2Z8DA

The galacto-n-biose-/lacto-n-biose i-binding protein (gl-bp) of the abc transporter from bifidobacterium longum in complex with lacto-n-biose
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
401
structure length
401
Chain Sequence
DDGGVVNITYMHRLPDSEGMTLVNDIVAKWNKQHPDIQVKATKFDGKASDMIKKLETDVKSGEAPDLAQVGYAELPEVFTKGLLQDVTQYAEQYKNDFASGPYSLVQVGGKAYGLPQDTGPLVYFYNKAEFEKLGITEIPQTADEFIAAAKTAAAAGKYIMSYQPDEAGNMISGLAGASGGWYKVKGDSWVVNTETDGSKATADFYQQLLDAKAATTNPRWDPSFDASIKDGSLIGTVAAAWEAPLFMTSSGGTGSGEWQVAQLGDWFGNAGKTGPDGGSAVAVLKNSKHPKEAMEFLDWFNTQVPDLVSQGLVPAATTEDAETPSEWSTFFGGQDIMKEFKTANNNMGDFTYMPGFSAVAAKMNETAAKATDGSGKVADIFSDAQTTSVDTLKNFGLSVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Galacto-N-biose/lacto-N-biose I transporter substrate-bindin
publication title Structural and thermodynamic analyses of solute-binding Protein from Bifidobacterium longum specific for core 1 disaccharide and lacto-N-biose I.
pubmed doi rcsb
source organism Bifidobacterium longum
total genus 145
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8dA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8dA02
1ZTYA 4QF9A 1QULA 2ZXTA 1NH7A 3MVWA 5I2NB 3FJ7A 1ZLQA 4F1UA 1XVXA 2DP8A 4EXKA 3HN0A 5IKBA 2UVHA 1PB8A 4LQ5A 3TCGA 5H8SA 1H45A 5H8FA 4ZEBA 5I57B 4OEUA 5CMCA 3MZ1A 1MH4A 1B7HA 3MVYA 1MPBA 4U4XA 3V89B 3VLUA 3ILUB 1P1OA 1FQAA 1RKMA 1SDXA 4BDQA 3CG1A 1N04A 4YICA 1WODA 4JSOA 3SKPA 3TQLA 3WAFA 3HHGA 1N0TA 3TTRA 4R72A 1P1UA 1MXUA 1QVSA 3U93A 3O29A 2X26A 4BDLA 2CZLA 3UP9A 1FTKA 1D3KA 2QMWA 2H9BA 3MAMA 5AA4B 1FTJA 4DXBA 4ZECA 1IEJA 2ESNA 3EHTA 3LR1A 3MZBA 3TTMA 5BUUA 3T9XB 1YPNA 5EHMA 4LVQA 4N07A 3FATA 5I84A 4ZE9A 5ITPA 1FQEA 3FZVA 3A09A 4ZDMA 1MXWA 4OFOA 1TFDA 4H0WA 3VLVA 1OLAA 3TTLA 4DIGA 3SERA 1ZU0A 5KDTA 1GTKA 5K2YA 2V3UA 1WVJA 3Q26A 1S50A 4R9GA 4YB7A 4POXA 4XKPA 2PVUA 4RK9A 2ZNUA 3OSRA 1B9JA 4ZS9A 1AL3A 5L9SA 5JEIA 4OMBA 1EH3A 4GXAA 3MW0A 4OERA 1NL5A 5DVJA 2HAVA 2RC8A 4U23A 4EQ9A 3H6TA 3IORA 4R75A 5TP9B 4BDMA 3CFLA 2DE4A 2PT2A 2F6PA 5M2VA 4F18A 1IZ1A 1MM7A 2IEEA 5HBCA 2O6AA 3DELB 4O3CA 4H1XA 3KEIA 1B6HA 1MPDA 1Y4CA 3EPEA 4OENA 3PU5A 3V8XB 3MUQA 5A5XB 3G3FA 4NF4A 3TFLA 3KSXA 1OMPA 2GHBA 3PGFA 3JV9A 2Q89A 4QFNA 3MBPA 4E0WA 1FQCA 4F3PA 4NE4A 2F36A 2ONSA 4NF5A 1NH8A 4TLMB 3FVNA 3V83A 5HPQA 4IO6A 3TUSA 3IB0A 4FORA 4RA1A 3RTWB 1B3HA 4G8HA 2XX8A 2R71A 3T9HB 4GRKA 2B65A 3MPKA 3IX1A 1SW1A 2H25A 1FTLA 1MQIA 4OFLA 3I6VA 2XXRA 4OYVA 1MDP1 3FUZA 3EF7A 1MQJA 1MY4A 1A55A 4KCDA 3FASA 5FTIA 4DDDA 4EQ7A 2NWJA 3AXFA 4ONYA 3H03A 2G93A 1UTHB 3MVZA 1LBCA 2Y7RA 3PUWE 4RPNA 2DE3A 2PYYA 4M4GA 1OIBA 1FW0A 2XXYA 2GFEA 1OVTA 4JWOA 2QJEA 2DWJA 2M8CA 3Q29A 4F19A 4H67A 4JBZA 1VSOA 3O6HA 2GRVA 1IXHA 1LAFE 3IAZA 4F22A 3K01A 4MF3A 3PPNA 2R6GE 3LSXA 4THIA 2RC7A 4U1OA 1OVBA 2UVIA 2NXOA 1LAHE 3K0VA 2GHAA 3VVDA 4G2ZA 4IO7A 3VVFA 4TLLB 3FJMA 2XXUA 3FJGA 1N84A 4NMYA 4PFTA 1A99A 1FTOA 1POTA 4YU0A 2WKYA 3PPPA 4IY6A 2DQVA 5ELVA 3H7MA 5ISUA 1Q35A 2QRYA 4JWYA 3O2AA 2NVUB 3KN7A 5H8HB 1QJMA 4IO3A 5LOMA 4P0GA 3DP8A 5I59B 3C36A 4IO5A 4DZ1A 2ABHA 3RY3A 1DMBA 1AIVA 3A3CA 4C0RA 5CBSA 3VVEA 1FCKA 3BFUA 3UGWA 4TOZA 3KSJA 5A5XA 1Z7ME 4M1VA 2VD2A 1A8EA 2DWIA 4JDFA 4G68B 3VLWA 4P11A 5CMMA 4RXLA 3PUZE 3CG3A 4KFQA 3RTFB 4PQJA 3RLFE 5AE4A 2I4CA 1H76A 4IGTA 1CE2A 2XXXA 3IJOB 1XS5A 3FXQA 1B2HA 4GLIA 1PBQA 1XVYA 3IJXB 2I4BA 2HFBA 3RGYA 4KYEA 2OJTA 1BIYA 1B5HA 2XXWA 2OK2A 1SYIA 3DP6A 1QW0A 2HCAA 3LSFB 4H8IA 3RN8A 1HSJA 5KCJB 1SD3A 4LUBA 1JW4A 4PE5B 4FEDA 2GH9A 2PT1A 1N7WA 4WEDA 1UTHA 3I3VA 3OMBA 1SYHA 2UVJA 3U1OA 4GD5A 2I48A 3H6WA 3MVXA 4DCXA 4DCYA 4ZZEA 2CMOA 2BJJX 3G3JA 1IXIA 3B6WA 3E4RA 3EN3A 4XXUA 2VP1A 4K3FA 3MZ9A 4H65A 2VHAA 4BLAA 3O6IA 4PFUA 4YKKA 4ZEFA 4PP0A 2I49A 5I58A 4EDPA 3O6GA 1GGGA 2UXAA 3DP4A 1OQHA 4EUOA 3IOWA 1US5A 4G77A 3G3IA 3W9WA 1MXYA 4OFJA 4P0IA 1YAEA 3W9VA 1URSA 1JNFA 4YMBA 3H3GA 4KYDA 2X7PA 5CMBA 3S9NC 3CSBA 4R6YA 2RF1A 4KD5A 4Z7EA 3QUFA 4LP2B 3TDJA 3K1NA 1M5BA 4U21A 1B40A 4OESA 2ZYOA 2ZYKA 4YKPA 1MXZA 4R6KA 4JSDA 1S9TA 1GR2A 5F7VA 2A5TB 4ZEDA 3O9PA 2Z8DA 4G68C 1B0HA 3IOUA 1JEUA 2FNCA 3LSLA 3EHUA 2W7YA 2PX1A 1ZIUA 2REGA 1ZKBA 1SQYA 3S9EA 4C1UA 1B7UA 2VGQA 4GFRA 5AA2A 1B1HA 4OHNA 2ZNTA 2VD3A 3JZJA 2PMSA 5J1DA 1IITA 4XTCQ 2QS1A 3PMVA 5FHNA 4LONB 4QSDA 4FATA 3THIA 2F35A 1B3EA 5DEXA 3TKDA 3OEKA 1LB9A 4HCWA 3TTKA 1P99A 3HV1A 3TPAA 2YLNA 3W15C 4XIGQ 4H5GA 2XX7A 2DSFA 1URGA 3QXMA 4QFPA 1FTMA 5IAIA 1Y9UA 3SEYA 3IO6A 1A40A 3KG2A 1JETA 2XXQA 3TQWA 1R9LA 4RNSA 3OO8A 2O1LA 4HS7A 1Y1MA 3ZSFA 1HSLA 4I62A 2HXWA 1IXGA 4KR5A 2HZKA 1LFHA 3OEMA 2E1SA 3MQ9A 2O7UA 4LATA 4C1TA 3P7IA 4XKQA 4F3BA 4OTEA 1JW5A 1B5IA 2H4IA 2DS9A 3IB1A 3FD3A 3PPOA 2XXPA 1D4NA 5H8QA 3ZKKA 4MFIA 2F34A 4JXIA 4F39A 1BTJA 2I58A 3C9HA 4GQOA 1TT1A 4GXSB 4OXVA 1LGBC 2XXHA 2F8DA 3Q28A 3OO7A 1B1XA 1VFDA 5I2NA 2ONKE 3TZAA 1Y4TA 2F97A 3E9XA 3TAJA 4GWOA 4OEVA 2A5TA 3QUJA 1Y20A 5I57A 4ZE8A 3I5OA 4ECFA 3E3KA 4LZ7A 5CBRA 1XC1A 2AYSA 2ONRA 3PPRA 1Z7NE 1USYH 4XKRA 4QSEA 3R26A 3CVGA 4YKJA 1DSNA 1MY1A 1LCFA 5HM4B 2F7BA 4XKNA 2RKMA 4DLDA 1ZBMA 2ALUA 2V84A 5CM6A 3U92A 2Q2AA 3UIFA 4GOTA 1EU8A 1MY3A 1LBBA 2FA7A 2F7CA 3K6WA 3S9MC 1CB6A 4DE8A 3CFZA 5AA4A 3IB2A 1B52A 3C32A 4GIZA 3TCHA 4ESWA 3K1PA 4IO2A 2QL3A 2XXVA 3T66A 3PUXE 4R9FA 4RK2A 1UTBB 3G3GA 5K2XA 3OELA 4RYAA 4OETA 1RYOA 3SEUA 4X1BA 1O64A 1NNKA 1EZOA 1GVCA 4MLQA 5BWJA 5KZTA 2Q9TA 2UYFA 4MH5A 3TELA 4HTGA 4KCCA 2DE2A 3S2VA 1N3XA 3PV0E 3RNNA 3CSGA 1XHYA 1B32A 1DTGA 3VV5A 5FTHA 3ECRA 5TP9A 3CFXA 3CRBA 1M5FA 1I6BA 1KWHA 3N5LA 3FVOA 4YMAA 3V5AA 2HQ0A 3PUVE 2QMXA 3TODA 4NF8B 3C33A 3T96B 4Q0CA 1B5JA 4YAHX 1NFTA 2DXYA 3LBSA 4HW8A 1JVXA 3KGCA 4F3GA 1B3GA 1D9VA 1JEVA 1Y3NA 3EQ1A 1M5DA 4YB6A 1IIWA 3OSQA 5H8FB 2OLBA 2P1SA 4F2OA 2V25A 4Q30B 3OD7A 4QFLA 1EZPA 1VFEA 1ELJA 2DWAA 3ZS6A 3OO9A 2OWTA 4WEPA 2XD3A 1LFGA 2I6EA 3QK6A 4H5FA 3KN8A 4F31B 3FXUA 3UN6A 4AQ4A 3RQTA 1B05A 3HHFA 4FECA 1DPPA 1POY1 1S7YA 1B3LA 5ICQA 1FQFA 2NOOA 3H6UA 4G8MA 1UIUA 4L17A 3SETA 4ND9A 2YPNA 3C31A 3K2DA 3C4MA 2Y7IA 4R73A 4YKIA 3D4GA 3KOSA 1JVYA 1AMFA 1PEBA 2D21A 2XX9A 1PDAA 2D3IA 3CIJA 3BFTA 1SI1A 4UA8A 3VXCA 2G29A 3HPIA 2QS4A 3FGSA 5ICTA 3S9LC 3R6UA 1B58A 1B0LA 1NNFA 4GF8A 3SEXA 4R74A 3PD8A 1PB7A 1ZJLA 4RY1A 3UORA 4EF2A 1NKXA 2ANJA 4LQ2A 2HZLA 1AOVA 1SBPA 3GZGA 2Z8EA 2P2AA 4I9DA 3FVGA 3SEVA 3M3FA 5EHSA 3OOAA 3TYHA 2D5WA 5H8HA 1SI0A 4FE8A 3GBAA 5CI5A 3VE1B 2V93A 5CMKA 3G3HA 3T22A 1PB9A 4N6PA 4KHZE 4KQPA 2DWHA 1ANFA 5JTYB 1A7LA 3A3UA 5I59A 4U2RA 3HO7A 2DOJA 1BP5A 4WKMA 5I2KB 4I8CA 1URDA 1F9BA 3LUYA 3TCFA 3C34A 4LZ8A 2Q2CA 4FJPA 2XXTA 4ESXA 1PBPA 4U1ZA 2DYXA 5DVIA 3U94A 3SESA 1BKAA 2Z23A 3DLNA 2O84X 3O97A 4KPTA 5DVFA 2I3WA 3FIRA 4NF5B 3B7DA 3PMWA 3VFJA 3N94A 3PPQA 2ZYNA 4G68A 5ITOA 4O3BA 5EYFA 3RPWA 3K02A 3O66A 4GL0A 4QFOA 3B6QA 1P1QA 1SW5A 3DM0A 4H6DA 1IUDA 1AH5A 5CRYA 2QSXA 1B7ZA 3T9VA 4ZEKA 1MXXA 1L5TA 2Y84A 1QUJA 2RINA 3D4CA 3G3KA 3JYRA 2B3FA 2XHDA 3KN3A 4OQOA 4ELRA 1A8FA 5L9MA 2AL4A 4ZZAA 1QKAA 4MLVA 2IA4A 3K1MA 3VXBA 3MWBA 1FQBA 1M5CA 3L6HA 3RT6B 5KCJA 1Y1ZA 3U72A 4ELPA 1LCTA 3LC8A 3IL1B 4TQUQ 4Q5TA 1LSTA 4MBPA 1B4ZA 2LAOA 3FXRA 5L9OA 3IR1A 4PFWA 1LB8A 3B6TA 3VDFA 2O1MA 1DPEA 1M5EA 3PUYE 4FEBA 1H43A 4N13A 4X9TA 3MP8A 2RC9A 1OQGA 5FHOA 3KFMA 2NUVA 2E0SA 3S4UA 2YJPA 3USDA 2I0CA 4NWCA 3U8QA 4ELQA 3KBRA 2UVGA 4WXJA 5TPAB 3IK6B 1R1NA 3TMGA 3QSLA 5L8DA 1JQFA 3PD9A 1IQ7A 4KI0E 4NF6B 4YZZA 2ZYMA 3TEPA 4F3SA 3MC2A 1VE4A 1SW2A 3E13X 1O7TA 3RT8A 3IOTA 2O69A 4F29A 4G8NA 2ZNSA 2KLFA 4JWXA 2PBWA 3Q27A 4OZ9A 2QS2A 1MG1A 4O3AA 5AA1A 4PETA 4BDRA 4ISUA 3PMXA 1LLSA 5JTYA 3QAXA 3BKIB 5I2KA 1SW4A 5DTBA 1VR5A 3KZGA 4F1YA 5DYHA 1II5A 4Q8RA 1P1WA 3K6XA 4IY5A 4NEDA 2P0SA 1MM6A 4ELOA 1MH3A 4FIMA 1QUKA 1ZMGA 2OCUA 3M3KA 2OWSA 3FVKA 1UIVA 4R6HA 3FV2A 1NNTA 1B4HA 1MQHA 4LA9A 5B7DA 3GBBA 4YB5A 1IXCA 4GL8A 1WDNA 1B46A 1MY2A 2XD2A 3C35A 4UACA 1N76A 4OWDA 2HEUA 4GVOA 4JB7A 1UQWA 2O51A 4IGRA 1R6ZA 2Z22A 2DXRA 3M3LA 4IO4A 3WAEA 4DXUA 5B70A 3K4UA 3Q25A 3IOVA 2Y7PA 2O68A 2ZMBA 2THIA 2R9JA 5DT6A 2RCBA 1MXVA 1T0KA 1XOCA 4RPOA 2F78A 5H8NB 3LSWA 3MP1A 4NTLA 1TFAA 2UYEA 1NNPA 5CC2A 4EXLA 2AL5A 4RJZA 3EHSA 5I58B 5AA2D 2Q88A 3OO6A 3O28A 1MDQA 4POWA 1MRPA 2QS3A 5TPAA 1MY0A 3K6UA 4E0XA 1NMUA 5I56B 3MJNA 3ODBA 3RUMA 4NF6A 1DTZA 1JW1A 2A5SA 1US4A 1PC3A 4QFKA 5JK4A 2Y7KA 2FYIA 1Y3QA 1I6QA 4HCYA 2X7QA 1I69A 1TXFA 2Z8FA 3OXNA 4R2BA 3ILTB 2Y7WA 4PFYA 3H6VA 4X48A 1TWYA 1ATGA 3CR9A 2VOZA 3QYTA 4G4PA 1SVXB 3SEWA 4NWDA 1OLCA 3N6UA 4I1DA 2AIXA 1A54A 3IO4A 3T9UA 2RCAA 1H44A 1USYE 3KOTA 4IB2A 3GLBA 3UK4A 4U22A 2V3QA 4FAJA 2OBGA 3G7WA 1EZ9A 4KYSA 1MPCA 3CI8A 3KJTA 3R7XA 4ZEIA 5AA2B 2HAUA 3GXAA 3M8UA 4F1VA 4DXCA 3KJ7A 5FHMA 3MPLA 2DVZA 3N26A 3BBRA 4QHQA 1Q1KA 3K6VA 1GV8A 5DEXB 1RYXA 3ZKLA 1YCJA 1N7XA 1MQDA 4BDOA 3FV1A 1LFIA 1QKBA 1DOTA 2DVCA 2QPQA 3MP6A 3TTNA 3SDFA 1Y3PA 1O63A 2B3BA 5AA3A 1LAXA 3UA8A 5TU0A 4EF1A 2F7AA 1UTBA 5KDTB 4QSCA 1YTVA 1I6AA 2I0BA 2XXIA 3H4ZA 4X1DA 2O7IA 2H99A 1LAGE 5H8NA 1R9QA 1P1NA 2F5XA 2OZZA 3L6GA 3ONMA 4H8JA 2REJA 4OVJA 3H06B 4F2QA 4EQBA 4AB5A 3T93B 4BDNA 1H3DA 4U4SA 4AB6A 1MQGA 1D9YA 3N6TA 1N3WA 1HSEA 2Q8JA 1B51A 1QUIA 2V3TA 3QIMA 4LZ5A 5F1QA 1J1NA 3K00A 4R2FA 2I3VA 5H8QB 5I56A 3HCQA 1B3FA 2H98A 4QRZA 3HSTA 4Z0IA 1MS7A 3OENA 4NF8A 1XT8A 1FQDA 2F6GA 1BLFA 4NF4B 3F11A 2H5YA
chains in the Genus database with same CATH superfamily
2JJKA 1NV5A 1ZTYA 4QF9A 1QULA 2ZXTA 1NH7A 3MVWA 2QVRA 5I2NB 3FJ7A 1ZLQA 4F1UA 1XVXA 5EQ9A 3RPLB 2DP8A 4EXKA 3HN0A 5IKBA 2UVHA 1PB8A 4LQ5A 3TCGA 5H8SA 1H45A 5H8FA 4ZEBA 5I57B 4OEUA 4GWSA 5CMCA 3MZ1A 1MH4A 4DI4B 1B7HA 3MVYA 1MPBA 4U4XA 4O7MA 3V89B 3VLUA 3ILUB 1RKMA 1P1OA 1FQAA 1JP4A 1SDXA 4BDQA 3CG1A 1N04A 4YICA 1WODA 4JSOA 3SKPA 3TQLA 3WAFA 3HHGA 1N0TA 3TTRA 4OANA 4OVTA 4R72A 1P1UA 1MXUA 1QVSA 3U93A 3O29A 2X26A 4BDLA 2CZLA 3UP9A 2R8TA 1FTKA 1D3KA 2QMWA 2H9BA 3MAMA 5AA4B 1FTJA 1NV4A 4DXBA 4ZECA 1IEJA 2ESNA 3EHTA 3LR1A 3MZBA 3TTMA 5BUUA 3T9XB 1YPNA 5EHMA 4LVQA 4N07A 3FATA 5I84A 4ZE9A 1G0IA 5ITPA 1FQEA 3FZVA 3A09A 4ZDMA 1MXWA 4OFOA 1TFDA 4H0WA 3VLVA 1OLAA 3TTLA 4DIGA 3SERA 4OVSA 1ZU0A 5KDTA 1GTKA 5K2YA 4PFIA 3LUZA 2V3UA 1WVJA 3Q26A 2XWIA 1S50A 4R9GA 4YB7A 4POXA 4XKPA 2PVUA 4RK9A 2ZNUA 3OSRA 1B9JA 4ZS9A 4P47A 1AL3A 5L9SA 4PAKA 5JEIA 4OMBA 1NV6A 1EH3A 4GXAA 3MW0A 4OERA 1NL5A 5DVJA 2VPOA 2HAVA 2RC8A 1FRPA 4U23A 4EQ9A 3H6TA 3IORA 4R75A 5TP9B 4BDMA 3CFLA 1NV2A 2DE4A 4H45A 4PGPA 2PT2A 2F6PA 5M2VA 4F18A 2WYKA 1IZ1A 1MM7A 2IEEA 5HBCA 4P1EA 2O6AA 2VT5A 3DELB 4O3CA 4H1XA 3IFAA 5I3SA 3KEIA 1B6HA 1MPDA 1Y4CA 4MX6A 1SPIA 2FIXA 3EPEA 4OENA 3PU5A 3V8XB 3MUQA 5A5XB 3G3FA 4NF4A 3TFLA 3KSXA 1OMPA 2GHBA 3PGFA 3JV9A 2Q89A 4QFNA 3MBPA 4E0WA 1FQCA 3RYDA 4F3PA 3RPLA 4NE4A 5EQ7A 2F36A 4NF5A 2ONSA 1NH8A 4TLMB 3FVNA 3V83A 5HPQA 4HE1A 4IO6A 3TUSA 3IB0A 3B50A 4FORA 4RA1A 2ZZVA 1FBEA 3RTWB 1B3HA 4G8HA 2XX8A 2R71A 3T9HB 4GRKA 2B65A 3MPKA 3IX1A 1RDZA 1SW1A 2H25A 1FTLA 1MQIA 4OFLA 3I6VA 2XXRA 4OYVA 1MDP1 2P3VA 3FUZA 1RDXA 3EF7A 1MQJA 4G61A 4PBQA 1MY4A 1A55A 4KCDA 3FASA 5FTIA 4DDDA 1NV0A 4EQ7A 4OVQA 2NWJA 3AXFA 5IZZA 4ONYA 4JVDA 3H03A 2G93A 1UTHB 3MVZA 1CNQA 1LBCA 2Y7RA 3PUWE 4RPNA 2DE3A 3KC1A 2PYYA 4M4GA 1OIBA 4H46A 1FW0A 2XXYA 2GFEA 4NF0A 1NV7A 1OVTA 4JWOA 2QJEA 2DWJA 2M8CA 3Q29A 4F19A 4H67A 4JBZA 1VSOA 3O6HA 5ET7A 4PC9A 2GRVA 1IXHA 1LAFE 3IAZA 4F22A 3K01A 2P3NA 4MF3A 3PPNA 2R6GE 3LSXA 4THIA 2RC7A 3FBPA 4U1OA 1OVBA 2UVIA 2NXOA 4N15A 1LAHE 3K0VA 2GHAA 3VVDA 4G2ZA 1FSAA 4IO7A 3VVFA 4TLLB 3FJMA 3PTYA 1NV3A 5EYGA 2XXUA 3FJGA 1N84A 4NMYA 4PFTA 1A99A 1FTOA 1POTA 4YU0A 2WKYA 3PPPA 4IY6A 2DQVA 5ELVA 3H7MA 5ISUA 1Q35A 2QRYA 4JWYA 3O2AA 2NVUB 3KN7A 5H8HB 1LBWA 1LBXA 1QJMA 2FIEA 2B4LA 4IO3A 5LOMA 4P0GA 4I3YA 3DP8A 5I59B 1IMCA 3C36A 4IO5A 4DZ1A 2ABHA 3RY3A 1DMBA 1AIVA 3A3CA 4C0RA 2Y5LA 5CBSA 3VVEA 1FCKA 3BFUA 3UGWA 4TOZA 5LDZA 3KSJA 5A5XA 1Z7ME 4M1VA 2VD2A 2XWVA 1A8EA 2DWIA 4KXPA 4PF6A 4JDFA 4G68B 4O94A 3VLWA 4MHFA 2XWOA 4P11A 4N8YA 5CMMA 4RXLA 1IMBA 1NUXA 3PUZE 3CG3A 4KFQA 3RTFB 4PQJA 3RLFE 5AE4A 3E79A 2OWZA 2I4CA 1H76A 4IGTA 4N6DA 1CE2A 2XXXA 3IJOB 1XS5A 3FXQA 1B2HA 4GLIA 1PBQA 1XVYA 3IJXB 2I4BA 2HFBA 3RGYA 4KYEA 2OJTA 1BIYA 1FPKA 1B5HA 2XXWA 2HHMA 2OK2A 1SYIA 3DP6A 1QW0A 2HCAA 1XI6A 3LSFB 4H8IA 5EQAA 1BK4A 3RN8A 1HSJA 5KCJB 2F3BA 1SD3A 4LUBA 1JW4A 4PE5B 4FEDA 2GH9A 2PT1A 3E78A 1N7WA 4WEDA 1UTHA 3I3VA 3OMBA 1SYHA 2UVJA 1LBYA 3U1OA 4GD5A 2I48A 3H6WA 5J16A 3MVXA 4DCXA 1EYIA 4DCYA 4ZZEA 2CMOA 2BJJX 3G3JA 5LTCA 1IXIA 4HE2A 3B6WA 3E4RA 3EN3A 4XXUA 2VP1A 4K3FA 3MZ9A 5DW8A 4H65A 4QBAA 2VHAA 4BLAA 3O6IA 4PFUA 4YKKA 5IM2A 4ZEFA 4PP0A 2I49A 5I58A 4EDPA 3O6GA 1GGGA 2UXAA 3DP4A 1OQHA 4EUOA 3IOWA 2OX3A 1US5A 4G77A 3G3IA 3W9WA 1MXYA 4OFJA 4P0IA 1YAEA 3W9VA 1URSA 1JNFA 1KA0A 4YMBA 3H3GA 4KYDA 2X7PA 5CMBA 4OVPA 3S9NC 3CSBA 4R6YA 2RF1A 4KD5A 4Z7EA 3QUFA 4LP2B 3TDJA 1LBVA 3K1NA 1M5BA 2FHYA 4U21A 1B40A 4OESA 2ZYOA 2ZYKA 4YKPA 1MXZA 4R6KA 4JSDA 2B4MA 1S9TA 1GR2A 5F7VA 2A5TB 4ZEDA 3O9PA 2Z8DA 4G68C 1B0HA 1FBFA 3IOUA 1JEUA 2FNCA 3LSLA 3EHUA 2W7YA 2PX1A 1ZIUA 2REGA 1ZKBA 1SQYA 3S9EA 4C1UA 1B7UA 4P9KA 2VGQA 4GFRA 5AA2A 1B1HA 2HPGA 4OHNA 2ZNTA 2VD3A 3JZJA 4MNIA 2PMSA 5J1DA 1IITA 4XTCQ 2QS1A 3PMVA 5FHNA 4LONB 4QSDA 4FATA 3THIA 5T3JA 2F35A 1B3EA 5DEXA 2F3DA 3TKDA 4JVIA 3OEKA 1LB9A 4HCWA 3TTKA 1P99A 3HV1A 3TPAA 2YLNA 3W15C 5FBPA 4XIGQ 4H5GA 2XX7A 2WYPA 2DSFA 1URGA 1FPJA 3QXMA 4QFPA 1K9ZA 1FTMA 5IAIA 1KA1A 1Y9UA 3SEYA 3IO6A 4GX6A 1A40A 3KG2A 1JETA 2XXQA 3TQWA 1R9LA 4RNSA 2QVVA 3OO8A 3T1BA 2O1LA 4DI3D 4HS7A 1Y1MA 2CZHA 3ZSFA 1HSLA 4N8GA 4I62A 2HXWA 2WEFA 3IFCA 1FBDA 1IXGA 2CEXA 5I5PA 4KR5A 2HZKA 1LFHA 3OEMA 2E1SA 3MQ9A 2O7UA 4LATA 4C1TA 3P7IA 4XKQA 4F3BA 4GBVA 4OTEA 1JW5A 1B5IA 3QMFA 2H4IA 2Q74A 2DS9A 3IB1A 3FD3A 3PPOA 2XXPA 1D4NA 5H8QA 3ZKKA 4MFIA 2ZZXA 2F34A 4JXIA 3B8BA 4MIJA 1BTJA 2I58A 3C9HA 4GQOA 4F39A 1TT1A 2CZKA 2CEYA 4MAGA 4GXSB 4OXVA 1LGBC 3EKIA 2XXHA 2F8DA 3Q28A 3OO7A 1B1XA 1VFDA 5I2NA 2ONKE 3TZAA 2V4CA 1Y4TA 2F97A 1FPFA 4GWZA 3E9XA 3TAJA 4GWOA 1FBCA 4OEVA 1IMEA 2A5TA 3QUJA 1Y20A 5I57A 4ZE8A 3I5OA 2L5VA 4ECFA 3E3KA 4LZ7A 5CBRA 1XC1A 2FBPA 2AYSA 2ONRA 3PPRA 1Z7NE 1USYH 2WBBA 4XKRA 4QSEA 3R26A 3CVGA 4YKJA 1DSNA 1MY1A 1LCFA 5HM4B 2F7BA 4XKNA 2RKMA 1LBZA 4DLDA 4PE3A 1ZBMA 2ALUA 2V84A 5CM6A 3U92A 2Q2AA 3UIFA 4GOTA 1EU8A 1MY3A 3U65A 4NQ8A 1LBBA 2FA7A 2F7CA 3K6WA 3S9MC 1CB6A 2PFYA 4DE8A 3CFZA 5AA4A 3IB2A 1B52A 5ESYA 2QVUA 4PFRA 3C32A 4GIZA 3TCHA 4ESWA 3K1PA 4IO2A 4XFEA 2QL3A 2XXVA 3T66A 3PUXE 4R9FA 4RK2A 1UTBB 3G3GA 5K2XA 3OELA 4RYAA 4OETA 1RYOA 3SEUA 4X1BA 1O64A 1NNKA 1EZOA 1GVCA 4MLQA 5BWJA 5KZTA 2Q9TA 3ROJA 2UYFA 4MH5A 3TELA 4HTGA 4KCCA 4OVRA 2DE2A 3S2VA 1N3XA 3PV0E 1D9QA 3RNNA 5IZ3B 3CSGA 1XHYA 1B32A 1DTGA 3VV5A 4PAFA 5FTHA 3ECRA 5TP9A 3CFXA 3CRBA 1M5FA 1I6BA 1KWHA 3FXBA 3N5LA 3FVOA 4YMAA 3V5AA 2HQ0A 3PUVE 2QMXA 3TODA 4NF8B 3C33A 5I7IA 2PFZA 3T96B 4Q0CA 2GQ1A 1B5JA 4YAHX 1NFTA 4FBPA 2DXYA 3LBSA 4HW8A 1JVXA 3KGCA 4F3GA 5IGAA 1B3GA 1D9VA 1JEVA 1Y3NA 3EQ1A 1M5DA 4YB6A 1IIWA 4I40A 3OSQA 4N81A 5H8FB 1NUZA 2OLBA 2P1SA 4F2OA 2V25A 4Q30B 4QFLA 3OD7A 4GWUA 1EZPA 1VFEA 1ELJA 4MCOA 2DWAA 1LEVA 3ZS6A 3OO9A 2OWTA 4GBWA 4WEPA 2XD3A 1FPIA 1LFGA 1FPBA 2I6EA 1KZ8A 3QK6A 4H5FA 3KN8A 4F31B 3FXUA 4AS5A 3UN6A 4AQ4A 2CZIA 3RQTA 1B05A 2VPNA 3HHFA 4FECA 1DPPA 1POY1 1S7YA 1FBHA 1B3LA 5ICQA 1IMDA 1FQFA 2NOOA 3H6UA 4G8MA 1UIUA 4PDDA 4L17A 3SETA 4ND9A 4QXDA 2YPNA 3MSTA 3C31A 2KR0A 3K2DA 3C4MA 2Y7IA 4R73A 4YKIA 3D4GA 3KOSA 1JVYA 1AMFA 1PEBA 2D21A 2XX9A 2WBDA 4GWWA 1PDAA 2D3IA 3CIJA 4PTKA 3BFTA 2BJIA 1SI1A 4UA8A 3VXCA 2G29A 3HPIA 2QS4A 3FGSA 5ICTA 3S9LC 3R6UA 1B58A 1B0LA 1NNFA 4GF8A 4MJOA 4GX4A 1FPDA 3SEXA 4R74A 3PD8A 1PB7A 1ZJLA 4RY1A 3UORA 4EF2A 3MYUA 5IZ1A 1NKXA 2ANJA 4LQ2A 1YYZA 2HZLA 3T0JA 1AOVA 1SBPA 3GZGA 2Z8EA 2P2AA 4I9DA 4NN3A 3FVGA 3SEVA 3M3FA 4O7IA 5EHSA 3OOAA 3TYHA 2D5WA 5H8HA 4PCDA 1SI0A 4FE8A 3GBAA 5CI5A 3VE1B 2V93A 1FTAA 5CMKA 4AS4A 3G3HA 3T22A 1PB9A 4N6PA 4KHZE 4KQPA 2DWHA 1ANFA 4N6KA 5JTYB 1A7LA 2XA5A 3A3UA 5I59A 4U2RA 3HO7A 2DOJA 1BP5A 4WKMA 5I2KB 4I8CA 1URDA 1F9BA 3LUYA 3TCFA 3C34A 4LZ8A 2Q2CA 3CHGA 2WX9A 1EYJA 4FJPA 2XXTA 4ESXA 1PBPA 4U1ZA 2DYXA 5DVIA 3U94A 3SESA 1BKAA 2Z23A 3DLNA 2O84X 3O97A 4KPTA 4JVCA 5DVFA 2I3WA 3FIRA 4NF5B 3B7DA 3PMWA 3VFJA 3N94A 3PPQA 1NUWA 2ZYNA 4G68A 5ITOA 4IR8A 4O3BA 5EYFA 3RPWA 3K02A 3O66A 4GL0A 4LN5A 4X04A 4QFOA 3B6QA 4N91A 4PF8A 1P1QA 1SW5A 3DM0A 4H6DA 4P1LA 1IUDA 1AH5A 5CRYA 2QSXA 1B7ZA 3T9VA 4ZEKA 1MXXA 3BIGA 1L5TA 1AWBA 1FBGA 2Y84A 1QUJA 2RINA 3D4CA 3G3KA 3JYRA 2B3FA 4MMPA 2XHDA 3KN3A 1FPLA 4OQOA 4ELRA 1A8FA 1QGXA 5L9MA 2AL4A 4ZZAA 1QKAA 4MLVA 2QFLA 2IA4A 4PFBA 5ET6A 3K1MA 3VXBA 3MWBA 4UABA 1FQBA 1M5CA 3L6HA 3RT6B 5KCJA 1Y1ZA 3U72A 4ELPA 1LCTA 3LC8A 3IL1B 4TQUQ 4Q5TA 1LSTA 4MBPA 1B4ZA 2LAOA 3FXRA 5L9OA 3IR1A 4XF5A 4PFWA 1LB8A 3B6TA 3VDFA 2O1MA 1DPEA 1M5EA 3PUYE 4FEBA 1H43A 4N13A 4X9TA 3MP8A 2RC9A 1OQGA 5FHOA 3KFMA 2NUVA 2E0SA 4GWYA 3S4UA 2YJPA 3USDA 2I0CA 4NWCA 3U8QA 4ELQA 3KBRA 2UVGA 4WXJA 5TPAB 3IK6B 1K9YA 1R1NA 3TMGA 3QSLA 5L8DA 1JQFA 3PD9A 1IQ7A 3SZPA 4KI0E 4NF6B 4YZZA 2ZYMA 1YXIA 3TEPA 4F3SA 3MC2A 1Q9DA 1VE4A 1SW2A 3E13X 1INPA 1O7TA 3RT8A 3IOTA 2O69A 4F29A 4G8NA 2ZNSA 4MEVA 2KLFA 4JWXA 5ET8A 2PBWA 3Q27A 4OZ9A 2QS2A 1MG1A 2XWKA 4O3AA 4X8RA 5AA1A 4PETA 4BDRA 4ISUA 3PMXA 1LLSA 4O8MA 5JTYA 3QAXA 3BKIB 5I2KA 1SW4A 5DTBA 2HXRA 4XEQA 1VR5A 3KZGA 5DYHA 4F1YA 4MNPA 1II5A 4NHBA 5A5LA 1IMAA 4Q8RA 5F24A 1P1WA 3K6XA 4IY5A 3ISPA 4NEDA 2P0SA 1MM6A 4ELOA 1MH3A 4FIMA 1QUKA 1YZ0A 1ZMGA 2OCUA 3M3KA 3HFUA 2OWSA 3FVKA 1UIVA 4R6HA 4HXVA 4NX1A 3FV2A 1NNTA 4HE0A 2FVZA 1B4HA 1FPGA 1MQHA 4LA9A 2MKZA 5B7DA 3GBBA 4YB5A 4P56A 1IXCA 4GL8A 1WDNA 1IMFA 1B46A 1MY2A 1DBZA 1G0HA 2XD2A 3C35A 4MNCA 4UACA 1N76A 4OWDA 2HEUA 4GVOA 4JB7A 1UQWA 2O51A 4IGRA 1R6ZA 2Z22A 2DXRA 3M3LA 4IO4A 3WAEA 4DXUA 5B70A 4PGNA 3K4UA 3Q25A 4OA4A 1VDWA 3IOVA 2Y7PA 1RDYA 2O68A 2ZMBA 2THIA 5EQ8A 2R9JA 5DT6A 2RCBA 1DCUA 1MXVA 1T0KA 1XOCA 4RPOA 1EYKA 2F78A 5H8NB 3LSWA 3MP1A 4NTLA 1FBPA 1TFAA 2UYEA 1NNPA 5CC2A 4EXLA 2AL5A 4RJZA 3EHSA 5I58B 2Q8MA 4NAPA 5AA2D 2Q88A 3OO6A 1FPEA 3O28A 1MDQA 4POWA 1MRPA 2QS3A 5TPAA 1MY0A 3K6UA 4E0XA 1NMUA 5I56B 3MJNA 3ODBA 3RUMA 4NF6A 1DTZA 1JW1A 2A5SA 1US4A 1PC3A 4QFKA 5JK4A 2Y7KA 2FYIA 1Y3QA 1I6QA 4HCYA 3BIHA 2X7QA 1I69A 1TXFA 2Z8FA 3KBZA 3OXNA 4R2BA 3D1RA 3ILTB 2Y7WA 4PFYA 3H6VA 4X48A 1TWYA 1ATGA 3CR9A 2VOZA 3QYTA 4G4PA 1SVXB 3SEWA 4NWDA 1OLCA 3N6UA 3LV0A 4I1DA 2AIXA 1A54A 3IO4A 3T9UA 2RCAA 1H44A 1USYE 2ZZWA 3KOTA 4IB2A 3GLBA 3UK4A 4U22A 2V3QA 4FAJA 2OBGA 3G7WA 1EZ9A 4KYSA 1MPCA 3CI8A 3KJTA 3R7XA 4ZEIA 5AA2B 2HAUA 3GXAA 3M8UA 4F1VA 4DXCA 3KJ7A 5FHMA 3MPLA 2DVZA 4N17A 3N26A 3BBRA 4QHQA 1Q1KA 4P8BA 3K6VA 1GV8A 5DEXB 2DDKA 2Y5KA 1RYXA 1FJ9A 3ZKLA 1YCJA 1N7XA 1MQDA 4BDOA 3FV1A 1LFIA 1QKBA 3GYYA 1DOTA 2DVCA 2QPQA 2PCRA 3MP6A 3TTNA 3SDFA 4P3LA 1Y3PA 1O63A 2B3BA 5AA3A 1LAXA 3UA8A 5TU0A 4EF1A 2F7AA 3A29A 1UTBA 5KDTB 4QSCA 4PBHA 1YTVA 4N4UA 1I6AA 2I0BA 2XXIA 3H4ZA 4X1DA 2O7IA 1NI9A 2H99A 1LAGE 4NG7A 1R9QA 5H8NA 1P1NA 2F5XA 2OZZA 3L6GA 3ONMA 4H8JA 2KQZA 2REJA 4OVJA 3H06B 5EYHA 4F2QA 4EQBA 4AB5A 3T93B 5ET5A 4BDNA 4I3EA 1H3DA 4U4SA 4AB6A 1MQGA 1D9YA 1DK4A 3N6TA 2XXKA 1N3WA 1HSEA 2Q8JA 1B51A 1QUIA 2V3TA 3QIMA 1FJ6A 4LZ5A 5IZ3A 5F1QA 1J1NA 3K00A 1NUYA 4R2FA 2I3VA 3NOHA 4PDHA 5H8QB 5I56A 3KC0A 1NV1A 3HCQA 1B3FA 2H98A 4QRZA 4GWXA 3HSTA 4PAIA 4Z0IA 1MS7A 3OENA 4NGUA 4NF8A 1XT8A 1FQDA 2F6GA 1BLFA 4GX3A 4NF4B 3F11A 2H5YA
chains in the Genus database with same CATH topology
1ZTYA 4QF9A 1QULA 2ZXTA 1NH7A 3MVWA 5I2NB 3FJ7A 1ZLQA 4F1UA 1XVXA 2DP8A 4EXKA 3HN0A 5IKBA 2UVHA 1PB8A 4LQ5A 3TCGA 5H8SA 1H45A 5H8FA 4ZEBA 5I57B 4OEUA 5CMCA 3MZ1A 1MH4A 1B7HA 3MVYA 1MPBA 4U4XA 3V89B 3VLUA 3ILUB 1P1OA 1FQAA 1RKMA 1SDXA 4BDQA 3CG1A 1N04A 4YICA 1WODA 4JSOA 3SKPA 3TQLA 3WAFA 3HHGA 1N0TA 3TTRA 4R72A 1P1UA 1MXUA 1QVSA 3U93A 3O29A 2X26A 4BDLA 2CZLA 3UP9A 1FTKA 1D3KA 2QMWA 2H9BA 3MAMA 5AA4B 1FTJA 4DXBA 4ZECA 1IEJA 2ESNA 3EHTA 3LR1A 3MZBA 3TTMA 5BUUA 3T9XB 1YPNA 5EHMA 4LVQA 4N07A 3FATA 5I84A 4ZE9A 5ITPA 1FQEA 3FZVA 3A09A 4ZDMA 1MXWA 4OFOA 1TFDA 4H0WA 3VLVA 1OLAA 3TTLA 4DIGA 3SERA 1ZU0A 5KDTA 1GTKA 5K2YA 2V3UA 1WVJA 3Q26A 1S50A 4R9GA 4YB7A 4POXA 4XKPA 2PVUA 4RK9A 2ZNUA 3OSRA 1B9JA 4ZS9A 1AL3A 5L9SA 5JEIA 4OMBA 1EH3A 4GXAA 3MW0A 4OERA 1NL5A 5DVJA 2HAVA 2RC8A 4U23A 4EQ9A 3H6TA 3IORA 4R75A 5TP9B 4BDMA 3CFLA 2DE4A 2PT2A 2F6PA 5M2VA 4F18A 1IZ1A 1MM7A 2IEEA 5HBCA 2O6AA 3DELB 4O3CA 4H1XA 3KEIA 1B6HA 1MPDA 1Y4CA 3EPEA 4OENA 3PU5A 3V8XB 3MUQA 5A5XB 3G3FA 4NF4A 3TFLA 3KSXA 1OMPA 2GHBA 3PGFA 3JV9A 2Q89A 4QFNA 3MBPA 4E0WA 1FQCA 4F3PA 4NE4A 2F36A 2ONSA 4NF5A 1NH8A 4TLMB 3FVNA 3V83A 5HPQA 4IO6A 3TUSA 3IB0A 4FORA 4RA1A 3RTWB 1B3HA 4G8HA 2XX8A 2R71A 3T9HB 4GRKA 2B65A 3MPKA 3IX1A 1SW1A 2H25A 1FTLA 1MQIA 4OFLA 3I6VA 2XXRA 4OYVA 1MDP1 3FUZA 3EF7A 1MQJA 1MY4A 1A55A 4KCDA 3FASA 5FTIA 4DDDA 4EQ7A 2NWJA 3AXFA 4ONYA 3H03A 2G93A 1UTHB 3MVZA 1LBCA 2Y7RA 3PUWE 4RPNA 2DE3A 2PYYA 4M4GA 1OIBA 1FW0A 2XXYA 2GFEA 1OVTA 4JWOA 2QJEA 2DWJA 2M8CA 3Q29A 4F19A 4H67A 4JBZA 1VSOA 3O6HA 2GRVA 1IXHA 1LAFE 3IAZA 4F22A 3K01A 4MF3A 3PPNA 2R6GE 3LSXA 4THIA 2RC7A 4U1OA 1OVBA 2UVIA 2NXOA 1LAHE 3K0VA 2GHAA 3VVDA 4G2ZA 4IO7A 3VVFA 4TLLB 3FJMA 2XXUA 3FJGA 1N84A 4NMYA 4PFTA 1A99A 1FTOA 1POTA 4YU0A 2WKYA 3PPPA 4IY6A 2DQVA 5ELVA 3H7MA 5ISUA 1Q35A 2QRYA 4JWYA 3O2AA 2NVUB 3KN7A 5H8HB 1QJMA 4IO3A 5LOMA 4P0GA 3DP8A 5I59B 3C36A 4IO5A 4DZ1A 2ABHA 3RY3A 1DMBA 1AIVA 3A3CA 4C0RA 5CBSA 3VVEA 1FCKA 3BFUA 3UGWA 4TOZA 3KSJA 5A5XA 1Z7ME 4M1VA 2VD2A 1A8EA 2DWIA 4JDFA 4G68B 3VLWA 4P11A 5CMMA 4RXLA 3PUZE 3CG3A 4KFQA 3RTFB 4PQJA 3RLFE 5AE4A 2I4CA 1H76A 4IGTA 1CE2A 2XXXA 3IJOB 1XS5A 3FXQA 1B2HA 4GLIA 1PBQA 1XVYA 3IJXB 2I4BA 2HFBA 3RGYA 4KYEA 2OJTA 1BIYA 1B5HA 2XXWA 2OK2A 1SYIA 3DP6A 1QW0A 2HCAA 3LSFB 4H8IA 3RN8A 1HSJA 5KCJB 1SD3A 4LUBA 1JW4A 4PE5B 4FEDA 2GH9A 2PT1A 1N7WA 4WEDA 1UTHA 3I3VA 3OMBA 1SYHA 2UVJA 3U1OA 4GD5A 2I48A 3H6WA 3MVXA 4DCXA 4DCYA 4ZZEA 2CMOA 2BJJX 3G3JA 1IXIA 3B6WA 3E4RA 3EN3A 4XXUA 2VP1A 4K3FA 3MZ9A 4H65A 2VHAA 4BLAA 3O6IA 4PFUA 4YKKA 4ZEFA 4PP0A 2I49A 5I58A 4EDPA 3O6GA 1GGGA 2UXAA 3DP4A 1OQHA 4EUOA 3IOWA 1US5A 4G77A 3G3IA 3W9WA 1MXYA 4OFJA 4P0IA 1YAEA 3W9VA 1URSA 1JNFA 4YMBA 3H3GA 4KYDA 2X7PA 5CMBA 3S9NC 3CSBA 4R6YA 2RF1A 4KD5A 4Z7EA 3QUFA 4LP2B 3TDJA 3K1NA 1M5BA 4U21A 1B40A 4OESA 2ZYOA 2ZYKA 4YKPA 1MXZA 4R6KA 4JSDA 1S9TA 1GR2A 5F7VA 2A5TB 4ZEDA 3O9PA 2Z8DA 4G68C 1B0HA 3IOUA 1JEUA 2FNCA 3LSLA 3EHUA 2W7YA 2PX1A 1ZIUA 2REGA 1ZKBA 1SQYA 3S9EA 4C1UA 1B7UA 2VGQA 4GFRA 5AA2A 1B1HA 4OHNA 2ZNTA 2VD3A 3JZJA 2PMSA 5J1DA 1IITA 4XTCQ 2QS1A 3PMVA 5FHNA 4LONB 4QSDA 4FATA 3THIA 2F35A 1B3EA 5DEXA 3TKDA 3OEKA 1LB9A 4HCWA 3TTKA 1P99A 3HV1A 3TPAA 2YLNA 3W15C 4XIGQ 4H5GA 2XX7A 2DSFA 1URGA 3QXMA 4QFPA 1FTMA 5IAIA 1Y9UA 3SEYA 3IO6A 1A40A 3KG2A 1JETA 2XXQA 3TQWA 1R9LA 4RNSA 3OO8A 2O1LA 4HS7A 1Y1MA 3ZSFA 1HSLA 4I62A 2HXWA 1IXGA 4KR5A 2HZKA 1LFHA 3OEMA 2E1SA 3MQ9A 2O7UA 4LATA 4C1TA 3P7IA 4XKQA 4F3BA 4OTEA 1JW5A 1B5IA 2H4IA 2DS9A 3IB1A 3FD3A 3PPOA 2XXPA 1D4NA 5H8QA 3ZKKA 4MFIA 2F34A 4JXIA 4F39A 1BTJA 2I58A 3C9HA 4GQOA 1TT1A 4GXSB 4OXVA 1LGBC 2XXHA 2F8DA 3Q28A 3OO7A 1B1XA 1VFDA 5I2NA 2ONKE 3TZAA 1Y4TA 2F97A 3E9XA 3TAJA 4GWOA 4OEVA 2A5TA 3QUJA 1Y20A 5I57A 4ZE8A 3I5OA 4ECFA 3E3KA 4LZ7A 5CBRA 1XC1A 2AYSA 2ONRA 3PPRA 1Z7NE 1USYH 4XKRA 4QSEA 3R26A 3CVGA 4YKJA 1DSNA 1MY1A 1LCFA 5HM4B 2F7BA 4XKNA 2RKMA 4DLDA 1ZBMA 2ALUA 2V84A 5CM6A 3U92A 2Q2AA 3UIFA 4GOTA 1EU8A 1MY3A 1LBBA 2FA7A 2F7CA 3K6WA 3S9MC 1CB6A 4DE8A 3CFZA 5AA4A 3IB2A 1B52A 3C32A 4GIZA 3TCHA 4ESWA 3K1PA 4IO2A 2QL3A 2XXVA 3T66A 3PUXE 4R9FA 4RK2A 1UTBB 3G3GA 5K2XA 3OELA 4RYAA 4OETA 1RYOA 3SEUA 4X1BA 1O64A 1NNKA 1EZOA 1GVCA 4MLQA 5BWJA 5KZTA 2Q9TA 2UYFA 4MH5A 3TELA 4HTGA 4KCCA 2DE2A 3S2VA 1N3XA 3PV0E 3RNNA 3CSGA 1XHYA 1B32A 1DTGA 3VV5A 5FTHA 3ECRA 5TP9A 3CFXA 3CRBA 1M5FA 1I6BA 1KWHA 3N5LA 3FVOA 4YMAA 3V5AA 2HQ0A 3PUVE 2QMXA 3TODA 4NF8B 3C33A 3T96B 4Q0CA 1B5JA 4YAHX 1NFTA 2DXYA 3LBSA 4HW8A 1JVXA 3KGCA 4F3GA 1B3GA 1D9VA 1JEVA 1Y3NA 3EQ1A 1M5DA 4YB6A 1IIWA 3OSQA 5H8FB 2OLBA 2P1SA 4F2OA 2V25A 4Q30B 3OD7A 4QFLA 1EZPA 1VFEA 1ELJA 2DWAA 3ZS6A 3OO9A 2OWTA 4WEPA 2XD3A 1LFGA 2I6EA 3QK6A 4H5FA 3KN8A 4F31B 3FXUA 3UN6A 4AQ4A 3RQTA 1B05A 3HHFA 4FECA 1DPPA 1POY1 1S7YA 1B3LA 5ICQA 1FQFA 2NOOA 3H6UA 4G8MA 1UIUA 4L17A 3SETA 4ND9A 2YPNA 3C31A 3K2DA 3C4MA 2Y7IA 4R73A 4YKIA 3D4GA 3KOSA 1JVYA 1AMFA 1PEBA 2D21A 2XX9A 1PDAA 2D3IA 3CIJA 3BFTA 1SI1A 4UA8A 3VXCA 2G29A 3HPIA 2QS4A 3FGSA 5ICTA 3S9LC 3R6UA 1B58A 1B0LA 1NNFA 4GF8A 3SEXA 4R74A 3PD8A 1PB7A 1ZJLA 4RY1A 3UORA 4EF2A 1NKXA 2ANJA 4LQ2A 2HZLA 1AOVA 1SBPA 3GZGA 2Z8EA 2P2AA 4I9DA 3FVGA 3SEVA 3M3FA 5EHSA 3OOAA 3TYHA 2D5WA 5H8HA 1SI0A 4FE8A 3GBAA 5CI5A 3VE1B 2V93A 5CMKA 3G3HA 3T22A 1PB9A 4N6PA 4KHZE 4KQPA 2DWHA 1ANFA 5JTYB 1A7LA 3A3UA 5I59A 4U2RA 3HO7A 2DOJA 1BP5A 4WKMA 5I2KB 4I8CA 1URDA 1F9BA 3LUYA 3TCFA 3C34A 4LZ8A 2Q2CA 4FJPA 2XXTA 4ESXA 1PBPA 4U1ZA 2DYXA 5DVIA 3U94A 3SESA 1BKAA 2Z23A 3DLNA 2O84X 3O97A 4KPTA 5DVFA 2I3WA 3FIRA 4NF5B 3B7DA 3PMWA 3VFJA 3N94A 3PPQA 2ZYNA 4G68A 5ITOA 4O3BA 5EYFA 3RPWA 3K02A 3O66A 4GL0A 4QFOA 3B6QA 1P1QA 1SW5A 3DM0A 4H6DA 1IUDA 1AH5A 5CRYA 2QSXA 1B7ZA 3T9VA 4ZEKA 1MXXA 1L5TA 2Y84A 1QUJA 2RINA 3D4CA 3G3KA 3JYRA 2B3FA 2XHDA 3KN3A 4OQOA 4ELRA 1A8FA 5L9MA 2AL4A 4ZZAA 1QKAA 4MLVA 2IA4A 3K1MA 3VXBA 3MWBA 1FQBA 1M5CA 3L6HA 3RT6B 5KCJA 1Y1ZA 3U72A 4ELPA 1LCTA 3LC8A 3IL1B 4TQUQ 4Q5TA 1LSTA 4MBPA 1B4ZA 2LAOA 3FXRA 5L9OA 3IR1A 4PFWA 1LB8A 3B6TA 3VDFA 2O1MA 1DPEA 1M5EA 3PUYE 4FEBA 1H43A 4N13A 4X9TA 3MP8A 2RC9A 1OQGA 5FHOA 3KFMA 2NUVA 2E0SA 3S4UA 2YJPA 3USDA 2I0CA 4NWCA 3U8QA 4ELQA 3KBRA 2UVGA 4WXJA 5TPAB 3IK6B 1R1NA 3TMGA 3QSLA 5L8DA 1JQFA 3PD9A 1IQ7A 4KI0E 4NF6B 4YZZA 2ZYMA 3TEPA 4F3SA 3MC2A 1VE4A 1SW2A 3E13X 1O7TA 3RT8A 3IOTA 2O69A 4F29A 4G8NA 2ZNSA 2KLFA 4JWXA 2PBWA 3Q27A 4OZ9A 2QS2A 1MG1A 4O3AA 5AA1A 4PETA 4BDRA 4ISUA 3PMXA 1LLSA 5JTYA 3QAXA 3BKIB 5I2KA 1SW4A 5DTBA 1VR5A 3KZGA 4F1YA 5DYHA 1II5A 4Q8RA 1P1WA 3K6XA 4IY5A 4NEDA 2P0SA 1MM6A 4ELOA 1MH3A 4FIMA 1QUKA 1ZMGA 2OCUA 3M3KA 2OWSA 3FVKA 1UIVA 4R6HA 3FV2A 1NNTA 1B4HA 1MQHA 4LA9A 5B7DA 3GBBA 4YB5A 1IXCA 4GL8A 1WDNA 1B46A 1MY2A 2XD2A 3C35A 4UACA 1N76A 4OWDA 2HEUA 4GVOA 4JB7A 1UQWA 2O51A 4IGRA 1R6ZA 2Z22A 2DXRA 3M3LA 4IO4A 3WAEA 4DXUA 5B70A 3K4UA 3Q25A 3IOVA 2Y7PA 2O68A 2ZMBA 2THIA 2R9JA 5DT6A 2RCBA 1MXVA 1T0KA 1XOCA 4RPOA 2F78A 5H8NB 3LSWA 3MP1A 4NTLA 1TFAA 2UYEA 1NNPA 5CC2A 4EXLA 2AL5A 4RJZA 3EHSA 5I58B 5AA2D 2Q88A 3OO6A 3O28A 1MDQA 4POWA 1MRPA 2QS3A 5TPAA 1MY0A 3K6UA 4E0XA 1NMUA 5I56B 3MJNA 3ODBA 3RUMA 4NF6A 1DTZA 1JW1A 2A5SA 1US4A 1PC3A 4QFKA 5JK4A 2Y7KA 2FYIA 1Y3QA 1I6QA 4HCYA 2X7QA 1I69A 1TXFA 2Z8FA 3OXNA 4R2BA 3ILTB 2Y7WA 4PFYA 3H6VA 4X48A 1TWYA 1ATGA 3CR9A 2VOZA 3QYTA 4G4PA 1SVXB 3SEWA 4NWDA 1OLCA 3N6UA 4I1DA 2AIXA 1A54A 3IO4A 3T9UA 2RCAA 1H44A 1USYE 3KOTA 4IB2A 3GLBA 3UK4A 4U22A 2V3QA 4FAJA 2OBGA 3G7WA 1EZ9A 4KYSA 1MPCA 3CI8A 3KJTA 3R7XA 4ZEIA 5AA2B 2HAUA 3GXAA 3M8UA 4F1VA 4DXCA 3KJ7A 5FHMA 3MPLA 2DVZA 3N26A 3BBRA 4QHQA 1Q1KA 3K6VA 1GV8A 5DEXB 1RYXA 3ZKLA 1YCJA 1N7XA 1MQDA 4BDOA 3FV1A 1LFIA 1QKBA 1DOTA 2DVCA 2QPQA 3MP6A 3TTNA 3SDFA 1Y3PA 1O63A 2B3BA 5AA3A 1LAXA 3UA8A 5TU0A 4EF1A 2F7AA 1UTBA 5KDTB 4QSCA 1YTVA 1I6AA 2I0BA 2XXIA 3H4ZA 4X1DA 2O7IA 2H99A 1LAGE 5H8NA 1R9QA 1P1NA 2F5XA 2OZZA 3L6GA 3ONMA 4H8JA 2REJA 4OVJA 3H06B 4F2QA 4EQBA 4AB5A 3T93B 4BDNA 1H3DA 4U4SA 4AB6A 1MQGA 1D9YA 3N6TA 1N3WA 1HSEA 2Q8JA 1B51A 1QUIA 2V3TA 3QIMA 4LZ5A 5F1QA 1J1NA 3K00A 4R2FA 2I3VA 5H8QB 5I56A 3HCQA 1B3FA 2H98A 4QRZA 3HSTA 4Z0IA 1MS7A 3OENA 4NF8A 1XT8A 1FQDA 2F6GA 1BLFA 4NF4B 3F11A 2H5YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZTY A;  4QF9 A;  1QUL A;  2ZXT A;  1NH7 A;  3MVW A;  5I2N B;  3FJ7 A;  1ZLQ A;  4F1U A;  1XVX A;  2DP8 A;  4EXK A;  3HN0 A;  5IKB A;  2UVH A;  1PB8 A;  4LQ5 A;  3TCG A;  5H8S A;  1H45 A;  5H8F A;  4ZEB A;  5I57 B;  4OEU A;  5CMC A;  3MZ1 A;  1MH4 A;  1B7H A;  3MVY A;  1MPB A;  4U4X A;  3V89 B;  3VLU A;  3ILU B;  1P1O A;  1FQA A;  1RKM A;  1SDX A;  4BDQ A;  3CG1 A;  1N04 A;  4YIC A;  1WOD A;  4JSO A;  3SKP A;  3TQL A;  3WAF A;  3HHG A;  1N0T A;  3TTR A;  4R72 A;  1P1U A;  1MXU A;  1QVS A;  3U93 A;  3O29 A;  2X26 A;  4BDL A;  2CZL A;  3UP9 A;  1FTK A;  1D3K A;  2QMW A;  2H9B A;  3MAM A;  5AA4 B;  1FTJ A;  4DXB A;  4ZEC A;  1IEJ A;  2ESN A;  3EHT A;  3LR1 A;  3MZB A;  3TTM A;  5BUU A;  3T9X B;  1YPN A;  5EHM A;  4LVQ A;  4N07 A;  3FAT A;  5I84 A;  4ZE9 A;  5ITP A;  1FQE A;  3FZV A;  3A09 A;  4ZDM A;  1MXW A;  4OFO A;  1TFD A;  4H0W A;  3VLV A;  1OLA A;  3TTL A;  4DIG A;  3SER A;  1ZU0 A;  5KDT A;  1GTK A;  5K2Y A;  2V3U A;  1WVJ A;  3Q26 A;  1S50 A;  4R9G A;  4YB7 A;  4POX A;  4XKP A;  2PVU A;  4RK9 A;  2ZNU A;  3OSR A;  1B9J A;  4ZS9 A;  1AL3 A;  5L9S A;  5JEI A;  4OMB A;  1EH3 A;  4GXA A;  3MW0 A;  4OER A;  1NL5 A;  5DVJ A;  2HAV A;  2RC8 A;  4U23 A;  4EQ9 A;  3H6T A;  3IOR A;  4R75 A;  5TP9 B;  4BDM A;  3CFL A;  2DE4 A;  2PT2 A;  2F6P A;  5M2V A;  4F18 A;  1IZ1 A;  1MM7 A;  2IEE A;  5HBC A;  2O6A A;  3DEL B;  4O3C A;  4H1X A;  3KEI A;  1B6H A;  1MPD A;  1Y4C A;  3EPE A;  4OEN A;  3PU5 A;  3V8X B;  3MUQ A;  5A5X B;  3G3F A;  4NF4 A;  3TFL A;  3KSX A;  1OMP A;  2GHB A;  3PGF A;  3JV9 A;  2Q89 A;  4QFN A;  3MBP A;  4E0W A;  1FQC A;  4F3P A;  4NE4 A;  2F36 A;  2ONS A;  4NF5 A;  1NH8 A;  4TLM B;  3FVN A;  3V83 A;  5HPQ A;  4IO6 A;  3TUS A;  3IB0 A;  4FOR A;  4RA1 A;  3RTW B;  1B3H A;  4G8H A;  2XX8 A;  2R71 A;  3T9H B;  4GRK A;  2B65 A;  3MPK A;  3IX1 A;  1SW1 A;  2H25 A;  1FTL A;  1MQI A;  4OFL A;  3I6V A;  2XXR A;  4OYV A;  1MDP 1;  3FUZ A;  3EF7 A;  1MQJ A;  1MY4 A;  1A55 A;  4KCD A;  3FAS A;  5FTI A;  4DDD A;  4EQ7 A;  2NWJ A;  3AXF A;  4ONY A;  3H03 A;  2G93 A;  1UTH B;  3MVZ A;  1LBC A;  2Y7R A;  3PUW E;  4RPN A;  2DE3 A;  2PYY A;  4M4G A;  1OIB A;  1FW0 A;  2XXY A;  2GFE A;  1OVT A;  4JWO A;  2QJE A;  2DWJ A;  2M8C A;  3Q29 A;  4F19 A;  4H67 A;  4JBZ A;  1VSO A;  3O6H A;  2GRV A;  1IXH A;  1LAF E;  3IAZ A;  4F22 A;  3K01 A;  4MF3 A;  3PPN A;  2R6G E;  3LSX A;  4THI A;  2RC7 A;  4U1O A;  1OVB A;  2UVI A;  2NXO A;  1LAH E;  3K0V A;  2GHA A;  3VVD A;  4G2Z A;  4IO7 A;  3VVF A;  4TLL B;  3FJM A;  2XXU A;  3FJG A;  1N84 A;  4NMY A;  4PFT A;  1A99 A;  1FTO A;  1POT A;  4YU0 A;  2WKY A;  3PPP A;  4IY6 A;  2DQV A;  5ELV A;  3H7M A;  5ISU A;  1Q35 A;  2QRY A;  4JWY A;  3O2A A;  2NVU B;  3KN7 A;  5H8H B;  1QJM A;  4IO3 A;  5LOM A;  4P0G A;  3DP8 A;  5I59 B;  3C36 A;  4IO5 A;  4DZ1 A;  2ABH A;  3RY3 A;  1DMB A;  1AIV A;  3A3C A;  4C0R A;  5CBS A;  3VVE A;  1FCK A;  3BFU A;  3UGW A;  4TOZ A;  3KSJ A;  5A5X A;  1Z7M E;  4M1V A;  2VD2 A;  1A8E A;  2DWI A;  4JDF A;  4G68 B;  3VLW A;  4P11 A;  5CMM A;  4RXL A;  3PUZ E;  3CG3 A;  4KFQ A;  3RTF B;  4PQJ A;  3RLF E;  5AE4 A;  2I4C A;  1H76 A;  4IGT A;  1CE2 A;  2XXX A;  3IJO B;  1XS5 A;  3FXQ A;  1B2H A;  4GLI A;  1PBQ A;  1XVY A;  3IJX B;  2I4B A;  2HFB A;  3RGY A;  4KYE A;  2OJT A;  1BIY A;  1B5H A;  2XXW A;  2OK2 A;  1SYI A;  3DP6 A;  1QW0 A;  2HCA A;  3LSF B;  4H8I A;  3RN8 A;  1HSJ A;  5KCJ B;  1SD3 A;  4LUB A;  1JW4 A;  4PE5 B;  4FED A;  2GH9 A;  2PT1 A;  1N7W A;  4WED A;  1UTH A;  3I3V A;  3OMB A;  1SYH A;  2UVJ A;  3U1O A;  4GD5 A;  2I48 A;  3H6W A;  3MVX A;  4DCX A;  4DCY A;  4ZZE A;  2CMO A;  2BJJ X;  3G3J A;  1IXI A;  3B6W A;  3E4R A;  3EN3 A;  4XXU A;  2VP1 A;  4K3F A;  3MZ9 A;  4H65 A;  2VHA A;  4BLA A;  3O6I A;  4PFU A;  4YKK A;  4ZEF A;  4PP0 A;  2I49 A;  5I58 A;  4EDP A;  3O6G A;  1GGG A;  2UXA A;  3DP4 A;  1OQH A;  4EUO A;  3IOW A;  1US5 A;  4G77 A;  3G3I A;  3W9W A;  1MXY A;  4OFJ A;  4P0I A;  1YAE A;  3W9V A;  1URS A;  1JNF A;  4YMB A;  3H3G A;  4KYD A;  2X7P A;  5CMB A;  3S9N C;  3CSB A;  4R6Y A;  2RF1 A;  4KD5 A;  4Z7E A;  3QUF A;  4LP2 B;  3TDJ A;  3K1N A;  1M5B A;  4U21 A;  1B40 A;  4OES A;  2ZYO A;  2ZYK A;  4YKP A;  1MXZ A;  4R6K A;  4JSD A;  1S9T A;  1GR2 A;  5F7V A;  2A5T B;  4ZED A;  3O9P A;  2Z8D A;  4G68 C;  1B0H A;  3IOU A;  1JEU A;  2FNC A;  3LSL A;  3EHU A;  2W7Y A;  2PX1 A;  1ZIU A;  2REG A;  1ZKB A;  1SQY A;  3S9E A;  4C1U A;  1B7U A;  2VGQ A;  4GFR A;  5AA2 A;  1B1H A;  4OHN A;  2ZNT A;  2VD3 A;  3JZJ A;  2PMS A;  5J1D A;  1IIT A;  4XTC Q;  2QS1 A;  3PMV A;  5FHN A;  4LON B;  4QSD A;  4FAT A;  3THI A;  2F35 A;  1B3E A;  5DEX A;  3TKD A;  3OEK A;  1LB9 A;  4HCW A;  3TTK A;  1P99 A;  3HV1 A;  3TPA A;  2YLN A;  3W15 C;  4XIG Q;  4H5G A;  2XX7 A;  2DSF A;  1URG A;  3QXM A;  4QFP A;  1FTM A;  5IAI A;  1Y9U A;  3SEY A;  3IO6 A;  1A40 A;  3KG2 A;  1JET A;  2XXQ A;  3TQW A;  1R9L A;  4RNS A;  3OO8 A;  2O1L A;  4HS7 A;  1Y1M A;  3ZSF A;  1HSL A;  4I62 A;  2HXW A;  1IXG A;  4KR5 A;  2HZK A;  1LFH A;  3OEM A;  2E1S A;  3MQ9 A;  2O7U A;  4LAT A;  4C1T A;  3P7I A;  4XKQ A;  4F3B A;  4OTE A;  1JW5 A;  1B5I A;  2H4I A;  2DS9 A;  3IB1 A;  3FD3 A;  3PPO A;  2XXP A;  1D4N A;  5H8Q A;  3ZKK A;  4MFI A;  2F34 A;  4JXI A;  4F39 A;  1BTJ A;  2I58 A;  3C9H A;  4GQO A;  1TT1 A;  4GXS B;  4OXV A;  1LGB C;  2XXH A;  2F8D A;  3Q28 A;  3OO7 A;  1B1X A;  1VFD A;  5I2N A;  2ONK E;  3TZA A;  1Y4T A;  2F97 A;  3E9X A;  3TAJ A;  4GWO A;  4OEV A;  2A5T A;  3QUJ A;  1Y20 A;  5I57 A;  4ZE8 A;  3I5O A;  4ECF A;  3E3K A;  4LZ7 A;  5CBR A;  1XC1 A;  2AYS A;  2ONR A;  3PPR A;  1Z7N E;  1USY H;  4XKR A;  4QSE A;  3R26 A;  3CVG A;  4YKJ A;  1DSN A;  1MY1 A;  1LCF A;  5HM4 B;  2F7B A;  4XKN A;  2RKM A;  4DLD A;  1ZBM A;  2ALU A;  2V84 A;  5CM6 A;  3U92 A;  2Q2A A;  3UIF A;  4GOT A;  1EU8 A;  1MY3 A;  1LBB A;  2FA7 A;  2F7C A;  3K6W A;  3S9M C;  1CB6 A;  4DE8 A;  3CFZ A;  5AA4 A;  3IB2 A;  1B52 A;  3C32 A;  4GIZ A;  3TCH A;  4ESW A;  3K1P A;  4IO2 A;  2QL3 A;  2XXV A;  3T66 A;  3PUX E;  4R9F A;  4RK2 A;  1UTB B;  3G3G A;  5K2X A;  3OEL A;  4RYA A;  4OET A;  1RYO A;  3SEU A;  4X1B A;  1O64 A;  1NNK A;  1EZO A;  1GVC A;  4MLQ A;  5BWJ A;  5KZT A;  2Q9T A;  2UYF A;  4MH5 A;  3TEL A;  4HTG A;  4KCC A;  2DE2 A;  3S2V A;  1N3X A;  3PV0 E;  3RNN A;  3CSG A;  1XHY A;  1B32 A;  1DTG A;  3VV5 A;  5FTH A;  3ECR A;  5TP9 A;  3CFX A;  3CRB A;  1M5F A;  1I6B A;  1KWH A;  3N5L A;  3FVO A;  4YMA A;  3V5A A;  2HQ0 A;  3PUV E;  2QMX A;  3TOD A;  4NF8 B;  3C33 A;  3T96 B;  4Q0C A;  1B5J A;  4YAH X;  1NFT A;  2DXY A;  3LBS A;  4HW8 A;  1JVX A;  3KGC A;  4F3G A;  1B3G A;  1D9V A;  1JEV A;  1Y3N A;  3EQ1 A;  1M5D A;  4YB6 A;  1IIW A;  3OSQ A;  5H8F B;  2OLB A;  2P1S A;  4F2O A;  2V25 A;  4Q30 B;  3OD7 A;  4QFL A;  1EZP A;  1VFE A;  1ELJ A;  2DWA A;  3ZS6 A;  3OO9 A;  2OWT A;  4WEP A;  2XD3 A;  1LFG A;  2I6E A;  3QK6 A;  4H5F A;  3KN8 A;  4F31 B;  3FXU A;  3UN6 A;  4AQ4 A;  3RQT A;  1B05 A;  3HHF A;  4FEC A;  1DPP A;  1POY 1;  1S7Y A;  1B3L A;  5ICQ A;  1FQF A;  2NOO A;  3H6U A;  4G8M A;  1UIU A;  4L17 A;  3SET A;  4ND9 A;  2YPN A;  3C31 A;  3K2D A;  3C4M A;  2Y7I A;  4R73 A;  4YKI A;  3D4G A;  3KOS A;  1JVY A;  1AMF A;  1PEB A;  2D21 A;  2XX9 A;  1PDA A;  2D3I A;  3CIJ A;  3BFT A;  1SI1 A;  4UA8 A;  3VXC A;  2G29 A;  3HPI A;  2QS4 A;  3FGS A;  5ICT A;  3S9L C;  3R6U A;  1B58 A;  1B0L A;  1NNF A;  4GF8 A;  3SEX A;  4R74 A;  3PD8 A;  1PB7 A;  1ZJL A;  4RY1 A;  3UOR A;  4EF2 A;  1NKX A;  2ANJ A;  4LQ2 A;  2HZL A;  1AOV A;  1SBP A;  3GZG A;  2Z8E A;  2P2A A;  4I9D A;  3FVG A;  3SEV A;  3M3F A;  5EHS A;  3OOA A;  3TYH A;  2D5W A;  5H8H A;  1SI0 A;  4FE8 A;  3GBA A;  5CI5 A;  3VE1 B;  2V93 A;  5CMK A;  3G3H A;  3T22 A;  1PB9 A;  4N6P A;  4KHZ E;  4KQP A;  2DWH A;  1ANF A;  5JTY B;  1A7L A;  3A3U A;  5I59 A;  4U2R A;  3HO7 A;  2DOJ A;  1BP5 A;  4WKM A;  5I2K B;  4I8C A;  1URD A;  1F9B A;  3LUY A;  3TCF A;  3C34 A;  4LZ8 A;  2Q2C A;  4FJP A;  2XXT A;  4ESX A;  1PBP A;  4U1Z A;  2DYX A;  5DVI A;  3U94 A;  3SES A;  1BKA A;  2Z23 A;  3DLN A;  2O84 X;  3O97 A;  4KPT A;  5DVF A;  2I3W A;  3FIR A;  4NF5 B;  3B7D A;  3PMW A;  3VFJ A;  3N94 A;  3PPQ A;  2ZYN A;  4G68 A;  5ITO A;  4O3B A;  5EYF A;  3RPW A;  3K02 A;  3O66 A;  4GL0 A;  4QFO A;  3B6Q A;  1P1Q A;  1SW5 A;  3DM0 A;  4H6D A;  1IUD A;  1AH5 A;  5CRY A;  2QSX A;  1B7Z A;  3T9V A;  4ZEK A;  1MXX A;  1L5T A;  2Y84 A;  1QUJ A;  2RIN A;  3D4C A;  3G3K A;  3JYR A;  2B3F A;  2XHD A;  3KN3 A;  4OQO A;  4ELR A;  1A8F A;  5L9M A;  2AL4 A;  4ZZA A;  1QKA A;  4MLV A;  2IA4 A;  3K1M A;  3VXB A;  3MWB A;  1FQB A;  1M5C A;  3L6H A;  3RT6 B;  5KCJ A;  1Y1Z A;  3U72 A;  4ELP A;  1LCT A;  3LC8 A;  3IL1 B;  4TQU Q;  4Q5T A;  1LST A;  4MBP A;  1B4Z A;  2LAO A;  3FXR A;  5L9O A;  3IR1 A;  4PFW A;  1LB8 A;  3B6T A;  3VDF A;  2O1M A;  1DPE A;  1M5E A;  3PUY E;  4FEB A;  1H43 A;  4N13 A;  4X9T A;  3MP8 A;  2RC9 A;  1OQG A;  5FHO A;  3KFM A;  2NUV A;  2E0S A;  3S4U A;  2YJP A;  3USD A;  2I0C A;  4NWC A;  3U8Q A;  4ELQ A;  3KBR A;  2UVG A;  4WXJ A;  5TPA B;  3IK6 B;  1R1N A;  3TMG A;  3QSL A;  5L8D A;  1JQF A;  3PD9 A;  1IQ7 A;  4KI0 E;  4NF6 B;  4YZZ A;  2ZYM A;  3TEP A;  4F3S A;  3MC2 A;  1VE4 A;  1SW2 A;  3E13 X;  1O7T A;  3RT8 A;  3IOT A;  2O69 A;  4F29 A;  4G8N A;  2ZNS A;  2KLF A;  4JWX A;  2PBW A;  3Q27 A;  4OZ9 A;  2QS2 A;  1MG1 A;  4O3A A;  5AA1 A;  4PET A;  4BDR A;  4ISU A;  3PMX A;  1LLS A;  5JTY A;  3QAX A;  3BKI B;  5I2K A;  1SW4 A;  5DTB A;  1VR5 A;  3KZG A;  4F1Y A;  5DYH A;  1II5 A;  4Q8R A;  1P1W A;  3K6X A;  4IY5 A;  4NED A;  2P0S A;  1MM6 A;  4ELO A;  1MH3 A;  4FIM A;  1QUK A;  1ZMG A;  2OCU A;  3M3K A;  2OWS A;  3FVK A;  1UIV A;  4R6H A;  3FV2 A;  1NNT A;  1B4H A;  1MQH A;  4LA9 A;  5B7D A;  3GBB A;  4YB5 A;  1IXC A;  4GL8 A;  1WDN A;  1B46 A;  1MY2 A;  2XD2 A;  3C35 A;  4UAC A;  1N76 A;  4OWD A;  2HEU A;  4GVO A;  4JB7 A;  1UQW A;  2O51 A;  4IGR A;  1R6Z A;  2Z22 A;  2DXR A;  3M3L A;  4IO4 A;  3WAE A;  4DXU A;  5B70 A;  3K4U A;  3Q25 A;  3IOV A;  2Y7P A;  2O68 A;  2ZMB A;  2THI A;  2R9J A;  5DT6 A;  2RCB A;  1MXV A;  1T0K A;  1XOC A;  4RPO A;  2F78 A;  5H8N B;  3LSW A;  3MP1 A;  4NTL A;  1TFA A;  2UYE A;  1NNP A;  5CC2 A;  4EXL A;  2AL5 A;  4RJZ A;  3EHS A;  5I58 B;  5AA2 D;  2Q88 A;  3OO6 A;  3O28 A;  1MDQ A;  4POW A;  1MRP A;  2QS3 A;  5TPA A;  1MY0 A;  3K6U A;  4E0X A;  1NMU A;  5I56 B;  3MJN A;  3ODB A;  3RUM A;  4NF6 A;  1DTZ A;  1JW1 A;  2A5S A;  1US4 A;  1PC3 A;  4QFK A;  5JK4 A;  2Y7K A;  2FYI A;  1Y3Q A;  1I6Q A;  4HCY A;  2X7Q A;  1I69 A;  1TXF A;  2Z8F A;  3OXN A;  4R2B A;  3ILT B;  2Y7W A;  4PFY A;  3H6V A;  4X48 A;  1TWY A;  1ATG A;  3CR9 A;  2VOZ A;  3QYT A;  4G4P A;  1SVX B;  3SEW A;  4NWD A;  1OLC A;  3N6U A;  4I1D A;  2AIX A;  1A54 A;  3IO4 A;  3T9U A;  2RCA A;  1H44 A;  1USY E;  3KOT A;  4IB2 A;  3GLB A;  3UK4 A;  4U22 A;  2V3Q A;  4FAJ A;  2OBG A;  3G7W A;  1EZ9 A;  4KYS A;  1MPC A;  3CI8 A;  3KJT A;  3R7X A;  4ZEI A;  5AA2 B;  2HAU A;  3GXA A;  3M8U A;  4F1V A;  4DXC A;  3KJ7 A;  5FHM A;  3MPL A;  2DVZ A;  3N26 A;  3BBR A;  4QHQ A;  1Q1K A;  3K6V A;  1GV8 A;  5DEX B;  1RYX A;  3ZKL A;  1YCJ A;  1N7X A;  1MQD A;  4BDO A;  3FV1 A;  1LFI A;  1QKB A;  1DOT A;  2DVC A;  2QPQ A;  3MP6 A;  3TTN A;  3SDF A;  1Y3P A;  1O63 A;  2B3B A;  5AA3 A;  1LAX A;  3UA8 A;  5TU0 A;  4EF1 A;  2F7A A;  1UTB A;  5KDT B;  4QSC A;  1YTV A;  1I6A A;  2I0B A;  2XXI A;  3H4Z A;  4X1D A;  2O7I A;  2H99 A;  1LAG E;  5H8N A;  1R9Q A;  1P1N A;  2F5X A;  2OZZ A;  3L6G A;  3ONM A;  4H8J A;  2REJ A;  4OVJ A;  3H06 B;  4F2Q A;  4EQB A;  4AB5 A;  3T93 B;  4BDN A;  1H3D A;  4U4S A;  4AB6 A;  1MQG A;  1D9Y A;  3N6T A;  1N3W A;  1HSE A;  2Q8J A;  1B51 A;  1QUI A;  2V3T A;  3QIM A;  4LZ5 A;  5F1Q A;  1J1N A;  3K00 A;  4R2F A;  2I3V A;  5H8Q B;  5I56 A;  3HCQ A;  1B3F A;  2H98 A;  4QRZ A;  3HST A;  4Z0I A;  1MS7 A;  3OEN A;  4NF8 A;  1XT8 A;  1FQD A;  2F6G A;  1BLF A;  4NF4 B;  3F11 A;  2H5Y A; 
#chains in the Genus database with same CATH topology
 2JJK A;  1NV5 A;  1ZTY A;  4QF9 A;  1QUL A;  2ZXT A;  1NH7 A;  3MVW A;  2QVR A;  5I2N B;  3FJ7 A;  1ZLQ A;  4F1U A;  1XVX A;  5EQ9 A;  3RPL B;  2DP8 A;  4EXK A;  3HN0 A;  5IKB A;  2UVH A;  1PB8 A;  4LQ5 A;  3TCG A;  5H8S A;  1H45 A;  5H8F A;  4ZEB A;  5I57 B;  4OEU A;  4GWS A;  5CMC A;  3MZ1 A;  1MH4 A;  4DI4 B;  1B7H A;  3MVY A;  1MPB A;  4U4X A;  4O7M A;  3V89 B;  3VLU A;  3ILU B;  1RKM A;  1P1O A;  1FQA A;  1JP4 A;  1SDX A;  4BDQ A;  3CG1 A;  1N04 A;  4YIC A;  1WOD A;  4JSO A;  3SKP A;  3TQL A;  3WAF A;  3HHG A;  1N0T A;  3TTR A;  4OAN A;  4OVT A;  4R72 A;  1P1U A;  1MXU A;  1QVS A;  3U93 A;  3O29 A;  2X26 A;  4BDL A;  2CZL A;  3UP9 A;  2R8T A;  1FTK A;  1D3K A;  2QMW A;  2H9B A;  3MAM A;  5AA4 B;  1FTJ A;  1NV4 A;  4DXB A;  4ZEC A;  1IEJ A;  2ESN A;  3EHT A;  3LR1 A;  3MZB A;  3TTM A;  5BUU A;  3T9X B;  1YPN A;  5EHM A;  4LVQ A;  4N07 A;  3FAT A;  5I84 A;  4ZE9 A;  1G0I A;  5ITP A;  1FQE A;  3FZV A;  3A09 A;  4ZDM A;  1MXW A;  4OFO A;  1TFD A;  4H0W A;  3VLV A;  1OLA A;  3TTL A;  4DIG A;  3SER A;  4OVS A;  1ZU0 A;  5KDT A;  1GTK A;  5K2Y A;  4PFI A;  3LUZ A;  2V3U A;  1WVJ A;  3Q26 A;  2XWI A;  1S50 A;  4R9G A;  4YB7 A;  4POX A;  4XKP A;  2PVU A;  4RK9 A;  2ZNU A;  3OSR A;  1B9J A;  4ZS9 A;  4P47 A;  1AL3 A;  5L9S A;  4PAK A;  5JEI A;  4OMB A;  1NV6 A;  1EH3 A;  4GXA A;  3MW0 A;  4OER A;  1NL5 A;  5DVJ A;  2VPO A;  2HAV A;  2RC8 A;  1FRP A;  4U23 A;  4EQ9 A;  3H6T A;  3IOR A;  4R75 A;  5TP9 B;  4BDM A;  3CFL A;  1NV2 A;  2DE4 A;  4H45 A;  4PGP A;  2PT2 A;  2F6P A;  5M2V A;  4F18 A;  2WYK A;  1IZ1 A;  1MM7 A;  2IEE A;  5HBC A;  4P1E A;  2O6A A;  2VT5 A;  3DEL B;  4O3C A;  4H1X A;  3IFA A;  5I3S A;  3KEI A;  1B6H A;  1MPD A;  1Y4C A;  4MX6 A;  1SPI A;  2FIX A;  3EPE A;  4OEN A;  3PU5 A;  3V8X B;  3MUQ A;  5A5X B;  3G3F A;  4NF4 A;  3TFL A;  3KSX A;  1OMP A;  2GHB A;  3PGF A;  3JV9 A;  2Q89 A;  4QFN A;  3MBP A;  4E0W A;  1FQC A;  3RYD A;  4F3P A;  3RPL A;  4NE4 A;  5EQ7 A;  2F36 A;  4NF5 A;  2ONS A;  1NH8 A;  4TLM B;  3FVN A;  3V83 A;  5HPQ A;  4HE1 A;  4IO6 A;  3TUS A;  3IB0 A;  3B50 A;  4FOR A;  4RA1 A;  2ZZV A;  1FBE A;  3RTW B;  1B3H A;  4G8H A;  2XX8 A;  2R71 A;  3T9H B;  4GRK A;  2B65 A;  3MPK A;  3IX1 A;  1RDZ A;  1SW1 A;  2H25 A;  1FTL A;  1MQI A;  4OFL A;  3I6V A;  2XXR A;  4OYV A;  1MDP 1;  2P3V A;  3FUZ A;  1RDX A;  3EF7 A;  1MQJ A;  4G61 A;  4PBQ A;  1MY4 A;  1A55 A;  4KCD A;  3FAS A;  5FTI A;  4DDD A;  1NV0 A;  4EQ7 A;  4OVQ A;  2NWJ A;  3AXF A;  5IZZ A;  4ONY A;  4JVD A;  3H03 A;  2G93 A;  1UTH B;  3MVZ A;  1CNQ A;  1LBC A;  2Y7R A;  3PUW E;  4RPN A;  2DE3 A;  3KC1 A;  2PYY A;  4M4G A;  1OIB A;  4H46 A;  1FW0 A;  2XXY A;  2GFE A;  4NF0 A;  1NV7 A;  1OVT A;  4JWO A;  2QJE A;  2DWJ A;  2M8C A;  3Q29 A;  4F19 A;  4H67 A;  4JBZ A;  1VSO A;  3O6H A;  5ET7 A;  4PC9 A;  2GRV A;  1IXH A;  1LAF E;  3IAZ A;  4F22 A;  3K01 A;  2P3N A;  4MF3 A;  3PPN A;  2R6G E;  3LSX A;  4THI A;  2RC7 A;  3FBP A;  4U1O A;  1OVB A;  2UVI A;  2NXO A;  4N15 A;  1LAH E;  3K0V A;  2GHA A;  3VVD A;  4G2Z A;  1FSA A;  4IO7 A;  3VVF A;  4TLL B;  3FJM A;  3PTY A;  1NV3 A;  5EYG A;  2XXU A;  3FJG A;  1N84 A;  4NMY A;  4PFT A;  1A99 A;  1FTO A;  1POT A;  4YU0 A;  2WKY A;  3PPP A;  4IY6 A;  2DQV A;  5ELV A;  3H7M A;  5ISU A;  1Q35 A;  2QRY A;  4JWY A;  3O2A A;  2NVU B;  3KN7 A;  5H8H B;  1LBW A;  1LBX A;  1QJM A;  2FIE A;  2B4L A;  4IO3 A;  5LOM A;  4P0G A;  4I3Y A;  3DP8 A;  5I59 B;  1IMC A;  3C36 A;  4IO5 A;  4DZ1 A;  2ABH A;  3RY3 A;  1DMB A;  1AIV A;  3A3C A;  4C0R A;  2Y5L A;  5CBS A;  3VVE A;  1FCK A;  3BFU A;  3UGW A;  4TOZ A;  5LDZ A;  3KSJ A;  5A5X A;  1Z7M E;  4M1V A;  2VD2 A;  2XWV A;  1A8E A;  2DWI A;  4KXP A;  4PF6 A;  4JDF A;  4G68 B;  4O94 A;  3VLW A;  4MHF A;  2XWO A;  4P11 A;  4N8Y A;  5CMM A;  4RXL A;  1IMB A;  1NUX A;  3PUZ E;  3CG3 A;  4KFQ A;  3RTF B;  4PQJ A;  3RLF E;  5AE4 A;  3E79 A;  2OWZ A;  2I4C A;  1H76 A;  4IGT A;  4N6D A;  1CE2 A;  2XXX A;  3IJO B;  1XS5 A;  3FXQ A;  1B2H A;  4GLI A;  1PBQ A;  1XVY A;  3IJX B;  2I4B A;  2HFB A;  3RGY A;  4KYE A;  2OJT A;  1BIY A;  1FPK A;  1B5H A;  2XXW A;  2HHM A;  2OK2 A;  1SYI A;  3DP6 A;  1QW0 A;  2HCA A;  1XI6 A;  3LSF B;  4H8I A;  5EQA A;  1BK4 A;  3RN8 A;  1HSJ A;  5KCJ B;  2F3B A;  1SD3 A;  4LUB A;  1JW4 A;  4PE5 B;  4FED A;  2GH9 A;  2PT1 A;  3E78 A;  1N7W A;  4WED A;  1UTH A;  3I3V A;  3OMB A;  1SYH A;  2UVJ A;  1LBY A;  3U1O A;  4GD5 A;  2I48 A;  3H6W A;  5J16 A;  3MVX A;  4DCX A;  1EYI A;  4DCY A;  4ZZE A;  2CMO A;  2BJJ X;  3G3J A;  5LTC A;  1IXI A;  4HE2 A;  3B6W A;  3E4R A;  3EN3 A;  4XXU A;  2VP1 A;  4K3F A;  3MZ9 A;  5DW8 A;  4H65 A;  4QBA A;  2VHA A;  4BLA A;  3O6I A;  4PFU A;  4YKK A;  5IM2 A;  4ZEF A;  4PP0 A;  2I49 A;  5I58 A;  4EDP A;  3O6G A;  1GGG A;  2UXA A;  3DP4 A;  1OQH A;  4EUO A;  3IOW A;  2OX3 A;  1US5 A;  4G77 A;  3G3I A;  3W9W A;  1MXY A;  4OFJ A;  4P0I A;  1YAE A;  3W9V A;  1URS A;  1JNF A;  1KA0 A;  4YMB A;  3H3G A;  4KYD A;  2X7P A;  5CMB A;  4OVP A;  3S9N C;  3CSB A;  4R6Y A;  2RF1 A;  4KD5 A;  4Z7E A;  3QUF A;  4LP2 B;  3TDJ A;  1LBV A;  3K1N A;  1M5B A;  2FHY A;  4U21 A;  1B40 A;  4OES A;  2ZYO A;  2ZYK A;  4YKP A;  1MXZ A;  4R6K A;  4JSD A;  2B4M A;  1S9T A;  1GR2 A;  5F7V A;  2A5T B;  4ZED A;  3O9P A;  2Z8D A;  4G68 C;  1B0H A;  1FBF A;  3IOU A;  1JEU A;  2FNC A;  3LSL A;  3EHU A;  2W7Y A;  2PX1 A;  1ZIU A;  2REG A;  1ZKB A;  1SQY A;  3S9E A;  4C1U A;  1B7U A;  4P9K A;  2VGQ A;  4GFR A;  5AA2 A;  1B1H A;  2HPG A;  4OHN A;  2ZNT A;  2VD3 A;  3JZJ A;  4MNI A;  2PMS A;  5J1D A;  1IIT A;  4XTC Q;  2QS1 A;  3PMV A;  5FHN A;  4LON B;  4QSD A;  4FAT A;  3THI A;  5T3J A;  2F35 A;  1B3E A;  5DEX A;  2F3D A;  3TKD A;  4JVI A;  3OEK A;  1LB9 A;  4HCW A;  3TTK A;  1P99 A;  3HV1 A;  3TPA A;  2YLN A;  3W15 C;  5FBP A;  4XIG Q;  4H5G A;  2XX7 A;  2WYP A;  2DSF A;  1URG A;  1FPJ A;  3QXM A;  4QFP A;  1K9Z A;  1FTM A;  5IAI A;  1KA1 A;  1Y9U A;  3SEY A;  3IO6 A;  4GX6 A;  1A40 A;  3KG2 A;  1JET A;  2XXQ A;  3TQW A;  1R9L A;  4RNS A;  2QVV A;  3OO8 A;  3T1B A;  2O1L A;  4DI3 D;  4HS7 A;  1Y1M A;  2CZH A;  3ZSF A;  1HSL A;  4N8G A;  4I62 A;  2HXW A;  2WEF A;  3IFC A;  1FBD A;  1IXG A;  2CEX A;  5I5P A;  4KR5 A;  2HZK A;  1LFH A;  3OEM A;  2E1S A;  3MQ9 A;  2O7U A;  4LAT A;  4C1T A;  3P7I A;  4XKQ A;  4F3B A;  4GBV A;  4OTE A;  1JW5 A;  1B5I A;  3QMF A;  2H4I A;  2Q74 A;  2DS9 A;  3IB1 A;  3FD3 A;  3PPO A;  2XXP A;  1D4N A;  5H8Q A;  3ZKK A;  4MFI A;  2ZZX A;  2F34 A;  4JXI A;  3B8B A;  4MIJ A;  1BTJ A;  2I58 A;  3C9H A;  4GQO A;  4F39 A;  1TT1 A;  2CZK A;  2CEY A;  4MAG A;  4GXS B;  4OXV A;  1LGB C;  3EKI A;  2XXH A;  2F8D A;  3Q28 A;  3OO7 A;  1B1X A;  1VFD A;  5I2N A;  2ONK E;  3TZA A;  2V4C A;  1Y4T A;  2F97 A;  1FPF A;  4GWZ A;  3E9X A;  3TAJ A;  4GWO A;  1FBC A;  4OEV A;  1IME A;  2A5T A;  3QUJ A;  1Y20 A;  5I57 A;  4ZE8 A;  3I5O A;  2L5V A;  4ECF A;  3E3K A;  4LZ7 A;  5CBR A;  1XC1 A;  2FBP A;  2AYS A;  2ONR A;  3PPR A;  1Z7N E;  1USY H;  2WBB A;  4XKR A;  4QSE A;  3R26 A;  3CVG A;  4YKJ A;  1DSN A;  1MY1 A;  1LCF A;  5HM4 B;  2F7B A;  4XKN A;  2RKM A;  1LBZ A;  4DLD A;  4PE3 A;  1ZBM A;  2ALU A;  2V84 A;  5CM6 A;  3U92 A;  2Q2A A;  3UIF A;  4GOT A;  1EU8 A;  1MY3 A;  3U65 A;  4NQ8 A;  1LBB A;  2FA7 A;  2F7C A;  3K6W A;  3S9M C;  1CB6 A;  2PFY A;  4DE8 A;  3CFZ A;  5AA4 A;  3IB2 A;  1B52 A;  5ESY A;  2QVU A;  4PFR A;  3C32 A;  4GIZ A;  3TCH A;  4ESW A;  3K1P A;  4IO2 A;  4XFE A;  2QL3 A;  2XXV A;  3T66 A;  3PUX E;  4R9F A;  4RK2 A;  1UTB B;  3G3G A;  5K2X A;  3OEL A;  4RYA A;  4OET A;  1RYO A;  3SEU A;  4X1B A;  1O64 A;  1NNK A;  1EZO A;  1GVC A;  4MLQ A;  5BWJ A;  5KZT A;  2Q9T A;  3ROJ A;  2UYF A;  4MH5 A;  3TEL A;  4HTG A;  4KCC A;  4OVR A;  2DE2 A;  3S2V A;  1N3X A;  3PV0 E;  1D9Q A;  3RNN A;  5IZ3 B;  3CSG A;  1XHY A;  1B32 A;  1DTG A;  3VV5 A;  4PAF A;  5FTH A;  3ECR A;  5TP9 A;  3CFX A;  3CRB A;  1M5F A;  1I6B A;  1KWH A;  3FXB A;  3N5L A;  3FVO A;  4YMA A;  3V5A A;  2HQ0 A;  3PUV E;  2QMX A;  3TOD A;  4NF8 B;  3C33 A;  5I7I A;  2PFZ A;  3T96 B;  4Q0C A;  2GQ1 A;  1B5J A;  4YAH X;  1NFT A;  4FBP A;  2DXY A;  3LBS A;  4HW8 A;  1JVX A;  3KGC A;  4F3G A;  5IGA A;  1B3G A;  1D9V A;  1JEV A;  1Y3N A;  3EQ1 A;  1M5D A;  4YB6 A;  1IIW A;  4I40 A;  3OSQ A;  4N81 A;  5H8F B;  1NUZ A;  2OLB A;  2P1S A;  4F2O A;  2V25 A;  4Q30 B;  4QFL A;  3OD7 A;  4GWU A;  1EZP A;  1VFE A;  1ELJ A;  4MCO A;  2DWA A;  1LEV A;  3ZS6 A;  3OO9 A;  2OWT A;  4GBW A;  4WEP A;  2XD3 A;  1FPI A;  1LFG A;  1FPB A;  2I6E A;  1KZ8 A;  3QK6 A;  4H5F A;  3KN8 A;  4F31 B;  3FXU A;  4AS5 A;  3UN6 A;  4AQ4 A;  2CZI A;  3RQT A;  1B05 A;  2VPN A;  3HHF A;  4FEC A;  1DPP A;  1POY 1;  1S7Y A;  1FBH A;  1B3L A;  5ICQ A;  1IMD A;  1FQF A;  2NOO A;  3H6U A;  4G8M A;  1UIU A;  4PDD A;  4L17 A;  3SET A;  4ND9 A;  4QXD A;  2YPN A;  3MST A;  3C31 A;  2KR0 A;  3K2D A;  3C4M A;  2Y7I A;  4R73 A;  4YKI A;  3D4G A;  3KOS A;  1JVY A;  1AMF A;  1PEB A;  2D21 A;  2XX9 A;  2WBD A;  4GWW A;  1PDA A;  2D3I A;  3CIJ A;  4PTK A;  3BFT A;  2BJI A;  1SI1 A;  4UA8 A;  3VXC A;  2G29 A;  3HPI A;  2QS4 A;  3FGS A;  5ICT A;  3S9L C;  3R6U A;  1B58 A;  1B0L A;  1NNF A;  4GF8 A;  4MJO A;  4GX4 A;  1FPD A;  3SEX A;  4R74 A;  3PD8 A;  1PB7 A;  1ZJL A;  4RY1 A;  3UOR A;  4EF2 A;  3MYU A;  5IZ1 A;  1NKX A;  2ANJ A;  4LQ2 A;  1YYZ A;  2HZL A;  3T0J A;  1AOV A;  1SBP A;  3GZG A;  2Z8E A;  2P2A A;  4I9D A;  4NN3 A;  3FVG A;  3SEV A;  3M3F A;  4O7I A;  5EHS A;  3OOA A;  3TYH A;  2D5W A;  5H8H A;  4PCD A;  1SI0 A;  4FE8 A;  3GBA A;  5CI5 A;  3VE1 B;  2V93 A;  1FTA A;  5CMK A;  4AS4 A;  3G3H A;  3T22 A;  1PB9 A;  4N6P A;  4KHZ E;  4KQP A;  2DWH A;  1ANF A;  4N6K A;  5JTY B;  1A7L A;  2XA5 A;  3A3U A;  5I59 A;  4U2R A;  3HO7 A;  2DOJ A;  1BP5 A;  4WKM A;  5I2K B;  4I8C A;  1URD A;  1F9B A;  3LUY A;  3TCF A;  3C34 A;  4LZ8 A;  2Q2C A;  3CHG A;  2WX9 A;  1EYJ A;  4FJP A;  2XXT A;  4ESX A;  1PBP A;  4U1Z A;  2DYX A;  5DVI A;  3U94 A;  3SES A;  1BKA A;  2Z23 A;  3DLN A;  2O84 X;  3O97 A;  4KPT A;  4JVC A;  5DVF A;  2I3W A;  3FIR A;  4NF5 B;  3B7D A;  3PMW A;  3VFJ A;  3N94 A;  3PPQ A;  1NUW A;  2ZYN A;  4G68 A;  5ITO A;  4IR8 A;  4O3B A;  5EYF A;  3RPW A;  3K02 A;  3O66 A;  4GL0 A;  4LN5 A;  4X04 A;  4QFO A;  3B6Q A;  4N91 A;  4PF8 A;  1P1Q A;  1SW5 A;  3DM0 A;  4H6D A;  4P1L A;  1IUD A;  1AH5 A;  5CRY A;  2QSX A;  1B7Z A;  3T9V A;  4ZEK A;  1MXX A;  3BIG A;  1L5T A;  1AWB A;  1FBG A;  2Y84 A;  1QUJ A;  2RIN A;  3D4C A;  3G3K A;  3JYR A;  2B3F A;  4MMP A;  2XHD A;  3KN3 A;  1FPL A;  4OQO A;  4ELR A;  1A8F A;  1QGX A;  5L9M A;  2AL4 A;  4ZZA A;  1QKA A;  4MLV A;  2QFL A;  2IA4 A;  4PFB A;  5ET6 A;  3K1M A;  3VXB A;  3MWB A;  4UAB A;  1FQB A;  1M5C A;  3L6H A;  3RT6 B;  5KCJ A;  1Y1Z A;  3U72 A;  4ELP A;  1LCT A;  3LC8 A;  3IL1 B;  4TQU Q;  4Q5T A;  1LST A;  4MBP A;  1B4Z A;  2LAO A;  3FXR A;  5L9O A;  3IR1 A;  4XF5 A;  4PFW A;  1LB8 A;  3B6T A;  3VDF A;  2O1M A;  1DPE A;  1M5E A;  3PUY E;  4FEB A;  1H43 A;  4N13 A;  4X9T A;  3MP8 A;  2RC9 A;  1OQG A;  5FHO A;  3KFM A;  2NUV A;  2E0S A;  4GWY A;  3S4U A;  2YJP A;  3USD A;  2I0C A;  4NWC A;  3U8Q A;  4ELQ A;  3KBR A;  2UVG A;  4WXJ A;  5TPA B;  3IK6 B;  1K9Y A;  1R1N A;  3TMG A;  3QSL A;  5L8D A;  1JQF A;  3PD9 A;  1IQ7 A;  3SZP A;  4KI0 E;  4NF6 B;  4YZZ A;  2ZYM A;  1YXI A;  3TEP A;  4F3S A;  3MC2 A;  1Q9D A;  1VE4 A;  1SW2 A;  3E13 X;  1INP A;  1O7T A;  3RT8 A;  3IOT A;  2O69 A;  4F29 A;  4G8N A;  2ZNS A;  4MEV A;  2KLF A;  4JWX A;  5ET8 A;  2PBW A;  3Q27 A;  4OZ9 A;  2QS2 A;  1MG1 A;  2XWK A;  4O3A A;  4X8R A;  5AA1 A;  4PET A;  4BDR A;  4ISU A;  3PMX A;  1LLS A;  4O8M A;  5JTY A;  3QAX A;  3BKI B;  5I2K A;  1SW4 A;  5DTB A;  2HXR A;  4XEQ A;  1VR5 A;  3KZG A;  5DYH A;  4F1Y A;  4MNP A;  1II5 A;  4NHB A;  5A5L A;  1IMA A;  4Q8R A;  5F24 A;  1P1W A;  3K6X A;  4IY5 A;  3ISP A;  4NED A;  2P0S A;  1MM6 A;  4ELO A;  1MH3 A;  4FIM A;  1QUK A;  1YZ0 A;  1ZMG A;  2OCU A;  3M3K A;  3HFU A;  2OWS A;  3FVK A;  1UIV A;  4R6H A;  4HXV A;  4NX1 A;  3FV2 A;  1NNT A;  4HE0 A;  2FVZ A;  1B4H A;  1FPG A;  1MQH A;  4LA9 A;  2MKZ A;  5B7D A;  3GBB A;  4YB5 A;  4P56 A;  1IXC A;  4GL8 A;  1WDN A;  1IMF A;  1B46 A;  1MY2 A;  1DBZ A;  1G0H A;  2XD2 A;  3C35 A;  4MNC A;  4UAC A;  1N76 A;  4OWD A;  2HEU A;  4GVO A;  4JB7 A;  1UQW A;  2O51 A;  4IGR A;  1R6Z A;  2Z22 A;  2DXR A;  3M3L A;  4IO4 A;  3WAE A;  4DXU A;  5B70 A;  4PGN A;  3K4U A;  3Q25 A;  4OA4 A;  1VDW A;  3IOV A;  2Y7P A;  1RDY A;  2O68 A;  2ZMB A;  2THI A;  5EQ8 A;  2R9J A;  5DT6 A;  2RCB A;  1DCU A;  1MXV A;  1T0K A;  1XOC A;  4RPO A;  1EYK A;  2F78 A;  5H8N B;  3LSW A;  3MP1 A;  4NTL A;  1FBP A;  1TFA A;  2UYE A;  1NNP A;  5CC2 A;  4EXL A;  2AL5 A;  4RJZ A;  3EHS A;  5I58 B;  2Q8M A;  4NAP A;  5AA2 D;  2Q88 A;  3OO6 A;  1FPE A;  3O28 A;  1MDQ A;  4POW A;  1MRP A;  2QS3 A;  5TPA A;  1MY0 A;  3K6U A;  4E0X A;  1NMU A;  5I56 B;  3MJN A;  3ODB A;  3RUM A;  4NF6 A;  1DTZ A;  1JW1 A;  2A5S A;  1US4 A;  1PC3 A;  4QFK A;  5JK4 A;  2Y7K A;  2FYI A;  1Y3Q A;  1I6Q A;  4HCY A;  3BIH A;  2X7Q A;  1I69 A;  1TXF A;  2Z8F A;  3KBZ A;  3OXN A;  4R2B A;  3D1R A;  3ILT B;  2Y7W A;  4PFY A;  3H6V A;  4X48 A;  1TWY A;  1ATG A;  3CR9 A;  2VOZ A;  3QYT A;  4G4P A;  1SVX B;  3SEW A;  4NWD A;  1OLC A;  3N6U A;  3LV0 A;  4I1D A;  2AIX A;  1A54 A;  3IO4 A;  3T9U A;  2RCA A;  1H44 A;  1USY E;  2ZZW A;  3KOT A;  4IB2 A;  3GLB A;  3UK4 A;  4U22 A;  2V3Q A;  4FAJ A;  2OBG A;  3G7W A;  1EZ9 A;  4KYS A;  1MPC A;  3CI8 A;  3KJT A;  3R7X A;  4ZEI A;  5AA2 B;  2HAU A;  3GXA A;  3M8U A;  4F1V A;  4DXC A;  3KJ7 A;  5FHM A;  3MPL A;  2DVZ A;  4N17 A;  3N26 A;  3BBR A;  4QHQ A;  1Q1K A;  4P8B A;  3K6V A;  1GV8 A;  5DEX B;  2DDK A;  2Y5K A;  1RYX A;  1FJ9 A;  3ZKL A;  1YCJ A;  1N7X A;  1MQD A;  4BDO A;  3FV1 A;  1LFI A;  1QKB A;  3GYY A;  1DOT A;  2DVC A;  2QPQ A;  2PCR A;  3MP6 A;  3TTN A;  3SDF A;  4P3L A;  1Y3P A;  1O63 A;  2B3B A;  5AA3 A;  1LAX A;  3UA8 A;  5TU0 A;  4EF1 A;  2F7A A;  3A29 A;  1UTB A;  5KDT B;  4QSC A;  4PBH A;  1YTV A;  4N4U A;  1I6A A;  2I0B A;  2XXI A;  3H4Z A;  4X1D A;  2O7I A;  1NI9 A;  2H99 A;  1LAG E;  4NG7 A;  1R9Q A;  5H8N A;  1P1N A;  2F5X A;  2OZZ A;  3L6G A;  3ONM A;  4H8J A;  2KQZ A;  2REJ A;  4OVJ A;  3H06 B;  5EYH A;  4F2Q A;  4EQB A;  4AB5 A;  3T93 B;  5ET5 A;  4BDN A;  4I3E A;  1H3D A;  4U4S A;  4AB6 A;  1MQG A;  1D9Y A;  1DK4 A;  3N6T A;  2XXK A;  1N3W A;  1HSE A;  2Q8J A;  1B51 A;  1QUI A;  2V3T A;  3QIM A;  1FJ6 A;  4LZ5 A;  5IZ3 A;  5F1Q A;  1J1N A;  3K00 A;  1NUY A;  4R2F A;  2I3V A;  3NOH A;  4PDH A;  5H8Q B;  5I56 A;  3KC0 A;  1NV1 A;  3HCQ A;  1B3F A;  2H98 A;  4QRZ A;  4GWX A;  3HST A;  4PAI A;  4Z0I A;  1MS7 A;  3OEN A;  4NGU A;  4NF8 A;  1XT8 A;  1FQD A;  2F6G A;  1BLF A;  4GX3 A;  4NF4 B;  3F11 A;  2H5Y A; 
#chains in the Genus database with same CATH homology
 1ZTY A;  4QF9 A;  1QUL A;  2ZXT A;  1NH7 A;  3MVW A;  5I2N B;  3FJ7 A;  1ZLQ A;  4F1U A;  1XVX A;  2DP8 A;  4EXK A;  3HN0 A;  5IKB A;  2UVH A;  1PB8 A;  4LQ5 A;  3TCG A;  5H8S A;  1H45 A;  5H8F A;  4ZEB A;  5I57 B;  4OEU A;  5CMC A;  3MZ1 A;  1MH4 A;  1B7H A;  3MVY A;  1MPB A;  4U4X A;  3V89 B;  3VLU A;  3ILU B;  1P1O A;  1FQA A;  1RKM A;  1SDX A;  4BDQ A;  3CG1 A;  1N04 A;  4YIC A;  1WOD A;  4JSO A;  3SKP A;  3TQL A;  3WAF A;  3HHG A;  1N0T A;  3TTR A;  4R72 A;  1P1U A;  1MXU A;  1QVS A;  3U93 A;  3O29 A;  2X26 A;  4BDL A;  2CZL A;  3UP9 A;  1FTK A;  1D3K A;  2QMW A;  2H9B A;  3MAM A;  5AA4 B;  1FTJ A;  4DXB A;  4ZEC A;  1IEJ A;  2ESN A;  3EHT A;  3LR1 A;  3MZB A;  3TTM A;  5BUU A;  3T9X B;  1YPN A;  5EHM A;  4LVQ A;  4N07 A;  3FAT A;  5I84 A;  4ZE9 A;  5ITP A;  1FQE A;  3FZV A;  3A09 A;  4ZDM A;  1MXW A;  4OFO A;  1TFD A;  4H0W A;  3VLV A;  1OLA A;  3TTL A;  4DIG A;  3SER A;  1ZU0 A;  5KDT A;  1GTK A;  5K2Y A;  2V3U A;  1WVJ A;  3Q26 A;  1S50 A;  4R9G A;  4YB7 A;  4POX A;  4XKP A;  2PVU A;  4RK9 A;  2ZNU A;  3OSR A;  1B9J A;  4ZS9 A;  1AL3 A;  5L9S A;  5JEI A;  4OMB A;  1EH3 A;  4GXA A;  3MW0 A;  4OER A;  1NL5 A;  5DVJ A;  2HAV A;  2RC8 A;  4U23 A;  4EQ9 A;  3H6T A;  3IOR A;  4R75 A;  5TP9 B;  4BDM A;  3CFL A;  2DE4 A;  2PT2 A;  2F6P A;  5M2V A;  4F18 A;  1IZ1 A;  1MM7 A;  2IEE A;  5HBC A;  2O6A A;  3DEL B;  4O3C A;  4H1X A;  3KEI A;  1B6H A;  1MPD A;  1Y4C A;  3EPE A;  4OEN A;  3PU5 A;  3V8X B;  3MUQ A;  5A5X B;  3G3F A;  4NF4 A;  3TFL A;  3KSX A;  1OMP A;  2GHB A;  3PGF A;  3JV9 A;  2Q89 A;  4QFN A;  3MBP A;  4E0W A;  1FQC A;  4F3P A;  4NE4 A;  2F36 A;  2ONS A;  4NF5 A;  1NH8 A;  4TLM B;  3FVN A;  3V83 A;  5HPQ A;  4IO6 A;  3TUS A;  3IB0 A;  4FOR A;  4RA1 A;  3RTW B;  1B3H A;  4G8H A;  2XX8 A;  2R71 A;  3T9H B;  4GRK A;  2B65 A;  3MPK A;  3IX1 A;  1SW1 A;  2H25 A;  1FTL A;  1MQI A;  4OFL A;  3I6V A;  2XXR A;  4OYV A;  1MDP 1;  3FUZ A;  3EF7 A;  1MQJ A;  1MY4 A;  1A55 A;  4KCD A;  3FAS A;  5FTI A;  4DDD A;  4EQ7 A;  2NWJ A;  3AXF A;  4ONY A;  3H03 A;  2G93 A;  1UTH B;  3MVZ A;  1LBC A;  2Y7R A;  3PUW E;  4RPN A;  2DE3 A;  2PYY A;  4M4G A;  1OIB A;  1FW0 A;  2XXY A;  2GFE A;  1OVT A;  4JWO A;  2QJE A;  2DWJ A;  2M8C A;  3Q29 A;  4F19 A;  4H67 A;  4JBZ A;  1VSO A;  3O6H A;  2GRV A;  1IXH A;  1LAF E;  3IAZ A;  4F22 A;  3K01 A;  4MF3 A;  3PPN A;  2R6G E;  3LSX A;  4THI A;  2RC7 A;  4U1O A;  1OVB A;  2UVI A;  2NXO A;  1LAH E;  3K0V A;  2GHA A;  3VVD A;  4G2Z A;  4IO7 A;  3VVF A;  4TLL B;  3FJM A;  2XXU A;  3FJG A;  1N84 A;  4NMY A;  4PFT A;  1A99 A;  1FTO A;  1POT A;  4YU0 A;  2WKY A;  3PPP A;  4IY6 A;  2DQV A;  5ELV A;  3H7M A;  5ISU A;  1Q35 A;  2QRY A;  4JWY A;  3O2A A;  2NVU B;  3KN7 A;  5H8H B;  1QJM A;  4IO3 A;  5LOM A;  4P0G A;  3DP8 A;  5I59 B;  3C36 A;  4IO5 A;  4DZ1 A;  2ABH A;  3RY3 A;  1DMB A;  1AIV A;  3A3C A;  4C0R A;  5CBS A;  3VVE A;  1FCK A;  3BFU A;  3UGW A;  4TOZ A;  3KSJ A;  5A5X A;  1Z7M E;  4M1V A;  2VD2 A;  1A8E A;  2DWI A;  4JDF A;  4G68 B;  3VLW A;  4P11 A;  5CMM A;  4RXL A;  3PUZ E;  3CG3 A;  4KFQ A;  3RTF B;  4PQJ A;  3RLF E;  5AE4 A;  2I4C A;  1H76 A;  4IGT A;  1CE2 A;  2XXX A;  3IJO B;  1XS5 A;  3FXQ A;  1B2H A;  4GLI A;  1PBQ A;  1XVY A;  3IJX B;  2I4B A;  2HFB A;  3RGY A;  4KYE A;  2OJT A;  1BIY A;  1B5H A;  2XXW A;  2OK2 A;  1SYI A;  3DP6 A;  1QW0 A;  2HCA A;  3LSF B;  4H8I A;  3RN8 A;  1HSJ A;  5KCJ B;  1SD3 A;  4LUB A;  1JW4 A;  4PE5 B;  4FED A;  2GH9 A;  2PT1 A;  1N7W A;  4WED A;  1UTH A;  3I3V A;  3OMB A;  1SYH A;  2UVJ A;  3U1O A;  4GD5 A;  2I48 A;  3H6W A;  3MVX A;  4DCX A;  4DCY A;  4ZZE A;  2CMO A;  2BJJ X;  3G3J A;  1IXI A;  3B6W A;  3E4R A;  3EN3 A;  4XXU A;  2VP1 A;  4K3F A;  3MZ9 A;  4H65 A;  2VHA A;  4BLA A;  3O6I A;  4PFU A;  4YKK A;  4ZEF A;  4PP0 A;  2I49 A;  5I58 A;  4EDP A;  3O6G A;  1GGG A;  2UXA A;  3DP4 A;  1OQH A;  4EUO A;  3IOW A;  1US5 A;  4G77 A;  3G3I A;  3W9W A;  1MXY A;  4OFJ A;  4P0I A;  1YAE A;  3W9V A;  1URS A;  1JNF A;  4YMB A;  3H3G A;  4KYD A;  2X7P A;  5CMB A;  3S9N C;  3CSB A;  4R6Y A;  2RF1 A;  4KD5 A;  4Z7E A;  3QUF A;  4LP2 B;  3TDJ A;  3K1N A;  1M5B A;  4U21 A;  1B40 A;  4OES A;  2ZYO A;  2ZYK A;  4YKP A;  1MXZ A;  4R6K A;  4JSD A;  1S9T A;  1GR2 A;  5F7V A;  2A5T B;  4ZED A;  3O9P A;  2Z8D A;  4G68 C;  1B0H A;  3IOU A;  1JEU A;  2FNC A;  3LSL A;  3EHU A;  2W7Y A;  2PX1 A;  1ZIU A;  2REG A;  1ZKB A;  1SQY A;  3S9E A;  4C1U A;  1B7U A;  2VGQ A;  4GFR A;  5AA2 A;  1B1H A;  4OHN A;  2ZNT A;  2VD3 A;  3JZJ A;  2PMS A;  5J1D A;  1IIT A;  4XTC Q;  2QS1 A;  3PMV A;  5FHN A;  4LON B;  4QSD A;  4FAT A;  3THI A;  2F35 A;  1B3E A;  5DEX A;  3TKD A;  3OEK A;  1LB9 A;  4HCW A;  3TTK A;  1P99 A;  3HV1 A;  3TPA A;  2YLN A;  3W15 C;  4XIG Q;  4H5G A;  2XX7 A;  2DSF A;  1URG A;  3QXM A;  4QFP A;  1FTM A;  5IAI A;  1Y9U A;  3SEY A;  3IO6 A;  1A40 A;  3KG2 A;  1JET A;  2XXQ A;  3TQW A;  1R9L A;  4RNS A;  3OO8 A;  2O1L A;  4HS7 A;  1Y1M A;  3ZSF A;  1HSL A;  4I62 A;  2HXW A;  1IXG A;  4KR5 A;  2HZK A;  1LFH A;  3OEM A;  2E1S A;  3MQ9 A;  2O7U A;  4LAT A;  4C1T A;  3P7I A;  4XKQ A;  4F3B A;  4OTE A;  1JW5 A;  1B5I A;  2H4I A;  2DS9 A;  3IB1 A;  3FD3 A;  3PPO A;  2XXP A;  1D4N A;  5H8Q A;  3ZKK A;  4MFI A;  2F34 A;  4JXI A;  4F39 A;  1BTJ A;  2I58 A;  3C9H A;  4GQO A;  1TT1 A;  4GXS B;  4OXV A;  1LGB C;  2XXH A;  2F8D A;  3Q28 A;  3OO7 A;  1B1X A;  1VFD A;  5I2N A;  2ONK E;  3TZA A;  1Y4T A;  2F97 A;  3E9X A;  3TAJ A;  4GWO A;  4OEV A;  2A5T A;  3QUJ A;  1Y20 A;  5I57 A;  4ZE8 A;  3I5O A;  4ECF A;  3E3K A;  4LZ7 A;  5CBR A;  1XC1 A;  2AYS A;  2ONR A;  3PPR A;  1Z7N E;  1USY H;  4XKR A;  4QSE A;  3R26 A;  3CVG A;  4YKJ A;  1DSN A;  1MY1 A;  1LCF A;  5HM4 B;  2F7B A;  4XKN A;  2RKM A;  4DLD A;  1ZBM A;  2ALU A;  2V84 A;  5CM6 A;  3U92 A;  2Q2A A;  3UIF A;  4GOT A;  1EU8 A;  1MY3 A;  1LBB A;  2FA7 A;  2F7C A;  3K6W A;  3S9M C;  1CB6 A;  4DE8 A;  3CFZ A;  5AA4 A;  3IB2 A;  1B52 A;  3C32 A;  4GIZ A;  3TCH A;  4ESW A;  3K1P A;  4IO2 A;  2QL3 A;  2XXV A;  3T66 A;  3PUX E;  4R9F A;  4RK2 A;  1UTB B;  3G3G A;  5K2X A;  3OEL A;  4RYA A;  4OET A;  1RYO A;  3SEU A;  4X1B A;  1O64 A;  1NNK A;  1EZO A;  1GVC A;  4MLQ A;  5BWJ A;  5KZT A;  2Q9T A;  2UYF A;  4MH5 A;  3TEL A;  4HTG A;  4KCC A;  2DE2 A;  3S2V A;  1N3X A;  3PV0 E;  3RNN A;  3CSG A;  1XHY A;  1B32 A;  1DTG A;  3VV5 A;  5FTH A;  3ECR A;  5TP9 A;  3CFX A;  3CRB A;  1M5F A;  1I6B A;  1KWH A;  3N5L A;  3FVO A;  4YMA A;  3V5A A;  2HQ0 A;  3PUV E;  2QMX A;  3TOD A;  4NF8 B;  3C33 A;  3T96 B;  4Q0C A;  1B5J A;  4YAH X;  1NFT A;  2DXY A;  3LBS A;  4HW8 A;  1JVX A;  3KGC A;  4F3G A;  1B3G A;  1D9V A;  1JEV A;  1Y3N A;  3EQ1 A;  1M5D A;  4YB6 A;  1IIW A;  3OSQ A;  5H8F B;  2OLB A;  2P1S A;  4F2O A;  2V25 A;  4Q30 B;  3OD7 A;  4QFL A;  1EZP A;  1VFE A;  1ELJ A;  2DWA A;  3ZS6 A;  3OO9 A;  2OWT A;  4WEP A;  2XD3 A;  1LFG A;  2I6E A;  3QK6 A;  4H5F A;  3KN8 A;  4F31 B;  3FXU A;  3UN6 A;  4AQ4 A;  3RQT A;  1B05 A;  3HHF A;  4FEC A;  1DPP A;  1POY 1;  1S7Y A;  1B3L A;  5ICQ A;  1FQF A;  2NOO A;  3H6U A;  4G8M A;  1UIU A;  4L17 A;  3SET A;  4ND9 A;  2YPN A;  3C31 A;  3K2D A;  3C4M A;  2Y7I A;  4R73 A;  4YKI A;  3D4G A;  3KOS A;  1JVY A;  1AMF A;  1PEB A;  2D21 A;  2XX9 A;  1PDA A;  2D3I A;  3CIJ A;  3BFT A;  1SI1 A;  4UA8 A;  3VXC A;  2G29 A;  3HPI A;  2QS4 A;  3FGS A;  5ICT A;  3S9L C;  3R6U A;  1B58 A;  1B0L A;  1NNF A;  4GF8 A;  3SEX A;  4R74 A;  3PD8 A;  1PB7 A;  1ZJL A;  4RY1 A;  3UOR A;  4EF2 A;  1NKX A;  2ANJ A;  4LQ2 A;  2HZL A;  1AOV A;  1SBP A;  3GZG A;  2Z8E A;  2P2A A;  4I9D A;  3FVG A;  3SEV A;  3M3F A;  5EHS A;  3OOA A;  3TYH A;  2D5W A;  5H8H A;  1SI0 A;  4FE8 A;  3GBA A;  5CI5 A;  3VE1 B;  2V93 A;  5CMK A;  3G3H A;  3T22 A;  1PB9 A;  4N6P A;  4KHZ E;  4KQP A;  2DWH A;  1ANF A;  5JTY B;  1A7L A;  3A3U A;  5I59 A;  4U2R A;  3HO7 A;  2DOJ A;  1BP5 A;  4WKM A;  5I2K B;  4I8C A;  1URD A;  1F9B A;  3LUY A;  3TCF A;  3C34 A;  4LZ8 A;  2Q2C A;  4FJP A;  2XXT A;  4ESX A;  1PBP A;  4U1Z A;  2DYX A;  5DVI A;  3U94 A;  3SES A;  1BKA A;  2Z23 A;  3DLN A;  2O84 X;  3O97 A;  4KPT A;  5DVF A;  2I3W A;  3FIR A;  4NF5 B;  3B7D A;  3PMW A;  3VFJ A;  3N94 A;  3PPQ A;  2ZYN A;  4G68 A;  5ITO A;  4O3B A;  5EYF A;  3RPW A;  3K02 A;  3O66 A;  4GL0 A;  4QFO A;  3B6Q A;  1P1Q A;  1SW5 A;  3DM0 A;  4H6D A;  1IUD A;  1AH5 A;  5CRY A;  2QSX A;  1B7Z A;  3T9V A;  4ZEK A;  1MXX A;  1L5T A;  2Y84 A;  1QUJ A;  2RIN A;  3D4C A;  3G3K A;  3JYR A;  2B3F A;  2XHD A;  3KN3 A;  4OQO A;  4ELR A;  1A8F A;  5L9M A;  2AL4 A;  4ZZA A;  1QKA A;  4MLV A;  2IA4 A;  3K1M A;  3VXB A;  3MWB A;  1FQB A;  1M5C A;  3L6H A;  3RT6 B;  5KCJ A;  1Y1Z A;  3U72 A;  4ELP A;  1LCT A;  3LC8 A;  3IL1 B;  4TQU Q;  4Q5T A;  1LST A;  4MBP A;  1B4Z A;  2LAO A;  3FXR A;  5L9O A;  3IR1 A;  4PFW A;  1LB8 A;  3B6T A;  3VDF A;  2O1M A;  1DPE A;  1M5E A;  3PUY E;  4FEB A;  1H43 A;  4N13 A;  4X9T A;  3MP8 A;  2RC9 A;  1OQG A;  5FHO A;  3KFM A;  2NUV A;  2E0S A;  3S4U A;  2YJP A;  3USD A;  2I0C A;  4NWC A;  3U8Q A;  4ELQ A;  3KBR A;  2UVG A;  4WXJ A;  5TPA B;  3IK6 B;  1R1N A;  3TMG A;  3QSL A;  5L8D A;  1JQF A;  3PD9 A;  1IQ7 A;  4KI0 E;  4NF6 B;  4YZZ A;  2ZYM A;  3TEP A;  4F3S A;  3MC2 A;  1VE4 A;  1SW2 A;  3E13 X;  1O7T A;  3RT8 A;  3IOT A;  2O69 A;  4F29 A;  4G8N A;  2ZNS A;  2KLF A;  4JWX A;  2PBW A;  3Q27 A;  4OZ9 A;  2QS2 A;  1MG1 A;  4O3A A;  5AA1 A;  4PET A;  4BDR A;  4ISU A;  3PMX A;  1LLS A;  5JTY A;  3QAX A;  3BKI B;  5I2K A;  1SW4 A;  5DTB A;  1VR5 A;  3KZG A;  4F1Y A;  5DYH A;  1II5 A;  4Q8R A;  1P1W A;  3K6X A;  4IY5 A;  4NED A;  2P0S A;  1MM6 A;  4ELO A;  1MH3 A;  4FIM A;  1QUK A;  1ZMG A;  2OCU A;  3M3K A;  2OWS A;  3FVK A;  1UIV A;  4R6H A;  3FV2 A;  1NNT A;  1B4H A;  1MQH A;  4LA9 A;  5B7D A;  3GBB A;  4YB5 A;  1IXC A;  4GL8 A;  1WDN A;  1B46 A;  1MY2 A;  2XD2 A;  3C35 A;  4UAC A;  1N76 A;  4OWD A;  2HEU A;  4GVO A;  4JB7 A;  1UQW A;  2O51 A;  4IGR A;  1R6Z A;  2Z22 A;  2DXR A;  3M3L A;  4IO4 A;  3WAE A;  4DXU A;  5B70 A;  3K4U A;  3Q25 A;  3IOV A;  2Y7P A;  2O68 A;  2ZMB A;  2THI A;  2R9J A;  5DT6 A;  2RCB A;  1MXV A;  1T0K A;  1XOC A;  4RPO A;  2F78 A;  5H8N B;  3LSW A;  3MP1 A;  4NTL A;  1TFA A;  2UYE A;  1NNP A;  5CC2 A;  4EXL A;  2AL5 A;  4RJZ A;  3EHS A;  5I58 B;  5AA2 D;  2Q88 A;  3OO6 A;  3O28 A;  1MDQ A;  4POW A;  1MRP A;  2QS3 A;  5TPA A;  1MY0 A;  3K6U A;  4E0X A;  1NMU A;  5I56 B;  3MJN A;  3ODB A;  3RUM A;  4NF6 A;  1DTZ A;  1JW1 A;  2A5S A;  1US4 A;  1PC3 A;  4QFK A;  5JK4 A;  2Y7K A;  2FYI A;  1Y3Q A;  1I6Q A;  4HCY A;  2X7Q A;  1I69 A;  1TXF A;  2Z8F A;  3OXN A;  4R2B A;  3ILT B;  2Y7W A;  4PFY A;  3H6V A;  4X48 A;  1TWY A;  1ATG A;  3CR9 A;  2VOZ A;  3QYT A;  4G4P A;  1SVX B;  3SEW A;  4NWD A;  1OLC A;  3N6U A;  4I1D A;  2AIX A;  1A54 A;  3IO4 A;  3T9U A;  2RCA A;  1H44 A;  1USY E;  3KOT A;  4IB2 A;  3GLB A;  3UK4 A;  4U22 A;  2V3Q A;  4FAJ A;  2OBG A;  3G7W A;  1EZ9 A;  4KYS A;  1MPC A;  3CI8 A;  3KJT A;  3R7X A;  4ZEI A;  5AA2 B;  2HAU A;  3GXA A;  3M8U A;  4F1V A;  4DXC A;  3KJ7 A;  5FHM A;  3MPL A;  2DVZ A;  3N26 A;  3BBR A;  4QHQ A;  1Q1K A;  3K6V A;  1GV8 A;  5DEX B;  1RYX A;  3ZKL A;  1YCJ A;  1N7X A;  1MQD A;  4BDO A;  3FV1 A;  1LFI A;  1QKB A;  1DOT A;  2DVC A;  2QPQ A;  3MP6 A;  3TTN A;  3SDF A;  1Y3P A;  1O63 A;  2B3B A;  5AA3 A;  1LAX A;  3UA8 A;  5TU0 A;  4EF1 A;  2F7A A;  1UTB A;  5KDT B;  4QSC A;  1YTV A;  1I6A A;  2I0B A;  2XXI A;  3H4Z A;  4X1D A;  2O7I A;  2H99 A;  1LAG E;  5H8N A;  1R9Q A;  1P1N A;  2F5X A;  2OZZ A;  3L6G A;  3ONM A;  4H8J A;  2REJ A;  4OVJ A;  3H06 B;  4F2Q A;  4EQB A;  4AB5 A;  3T93 B;  4BDN A;  1H3D A;  4U4S A;  4AB6 A;  1MQG A;  1D9Y A;  3N6T A;  1N3W A;  1HSE A;  2Q8J A;  1B51 A;  1QUI A;  2V3T A;  3QIM A;  4LZ5 A;  5F1Q A;  1J1N A;  3K00 A;  4R2F A;  2I3V A;  5H8Q B;  5I56 A;  3HCQ A;  1B3F A;  2H98 A;  4QRZ A;  3HST A;  4Z0I A;  1MS7 A;  3OEN A;  4NF8 A;  1XT8 A;  1FQD A;  2F6G A;  1BLF A;  4NF4 B;  3F11 A;  2H5Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...