2Z8DA

The galacto-n-biose-/lacto-n-biose i-binding protein (gl-bp) of the abc transporter from bifidobacterium longum in complex with lacto-n-biose
Total Genus 145
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
145
sequence length
401
structure length
401
Chain Sequence
b'DDGGVVNITYMHRLPDSEGMTLVNDIVAKWNKQHPDIQVKATKFDGKASDMIKKLETDVKSGEAPDLAQVGYAELPEVFTKGLLQDVTQYAEQYKNDFASGPYSLVQVGGKAYGLPQDTGPLVYFYNKAEFEKLGITEIPQTADEFIAAAKTAAAAGKYIMSYQPDEAGNMISGLAGASGGWYKVKGDSWVVNTETDGSKATADFYQQLLDAKAATTNPRWDPSFDASIKDGSLIGTVAAAWEAPLFMTSSGGTGSGEWQVAQLGDWFGNAGKTGPDGGSAVAVLKNSKHPKEAMEFLDWFNTQVPDLVSQGLVPAATTEDAETPSEWSTFFGGQDIMKEFKTANNNMGDFTYMPGFSAVAAKMNETAAKATDGSGKVADIFSDAQTTSVDTLKNFGLSVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Galacto-N-biose/lacto-N-biose I transporter substrate-bindin
publication title Structural and thermodynamic analyses of solute-binding Protein from Bifidobacterium longum specific for core 1 disaccharide and lacto-N-biose I.
pubmed doi rcsb
source organism Bifidobacterium longum
molecule tags Sugar binding protein
total genus 145
structure length 401
sequence length 401
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-09-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8dA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2z8dA02
1B7ZA 5DT6A 2H9BA 3JZJA 3TQLA 4H1XA 3C4MA 2X7PA 3IORA 1SW4A 4ZDMA 4ZEFA 4O3AA 1FQEA 4ZE9A 1SI1A 5KCJA 4ND9A 1URSA 4BDQA 4OEUA 3TFLA 2NVUB 1WDNA 1UQWA 4P11A 4GWOA 4OFJA 2DYXA 2O84X 2DXRA 4PFTA 3OEMA 1US5A 3IOUA 1Y3NA 4R6KA 2QMXA 3UN6A 4DXUA 4H6DA 5L9SA 1MDQA 3IJOB 4XIGQ 3W9WA 1FTKA 3OO8A 1Q35A 3TCGA 3FXRA 3E9XA 3PPQA 4OTEA 3LBSA 2I4BA 3TUSA 1QW0A 5FHNA 2DWHA 3MWBA 3SETA 3LC8A 2ZMBA 3KN8A 4XKPA 4QHQA 3FZVA 5JTYA 4DXBA 3QIMA 1GTKA 1N76A 4OVJA 3K01A 3L6HA 5H8SA 3TCFA 2QS1A 1QKAA 3MP6A 2OK2A 3N94A 4HS7A 3T66A 1URDA 3MVYA 1GR2A 3T93B 1VR5A 1B5JA 1B3EA 2AIXA 2PMSA 3OSRA 3ODBA 4H0WA 5ELVA 3VDFA 3QXMA 5AA2B 2D21A 1Y9UA 2B3FA 3OEKA 4OQOA 1XVYA 3MZ9A 2O69A 3O28A 4YB5A 4ELOA 3D4GA 2H25A 1A54A 1QULA 1MG1A 4LUBA 4LZ5A 3OOAA 2XXPA 3FV2A 3S2VA 1MXXA 1NH7A 2FA7A 5TU0A 3MPKA 1Y3QA 3OO7A 3A3UA 4R75A 3S9NC 4U4SA 4F29A 1ANFA 4N13A 2O68A 5H8NA 2I58A 4LQ5A 4X48A 1OLCA 3EQ1A 4R9FA 3ILUB 3ZSFA 5L8DA 4GL0A 1I6BA 4FE8A 3ONMA 3G7WA 2HZLA 3LR1A 2ONSA 1LFGA 3B7DA 4NTLA 1GGGA 4RA1A 3KFMA 1IXCA 4OERA 5L9OA 4M1VA 4DCYA 3TTMA 4GFRA 2I0BA 2RC7A 4QFNA 5H8FB 2O1LA 1B7HA 1MXYA 2ONKE 3SEXA 2YLNA 4O3CA 3G3IA 5CRYA 3FXUA 1EH3A 3CVGA 1AOVA 1QUJA 4OHNA 2PT2A 3KZGA 1A7LA 5CI5A 3PMWA 3KGCA 4Q5TA 3CFZA 3KN3A 5IAIA 2KLFA 4GXAA 1B5HA 3IK6B 3SEWA 3O66A 2RF1A 1B4ZA 4O3BA 4YZZA 5CC2A 3K0VA 3H6TA 1HSJA 3IO4A 3H4ZA 4EF1A 4RPNA 4U22A 4JXIA 1B4HA 3PUXE 2Z23A 4F3SA 1NMUA 4R72A 1YAEA 1M5EA 4KR5A 4NMYA 4IGTA 2V3TA 3CG3A 3QK6A 2Y84A 3MZBA 3FVOA 1B3FA 4RXLA 1NNKA 3H7MA 3H6VA 4LONB 3O6HA 1D4NA 4RY1A 1POTA 3MQ9A 2HCAA 1USYE 3M8UA 2XXTA 1B51A 4AQ4A 4OENA 1DTGA 4F22A 3PGFA 2XXXA 5I56A 3DELB 1ZJLA 3SKPA 1IQ7A 3O9PA 1B2HA 2UVJA 1MXWA 1YTVA 1SBPA 3MBPA 4KHZE 3K1MA 2Q89A 3FXQA 2H5YA 4TOZA 2QMWA 1SD3A 1B58A 3Q27A 4ISUA 2F7BA 2CZLA 4BDRA 3ECRA 2UXAA 2F6PA 1AMFA 1XC1A 1JNFA 5I84A 4H67A 3TYHA 3GBAA 1IZ1A 1XHYA 3EHSA 4F2QA 1VE4A 2AL5A 1I6AA 1B0HA 4LQ2A 4FAJA 2RC9A 3MPLA 1N3XA 1N7XA 2DE3A 4POWA 2ESNA 3VVEA 2RINA 4F39A 4HCYA 2XXIA 2I3WA 3TPAA 3FD3A 3FVKA 4MH5A 1B3GA 1M5CA 1BLFA 2PYYA 2E1SA 1JVXA 5DVIA 4XKNA 3SERA 2FNCA 2NXOA 3UGWA 4GIZA 5AA2D 1OVBA 1VFDA 1PDAA 3JYRA 1J1NA 1MQDA 5H8QA 5B70A 3CFLA 1RKMA 3UORA 4IGRA 3ZS6A 2IA4A 5I2NA 4WXJA 3FVNA 2XXRA 1FTJA 2QS4A 3FATA 2DE4A 5KDTB 3E4RA 4JSOA 1B3LA 2FYIA 3H06B 3LSWA 2REJA 1O64A 3K1NA 1B3HA 1NKXA 2VHAA 1NH8A 1RYXA 3DP8A 2ZYKA 4DE8A 5H8NB 4YAHX 2HXWA 1AH5A 1Y20A 1LB9A 1PB8A 2DWJA 1VFEA 4GD5A 2XHDA 5DTBA 1N04A 2OCUA 4RYAA 1B52A 4FORA 2V84A 4MLQA 2Y7IA 1T0KA 2QPQA 3CSGA 4PE5B 4IO6A 3E3KA 2ZYOA 3L6GA 1FQDA 3LSXA 4I1DA 4NF8A 2GRVA 4X9TA 4GQOA 1OMPA 4F3BA 1LAGE 2ZYMA 2PBWA 1OIBA 3OD7A 4N07A 3G3KA 4MFIA 1IIWA 2XD2A 1Q1KA 1B1HA 2VOZA 3PV0E 3T9UA 1PB7A 4G2ZA 4OEVA 4QSDA 3SEVA 1R6ZA 4K3FA 5K2YA 1Y1MA 4C1UA 3MAMA 1ZTYA 3RPWA 4RK2A 3RTWB 4H8IA 5I58A 1S9TA 4X1DA 1NFTA 3OO9A 4IO5A 3BFTA 1A99A 2ONRA 3K6UA 4OXVA 4DXCA 4HW8A 3IAZA 1IXGA 4R74A 3SEYA 3IOWA 1XT8A 3QAXA 4RNSA 4ESWA 1FQCA 5DEXA 5I2KB 2Y7RA 5TPAA 3IB0A 4G4PA 4TQUQ 3MP8A 1TXFA 3MUQA 4R2FA 3K6WA 1MH3A 5I56B 3I3VA 3KG2A 1SI0A 3A3CA 3C32A 3H6WA 4NWDA 1MY2A 3N6TA 2NOOA 4X1BA 1AIVA 3PPNA 3E13X 2F5XA 2AL4A 5FHMA 2UYFA 2H98A 4KCCA 2UYEA 4GL8A 2F6GA 4R2BA 1P1QA 3EHUA 2OBGA 2Q2CA 1FQBA 5LOMA 4JDFA 4R6YA 2X26A 1VSOA 3VLVA 3DLNA 1ZBMA 3MZ1A 5CM6A 1FTMA 1P1NA 3H6UA 1ELJA 3I6VA 5JK4A 1N7WA 4POXA 1ATGA 5CMBA 1TFDA 2XX7A 3BBRA 1BTJA 4F1VA 1MDP1 4ZZAA 1SYHA 3QUFA 3T96B 1JEVA 2QSXA 3IR1A 2O1MA 2B65A 1XOCA 4QRZA 1LFHA 3Q25A 3KSJA 1B0LA 2XX8A 5H8QB 3CI8A 1RYOA 1Y1ZA 4AB6A 3R6UA 3OELA 4KQPA 1S7YA 1H76A 3MW0A 5I2NB 5KDTA 1YCJA 1LFIA 2DOJA 5ITOA 3U92A 4F19A 3V8XB 1H45A 4JB7A 3G3FA 4EF2A 5FHOA 1ZIUA 2XX9A 2G29A 4U1ZA 3HO7A 2O6AA 3FGSA 5HM4B 4PETA 1GVCA 3UK4A 4YKKA 3RGYA 4Q8RA 3VV5A 2E0SA 2G93A 4ELPA 3R7XA 3VE1B 4EQBA 1II5A 1ZU0A 1B40A 5DVFA 1LCFA 1MM6A 3TTNA 3RT8A 4I62A 4P0GA 4YKJA 3K00A 2DVZA 4XKRA 3M3LA 2GHBA 1FTLA 4NF8B 2QS3A 2V3QA 3N5LA 1EZPA 1UIVA 1SVXB 3DP6A 3KOSA 1SW2A 3QSLA 4G8HA 1Y3PA 1IEJA 3S4UA 2I6EA 2V25A 4KYEA 3K4UA 4R6HA 2XD3A 2ZNUA 4Q30B 1SDXA 4WKMA 2UVGA 2Y7WA 5I58B 2OWSA 3BKIB 3TEPA 1LSTA 2PVUA 3RN8A 2DVCA 4BDLA 5CMCA 2OJTA 3GBBA 3H03A 4MF3A 2F35A 2RCBA 3LSFB 3AXFA 5L9MA 4ONYA 3B6QA 3D4CA 1LBCA 5I2KA 1Z7ME 2Z8FA 5DEXB 3FV1A 1D9YA 1Y4TA 5TPAB 1IITA 3HN0A 3F11A 1QUKA 4ZEIA 3CRBA 4Q0CA 4OETA 2PT1A 3FASA 3KN7A 4DIGA 2M8CA 4Z7EA 3GXAA 3RQTA 5AA4A 1LGBC 2BJJX 3A09A 1URGA 4NEDA 3O6IA 4EUOA 2B3BA 1POY1 3HHGA 1B5IA 1SYIA 5F7VA 3HSTA 4BLAA 3Q28A 1MXVA 2RCAA 1B46A 3FUZA 1FTOA 4H8JA 1H3DA 5JEIA 5DVJA 1GV8A 2NWJA 4GOTA 4GF8A 4C0RA 4OFOA 3U1OA 3PD8A 1UIUA 2HAUA 5CBRA 2LAOA 4UA8A 3KJ7A 3TZAA 5ISUA 1USYH 4IO2A 2O7IA 5H8HB 3C9HA 2HQ0A 4NE4A 4EQ9A 2OZZA 3HPIA 4ZEBA 4DDDA 4G77A 4JWXA 4ECFA 3ZKLA 3VLWA 4OMBA 4QF9A 3IX1A 2PX1A 3IO6A 2ABHA 2VP1A 4ESXA 3WAFA 4NF5A 1MPDA 1AL3A 1B9JA 1D9VA 2V3UA 3UIFA 4G8NA 1A8EA 4R73A 2CMOA 3ILTB 2O7UA 1HSEA 1Y4CA 4EDPA 3N6UA 3TQWA 3SESA 4KYSA 1H43A 4F3PA 1PEBA 5J1DA 2GFEA 2DWAA 4ZEDA 3T9VA 3O6GA 4JWYA 1O63A 1B1XA 4BDNA 3O29A 3TTRA 3MC2A 4G68C 4RK9A 4KPTA 1ZMGA 1QJMA 4ZE8A 2R9JA 3K02A 3RY3A 4OZ9A 4KCDA 4YB7A 4HCWA 3O97A 3JV9A 3H3GA 5M2VA 3K6VA 1CE2A 3C35A 3EF7A 2HEUA 2F7CA 3OO6A 4LZ7A 3TELA 1IUDA 1B32A 2ZNTA 4H65A 2XXQA 3O2AA 3OXNA 3KJTA 3Q29A 2XXHA 4L17A 3C36A 4FECA 2F34A 4OYVA 4IY5A 1LAFE 4RJZA 4TLMB 3SDFA 4QFOA 2QL3A 5HBCA 1IXIA 1ZLQA 4U21A 3U8QA 4XTCQ 1SW5A 3DM0A 2ANJA 5K2XA 3CSBA 2YPNA 5FTHA 1LBBA 1LLSA 3G3JA 2AYSA 3OSQA 3IOTA 1FW0A 2I4CA 4IO7A 2A5SA 4KYDA 4OFLA 5EHMA 5IKBA 5EHSA 4OWDA 4XKQA 3TAJA 2QRYA 4XXUA 1TFAA 3PD9A 3RT6B 2Q88A 1EZ9A 4JWOA 2HFBA 3FJGA 2DP8A 1DSNA 2HAVA 2DQVA 2DSFA 4YMBA 1NNFA 2D5WA 3C34A 4FIMA 1MQHA 1QKBA 1MY3A 4JBZA 3EHTA 3FJMA 1F9BA 3VFJA 1TT1A 1MQGA 2W7YA 5AA4B 3RNNA 1KWHA 1BP5A 1SW1A 4U1OA 1I69A 1LB8A 1N0TA 3GZGA 2GHAA 3IB2A 2RKMA 1MY4A 3K2DA 4U23A 4ZEKA 3V89B 1D3KA 2Q9TA 5CBSA 4PFWA 3M3FA 1UTHA 1R1NA 2DXYA 3GLBA 2F97A 4PQJA 1FQFA 2DS9A 2NUVA 3HV1A 4U4XA 4HTGA 3FIRA 4OESA 3UA8A 3PUZE 5H8HA 4EXLA 1US4A 5F1QA 1UTBA 1OLAA 3S9MC 4WEDA 2XXWA 3Q26A 3G3HA 4AB5A 1MRPA 1P1WA 4F2OA 2ZYNA 5AE4A 5B7DA 1H44A 4F31B 4PFYA 3TODA 3WAEA 1MXZA 3N26A 4N6PA 1PC3A 4MBPA 1N84A 1JVYA 3TCHA 2F36A 4H5FA 3KOTA 1L5TA 4NF5B 1MPCA 4NF6A 2XXVA 5I57B 2DWIA 4QFKA 2ALUA 4G8MA 4QSCA 4DCXA 2XXUA 4QFPA 1XS5A 5TP9A 4IO3A 4PP0A 2P1SA 2Z8EA 3PMVA 1PB9A 5AA3A 1MQIA 1DOTA 1P1UA 3P7IA 4YU0A 3CFXA 3DP4A 4KD5A 1EU8A 3VVFA 4NF4A 3LSLA 1FQAA 5ICTA 3MVWA 3TTKA 3PUWE 4E0WA 4ELRA 1MH4A 3VVDA 3LUYA 4R9GA 1MY1A 3C31A 4IO4A 1IXHA 1QUIA 3FVGA 2H99A 1LAXA 1NL5A 3I5OA 3RLFE 5EYFA 1NNPA 3CIJA 4ELQA 3OENA 3PUYE 1B7UA 1M5BA 1M5DA 3RTFB 2XXYA 3MVXA 3OMBA 5KZTA 5I59B 1FCKA 3PMXA 4F1UA 3UP9A 2A5TA 3MP1A 5DYHA 2Z8DA 4YB6A 3T9HB 1P99A 5A5XA 2UVHA 3G3GA 4G68A 1LAHE 1EZOA 4LP2B 3HHFA 4F3GA 2QS2A 3CG1A 3V83A 1OVTA 4KFQA 3VXBA 4KI0E 3QYTA 3VXCA 3PU5A 2D3IA 4YMAA 3THIA 5KCJB 2H4IA 2R71A 3VLUA 4BDOA 2P0SA 3RUMA 3IOVA 5BWJA 4Z0IA 1JETA 2I3VA 2I49A 1SQYA 1MS7A 1ZKBA 3BFUA 2Q2AA 4IB2A 3IL1B 4FJPA 1P1OA 3KEIA 1QVSA 4JSDA 3QUJA 2F78A 5AA1A 4EXKA 1DTZA 1JW4A 3T9XB 4TLLB 4F18A 2F7AA 1A55A 4QFLA 4P0IA 1JW1A 2I48A 3U93A 4ZECA 3R26A 4QSEA 1MM7A 3C33A 1UTHB 4U2RA 3USDA 3U72A 2IEEA 2HZKA 4LZ8A 5BUUA 3EPEA 1TWYA 1R9QA 2WKYA 1MXUA 2Y7KA 4FEDA 3S9EA 1HSLA 4C1TA 4EQ7A 3CR9A 3V5AA 1A8FA 4YKIA 3ZKKA 5HPQA 5JTYB 4YKPA 4LVQA 5CMMA 1UTBB 4GLIA 1S50A 4LATA 1CB6A 5ITPA 2THIA 3TMGA 3FJ7A 2OWTA 4FEBA 2P2AA 2QJEA 1DPPA 1B6HA 4E0XA 4BDMA 2REGA 1WVJA 4IY6A 5CMKA 4MLVA 4LA9A 3K6XA 3W9VA 1OQHA 1B05A 5FTIA 3IJXB 1YPNA 2ZNSA 5AA2A 3KSXA 1O7TA 2Y7PA 3PPOA 5I57A 3TKDA 1PBPA 1JQFA 5ICQA 1MQJA 4NF6B 2O51A 2YJPA 3M3KA 1WODA 1N3WA 1DPEA 4GRKA 1JEUA 4FATA 4WEPA 5TP9B 3IB1A 1BKAA 3T22A 3MVZA 2ZXTA 4PFUA 2VD2A 4GVOA 4GXSB 3U94A 3PUVE 3B6TA 4DZ1A 3B6WA 4DLDA 2UVIA 4H5GA 2V93A 1A40A 4NF4B 1Z7NE 2DE2A 3PPRA 2F8DA 3S9LC 2Z22A 1XVXA 1NNTA 4F1YA 1PBQA 2VD3A 2I0CA 4UACA 3EN3A 3TTLA 1MY0A 1I6QA 5H8FA 3KBRA 1R9LA 1OQGA 4I9DA 5I59A 2GH9A 3W15C 4ZS9A 3TDJA 2R6GE 4YICA 1JW5A 3K1PA 3MJNA 4THIA 4I8CA 4M4GA 2OLBA 2VGQA 2Q8JA 1DMBA 2A5TB 3SEUA 3PPPA 1BIYA 4ZZEA 4RPOA 1MPBA 4NWCA 1LCTA 2RC8A 5A5XB 4G68B 2X7QA 3HCQA 1M5FA
chains in the Genus database with same CATH superfamily
1B7ZA 5DT6A 2H9BA 3JZJA 3TQLA 4H1XA 3C4MA 2X7PA 3IORA 1SW4A 4ZDMA 4ZEFA 4O3AA 1FQEA 4ZE9A 1SI1A 5KCJA 4ND9A 1URSA 4I40A 4BDQA 4OEUA 1LBZA 3TFLA 2NVUB 1WDNA 1UQWA 4P11A 4GWOA 4OFJA 2DYXA 2CZHA 2O84X 2DXRA 4PFTA 3OEMA 1US5A 3IOUA 5F24A 1Y3NA 4R6KA 2QMXA 3UN6A 4PBHA 4DXUA 4H6DA 4I3YA 5L9SA 5LDZA 1MDQA 3IJOB 4XIGQ 5IZ3B 3W9WA 1FTKA 1NV5A 3OO8A 1Q35A 3TCGA 3FXRA 1IMAA 3E9XA 2FIXA 5IZ1A 3PPQA 4OTEA 3LBSA 4MAGA 4NAPA 2I4BA 3TUSA 1QW0A 4KXPA 1NUXA 5FHNA 2DWHA 3MWBA 3SETA 3LC8A 1KA1A 2ZMBA 4PFRA 3KN8A 4XKPA 4QHQA 2BJIA 3FZVA 5JTYA 1YZ0A 4DXBA 3QIMA 1GTKA 1N76A 4OVJA 3K01A 3L6HA 5IZZA 4P3LA 5H8SA 4IR8A 5ET7A 3TCFA 2QS1A 1QKAA 3MP6A 2OK2A 3N94A 4HS7A 3T66A 1CNQA 3IFCA 1URDA 3MVYA 1GR2A 3T93B 4GBVA 4OVTA 4O7IA 1VR5A 5DW8A 2PCRA 1B5JA 1B3EA 2AIXA 2PMSA 3OSRA 3ODBA 4H0WA 5ELVA 3VDFA 2CEXA 3QXMA 5AA2B 4PF6A 2D21A 1Y9UA 2B3FA 3OEKA 4OQOA 1XVYA 3MZ9A 2WYKA 2O69A 4GWYA 3O28A 4YB5A 4ELOA 3D4GA 2H25A 1A54A 1QULA 3FXBA 4P47A 4MNIA 1MG1A 4LUBA 4LZ5A 3OOAA 2XXPA 3FV2A 3S2VA 1JP4A 1MXXA 1NH7A 4N6KA 1FBHA 2FA7A 5TU0A 3MPKA 1Y3QA 3OO7A 3A3UA 4R75A 3S9NC 3QMFA 4U4SA 4F29A 1FTAA 1ANFA 4N13A 2O68A 5H8NA 2MKZA 4N6DA 2I58A 4LQ5A 4X48A 4PC9A 4FBPA 1OLCA 3EQ1A 4R9FA 3ILUB 3ZSFA 4P1EA 5L8DA 4GL0A 1I6BA 4FE8A 3ONMA 3G7WA 2FHYA 2HZLA 3LR1A 2ONSA 1LFGA 3B7DA 4NTLA 1GGGA 4RA1A 3KC1A 3KFMA 1IXCA 3A29A 4OERA 5L9OA 4M1VA 4DCYA 3TTMA 4GFRA 2I0BA 2RC7A 4QFNA 5H8FB 2O1LA 1B7HA 1MXYA 2ONKE 3SEXA 2YLNA 4O3CA 3G3IA 5CRYA 4I3EA 3FXUA 1EH3A 3CVGA 1AOVA 1QUJA 4OHNA 2CZIA 2PT2A 3KZGA 1A7LA 5CI5A 3PMWA 3KGCA 4Q5TA 3CFZA 3KN3A 5IAIA 2KLFA 4GXAA 1B5HA 3IK6B 3SEWA 3O66A 2RF1A 1B4ZA 4GBWA 4O3BA 4YZZA 5CC2A 4OA4A 3K0VA 3H6TA 1HSJA 3IO4A 4PDHA 3H4ZA 4PGNA 4GWSA 4EF1A 2R8TA 4RPNA 4U22A 4JXIA 2VT5A 1B4HA 3PUXE 4GX6A 2Z23A 4F3SA 1NMUA 4R72A 1YAEA 1M5EA 4N81A 4KR5A 4NMYA 4IGTA 2V3TA 3CG3A 3QK6A 2Y84A 3MZBA 1INPA 3FVOA 1B3FA 2V4CA 4RXLA 1NNKA 3H7MA 3H6VA 4LONB 3O6HA 1D4NA 4RY1A 1POTA 3MQ9A 2VPOA 4JVCA 2HCAA 1USYE 3M8UA 2XXTA 4N17A 1B51A 4AQ4A 4OENA 1DTGA 4F22A 3PGFA 2XXXA 5I56A 3DELB 1ZJLA 3SKPA 1IQ7A 3O9PA 1LBVA 1B2HA 2UVJA 1MXWA 1YTVA 5EYGA 1SBPA 5ESYA 3MBPA 4KHZE 3K1MA 2Q89A 3FXQA 2H5YA 4TOZA 1FJ9A 2Y5LA 2QMWA 2WX9A 1SD3A 1B58A 1KZ8A 3Q27A 3BIHA 4ISUA 2F7BA 2CZLA 4BDRA 3ECRA 2UXAA 2F6PA 1AMFA 3E78A 1NI9A 1XC1A 1JNFA 1FRPA 5I84A 4H67A 3TYHA 3GBAA 1IZ1A 1XHYA 3EHSA 4F2QA 1VE4A 2AL5A 1I6AA 1B0HA 4DI3D 4LQ2A 4FAJA 2RC9A 3MPLA 1N3XA 4MEVA 1N7XA 2DE3A 2QFLA 4POWA 2ESNA 3VVEA 2RINA 4F39A 4HCYA 2XXIA 2I3WA 3TPAA 3FD3A 3FVKA 4MH5A 1B3GA 1M5CA 1BLFA 2PYYA 2E1SA 1JVXA 2HPGA 5DVIA 3BIGA 4XKNA 5IM2A 1FBGA 3SERA 2FNCA 2NXOA 3UGWA 4GIZA 5AA2D 1OVBA 1VFDA 1PDAA 3JYRA 1J1NA 1MQDA 5H8QA 5B70A 3CFLA 1RKMA 3UORA 4IGRA 3ZS6A 2IA4A 2HHMA 5I2NA 4WXJA 3FVNA 2XXRA 3T0JA 1K9YA 4OVQA 1FTJA 1NV3A 2QS4A 3FATA 2DE4A 5KDTB 3E4RA 4JSOA 1B3LA 2FYIA 3H06B 3LSWA 2REJA 4QXDA 1O64A 2QVUA 2Q8MA 3K1NA 1B3HA 1NKXA 4LN5A 2VHAA 1NH8A 1RYXA 1FPFA 4PF8A 3DP8A 2ZYKA 4DE8A 5H8NB 4YAHX 2HXWA 1AH5A 1Y20A 1LB9A 1PB8A 2DWJA 1FPLA 3ISPA 1VFEA 4GD5A 1NV0A 2XHDA 5DTBA 1N04A 2OCUA 4RYAA 1B52A 4FORA 2V84A 1IMDA 2Q74A 1FPJA 4MLQA 2Y7IA 1T0KA 2QPQA 3CSGA 4PE5B 2F3BA 2XA5A 4IO6A 3E3KA 2ZYOA 3L6GA 1FQDA 3LSXA 4I1DA 4NF8A 2GRVA 2P3NA 4HE2A 4X9TA 4GQOA 1OMPA 4F3BA 1LAGE 2ZYMA 4QBAA 2PBWA 1OIBA 3OD7A 4N07A 3G3KA 4MFIA 1IIWA 2XD2A 1Q1KA 1B1HA 2VOZA 3PV0E 3T9UA 1PB7A 4G2ZA 4OEVA 4QSDA 3SEVA 2F3DA 4PE3A 1R6ZA 4K3FA 5K2YA 1Y1MA 4C1UA 4GWWA 1EYJA 3MAMA 1ZTYA 3RPWA 4RK2A 3RTWB 4H8IA 5I58A 1S9TA 4X8RA 1FBCA 4X1DA 1NFTA 3OO9A 4IO5A 3BFTA 1A99A 2ONRA 3K6UA 4OXVA 4DXCA 4HW8A 3IAZA 5EQ7A 1IXGA 4R74A 3SEYA 3IOWA 1XT8A 3QAXA 4RNSA 5IGAA 4ESWA 4MIJA 1FQCA 5DEXA 5I2KB 2Y7RA 5TPAA 3IB0A 4G4PA 4TQUQ 3MP8A 1TXFA 3MUQA 4R2FA 3K6WA 2DDKA 1MH3A 5I56B 5I5PA 3I3VA 3KG2A 1SI0A 3A3CA 3C32A 3H6WA 4NWDA 1MY2A 3N6TA 2NOOA 4X1BA 1AIVA 3PPNA 3E13X 2F5XA 2AL4A 5FHMA 2UYFA 2H98A 2FBPA 4KCCA 2UYEA 4GL8A 2F6GA 4R2BA 1P1QA 3EHUA 2OBGA 2Q2CA 1FQBA 5LOMA 4JDFA 4R6YA 2X26A 1VSOA 3VLVA 3DLNA 4O8MA 1ZBMA 2XWIA 3MZ1A 5CM6A 1FTMA 1P1NA 3H6UA 1ELJA 3I6VA 5JK4A 1N7WA 4POXA 1ATGA 5CMBA 1TFDA 2XX7A 3BBRA 1BTJA 4F1VA 1MDP1 4ZZAA 1SYHA 3QUFA 4OVRA 3T96B 1JEVA 3LUZA 2QSXA 3IR1A 1LBWA 2O1MA 2B65A 1XOCA 4QRZA 1LFHA 1RDXA 4DI4B 4JVIA 3Q25A 3KSJA 1B0LA 1FPIA 2XX8A 4O94A 5H8QB 3CI8A 1RYOA 1Y1ZA 4AB6A 3R6UA 3OELA 4KQPA 1S7YA 1H76A 3MW0A 5I2NB 5KDTA 4PCDA 1LFIA 1YCJA 2DOJA 5ITOA 5ET5A 3U92A 3KBZA 1DCUA 4F19A 3V8XB 1H45A 5ET8A 4JB7A 3G3FA 4EF2A 5FHOA 1ZIUA 2XX9A 2Y5KA 2G29A 4U1ZA 3T1BA 3HO7A 5T3JA 2O6AA 1VDWA 3FGSA 5HM4B 4PETA 2CEYA 1GVCA 3UK4A 4YKKA 1NUYA 3RGYA 4N8GA 4PAIA 4MNPA 4Q8RA 3VV5A 4G61A 2E0SA 4H46A 3CHGA 2G93A 4ELPA 3R7XA 3VE1B 2OX3A 4EQBA 1II5A 1ZU0A 1B40A 5DVFA 1LCFA 1MM6A 4H45A 1Q9DA 4NF0A 3TTNA 3RT8A 4I62A 4P0GA 4PBQA 4YKJA 3K00A 2DVZA 4XKRA 3M3LA 2GHBA 1FTLA 4GWXA 4NF8B 4GX4A 2QS3A 2V3QA 3N5LA 5EYHA 1EZPA 1UIVA 4MHFA 1K9ZA 1YYZA 4MJOA 1SVXB 3DP6A 3KOSA 1SW2A 3QSLA 4G8HA 4P8BA 1Y3PA 1IEJA 3S4UA 2I6EA 2V25A 4KYEA 3K4UA 2XWOA 4R6HA 2XD3A 1YXIA 4PDDA 2ZNUA 4Q30B 1SDXA 4WKMA 2UVGA 2Y7WA 5I58B 2OWSA 3BKIB 3TEPA 1LSTA 2PVUA 3PTYA 3RN8A 2DVCA 4BDLA 5CMCA 2OJTA 3GBBA 3H03A 4MF3A 2F35A 2RCBA 3LSFB 3AXFA 5L9MA 4ONYA 3B6QA 3D4CA 1LBCA 5I2KA 1Z7ME 2Z8FA 5DEXB 3FV1A 1D9YA 1Y4TA 5TPAB 1IITA 3HN0A 3F11A 1QUKA 4ZEIA 4JVDA 3CRBA 4PFBA 4NG7A 5I7IA 4Q0CA 4OETA 2PT1A 3FASA 3KN7A 4DIGA 2M8CA 4Z7EA 3GXAA 4OVSA 3RQTA 5AA4A 1LGBC 2BJJX 3A09A 1URGA 4NEDA 3O6IA 4EUOA 2B3BA 5ET6A 2QVVA 1POY1 2WBBA 3HHGA 4MCOA 1B5IA 1SYIA 5F7VA 3HSTA 4BLAA 2B4MA 3Q28A 1MXVA 2RCAA 1B46A 3FUZA 1FTOA 4H8JA 1H3DA 5JEIA 5DVJA 1GV8A 2NWJA 4GOTA 4GF8A 4C0RA 4OFOA 3U1OA 3PD8A 1UIUA 2HAUA 5CBRA 2LAOA 4UA8A 2ZZXA 3KJ7A 4HXVA 3TZAA 5ISUA 1USYH 4IO2A 2O7IA 5H8HB 3C9HA 2CZKA 2HQ0A 4NE4A 4EQ9A 2OZZA 3HPIA 4P9KA 4ZEBA 4HE0A 5EQ8A 4DDDA 4G77A 4JWXA 4ECFA 3ZKLA 3VLWA 1LBYA 4OMBA 4QF9A 3IX1A 2KR0A 2PX1A 3IO6A 2ABHA 4XF5A 2VP1A 4ESXA 2XXKA 1KA0A 3WAFA 4NF5A 1MPDA 1IMCA 1AL3A 3KC0A 1B9JA 1D9VA 2V3UA 3UIFA 4G8NA 1A8EA 1FBFA 4R73A 2CMOA 3ILTB 2O7UA 1HSEA 1Y4CA 4EDPA 3N6UA 3TQWA 3E79A 3SESA 4KYSA 1H43A 1FBDA 4F3PA 1PEBA 5J1DA 2GFEA 2DWAA 2B4LA 4ZEDA 3T9VA 3O6GA 4JWYA 1O63A 1B1XA 4BDNA 3O29A 3TTRA 3MC2A 4G68C 4RK9A 4KPTA 1ZMGA 1QJMA 4ZE8A 2R9JA 3K02A 3RY3A 4OZ9A 4KCDA 4YB7A 4N91A 4P1LA 4HCWA 3O97A 3JV9A 3H3GA 5M2VA 3K6VA 1CE2A 3C35A 3EF7A 4PFIA 2HEUA 2F7CA 3OO6A 4LZ7A 3TELA 1IUDA 1B32A 2ZNTA 4H65A 2XXQA 1EYKA 3O2AA 1FBPA 3OXNA 3KJTA 1LBXA 3Q29A 2XXHA 3EKIA 3HFUA 3IFAA 4L17A 2KQZA 3C36A 4FECA 2F34A 4OYVA 3RPLA 4IY5A 1LAFE 4RJZA 4TLMB 3SDFA 4QFOA 2QL3A 5HBCA 1FSAA 1IXIA 1ZLQA 4U21A 3U8QA 4XTCQ 1SW5A 3DM0A 2ANJA 5K2XA 3CSBA 2YPNA 5FTHA 1LBBA 1LLSA 3G3JA 2AYSA 3OSQA 3IOTA 1FW0A 2I4CA 4IO7A 2A5SA 4X04A 4KYDA 4OFLA 5EHMA 5IKBA 5EHSA 4OWDA 4O7MA 4XKQA 3TAJA 2QRYA 4XXUA 1TFAA 3PD9A 3RT6B 4NN3A 2Q88A 1FBEA 1EZ9A 4JWOA 2P3VA 2WBDA 2HFBA 1FPGA 3FJGA 2DP8A 1DSNA 2HAVA 2DQVA 2DSFA 4YMBA 1NNFA 5FBPA 2D5WA 3C34A 4FIMA 3MYUA 1MQHA 1QKBA 1MY3A 4JBZA 5LTCA 1FPEA 3EHTA 3FJMA 1F9BA 3VFJA 1TT1A 1MQGA 2W7YA 5AA4B 3RNNA 1KWHA 1BP5A 1SW1A 4U1OA 2XWVA 1I69A 1LB8A 1N0TA 3GZGA 2GHAA 3IB2A 2RKMA 1MY4A 3K2DA 1AWBA 1NUZA 4U23A 4ZEKA 3V89B 2PFZA 1D3KA 2Q9TA 5CBSA 4PFWA 3M3FA 1UTHA 1R1NA 2DXYA 3GLBA 2F97A 4PQJA 1FQFA 1LEVA 3NOHA 3D1RA 2DS9A 2NUVA 3HV1A 4U4XA 4HTGA 3FIRA 4OESA 3UA8A 3PUZE 5H8HA 4EXLA 1US4A 2WYPA 5F1QA 1UTBA 1OLAA 3U65A 1FPDA 3S9MC 4WEDA 2XXWA 3Q26A 3G3HA 4AB5A 1MRPA 1P1WA 4F2OA 2ZYNA 5AE4A 5B7DA 1H44A 4F31B 4PFYA 3TODA 3WAEA 1MXZA 2FVZA 1QGXA 3N26A 4N6PA 1PC3A 4MBPA 1N84A 1JVYA 3TCHA 2F36A 4H5FA 3KOTA 1L5TA 4N15A 4NF5B 1G0HA 1MPCA 4NF6A 2XXVA 5I57B 2DWIA 4QFKA 2ALUA 4G8MA 4QSCA 4DCXA 2XXUA 1D9QA 4QFPA 1XS5A 5TP9A 4IO3A 4PP0A 2P1SA 4OVPA 2Z8EA 3PMVA 1PB9A 5AA3A 4UABA 1MQIA 1DOTA 1P1UA 3P7IA 4YU0A 3CFXA 3DP4A 4KD5A 1NV1A 1EU8A 3VVFA 4NF4A 3LSLA 1FQAA 5ICTA 3MVWA 3TTKA 3PUWE 4E0WA 4ELRA 1MH4A 3VVDA 3LUYA 4R9GA 1MY1A 3C31A 1NV7A 4GWZA 4IO4A 1IXHA 3GYYA 1QUIA 3FVGA 2H99A 1LAXA 1NL5A 3I5OA 3RLFE 5EYFA 2L5VA 1NNPA 3CIJA 2QVRA 4ELQA 3OENA 1NUWA 2ZZWA 3PUYE 1B7UA 4OANA 4MX6A 1M5BA 1M5DA 3RTFB 1NV2A 2XXYA 3MVXA 3OMBA 5KZTA 5I59B 1FCKA 3PMXA 4F1UA 3RPLB 2JJKA 2VPNA 4AS5A 3UP9A 3B50A 2A5TA 3MP1A 5DYHA 2Z8DA 4YB6A 1IMBA 3T9HB 1P99A 5A5XA 2UVHA 3G3GA 4G68A 1LAHE 1EZOA 3LV0A 4LP2B 3HHFA 4F3GA 2QS2A 3CG1A 3V83A 1OVTA 4PAFA 4KFQA 3VXBA 4KI0E 3QYTA 3VXCA 3PU5A 2D3IA 4YMAA 3THIA 5KCJB 2H4IA 2R71A 1NV6A 4NQ8A 3VLUA 4BDOA 2P0SA 3RUMA 3IOVA 5BWJA 4Z0IA 1JETA 2I3VA 2I49A 1SQYA 1MS7A 1ZKBA 3BFUA 2Q2AA 4IB2A 4NHBA 4N4UA 3IL1B 4FJPA 4XEQA 1P1OA 1FPBA 2ZZVA 3KEIA 1QVSA 4JSDA 3QUJA 2F78A 5AA1A 4GWUA 5IZ3A 4EXKA 1DTZA 1JW4A 2OWZA 3T9XB 4TLLB 4F18A 2F7AA 1A55A 4QFLA 4P0IA 1EYIA 1JW1A 2I48A 3U93A 2PFYA 4ZECA 3R26A 4QSEA 4MMPA 4XFEA 1MM7A 2FIEA 3C33A 1NV4A 4HE1A 1XI6A 1UTHB 4U2RA 1FPKA 3USDA 3U72A 2IEEA 2HZKA 4LZ8A 5BUUA 3EPEA 1TWYA 1R9QA 2WKYA 1MXUA 3RYDA 2Y7KA 4FEDA 1DBZA 3ROJA 3S9EA 1HSLA 4C1TA 4EQ7A 3CR9A 3V5AA 4MNCA 1A8FA 4YKIA 1G0IA 3ZKKA 5HPQA 1BK4A 4PGPA 5JTYB 4YKPA 4LVQA 5CMMA 1UTBB 4GLIA 1S50A 4LATA 1CB6A 5ITPA 2THIA 3TMGA 3FJ7A 2OWTA 4FEBA 4AS4A 2P2AA 2QJEA 1DPPA 1FJ6A 1SPIA 1B6HA 4E0XA 4BDMA 2REGA 1DK4A 1WVJA 4IY6A 5CMKA 4MLVA 4LA9A 3K6XA 3W9VA 1OQHA 1B05A 5FTIA 3IJXB 1YPNA 2ZNSA 5AA2A 3KSXA 1O7TA 2Y7PA 3PPOA 5I57A 3TKDA 1PBPA 1JQFA 5ICQA 1MQJA 4NF6B 2O51A 2YJPA 3M3KA 1WODA 1N3WA 1DPEA 4GRKA 5J16A 1JEUA 1IMEA 4FATA 4WEPA 5TP9B 3IB1A 1BKAA 4NGUA 3T22A 3MVZA 2ZXTA 4NX1A 4PFUA 2VD2A 4GX3A 3MSTA 4GVOA 4GXSB 3U94A 3PUVE 3B6TA 3SZPA 4DZ1A 3B6WA 4DLDA 2UVIA 2XWKA 4H5GA 2V93A 1A40A 4NF4B 1Z7NE 2DE2A 3PPRA 2F8DA 3S9LC 2Z22A 1XVXA 1NNTA 4PAKA 4F1YA 1PBQA 2VD3A 3B8BA 2HXRA 2I0CA 4PTKA 4UACA 1RDZA 3EN3A 3TTLA 1MY0A 1I6QA 5H8FA 3KBRA 1R9LA 1OQGA 3FBPA 4I9DA 5I59A 2GH9A 2WEFA 3W15C 4ZS9A 3TDJA 1RDYA 2R6GE 5EQ9A 4YICA 1JW5A 4P56A 3K1PA 3MJNA 4THIA 4I8CA 4M4GA 1IMFA 2OLBA 2VGQA 5A5LA 2Q8JA 1DMBA 2A5TB 3SEUA 3PPPA 1BIYA 4ZZEA 4RPOA 1MPBA 4NWCA 5I3SA 5EQAA 1LCTA 2RC8A 5A5XB 4G68B 2X7QA 2GQ1A 4N8YA 3HCQA 1M5FA
chains in the Genus database with same CATH topology
1B7ZA 5DT6A 2H9BA 3JZJA 3TQLA 4H1XA 3C4MA 2X7PA 3IORA 1SW4A 4ZDMA 4ZEFA 4O3AA 1FQEA 4ZE9A 1SI1A 5KCJA 4ND9A 1URSA 4BDQA 4OEUA 3TFLA 2NVUB 1WDNA 1UQWA 4P11A 4GWOA 4OFJA 2DYXA 2O84X 2DXRA 4PFTA 3OEMA 1US5A 3IOUA 1Y3NA 4R6KA 2QMXA 3UN6A 4DXUA 4H6DA 5L9SA 1MDQA 3IJOB 4XIGQ 3W9WA 1FTKA 3OO8A 1Q35A 3TCGA 3FXRA 3E9XA 3PPQA 4OTEA 3LBSA 2I4BA 3TUSA 1QW0A 5FHNA 2DWHA 3MWBA 3SETA 3LC8A 2ZMBA 3KN8A 4XKPA 4QHQA 3FZVA 5JTYA 4DXBA 3QIMA 1GTKA 1N76A 4OVJA 3K01A 3L6HA 5H8SA 3TCFA 2QS1A 1QKAA 3MP6A 2OK2A 3N94A 4HS7A 3T66A 1URDA 3MVYA 1GR2A 3T93B 1VR5A 1B5JA 1B3EA 2AIXA 2PMSA 3OSRA 3ODBA 4H0WA 5ELVA 3VDFA 3QXMA 5AA2B 2D21A 1Y9UA 2B3FA 3OEKA 4OQOA 1XVYA 3MZ9A 2O69A 3O28A 4YB5A 4ELOA 3D4GA 2H25A 1A54A 1QULA 1MG1A 4LUBA 4LZ5A 3OOAA 2XXPA 3FV2A 3S2VA 1MXXA 1NH7A 2FA7A 5TU0A 3MPKA 1Y3QA 3OO7A 3A3UA 4R75A 3S9NC 4U4SA 4F29A 1ANFA 4N13A 2O68A 5H8NA 2I58A 4LQ5A 4X48A 1OLCA 3EQ1A 4R9FA 3ILUB 3ZSFA 5L8DA 4GL0A 1I6BA 4FE8A 3ONMA 3G7WA 2HZLA 3LR1A 2ONSA 1LFGA 3B7DA 4NTLA 1GGGA 4RA1A 3KFMA 1IXCA 4OERA 5L9OA 4M1VA 4DCYA 3TTMA 4GFRA 2I0BA 2RC7A 4QFNA 5H8FB 2O1LA 1B7HA 1MXYA 2ONKE 3SEXA 2YLNA 4O3CA 3G3IA 5CRYA 3FXUA 1EH3A 3CVGA 1AOVA 1QUJA 4OHNA 2PT2A 3KZGA 1A7LA 5CI5A 3PMWA 3KGCA 4Q5TA 3CFZA 3KN3A 5IAIA 2KLFA 4GXAA 1B5HA 3IK6B 3SEWA 3O66A 2RF1A 1B4ZA 4O3BA 4YZZA 5CC2A 3K0VA 3H6TA 1HSJA 3IO4A 3H4ZA 4EF1A 4RPNA 4U22A 4JXIA 1B4HA 3PUXE 2Z23A 4F3SA 1NMUA 4R72A 1YAEA 1M5EA 4KR5A 4NMYA 4IGTA 2V3TA 3CG3A 3QK6A 2Y84A 3MZBA 3FVOA 1B3FA 4RXLA 1NNKA 3H7MA 3H6VA 4LONB 3O6HA 1D4NA 4RY1A 1POTA 3MQ9A 2HCAA 1USYE 3M8UA 2XXTA 1B51A 4AQ4A 4OENA 1DTGA 4F22A 3PGFA 2XXXA 5I56A 3DELB 1ZJLA 3SKPA 1IQ7A 3O9PA 1B2HA 2UVJA 1MXWA 1YTVA 1SBPA 3MBPA 4KHZE 3K1MA 2Q89A 3FXQA 2H5YA 4TOZA 2QMWA 1SD3A 1B58A 3Q27A 4ISUA 2F7BA 2CZLA 4BDRA 3ECRA 2UXAA 2F6PA 1AMFA 1XC1A 1JNFA 5I84A 4H67A 3TYHA 3GBAA 1IZ1A 1XHYA 3EHSA 4F2QA 1VE4A 2AL5A 1I6AA 1B0HA 4LQ2A 4FAJA 2RC9A 3MPLA 1N3XA 1N7XA 2DE3A 4POWA 2ESNA 3VVEA 2RINA 4F39A 4HCYA 2XXIA 2I3WA 3TPAA 3FD3A 3FVKA 4MH5A 1B3GA 1M5CA 1BLFA 2PYYA 2E1SA 1JVXA 5DVIA 4XKNA 3SERA 2FNCA 2NXOA 3UGWA 4GIZA 5AA2D 1OVBA 1VFDA 1PDAA 3JYRA 1J1NA 1MQDA 5H8QA 5B70A 3CFLA 1RKMA 3UORA 4IGRA 3ZS6A 2IA4A 5I2NA 4WXJA 3FVNA 2XXRA 1FTJA 2QS4A 3FATA 2DE4A 5KDTB 3E4RA 4JSOA 1B3LA 2FYIA 3H06B 3LSWA 2REJA 1O64A 3K1NA 1B3HA 1NKXA 2VHAA 1NH8A 1RYXA 3DP8A 2ZYKA 4DE8A 5H8NB 4YAHX 2HXWA 1AH5A 1Y20A 1LB9A 1PB8A 2DWJA 1VFEA 4GD5A 2XHDA 5DTBA 1N04A 2OCUA 4RYAA 1B52A 4FORA 2V84A 4MLQA 2Y7IA 1T0KA 2QPQA 3CSGA 4PE5B 4IO6A 3E3KA 2ZYOA 3L6GA 1FQDA 3LSXA 4I1DA 4NF8A 2GRVA 4X9TA 4GQOA 1OMPA 4F3BA 1LAGE 2ZYMA 2PBWA 1OIBA 3OD7A 4N07A 3G3KA 4MFIA 1IIWA 2XD2A 1Q1KA 1B1HA 2VOZA 3PV0E 3T9UA 1PB7A 4G2ZA 4OEVA 4QSDA 3SEVA 1R6ZA 4K3FA 5K2YA 1Y1MA 4C1UA 3MAMA 1ZTYA 3RPWA 4RK2A 3RTWB 4H8IA 5I58A 1S9TA 4X1DA 1NFTA 3OO9A 4IO5A 3BFTA 1A99A 2ONRA 3K6UA 4OXVA 4DXCA 4HW8A 3IAZA 1IXGA 4R74A 3SEYA 3IOWA 1XT8A 3QAXA 4RNSA 4ESWA 1FQCA 5DEXA 5I2KB 2Y7RA 5TPAA 3IB0A 4G4PA 4TQUQ 3MP8A 1TXFA 3MUQA 4R2FA 3K6WA 1MH3A 5I56B 3I3VA 3KG2A 1SI0A 3A3CA 3C32A 3H6WA 4NWDA 1MY2A 3N6TA 2NOOA 4X1BA 1AIVA 3PPNA 3E13X 2F5XA 2AL4A 5FHMA 2UYFA 2H98A 4KCCA 2UYEA 4GL8A 2F6GA 4R2BA 1P1QA 3EHUA 2OBGA 2Q2CA 1FQBA 5LOMA 4JDFA 4R6YA 2X26A 1VSOA 3VLVA 3DLNA 1ZBMA 3MZ1A 5CM6A 1FTMA 1P1NA 3H6UA 1ELJA 3I6VA 5JK4A 1N7WA 4POXA 1ATGA 5CMBA 1TFDA 2XX7A 3BBRA 1BTJA 4F1VA 1MDP1 4ZZAA 1SYHA 3QUFA 3T96B 1JEVA 2QSXA 3IR1A 2O1MA 2B65A 1XOCA 4QRZA 1LFHA 3Q25A 3KSJA 1B0LA 2XX8A 5H8QB 3CI8A 1RYOA 1Y1ZA 4AB6A 3R6UA 3OELA 4KQPA 1S7YA 1H76A 3MW0A 5I2NB 5KDTA 1YCJA 1LFIA 2DOJA 5ITOA 3U92A 4F19A 3V8XB 1H45A 4JB7A 3G3FA 4EF2A 5FHOA 1ZIUA 2XX9A 2G29A 4U1ZA 3HO7A 2O6AA 3FGSA 5HM4B 4PETA 1GVCA 3UK4A 4YKKA 3RGYA 4Q8RA 3VV5A 2E0SA 2G93A 4ELPA 3R7XA 3VE1B 4EQBA 1II5A 1ZU0A 1B40A 5DVFA 1LCFA 1MM6A 3TTNA 3RT8A 4I62A 4P0GA 4YKJA 3K00A 2DVZA 4XKRA 3M3LA 2GHBA 1FTLA 4NF8B 2QS3A 2V3QA 3N5LA 1EZPA 1UIVA 1SVXB 3DP6A 3KOSA 1SW2A 3QSLA 4G8HA 1Y3PA 1IEJA 3S4UA 2I6EA 2V25A 4KYEA 3K4UA 4R6HA 2XD3A 2ZNUA 4Q30B 1SDXA 4WKMA 2UVGA 2Y7WA 5I58B 2OWSA 3BKIB 3TEPA 1LSTA 2PVUA 3RN8A 2DVCA 4BDLA 5CMCA 2OJTA 3GBBA 3H03A 4MF3A 2F35A 2RCBA 3LSFB 3AXFA 5L9MA 4ONYA 3B6QA 3D4CA 1LBCA 5I2KA 1Z7ME 2Z8FA 5DEXB 3FV1A 1D9YA 1Y4TA 5TPAB 1IITA 3HN0A 3F11A 1QUKA 4ZEIA 3CRBA 4Q0CA 4OETA 2PT1A 3FASA 3KN7A 4DIGA 2M8CA 4Z7EA 3GXAA 3RQTA 5AA4A 1LGBC 2BJJX 3A09A 1URGA 4NEDA 3O6IA 4EUOA 2B3BA 1POY1 3HHGA 1B5IA 1SYIA 5F7VA 3HSTA 4BLAA 3Q28A 1MXVA 2RCAA 1B46A 3FUZA 1FTOA 4H8JA 1H3DA 5JEIA 5DVJA 1GV8A 2NWJA 4GOTA 4GF8A 4C0RA 4OFOA 3U1OA 3PD8A 1UIUA 2HAUA 5CBRA 2LAOA 4UA8A 3KJ7A 3TZAA 5ISUA 1USYH 4IO2A 2O7IA 5H8HB 3C9HA 2HQ0A 4NE4A 4EQ9A 2OZZA 3HPIA 4ZEBA 4DDDA 4G77A 4JWXA 4ECFA 3ZKLA 3VLWA 4OMBA 4QF9A 3IX1A 2PX1A 3IO6A 2ABHA 2VP1A 4ESXA 3WAFA 4NF5A 1MPDA 1AL3A 1B9JA 1D9VA 2V3UA 3UIFA 4G8NA 1A8EA 4R73A 2CMOA 3ILTB 2O7UA 1HSEA 1Y4CA 4EDPA 3N6UA 3TQWA 3SESA 4KYSA 1H43A 4F3PA 1PEBA 5J1DA 2GFEA 2DWAA 4ZEDA 3T9VA 3O6GA 4JWYA 1O63A 1B1XA 4BDNA 3O29A 3TTRA 3MC2A 4G68C 4RK9A 4KPTA 1ZMGA 1QJMA 4ZE8A 2R9JA 3K02A 3RY3A 4OZ9A 4KCDA 4YB7A 4HCWA 3O97A 3JV9A 3H3GA 5M2VA 3K6VA 1CE2A 3C35A 3EF7A 2HEUA 2F7CA 3OO6A 4LZ7A 3TELA 1IUDA 1B32A 2ZNTA 4H65A 2XXQA 3O2AA 3OXNA 3KJTA 3Q29A 2XXHA 4L17A 3C36A 4FECA 2F34A 4OYVA 4IY5A 1LAFE 4RJZA 4TLMB 3SDFA 4QFOA 2QL3A 5HBCA 1IXIA 1ZLQA 4U21A 3U8QA 4XTCQ 1SW5A 3DM0A 2ANJA 5K2XA 3CSBA 2YPNA 5FTHA 1LBBA 1LLSA 3G3JA 2AYSA 3OSQA 3IOTA 1FW0A 2I4CA 4IO7A 2A5SA 4KYDA 4OFLA 5EHMA 5IKBA 5EHSA 4OWDA 4XKQA 3TAJA 2QRYA 4XXUA 1TFAA 3PD9A 3RT6B 2Q88A 1EZ9A 4JWOA 2HFBA 3FJGA 2DP8A 1DSNA 2HAVA 2DQVA 2DSFA 4YMBA 1NNFA 2D5WA 3C34A 4FIMA 1MQHA 1QKBA 1MY3A 4JBZA 3EHTA 3FJMA 1F9BA 3VFJA 1TT1A 1MQGA 2W7YA 5AA4B 3RNNA 1KWHA 1BP5A 1SW1A 4U1OA 1I69A 1LB8A 1N0TA 3GZGA 2GHAA 3IB2A 2RKMA 1MY4A 3K2DA 4U23A 4ZEKA 3V89B 1D3KA 2Q9TA 5CBSA 4PFWA 3M3FA 1UTHA 1R1NA 2DXYA 3GLBA 2F97A 4PQJA 1FQFA 2DS9A 2NUVA 3HV1A 4U4XA 4HTGA 3FIRA 4OESA 3UA8A 3PUZE 5H8HA 4EXLA 1US4A 5F1QA 1UTBA 1OLAA 3S9MC 4WEDA 2XXWA 3Q26A 3G3HA 4AB5A 1MRPA 1P1WA 4F2OA 2ZYNA 5AE4A 5B7DA 1H44A 4F31B 4PFYA 3TODA 3WAEA 1MXZA 3N26A 4N6PA 1PC3A 4MBPA 1N84A 1JVYA 3TCHA 2F36A 4H5FA 3KOTA 1L5TA 4NF5B 1MPCA 4NF6A 2XXVA 5I57B 2DWIA 4QFKA 2ALUA 4G8MA 4QSCA 4DCXA 2XXUA 4QFPA 1XS5A 5TP9A 4IO3A 4PP0A 2P1SA 2Z8EA 3PMVA 1PB9A 5AA3A 1MQIA 1DOTA 1P1UA 3P7IA 4YU0A 3CFXA 3DP4A 4KD5A 1EU8A 3VVFA 4NF4A 3LSLA 1FQAA 5ICTA 3MVWA 3TTKA 3PUWE 4E0WA 4ELRA 1MH4A 3VVDA 3LUYA 4R9GA 1MY1A 3C31A 4IO4A 1IXHA 1QUIA 3FVGA 2H99A 1LAXA 1NL5A 3I5OA 3RLFE 5EYFA 1NNPA 3CIJA 4ELQA 3OENA 3PUYE 1B7UA 1M5BA 1M5DA 3RTFB 2XXYA 3MVXA 3OMBA 5KZTA 5I59B 1FCKA 3PMXA 4F1UA 3UP9A 2A5TA 3MP1A 5DYHA 2Z8DA 4YB6A 3T9HB 1P99A 5A5XA 2UVHA 3G3GA 4G68A 1LAHE 1EZOA 4LP2B 3HHFA 4F3GA 2QS2A 3CG1A 3V83A 1OVTA 4KFQA 3VXBA 4KI0E 3QYTA 3VXCA 3PU5A 2D3IA 4YMAA 3THIA 5KCJB 2H4IA 2R71A 3VLUA 4BDOA 2P0SA 3RUMA 3IOVA 5BWJA 4Z0IA 1JETA 2I3VA 2I49A 1SQYA 1MS7A 1ZKBA 3BFUA 2Q2AA 4IB2A 3IL1B 4FJPA 1P1OA 3KEIA 1QVSA 4JSDA 3QUJA 2F78A 5AA1A 4EXKA 1DTZA 1JW4A 3T9XB 4TLLB 4F18A 2F7AA 1A55A 4QFLA 4P0IA 1JW1A 2I48A 3U93A 4ZECA 3R26A 4QSEA 1MM7A 3C33A 1UTHB 4U2RA 3USDA 3U72A 2IEEA 2HZKA 4LZ8A 5BUUA 3EPEA 1TWYA 1R9QA 2WKYA 1MXUA 2Y7KA 4FEDA 3S9EA 1HSLA 4C1TA 4EQ7A 3CR9A 3V5AA 1A8FA 4YKIA 3ZKKA 5HPQA 5JTYB 4YKPA 4LVQA 5CMMA 1UTBB 4GLIA 1S50A 4LATA 1CB6A 5ITPA 2THIA 3TMGA 3FJ7A 2OWTA 4FEBA 2P2AA 2QJEA 1DPPA 1B6HA 4E0XA 4BDMA 2REGA 1WVJA 4IY6A 5CMKA 4MLVA 4LA9A 3K6XA 3W9VA 1OQHA 1B05A 5FTIA 3IJXB 1YPNA 2ZNSA 5AA2A 3KSXA 1O7TA 2Y7PA 3PPOA 5I57A 3TKDA 1PBPA 1JQFA 5ICQA 1MQJA 4NF6B 2O51A 2YJPA 3M3KA 1WODA 1N3WA 1DPEA 4GRKA 1JEUA 4FATA 4WEPA 5TP9B 3IB1A 1BKAA 3T22A 3MVZA 2ZXTA 4PFUA 2VD2A 4GVOA 4GXSB 3U94A 3PUVE 3B6TA 4DZ1A 3B6WA 4DLDA 2UVIA 4H5GA 2V93A 1A40A 4NF4B 1Z7NE 2DE2A 3PPRA 2F8DA 3S9LC 2Z22A 1XVXA 1NNTA 4F1YA 1PBQA 2VD3A 2I0CA 4UACA 3EN3A 3TTLA 1MY0A 1I6QA 5H8FA 3KBRA 1R9LA 1OQGA 4I9DA 5I59A 2GH9A 3W15C 4ZS9A 3TDJA 2R6GE 4YICA 1JW5A 3K1PA 3MJNA 4THIA 4I8CA 4M4GA 2OLBA 2VGQA 2Q8JA 1DMBA 2A5TB 3SEUA 3PPPA 1BIYA 4ZZEA 4RPOA 1MPBA 4NWCA 1LCTA 2RC8A 5A5XB 4G68B 2X7QA 3HCQA 1M5FA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B7Z A;  5DT6 A;  2H9B A;  3JZJ A;  3TQL A;  4H1X A;  3C4M A;  2X7P A;  3IOR A;  1SW4 A;  4ZDM A;  4ZEF A;  4O3A A;  1FQE A;  4ZE9 A;  1SI1 A;  5KCJ A;  4ND9 A;  1URS A;  4BDQ A;  4OEU A;  3TFL A;  2NVU B;  1WDN A;  1UQW A;  4P11 A;  4GWO A;  4OFJ A;  2DYX A;  2O84 X;  2DXR A;  4PFT A;  3OEM A;  1US5 A;  3IOU A;  1Y3N A;  4R6K A;  2QMX A;  3UN6 A;  4DXU A;  4H6D A;  5L9S A;  1MDQ A;  3IJO B;  4XIG Q;  3W9W A;  1FTK A;  3OO8 A;  1Q35 A;  3TCG A;  3FXR A;  3E9X A;  3PPQ A;  4OTE A;  3LBS A;  2I4B A;  3TUS A;  1QW0 A;  5FHN A;  2DWH A;  3MWB A;  3SET A;  3LC8 A;  2ZMB A;  3KN8 A;  4XKP A;  4QHQ A;  3FZV A;  5JTY A;  4DXB A;  3QIM A;  1GTK A;  1N76 A;  4OVJ A;  3K01 A;  3L6H A;  5H8S A;  3TCF A;  2QS1 A;  1QKA A;  3MP6 A;  2OK2 A;  3N94 A;  4HS7 A;  3T66 A;  1URD A;  3MVY A;  1GR2 A;  3T93 B;  1VR5 A;  1B5J A;  1B3E A;  2AIX A;  2PMS A;  3OSR A;  3ODB A;  4H0W A;  5ELV A;  3VDF A;  3QXM A;  5AA2 B;  2D21 A;  1Y9U A;  2B3F A;  3OEK A;  4OQO A;  1XVY A;  3MZ9 A;  2O69 A;  3O28 A;  4YB5 A;  4ELO A;  3D4G A;  2H25 A;  1A54 A;  1QUL A;  1MG1 A;  4LUB A;  4LZ5 A;  3OOA A;  2XXP A;  3FV2 A;  3S2V A;  1MXX A;  1NH7 A;  2FA7 A;  5TU0 A;  3MPK A;  1Y3Q A;  3OO7 A;  3A3U A;  4R75 A;  3S9N C;  4U4S A;  4F29 A;  1ANF A;  4N13 A;  2O68 A;  5H8N A;  2I58 A;  4LQ5 A;  4X48 A;  1OLC A;  3EQ1 A;  4R9F A;  3ILU B;  3ZSF A;  5L8D A;  4GL0 A;  1I6B A;  4FE8 A;  3ONM A;  3G7W A;  2HZL A;  3LR1 A;  2ONS A;  1LFG A;  3B7D A;  4NTL A;  1GGG A;  4RA1 A;  3KFM A;  1IXC A;  4OER A;  5L9O A;  4M1V A;  4DCY A;  3TTM A;  4GFR A;  2I0B A;  2RC7 A;  4QFN A;  5H8F B;  2O1L A;  1B7H A;  1MXY A;  2ONK E;  3SEX A;  2YLN A;  4O3C A;  3G3I A;  5CRY A;  3FXU A;  1EH3 A;  3CVG A;  1AOV A;  1QUJ A;  4OHN A;  2PT2 A;  3KZG A;  1A7L A;  5CI5 A;  3PMW A;  3KGC A;  4Q5T A;  3CFZ A;  3KN3 A;  5IAI A;  2KLF A;  4GXA A;  1B5H A;  3IK6 B;  3SEW A;  3O66 A;  2RF1 A;  1B4Z A;  4O3B A;  4YZZ A;  5CC2 A;  3K0V A;  3H6T A;  1HSJ A;  3IO4 A;  3H4Z A;  4EF1 A;  4RPN A;  4U22 A;  4JXI A;  1B4H A;  3PUX E;  2Z23 A;  4F3S A;  1NMU A;  4R72 A;  1YAE A;  1M5E A;  4KR5 A;  4NMY A;  4IGT A;  2V3T A;  3CG3 A;  3QK6 A;  2Y84 A;  3MZB A;  3FVO A;  1B3F A;  4RXL A;  1NNK A;  3H7M A;  3H6V A;  4LON B;  3O6H A;  1D4N A;  4RY1 A;  1POT A;  3MQ9 A;  2HCA A;  1USY E;  3M8U A;  2XXT A;  1B51 A;  4AQ4 A;  4OEN A;  1DTG A;  4F22 A;  3PGF A;  2XXX A;  5I56 A;  3DEL B;  1ZJL A;  3SKP A;  1IQ7 A;  3O9P A;  1B2H A;  2UVJ A;  1MXW A;  1YTV A;  1SBP A;  3MBP A;  4KHZ E;  3K1M A;  2Q89 A;  3FXQ A;  2H5Y A;  4TOZ A;  2QMW A;  1SD3 A;  1B58 A;  3Q27 A;  4ISU A;  2F7B A;  2CZL A;  4BDR A;  3ECR A;  2UXA A;  2F6P A;  1AMF A;  1XC1 A;  1JNF A;  5I84 A;  4H67 A;  3TYH A;  3GBA A;  1IZ1 A;  1XHY A;  3EHS A;  4F2Q A;  1VE4 A;  2AL5 A;  1I6A A;  1B0H A;  4LQ2 A;  4FAJ A;  2RC9 A;  3MPL A;  1N3X A;  1N7X A;  2DE3 A;  4POW A;  2ESN A;  3VVE A;  2RIN A;  4F39 A;  4HCY A;  2XXI A;  2I3W A;  3TPA A;  3FD3 A;  3FVK A;  4MH5 A;  1B3G A;  1M5C A;  1BLF A;  2PYY A;  2E1S A;  1JVX A;  5DVI A;  4XKN A;  3SER A;  2FNC A;  2NXO A;  3UGW A;  4GIZ A;  5AA2 D;  1OVB A;  1VFD A;  1PDA A;  3JYR A;  1J1N A;  1MQD A;  5H8Q A;  5B70 A;  3CFL A;  1RKM A;  3UOR A;  4IGR A;  3ZS6 A;  2IA4 A;  5I2N A;  4WXJ A;  3FVN A;  2XXR A;  1FTJ A;  2QS4 A;  3FAT A;  2DE4 A;  5KDT B;  3E4R A;  4JSO A;  1B3L A;  2FYI A;  3H06 B;  3LSW A;  2REJ A;  1O64 A;  3K1N A;  1B3H A;  1NKX A;  2VHA A;  1NH8 A;  1RYX A;  3DP8 A;  2ZYK A;  4DE8 A;  5H8N B;  4YAH X;  2HXW A;  1AH5 A;  1Y20 A;  1LB9 A;  1PB8 A;  2DWJ A;  1VFE A;  4GD5 A;  2XHD A;  5DTB A;  1N04 A;  2OCU A;  4RYA A;  1B52 A;  4FOR A;  2V84 A;  4MLQ A;  2Y7I A;  1T0K A;  2QPQ A;  3CSG A;  4PE5 B;  4IO6 A;  3E3K A;  2ZYO A;  3L6G A;  1FQD A;  3LSX A;  4I1D A;  4NF8 A;  2GRV A;  4X9T A;  4GQO A;  1OMP A;  4F3B A;  1LAG E;  2ZYM A;  2PBW A;  1OIB A;  3OD7 A;  4N07 A;  3G3K A;  4MFI A;  1IIW A;  2XD2 A;  1Q1K A;  1B1H A;  2VOZ A;  3PV0 E;  3T9U A;  1PB7 A;  4G2Z A;  4OEV A;  4QSD A;  3SEV A;  1R6Z A;  4K3F A;  5K2Y A;  1Y1M A;  4C1U A;  3MAM A;  1ZTY A;  3RPW A;  4RK2 A;  3RTW B;  4H8I A;  5I58 A;  1S9T A;  4X1D A;  1NFT A;  3OO9 A;  4IO5 A;  3BFT A;  1A99 A;  2ONR A;  3K6U A;  4OXV A;  4DXC A;  4HW8 A;  3IAZ A;  1IXG A;  4R74 A;  3SEY A;  3IOW A;  1XT8 A;  3QAX A;  4RNS A;  4ESW A;  1FQC A;  5DEX A;  5I2K B;  2Y7R A;  5TPA A;  3IB0 A;  4G4P A;  4TQU Q;  3MP8 A;  1TXF A;  3MUQ A;  4R2F A;  3K6W A;  1MH3 A;  5I56 B;  3I3V A;  3KG2 A;  1SI0 A;  3A3C A;  3C32 A;  3H6W A;  4NWD A;  1MY2 A;  3N6T A;  2NOO A;  4X1B A;  1AIV A;  3PPN A;  3E13 X;  2F5X A;  2AL4 A;  5FHM A;  2UYF A;  2H98 A;  4KCC A;  2UYE A;  4GL8 A;  2F6G A;  4R2B A;  1P1Q A;  3EHU A;  2OBG A;  2Q2C A;  1FQB A;  5LOM A;  4JDF A;  4R6Y A;  2X26 A;  1VSO A;  3VLV A;  3DLN A;  1ZBM A;  3MZ1 A;  5CM6 A;  1FTM A;  1P1N A;  3H6U A;  1ELJ A;  3I6V A;  5JK4 A;  1N7W A;  4POX A;  1ATG A;  5CMB A;  1TFD A;  2XX7 A;  3BBR A;  1BTJ A;  4F1V A;  1MDP 1;  4ZZA A;  1SYH A;  3QUF A;  3T96 B;  1JEV A;  2QSX A;  3IR1 A;  2O1M A;  2B65 A;  1XOC A;  4QRZ A;  1LFH A;  3Q25 A;  3KSJ A;  1B0L A;  2XX8 A;  5H8Q B;  3CI8 A;  1RYO A;  1Y1Z A;  4AB6 A;  3R6U A;  3OEL A;  4KQP A;  1S7Y A;  1H76 A;  3MW0 A;  5I2N B;  5KDT A;  1YCJ A;  1LFI A;  2DOJ A;  5ITO A;  3U92 A;  4F19 A;  3V8X B;  1H45 A;  4JB7 A;  3G3F A;  4EF2 A;  5FHO A;  1ZIU A;  2XX9 A;  2G29 A;  4U1Z A;  3HO7 A;  2O6A A;  3FGS A;  5HM4 B;  4PET A;  1GVC A;  3UK4 A;  4YKK A;  3RGY A;  4Q8R A;  3VV5 A;  2E0S A;  2G93 A;  4ELP A;  3R7X A;  3VE1 B;  4EQB A;  1II5 A;  1ZU0 A;  1B40 A;  5DVF A;  1LCF A;  1MM6 A;  3TTN A;  3RT8 A;  4I62 A;  4P0G A;  4YKJ A;  3K00 A;  2DVZ A;  4XKR A;  3M3L A;  2GHB A;  1FTL A;  4NF8 B;  2QS3 A;  2V3Q A;  3N5L A;  1EZP A;  1UIV A;  1SVX B;  3DP6 A;  3KOS A;  1SW2 A;  3QSL A;  4G8H A;  1Y3P A;  1IEJ A;  3S4U A;  2I6E A;  2V25 A;  4KYE A;  3K4U A;  4R6H A;  2XD3 A;  2ZNU A;  4Q30 B;  1SDX A;  4WKM A;  2UVG A;  2Y7W A;  5I58 B;  2OWS A;  3BKI B;  3TEP A;  1LST A;  2PVU A;  3RN8 A;  2DVC A;  4BDL A;  5CMC A;  2OJT A;  3GBB A;  3H03 A;  4MF3 A;  2F35 A;  2RCB A;  3LSF B;  3AXF A;  5L9M A;  4ONY A;  3B6Q A;  3D4C A;  1LBC A;  5I2K A;  1Z7M E;  2Z8F A;  5DEX B;  3FV1 A;  1D9Y A;  1Y4T A;  5TPA B;  1IIT A;  3HN0 A;  3F11 A;  1QUK A;  4ZEI A;  3CRB A;  4Q0C A;  4OET A;  2PT1 A;  3FAS A;  3KN7 A;  4DIG A;  2M8C A;  4Z7E A;  3GXA A;  3RQT A;  5AA4 A;  1LGB C;  2BJJ X;  3A09 A;  1URG A;  4NED A;  3O6I A;  4EUO A;  2B3B A;  1POY 1;  3HHG A;  1B5I A;  1SYI A;  5F7V A;  3HST A;  4BLA A;  3Q28 A;  1MXV A;  2RCA A;  1B46 A;  3FUZ A;  1FTO A;  4H8J A;  1H3D A;  5JEI A;  5DVJ A;  1GV8 A;  2NWJ A;  4GOT A;  4GF8 A;  4C0R A;  4OFO A;  3U1O A;  3PD8 A;  1UIU A;  2HAU A;  5CBR A;  2LAO A;  4UA8 A;  3KJ7 A;  3TZA A;  5ISU A;  1USY H;  4IO2 A;  2O7I A;  5H8H B;  3C9H A;  2HQ0 A;  4NE4 A;  4EQ9 A;  2OZZ A;  3HPI A;  4ZEB A;  4DDD A;  4G77 A;  4JWX A;  4ECF A;  3ZKL A;  3VLW A;  4OMB A;  4QF9 A;  3IX1 A;  2PX1 A;  3IO6 A;  2ABH A;  2VP1 A;  4ESX A;  3WAF A;  4NF5 A;  1MPD A;  1AL3 A;  1B9J A;  1D9V A;  2V3U A;  3UIF A;  4G8N A;  1A8E A;  4R73 A;  2CMO A;  3ILT B;  2O7U A;  1HSE A;  1Y4C A;  4EDP A;  3N6U A;  3TQW A;  3SES A;  4KYS A;  1H43 A;  4F3P A;  1PEB A;  5J1D A;  2GFE A;  2DWA A;  4ZED A;  3T9V A;  3O6G A;  4JWY A;  1O63 A;  1B1X A;  4BDN A;  3O29 A;  3TTR A;  3MC2 A;  4G68 C;  4RK9 A;  4KPT A;  1ZMG A;  1QJM A;  4ZE8 A;  2R9J A;  3K02 A;  3RY3 A;  4OZ9 A;  4KCD A;  4YB7 A;  4HCW A;  3O97 A;  3JV9 A;  3H3G A;  5M2V A;  3K6V A;  1CE2 A;  3C35 A;  3EF7 A;  2HEU A;  2F7C A;  3OO6 A;  4LZ7 A;  3TEL A;  1IUD A;  1B32 A;  2ZNT A;  4H65 A;  2XXQ A;  3O2A A;  3OXN A;  3KJT A;  3Q29 A;  2XXH A;  4L17 A;  3C36 A;  4FEC A;  2F34 A;  4OYV A;  4IY5 A;  1LAF E;  4RJZ A;  4TLM B;  3SDF A;  4QFO A;  2QL3 A;  5HBC A;  1IXI A;  1ZLQ A;  4U21 A;  3U8Q A;  4XTC Q;  1SW5 A;  3DM0 A;  2ANJ A;  5K2X A;  3CSB A;  2YPN A;  5FTH A;  1LBB A;  1LLS A;  3G3J A;  2AYS A;  3OSQ A;  3IOT A;  1FW0 A;  2I4C A;  4IO7 A;  2A5S A;  4KYD A;  4OFL A;  5EHM A;  5IKB A;  5EHS A;  4OWD A;  4XKQ A;  3TAJ A;  2QRY A;  4XXU A;  1TFA A;  3PD9 A;  3RT6 B;  2Q88 A;  1EZ9 A;  4JWO A;  2HFB A;  3FJG A;  2DP8 A;  1DSN A;  2HAV A;  2DQV A;  2DSF A;  4YMB A;  1NNF A;  2D5W A;  3C34 A;  4FIM A;  1MQH A;  1QKB A;  1MY3 A;  4JBZ A;  3EHT A;  3FJM A;  1F9B A;  3VFJ A;  1TT1 A;  1MQG A;  2W7Y A;  5AA4 B;  3RNN A;  1KWH A;  1BP5 A;  1SW1 A;  4U1O A;  1I69 A;  1LB8 A;  1N0T A;  3GZG A;  2GHA A;  3IB2 A;  2RKM A;  1MY4 A;  3K2D A;  4U23 A;  4ZEK A;  3V89 B;  1D3K A;  2Q9T A;  5CBS A;  4PFW A;  3M3F A;  1UTH A;  1R1N A;  2DXY A;  3GLB A;  2F97 A;  4PQJ A;  1FQF A;  2DS9 A;  2NUV A;  3HV1 A;  4U4X A;  4HTG A;  3FIR A;  4OES A;  3UA8 A;  3PUZ E;  5H8H A;  4EXL A;  1US4 A;  5F1Q A;  1UTB A;  1OLA A;  3S9M C;  4WED A;  2XXW A;  3Q26 A;  3G3H A;  4AB5 A;  1MRP A;  1P1W A;  4F2O A;  2ZYN A;  5AE4 A;  5B7D A;  1H44 A;  4F31 B;  4PFY A;  3TOD A;  3WAE A;  1MXZ A;  3N26 A;  4N6P A;  1PC3 A;  4MBP A;  1N84 A;  1JVY A;  3TCH A;  2F36 A;  4H5F A;  3KOT A;  1L5T A;  4NF5 B;  1MPC A;  4NF6 A;  2XXV A;  5I57 B;  2DWI A;  4QFK A;  2ALU A;  4G8M A;  4QSC A;  4DCX A;  2XXU A;  4QFP A;  1XS5 A;  5TP9 A;  4IO3 A;  4PP0 A;  2P1S A;  2Z8E A;  3PMV A;  1PB9 A;  5AA3 A;  1MQI A;  1DOT A;  1P1U A;  3P7I A;  4YU0 A;  3CFX A;  3DP4 A;  4KD5 A;  1EU8 A;  3VVF A;  4NF4 A;  3LSL A;  1FQA A;  5ICT A;  3MVW A;  3TTK A;  3PUW E;  4E0W A;  4ELR A;  1MH4 A;  3VVD A;  3LUY A;  4R9G A;  1MY1 A;  3C31 A;  4IO4 A;  1IXH A;  1QUI A;  3FVG A;  2H99 A;  1LAX A;  1NL5 A;  3I5O A;  3RLF E;  5EYF A;  1NNP A;  3CIJ A;  4ELQ A;  3OEN A;  3PUY E;  1B7U A;  1M5B A;  1M5D A;  3RTF B;  2XXY A;  3MVX A;  3OMB A;  5KZT A;  5I59 B;  1FCK A;  3PMX A;  4F1U A;  3UP9 A;  2A5T A;  3MP1 A;  5DYH A;  2Z8D A;  4YB6 A;  3T9H B;  1P99 A;  5A5X A;  2UVH A;  3G3G A;  4G68 A;  1LAH E;  1EZO A;  4LP2 B;  3HHF A;  4F3G A;  2QS2 A;  3CG1 A;  3V83 A;  1OVT A;  4KFQ A;  3VXB A;  4KI0 E;  3QYT A;  3VXC A;  3PU5 A;  2D3I A;  4YMA A;  3THI A;  5KCJ B;  2H4I A;  2R71 A;  3VLU A;  4BDO A;  2P0S A;  3RUM A;  3IOV A;  5BWJ A;  4Z0I A;  1JET A;  2I3V A;  2I49 A;  1SQY A;  1MS7 A;  1ZKB A;  3BFU A;  2Q2A A;  4IB2 A;  3IL1 B;  4FJP A;  1P1O A;  3KEI A;  1QVS A;  4JSD A;  3QUJ A;  2F78 A;  5AA1 A;  4EXK A;  1DTZ A;  1JW4 A;  3T9X B;  4TLL B;  4F18 A;  2F7A A;  1A55 A;  4QFL A;  4P0I A;  1JW1 A;  2I48 A;  3U93 A;  4ZEC A;  3R26 A;  4QSE A;  1MM7 A;  3C33 A;  1UTH B;  4U2R A;  3USD A;  3U72 A;  2IEE A;  2HZK A;  4LZ8 A;  5BUU A;  3EPE A;  1TWY A;  1R9Q A;  2WKY A;  1MXU A;  2Y7K A;  4FED A;  3S9E A;  1HSL A;  4C1T A;  4EQ7 A;  3CR9 A;  3V5A A;  1A8F A;  4YKI A;  3ZKK A;  5HPQ A;  5JTY B;  4YKP A;  4LVQ A;  5CMM A;  1UTB B;  4GLI A;  1S50 A;  4LAT A;  1CB6 A;  5ITP A;  2THI A;  3TMG A;  3FJ7 A;  2OWT A;  4FEB A;  2P2A A;  2QJE A;  1DPP A;  1B6H A;  4E0X A;  4BDM A;  2REG A;  1WVJ A;  4IY6 A;  5CMK A;  4MLV A;  4LA9 A;  3K6X A;  3W9V A;  1OQH A;  1B05 A;  5FTI A;  3IJX B;  1YPN A;  2ZNS A;  5AA2 A;  3KSX A;  1O7T A;  2Y7P A;  3PPO A;  5I57 A;  3TKD A;  1PBP A;  1JQF A;  5ICQ A;  1MQJ A;  4NF6 B;  2O51 A;  2YJP A;  3M3K A;  1WOD A;  1N3W A;  1DPE A;  4GRK A;  1JEU A;  4FAT A;  4WEP A;  5TP9 B;  3IB1 A;  1BKA A;  3T22 A;  3MVZ A;  2ZXT A;  4PFU A;  2VD2 A;  4GVO A;  4GXS B;  3U94 A;  3PUV E;  3B6T A;  4DZ1 A;  3B6W A;  4DLD A;  2UVI A;  4H5G A;  2V93 A;  1A40 A;  4NF4 B;  1Z7N E;  2DE2 A;  3PPR A;  2F8D A;  3S9L C;  2Z22 A;  1XVX A;  1NNT A;  4F1Y A;  1PBQ A;  2VD3 A;  2I0C A;  4UAC A;  3EN3 A;  3TTL A;  1MY0 A;  1I6Q A;  5H8F A;  3KBR A;  1R9L A;  1OQG A;  4I9D A;  5I59 A;  2GH9 A;  3W15 C;  4ZS9 A;  3TDJ A;  2R6G E;  4YIC A;  1JW5 A;  3K1P A;  3MJN A;  4THI A;  4I8C A;  4M4G A;  2OLB A;  2VGQ A;  2Q8J A;  1DMB A;  2A5T B;  3SEU A;  3PPP A;  1BIY A;  4ZZE A;  4RPO A;  1MPB A;  4NWC A;  1LCT A;  2RC8 A;  5A5X B;  4G68 B;  2X7Q A;  3HCQ A;  1M5F A; 
#chains in the Genus database with same CATH topology
 1B7Z A;  5DT6 A;  2H9B A;  3JZJ A;  3TQL A;  4H1X A;  3C4M A;  2X7P A;  3IOR A;  1SW4 A;  4ZDM A;  4ZEF A;  4O3A A;  1FQE A;  4ZE9 A;  1SI1 A;  5KCJ A;  4ND9 A;  1URS A;  4I40 A;  4BDQ A;  4OEU A;  1LBZ A;  3TFL A;  2NVU B;  1WDN A;  1UQW A;  4P11 A;  4GWO A;  4OFJ A;  2DYX A;  2CZH A;  2O84 X;  2DXR A;  4PFT A;  3OEM A;  1US5 A;  3IOU A;  5F24 A;  1Y3N A;  4R6K A;  2QMX A;  3UN6 A;  4PBH A;  4DXU A;  4H6D A;  4I3Y A;  5L9S A;  5LDZ A;  1MDQ A;  3IJO B;  4XIG Q;  5IZ3 B;  3W9W A;  1FTK A;  1NV5 A;  3OO8 A;  1Q35 A;  3TCG A;  3FXR A;  1IMA A;  3E9X A;  2FIX A;  5IZ1 A;  3PPQ A;  4OTE A;  3LBS A;  4MAG A;  4NAP A;  2I4B A;  3TUS A;  1QW0 A;  4KXP A;  1NUX A;  5FHN A;  2DWH A;  3MWB A;  3SET A;  3LC8 A;  1KA1 A;  2ZMB A;  4PFR A;  3KN8 A;  4XKP A;  4QHQ A;  2BJI A;  3FZV A;  5JTY A;  1YZ0 A;  4DXB A;  3QIM A;  1GTK A;  1N76 A;  4OVJ A;  3K01 A;  3L6H A;  5IZZ A;  4P3L A;  5H8S A;  4IR8 A;  5ET7 A;  3TCF A;  2QS1 A;  1QKA A;  3MP6 A;  2OK2 A;  3N94 A;  4HS7 A;  3T66 A;  1CNQ A;  3IFC A;  1URD A;  3MVY A;  1GR2 A;  3T93 B;  4GBV A;  4OVT A;  4O7I A;  1VR5 A;  5DW8 A;  2PCR A;  1B5J A;  1B3E A;  2AIX A;  2PMS A;  3OSR A;  3ODB A;  4H0W A;  5ELV A;  3VDF A;  2CEX A;  3QXM A;  5AA2 B;  4PF6 A;  2D21 A;  1Y9U A;  2B3F A;  3OEK A;  4OQO A;  1XVY A;  3MZ9 A;  2WYK A;  2O69 A;  4GWY A;  3O28 A;  4YB5 A;  4ELO A;  3D4G A;  2H25 A;  1A54 A;  1QUL A;  3FXB A;  4P47 A;  4MNI A;  1MG1 A;  4LUB A;  4LZ5 A;  3OOA A;  2XXP A;  3FV2 A;  3S2V A;  1JP4 A;  1MXX A;  1NH7 A;  4N6K A;  1FBH A;  2FA7 A;  5TU0 A;  3MPK A;  1Y3Q A;  3OO7 A;  3A3U A;  4R75 A;  3S9N C;  3QMF A;  4U4S A;  4F29 A;  1FTA A;  1ANF A;  4N13 A;  2O68 A;  5H8N A;  2MKZ A;  4N6D A;  2I58 A;  4LQ5 A;  4X48 A;  4PC9 A;  4FBP A;  1OLC A;  3EQ1 A;  4R9F A;  3ILU B;  3ZSF A;  4P1E A;  5L8D A;  4GL0 A;  1I6B A;  4FE8 A;  3ONM A;  3G7W A;  2FHY A;  2HZL A;  3LR1 A;  2ONS A;  1LFG A;  3B7D A;  4NTL A;  1GGG A;  4RA1 A;  3KC1 A;  3KFM A;  1IXC A;  3A29 A;  4OER A;  5L9O A;  4M1V A;  4DCY A;  3TTM A;  4GFR A;  2I0B A;  2RC7 A;  4QFN A;  5H8F B;  2O1L A;  1B7H A;  1MXY A;  2ONK E;  3SEX A;  2YLN A;  4O3C A;  3G3I A;  5CRY A;  4I3E A;  3FXU A;  1EH3 A;  3CVG A;  1AOV A;  1QUJ A;  4OHN A;  2CZI A;  2PT2 A;  3KZG A;  1A7L A;  5CI5 A;  3PMW A;  3KGC A;  4Q5T A;  3CFZ A;  3KN3 A;  5IAI A;  2KLF A;  4GXA A;  1B5H A;  3IK6 B;  3SEW A;  3O66 A;  2RF1 A;  1B4Z A;  4GBW A;  4O3B A;  4YZZ A;  5CC2 A;  4OA4 A;  3K0V A;  3H6T A;  1HSJ A;  3IO4 A;  4PDH A;  3H4Z A;  4PGN A;  4GWS A;  4EF1 A;  2R8T A;  4RPN A;  4U22 A;  4JXI A;  2VT5 A;  1B4H A;  3PUX E;  4GX6 A;  2Z23 A;  4F3S A;  1NMU A;  4R72 A;  1YAE A;  1M5E A;  4N81 A;  4KR5 A;  4NMY A;  4IGT A;  2V3T A;  3CG3 A;  3QK6 A;  2Y84 A;  3MZB A;  1INP A;  3FVO A;  1B3F A;  2V4C A;  4RXL A;  1NNK A;  3H7M A;  3H6V A;  4LON B;  3O6H A;  1D4N A;  4RY1 A;  1POT A;  3MQ9 A;  2VPO A;  4JVC A;  2HCA A;  1USY E;  3M8U A;  2XXT A;  4N17 A;  1B51 A;  4AQ4 A;  4OEN A;  1DTG A;  4F22 A;  3PGF A;  2XXX A;  5I56 A;  3DEL B;  1ZJL A;  3SKP A;  1IQ7 A;  3O9P A;  1LBV A;  1B2H A;  2UVJ A;  1MXW A;  1YTV A;  5EYG A;  1SBP A;  5ESY A;  3MBP A;  4KHZ E;  3K1M A;  2Q89 A;  3FXQ A;  2H5Y A;  4TOZ A;  1FJ9 A;  2Y5L A;  2QMW A;  2WX9 A;  1SD3 A;  1B58 A;  1KZ8 A;  3Q27 A;  3BIH A;  4ISU A;  2F7B A;  2CZL A;  4BDR A;  3ECR A;  2UXA A;  2F6P A;  1AMF A;  3E78 A;  1NI9 A;  1XC1 A;  1JNF A;  1FRP A;  5I84 A;  4H67 A;  3TYH A;  3GBA A;  1IZ1 A;  1XHY A;  3EHS A;  4F2Q A;  1VE4 A;  2AL5 A;  1I6A A;  1B0H A;  4DI3 D;  4LQ2 A;  4FAJ A;  2RC9 A;  3MPL A;  1N3X A;  4MEV A;  1N7X A;  2DE3 A;  2QFL A;  4POW A;  2ESN A;  3VVE A;  2RIN A;  4F39 A;  4HCY A;  2XXI A;  2I3W A;  3TPA A;  3FD3 A;  3FVK A;  4MH5 A;  1B3G A;  1M5C A;  1BLF A;  2PYY A;  2E1S A;  1JVX A;  2HPG A;  5DVI A;  3BIG A;  4XKN A;  5IM2 A;  1FBG A;  3SER A;  2FNC A;  2NXO A;  3UGW A;  4GIZ A;  5AA2 D;  1OVB A;  1VFD A;  1PDA A;  3JYR A;  1J1N A;  1MQD A;  5H8Q A;  5B70 A;  3CFL A;  1RKM A;  3UOR A;  4IGR A;  3ZS6 A;  2IA4 A;  2HHM A;  5I2N A;  4WXJ A;  3FVN A;  2XXR A;  3T0J A;  1K9Y A;  4OVQ A;  1FTJ A;  1NV3 A;  2QS4 A;  3FAT A;  2DE4 A;  5KDT B;  3E4R A;  4JSO A;  1B3L A;  2FYI A;  3H06 B;  3LSW A;  2REJ A;  4QXD A;  1O64 A;  2QVU A;  2Q8M A;  3K1N A;  1B3H A;  1NKX A;  4LN5 A;  2VHA A;  1NH8 A;  1RYX A;  1FPF A;  4PF8 A;  3DP8 A;  2ZYK A;  4DE8 A;  5H8N B;  4YAH X;  2HXW A;  1AH5 A;  1Y20 A;  1LB9 A;  1PB8 A;  2DWJ A;  1FPL A;  3ISP A;  1VFE A;  4GD5 A;  1NV0 A;  2XHD A;  5DTB A;  1N04 A;  2OCU A;  4RYA A;  1B52 A;  4FOR A;  2V84 A;  1IMD A;  2Q74 A;  1FPJ A;  4MLQ A;  2Y7I A;  1T0K A;  2QPQ A;  3CSG A;  4PE5 B;  2F3B A;  2XA5 A;  4IO6 A;  3E3K A;  2ZYO A;  3L6G A;  1FQD A;  3LSX A;  4I1D A;  4NF8 A;  2GRV A;  2P3N A;  4HE2 A;  4X9T A;  4GQO A;  1OMP A;  4F3B A;  1LAG E;  2ZYM A;  4QBA A;  2PBW A;  1OIB A;  3OD7 A;  4N07 A;  3G3K A;  4MFI A;  1IIW A;  2XD2 A;  1Q1K A;  1B1H A;  2VOZ A;  3PV0 E;  3T9U A;  1PB7 A;  4G2Z A;  4OEV A;  4QSD A;  3SEV A;  2F3D A;  4PE3 A;  1R6Z A;  4K3F A;  5K2Y A;  1Y1M A;  4C1U A;  4GWW A;  1EYJ A;  3MAM A;  1ZTY A;  3RPW A;  4RK2 A;  3RTW B;  4H8I A;  5I58 A;  1S9T A;  4X8R A;  1FBC A;  4X1D A;  1NFT A;  3OO9 A;  4IO5 A;  3BFT A;  1A99 A;  2ONR A;  3K6U A;  4OXV A;  4DXC A;  4HW8 A;  3IAZ A;  5EQ7 A;  1IXG A;  4R74 A;  3SEY A;  3IOW A;  1XT8 A;  3QAX A;  4RNS A;  5IGA A;  4ESW A;  4MIJ A;  1FQC A;  5DEX A;  5I2K B;  2Y7R A;  5TPA A;  3IB0 A;  4G4P A;  4TQU Q;  3MP8 A;  1TXF A;  3MUQ A;  4R2F A;  3K6W A;  2DDK A;  1MH3 A;  5I56 B;  5I5P A;  3I3V A;  3KG2 A;  1SI0 A;  3A3C A;  3C32 A;  3H6W A;  4NWD A;  1MY2 A;  3N6T A;  2NOO A;  4X1B A;  1AIV A;  3PPN A;  3E13 X;  2F5X A;  2AL4 A;  5FHM A;  2UYF A;  2H98 A;  2FBP A;  4KCC A;  2UYE A;  4GL8 A;  2F6G A;  4R2B A;  1P1Q A;  3EHU A;  2OBG A;  2Q2C A;  1FQB A;  5LOM A;  4JDF A;  4R6Y A;  2X26 A;  1VSO A;  3VLV A;  3DLN A;  4O8M A;  1ZBM A;  2XWI A;  3MZ1 A;  5CM6 A;  1FTM A;  1P1N A;  3H6U A;  1ELJ A;  3I6V A;  5JK4 A;  1N7W A;  4POX A;  1ATG A;  5CMB A;  1TFD A;  2XX7 A;  3BBR A;  1BTJ A;  4F1V A;  1MDP 1;  4ZZA A;  1SYH A;  3QUF A;  4OVR A;  3T96 B;  1JEV A;  3LUZ A;  2QSX A;  3IR1 A;  1LBW A;  2O1M A;  2B65 A;  1XOC A;  4QRZ A;  1LFH A;  1RDX A;  4DI4 B;  4JVI A;  3Q25 A;  3KSJ A;  1B0L A;  1FPI A;  2XX8 A;  4O94 A;  5H8Q B;  3CI8 A;  1RYO A;  1Y1Z A;  4AB6 A;  3R6U A;  3OEL A;  4KQP A;  1S7Y A;  1H76 A;  3MW0 A;  5I2N B;  5KDT A;  4PCD A;  1LFI A;  1YCJ A;  2DOJ A;  5ITO A;  5ET5 A;  3U92 A;  3KBZ A;  1DCU A;  4F19 A;  3V8X B;  1H45 A;  5ET8 A;  4JB7 A;  3G3F A;  4EF2 A;  5FHO A;  1ZIU A;  2XX9 A;  2Y5K A;  2G29 A;  4U1Z A;  3T1B A;  3HO7 A;  5T3J A;  2O6A A;  1VDW A;  3FGS A;  5HM4 B;  4PET A;  2CEY A;  1GVC A;  3UK4 A;  4YKK A;  1NUY A;  3RGY A;  4N8G A;  4PAI A;  4MNP A;  4Q8R A;  3VV5 A;  4G61 A;  2E0S A;  4H46 A;  3CHG A;  2G93 A;  4ELP A;  3R7X A;  3VE1 B;  2OX3 A;  4EQB A;  1II5 A;  1ZU0 A;  1B40 A;  5DVF A;  1LCF A;  1MM6 A;  4H45 A;  1Q9D A;  4NF0 A;  3TTN A;  3RT8 A;  4I62 A;  4P0G A;  4PBQ A;  4YKJ A;  3K00 A;  2DVZ A;  4XKR A;  3M3L A;  2GHB A;  1FTL A;  4GWX A;  4NF8 B;  4GX4 A;  2QS3 A;  2V3Q A;  3N5L A;  5EYH A;  1EZP A;  1UIV A;  4MHF A;  1K9Z A;  1YYZ A;  4MJO A;  1SVX B;  3DP6 A;  3KOS A;  1SW2 A;  3QSL A;  4G8H A;  4P8B A;  1Y3P A;  1IEJ A;  3S4U A;  2I6E A;  2V25 A;  4KYE A;  3K4U A;  2XWO A;  4R6H A;  2XD3 A;  1YXI A;  4PDD A;  2ZNU A;  4Q30 B;  1SDX A;  4WKM A;  2UVG A;  2Y7W A;  5I58 B;  2OWS A;  3BKI B;  3TEP A;  1LST A;  2PVU A;  3PTY A;  3RN8 A;  2DVC A;  4BDL A;  5CMC A;  2OJT A;  3GBB A;  3H03 A;  4MF3 A;  2F35 A;  2RCB A;  3LSF B;  3AXF A;  5L9M A;  4ONY A;  3B6Q A;  3D4C A;  1LBC A;  5I2K A;  1Z7M E;  2Z8F A;  5DEX B;  3FV1 A;  1D9Y A;  1Y4T A;  5TPA B;  1IIT A;  3HN0 A;  3F11 A;  1QUK A;  4ZEI A;  4JVD A;  3CRB A;  4PFB A;  4NG7 A;  5I7I A;  4Q0C A;  4OET A;  2PT1 A;  3FAS A;  3KN7 A;  4DIG A;  2M8C A;  4Z7E A;  3GXA A;  4OVS A;  3RQT A;  5AA4 A;  1LGB C;  2BJJ X;  3A09 A;  1URG A;  4NED A;  3O6I A;  4EUO A;  2B3B A;  5ET6 A;  2QVV A;  1POY 1;  2WBB A;  3HHG A;  4MCO A;  1B5I A;  1SYI A;  5F7V A;  3HST A;  4BLA A;  2B4M A;  3Q28 A;  1MXV A;  2RCA A;  1B46 A;  3FUZ A;  1FTO A;  4H8J A;  1H3D A;  5JEI A;  5DVJ A;  1GV8 A;  2NWJ A;  4GOT A;  4GF8 A;  4C0R A;  4OFO A;  3U1O A;  3PD8 A;  1UIU A;  2HAU A;  5CBR A;  2LAO A;  4UA8 A;  2ZZX A;  3KJ7 A;  4HXV A;  3TZA A;  5ISU A;  1USY H;  4IO2 A;  2O7I A;  5H8H B;  3C9H A;  2CZK A;  2HQ0 A;  4NE4 A;  4EQ9 A;  2OZZ A;  3HPI A;  4P9K A;  4ZEB A;  4HE0 A;  5EQ8 A;  4DDD A;  4G77 A;  4JWX A;  4ECF A;  3ZKL A;  3VLW A;  1LBY A;  4OMB A;  4QF9 A;  3IX1 A;  2KR0 A;  2PX1 A;  3IO6 A;  2ABH A;  4XF5 A;  2VP1 A;  4ESX A;  2XXK A;  1KA0 A;  3WAF A;  4NF5 A;  1MPD A;  1IMC A;  1AL3 A;  3KC0 A;  1B9J A;  1D9V A;  2V3U A;  3UIF A;  4G8N A;  1A8E A;  1FBF A;  4R73 A;  2CMO A;  3ILT B;  2O7U A;  1HSE A;  1Y4C A;  4EDP A;  3N6U A;  3TQW A;  3E79 A;  3SES A;  4KYS A;  1H43 A;  1FBD A;  4F3P A;  1PEB A;  5J1D A;  2GFE A;  2DWA A;  2B4L A;  4ZED A;  3T9V A;  3O6G A;  4JWY A;  1O63 A;  1B1X A;  4BDN A;  3O29 A;  3TTR A;  3MC2 A;  4G68 C;  4RK9 A;  4KPT A;  1ZMG A;  1QJM A;  4ZE8 A;  2R9J A;  3K02 A;  3RY3 A;  4OZ9 A;  4KCD A;  4YB7 A;  4N91 A;  4P1L A;  4HCW A;  3O97 A;  3JV9 A;  3H3G A;  5M2V A;  3K6V A;  1CE2 A;  3C35 A;  3EF7 A;  4PFI A;  2HEU A;  2F7C A;  3OO6 A;  4LZ7 A;  3TEL A;  1IUD A;  1B32 A;  2ZNT A;  4H65 A;  2XXQ A;  1EYK A;  3O2A A;  1FBP A;  3OXN A;  3KJT A;  1LBX A;  3Q29 A;  2XXH A;  3EKI A;  3HFU A;  3IFA A;  4L17 A;  2KQZ A;  3C36 A;  4FEC A;  2F34 A;  4OYV A;  3RPL A;  4IY5 A;  1LAF E;  4RJZ A;  4TLM B;  3SDF A;  4QFO A;  2QL3 A;  5HBC A;  1FSA A;  1IXI A;  1ZLQ A;  4U21 A;  3U8Q A;  4XTC Q;  1SW5 A;  3DM0 A;  2ANJ A;  5K2X A;  3CSB A;  2YPN A;  5FTH A;  1LBB A;  1LLS A;  3G3J A;  2AYS A;  3OSQ A;  3IOT A;  1FW0 A;  2I4C A;  4IO7 A;  2A5S A;  4X04 A;  4KYD A;  4OFL A;  5EHM A;  5IKB A;  5EHS A;  4OWD A;  4O7M A;  4XKQ A;  3TAJ A;  2QRY A;  4XXU A;  1TFA A;  3PD9 A;  3RT6 B;  4NN3 A;  2Q88 A;  1FBE A;  1EZ9 A;  4JWO A;  2P3V A;  2WBD A;  2HFB A;  1FPG A;  3FJG A;  2DP8 A;  1DSN A;  2HAV A;  2DQV A;  2DSF A;  4YMB A;  1NNF A;  5FBP A;  2D5W A;  3C34 A;  4FIM A;  3MYU A;  1MQH A;  1QKB A;  1MY3 A;  4JBZ A;  5LTC A;  1FPE A;  3EHT A;  3FJM A;  1F9B A;  3VFJ A;  1TT1 A;  1MQG A;  2W7Y A;  5AA4 B;  3RNN A;  1KWH A;  1BP5 A;  1SW1 A;  4U1O A;  2XWV A;  1I69 A;  1LB8 A;  1N0T A;  3GZG A;  2GHA A;  3IB2 A;  2RKM A;  1MY4 A;  3K2D A;  1AWB A;  1NUZ A;  4U23 A;  4ZEK A;  3V89 B;  2PFZ A;  1D3K A;  2Q9T A;  5CBS A;  4PFW A;  3M3F A;  1UTH A;  1R1N A;  2DXY A;  3GLB A;  2F97 A;  4PQJ A;  1FQF A;  1LEV A;  3NOH A;  3D1R A;  2DS9 A;  2NUV A;  3HV1 A;  4U4X A;  4HTG A;  3FIR A;  4OES A;  3UA8 A;  3PUZ E;  5H8H A;  4EXL A;  1US4 A;  2WYP A;  5F1Q A;  1UTB A;  1OLA A;  3U65 A;  1FPD A;  3S9M C;  4WED A;  2XXW A;  3Q26 A;  3G3H A;  4AB5 A;  1MRP A;  1P1W A;  4F2O A;  2ZYN A;  5AE4 A;  5B7D A;  1H44 A;  4F31 B;  4PFY A;  3TOD A;  3WAE A;  1MXZ A;  2FVZ A;  1QGX A;  3N26 A;  4N6P A;  1PC3 A;  4MBP A;  1N84 A;  1JVY A;  3TCH A;  2F36 A;  4H5F A;  3KOT A;  1L5T A;  4N15 A;  4NF5 B;  1G0H A;  1MPC A;  4NF6 A;  2XXV A;  5I57 B;  2DWI A;  4QFK A;  2ALU A;  4G8M A;  4QSC A;  4DCX A;  2XXU A;  1D9Q A;  4QFP A;  1XS5 A;  5TP9 A;  4IO3 A;  4PP0 A;  2P1S A;  4OVP A;  2Z8E A;  3PMV A;  1PB9 A;  5AA3 A;  4UAB A;  1MQI A;  1DOT A;  1P1U A;  3P7I A;  4YU0 A;  3CFX A;  3DP4 A;  4KD5 A;  1NV1 A;  1EU8 A;  3VVF A;  4NF4 A;  3LSL A;  1FQA A;  5ICT A;  3MVW A;  3TTK A;  3PUW E;  4E0W A;  4ELR A;  1MH4 A;  3VVD A;  3LUY A;  4R9G A;  1MY1 A;  3C31 A;  1NV7 A;  4GWZ A;  4IO4 A;  1IXH A;  3GYY A;  1QUI A;  3FVG A;  2H99 A;  1LAX A;  1NL5 A;  3I5O A;  3RLF E;  5EYF A;  2L5V A;  1NNP A;  3CIJ A;  2QVR A;  4ELQ A;  3OEN A;  1NUW A;  2ZZW A;  3PUY E;  1B7U A;  4OAN A;  4MX6 A;  1M5B A;  1M5D A;  3RTF B;  1NV2 A;  2XXY A;  3MVX A;  3OMB A;  5KZT A;  5I59 B;  1FCK A;  3PMX A;  4F1U A;  3RPL B;  2JJK A;  2VPN A;  4AS5 A;  3UP9 A;  3B50 A;  2A5T A;  3MP1 A;  5DYH A;  2Z8D A;  4YB6 A;  1IMB A;  3T9H B;  1P99 A;  5A5X A;  2UVH A;  3G3G A;  4G68 A;  1LAH E;  1EZO A;  3LV0 A;  4LP2 B;  3HHF A;  4F3G A;  2QS2 A;  3CG1 A;  3V83 A;  1OVT A;  4PAF A;  4KFQ A;  3VXB A;  4KI0 E;  3QYT A;  3VXC A;  3PU5 A;  2D3I A;  4YMA A;  3THI A;  5KCJ B;  2H4I A;  2R71 A;  1NV6 A;  4NQ8 A;  3VLU A;  4BDO A;  2P0S A;  3RUM A;  3IOV A;  5BWJ A;  4Z0I A;  1JET A;  2I3V A;  2I49 A;  1SQY A;  1MS7 A;  1ZKB A;  3BFU A;  2Q2A A;  4IB2 A;  4NHB A;  4N4U A;  3IL1 B;  4FJP A;  4XEQ A;  1P1O A;  1FPB A;  2ZZV A;  3KEI A;  1QVS A;  4JSD A;  3QUJ A;  2F78 A;  5AA1 A;  4GWU A;  5IZ3 A;  4EXK A;  1DTZ A;  1JW4 A;  2OWZ A;  3T9X B;  4TLL B;  4F18 A;  2F7A A;  1A55 A;  4QFL A;  4P0I A;  1EYI A;  1JW1 A;  2I48 A;  3U93 A;  2PFY A;  4ZEC A;  3R26 A;  4QSE A;  4MMP A;  4XFE A;  1MM7 A;  2FIE A;  3C33 A;  1NV4 A;  4HE1 A;  1XI6 A;  1UTH B;  4U2R A;  1FPK A;  3USD A;  3U72 A;  2IEE A;  2HZK A;  4LZ8 A;  5BUU A;  3EPE A;  1TWY A;  1R9Q A;  2WKY A;  1MXU A;  3RYD A;  2Y7K A;  4FED A;  1DBZ A;  3ROJ A;  3S9E A;  1HSL A;  4C1T A;  4EQ7 A;  3CR9 A;  3V5A A;  4MNC A;  1A8F A;  4YKI A;  1G0I A;  3ZKK A;  5HPQ A;  1BK4 A;  4PGP A;  5JTY B;  4YKP A;  4LVQ A;  5CMM A;  1UTB B;  4GLI A;  1S50 A;  4LAT A;  1CB6 A;  5ITP A;  2THI A;  3TMG A;  3FJ7 A;  2OWT A;  4FEB A;  4AS4 A;  2P2A A;  2QJE A;  1DPP A;  1FJ6 A;  1SPI A;  1B6H A;  4E0X A;  4BDM A;  2REG A;  1DK4 A;  1WVJ A;  4IY6 A;  5CMK A;  4MLV A;  4LA9 A;  3K6X A;  3W9V A;  1OQH A;  1B05 A;  5FTI A;  3IJX B;  1YPN A;  2ZNS A;  5AA2 A;  3KSX A;  1O7T A;  2Y7P A;  3PPO A;  5I57 A;  3TKD A;  1PBP A;  1JQF A;  5ICQ A;  1MQJ A;  4NF6 B;  2O51 A;  2YJP A;  3M3K A;  1WOD A;  1N3W A;  1DPE A;  4GRK A;  5J16 A;  1JEU A;  1IME A;  4FAT A;  4WEP A;  5TP9 B;  3IB1 A;  1BKA A;  4NGU A;  3T22 A;  3MVZ A;  2ZXT A;  4NX1 A;  4PFU A;  2VD2 A;  4GX3 A;  3MST A;  4GVO A;  4GXS B;  3U94 A;  3PUV E;  3B6T A;  3SZP A;  4DZ1 A;  3B6W A;  4DLD A;  2UVI A;  2XWK A;  4H5G A;  2V93 A;  1A40 A;  4NF4 B;  1Z7N E;  2DE2 A;  3PPR A;  2F8D A;  3S9L C;  2Z22 A;  1XVX A;  1NNT A;  4PAK A;  4F1Y A;  1PBQ A;  2VD3 A;  3B8B A;  2HXR A;  2I0C A;  4PTK A;  4UAC A;  1RDZ A;  3EN3 A;  3TTL A;  1MY0 A;  1I6Q A;  5H8F A;  3KBR A;  1R9L A;  1OQG A;  3FBP A;  4I9D A;  5I59 A;  2GH9 A;  2WEF A;  3W15 C;  4ZS9 A;  3TDJ A;  1RDY A;  2R6G E;  5EQ9 A;  4YIC A;  1JW5 A;  4P56 A;  3K1P A;  3MJN A;  4THI A;  4I8C A;  4M4G A;  1IMF A;  2OLB A;  2VGQ A;  5A5L A;  2Q8J A;  1DMB A;  2A5T B;  3SEU A;  3PPP A;  1BIY A;  4ZZE A;  4RPO A;  1MPB A;  4NWC A;  5I3S A;  5EQA A;  1LCT A;  2RC8 A;  5A5X B;  4G68 B;  2X7Q A;  2GQ1 A;  4N8Y A;  3HCQ A;  1M5F A; 
#chains in the Genus database with same CATH homology
 1B7Z A;  5DT6 A;  2H9B A;  3JZJ A;  3TQL A;  4H1X A;  3C4M A;  2X7P A;  3IOR A;  1SW4 A;  4ZDM A;  4ZEF A;  4O3A A;  1FQE A;  4ZE9 A;  1SI1 A;  5KCJ A;  4ND9 A;  1URS A;  4BDQ A;  4OEU A;  3TFL A;  2NVU B;  1WDN A;  1UQW A;  4P11 A;  4GWO A;  4OFJ A;  2DYX A;  2O84 X;  2DXR A;  4PFT A;  3OEM A;  1US5 A;  3IOU A;  1Y3N A;  4R6K A;  2QMX A;  3UN6 A;  4DXU A;  4H6D A;  5L9S A;  1MDQ A;  3IJO B;  4XIG Q;  3W9W A;  1FTK A;  3OO8 A;  1Q35 A;  3TCG A;  3FXR A;  3E9X A;  3PPQ A;  4OTE A;  3LBS A;  2I4B A;  3TUS A;  1QW0 A;  5FHN A;  2DWH A;  3MWB A;  3SET A;  3LC8 A;  2ZMB A;  3KN8 A;  4XKP A;  4QHQ A;  3FZV A;  5JTY A;  4DXB A;  3QIM A;  1GTK A;  1N76 A;  4OVJ A;  3K01 A;  3L6H A;  5H8S A;  3TCF A;  2QS1 A;  1QKA A;  3MP6 A;  2OK2 A;  3N94 A;  4HS7 A;  3T66 A;  1URD A;  3MVY A;  1GR2 A;  3T93 B;  1VR5 A;  1B5J A;  1B3E A;  2AIX A;  2PMS A;  3OSR A;  3ODB A;  4H0W A;  5ELV A;  3VDF A;  3QXM A;  5AA2 B;  2D21 A;  1Y9U A;  2B3F A;  3OEK A;  4OQO A;  1XVY A;  3MZ9 A;  2O69 A;  3O28 A;  4YB5 A;  4ELO A;  3D4G A;  2H25 A;  1A54 A;  1QUL A;  1MG1 A;  4LUB A;  4LZ5 A;  3OOA A;  2XXP A;  3FV2 A;  3S2V A;  1MXX A;  1NH7 A;  2FA7 A;  5TU0 A;  3MPK A;  1Y3Q A;  3OO7 A;  3A3U A;  4R75 A;  3S9N C;  4U4S A;  4F29 A;  1ANF A;  4N13 A;  2O68 A;  5H8N A;  2I58 A;  4LQ5 A;  4X48 A;  1OLC A;  3EQ1 A;  4R9F A;  3ILU B;  3ZSF A;  5L8D A;  4GL0 A;  1I6B A;  4FE8 A;  3ONM A;  3G7W A;  2HZL A;  3LR1 A;  2ONS A;  1LFG A;  3B7D A;  4NTL A;  1GGG A;  4RA1 A;  3KFM A;  1IXC A;  4OER A;  5L9O A;  4M1V A;  4DCY A;  3TTM A;  4GFR A;  2I0B A;  2RC7 A;  4QFN A;  5H8F B;  2O1L A;  1B7H A;  1MXY A;  2ONK E;  3SEX A;  2YLN A;  4O3C A;  3G3I A;  5CRY A;  3FXU A;  1EH3 A;  3CVG A;  1AOV A;  1QUJ A;  4OHN A;  2PT2 A;  3KZG A;  1A7L A;  5CI5 A;  3PMW A;  3KGC A;  4Q5T A;  3CFZ A;  3KN3 A;  5IAI A;  2KLF A;  4GXA A;  1B5H A;  3IK6 B;  3SEW A;  3O66 A;  2RF1 A;  1B4Z A;  4O3B A;  4YZZ A;  5CC2 A;  3K0V A;  3H6T A;  1HSJ A;  3IO4 A;  3H4Z A;  4EF1 A;  4RPN A;  4U22 A;  4JXI A;  1B4H A;  3PUX E;  2Z23 A;  4F3S A;  1NMU A;  4R72 A;  1YAE A;  1M5E A;  4KR5 A;  4NMY A;  4IGT A;  2V3T A;  3CG3 A;  3QK6 A;  2Y84 A;  3MZB A;  3FVO A;  1B3F A;  4RXL A;  1NNK A;  3H7M A;  3H6V A;  4LON B;  3O6H A;  1D4N A;  4RY1 A;  1POT A;  3MQ9 A;  2HCA A;  1USY E;  3M8U A;  2XXT A;  1B51 A;  4AQ4 A;  4OEN A;  1DTG A;  4F22 A;  3PGF A;  2XXX A;  5I56 A;  3DEL B;  1ZJL A;  3SKP A;  1IQ7 A;  3O9P A;  1B2H A;  2UVJ A;  1MXW A;  1YTV A;  1SBP A;  3MBP A;  4KHZ E;  3K1M A;  2Q89 A;  3FXQ A;  2H5Y A;  4TOZ A;  2QMW A;  1SD3 A;  1B58 A;  3Q27 A;  4ISU A;  2F7B A;  2CZL A;  4BDR A;  3ECR A;  2UXA A;  2F6P A;  1AMF A;  1XC1 A;  1JNF A;  5I84 A;  4H67 A;  3TYH A;  3GBA A;  1IZ1 A;  1XHY A;  3EHS A;  4F2Q A;  1VE4 A;  2AL5 A;  1I6A A;  1B0H A;  4LQ2 A;  4FAJ A;  2RC9 A;  3MPL A;  1N3X A;  1N7X A;  2DE3 A;  4POW A;  2ESN A;  3VVE A;  2RIN A;  4F39 A;  4HCY A;  2XXI A;  2I3W A;  3TPA A;  3FD3 A;  3FVK A;  4MH5 A;  1B3G A;  1M5C A;  1BLF A;  2PYY A;  2E1S A;  1JVX A;  5DVI A;  4XKN A;  3SER A;  2FNC A;  2NXO A;  3UGW A;  4GIZ A;  5AA2 D;  1OVB A;  1VFD A;  1PDA A;  3JYR A;  1J1N A;  1MQD A;  5H8Q A;  5B70 A;  3CFL A;  1RKM A;  3UOR A;  4IGR A;  3ZS6 A;  2IA4 A;  5I2N A;  4WXJ A;  3FVN A;  2XXR A;  1FTJ A;  2QS4 A;  3FAT A;  2DE4 A;  5KDT B;  3E4R A;  4JSO A;  1B3L A;  2FYI A;  3H06 B;  3LSW A;  2REJ A;  1O64 A;  3K1N A;  1B3H A;  1NKX A;  2VHA A;  1NH8 A;  1RYX A;  3DP8 A;  2ZYK A;  4DE8 A;  5H8N B;  4YAH X;  2HXW A;  1AH5 A;  1Y20 A;  1LB9 A;  1PB8 A;  2DWJ A;  1VFE A;  4GD5 A;  2XHD A;  5DTB A;  1N04 A;  2OCU A;  4RYA A;  1B52 A;  4FOR A;  2V84 A;  4MLQ A;  2Y7I A;  1T0K A;  2QPQ A;  3CSG A;  4PE5 B;  4IO6 A;  3E3K A;  2ZYO A;  3L6G A;  1FQD A;  3LSX A;  4I1D A;  4NF8 A;  2GRV A;  4X9T A;  4GQO A;  1OMP A;  4F3B A;  1LAG E;  2ZYM A;  2PBW A;  1OIB A;  3OD7 A;  4N07 A;  3G3K A;  4MFI A;  1IIW A;  2XD2 A;  1Q1K A;  1B1H A;  2VOZ A;  3PV0 E;  3T9U A;  1PB7 A;  4G2Z A;  4OEV A;  4QSD A;  3SEV A;  1R6Z A;  4K3F A;  5K2Y A;  1Y1M A;  4C1U A;  3MAM A;  1ZTY A;  3RPW A;  4RK2 A;  3RTW B;  4H8I A;  5I58 A;  1S9T A;  4X1D A;  1NFT A;  3OO9 A;  4IO5 A;  3BFT A;  1A99 A;  2ONR A;  3K6U A;  4OXV A;  4DXC A;  4HW8 A;  3IAZ A;  1IXG A;  4R74 A;  3SEY A;  3IOW A;  1XT8 A;  3QAX A;  4RNS A;  4ESW A;  1FQC A;  5DEX A;  5I2K B;  2Y7R A;  5TPA A;  3IB0 A;  4G4P A;  4TQU Q;  3MP8 A;  1TXF A;  3MUQ A;  4R2F A;  3K6W A;  1MH3 A;  5I56 B;  3I3V A;  3KG2 A;  1SI0 A;  3A3C A;  3C32 A;  3H6W A;  4NWD A;  1MY2 A;  3N6T A;  2NOO A;  4X1B A;  1AIV A;  3PPN A;  3E13 X;  2F5X A;  2AL4 A;  5FHM A;  2UYF A;  2H98 A;  4KCC A;  2UYE A;  4GL8 A;  2F6G A;  4R2B A;  1P1Q A;  3EHU A;  2OBG A;  2Q2C A;  1FQB A;  5LOM A;  4JDF A;  4R6Y A;  2X26 A;  1VSO A;  3VLV A;  3DLN A;  1ZBM A;  3MZ1 A;  5CM6 A;  1FTM A;  1P1N A;  3H6U A;  1ELJ A;  3I6V A;  5JK4 A;  1N7W A;  4POX A;  1ATG A;  5CMB A;  1TFD A;  2XX7 A;  3BBR A;  1BTJ A;  4F1V A;  1MDP 1;  4ZZA A;  1SYH A;  3QUF A;  3T96 B;  1JEV A;  2QSX A;  3IR1 A;  2O1M A;  2B65 A;  1XOC A;  4QRZ A;  1LFH A;  3Q25 A;  3KSJ A;  1B0L A;  2XX8 A;  5H8Q B;  3CI8 A;  1RYO A;  1Y1Z A;  4AB6 A;  3R6U A;  3OEL A;  4KQP A;  1S7Y A;  1H76 A;  3MW0 A;  5I2N B;  5KDT A;  1YCJ A;  1LFI A;  2DOJ A;  5ITO A;  3U92 A;  4F19 A;  3V8X B;  1H45 A;  4JB7 A;  3G3F A;  4EF2 A;  5FHO A;  1ZIU A;  2XX9 A;  2G29 A;  4U1Z A;  3HO7 A;  2O6A A;  3FGS A;  5HM4 B;  4PET A;  1GVC A;  3UK4 A;  4YKK A;  3RGY A;  4Q8R A;  3VV5 A;  2E0S A;  2G93 A;  4ELP A;  3R7X A;  3VE1 B;  4EQB A;  1II5 A;  1ZU0 A;  1B40 A;  5DVF A;  1LCF A;  1MM6 A;  3TTN A;  3RT8 A;  4I62 A;  4P0G A;  4YKJ A;  3K00 A;  2DVZ A;  4XKR A;  3M3L A;  2GHB A;  1FTL A;  4NF8 B;  2QS3 A;  2V3Q A;  3N5L A;  1EZP A;  1UIV A;  1SVX B;  3DP6 A;  3KOS A;  1SW2 A;  3QSL A;  4G8H A;  1Y3P A;  1IEJ A;  3S4U A;  2I6E A;  2V25 A;  4KYE A;  3K4U A;  4R6H A;  2XD3 A;  2ZNU A;  4Q30 B;  1SDX A;  4WKM A;  2UVG A;  2Y7W A;  5I58 B;  2OWS A;  3BKI B;  3TEP A;  1LST A;  2PVU A;  3RN8 A;  2DVC A;  4BDL A;  5CMC A;  2OJT A;  3GBB A;  3H03 A;  4MF3 A;  2F35 A;  2RCB A;  3LSF B;  3AXF A;  5L9M A;  4ONY A;  3B6Q A;  3D4C A;  1LBC A;  5I2K A;  1Z7M E;  2Z8F A;  5DEX B;  3FV1 A;  1D9Y A;  1Y4T A;  5TPA B;  1IIT A;  3HN0 A;  3F11 A;  1QUK A;  4ZEI A;  3CRB A;  4Q0C A;  4OET A;  2PT1 A;  3FAS A;  3KN7 A;  4DIG A;  2M8C A;  4Z7E A;  3GXA A;  3RQT A;  5AA4 A;  1LGB C;  2BJJ X;  3A09 A;  1URG A;  4NED A;  3O6I A;  4EUO A;  2B3B A;  1POY 1;  3HHG A;  1B5I A;  1SYI A;  5F7V A;  3HST A;  4BLA A;  3Q28 A;  1MXV A;  2RCA A;  1B46 A;  3FUZ A;  1FTO A;  4H8J A;  1H3D A;  5JEI A;  5DVJ A;  1GV8 A;  2NWJ A;  4GOT A;  4GF8 A;  4C0R A;  4OFO A;  3U1O A;  3PD8 A;  1UIU A;  2HAU A;  5CBR A;  2LAO A;  4UA8 A;  3KJ7 A;  3TZA A;  5ISU A;  1USY H;  4IO2 A;  2O7I A;  5H8H B;  3C9H A;  2HQ0 A;  4NE4 A;  4EQ9 A;  2OZZ A;  3HPI A;  4ZEB A;  4DDD A;  4G77 A;  4JWX A;  4ECF A;  3ZKL A;  3VLW A;  4OMB A;  4QF9 A;  3IX1 A;  2PX1 A;  3IO6 A;  2ABH A;  2VP1 A;  4ESX A;  3WAF A;  4NF5 A;  1MPD A;  1AL3 A;  1B9J A;  1D9V A;  2V3U A;  3UIF A;  4G8N A;  1A8E A;  4R73 A;  2CMO A;  3ILT B;  2O7U A;  1HSE A;  1Y4C A;  4EDP A;  3N6U A;  3TQW A;  3SES A;  4KYS A;  1H43 A;  4F3P A;  1PEB A;  5J1D A;  2GFE A;  2DWA A;  4ZED A;  3T9V A;  3O6G A;  4JWY A;  1O63 A;  1B1X A;  4BDN A;  3O29 A;  3TTR A;  3MC2 A;  4G68 C;  4RK9 A;  4KPT A;  1ZMG A;  1QJM A;  4ZE8 A;  2R9J A;  3K02 A;  3RY3 A;  4OZ9 A;  4KCD A;  4YB7 A;  4HCW A;  3O97 A;  3JV9 A;  3H3G A;  5M2V A;  3K6V A;  1CE2 A;  3C35 A;  3EF7 A;  2HEU A;  2F7C A;  3OO6 A;  4LZ7 A;  3TEL A;  1IUD A;  1B32 A;  2ZNT A;  4H65 A;  2XXQ A;  3O2A A;  3OXN A;  3KJT A;  3Q29 A;  2XXH A;  4L17 A;  3C36 A;  4FEC A;  2F34 A;  4OYV A;  4IY5 A;  1LAF E;  4RJZ A;  4TLM B;  3SDF A;  4QFO A;  2QL3 A;  5HBC A;  1IXI A;  1ZLQ A;  4U21 A;  3U8Q A;  4XTC Q;  1SW5 A;  3DM0 A;  2ANJ A;  5K2X A;  3CSB A;  2YPN A;  5FTH A;  1LBB A;  1LLS A;  3G3J A;  2AYS A;  3OSQ A;  3IOT A;  1FW0 A;  2I4C A;  4IO7 A;  2A5S A;  4KYD A;  4OFL A;  5EHM A;  5IKB A;  5EHS A;  4OWD A;  4XKQ A;  3TAJ A;  2QRY A;  4XXU A;  1TFA A;  3PD9 A;  3RT6 B;  2Q88 A;  1EZ9 A;  4JWO A;  2HFB A;  3FJG A;  2DP8 A;  1DSN A;  2HAV A;  2DQV A;  2DSF A;  4YMB A;  1NNF A;  2D5W A;  3C34 A;  4FIM A;  1MQH A;  1QKB A;  1MY3 A;  4JBZ A;  3EHT A;  3FJM A;  1F9B A;  3VFJ A;  1TT1 A;  1MQG A;  2W7Y A;  5AA4 B;  3RNN A;  1KWH A;  1BP5 A;  1SW1 A;  4U1O A;  1I69 A;  1LB8 A;  1N0T A;  3GZG A;  2GHA A;  3IB2 A;  2RKM A;  1MY4 A;  3K2D A;  4U23 A;  4ZEK A;  3V89 B;  1D3K A;  2Q9T A;  5CBS A;  4PFW A;  3M3F A;  1UTH A;  1R1N A;  2DXY A;  3GLB A;  2F97 A;  4PQJ A;  1FQF A;  2DS9 A;  2NUV A;  3HV1 A;  4U4X A;  4HTG A;  3FIR A;  4OES A;  3UA8 A;  3PUZ E;  5H8H A;  4EXL A;  1US4 A;  5F1Q A;  1UTB A;  1OLA A;  3S9M C;  4WED A;  2XXW A;  3Q26 A;  3G3H A;  4AB5 A;  1MRP A;  1P1W A;  4F2O A;  2ZYN A;  5AE4 A;  5B7D A;  1H44 A;  4F31 B;  4PFY A;  3TOD A;  3WAE A;  1MXZ A;  3N26 A;  4N6P A;  1PC3 A;  4MBP A;  1N84 A;  1JVY A;  3TCH A;  2F36 A;  4H5F A;  3KOT A;  1L5T A;  4NF5 B;  1MPC A;  4NF6 A;  2XXV A;  5I57 B;  2DWI A;  4QFK A;  2ALU A;  4G8M A;  4QSC A;  4DCX A;  2XXU A;  4QFP A;  1XS5 A;  5TP9 A;  4IO3 A;  4PP0 A;  2P1S A;  2Z8E A;  3PMV A;  1PB9 A;  5AA3 A;  1MQI A;  1DOT A;  1P1U A;  3P7I A;  4YU0 A;  3CFX A;  3DP4 A;  4KD5 A;  1EU8 A;  3VVF A;  4NF4 A;  3LSL A;  1FQA A;  5ICT A;  3MVW A;  3TTK A;  3PUW E;  4E0W A;  4ELR A;  1MH4 A;  3VVD A;  3LUY A;  4R9G A;  1MY1 A;  3C31 A;  4IO4 A;  1IXH A;  1QUI A;  3FVG A;  2H99 A;  1LAX A;  1NL5 A;  3I5O A;  3RLF E;  5EYF A;  1NNP A;  3CIJ A;  4ELQ A;  3OEN A;  3PUY E;  1B7U A;  1M5B A;  1M5D A;  3RTF B;  2XXY A;  3MVX A;  3OMB A;  5KZT A;  5I59 B;  1FCK A;  3PMX A;  4F1U A;  3UP9 A;  2A5T A;  3MP1 A;  5DYH A;  2Z8D A;  4YB6 A;  3T9H B;  1P99 A;  5A5X A;  2UVH A;  3G3G A;  4G68 A;  1LAH E;  1EZO A;  4LP2 B;  3HHF A;  4F3G A;  2QS2 A;  3CG1 A;  3V83 A;  1OVT A;  4KFQ A;  3VXB A;  4KI0 E;  3QYT A;  3VXC A;  3PU5 A;  2D3I A;  4YMA A;  3THI A;  5KCJ B;  2H4I A;  2R71 A;  3VLU A;  4BDO A;  2P0S A;  3RUM A;  3IOV A;  5BWJ A;  4Z0I A;  1JET A;  2I3V A;  2I49 A;  1SQY A;  1MS7 A;  1ZKB A;  3BFU A;  2Q2A A;  4IB2 A;  3IL1 B;  4FJP A;  1P1O A;  3KEI A;  1QVS A;  4JSD A;  3QUJ A;  2F78 A;  5AA1 A;  4EXK A;  1DTZ A;  1JW4 A;  3T9X B;  4TLL B;  4F18 A;  2F7A A;  1A55 A;  4QFL A;  4P0I A;  1JW1 A;  2I48 A;  3U93 A;  4ZEC A;  3R26 A;  4QSE A;  1MM7 A;  3C33 A;  1UTH B;  4U2R A;  3USD A;  3U72 A;  2IEE A;  2HZK A;  4LZ8 A;  5BUU A;  3EPE A;  1TWY A;  1R9Q A;  2WKY A;  1MXU A;  2Y7K A;  4FED A;  3S9E A;  1HSL A;  4C1T A;  4EQ7 A;  3CR9 A;  3V5A A;  1A8F A;  4YKI A;  3ZKK A;  5HPQ A;  5JTY B;  4YKP A;  4LVQ A;  5CMM A;  1UTB B;  4GLI A;  1S50 A;  4LAT A;  1CB6 A;  5ITP A;  2THI A;  3TMG A;  3FJ7 A;  2OWT A;  4FEB A;  2P2A A;  2QJE A;  1DPP A;  1B6H A;  4E0X A;  4BDM A;  2REG A;  1WVJ A;  4IY6 A;  5CMK A;  4MLV A;  4LA9 A;  3K6X A;  3W9V A;  1OQH A;  1B05 A;  5FTI A;  3IJX B;  1YPN A;  2ZNS A;  5AA2 A;  3KSX A;  1O7T A;  2Y7P A;  3PPO A;  5I57 A;  3TKD A;  1PBP A;  1JQF A;  5ICQ A;  1MQJ A;  4NF6 B;  2O51 A;  2YJP A;  3M3K A;  1WOD A;  1N3W A;  1DPE A;  4GRK A;  1JEU A;  4FAT A;  4WEP A;  5TP9 B;  3IB1 A;  1BKA A;  3T22 A;  3MVZ A;  2ZXT A;  4PFU A;  2VD2 A;  4GVO A;  4GXS B;  3U94 A;  3PUV E;  3B6T A;  4DZ1 A;  3B6W A;  4DLD A;  2UVI A;  4H5G A;  2V93 A;  1A40 A;  4NF4 B;  1Z7N E;  2DE2 A;  3PPR A;  2F8D A;  3S9L C;  2Z22 A;  1XVX A;  1NNT A;  4F1Y A;  1PBQ A;  2VD3 A;  2I0C A;  4UAC A;  3EN3 A;  3TTL A;  1MY0 A;  1I6Q A;  5H8F A;  3KBR A;  1R9L A;  1OQG A;  4I9D A;  5I59 A;  2GH9 A;  3W15 C;  4ZS9 A;  3TDJ A;  2R6G E;  4YIC A;  1JW5 A;  3K1P A;  3MJN A;  4THI A;  4I8C A;  4M4G A;  2OLB A;  2VGQ A;  2Q8J A;  1DMB A;  2A5T B;  3SEU A;  3PPP A;  1BIY A;  4ZZE A;  4RPO A;  1MPB A;  4NWC A;  1LCT A;  2RC8 A;  5A5X B;  4G68 B;  2X7Q A;  3HCQ A;  1M5F A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...