XKNA 1B4ZA 3TKDA 4QFKA 4RPOA 4I1DA 3OO6A 5AE4A 3KC1A 2XXKA 3OEMA 3SEVA 4AQ4A 1IXCA 1NNFA 2OLBA 1HSJA 1IITA 4RJZA 4LZ5A 3KSJA 3K0VA 4NF6A 2X26A 1MPBA 3ILUB 1A99A 4X1DA 3MVZA 1MH4A 4RA1A 3RQTA 3IJOB 4EUOA 3T66A 1LAFE 4G68C 4PFTA 2KR0A 2RCAA 3K6VA 3K1MA 4R75A 2ZYNA 5DYHA 2XX8A 1B52A 2O84X 3PUZE 4JWXA 3HCQA 1PB8A 4PGPA 1B46A 4LA9A 1S7YA 2QVUA 1FBGA 4QSCA 1LSTA 4KR5A 1NUZA 4FIMA 3SEYA 4F1VA 4LUBA 4PAKA 1POY1 1DPPA 1FPGA 5I84A 3TYHA 4TLMB 4N8YA 4XKPA 4F3GA 4K3FA 1ZBMA 3KOTA 4WEDA 4HW8A 1QULA 1BLFA 2Q2CA 3M3FA 3U8QA 4IY6A 2JJKA 1JW4A 3T0JA 4GX6A 3LSWA 1FPIA 1NV5A 4DDDA 2V3TA 3DLNA 4IB2A 1FQAA 2AL5A 5J16A 4IGTA 3IFCA 1HSLA 4YU0A 1NV0A 3S4UA 1MM7A 3DP6A 4PAIA 1LLSA 1VDWA 3T9XB 1A55A 3O2AA 2OX3A 4OTEA 4HE0A 3UORA 3TDJA 1USYH 4PCDA 1WODA 3CFLA 4ONYA 4PETA 2P1SA 3SETA 4YMAA 4L17A 1PBQA 2F78A 4PQJA 4HCWA 2XX7A 1SPIA 1NV7A 1EH3A 2XWIA 4YKKA 1EYKA 3C9HA 5TP9B 1RYOA 3CFZA 3JZJA 1LFIA 4YKIA 2O68A 1MPCA 3E3KA 2QMWA 3QIMA 4HXVA 4RPNA 1S50A 2F8DA 4GWUA 4BDNA 1XT8A 1HSEA 1B7HA 4RK2A 3VVFA 1BIYA 1IIWA 2F36A 1R9QA 3H03A 1XOCA 2PYYA 1FTJA 1Y1ZA 4H6DA 3K00A 4IO7A 4NF0A 4EXLA 1OVBA 2Z8DA 1P99A 1II5A 1ZLQA 4LVQA 2QS4A 3FUZA 3U92A 1B3GA 5FHNA 3U94A 1MM6A 3Q29A 1ZIUA 2VT5A 3MZ1A 4JSOA 4QFOA 2F6PA 3R26A 4N6KA 2DSFA 1S9TA 1M5FA 4U1ZA 4NF5B 1LBWA 3GXAA 4MBPA 2M8CA 3VDFA 3LUZA 3TFLA 3LSFB 1MPDA 2I0CA 4IR8A 5ICQA 3EPEA 3PPNA 1LAXA 2OWTA 4WXJA 5I59A 3VVEA 2B65A 3E9XA 1B0HA 3GBBA 1SYHA 2ZYOA 3PU5A 4PFYA 5DTBA 1B7ZA 2Q2AA 3O9PA 4R73A 2PFYA 2RC7A 3L6GA 2I49A 2Q88A 3D1RA 4P56A 4Z7EA 4I3YA 2DXRA 1LFHA 3MVWA 3V89B 1CE2A 5ITPA 2Y5LA 4GWXA 4OHNA 1RKMA 1DOTA 3RPLB 5A5XB 3K4UA 3OO8A 1SBPA 3O66A 4Q0CA 3ISPA 1N0TA 4OANA 1XC1A 4IO2A 2DVZA 4N15A 1NH7A 4FEDA 5F24A 2XXVA 1SVXB 2QPQA 4Q30B 1JETA 2IEEA 4ZEKA 1UTHA 1IXHA 4GLIA 2DXYA 4F1UA 4ZECA 1A7LA 4LONB 1VE4A 4MEVA 4LZ7A 5KCJB 5TPAA 2XHDA 1R9LA 4F39A 4F22A 2ZNUA 3EF7A 2KQZA 5I58A 2YPNA 3TCGA 2CEYA 4GWZA 3U93A 4MLVA 2WYKA 1POTA 3M3KA 4JWYA 4UABA 1XHYA 5ICTA 2CZLA 2PBWA 4OENA 3CSBA 3G3IA 3MPKA 4JVIA 4KQPA 1DTGA 4Z0IA 2P0SA 2DQVA 2XD2A 4QRZA 4OVRA 3KBRA 3IO6A 4ZZEA 4N17A 1ZU0A 4POXA 2AIXA 2RCBA 3MQ9A 2Z23A 4DXBA 2UYFA 4HE2A 1NV1A 4JWOA 3MAMA 4G77A 3C34A 1N3WA 3MW0A 1B4HA 2G29A 4N07A 4KXPA 3SESA 1LBBA 2Q8JA 5FTIA 2CMOA 1IXIA 3N26A 1FPJA 1I6BA 3VLUA 1JEUA 2O51A 5CM6A 1MQHA 3ONMA 2Y7PA 1Z7NE 3E79A 1IMAA 3S9EA 3KSXA 1ZJLA 3PUWE 3FBPA 1QUIA 4OQOA 1OLCA 3VXBA 5I3SA 1B9JA 5CBRA 1JNFA 3UP9A 3WAFA 1B32A 3LSLA 3FVNA 2FBPA 3UN6A 1UIVA 1NV2A 1MRPA 1RDXA 3O29A 2PT2A 5H8QB 1D4NA 4H1XA 1B3EA 3H3GA 4U22A 3GBAA 3RNNA 2MKZA 1LAGE 4O94A 1FPKA 3JV9A 1FJ6A 1FQEA 3K6UA 1SW1A 4ZE9A 1DPEA 4GF8A 4QXDA 3S9MC 2DE4A 3C4MA 4O3BA 1JW1A 4GWSA 2I4CA 1TWYA 3B50A 1DMBA 1URGA 3N94A 3MYUA 3L6HA 5I5PA 2QFLA 1Y3NA 1G0IA 4H45A 5CBSA 2RC8A 3IOVA 4ELQA 3O6IA 3VVDA 1YPNA 5I7IA 1B0LA 3KBZA 4PDDA 3CG1A 3G3HA 5H8HB 4XXUA 2HXWA 1Y20A 1SD3A 4I3EA 2D3IA 1FBHA 1FW0A 1ZTYA 4H0WA 4RXLA 3FXUA 4DI3D 5I59B 1FTKA 3FJ7A 1FTLA 3RTWB 1Y3QA 5L9SA 4DXUA 4Q5TA 1FBPA 3TEPA 2V93A 2ZYKA 1LBYA 4G68A 2ZZVA 3ODBA 3T93B 2XXYA 5AA1A 1WVJA 1GTKA 2ZZWA 1YCJA 2I3VA 2DWAA 3MP1A 4U1OA 2DP8A 3PV0E 4EQ7A 2O69A 5H8FB 4H5GA 4WEPA 1MQGA 4PBHA 2FHYA 1PBPA 4GQOA 3FVOA 2XXXA 2F7CA 1LBCA 3VV5A 1DSNA 5CMKA 1D9YA 3IO4A 1FJ9A 2PVUA 1B3FA 2E1SA 4P1LA 1UTHB 4QSDA 2OK2A 2QS3A 1XVXA 2Y84A 2Z8FA 1JP4A 3LV0A 4HTGA 2VGQA 4OMBA 2QRYA 3KC0A 5M2VA 1O63A 1IUDA 5IZ3B 2G93A 4IO4A 4AB6A 1UTBB 3PPRA 2KLFA 5ELVA 1FSAA 3FJGA 1FQDA 1NV6A 4JBZA 2WX9A 3BBRA 3S9NC 3FV2A 1AWBA 3QXMA 1NV4A 3IOWA 1EZ9A 3Q27A 4O8MA 4OWDA 4P0IA 3K1NA 1MG1A 4HS7A 3IX1A 2X7PA 4DLDA 2I4BA 4E0XA 3CFXA 1YTVA 5CI5A 3BFUA 3H7MA 1NUWA 4NWCA 4NWDA 1Z7ME 5I2KA 1BK4A 5F7VA 5AA4B 4MLQA 1JEVA 5I56A 1P1NA 5H8NA 4N81A 3IR1A 1M5CA 1FQBA 4ELPA 2XXIA 1B51A 4KYSA 1CB6A 3OOAA 2LAOA 4UACA 4YAHX 1VR5A 4N6DA 4F3BA 1IZ1A 1MS7A 3IOTA 4PF6A 4YZZA 1B1XA 4F1YA 3K1PA 4OEVA 3EHUA 1ANFA 1P1QA 4R2BA 3PUYE 4H65A 1OQGA 1IMCA 2F7AA 2WBBA 1MXXA 1B58A 4JB7A 4OETA 3RTFB 2QL3A 3B6QA 3A3UA 3RPWA 1OQHA 3PPPA 5I57A 2GH9A 3I5OA 1LB8A 2UVJA 1IXGA 3G3FA 3OMBA 1IMFA 4EQBA 1AMFA 2RC9A 5JTYB 1NUYA 4PE5B 1H43A 3OO9A 1XI6A 1LBZA 5CMBA 1A8EA 4F29A 2FIXA 3FXQA 5AA2D 2PT1A 4H5FA 1BKAA 2VP1A 4R2FA 1SI1A 4NG7A 4NN3A 4OEUA 4OFJA 3ECRA 4GL0A 2HAUA 5L8DA 2O1LA 5EQ8A 2I58A 4M4GA 3MZBA 2AL4A 1J1NA 3CHGA 2QMXA 1B6HA 5FTHA 5IAIA 4M1VA 2NXOA 4NTLA 3A29A 4P8BA 5DEXA 3ROJA 4HCYA 2ZZXA 2QVVA 2DWJA 1URDA 5T3JA 3MVXA 5LTCA 3C32A 3MBPA 4KI0E 5EQAA 3IORA 3VXCA 3DP8A 5ET6A 2R8TA 4G4PA 2XXHA 1MXYA 3TTLA 1N76A 1K9ZA 5ISUA 4ECFA 1FPEA 4PF8A 4IO3A 4RYAA 2WEFA 2O6AA 1FBEA 1IMDA 4F2QA 3PMXA 4RY1A 2PFZA 4GWOA 4NF8A 1MY4A 1DCUA 5I2NA 3A09A 1MY1A 2ONKE 3ZS6A 1US5A 1OMPA 2UVIA 4QHQA 4N6PA 3KEIA 4NAPA 3G7WA 2F97A 4TLLB 4YICA 1SW4A 4YKPA 1MXZA 1B3LA 1SYIA 3R7XA 4HE1A 1N84A 3OENA 1LCTA 2REGA 1FBDA 4RK9A 1PB7A 1ZKBA 4GRKA 1YAEA 3SEXA 2BJJX 4KCDA 1LBVA 3H6WA 3N5LA 3LC8A 3BKIB 1B7UA 4U21A 5EHSA 2A5TA 4FATA 4G2ZA 3AXFA 2H98A 1N3XA 3B7DA 5A5LA 3TPAA 5TU0A 2P3NA 1JW5A 2VPNA 4NF6B 4GWYA 3KJ7A 1QJMA 1URSA 3ILTB 4MF3A 3MP6A 1NV3A 1H44A 2Q9TA 5H8SA 1QUJA 2HPGA 4G61A 4BLAA 3CR9A 4NMYA 2ZYMA 2REJA 1MXVA 2H99A 3PPQA 4KYEA 3ZSFA 1FBCA 4F19A 4P9KA 1FTMA 4C0RA 2HCAA 4MJOA 3SEWA 3TMGA 3V5AA 4YMBA 2FA7A 1NL5A 3HV1A 2L5VA 2XX9A 2OJTA 3CSGA 1TFAA 3EQ1A 4NGUA 2A5SA 2DOJA 3JYRA 1OLAA 1TXFA 2ABHA 1IMBA 1DBZA 5I56B 2XXUA 4TOZA 5H8NB 1LB9A 4F3PA 5KDTA 3N6TA 3T22A 3SZPA 4BDOA 3IAZA 4GBWA 2DWHA 4MNCA 4ND9A 4O7MA 2DE3A 1KWHA 2HFBA 3O6HA 1DTZA 4ZEIA 3W15C 5IZ1A 2F5XA 3HFUA 1D3KA 3N6UA 1BTJA 4OA4A 2B3BA 1LEVA 3UGWA 2WYPA 1RDYA 4WKMA 1LFGA 1ELJA 5ESYA 1Y3PA 3T9HB 3PMVA 1LBXA 2FYIA 3V8XB 4JVDA 3H6VA 4LP2B 3VFJA 1UIUA 4XTCQ 3G3JA 1NNTA 3TQLA 3HHFA 3FATA 3BFTA 5DVFA 1SI0A 3BIGA 4ZEDA 4ZDMA 1R6ZA 1PB9A 3FVGA 4FJPA 4PFBA 4O7IA 4P0GA 2Y7RA 4F3SA 5BWJA 3IB0A 5IM2A 3GLBA 2FVZA 2DVCA 4EXKA 4R9FA 2PMSA 4NQ8A 3S2VA 2ANJA 2FNCA 2O1MA 3MUQA 5JEIA 1GR2A 3RT6B 1TFDA 1QKAA 2Q8MA 3KZGA 1MQDA 3RUMA 3TCFA 3K2DA 2GHBA 3QK6A 3IK6B 4ZEBA 3QUJA 4LQ2A 5ITOA 5DEXB 2VD2A 3FVKA 1GV8A 1FCKA 5B70A 2F6GA 3TQWA 1FQFA 3O6GA 2H9BA 2HEUA 3UIFA 2ONSA 1WDNA 4LN5A 3FV1A 1NMUA 2XD3A 3PMWA 5EYGA 1ATGA 3TELA 3M8UA 2E0SA 1PC3A 1EYIA 2RF1A 4PTKA 1RYXA 3QYTA 5DVJA 3OSQA 1QKBA 1FPBA 5CRYA 4X1BA 4YB6A 1Y9UA 2O7UA 3P7IA 1SW2A 2UXAA 3ZKKA 4FBPA 1R1NA 2XWVA 3MPLA 3TTRA 2WBDA 1B1HA 3E78A 3TTNA 1PEBA 4JDFA 2I0BA 3CG3A 3FGSA 1QVSA 3OD7A 4NX1A 5K2XA 4XKRA 4KPTA 4OFLA 4O3CA 3MJNA 1O64A 4FORA 4GIZA 4NF5A 2DE2A 4QFNA 2V4CA 2ALUA 3HHGA 3SKPA 2B3FA 3H6UA 5AA2A 5ET5A 1MH3A 2XXTA 4ESWA 3PTYA 2QS2A 1B5IA 1O7TA 2F34A 2Q89A 1US4A 4GD5A 5F1QA 3O28A 2H4IA 1JVYA 3RLFE 4P1EA 4QSEA 4GXSB 1FTOA 2NWJA 1B05A 5EYFA 1KA0A 3QAXA 1EU8A 1USYE 4MNIA 5BUUA 5TPAB 1Q35A 1SW5A 3UK4A 3FXBA 2R9JA 3PD8A 4N13A 3TTKA 3NOHA 5I58B 2XXQA 4H67A 4YKJA 2THIA 1SDXA 2CZIA 1XVYA 4N8GA 5ET8A 4GXAA 3RPLA 5A5XA 4PFWA 4PAFA 4GX4A 1UQWA 1B5JA 4OVJA 4U2RA 3TZAA 2RKMA 2VPOA 2QSXA 1FTAA 2HZKA 5KDTB 4X48A 3CVGA 4H8IA 1IQ7A 3K6WA 5LOMA 1P1WA 4BDRA 4Q8RA 4R6HA 2XWKA 4H8JA 1M5BA 1RDZA 5KCJA 3S9LC 3R6UA 2OZZA 4R72A 2D5WA 1PDAA 2QJEA 1MY3A 3MVYA 1OVTA 3RT8A 3QMFA 2ONRA 4EDPA 3RGYA 1KZ8A 1MXUA 1FBFA 1FPLA 1BP5A 4AS5A 1B5HA 2HZLA 1JQFA 2DDKA 4G8NA 2ZNSA 2H25A 2IA4A 2NUVA 2OWZA 3VLVA 3RY3A 4AB5A 3PPOA 3IL1B 4OVPA 1IMEA 1MDP1 4I62A 2Q74A 1A8FA 2DS9A 2GFEA 2O7IA 2QS1A 4QFLA 4OFOA 4OZ9A 4E0WA 1MQIA 2V3QA 2V25A 4F18A 4IO6A 1NKXA 2DYXA 3THIA 3KN7A 3U72A 3TTMA 1Y4TA 4PFIA 3KN8A 4P47A 4OVTA 4ZE8A 2CEXA 4F31B 3OELA 4U23A 4ISUA 5CMMA 3M3LA 4G8MA 3QSLA 1YZ0A 4DCYA 2Y7IA 3KFMA 5EQ7A 3LBSA 4LQ5A 3FJMA 5L9OA 5EQ9A 3C33A 3LR1A 5KZTA 2VOZA 4IO5A 2ZNTA 4PFUA 3DELB 5H8QA 4PGNA 4G8HA 2XWOA 1H3DA 3I6VA 3Q28A 5HBCA 4GOTA
chains in the Genus database with same CATH topology
4KD5A 1P1OA 3QUFA 4O3AA 2F7BA 2XXWA 3MP8A 4EF1A 3K01A 2R6GE 4LATA 4BDLA 5J1DA 3SERA 3PGFA 3LSXA 1LGBC 2R71A 2Y7KA 2XXRA 3PUXE 3CIJA 4G68B 1N7XA 4C1TA 2X7QA 1MXWA 2DWIA 3CI8A 4IY5A 4OERA 4P11A 3IB2A 1T0KA 3A3CA 5H8HA 3T9UA 2YJPA 1H45A 3IOUA 2XXPA 5AA2B 1MY0A 1JVXA 5DT6A 3D4CA 4LZ8A 4DE8A 1ZMGA 1L5TA 2H5YA 3OEKA 4I9DA 3SDFA 3USDA 2V84A 1D9VA 5FHMA 3SEUA 2AYSA 3Q26A 3KJTA 4ZEFA 1QUKA 4JSDA 4NF4A 3DP4A 4KYDA 4R74A 4DIGA 2NOOA 4OYVA 5H8FA 4YB5A 1AOVA 4FECA 2WKYA 3FIRA 2PX1A 3H6TA 4JXIA 3E4RA 1LAHE 5CC2A 3HN0A 2OWSA 1B2HA 4ELRA 3IJXB 1N7WA 3C35A 3EHSA 3KOSA 5AA3A 3EHTA 5I2KB 1TT1A 1VFEA 1UTBA 4GVOA 3FXRA 1MQJA 3KGCA 2D21A 4OESA 3EN3A 3U1OA 3T96B 3VE1B 2VHAA 1NH8A 2Y7WA 5FHOA 4ZZAA 5EHMA 3TCHA 4DXCA 2OBGA 1I6QA 3KN3A 3GZGA 5JK4A 5DVIA 4KFQA 3H4ZA 1XS5A 3TODA 2GHAA 1MDQA 3C31A 3FASA 5K2YA 3PUVE 4FE8A 5AA4A 3MWBA 2UVHA 1VFDA 3HSTA 1NNPA 4TQUQ 3MZ9A 5I57B 2OCUA 3TUSA 4DZ1A 3C36A 3ZKLA 2HQ0A 4GFRA 1OIBA 2GRVA 1A40A 4FEBA 1EZPA 3OO7A 1Y1MA 3UA8A 1A54A 4BDMA 3TAJA 1NFTA 4FAJA 4NE4A 2Z8EA 3Q25A 4EQ9A 3K6XA 4KCCA 4EF2A 4KHZE 4ESXA 2YLNA 4R6YA 1QW0A 1EZOA 4I8CA 4IGRA 1VSOA 3IB1A 4U4XA 2I48A 1AL3A 2P2AA 4DCXA 2W7YA 3OXNA 5TP9A 5JTYA 3T9VA 1N04A 4BDQA 1H76A 3OSRA 1FQCA 3CRBA 1MY2A 2VD3A 1B40A 3HPIA 5CMCA 2UYEA 1Y4CA 1IEJA 2ZXTA 3MC2A 3LUYA 1M5EA 4ZS9A 4R9GA 2ESNA 1NNKA 4YB7A 4C1UA 4MFIA 3E13X 3I3VA 4X9TA 3B6WA 4POWA 2NVUB 3B6TA 5L9MA 4NF8B 1I69A 5I2NB 4RNSA 4U4SA 3KG2A 3W9WA 2I3WA 4ELOA 2HAVA 4R6KA 4QF9A 3VLWA 1GGGA 4PP0A 1F9BA 3H06B 3HO7A 5HM4B 3FZVA 4XIGQ 4XKQA 3G3KA 3RN8A 5B7DA 3WAEA 5IKBA 4OXVA 1SQYA 3FD3A 3PD9A 3D4GA 2UVGA 2F35A 5HPQA 3W9VA 2A5TB 4GL8A 4UA8A 1M5DA 2Z22A 3F11A 4NF4B 2I6EA 1I6AA 4QFPA 1GVCA 1B3HA 1AIVA 1LCFA 1AH5A 1Q1KA 3K02A 4F2OA 3G3GA 3O97A 4MH5A 4THIA 3DM0A 2V3UA 2ZMBA 4NEDA 3V83A 1P1UA 2RINA 3TKDA 1B4ZA 4XKNA 4QFKA 4RPOA 4I1DA 3OO6A 5AE4A 3OEMA 3SEVA 4AQ4A 1IXCA 1NNFA 2OLBA 1HSJA 1IITA 4RJZA 4LZ5A 3KSJA 3K0VA 4NF6A 2X26A 1MPBA 3ILUB 1A99A 4X1DA 3MVZA 1MH4A 4RA1A 3RQTA 3IJOB 4EUOA 3T66A 1LAFE 4G68C 4PFTA 2RCAA 3K6VA 3K1MA 4R75A 2ZYNA 5DYHA 2XX8A 1B52A 2O84X 3PUZE 4JWXA 3HCQA 1PB8A 1B46A 4LA9A 1S7YA 4QSCA 1LSTA 4KR5A 4FIMA 3SEYA 4F1VA 4LUBA 1POY1 1DPPA 5I84A 3TYHA 4TLMB 4XKPA 4F3GA 4K3FA 1ZBMA 3KOTA 4WEDA 4HW8A 1QULA 1BLFA 2Q2CA 3M3FA 3U8QA 4IY6A 1JW4A 3LSWA 4DDDA 2V3TA 3DLNA 4IB2A 1FQAA 2AL5A 4IGTA 1HSLA 4YU0A 3S4UA 1MM7A 3DP6A 1LLSA 3T9XB 1A55A 3O2AA 4OTEA 3UORA 3TDJA 1USYH 1WODA 3CFLA 4ONYA 4PETA 2P1SA 3SETA 4YMAA 4L17A 1PBQA 2F78A 4PQJA 4HCWA 2XX7A 1EH3A 4YKKA 3C9HA 5TP9B 1RYOA 3CFZA 3JZJA 1LFIA 4YKIA 2O68A 1MPCA 3E3KA 2QMWA 3QIMA 4RPNA 1S50A 2F8DA 4BDNA 1XT8A 1HSEA 1B7HA 4RK2A 3VVFA 1BIYA 1IIWA 2F36A 1R9QA 3H03A 1XOCA 2PYYA 1FTJA 1Y1ZA 4H6DA 3K00A 4IO7A 4EXLA 1OVBA 2Z8DA 1P99A 1II5A 1ZLQA 4LVQA 2QS4A 3FUZA 3U92A 1B3GA 5FHNA 3U94A 1MM6A 3Q29A 1ZIUA 3MZ1A 4JSOA 4QFOA 2F6PA 3R26A 2DSFA 1S9TA 1M5FA 4U1ZA 4NF5B 3GXAA 4MBPA 2M8CA 3VDFA 3TFLA 3LSFB 1MPDA 2I0CA 5ICQA 3EPEA 3PPNA 1LAXA 2OWTA 4WXJA 5I59A 3VVEA 2B65A 3E9XA 1B0HA 3GBBA 1SYHA 2ZYOA 3PU5A 4PFYA 5DTBA 1B7ZA 2Q2AA 3O9PA 4R73A 2RC7A 3L6GA 2I49A 2Q88A 4Z7EA 2DXRA 1LFHA 3MVWA 3V89B 1CE2A 5ITPA 4OHNA 1RKMA 1DOTA 5A5XB 3K4UA 3OO8A 1SBPA 3O66A 4Q0CA 1N0TA 1XC1A 4IO2A 2DVZA 1NH7A 4FEDA 2XXVA 1SVXB 2QPQA 4Q30B 1JETA 2IEEA 4ZEKA 1UTHA 1IXHA 4GLIA 2DXYA 4F1UA 4ZECA 1A7LA 4LONB 1VE4A 4LZ7A 5KCJB 5TPAA 2XHDA 1R9LA 4F39A 4F22A 2ZNUA 3EF7A 5I58A 2YPNA 3TCGA 3U93A 4MLVA 1POTA 3M3KA 4JWYA 1XHYA 5ICTA 2CZLA 2PBWA 4OENA 3CSBA 3G3IA 3MPKA 4KQPA 1DTGA 4Z0IA 2P0SA 2DQVA 2XD2A 4QRZA 3KBRA 3IO6A 4ZZEA 1ZU0A 4POXA 2AIXA 2RCBA 3MQ9A 2Z23A 4DXBA 2UYFA 4JWOA 3MAMA 4G77A 3C34A 1N3WA 3MW0A 1B4HA 2G29A 4N07A 3SESA 1LBBA 2Q8JA 5FTIA 2CMOA 1IXIA 3N26A 1I6BA 3VLUA 1JEUA 2O51A 5CM6A 1MQHA 3ONMA 2Y7PA 1Z7NE 3S9EA 3KSXA 1ZJLA 3PUWE 1QUIA 4OQOA 1OLCA 3VXBA 1B9JA 5CBRA 1JNFA 3UP9A 3WAFA 1B32A 3LSLA 3FVNA 3UN6A 1UIVA 1MRPA 3O29A 2PT2A 5H8QB 1D4NA 4H1XA 1B3EA 3H3GA 4U22A 3GBAA 3RNNA 1LAGE 3JV9A 1FQEA 3K6UA 1SW1A 4ZE9A 1DPEA 4GF8A 3S9MC 2DE4A 3C4MA 4O3BA 1JW1A 2I4CA 1TWYA 1DMBA 1URGA 3N94A 3L6HA 1Y3NA 5CBSA 2RC8A 3IOVA 4ELQA 3O6IA 3VVDA 1YPNA 1B0LA 3CG1A 3G3HA 5H8HB 4XXUA 2HXWA 1Y20A 1SD3A 2D3IA 1FW0A 1ZTYA 4H0WA 4RXLA 3FXUA 5I59B 1FTKA 3FJ7A 1FTLA 3RTWB 1Y3QA 5L9SA 4DXUA 4Q5TA 3TEPA 2V93A 2ZYKA 4G68A 3ODBA 3T93B 2XXYA 5AA1A 1WVJA 1GTKA 1YCJA 2I3VA 2DWAA 3MP1A 4U1OA 2DP8A 3PV0E 4EQ7A 2O69A 5H8FB 4H5GA 4WEPA 1MQGA 1PBPA 4GQOA 3FVOA 2XXXA 2F7CA 1LBCA 3VV5A 1DSNA 5CMKA 1D9YA 3IO4A 2PVUA 1B3FA 2E1SA 1UTHB 4QSDA 2OK2A 2QS3A 1XVXA 2Y84A 2Z8FA 4HTGA 2VGQA 4OMBA 2QRYA 5M2VA 1O63A 1IUDA 2G93A 4IO4A 4AB6A 1UTBB 3PPRA 2KLFA 5ELVA 3FJGA 1FQDA 4JBZA 3BBRA 3S9NC 3FV2A 3QXMA 3IOWA 1EZ9A 3Q27A 4P0IA 4OWDA 3K1NA 1MG1A 4HS7A 3IX1A 2X7PA 4DLDA 2I4BA 4E0XA 3CFXA 1YTVA 5CI5A 3BFUA 3H7MA 4NWCA 4NWDA 1Z7ME 5I2KA 5F7VA 5AA4B 4MLQA 1JEVA 5I56A 1P1NA 5H8NA 3IR1A 1M5CA 1FQBA 4ELPA 2XXIA 1B51A 4KYSA 1CB6A 3OOAA 2LAOA 4UACA 4YAHX 1VR5A 4F3BA 1IZ1A 1MS7A 3IOTA 4YZZA 1B1XA 4F1YA 3K1PA 4OEVA 3EHUA 1ANFA 1P1QA 4R2BA 3PUYE 4H65A 1OQGA 2F7AA 1MXXA 1B58A 4JB7A 4OETA 3RTFB 2QL3A 3B6QA 3A3UA 3RPWA 1OQHA 3PPPA 5I57A 2GH9A 3I5OA 1LB8A 2UVJA 1IXGA 3G3FA 3OMBA 4EQBA 1AMFA 2RC9A 5JTYB 4PE5B 1H43A 3OO9A 5CMBA 1A8EA 4F29A 3FXQA 5AA2D 2PT1A 4H5FA 1BKAA 2VP1A 4R2FA 1SI1A 4OEUA 4OFJA 3ECRA 4GL0A 2HAUA 5L8DA 2O1LA 2I58A 4M4GA 3MZBA 2AL4A 1J1NA 2QMXA 1B6HA 5FTHA 5IAIA 4M1VA 2NXOA 4NTLA 5DEXA 4HCYA 2DWJA 1URDA 3MVXA 3C32A 3MBPA 4KI0E 3IORA 3VXCA 3DP8A 4G4PA 2XXHA 1MXYA 3TTLA 1N76A 5ISUA 4ECFA 4IO3A 4RYAA 2O6AA 4F2QA 3PMXA 4RY1A 4GWOA 4NF8A 1MY4A 5I2NA 3A09A 1MY1A 2ONKE 3ZS6A 1US5A 1OMPA 2UVIA 4QHQA 4N6PA 3KEIA 3G7WA 2F97A 4TLLB 4YICA 1SW4A 4YKPA 1MXZA 1B3LA 1SYIA 3R7XA 1N84A 3OENA 1LCTA 2REGA 4RK9A 1PB7A 1ZKBA 4GRKA 1YAEA 3SEXA 2BJJX 4KCDA 3H6WA 3N5LA 3LC8A 3BKIB 1B7UA 4U21A 5EHSA 2A5TA 4FATA 4G2ZA 3AXFA 2H98A 1N3XA 3B7DA 3TPAA 5TU0A 1JW5A 4NF6B 3KJ7A 1QJMA 1URSA 3ILTB 4MF3A 3MP6A 1H44A 2Q9TA 5H8SA 1QUJA 4BLAA 3CR9A 4NMYA 2ZYMA 2REJA 1MXVA 2H99A 3PPQA 4KYEA 3ZSFA 4F19A 1FTMA 4C0RA 2HCAA 3SEWA 3V5AA 3TMGA 4YMBA 2FA7A 1NL5A 3HV1A 2XX9A 2OJTA 3CSGA 1TFAA 3EQ1A 2A5SA 2DOJA 3JYRA 1OLAA 1TXFA 2ABHA 5I56B 2XXUA 4TOZA 5H8NB 1LB9A 4F3PA 5KDTA 3N6TA 3T22A 4BDOA 3IAZA 2DWHA 4ND9A 2DE3A 1KWHA 2HFBA 3O6HA 1DTZA 4ZEIA 3W15C 2F5XA 1D3KA 3N6UA 1BTJA 2B3BA 3UGWA 4WKMA 1LFGA 1ELJA 1Y3PA 3T9HB 3PMVA 2FYIA 3V8XB 3H6VA 4LP2B 3VFJA 1UIUA 4XTCQ 3G3JA 1NNTA 3TQLA 3HHFA 3FATA 3BFTA 5DVFA 1SI0A 4ZEDA 4ZDMA 1R6ZA 1PB9A 3FVGA 4FJPA 4P0GA 2Y7RA 4F3SA 5BWJA 3IB0A 3GLBA 4EXKA 2DVCA 4R9FA 2PMSA 3S2VA 2ANJA 2FNCA 2O1MA 3MUQA 5JEIA 1GR2A 3RT6B 1TFDA 1QKAA 3KZGA 1MQDA 3RUMA 3TCFA 3K2DA 2GHBA 3QK6A 3IK6B 4ZEBA 3QUJA 4LQ2A 5ITOA 5DEXB 2VD2A 3FVKA 1GV8A 1FCKA 5B70A 2F6GA 3TQWA 1FQFA 3O6GA 2H9BA 2HEUA 3UIFA 2ONSA 1WDNA 3FV1A 1NMUA 2XD3A 3PMWA 1ATGA 3TELA 3M8UA 2E0SA 1PC3A 2RF1A 1RYXA 3QYTA 5DVJA 3OSQA 1QKBA 5CRYA 4X1BA 4YB6A 1Y9UA 2O7UA 3P7IA 1SW2A 2UXAA 3ZKKA 1R1NA 3MPLA 3TTRA 1B1HA 3TTNA 1PEBA 4JDFA 2I0BA 3CG3A 3FGSA 1QVSA 3OD7A 5K2XA 4XKRA 4KPTA 4OFLA 4O3CA 3MJNA 1O64A 4FORA 4GIZA 4NF5A 2DE2A 4QFNA 2ALUA 3HHGA 3SKPA 2B3FA 3H6UA 5AA2A 1MH3A 2XXTA 4ESWA 2QS2A 1B5IA 1O7TA 2F34A 2Q89A 1US4A 4GD5A 5F1QA 3O28A 2H4IA 1JVYA 3RLFE 4QSEA 4GXSB 1FTOA 2NWJA 1B05A 5EYFA 3QAXA 1EU8A 1USYE 5BUUA 5TPAB 1Q35A 1SW5A 3UK4A 2R9JA 3PD8A 4N13A 3TTKA 5I58B 2XXQA 4H67A 4YKJA 2THIA 1SDXA 1XVYA 5A5XA 4GXAA 4PFWA 1UQWA 1B5JA 4OVJA 4U2RA 3TZAA 2RKMA 2QSXA 2HZKA 5KDTB 4X48A 3CVGA 4H8IA 1IQ7A 3K6WA 5LOMA 1P1WA 4BDRA 4Q8RA 4R6HA 4H8JA 1M5BA 5KCJA 3S9LC 3R6UA 2OZZA 4R72A 2D5WA 1PDAA 2QJEA 1MY3A 3MVYA 1OVTA 3RT8A 2ONRA 4EDPA 3RGYA 1MXUA 1BP5A 1B5HA 2HZLA 1JQFA 4G8NA 2ZNSA 2H25A 2IA4A 2NUVA 3VLVA 3RY3A 4AB5A 3PPOA 3IL1B 1MDP1 4I62A 1A8FA 2DS9A 2GFEA 2O7IA 2QS1A 4QFLA 4OFOA 4OZ9A 4E0WA 1MQIA 2V3QA 2V25A 4F18A 4IO6A 1NKXA 3THIA 2DYXA 3KN7A 3U72A 3TTMA 1Y4TA 3KN8A 4ZE8A 4F31B 3OELA 4U23A 4ISUA 5CMMA 3M3LA 3QSLA 4G8MA 4DCYA 2Y7IA 3KFMA 3LBSA 4LQ5A 3FJMA 5L9OA 3C33A 3LR1A 5KZTA 2VOZA 4IO5A 2ZNTA 4PFUA 3DELB 5H8QA 4G8HA 1H3DA 3I6VA 3Q28A 5HBCA 4GOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KD5 A;  1P1O A;  3QUF A;  4O3A A;  2F7B A;  2XXW A;  3MP8 A;  4EF1 A;  3K01 A;  2R6G E;  4LAT A;  4BDL A;  5J1D A;  3SER A;  3PGF A;  3LSX A;  1LGB C;  2R71 A;  2Y7K A;  2XXR A;  3PUX E;  3CIJ A;  4G68 B;  1N7X A;  4C1T A;  2X7Q A;  1MXW A;  2DWI A;  3CI8 A;  4IY5 A;  4OER A;  4P11 A;  3IB2 A;  1T0K A;  3A3C A;  5H8H A;  3T9U A;  2YJP A;  1H45 A;  3IOU A;  2XXP A;  5AA2 B;  1MY0 A;  1JVX A;  5DT6 A;  3D4C A;  4LZ8 A;  4DE8 A;  1ZMG A;  1L5T A;  2H5Y A;  3OEK A;  4I9D A;  3SDF A;  3USD A;  2V84 A;  1D9V A;  5FHM A;  3SEU A;  2AYS A;  3Q26 A;  3KJT A;  4ZEF A;  1QUK A;  4JSD A;  4NF4 A;  3DP4 A;  4KYD A;  4R74 A;  4DIG A;  2NOO A;  4OYV A;  5H8F A;  4YB5 A;  1AOV A;  4FEC A;  2WKY A;  3FIR A;  2PX1 A;  3H6T A;  4JXI A;  3E4R A;  1LAH E;  5CC2 A;  3HN0 A;  2OWS A;  1B2H A;  4ELR A;  3IJX B;  1N7W A;  3C35 A;  3EHS A;  3KOS A;  5AA3 A;  3EHT A;  5I2K B;  1TT1 A;  1VFE A;  1UTB A;  4GVO A;  3FXR A;  1MQJ A;  3KGC A;  2D21 A;  4OES A;  3EN3 A;  3U1O A;  3T96 B;  3VE1 B;  2VHA A;  1NH8 A;  2Y7W A;  5FHO A;  4ZZA A;  5EHM A;  3TCH A;  4DXC A;  2OBG A;  1I6Q A;  3KN3 A;  3GZG A;  5JK4 A;  5DVI A;  4KFQ A;  3H4Z A;  1XS5 A;  3TOD A;  2GHA A;  1MDQ A;  3C31 A;  3FAS A;  5K2Y A;  3PUV E;  4FE8 A;  5AA4 A;  3MWB A;  2UVH A;  1VFD A;  3HST A;  1NNP A;  4TQU Q;  3MZ9 A;  5I57 B;  2OCU A;  3TUS A;  4DZ1 A;  3C36 A;  3ZKL A;  2HQ0 A;  4GFR A;  1OIB A;  2GRV A;  1A40 A;  4FEB A;  1EZP A;  3OO7 A;  1Y1M A;  3UA8 A;  1A54 A;  4BDM A;  3TAJ A;  1NFT A;  4FAJ A;  4NE4 A;  2Z8E A;  3Q25 A;  4EQ9 A;  3K6X A;  4KCC A;  4EF2 A;  4KHZ E;  4ESX A;  2YLN A;  4R6Y A;  1QW0 A;  1EZO A;  4I8C A;  4IGR A;  1VSO A;  3IB1 A;  4U4X A;  2I48 A;  1AL3 A;  2P2A A;  4DCX A;  2W7Y A;  3OXN A;  5TP9 A;  5JTY A;  3T9V A;  1N04 A;  4BDQ A;  1H76 A;  3OSR A;  1FQC A;  3CRB A;  1MY2 A;  2VD3 A;  1B40 A;  3HPI A;  5CMC A;  2UYE A;  1Y4C A;  1IEJ A;  2ZXT A;  3MC2 A;  3LUY A;  1M5E A;  4ZS9 A;  4R9G A;  2ESN A;  1NNK A;  4YB7 A;  4C1U A;  4MFI A;  3E13 X;  3I3V A;  4X9T A;  3B6W A;  4POW A;  2NVU B;  3B6T A;  5L9M A;  4NF8 B;  1I69 A;  5I2N B;  4RNS A;  4U4S A;  3KG2 A;  3W9W A;  2I3W A;  4ELO A;  2HAV A;  4R6K A;  4QF9 A;  3VLW A;  1GGG A;  4PP0 A;  1F9B A;  3H06 B;  3HO7 A;  5HM4 B;  3FZV A;  4XIG Q;  4XKQ A;  3G3K A;  3RN8 A;  5B7D A;  3WAE A;  5IKB A;  4OXV A;  1SQY A;  3FD3 A;  3PD9 A;  3D4G A;  2UVG A;  2F35 A;  5HPQ A;  3W9V A;  2A5T B;  4GL8 A;  4UA8 A;  1M5D A;  2Z22 A;  3F11 A;  4NF4 B;  2I6E A;  1I6A A;  4QFP A;  1GVC A;  1B3H A;  1AIV A;  1LCF A;  1AH5 A;  1Q1K A;  3K02 A;  4F2O A;  3G3G A;  3O97 A;  4MH5 A;  4THI A;  3DM0 A;  2V3U A;  2ZMB A;  4NED A;  3V83 A;  1P1U A;  2RIN A;  3TKD A;  1B4Z A;  4XKN A;  4QFK A;  4RPO A;  4I1D A;  3OO6 A;  5AE4 A;  3OEM A;  3SEV A;  4AQ4 A;  1IXC A;  1NNF A;  2OLB A;  1HSJ A;  1IIT A;  4RJZ A;  4LZ5 A;  3KSJ A;  3K0V A;  4NF6 A;  2X26 A;  1MPB A;  3ILU B;  1A99 A;  4X1D A;  3MVZ A;  1MH4 A;  4RA1 A;  3RQT A;  3IJO B;  4EUO A;  3T66 A;  1LAF E;  4G68 C;  4PFT A;  2RCA A;  3K6V A;  3K1M A;  4R75 A;  2ZYN A;  5DYH A;  2XX8 A;  1B52 A;  2O84 X;  3PUZ E;  4JWX A;  3HCQ A;  1PB8 A;  1B46 A;  4LA9 A;  1S7Y A;  4QSC A;  1LST A;  4KR5 A;  4FIM A;  3SEY A;  4F1V A;  4LUB A;  1POY 1;  1DPP A;  5I84 A;  3TYH A;  4TLM B;  4XKP A;  4F3G A;  4K3F A;  1ZBM A;  3KOT A;  4WED A;  4HW8 A;  1QUL A;  1BLF A;  2Q2C A;  3M3F A;  3U8Q A;  4IY6 A;  1JW4 A;  3LSW A;  4DDD A;  2V3T A;  3DLN A;  4IB2 A;  1FQA A;  2AL5 A;  4IGT A;  1HSL A;  4YU0 A;  3S4U A;  1MM7 A;  3DP6 A;  1LLS A;  3T9X B;  1A55 A;  3O2A A;  4OTE A;  3UOR A;  3TDJ A;  1USY H;  1WOD A;  3CFL A;  4ONY A;  4PET A;  2P1S A;  3SET A;  4YMA A;  4L17 A;  1PBQ A;  2F78 A;  4PQJ A;  4HCW A;  2XX7 A;  1EH3 A;  4YKK A;  3C9H A;  5TP9 B;  1RYO A;  3CFZ A;  3JZJ A;  1LFI A;  4YKI A;  2O68 A;  1MPC A;  3E3K A;  2QMW A;  3QIM A;  4RPN A;  1S50 A;  2F8D A;  4BDN A;  1XT8 A;  1HSE A;  1B7H A;  4RK2 A;  3VVF A;  1BIY A;  1IIW A;  2F36 A;  1R9Q A;  3H03 A;  1XOC A;  2PYY A;  1FTJ A;  1Y1Z A;  4H6D A;  3K00 A;  4IO7 A;  4EXL A;  1OVB A;  2Z8D A;  1P99 A;  1II5 A;  1ZLQ A;  4LVQ A;  2QS4 A;  3FUZ A;  3U92 A;  1B3G A;  5FHN A;  3U94 A;  1MM6 A;  3Q29 A;  1ZIU A;  3MZ1 A;  4JSO A;  4QFO A;  2F6P A;  3R26 A;  2DSF A;  1S9T A;  1M5F A;  4U1Z A;  4NF5 B;  3GXA A;  4MBP A;  2M8C A;  3VDF A;  3TFL A;  3LSF B;  1MPD A;  2I0C A;  5ICQ A;  3EPE A;  3PPN A;  1LAX A;  2OWT A;  4WXJ A;  5I59 A;  3VVE A;  2B65 A;  3E9X A;  1B0H A;  3GBB A;  1SYH A;  2ZYO A;  3PU5 A;  4PFY A;  5DTB A;  1B7Z A;  2Q2A A;  3O9P A;  4R73 A;  2RC7 A;  3L6G A;  2I49 A;  2Q88 A;  4Z7E A;  2DXR A;  1LFH A;  3MVW A;  3V89 B;  1CE2 A;  5ITP A;  4OHN A;  1RKM A;  1DOT A;  5A5X B;  3K4U A;  3OO8 A;  1SBP A;  3O66 A;  4Q0C A;  1N0T A;  1XC1 A;  4IO2 A;  2DVZ A;  1NH7 A;  4FED A;  2XXV A;  1SVX B;  2QPQ A;  4Q30 B;  1JET A;  2IEE A;  4ZEK A;  1UTH A;  1IXH A;  4GLI A;  2DXY A;  4F1U A;  4ZEC A;  1A7L A;  4LON B;  1VE4 A;  4LZ7 A;  5KCJ B;  5TPA A;  2XHD A;  1R9L A;  4F39 A;  4F22 A;  2ZNU A;  3EF7 A;  5I58 A;  2YPN A;  3TCG A;  3U93 A;  4MLV A;  1POT A;  3M3K A;  4JWY A;  1XHY A;  5ICT A;  2CZL A;  2PBW A;  4OEN A;  3CSB A;  3G3I A;  3MPK A;  4KQP A;  1DTG A;  4Z0I A;  2P0S A;  2DQV A;  2XD2 A;  4QRZ A;  3KBR A;  3IO6 A;  4ZZE A;  1ZU0 A;  4POX A;  2AIX A;  2RCB A;  3MQ9 A;  2Z23 A;  4DXB A;  2UYF A;  4JWO A;  3MAM A;  4G77 A;  3C34 A;  1N3W A;  3MW0 A;  1B4H A;  2G29 A;  4N07 A;  3SES A;  1LBB A;  2Q8J A;  5FTI A;  2CMO A;  1IXI A;  3N26 A;  1I6B A;  3VLU A;  1JEU A;  2O51 A;  5CM6 A;  1MQH A;  3ONM A;  2Y7P A;  1Z7N E;  3S9E A;  3KSX A;  1ZJL A;  3PUW E;  1QUI A;  4OQO A;  1OLC A;  3VXB A;  1B9J A;  5CBR A;  1JNF A;  3UP9 A;  3WAF A;  1B32 A;  3LSL A;  3FVN A;  3UN6 A;  1UIV A;  1MRP A;  3O29 A;  2PT2 A;  5H8Q B;  1D4N A;  4H1X A;  1B3E A;  3H3G A;  4U22 A;  3GBA A;  3RNN A;  1LAG E;  3JV9 A;  1FQE A;  3K6U A;  1SW1 A;  4ZE9 A;  1DPE A;  4GF8 A;  3S9M C;  2DE4 A;  3C4M A;  4O3B A;  1JW1 A;  2I4C A;  1TWY A;  1DMB A;  1URG A;  3N94 A;  3L6H A;  1Y3N A;  5CBS A;  2RC8 A;  3IOV A;  4ELQ A;  3O6I A;  3VVD A;  1YPN A;  1B0L A;  3CG1 A;  3G3H A;  5H8H B;  4XXU A;  2HXW A;  1Y20 A;  1SD3 A;  2D3I A;  1FW0 A;  1ZTY A;  4H0W A;  4RXL A;  3FXU A;  5I59 B;  1FTK A;  3FJ7 A;  1FTL A;  3RTW B;  1Y3Q A;  5L9S A;  4DXU A;  4Q5T A;  3TEP A;  2V93 A;  2ZYK A;  4G68 A;  3ODB A;  3T93 B;  2XXY A;  5AA1 A;  1WVJ A;  1GTK A;  1YCJ A;  2I3V A;  2DWA A;  3MP1 A;  4U1O A;  2DP8 A;  3PV0 E;  4EQ7 A;  2O69 A;  5H8F B;  4H5G A;  4WEP A;  1MQG A;  1PBP A;  4GQO A;  3FVO A;  2XXX A;  2F7C A;  1LBC A;  3VV5 A;  1DSN A;  5CMK A;  1D9Y A;  3IO4 A;  2PVU A;  1B3F A;  2E1S A;  1UTH B;  4QSD A;  2OK2 A;  2QS3 A;  1XVX A;  2Y84 A;  2Z8F A;  4HTG A;  2VGQ A;  4OMB A;  2QRY A;  5M2V A;  1O63 A;  1IUD A;  2G93 A;  4IO4 A;  4AB6 A;  1UTB B;  3PPR A;  2KLF A;  5ELV A;  3FJG A;  1FQD A;  4JBZ A;  3BBR A;  3S9N C;  3FV2 A;  3QXM A;  3IOW A;  1EZ9 A;  3Q27 A;  4P0I A;  4OWD A;  3K1N A;  1MG1 A;  4HS7 A;  3IX1 A;  2X7P A;  4DLD A;  2I4B A;  4E0X A;  3CFX A;  1YTV A;  5CI5 A;  3BFU A;  3H7M A;  4NWC A;  4NWD A;  1Z7M E;  5I2K A;  5F7V A;  5AA4 B;  4MLQ A;  1JEV A;  5I56 A;  1P1N A;  5H8N A;  3IR1 A;  1M5C A;  1FQB A;  4ELP A;  2XXI A;  1B51 A;  4KYS A;  1CB6 A;  3OOA A;  2LAO A;  4UAC A;  4YAH X;  1VR5 A;  4F3B A;  1IZ1 A;  1MS7 A;  3IOT A;  4YZZ A;  1B1X A;  4F1Y A;  3K1P A;  4OEV A;  3EHU A;  1ANF A;  1P1Q A;  4R2B A;  3PUY E;  4H65 A;  1OQG A;  2F7A A;  1MXX A;  1B58 A;  4JB7 A;  4OET A;  3RTF B;  2QL3 A;  3B6Q A;  3A3U A;  3RPW A;  1OQH A;  3PPP A;  5I57 A;  2GH9 A;  3I5O A;  1LB8 A;  2UVJ A;  1IXG A;  3G3F A;  3OMB A;  4EQB A;  1AMF A;  2RC9 A;  5JTY B;  4PE5 B;  1H43 A;  3OO9 A;  5CMB A;  1A8E A;  4F29 A;  3FXQ A;  5AA2 D;  2PT1 A;  4H5F A;  1BKA A;  2VP1 A;  4R2F A;  1SI1 A;  4OEU A;  4OFJ A;  3ECR A;  4GL0 A;  2HAU A;  5L8D A;  2O1L A;  2I58 A;  4M4G A;  3MZB A;  2AL4 A;  1J1N A;  2QMX A;  1B6H A;  5FTH A;  5IAI A;  4M1V A;  2NXO A;  4NTL A;  5DEX A;  4HCY A;  2DWJ A;  1URD A;  3MVX A;  3C32 A;  3MBP A;  4KI0 E;  3IOR A;  3VXC A;  3DP8 A;  4G4P A;  2XXH A;  1MXY A;  3TTL A;  1N76 A;  5ISU A;  4ECF A;  4IO3 A;  4RYA A;  2O6A A;  4F2Q A;  3PMX A;  4RY1 A;  4GWO A;  4NF8 A;  1MY4 A;  5I2N A;  3A09 A;  1MY1 A;  2ONK E;  3ZS6 A;  1US5 A;  1OMP A;  2UVI A;  4QHQ A;  4N6P A;  3KEI A;  3G7W A;  2F97 A;  4TLL B;  4YIC A;  1SW4 A;  4YKP A;  1MXZ A;  1B3L A;  1SYI A;  3R7X A;  1N84 A;  3OEN A;  1LCT A;  2REG A;  4RK9 A;  1PB7 A;  1ZKB A;  4GRK A;  1YAE A;  3SEX A;  2BJJ X;  4KCD A;  3H6W A;  3N5L A;  3LC8 A;  3BKI B;  1B7U A;  4U21 A;  5EHS A;  2A5T A;  4FAT A;  4G2Z A;  3AXF A;  2H98 A;  1N3X A;  3B7D A;  3TPA A;  5TU0 A;  1JW5 A;  4NF6 B;  3KJ7 A;  1QJM A;  1URS A;  3ILT B;  4MF3 A;  3MP6 A;  1H44 A;  2Q9T A;  5H8S A;  1QUJ A;  4BLA A;  3CR9 A;  4NMY A;  2ZYM A;  2REJ A;  1MXV A;  2H99 A;  3PPQ A;  4KYE A;  3ZSF A;  4F19 A;  1FTM A;  4C0R A;  2HCA A;  3SEW A;  3V5A A;  3TMG A;  4YMB A;  2FA7 A;  1NL5 A;  3HV1 A;  2XX9 A;  2OJT A;  3CSG A;  1TFA A;  3EQ1 A;  2A5S A;  2DOJ A;  3JYR A;  1OLA A;  1TXF A;  2ABH A;  5I56 B;  2XXU A;  4TOZ A;  5H8N B;  1LB9 A;  4F3P A;  5KDT A;  3N6T A;  3T22 A;  4BDO A;  3IAZ A;  2DWH A;  4ND9 A;  2DE3 A;  1KWH A;  2HFB A;  3O6H A;  1DTZ A;  4ZEI A;  3W15 C;  2F5X A;  1D3K A;  3N6U A;  1BTJ A;  2B3B A;  3UGW A;  4WKM A;  1LFG A;  1ELJ A;  1Y3P A;  3T9H B;  3PMV A;  2FYI A;  3V8X B;  3H6V A;  4LP2 B;  3VFJ A;  1UIU A;  4XTC Q;  3G3J A;  1NNT A;  3TQL A;  3HHF A;  3FAT A;  3BFT A;  5DVF A;  1SI0 A;  4ZED A;  4ZDM A;  1R6Z A;  1PB9 A;  3FVG A;  4FJP A;  4P0G A;  2Y7R A;  4F3S A;  5BWJ A;  3IB0 A;  3GLB A;  4EXK A;  2DVC A;  4R9F A;  2PMS A;  3S2V A;  2ANJ A;  2FNC A;  2O1M A;  3MUQ A;  5JEI A;  1GR2 A;  3RT6 B;  1TFD A;  1QKA A;  3KZG A;  1MQD A;  3RUM A;  3TCF A;  3K2D A;  2GHB A;  3QK6 A;  3IK6 B;  4ZEB A;  3QUJ A;  4LQ2 A;  5ITO A;  5DEX B;  2VD2 A;  3FVK A;  1GV8 A;  1FCK A;  5B70 A;  2F6G A;  3TQW A;  1FQF A;  3O6G A;  2H9B A;  2HEU A;  3UIF A;  2ONS A;  1WDN A;  3FV1 A;  1NMU A;  2XD3 A;  3PMW A;  1ATG A;  3TEL A;  3M8U A;  2E0S A;  1PC3 A;  2RF1 A;  1RYX A;  3QYT A;  5DVJ A;  3OSQ A;  1QKB A;  5CRY A;  4X1B A;  4YB6 A;  1Y9U A;  2O7U A;  3P7I A;  1SW2 A;  2UXA A;  3ZKK A;  1R1N A;  3MPL A;  3TTR A;  1B1H A;  3TTN A;  1PEB A;  4JDF A;  2I0B A;  3CG3 A;  3FGS A;  1QVS A;  3OD7 A;  5K2X A;  4XKR A;  4KPT A;  4OFL A;  4O3C A;  3MJN A;  1O64 A;  4FOR A;  4GIZ A;  4NF5 A;  2DE2 A;  4QFN A;  2ALU A;  3HHG A;  3SKP A;  2B3F A;  3H6U A;  5AA2 A;  1MH3 A;  2XXT A;  4ESW A;  2QS2 A;  1B5I A;  1O7T A;  2F34 A;  2Q89 A;  1US4 A;  4GD5 A;  5F1Q A;  3O28 A;  2H4I A;  1JVY A;  3RLF E;  4QSE A;  4GXS B;  1FTO A;  2NWJ A;  1B05 A;  5EYF A;  3QAX A;  1EU8 A;  1USY E;  5BUU A;  5TPA B;  1Q35 A;  1SW5 A;  3UK4 A;  2R9J A;  3PD8 A;  4N13 A;  3TTK A;  5I58 B;  2XXQ A;  4H67 A;  4YKJ A;  2THI A;  1SDX A;  1XVY A;  5A5X A;  4GXA A;  4PFW A;  1UQW A;  1B5J A;  4OVJ A;  4U2R A;  3TZA A;  2RKM A;  2QSX A;  2HZK A;  5KDT B;  4X48 A;  3CVG A;  4H8I A;  1IQ7 A;  3K6W A;  5LOM A;  1P1W A;  4BDR A;  4Q8R A;  4R6H A;  4H8J A;  1M5B A;  5KCJ A;  3S9L C;  3R6U A;  2OZZ A;  4R72 A;  2D5W A;  1PDA A;  2QJE A;  1MY3 A;  3MVY A;  1OVT A;  3RT8 A;  2ONR A;  4EDP A;  3RGY A;  1MXU A;  1BP5 A;  1B5H A;  2HZL A;  1JQF A;  4G8N A;  2ZNS A;  2H25 A;  2IA4 A;  2NUV A;  3VLV A;  3RY3 A;  4AB5 A;  3PPO A;  3IL1 B;  1MDP 1;  4I62 A;  1A8F A;  2DS9 A;  2GFE A;  2O7I A;  2QS1 A;  4QFL A;  4OFO A;  4OZ9 A;  4E0W A;  1MQI A;  2V3Q A;  2V25 A;  4F18 A;  4IO6 A;  1NKX A;  3THI A;  2DYX A;  3KN7 A;  3U72 A;  3TTM A;  1Y4T A;  3KN8 A;  4ZE8 A;  4F31 B;  3OEL A;  4U23 A;  4ISU A;  5CMM A;  3M3L A;  3QSL A;  4G8M A;  4DCY A;  2Y7I A;  3KFM A;  3LBS A;  4LQ5 A;  3FJM A;  5L9O A;  3C33 A;  3LR1 A;  5KZT A;  2VOZ A;  4IO5 A;  2ZNT A;  4PFU A;  3DEL B;  5H8Q A;  4G8H A;  1H3D A;  3I6V A;  3Q28 A;  5HBC A;  4GOT A; 
#chains in the Genus database with same CATH topology
 4KD5 A;  1P1O A;  3QUF A;  4O3A A;  2F7B A;  2XXW A;  3MP8 A;  4EF1 A;  3K01 A;  2R6G E;  3GYY A;  4LAT A;  4BDL A;  5J1D A;  3SER A;  3PGF A;  3LSX A;  2PCR A;  1LGB C;  3MST A;  2R71 A;  2Y7K A;  2XXR A;  3PUX E;  3CIJ A;  1CNQ A;  4G68 B;  1N7X A;  4C1T A;  2X7Q A;  1MXW A;  2DWI A;  3CI8 A;  4IY5 A;  4GX3 A;  4OER A;  4P11 A;  3IB2 A;  1T0K A;  3A3C A;  2GQ1 A;  3EKI A;  5H8H A;  3T9U A;  2YJP A;  1H45 A;  3IOU A;  2XXP A;  5DW8 A;  5AA2 B;  2QVR A;  1MY0 A;  1JVX A;  5DT6 A;  3D4C A;  4JVC A;  4LZ8 A;  4DE8 A;  2P3V A;  1ZMG A;  1L5T A;  1K9Y A;  2H5Y A;  3OEK A;  4I9D A;  3SDF A;  3USD A;  2V84 A;  1D9V A;  5FHM A;  3SEU A;  2Y5K A;  2AYS A;  3Q26 A;  5IGA A;  3KJT A;  1G0H A;  4ZEF A;  1QUK A;  4JSD A;  1DK4 A;  4NF4 A;  3DP4 A;  4KYD A;  4MNP A;  4R74 A;  4DIG A;  2BJI A;  4MIJ A;  2NOO A;  4OYV A;  5H8F A;  4YB5 A;  4OVQ A;  1AOV A;  4FEC A;  2WKY A;  3FIR A;  2PX1 A;  3H6T A;  4JXI A;  3E4R A;  2CZK A;  1LAH E;  4NHB A;  5CC2 A;  3HN0 A;  5FBP A;  2OWS A;  1B2H A;  4ELR A;  3IJX B;  1N7W A;  2HHM A;  4MX6 A;  3C35 A;  3EHS A;  3KOS A;  5AA3 A;  5EYH A;  3EHT A;  5I2K B;  1TT1 A;  5IZ3 A;  4MAG A;  2B4L A;  1VFE A;  1UTB A;  4PDH A;  4GVO A;  4GWW A;  3FXR A;  4X8R A;  4P3L A;  1MQJ A;  3KGC A;  2D21 A;  4OES A;  3EN3 A;  4MMP A;  4H46 A;  3U1O A;  3T96 B;  3VE1 B;  2VHA A;  1NH8 A;  1FPF A;  2Y7W A;  5FHO A;  4ZZA A;  5EHM A;  3TCH A;  4DXC A;  2OBG A;  1I6Q A;  4N4U A;  3KN3 A;  3GZG A;  4PBQ A;  5JK4 A;  1YYZ A;  1KA1 A;  5DVI A;  4KFQ A;  3B8B A;  3H4Z A;  1INP A;  1XS5 A;  3TOD A;  2GHA A;  1MDQ A;  3C31 A;  3FAS A;  5K2Y A;  1EYJ A;  3PUV E;  4FE8 A;  4N91 A;  5AA4 A;  3MWB A;  2UVH A;  2HXR A;  1VFD A;  3HST A;  1NNP A;  4TQU Q;  3MZ9 A;  4AS4 A;  5I57 B;  2OCU A;  3TUS A;  4DZ1 A;  3C36 A;  3ZKL A;  2HQ0 A;  4GFR A;  1OIB A;  2GRV A;  2F3B A;  1A40 A;  4FEB A;  1EZP A;  2B4M A;  4MHF A;  3IFA A;  3RYD A;  3OO7 A;  1Y1M A;  3BIH A;  1A54 A;  3UA8 A;  4BDM A;  1FPD A;  3TAJ A;  1NFT A;  3T1B A;  4FAJ A;  1NUX A;  4NE4 A;  2Z8E A;  3Q25 A;  5ET7 A;  4EQ9 A;  3K6X A;  4KCC A;  4EF2 A;  4KHZ E;  4R6Y A;  2YLN A;  4ESX A;  1QW0 A;  1EZO A;  4I8C A;  4IGR A;  1VSO A;  3IB1 A;  4U4X A;  2I48 A;  1AL3 A;  2P2A A;  4DCX A;  2W7Y A;  3OXN A;  5TP9 A;  5JTY A;  3T9V A;  1N04 A;  4BDQ A;  1H76 A;  3OSR A;  1FQC A;  1NI9 A;  1Q9D A;  3CRB A;  1MY2 A;  2VD3 A;  1B40 A;  3HPI A;  4XF5 A;  5CMC A;  2CZH A;  2UYE A;  1Y4C A;  1IEJ A;  4GBV A;  2ZXT A;  2F3D A;  3MC2 A;  4QBA A;  3LUY A;  1M5E A;  4ZS9 A;  4R9G A;  2ESN A;  3U65 A;  1QGX A;  1NNK A;  4YB7 A;  1YXI A;  4C1U A;  4MFI A;  3E13 X;  3I3V A;  4X9T A;  3B6W A;  4POW A;  2NVU B;  3B6T A;  5L9M A;  4NF8 B;  1I69 A;  5I2N B;  4RNS A;  4U4S A;  3KG2 A;  2XA5 A;  3W9W A;  4X04 A;  2I3W A;  4ELO A;  2HAV A;  4R6K A;  4QF9 A;  3VLW A;  1GGG A;  4PP0 A;  1F9B A;  3H06 B;  4MCO A;  3HO7 A;  5HM4 B;  3FZV A;  5IZZ A;  4XIG Q;  4XKQ A;  3G3K A;  3RN8 A;  5B7D A;  3WAE A;  5IKB A;  4OXV A;  1SQY A;  3FD3 A;  3PD9 A;  3D4G A;  2UVG A;  2F35 A;  4XFE A;  5HPQ A;  4I40 A;  5LDZ A;  3W9V A;  4PC9 A;  2A5T B;  4GL8 A;  4OVS A;  4UA8 A;  1M5D A;  2Z22 A;  3F11 A;  4NF4 B;  2I6E A;  1I6A A;  4QFP A;  1GVC A;  1B3H A;  1AIV A;  4PFR A;  1LCF A;  1AH5 A;  1Q1K A;  3K02 A;  4F2O A;  3G3G A;  3O97 A;  4MH5 A;  4THI A;  3DM0 A;  4DI4 B;  4XEQ A;  1FRP A;  2FIE A;  2V3U A;  2ZMB A;  4NED A;  3V83 A;  4PE3 A;  1P1U A;  2RIN A;  1D9Q A;  4XKN A;  1B4Z A;  3TKD A;  4QFK A;  4RPO A;  4I1D A;  3OO6 A;  5AE4 A;  3KC1 A;  2XXK A;  3OEM A;  3SEV A;  4AQ4 A;  1IXC A;  1NNF A;  2OLB A;  1HSJ A;  1IIT A;  4RJZ A;  4LZ5 A;  3KSJ A;  3K0V A;  4NF6 A;  2X26 A;  1MPB A;  3ILU B;  1A99 A;  4X1D A;  3MVZ A;  1MH4 A;  4RA1 A;  3RQT A;  3IJO B;  4EUO A;  3T66 A;  1LAF E;  4G68 C;  4PFT A;  2KR0 A;  2RCA A;  3K6V A;  3K1M A;  4R75 A;  2ZYN A;  5DYH A;  2XX8 A;  1B52 A;  2O84 X;  3PUZ E;  4JWX A;  3HCQ A;  1PB8 A;  4PGP A;  1B46 A;  4LA9 A;  1S7Y A;  2QVU A;  1FBG A;  4QSC A;  1LST A;  4KR5 A;  1NUZ A;  4FIM A;  3SEY A;  4F1V A;  4LUB A;  4PAK A;  1POY 1;  1DPP A;  1FPG A;  5I84 A;  3TYH A;  4TLM B;  4N8Y A;  4XKP A;  4F3G A;  4K3F A;  1ZBM A;  3KOT A;  4WED A;  4HW8 A;  1QUL A;  1BLF A;  2Q2C A;  3M3F A;  3U8Q A;  4IY6 A;  2JJK A;  1JW4 A;  3T0J A;  4GX6 A;  3LSW A;  1FPI A;  1NV5 A;  4DDD A;  2V3T A;  3DLN A;  4IB2 A;  1FQA A;  2AL5 A;  5J16 A;  4IGT A;  3IFC A;  1HSL A;  4YU0 A;  1NV0 A;  3S4U A;  1MM7 A;  3DP6 A;  4PAI A;  1LLS A;  1VDW A;  3T9X B;  1A55 A;  3O2A A;  2OX3 A;  4OTE A;  4HE0 A;  3UOR A;  3TDJ A;  1USY H;  4PCD A;  1WOD A;  3CFL A;  4ONY A;  4PET A;  2P1S A;  3SET A;  4YMA A;  4L17 A;  1PBQ A;  2F78 A;  4PQJ A;  4HCW A;  2XX7 A;  1SPI A;  1NV7 A;  1EH3 A;  2XWI A;  4YKK A;  1EYK A;  3C9H A;  5TP9 B;  1RYO A;  3CFZ A;  3JZJ A;  1LFI A;  4YKI A;  2O68 A;  1MPC A;  3E3K A;  2QMW A;  3QIM A;  4HXV A;  4RPN A;  1S50 A;  2F8D A;  4GWU A;  4BDN A;  1XT8 A;  1HSE A;  1B7H A;  4RK2 A;  3VVF A;  1BIY A;  1IIW A;  2F36 A;  1R9Q A;  3H03 A;  1XOC A;  2PYY A;  1FTJ A;  1Y1Z A;  4H6D A;  3K00 A;  4IO7 A;  4NF0 A;  4EXL A;  1OVB A;  2Z8D A;  1P99 A;  1II5 A;  1ZLQ A;  4LVQ A;  2QS4 A;  3FUZ A;  3U92 A;  1B3G A;  5FHN A;  3U94 A;  1MM6 A;  3Q29 A;  1ZIU A;  2VT5 A;  3MZ1 A;  4JSO A;  4QFO A;  2F6P A;  3R26 A;  4N6K A;  2DSF A;  1S9T A;  1M5F A;  4U1Z A;  4NF5 B;  1LBW A;  3GXA A;  4MBP A;  2M8C A;  3VDF A;  3LUZ A;  3TFL A;  3LSF B;  1MPD A;  2I0C A;  4IR8 A;  5ICQ A;  3EPE A;  3PPN A;  1LAX A;  2OWT A;  4WXJ A;  5I59 A;  3VVE A;  2B65 A;  3E9X A;  1B0H A;  3GBB A;  1SYH A;  2ZYO A;  3PU5 A;  4PFY A;  5DTB A;  1B7Z A;  2Q2A A;  3O9P A;  4R73 A;  2PFY A;  2RC7 A;  3L6G A;  2I49 A;  2Q88 A;  3D1R A;  4P56 A;  4Z7E A;  4I3Y A;  2DXR A;  1LFH A;  3MVW A;  3V89 B;  1CE2 A;  5ITP A;  2Y5L A;  4GWX A;  4OHN A;  1RKM A;  1DOT A;  3RPL B;  5A5X B;  3K4U A;  3OO8 A;  1SBP A;  3O66 A;  4Q0C A;  3ISP A;  1N0T A;  4OAN A;  1XC1 A;  4IO2 A;  2DVZ A;  4N15 A;  1NH7 A;  4FED A;  5F24 A;  2XXV A;  1SVX B;  2QPQ A;  4Q30 B;  1JET A;  2IEE A;  4ZEK A;  1UTH A;  1IXH A;  4GLI A;  2DXY A;  4F1U A;  4ZEC A;  1A7L A;  4LON B;  1VE4 A;  4MEV A;  4LZ7 A;  5KCJ B;  5TPA A;  2XHD A;  1R9L A;  4F39 A;  4F22 A;  2ZNU A;  3EF7 A;  2KQZ A;  5I58 A;  2YPN A;  3TCG A;  2CEY A;  4GWZ A;  3U93 A;  4MLV A;  2WYK A;  1POT A;  3M3K A;  4JWY A;  4UAB A;  1XHY A;  5ICT A;  2CZL A;  2PBW A;  4OEN A;  3CSB A;  3G3I A;  3MPK A;  4JVI A;  4KQP A;  1DTG A;  4Z0I A;  2P0S A;  2DQV A;  2XD2 A;  4QRZ A;  4OVR A;  3KBR A;  3IO6 A;  4ZZE A;  4N17 A;  1ZU0 A;  4POX A;  2AIX A;  2RCB A;  3MQ9 A;  2Z23 A;  4DXB A;  2UYF A;  4HE2 A;  1NV1 A;  4JWO A;  3MAM A;  4G77 A;  3C34 A;  1N3W A;  3MW0 A;  1B4H A;  2G29 A;  4N07 A;  4KXP A;  3SES A;  1LBB A;  2Q8J A;  5FTI A;  2CMO A;  1IXI A;  3N26 A;  1FPJ A;  1I6B A;  3VLU A;  1JEU A;  2O51 A;  5CM6 A;  1MQH A;  3ONM A;  2Y7P A;  1Z7N E;  3E79 A;  1IMA A;  3S9E A;  3KSX A;  1ZJL A;  3PUW E;  3FBP A;  1QUI A;  4OQO A;  1OLC A;  3VXB A;  5I3S A;  1B9J A;  5CBR A;  1JNF A;  3UP9 A;  3WAF A;  1B32 A;  3LSL A;  3FVN A;  2FBP A;  3UN6 A;  1UIV A;  1NV2 A;  1MRP A;  1RDX A;  3O29 A;  2PT2 A;  5H8Q B;  1D4N A;  4H1X A;  1B3E A;  3H3G A;  4U22 A;  3GBA A;  3RNN A;  2MKZ A;  1LAG E;  4O94 A;  1FPK A;  3JV9 A;  1FJ6 A;  1FQE A;  3K6U A;  1SW1 A;  4ZE9 A;  1DPE A;  4GF8 A;  4QXD A;  3S9M C;  2DE4 A;  3C4M A;  4O3B A;  1JW1 A;  4GWS A;  2I4C A;  1TWY A;  3B50 A;  1DMB A;  1URG A;  3N94 A;  3MYU A;  3L6H A;  5I5P A;  2QFL A;  1Y3N A;  1G0I A;  4H45 A;  5CBS A;  2RC8 A;  3IOV A;  4ELQ A;  3O6I A;  3VVD A;  1YPN A;  5I7I A;  1B0L A;  3KBZ A;  4PDD A;  3CG1 A;  3G3H A;  5H8H B;  4XXU A;  2HXW A;  1Y20 A;  1SD3 A;  4I3E A;  2D3I A;  1FBH A;  1FW0 A;  1ZTY A;  4H0W A;  4RXL A;  3FXU A;  4DI3 D;  5I59 B;  1FTK A;  3FJ7 A;  1FTL A;  3RTW B;  1Y3Q A;  5L9S A;  4DXU A;  4Q5T A;  1FBP A;  3TEP A;  2V93 A;  2ZYK A;  1LBY A;  4G68 A;  2ZZV A;  3ODB A;  3T93 B;  2XXY A;  5AA1 A;  1WVJ A;  1GTK A;  2ZZW A;  1YCJ A;  2I3V A;  2DWA A;  3MP1 A;  4U1O A;  2DP8 A;  3PV0 E;  4EQ7 A;  2O69 A;  5H8F B;  4H5G A;  4WEP A;  1MQG A;  4PBH A;  2FHY A;  1PBP A;  4GQO A;  3FVO A;  2XXX A;  2F7C A;  1LBC A;  3VV5 A;  1DSN A;  5CMK A;  1D9Y A;  3IO4 A;  1FJ9 A;  2PVU A;  1B3F A;  2E1S A;  4P1L A;  1UTH B;  4QSD A;  2OK2 A;  2QS3 A;  1XVX A;  2Y84 A;  2Z8F A;  1JP4 A;  3LV0 A;  4HTG A;  2VGQ A;  4OMB A;  2QRY A;  3KC0 A;  5M2V A;  1O63 A;  1IUD A;  5IZ3 B;  2G93 A;  4IO4 A;  4AB6 A;  1UTB B;  3PPR A;  2KLF A;  5ELV A;  1FSA A;  3FJG A;  1FQD A;  1NV6 A;  4JBZ A;  2WX9 A;  3BBR A;  3S9N C;  3FV2 A;  1AWB A;  3QXM A;  1NV4 A;  3IOW A;  1EZ9 A;  3Q27 A;  4O8M A;  4OWD A;  4P0I A;  3K1N A;  1MG1 A;  4HS7 A;  3IX1 A;  2X7P A;  4DLD A;  2I4B A;  4E0X A;  3CFX A;  1YTV A;  5CI5 A;  3BFU A;  3H7M A;  1NUW A;  4NWC A;  4NWD A;  1Z7M E;  5I2K A;  1BK4 A;  5F7V A;  5AA4 B;  4MLQ A;  1JEV A;  5I56 A;  1P1N A;  5H8N A;  4N81 A;  3IR1 A;  1M5C A;  1FQB A;  4ELP A;  2XXI A;  1B51 A;  4KYS A;  1CB6 A;  3OOA A;  2LAO A;  4UAC A;  4YAH X;  1VR5 A;  4N6D A;  4F3B A;  1IZ1 A;  1MS7 A;  3IOT A;  4PF6 A;  4YZZ A;  1B1X A;  4F1Y A;  3K1P A;  4OEV A;  3EHU A;  1ANF A;  1P1Q A;  4R2B A;  3PUY E;  4H65 A;  1OQG A;  1IMC A;  2F7A A;  2WBB A;  1MXX A;  1B58 A;  4JB7 A;  4OET A;  3RTF B;  2QL3 A;  3B6Q A;  3A3U A;  3RPW A;  1OQH A;  3PPP A;  5I57 A;  2GH9 A;  3I5O A;  1LB8 A;  2UVJ A;  1IXG A;  3G3F A;  3OMB A;  1IMF A;  4EQB A;  1AMF A;  2RC9 A;  5JTY B;  1NUY A;  4PE5 B;  1H43 A;  3OO9 A;  1XI6 A;  1LBZ A;  5CMB A;  1A8E A;  4F29 A;  2FIX A;  3FXQ A;  5AA2 D;  2PT1 A;  4H5F A;  1BKA A;  2VP1 A;  4R2F A;  1SI1 A;  4NG7 A;  4NN3 A;  4OEU A;  4OFJ A;  3ECR A;  4GL0 A;  2HAU A;  5L8D A;  2O1L A;  5EQ8 A;  2I58 A;  4M4G A;  3MZB A;  2AL4 A;  1J1N A;  3CHG A;  2QMX A;  1B6H A;  5FTH A;  5IAI A;  4M1V A;  2NXO A;  4NTL A;  3A29 A;  4P8B A;  5DEX A;  3ROJ A;  4HCY A;  2ZZX A;  2QVV A;  2DWJ A;  1URD A;  5T3J A;  3MVX A;  5LTC A;  3C32 A;  3MBP A;  4KI0 E;  5EQA A;  3IOR A;  3VXC A;  3DP8 A;  5ET6 A;  2R8T A;  4G4P A;  2XXH A;  1MXY A;  3TTL A;  1N76 A;  1K9Z A;  5ISU A;  4ECF A;  1FPE A;  4PF8 A;  4IO3 A;  4RYA A;  2WEF A;  2O6A A;  1FBE A;  1IMD A;  4F2Q A;  3PMX A;  4RY1 A;  2PFZ A;  4GWO A;  4NF8 A;  1MY4 A;  1DCU A;  5I2N A;  3A09 A;  1MY1 A;  2ONK E;  3ZS6 A;  1US5 A;  1OMP A;  2UVI A;  4QHQ A;  4N6P A;  3KEI A;  4NAP A;  3G7W A;  2F97 A;  4TLL B;  4YIC A;  1SW4 A;  4YKP A;  1MXZ A;  1B3L A;  1SYI A;  3R7X A;  4HE1 A;  1N84 A;  3OEN A;  1LCT A;  2REG A;  1FBD A;  4RK9 A;  1PB7 A;  1ZKB A;  4GRK A;  1YAE A;  3SEX A;  2BJJ X;  4KCD A;  1LBV A;  3H6W A;  3N5L A;  3LC8 A;  3BKI B;  1B7U A;  4U21 A;  5EHS A;  2A5T A;  4FAT A;  4G2Z A;  3AXF A;  2H98 A;  1N3X A;  3B7D A;  5A5L A;  3TPA A;  5TU0 A;  2P3N A;  1JW5 A;  2VPN A;  4NF6 B;  4GWY A;  3KJ7 A;  1QJM A;  1URS A;  3ILT B;  4MF3 A;  3MP6 A;  1NV3 A;  1H44 A;  2Q9T A;  5H8S A;  1QUJ A;  2HPG A;  4G61 A;  4BLA A;  3CR9 A;  4NMY A;  2ZYM A;  2REJ A;  1MXV A;  2H99 A;  3PPQ A;  4KYE A;  3ZSF A;  1FBC A;  4F19 A;  4P9K A;  1FTM A;  4C0R A;  2HCA A;  4MJO A;  3SEW A;  3TMG A;  3V5A A;  4YMB A;  2FA7 A;  1NL5 A;  3HV1 A;  2L5V A;  2XX9 A;  2OJT A;  3CSG A;  1TFA A;  3EQ1 A;  4NGU A;  2A5S A;  2DOJ A;  3JYR A;  1OLA A;  1TXF A;  2ABH A;  1IMB A;  1DBZ A;  5I56 B;  2XXU A;  4TOZ A;  5H8N B;  1LB9 A;  4F3P A;  5KDT A;  3N6T A;  3T22 A;  3SZP A;  4BDO A;  3IAZ A;  4GBW A;  2DWH A;  4MNC A;  4ND9 A;  4O7M A;  2DE3 A;  1KWH A;  2HFB A;  3O6H A;  1DTZ A;  4ZEI A;  3W15 C;  5IZ1 A;  2F5X A;  3HFU A;  1D3K A;  3N6U A;  1BTJ A;  4OA4 A;  2B3B A;  1LEV A;  3UGW A;  2WYP A;  1RDY A;  4WKM A;  1LFG A;  1ELJ A;  5ESY A;  1Y3P A;  3T9H B;  3PMV A;  1LBX A;  2FYI A;  3V8X B;  4JVD A;  3H6V A;  4LP2 B;  3VFJ A;  1UIU A;  4XTC Q;  3G3J A;  1NNT A;  3TQL A;  3HHF A;  3FAT A;  3BFT A;  5DVF A;  1SI0 A;  3BIG A;  4ZED A;  4ZDM A;  1R6Z A;  1PB9 A;  3FVG A;  4FJP A;  4PFB A;  4O7I A;  4P0G A;  2Y7R A;  4F3S A;  5BWJ A;  3IB0 A;  5IM2 A;  3GLB A;  2FVZ A;  2DVC A;  4EXK A;  4R9F A;  2PMS A;  4NQ8 A;  3S2V A;  2ANJ A;  2FNC A;  2O1M A;  3MUQ A;  5JEI A;  1GR2 A;  3RT6 B;  1TFD A;  1QKA A;  2Q8M A;  3KZG A;  1MQD A;  3RUM A;  3TCF A;  3K2D A;  2GHB A;  3QK6 A;  3IK6 B;  4ZEB A;  3QUJ A;  4LQ2 A;  5ITO A;  5DEX B;  2VD2 A;  3FVK A;  1GV8 A;  1FCK A;  5B70 A;  2F6G A;  3TQW A;  1FQF A;  3O6G A;  2H9B A;  2HEU A;  3UIF A;  2ONS A;  1WDN A;  4LN5 A;  3FV1 A;  1NMU A;  2XD3 A;  3PMW A;  5EYG A;  1ATG A;  3TEL A;  3M8U A;  2E0S A;  1PC3 A;  1EYI A;  2RF1 A;  4PTK A;  1RYX A;  3QYT A;  5DVJ A;  3OSQ A;  1QKB A;  1FPB A;  5CRY A;  4X1B A;  4YB6 A;  1Y9U A;  2O7U A;  3P7I A;  1SW2 A;  2UXA A;  3ZKK A;  4FBP A;  1R1N A;  2XWV A;  3MPL A;  3TTR A;  2WBD A;  1B1H A;  3E78 A;  3TTN A;  1PEB A;  4JDF A;  2I0B A;  3CG3 A;  3FGS A;  1QVS A;  3OD7 A;  4NX1 A;  5K2X A;  4XKR A;  4KPT A;  4OFL A;  4O3C A;  3MJN A;  1O64 A;  4FOR A;  4GIZ A;  4NF5 A;  2DE2 A;  4QFN A;  2V4C A;  2ALU A;  3HHG A;  3SKP A;  2B3F A;  3H6U A;  5AA2 A;  5ET5 A;  1MH3 A;  2XXT A;  4ESW A;  3PTY A;  2QS2 A;  1B5I A;  1O7T A;  2F34 A;  2Q89 A;  1US4 A;  4GD5 A;  5F1Q A;  3O28 A;  2H4I A;  1JVY A;  3RLF E;  4P1E A;  4QSE A;  4GXS B;  1FTO A;  2NWJ A;  1B05 A;  5EYF A;  1KA0 A;  3QAX A;  1EU8 A;  1USY E;  4MNI A;  5BUU A;  5TPA B;  1Q35 A;  1SW5 A;  3UK4 A;  3FXB A;  2R9J A;  3PD8 A;  4N13 A;  3TTK A;  3NOH A;  5I58 B;  2XXQ A;  4H67 A;  4YKJ A;  2THI A;  1SDX A;  2CZI A;  1XVY A;  4N8G A;  5ET8 A;  4GXA A;  3RPL A;  5A5X A;  4PFW A;  4PAF A;  4GX4 A;  1UQW A;  1B5J A;  4OVJ A;  4U2R A;  3TZA A;  2RKM A;  2VPO A;  2QSX A;  1FTA A;  2HZK A;  5KDT B;  4X48 A;  3CVG A;  4H8I A;  1IQ7 A;  3K6W A;  5LOM A;  1P1W A;  4BDR A;  4Q8R A;  4R6H A;  2XWK A;  4H8J A;  1M5B A;  1RDZ A;  5KCJ A;  3S9L C;  3R6U A;  2OZZ A;  4R72 A;  2D5W A;  1PDA A;  2QJE A;  1MY3 A;  3MVY A;  1OVT A;  3RT8 A;  3QMF A;  2ONR A;  4EDP A;  3RGY A;  1KZ8 A;  1MXU A;  1FBF A;  1FPL A;  1BP5 A;  4AS5 A;  1B5H A;  2HZL A;  1JQF A;  2DDK A;  4G8N A;  2ZNS A;  2H25 A;  2IA4 A;  2NUV A;  2OWZ A;  3VLV A;  3RY3 A;  4AB5 A;  3PPO A;  3IL1 B;  4OVP A;  1IME A;  1MDP 1;  4I62 A;  2Q74 A;  1A8F A;  2DS9 A;  2GFE A;  2O7I A;  2QS1 A;  4QFL A;  4OFO A;  4OZ9 A;  4E0W A;  1MQI A;  2V3Q A;  2V25 A;  4F18 A;  4IO6 A;  1NKX A;  2DYX A;  3THI A;  3KN7 A;  3U72 A;  3TTM A;  1Y4T A;  4PFI A;  3KN8 A;  4P47 A;  4OVT A;  4ZE8 A;  2CEX A;  4F31 B;  3OEL A;  4U23 A;  4ISU A;  5CMM A;  3M3L A;  4G8M A;  3QSL A;  1YZ0 A;  4DCY A;  2Y7I A;  3KFM A;  5EQ7 A;  3LBS A;  4LQ5 A;  3FJM A;  5L9O A;  5EQ9 A;  3C33 A;  3LR1 A;  5KZT A;  2VOZ A;  4IO5 A;  2ZNT A;  4PFU A;  3DEL B;  5H8Q A;  4PGN A;  4G8H A;  2XWO A;  1H3D A;  3I6V A;  3Q28 A;  5HBC A;  4GOT A; 
#chains in the Genus database with same CATH homology
 4KD5 A;  1P1O A;  3QUF A;  4O3A A;  2F7B A;  2XXW A;  3MP8 A;  4EF1 A;  3K01 A;  2R6G E;  4LAT A;  4BDL A;  5J1D A;  3SER A;  3PGF A;  3LSX A;  1LGB C;  2R71 A;  2Y7K A;  2XXR A;  3PUX E;  3CIJ A;  4G68 B;  1N7X A;  4C1T A;  2X7Q A;  1MXW A;  2DWI A;  3CI8 A;  4IY5 A;  4OER A;  4P11 A;  3IB2 A;  1T0K A;  3A3C A;  5H8H A;  3T9U A;  2YJP A;  1H45 A;  3IOU A;  2XXP A;  5AA2 B;  1MY0 A;  1JVX A;  5DT6 A;  3D4C A;  4LZ8 A;  4DE8 A;  1ZMG A;  1L5T A;  2H5Y A;  3OEK A;  4I9D A;  3SDF A;  3USD A;  2V84 A;  1D9V A;  5FHM A;  3SEU A;  2AYS A;  3Q26 A;  3KJT A;  4ZEF A;  1QUK A;  4JSD A;  4NF4 A;  3DP4 A;  4KYD A;  4R74 A;  4DIG A;  2NOO A;  4OYV A;  5H8F A;  4YB5 A;  1AOV A;  4FEC A;  2WKY A;  3FIR A;  2PX1 A;  3H6T A;  4JXI A;  3E4R A;  1LAH E;  5CC2 A;  3HN0 A;  2OWS A;  1B2H A;  4ELR A;  3IJX B;  1N7W A;  3C35 A;  3EHS A;  3KOS A;  5AA3 A;  3EHT A;  5I2K B;  1TT1 A;  1VFE A;  1UTB A;  4GVO A;  3FXR A;  1MQJ A;  3KGC A;  2D21 A;  4OES A;  3EN3 A;  3U1O A;  3T96 B;  3VE1 B;  2VHA A;  1NH8 A;  2Y7W A;  5FHO A;  4ZZA A;  5EHM A;  3TCH A;  4DXC A;  2OBG A;  1I6Q A;  3KN3 A;  3GZG A;  5JK4 A;  5DVI A;  4KFQ A;  3H4Z A;  1XS5 A;  3TOD A;  2GHA A;  1MDQ A;  3C31 A;  3FAS A;  5K2Y A;  3PUV E;  4FE8 A;  5AA4 A;  3MWB A;  2UVH A;  1VFD A;  3HST A;  1NNP A;  4TQU Q;  3MZ9 A;  5I57 B;  2OCU A;  3TUS A;  4DZ1 A;  3C36 A;  3ZKL A;  2HQ0 A;  4GFR A;  1OIB A;  2GRV A;  1A40 A;  4FEB A;  1EZP A;  3OO7 A;  1Y1M A;  3UA8 A;  1A54 A;  4BDM A;  3TAJ A;  1NFT A;  4FAJ A;  4NE4 A;  2Z8E A;  3Q25 A;  4EQ9 A;  3K6X A;  4KCC A;  4EF2 A;  4KHZ E;  4ESX A;  2YLN A;  4R6Y A;  1QW0 A;  1EZO A;  4I8C A;  4IGR A;  1VSO A;  3IB1 A;  4U4X A;  2I48 A;  1AL3 A;  2P2A A;  4DCX A;  2W7Y A;  3OXN A;  5TP9 A;  5JTY A;  3T9V A;  1N04 A;  4BDQ A;  1H76 A;  3OSR A;  1FQC A;  3CRB A;  1MY2 A;  2VD3 A;  1B40 A;  3HPI A;  5CMC A;  2UYE A;  1Y4C A;  1IEJ A;  2ZXT A;  3MC2 A;  3LUY A;  1M5E A;  4ZS9 A;  4R9G A;  2ESN A;  1NNK A;  4YB7 A;  4C1U A;  4MFI A;  3E13 X;  3I3V A;  4X9T A;  3B6W A;  4POW A;  2NVU B;  3B6T A;  5L9M A;  4NF8 B;  1I69 A;  5I2N B;  4RNS A;  4U4S A;  3KG2 A;  3W9W A;  2I3W A;  4ELO A;  2HAV A;  4R6K A;  4QF9 A;  3VLW A;  1GGG A;  4PP0 A;  1F9B A;  3H06 B;  3HO7 A;  5HM4 B;  3FZV A;  4XIG Q;  4XKQ A;  3G3K A;  3RN8 A;  5B7D A;  3WAE A;  5IKB A;  4OXV A;  1SQY A;  3FD3 A;  3PD9 A;  3D4G A;  2UVG A;  2F35 A;  5HPQ A;  3W9V A;  2A5T B;  4GL8 A;  4UA8 A;  1M5D A;  2Z22 A;  3F11 A;  4NF4 B;  2I6E A;  1I6A A;  4QFP A;  1GVC A;  1B3H A;  1AIV A;  1LCF A;  1AH5 A;  1Q1K A;  3K02 A;  4F2O A;  3G3G A;  3O97 A;  4MH5 A;  4THI A;  3DM0 A;  2V3U A;  2ZMB A;  4NED A;  3V83 A;  1P1U A;  2RIN A;  3TKD A;  1B4Z A;  4XKN A;  4QFK A;  4RPO A;  4I1D A;  3OO6 A;  5AE4 A;  3OEM A;  3SEV A;  4AQ4 A;  1IXC A;  1NNF A;  2OLB A;  1HSJ A;  1IIT A;  4RJZ A;  4LZ5 A;  3KSJ A;  3K0V A;  4NF6 A;  2X26 A;  1MPB A;  3ILU B;  1A99 A;  4X1D A;  3MVZ A;  1MH4 A;  4RA1 A;  3RQT A;  3IJO B;  4EUO A;  3T66 A;  1LAF E;  4G68 C;  4PFT A;  2RCA A;  3K6V A;  3K1M A;  4R75 A;  2ZYN A;  5DYH A;  2XX8 A;  1B52 A;  2O84 X;  3PUZ E;  4JWX A;  3HCQ A;  1PB8 A;  1B46 A;  4LA9 A;  1S7Y A;  4QSC A;  1LST A;  4KR5 A;  4FIM A;  3SEY A;  4F1V A;  4LUB A;  1POY 1;  1DPP A;  5I84 A;  3TYH A;  4TLM B;  4XKP A;  4F3G A;  4K3F A;  1ZBM A;  3KOT A;  4WED A;  4HW8 A;  1QUL A;  1BLF A;  2Q2C A;  3M3F A;  3U8Q A;  4IY6 A;  1JW4 A;  3LSW A;  4DDD A;  2V3T A;  3DLN A;  4IB2 A;  1FQA A;  2AL5 A;  4IGT A;  1HSL A;  4YU0 A;  3S4U A;  1MM7 A;  3DP6 A;  1LLS A;  3T9X B;  1A55 A;  3O2A A;  4OTE A;  3UOR A;  3TDJ A;  1USY H;  1WOD A;  3CFL A;  4ONY A;  4PET A;  2P1S A;  3SET A;  4YMA A;  4L17 A;  1PBQ A;  2F78 A;  4PQJ A;  4HCW A;  2XX7 A;  1EH3 A;  4YKK A;  3C9H A;  5TP9 B;  1RYO A;  3CFZ A;  3JZJ A;  1LFI A;  4YKI A;  2O68 A;  1MPC A;  3E3K A;  2QMW A;  3QIM A;  4RPN A;  1S50 A;  2F8D A;  4BDN A;  1XT8 A;  1HSE A;  1B7H A;  4RK2 A;  3VVF A;  1BIY A;  1IIW A;  2F36 A;  1R9Q A;  3H03 A;  1XOC A;  2PYY A;  1FTJ A;  1Y1Z A;  4H6D A;  3K00 A;  4IO7 A;  4EXL A;  1OVB A;  2Z8D A;  1P99 A;  1II5 A;  1ZLQ A;  4LVQ A;  2QS4 A;  3FUZ A;  3U92 A;  1B3G A;  5FHN A;  3U94 A;  1MM6 A;  3Q29 A;  1ZIU A;  3MZ1 A;  4JSO A;  4QFO A;  2F6P A;  3R26 A;  2DSF A;  1S9T A;  1M5F A;  4U1Z A;  4NF5 B;  3GXA A;  4MBP A;  2M8C A;  3VDF A;  3TFL A;  3LSF B;  1MPD A;  2I0C A;  5ICQ A;  3EPE A;  3PPN A;  1LAX A;  2OWT A;  4WXJ A;  5I59 A;  3VVE A;  2B65 A;  3E9X A;  1B0H A;  3GBB A;  1SYH A;  2ZYO A;  3PU5 A;  4PFY A;  5DTB A;  1B7Z A;  2Q2A A;  3O9P A;  4R73 A;  2RC7 A;  3L6G A;  2I49 A;  2Q88 A;  4Z7E A;  2DXR A;  1LFH A;  3MVW A;  3V89 B;  1CE2 A;  5ITP A;  4OHN A;  1RKM A;  1DOT A;  5A5X B;  3K4U A;  3OO8 A;  1SBP A;  3O66 A;  4Q0C A;  1N0T A;  1XC1 A;  4IO2 A;  2DVZ A;  1NH7 A;  4FED A;  2XXV A;  1SVX B;  2QPQ A;  4Q30 B;  1JET A;  2IEE A;  4ZEK A;  1UTH A;  1IXH A;  4GLI A;  2DXY A;  4F1U A;  4ZEC A;  1A7L A;  4LON B;  1VE4 A;  4LZ7 A;  5KCJ B;  5TPA A;  2XHD A;  1R9L A;  4F39 A;  4F22 A;  2ZNU A;  3EF7 A;  5I58 A;  2YPN A;  3TCG A;  3U93 A;  4MLV A;  1POT A;  3M3K A;  4JWY A;  1XHY A;  5ICT A;  2CZL A;  2PBW A;  4OEN A;  3CSB A;  3G3I A;  3MPK A;  4KQP A;  1DTG A;  4Z0I A;  2P0S A;  2DQV A;  2XD2 A;  4QRZ A;  3KBR A;  3IO6 A;  4ZZE A;  1ZU0 A;  4POX A;  2AIX A;  2RCB A;  3MQ9 A;  2Z23 A;  4DXB A;  2UYF A;  4JWO A;  3MAM A;  4G77 A;  3C34 A;  1N3W A;  3MW0 A;  1B4H A;  2G29 A;  4N07 A;  3SES A;  1LBB A;  2Q8J A;  5FTI A;  2CMO A;  1IXI A;  3N26 A;  1I6B A;  3VLU A;  1JEU A;  2O51 A;  5CM6 A;  1MQH A;  3ONM A;  2Y7P A;  1Z7N E;  3S9E A;  3KSX A;  1ZJL A;  3PUW E;  1QUI A;  4OQO A;  1OLC A;  3VXB A;  1B9J A;  5CBR A;  1JNF A;  3UP9 A;  3WAF A;  1B32 A;  3LSL A;  3FVN A;  3UN6 A;  1UIV A;  1MRP A;  3O29 A;  2PT2 A;  5H8Q B;  1D4N A;  4H1X A;  1B3E A;  3H3G A;  4U22 A;  3GBA A;  3RNN A;  1LAG E;  3JV9 A;  1FQE A;  3K6U A;  1SW1 A;  4ZE9 A;  1DPE A;  4GF8 A;  3S9M C;  2DE4 A;  3C4M A;  4O3B A;  1JW1 A;  2I4C A;  1TWY A;  1DMB A;  1URG A;  3N94 A;  3L6H A;  1Y3N A;  5CBS A;  2RC8 A;  3IOV A;  4ELQ A;  3O6I A;  3VVD A;  1YPN A;  1B0L A;  3CG1 A;  3G3H A;  5H8H B;  4XXU A;  2HXW A;  1Y20 A;  1SD3 A;  2D3I A;  1FW0 A;  1ZTY A;  4H0W A;  4RXL A;  3FXU A;  5I59 B;  1FTK A;  3FJ7 A;  1FTL A;  3RTW B;  1Y3Q A;  5L9S A;  4DXU A;  4Q5T A;  3TEP A;  2V93 A;  2ZYK A;  4G68 A;  3ODB A;  3T93 B;  2XXY A;  5AA1 A;  1WVJ A;  1GTK A;  1YCJ A;  2I3V A;  2DWA A;  3MP1 A;  4U1O A;  2DP8 A;  3PV0 E;  4EQ7 A;  2O69 A;  5H8F B;  4H5G A;  4WEP A;  1MQG A;  1PBP A;  4GQO A;  3FVO A;  2XXX A;  2F7C A;  1LBC A;  3VV5 A;  1DSN A;  5CMK A;  1D9Y A;  3IO4 A;  2PVU A;  1B3F A;  2E1S A;  1UTH B;  4QSD A;  2OK2 A;  2QS3 A;  1XVX A;  2Y84 A;  2Z8F A;  4HTG A;  2VGQ A;  4OMB A;  2QRY A;  5M2V A;  1O63 A;  1IUD A;  2G93 A;  4IO4 A;  4AB6 A;  1UTB B;  3PPR A;  2KLF A;  5ELV A;  3FJG A;  1FQD A;  4JBZ A;  3BBR A;  3S9N C;  3FV2 A;  3QXM A;  3IOW A;  1EZ9 A;  3Q27 A;  4P0I A;  4OWD A;  3K1N A;  1MG1 A;  4HS7 A;  3IX1 A;  2X7P A;  4DLD A;  2I4B A;  4E0X A;  3CFX A;  1YTV A;  5CI5 A;  3BFU A;  3H7M A;  4NWC A;  4NWD A;  1Z7M E;  5I2K A;  5F7V A;  5AA4 B;  4MLQ A;  1JEV A;  5I56 A;  1P1N A;  5H8N A;  3IR1 A;  1M5C A;  1FQB A;  4ELP A;  2XXI A;  1B51 A;  4KYS A;  1CB6 A;  3OOA A;  2LAO A;  4UAC A;  4YAH X;  1VR5 A;  4F3B A;  1IZ1 A;  1MS7 A;  3IOT A;  4YZZ A;  1B1X A;  4F1Y A;  3K1P A;  4OEV A;  3EHU A;  1ANF A;  1P1Q A;  4R2B A;  3PUY E;  4H65 A;  1OQG A;  2F7A A;  1MXX A;  1B58 A;  4JB7 A;  4OET A;  3RTF B;  2QL3 A;  3B6Q A;  3A3U A;  3RPW A;  1OQH A;  3PPP A;  5I57 A;  2GH9 A;  3I5O A;  1LB8 A;  2UVJ A;  1IXG A;  3G3F A;  3OMB A;  4EQB A;  1AMF A;  2RC9 A;  5JTY B;  4PE5 B;  1H43 A;  3OO9 A;  5CMB A;  1A8E A;  4F29 A;  3FXQ A;  5AA2 D;  2PT1 A;  4H5F A;  1BKA A;  2VP1 A;  4R2F A;  1SI1 A;  4OEU A;  4OFJ A;  3ECR A;  4GL0 A;  2HAU A;  5L8D A;  2O1L A;  2I58 A;  4M4G A;  3MZB A;  2AL4 A;  1J1N A;  2QMX A;  1B6H A;  5FTH A;  5IAI A;  4M1V A;  2NXO A;  4NTL A;  5DEX A;  4HCY A;  2DWJ A;  1URD A;  3MVX A;  3C32 A;  3MBP A;  4KI0 E;  3IOR A;  3VXC A;  3DP8 A;  4G4P A;  2XXH A;  1MXY A;  3TTL A;  1N76 A;  5ISU A;  4ECF A;  4IO3 A;  4RYA A;  2O6A A;  4F2Q A;  3PMX A;  4RY1 A;  4GWO A;  4NF8 A;  1MY4 A;  5I2N A;  3A09 A;  1MY1 A;  2ONK E;  3ZS6 A;  1US5 A;  1OMP A;  2UVI A;  4QHQ A;  4N6P A;  3KEI A;  3G7W A;  2F97 A;  4TLL B;  4YIC A;  1SW4 A;  4YKP A;  1MXZ A;  1B3L A;  1SYI A;  3R7X A;  1N84 A;  3OEN A;  1LCT A;  2REG A;  4RK9 A;  1PB7 A;  1ZKB A;  4GRK A;  1YAE A;  3SEX A;  2BJJ X;  4KCD A;  3H6W A;  3N5L A;  3LC8 A;  3BKI B;  1B7U A;  4U21 A;  5EHS A;  2A5T A;  4FAT A;  4G2Z A;  3AXF A;  2H98 A;  1N3X A;  3B7D A;  3TPA A;  5TU0 A;  1JW5 A;  4NF6 B;  3KJ7 A;  1QJM A;  1URS A;  3ILT B;  4MF3 A;  3MP6 A;  1H44 A;  2Q9T A;  5H8S A;  1QUJ A;  4BLA A;  3CR9 A;  4NMY A;  2ZYM A;  2REJ A;  1MXV A;  2H99 A;  3PPQ A;  4KYE A;  3ZSF A;  4F19 A;  1FTM A;  4C0R A;  2HCA A;  3SEW A;  3V5A A;  3TMG A;  4YMB A;  2FA7 A;  1NL5 A;  3HV1 A;  2XX9 A;  2OJT A;  3CSG A;  1TFA A;  3EQ1 A;  2A5S A;  2DOJ A;  3JYR A;  1OLA A;  1TXF A;  2ABH A;  5I56 B;  2XXU A;  4TOZ A;  5H8N B;  1LB9 A;  4F3P A;  5KDT A;  3N6T A;  3T22 A;  4BDO A;  3IAZ A;  2DWH A;  4ND9 A;  2DE3 A;  1KWH A;  2HFB A;  3O6H A;  1DTZ A;  4ZEI A;  3W15 C;  2F5X A;  1D3K A;  3N6U A;  1BTJ A;  2B3B A;  3UGW A;  4WKM A;  1LFG A;  1ELJ A;  1Y3P A;  3T9H B;  3PMV A;  2FYI A;  3V8X B;  3H6V A;  4LP2 B;  3VFJ A;  1UIU A;  4XTC Q;  3G3J A;  1NNT A;  3TQL A;  3HHF A;  3FAT A;  3BFT A;  5DVF A;  1SI0 A;  4ZED A;  4ZDM A;  1R6Z A;  1PB9 A;  3FVG A;  4FJP A;  4P0G A;  2Y7R A;  4F3S A;  5BWJ A;  3IB0 A;  3GLB A;  4EXK A;  2DVC A;  4R9F A;  2PMS A;  3S2V A;  2ANJ A;  2FNC A;  2O1M A;  3MUQ A;  5JEI A;  1GR2 A;  3RT6 B;  1TFD A;  1QKA A;  3KZG A;  1MQD A;  3RUM A;  3TCF A;  3K2D A;  2GHB A;  3QK6 A;  3IK6 B;  4ZEB A;  3QUJ A;  4LQ2 A;  5ITO A;  5DEX B;  2VD2 A;  3FVK A;  1GV8 A;  1FCK A;  5B70 A;  2F6G A;  3TQW A;  1FQF A;  3O6G A;  2H9B A;  2HEU A;  3UIF A;  2ONS A;  1WDN A;  3FV1 A;  1NMU A;  2XD3 A;  3PMW A;  1ATG A;  3TEL A;  3M8U A;  2E0S A;  1PC3 A;  2RF1 A;  1RYX A;  3QYT A;  5DVJ A;  3OSQ A;  1QKB A;  5CRY A;  4X1B A;  4YB6 A;  1Y9U A;  2O7U A;  3P7I A;  1SW2 A;  2UXA A;  3ZKK A;  1R1N A;  3MPL A;  3TTR A;  1B1H A;  3TTN A;  1PEB A;  4JDF A;  2I0B A;  3CG3 A;  3FGS A;  1QVS A;  3OD7 A;  5K2X A;  4XKR A;  4KPT A;  4OFL A;  4O3C A;  3MJN A;  1O64 A;  4FOR A;  4GIZ A;  4NF5 A;  2DE2 A;  4QFN A;  2ALU A;  3HHG A;  3SKP A;  2B3F A;  3H6U A;  5AA2 A;  1MH3 A;  2XXT A;  4ESW A;  2QS2 A;  1B5I A;  1O7T A;  2F34 A;  2Q89 A;  1US4 A;  4GD5 A;  5F1Q A;  3O28 A;  2H4I A;  1JVY A;  3RLF E;  4QSE A;  4GXS B;  1FTO A;  2NWJ A;  1B05 A;  5EYF A;  3QAX A;  1EU8 A;  1USY E;  5BUU A;  5TPA B;  1Q35 A;  1SW5 A;  3UK4 A;  2R9J A;  3PD8 A;  4N13 A;  3TTK A;  5I58 B;  2XXQ A;  4H67 A;  4YKJ A;  2THI A;  1SDX A;  1XVY A;  5A5X A;  4GXA A;  4PFW A;  1UQW A;  1B5J A;  4OVJ A;  4U2R A;  3TZA A;  2RKM A;  2QSX A;  2HZK A;  5KDT B;  4X48 A;  3CVG A;  4H8I A;  1IQ7 A;  3K6W A;  5LOM A;  1P1W A;  4BDR A;  4Q8R A;  4R6H A;  4H8J A;  1M5B A;  5KCJ A;  3S9L C;  3R6U A;  2OZZ A;  4R72 A;  2D5W A;  1PDA A;  2QJE A;  1MY3 A;  3MVY A;  1OVT A;  3RT8 A;  2ONR A;  4EDP A;  3RGY A;  1MXU A;  1BP5 A;  1B5H A;  2HZL A;  1JQF A;  4G8N A;  2ZNS A;  2H25 A;  2IA4 A;  2NUV A;  3VLV A;  3RY3 A;  4AB5 A;  3PPO A;  3IL1 B;  1MDP 1;  4I62 A;  1A8F A;  2DS9 A;  2GFE A;  2O7I A;  2QS1 A;  4QFL A;  4OFO A;  4OZ9 A;  4E0W A;  1MQI A;  2V3Q A;  2V25 A;  4F18 A;  4IO6 A;  1NKX A;  3THI A;  2DYX A;  3KN7 A;  3U72 A;  3TTM A;  1Y4T A;  3KN8 A;  4ZE8 A;  4F31 B;  3OEL A;  4U23 A;  4ISU A;  5CMM A;  3M3L A;  3QSL A;  4G8M A;  4DCY A;  2Y7I A;  3KFM A;  3LBS A;  4LQ5 A;  3FJM A;  5L9O A;  3C33 A;  3LR1 A;  5KZT A;  2VOZ A;  4IO5 A;  2ZNT A;  4PFU A;  3DEL B;  5H8Q A;  4G8H A;  1H3D A;  3I6V A;  3Q28 A;  5HBC A;  4GOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...