1S7YA

Crystal structure of the glur6 ligand binding core in complex with glutamate at 1.75 a resolution orthorhombic form
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
251
structure length
251
Chain Sequence
NRSLIVTTILEEPYVLFKKSDKPLYGNDRFEGYCIDLLRELSTILGFTYEIRLVEDGKYGAQDDVNGQWNGMVRELIDHKADLAVAPLAITYVREKVIDFSKPFMTLGISILYRKGTPIDSADDLAKQTKIEYGAVEDGATMTFFKKSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQIGGLIDSKGYGVGTPMGSPYRDKITIAILQLQEEGKLHMMKEKWWR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glutamate receptor, ionotropic kainate 2 precursor
publication title Crystal structures of the GluR5 and GluR6 ligand binding cores: Molecular mechanisms underlying kainate receptor selectivity
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Membrane protein
total genus 86
structure length 251
sequence length 251
chains with identical sequence B
ec nomenclature
pdb deposition date 2004-01-30
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s7yA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1s7yA02
3OOAA 4LZ5A 3VDFA 3S2VA 1BLFA 4MLVA 4X1DA 1AIVA 4IO2A 1M5DA 1IXCA 3C9HA 1ZJLA 1Y20A 1LBBA 4YMAA 2X26A 3IOWA 1B7HA 3TFLA 2F7AA 3MVXA 1TT1A 5DEXA 1I69A 1US4A 3TUSA 4PP0A 2PX1A 1CB6A 3N5LA 4TQUQ 4F31B 4KI0E 3MJNA 3KN7A 3QXMA 2H98A 2Y7WA 2F78A 4ESXA 4OVJA 4R2BA 4JB7A 2XXYA 2B65A 1FQBA 3CVGA 2NOOA 3B6TA 4ZECA 3TAJA 2ZXTA 5L9SA 4OTEA 1EZPA 2DXYA 4EQ7A 4JXIA 1ANFA 1ELJA 2XHDA 1R1NA 5AA2D 2PMSA 4MF3A 5IAIA 4PETA 4G68B 5F7VA 1FTMA 2I6EA 4KHZE 2I3WA 2XXRA 3UP9A 1R9QA 4BDMA 1MXXA 4DXCA 1FQEA 2V25A 2HQ0A 4GF8A 4OFJA 3SEWA 3H7MA 4I8CA 1FTOA 3FV1A 3AXFA 1MPCA 3S9LC 4NF4B 4YKPA 4UA8A 2ANJA 2OWTA 5TPAB 4RA1A 1ZMGA 4HS7A 2V3UA 1B3HA 2GH9A 2Z23A 3UGWA 3RTFB 1SBPA 1BKAA 3DP4A 3H6WA 4HW8A 3FJGA 3V89B 2B3BA 5EHMA 1O63A 5I2NA 1H3DA 1BTJA 3E9XA 5CMCA 1RYOA 4Q8RA 1B4ZA 1SD3A 4GOTA 3DLNA 4KYEA 2DWHA 3IOUA 2YLNA 1CE2A 2AL5A 4RY1A 4F19A 4DLDA 3LSWA 4GXAA 1URGA 3MVYA 3K01A 1MQIA 3RT6B 4IY5A 1EU8A 2Q9TA 4HCYA 5AE4A 3GBAA 4JDFA 3VLVA 3HHFA 1DSNA 4LA9A 4ZE8A 1BIYA 1O64A 3KSXA 1I6BA 2V3TA 1JEVA 4YKJA 2VGQA 2THIA 3MC2A 4RXLA 3K4UA 2XXUA 2H9BA 3MAMA 3VXCA 1S7YA 3GLBA 1Q1KA 1LAHE 3BBRA 3FD3A 4XKPA 2G93A 2PBWA 3CFZA 4YKIA 4G68C 2HEUA 4RK2A 4FE8A 2H25A 4ZEFA 1TXFA 2OK2A 4H6DA 3UIFA 2Y7KA 3K02A 5IKBA 3RLFE 2ONRA 4NF6A 4F1YA 2OJTA 3SEYA 4NF4A 4O3CA 3T9VA 1FTKA 4ZEKA 3T22A 5I59B 4IY6A 1N0TA 4LUBA 4Q30B 3M8UA 3PUWE 3W9VA 1AOVA 4F3SA 3OSRA 3P7IA 3IORA 3O9PA 1PEBA 1OLAA 2VD2A 1LLSA 5A5XB 1SDXA 1A54A 3KEIA 1MH3A 4GXSB 1WODA 1D3KA 4PFYA 1FQAA 3E13X 3C31A 3KJTA 5FHMA 2QS2A 2H99A 2AYSA 2RC7A 4BDOA 2HZKA 1B3GA 4MLQA 2PYYA 4XKRA 3K6WA 2IA4A 1QJMA 3N6UA 4KCCA 4JSDA 1H43A 1IXGA 3PPNA 1B6HA 2UVGA 3K6UA 3VV5A 3RTWB 4E0WA 1P1NA 2ZYNA 1WVJA 4MBPA 3CR9A 4LZ7A 3OELA 3O6GA 1A7LA 4R6YA 5CC2A 1QULA 3MZBA 1ZKBA 3IOTA 2DE4A 3TTNA 1Y3PA 3HN0A 4ECFA 1B1HA 2QMWA 1MY4A 4EUOA 4R6KA 1NFTA 3GBBA 2DVZA 1H44A 4K3FA 3PD8A 1B0LA 4F22A 2Q8JA 3SETA 5AA1A 5I59A 4BDNA 3G3KA 4BDLA 3QAXA 1D4NA 3VXBA 2VP1A 4XIGQ 2O1MA 4F3BA 3S9NC 1MY3A 3MZ1A 3PUZE 1KWHA 1QKBA 1B46A 2IEEA 4X1BA 1TFAA 3KOTA 4H65A 1SW5A 1MY1A 2ZYOA 3A3UA 4GIZA 4DIGA 4GQOA 4DE8A 2P2AA 4YB6A 3DELB 3MPKA 3KOSA 2X7PA 2ALUA 2ZNUA 3FZVA 4QFNA 5I57A 1PDAA 1SYIA 1URSA 4POWA 1ZTYA 4OETA 3IB1A 3ILTB 1A8EA 1GVCA 3RNNA 2G29A 2DE3A 1MXUA 4IO4A 1P1UA 2H5YA 4NF5B 4QF9A 2AIXA 1NH7A 4AB5A 5DEXB 3WAFA 3TCFA 4NF8B 1I6AA 2XXPA 3FXUA 4I62A 1Y3QA 2D3IA 3LBSA 1EZ9A 4OFLA 4OMBA 3G3HA 1ZIUA 5KCJB 2D5WA 2DOJA 4RPOA 2QJEA 3H3GA 4QSDA 5H8QB 4YMBA 2ONKE 4BDQA 2E1SA 2FYIA 3UK4A 4F39A 1IQ7A 5HPQA 1DPEA 4H67A 3ZKKA 4F2OA 3SERA 3FV2A 4EF1A 1FQDA 1RKMA 4R6HA 4YU0A 2DWIA 4EXLA 4NEDA 5CMBA 2QS4A 3KBRA 3PPQA 1M5FA 1WDNA 1Y1MA 1N84A 4RK9A 3K0VA 1MG1A 3V5AA 5I2KA 1D9VA 2I4BA 2M8CA 1UIVA 4IB2A 2E0SA 3QUFA 3O6HA 5L9MA 2PVUA 1N76A 3IOVA 5AA2A 5BUUA 4TLLB 2I58A 3OD7A 4U2RA 1DPPA 1MXZA 1LFGA 1XS5A 1SI0A 2DSFA 1B0HA 2ZYMA 3FJMA 4NF5A 4R2FA 1Y1ZA 4RNSA 3K1MA 5I2NB 4NF8A 2Q88A 4OEVA 1XT8A 2Q2AA 4OQOA 3QUJA 1B7UA 3QIMA 3KN8A 3OEKA 1S9TA 2XXWA 5KCJA 3BKIB 4WEDA 1OQGA 4LZ8A 3CSBA 5H8QA 3CIJA 4IO7A 1AH5A 1A99A 4IO5A 1MS7A 5B70A 3OO8A 1EZOA 4QFLA 5M2VA 4ISUA 4G8HA 2YJPA 3TYHA 3T9HB 3FGSA 3SDFA 4KFQA 3M3FA 3GXAA 3DP6A 3D4CA 4OZ9A 1MDQA 1NKXA 1I6QA 3KN3A 1PB9A 5H8NA 2RINA 3D4GA 3FASA 3W9WA 4XKQA 2NVUB 4NF6B 5EHSA 2OLBA 4F1VA 2O68A 4NMYA 3PPRA 2H4IA 3T66A 4U23A 4FECA 2I0BA 1VSOA 4GL0A 1B9JA 4XTCQ 2DVCA 3WAEA 3N6TA 2RF1A 3JYRA 5F1QA 5DVIA 3H6VA 4R9GA 1FW0A 1EH3A 2Y7RA 2PT2A 3CFLA 4AB6A 1QUKA 2NUVA 4C0RA 1ZLQA 3RUMA 2I49A 4GL8A 5CBRA 3KFMA 3MPLA 1P1OA 3KJ7A 4ZE9A 1ATGA 2DYXA 4H0WA 4U22A 4YAHX 1IIWA 2F8DA 3K2DA 5FTHA 3PPPA 4ELRA 2R6GE 1MM7A 4E0XA 3FVKA 3SEXA 4Z7EA 1PBQA 3CG1A 1B4HA 5FTIA 3F11A 4R74A 3JZJA 5HBCA 2HFBA 3MP8A 4GVOA 5DT6A 1OMPA 3OO9A 2F6PA 2AL4A 4U1OA 5L8DA 3IO6A 4KD5A 2R71A 2XD3A 1IXHA 2RC9A 4THIA 1YAEA 3B6QA 1P1WA 2OBGA 2XX7A 1UIUA 1Y4TA 4HCWA 1XHYA 4EF2A 3BFUA 3TTRA 1MY2A 1NNKA 1NH8A 2VD3A 5DYHA 3H6TA 2KLFA 2XX8A 2DWJA 3HHGA 5ICQA 3G3IA 2D21A 2BJJX 2GRVA 3T96B 3VVDA 2XD2A 4M4GA 2A5TB 2QMXA 2ZNTA 4LATA 3O66A 1B5IA 1SVXB 1MQGA 5AA4B 1B5JA 3UORA 4F3GA 3H6UA 1AMFA 1DTGA 4OWDA 3CG3A 3IJOB 3S4UA 5ITOA 1SW4A 1QVSA 3FATA 2UVJA 1LB8A 2P0SA 3PMWA 4ELOA 3LSXA 5I57B 4PFWA 4GD5A 1R6ZA 4GFRA 3U1OA 1P1QA 4F2QA 1OVBA 4WXJA 3Q26A 1POY1 2Y7IA 1OQHA 3OENA 4BDRA 5CM6A 3G3FA 2O51A 2NXOA 3LUYA 4U21A 1B2HA 4OERA 3TODA 4F3PA 2RKMA 5FHOA 4NWCA 3C35A 4JSOA 4ZS9A 1MPDA 3A09A 1MY0A 3H06B 3V8XB 5H8HB 3EHTA 1LSTA 5FHNA 4LQ5A 1LCFA 3FIRA 3PUVE 1LAXA 2A5SA 2XXQA 3IK6B 4Q5TA 1XVXA 2RCAA 3B6WA 4POXA 3C34A 3EN3A 4EQBA 1HSEA 4ND9A 2F6GA 1MXWA 2A5TA 1N7WA 3CFXA 2Q89A 3C32A 4X9TA 1NMUA 5AA4A 3OXNA 3FXQA 3Q28A 2Y7PA 5I2KB 3A3CA 1IZ1A 3U94A 2XXVA 4QFKA 5KDTA 4DDDA 1QUJA 1SYHA 5CMKA 3L6GA 3FVOA 2CZLA 4IGTA 2XX9A 4ZZAA 3KGCA 2ONSA 4OESA 1Y4CA 2RC8A 3K00A 5AA2B 1N3XA 2ZYKA 5CI5A 3TDJA 3MQ9A 1H45A 1MRPA 3I5OA 1B3LA 3LR1A 1FTJA 3SKPA 1IEJA 1SQYA 3MVWA 3O29A 1OLCA 1II5A 4HTGA 2O1LA 3E4RA 4PE5B 1VR5A 4OENA 3PD9A 4LP2B 3C36A 2VOZA 3EHUA 3LSLA 2FA7A 5CBSA 1R9LA 1N3WA 2CMOA 4O3BA 1YTVA 5J1DA 4U4SA 4XXUA 3TQLA 4OYVA 1XC1A 5H8HA 4ZDMA 2HCAA 1GV8A 2QS3A 2F35A 4JWOA 1YPNA 4FAJA 1B1XA 1SW2A 3OO7A 3EPEA 2XXTA 1QW0A 1RYXA 4KYSA 3GZGA 1JVYA 4NE4A 4G4PA 4LVQA 3G3GA 5TU0A 2F34A 1LBCA 3VLWA 2O6AA 2F97A 1NNFA 4Z0IA 2VHAA 1JW1A 2GHAA 3FUZA 4TLMB 4RJZA 1Y9UA 3TTMA 4O3AA 2ESNA 4FORA 5H8NB 4P0GA 4I9DA 1B3EA 4DZ1A 4PFUA 2OWSA 5B7DA 3M3LA 3KZGA 4ELQA 1LGBC 4GWOA 3TCHA 5KZTA 1LFIA 3EHSA 4H8IA 4YB5A 3THIA 3TQWA 1Y3NA 4FEBA 1FQFA 1OVTA 4PFTA 1B05A 4U1ZA 1JNFA 3IB2A 3TKDA 3M3KA 4ONYA 3HSTA 3FVNA 3IAZA 3RT8A 5DVJA 4WKMA 1NNTA 1NNPA 4DXBA 2O69A 1FCKA 3RY3A 1PB7A 1BP5A 3EF7A 4MH5A 1QUIA 3N94A 3TTLA 1JQFA 3R26A 1SI1A 3U72A 3OO6A 1LFHA 2O7UA 2DP8A 1J1NA 3O97A 2UXAA 1YCJA 1TFDA 2NWJA 2F7CA 3U8QA 2P1SA 1JEUA 1XVYA 3PGFA 3CI8A 5H8FB 3E3KA 3EQ1A 3PMXA 4JWXA 4N13A 4ZZEA 3K1PA 2Z8FA 3IJXB 1B40A 5K2XA 1MXVA 3B7DA 2PT1A 2OZZA 5DVFA 4KPTA 3TZAA 4FJPA 1MQJA 3S9EA 1B52A 3O2AA 3TELA 1H76A 1PBPA 3C33A 1MDP1 3MP1A 5ICTA 1LAFE 1O7TA 4DCYA 4KR5A 2XXIA 4RYAA 2GFEA 3T9UA 3LC8A 4NTLA 2LAOA 2X7QA 1DOTA 4RPNA 2Z8EA 3RN8A 4R75A 4TOZA 3MBPA 1JETA 3SESA 3RPWA 4EXKA 3FXRA 2V84A 1IXIA 4QSEA 2HXWA 2QL3A 3U93A 5JTYB 2V93A 3W15C 5LOMA 2WKYA 1Z7NE 4L17A 2Y84A 4QRZA 2GHBA 3Q25A 3R6UA 3SEUA 1FQCA 2V3QA 3LSFB 4OEUA 3FVGA 2R9JA 1IUDA 2F5XA 4C1TA 3ZSFA 1DMBA 4H5GA 2QS1A 5H8FA 4P11A 3PV0E 1B3FA 5I84A 4G68A 4LONB 1PC3A 3ECRA 1Q35A 2REJA 4GLIA 4OHNA 3PMVA 4KCDA 4YKKA 1B32A 1US5A 3ZKLA 1GR2A 3PUXE 1B58A 1URDA 1JW4A 1JW5A 1LAGE 1XOCA 1B5HA 2O7IA 1GTKA 4P0IA 5TP9B 4EDPA 1USYH 5AA3A 4G8NA 1JVXA 3KSJA 4F29A 4N07A 4LQ2A 1N7XA 3BFTA 4IO3A 5CRYA 5TPAA 3FJ7A 4H8JA 3USDA 4R9FA 1UTHB 5KDTB 2F36A 4QSCA 2QPQA 1TWYA 2RCBA 4IGRA 2DS9A 4DXUA 3CSGA 3UA8A 5ISUA 2DQVA 2HAUA 3G3JA 4H1XA 1M5CA 3O6IA 1T0KA 1F9BA 3MZ9A 4JBZA 1DTZA 4NWDA 4GRKA 5JTYA 4X48A 4I1DA 4PQJA 4F18A 3VE1B 2DWAA 1UQWA 3S9MC 3HCQA 3ONMA 4ELPA 2QSXA 5I58B 4G8MA 3ZS6A 1SW1A 3I6VA 3PU5A 3U92A 3T93B 2ZMBA 5I56B 5EYFA 2FNCA 4R73A 1S50A 1NL5A 3PPOA 2ABHA 4XKNA 3C4MA 3OEMA 3ODBA 1AL3A 2DXRA 5DTBA 3V83A 4BLAA 3JV9A 3T9XB 2Z22A 4N6PA 4G2ZA 1ZU0A 4QFPA 4FEDA 3Q27A 1MH4A 2XXXA 1UTBB 4R72A 1VE4A 5TP9A 3RQTA 1USYE 2XXHA 4G77A 4YZZA 2O84X 3N26A 4WEPA 1IITA 3K6VA 4ZEDA 2I4CA 3PUYE 1MQDA 5H8SA 3VFJA 3MW0A 4FIMA 1UTHA 3MUQA 3MWBA 3R7XA 4ZEBA 3OSQA 1L5TA 1A8FA 4DCXA 3RGYA 3K1NA 3OMBA 2HAVA 1Z7ME 5JK4A 4H5FA 5A5XA 4ESWA 4U4XA 4M1VA 3TTKA 4C1UA 1ZBMA 5K2YA 3DM0A 3MP6A 4KYDA 1HSJA 3HO7A 3QYTA 3L6HA 3DP8A 1VFDA 3TMGA 2REGA 5I58A 1MM6A 2DE2A 1POTA 3VVFA 3IR1A 4YICA 3IX1A 3H03A 1HSLA 1FTLA 4JWYA 1P99A 4MFIA 4Q0CA 2OCUA 3QK6A 5I56A 3H4ZA 2UVHA 4EQ9A 2I48A 5CMMA 3KG2A 1LCTA 3I3VA 2UYEA 1A40A 2HZLA 4YB7A 3TEPA 2ZNSA 2YPNA 1D9YA 1M5BA 3G7WA 2Z8DA 4F1UA 4QFOA 4UACA 2Q2CA 1M5EA 1N04A 5ELVA 2W7YA 1MPBA 3HV1A 4IO6A 1PB8A 3VVEA 3IB0A 1UTBA 4FATA 5JEIA 1QKAA 5BWJA 4KQPA 5ITPA 3O28A 3QSLA 3TCGA 3HPIA 3VLUA 1B7ZA 3TPAA 4OFOA 5HM4B 3MVZA 4AQ4A 3IO4A 4ZEIA 1MXYA 2I3VA 1MQHA 1OIBA 3CRBA 2QRYA 2B3FA 2UVIA 3UN6A 3IL1B 1VFEA 2UYFA 1GGGA 3Q29A 4OXVA 5L9OA 3ILUB 3SEVA 2I0CA 1B51A 1LB9A 2F7BA 1A55A 3K6XA 4QHQA
chains in the Genus database with same CATH superfamily
3OOAA 4LZ5A 3PTYA 3VDFA 4PE3A 3S2VA 1BLFA 4MLVA 2V4CA 5A5LA 4X1DA 2R8TA 4IO2A 1AIVA 1M5DA 2P3VA 1IXCA 3C9HA 1BK4A 1ZJLA 1Y20A 1LBBA 4YMAA 2X26A 3IOWA 4OVRA 1B7HA 3TFLA 2F7AA 3MVXA 1TT1A 5DEXA 1I69A 4PBHA 2JJKA 4DI4B 4N4UA 1US4A 3TUSA 4PP0A 2PX1A 1CB6A 3N5LA 4TQUQ 4F31B 4KI0E 3MJNA 3KN7A 3QXMA 2H98A 2Y7WA 2F78A 4ESXA 4OVJA 4R2BA 4JB7A 2XXYA 1FJ6A 2B65A 1FQBA 1FBGA 3CVGA 2NOOA 3B6TA 4ZECA 3TAJA 2ZXTA 5L9SA 4OTEA 1EZPA 1YZ0A 2DXYA 4EQ7A 1LBZA 4JXIA 1ANFA 1ELJA 2XHDA 1R1NA 5AA2D 2PMSA 4MF3A 5IAIA 4PETA 4G68B 5F7VA 1FTMA 2I6EA 4KHZE 2I3WA 2XXRA 3UP9A 1R9QA 4BDMA 1MXXA 4DXCA 1LBWA 1EYIA 1FQEA 2V25A 2HQ0A 4GF8A 4OFJA 3SEWA 3H7MA 3MSTA 4I8CA 1FTOA 3FV1A 3AXFA 2CEXA 1MPCA 3S9LC 2FHYA 1LBXA 4NF4B 1DCUA 4YKPA 5IZ3A 4UA8A 2ANJA 2OWTA 5TPAB 4RA1A 1ZMGA 4GWUA 4HS7A 2V3UA 1B3HA 2GH9A 2Z23A 3UGWA 3RTFB 1SBPA 1BKAA 3DP4A 3FXBA 1NUYA 3H6WA 4HW8A 3FJGA 3V89B 2B3BA 5EHMA 1O63A 4QBAA 5I2NA 1H3DA 1BTJA 3E9XA 5CMCA 5ET8A 1RYOA 4Q8RA 1B4ZA 1SD3A 5IM2A 4GOTA 2FIEA 3HFUA 3DLNA 4KYEA 2DWHA 3IOUA 2YLNA 1CE2A 2AL5A 5T3JA 4RY1A 4F19A 4DLDA 3LSWA 4GXAA 4PBQA 1URGA 3MVYA 3K01A 1MQIA 3RT6B 4IY5A 1EU8A 2Q9TA 2WEFA 4HCYA 5AE4A 3GBAA 4JDFA 3VLVA 3HHFA 1DSNA 1IMAA 4LA9A 4ZE8A 1BIYA 1O64A 3KSXA 1I6BA 5EYGA 2V3TA 1JEVA 1EYJA 3A29A 4YKJA 2VGQA 2THIA 3MC2A 4RXLA 3K4UA 2XXUA 2H9BA 3MAMA 3VXCA 1S7YA 3GLBA 1Q1KA 1LAHE 3BBRA 3FD3A 4XKPA 2G93A 2PBWA 3CFZA 3SZPA 2WBDA 4YKIA 4G68C 2HEUA 4RK2A 4FE8A 2H25A 4ZEFA 1TXFA 2OK2A 4H6DA 4N8GA 3UIFA 2Y7KA 3K02A 5IKBA 3RLFE 2ONRA 4NF6A 4F1YA 2OJTA 3SEYA 4NF4A 4O3CA 3T9VA 1FTKA 2Q8MA 1D9QA 1NI9A 4ZEKA 3T22A 5I59B 4IY6A 1FPFA 1N0TA 4LUBA 4Q30B 3M8UA 3PUWE 3W9VA 3FBPA 1AOVA 4F3SA 3OSRA 3B50A 2B4LA 3P7IA 3IORA 3O9PA 1PEBA 3GYYA 4PGPA 1OLAA 2VD2A 1LLSA 5A5XB 1SDXA 1A54A 3KEIA 1MH3A 4GXSB 1WODA 4N8YA 1D3KA 4PFYA 1FQAA 4JVDA 3E13X 3C31A 3KJTA 5FHMA 2QS2A 2H99A 2AYSA 2XWIA 2RC7A 4BDOA 2HZKA 1B3GA 4MLQA 2PYYA 4XKRA 3K6WA 2IA4A 1QJMA 3N6UA 4KCCA 4JSDA 1H43A 1IXGA 3PPNA 1B6HA 2UVGA 3K6UA 3KBZA 3VV5A 3RTWB 4E0WA 1FPBA 1P1NA 2ZYNA 1WVJA 4MBPA 3RPLA 3CR9A 5J16A 4LZ7A 3OELA 4XF5A 3O6GA 1A7LA 4R6YA 5CC2A 1QULA 3MZBA 1ZKBA 3IOTA 2DE4A 3TTNA 1Y3PA 3HN0A 4ECFA 1B1HA 2QMWA 1MY4A 4EUOA 4NGUA 4JVIA 4R6KA 1NFTA 3GBBA 2DVZA 4MNPA 1H44A 4K3FA 3PD8A 1B0LA 4F22A 2Q8JA 3SETA 5AA1A 5I59A 4BDNA 3G3KA 5EQ8A 4MIJA 4BDLA 3QAXA 1D4NA 3VXBA 2VP1A 4XIGQ 2O1MA 4F3BA 3KC1A 3S9NC 1MY3A 3MZ1A 3PUZE 1KWHA 1QKBA 2KQZA 1FPGA 1B46A 2IEEA 4X1BA 1TFAA 3KOTA 4H65A 1SW5A 1MY1A 2ZYOA 3A3UA 4GIZA 4DIGA 4GQOA 2PFZA 4DE8A 2P2AA 4YB6A 3DELB 4OVSA 3MPKA 3KOSA 2X7PA 1FJ9A 2ALUA 4P1EA 2ZNUA 3FZVA 4QFNA 3LUZA 5I57A 2OX3A 1PDAA 1SYIA 1URSA 1NV2A 4OVTA 4POWA 1ZTYA 2PFYA 4OETA 3IB1A 3ILTB 1A8EA 1FBHA 1GVCA 3RNNA 2G29A 2DE3A 1MXUA 2ZZWA 4IO4A 1P1UA 4HE1A 2H5YA 4NF5B 4QF9A 2AIXA 1NH7A 4AB5A 4GBVA 5DEXB 3WAFA 3TCFA 3NOHA 4NF8B 1I6AA 2XXPA 3FXUA 4I62A 1Y3QA 2D3IA 3LBSA 1EZ9A 4MMPA 4OFLA 4OMBA 2CZIA 1ZIUA 3G3HA 5KCJB 2D5WA 2DOJA 4RPOA 2QJEA 3H3GA 4QSDA 5H8QB 4YMBA 2ONKE 4BDQA 2E1SA 2FYIA 3UK4A 2GQ1A 4F39A 1IQ7A 5HPQA 1DPEA 4H67A 3ZKKA 4F2OA 3SERA 1DK4A 3FV2A 4EF1A 1FQDA 2MKZA 1RKMA 4P56A 4R6HA 4PCDA 4PFBA 4YU0A 2DWIA 4EXLA 4NEDA 5CMBA 2QS4A 2VT5A 3KBRA 4OA4A 3PPQA 1M5FA 1WDNA 1Y1MA 1N84A 4RK9A 3K0VA 1NV3A 1MG1A 3V5AA 5I2KA 1D9VA 2I4BA 3LV0A 2M8CA 5FBPA 1QGXA 5ET7A 1UIVA 4IB2A 2E0SA 3QUFA 4QXDA 3O6HA 2QVUA 5L9MA 2PVUA 5IZ3B 1N76A 3IOVA 5AA2A 5BUUA 4TLLB 4PC9A 2I58A 3OD7A 4U2RA 1DPPA 1MXZA 1LFGA 1XS5A 1SI0A 2DSFA 1B0HA 2WBBA 2ZYMA 3FJMA 4PFRA 4NF5A 4R2FA 1Y1ZA 3B8BA 4RNSA 3K1MA 1Q9DA 5I2NB 1FTAA 4NF8A 2Q88A 4OEVA 1XT8A 2Q2AA 4OQOA 3QUJA 4PAIA 2HPGA 1B7UA 3QIMA 4AS5A 3KN8A 3OEKA 1S9TA 2XXWA 5IZ1A 5KCJA 3BKIB 4WEDA 1OQGA 4LZ8A 3CSBA 5H8QA 3CIJA 4IO7A 1AH5A 1A99A 4IO5A 1MS7A 5B70A 4X8RA 2ZZXA 3OO8A 4NQ8A 1EZOA 3IFAA 4QFLA 5M2VA 1NV0A 4ISUA 4G8HA 3ROJA 5IGAA 2YJPA 2BJIA 3TYHA 3T9HB 4P9KA 1NV6A 3FGSA 3SDFA 2Q74A 4KFQA 1NUXA 3M3FA 3GXAA 3DP6A 1NUZA 3D4CA 4OZ9A 1MDQA 1NKXA 1I6QA 3KN3A 4XEQA 4N81A 4PAKA 1PB9A 5H8NA 2RINA 1FBCA 3D4GA 3FASA 3RYDA 4XKQA 4HE2A 3W9WA 1FPJA 2NVUB 4NF6B 5EHSA 2OLBA 4F1VA 2O68A 4NMYA 3PPRA 4O7MA 4GWYA 2H4IA 3T66A 4U23A 3CHGA 4FECA 2I0BA 1VSOA 4GL0A 1B9JA 4XTCQ 2DVCA 3WAEA 2QVVA 3N6TA 3T0JA 2RF1A 3JYRA 5F1QA 5DVIA 4N91A 3H6VA 4R9GA 1FW0A 1EH3A 1INPA 2Y7RA 2PT2A 3CFLA 4AB6A 1QUKA 2NUVA 4C0RA 1ZLQA 3RUMA 2I49A 4GL8A 5CBRA 3KFMA 3MPLA 1P1OA 4N6KA 3KJ7A 4ZE9A 1ATGA 2DYXA 4H0WA 4U22A 4YAHX 1IIWA 2F8DA 3K2DA 5FTHA 3PPPA 4ELRA 2R6GE 1MM7A 5ESYA 4E0XA 3FVKA 3SEXA 4Z7EA 1PBQA 4NAPA 3CG1A 1B4HA 1NV4A 5FTIA 3F11A 1FPDA 4R74A 3JZJA 5HBCA 2HFBA 2HHMA 3MP8A 4GVOA 5DT6A 3E79A 1OMPA 3OO9A 2F6PA 2AL4A 4U1OA 5L8DA 3IO6A 4KD5A 1KZ8A 2R71A 2XD3A 1IXHA 1EYKA 2RC9A 3RPLB 4THIA 1YAEA 3B6QA 1P1WA 1K9YA 2OBGA 2XX7A 1UIUA 1Y4TA 4HCWA 1XHYA 4EF2A 5DW8A 3BFUA 3TTRA 1MY2A 1NNKA 1NH8A 2VD3A 1SPIA 5DYHA 1RDXA 3H6TA 2KLFA 2XX8A 2DWJA 1FSAA 3HHGA 5ICQA 3G3IA 2D21A 2BJJX 4G61A 2GRVA 3ISPA 3T96B 3VVDA 1G0IA 2XD2A 4M4GA 2A5TB 2QMXA 2ZNTA 4MCOA 4OVQA 4LATA 3O66A 1B5IA 1FBPA 1SVXB 1MQGA 5AA4B 4NN3A 3QMFA 4NG7A 5IZZA 1B5JA 3UORA 4F3GA 3H6UA 1AMFA 1DTGA 4OWDA 2FIXA 3CG3A 3IJOB 3S4UA 5ITOA 1SW4A 4XFEA 1QVSA 1FBFA 3FATA 2UVJA 1LB8A 2P0SA 3PMWA 3T1BA 4ELOA 3LSXA 5I57B 4PFWA 4GD5A 5ET6A 4N6DA 1R6ZA 4GFRA 3U1OA 1P1QA 4F2QA 1OVBA 4WXJA 3Q26A 1NV1A 1POY1 2XWKA 1NUWA 2Y7IA 1OQHA 3OENA 4BDRA 1KA1A 5CM6A 2XXKA 1YXIA 3G3FA 2O51A 2NXOA 1FPIA 3LUYA 4U21A 1B2HA 4OERA 3TODA 4F3PA 2RKMA 5FHOA 4NWCA 3C35A 4JSOA 4ZS9A 1MPDA 3A09A 1MY0A 3H06B 4GX6A 3V8XB 5H8HB 3EHTA 1LSTA 5FHNA 4LQ5A 1LCFA 3FIRA 3PUVE 1LAXA 2A5SA 2XXQA 3IK6B 4Q5TA 1XVXA 2RCAA 3B6WA 4POXA 3C34A 3EN3A 2Y5KA 4EQBA 4JVCA 1HSEA 4ND9A 2F6GA 1MXWA 2VPNA 2A5TA 1N7WA 3CFXA 2Q89A 3C32A 4X9TA 1NMUA 5AA4A 3OXNA 5I3SA 1VDWA 3FXQA 3Q28A 4OANA 2Y7PA 4PDDA 5I2KB 2XWVA 3A3CA 4GWZA 1IZ1A 3U94A 2XXVA 4QFKA 5KDTA 4DDDA 1QUJA 4MHFA 1SYHA 5CMKA 3L6GA 4NF0A 3FVOA 4P1LA 2CZLA 1NV7A 4IGTA 4GBWA 2XX9A 4ZZAA 3IFCA 3KGCA 2ONSA 4OESA 1Y4CA 1LBVA 2RC8A 3K00A 5AA2B 1N3XA 5I5PA 2ZYKA 5CI5A 4PGNA 3TDJA 3MQ9A 1H45A 1MRPA 3I5OA 1B3LA 3LR1A 1FTJA 2PCRA 3SKPA 1IEJA 1SQYA 3MVWA 3O29A 1OLCA 1II5A 4HTGA 2O1LA 3E4RA 4PE5B 1VR5A 4OENA 3PD9A 4LP2B 3C36A 2VOZA 3EHUA 3LSLA 2FA7A 5CBSA 1R9LA 1N3WA 2CMOA 4O3BA 1YTVA 5J1DA 4U4SA 2FBPA 3KC0A 5I7IA 4XXUA 3TQLA 2CZHA 4OYVA 1XC1A 2WYKA 5H8HA 4ZDMA 2HCAA 1GV8A 2QS3A 2F35A 4JWOA 1YPNA 4FAJA 1B1XA 1SW2A 3OO7A 3EPEA 1IMDA 2XXTA 1QW0A 1RYXA 4KYSA 3GZGA 1JVYA 4NE4A 4G4PA 2B4MA 4LVQA 3G3GA 5TU0A 2F34A 1LBCA 2ZZVA 3VLWA 2O6AA 2F97A 1NNFA 2P3NA 4Z0IA 4I3EA 2VHAA 1JW1A 2GHAA 3FUZA 4TLMB 4RJZA 1Y9UA 3TTMA 4O3AA 2ESNA 4FORA 5H8NB 4P0GA 4I9DA 1B3EA 4DZ1A 4PFUA 2OWSA 5B7DA 3M3LA 3KZGA 4ELQA 1LGBC 4GWOA 3TCHA 5KZTA 1LFIA 3EHSA 4H8IA 4YB5A 3THIA 3TQWA 1Y3NA 4FEBA 1FQFA 1OVTA 4PFTA 1B05A 4OVPA 4U1ZA 1JNFA 4HE0A 3IB2A 4NX1A 3TKDA 3M3KA 1NV5A 4ONYA 3HSTA 3FVNA 3IAZA 1FPKA 4O94A 4X04A 5DVJA 3RT8A 4WKMA 1NNTA 1NNPA 4DXBA 2O69A 1FCKA 3RY3A 4NHBA 1PB7A 1BP5A 3EF7A 4MX6A 4N17A 4MH5A 1QUIA 3N94A 1KA0A 3TTLA 3MYUA 1JQFA 3R26A 1SI1A 3U72A 3OO6A 4IR8A 1LFHA 2O7UA 2DP8A 4HXVA 1J1NA 3O97A 2UXAA 1YCJA 1TFDA 4FBPA 2NWJA 2F7CA 3U8QA 2FVZA 2P1SA 1JEUA 1XVYA 3PGFA 3CI8A 5H8FB 5EQ7A 3E3KA 3EQ1A 3PMXA 4JWXA 4N13A 4ZZEA 3K1PA 2Z8FA 3IJXB 1B40A 5K2XA 2CEYA 4UABA 1MXVA 3B7DA 2PT1A 2OZZA 5DVFA 4KPTA 3TZAA 4FJPA 1MQJA 3S9EA 1B52A 3O2AA 1FPLA 1G0HA 1JP4A 3TELA 1H76A 1PBPA 3D1RA 3BIGA 1FRPA 3C33A 1MDP1 2F3BA 3MP1A 5ICTA 1LAFE 4I40A 1O7TA 4DCYA 4KR5A 2XXIA 4RYAA 2GFEA 3T9UA 3LC8A 4NTLA 2LAOA 2X7QA 1DOTA 4RPNA 2Z8EA 3RN8A 4R75A 4TOZA 3MBPA 4GWWA 1JETA 3SESA 3RPWA 4EXKA 3FXRA 2V84A 1IXIA 4QSEA 2HXWA 2QL3A 2KR0A 1CNQA 3BIHA 3U93A 4P8BA 5JTYB 2V93A 3W15C 5LOMA 2WKYA 1Z7NE 2HXRA 4GWSA 4L17A 2Y84A 4QRZA 1LBYA 2GHBA 2CZKA 3Q25A 3R6UA 3SEUA 1FQCA 2V3QA 4GX4A 3LSFB 2DDKA 4OEUA 4KXPA 3FVGA 2R9JA 1IUDA 2F5XA 4C1TA 3ZSFA 1DMBA 4H5GA 2QS1A 5H8FA 1FBDA 4P11A 1FPEA 3PV0E 1B3FA 5I84A 4G68A 4LONB 1PC3A 2Y5LA 4MEVA 3ECRA 1Q35A 2REJA 4GLIA 4OHNA 3PMVA 4KCDA 4YKKA 1B32A 1US5A 3ZKLA 1GR2A 3PUXE 1B58A 3EKIA 1URDA 1JW4A 1JW5A 1LAGE 1XOCA 4N15A 1LEVA 4GX3A 1B5HA 2O7IA 1GTKA 4P0IA 5TP9B 4EDPA 1IMEA 1USYH 5AA3A 5LDZA 4G8NA 4LN5A 1JVXA 3KSJA 4F29A 2XWOA 4N07A 4LQ2A 1IMBA 1N7XA 3BFTA 4IO3A 5CRYA 5TPAA 3FJ7A 4H8JA 3USDA 4R9FA 1UTHB 5KDTB 2F36A 4QSCA 2QPQA 1TWYA 2RCBA 5ET5A 4IGRA 1DBZA 2DS9A 4DXUA 3CSGA 3UA8A 5ISUA 2DQVA 2HAUA 3G3JA 4H1XA 1M5CA 3O6IA 1T0KA 1F9BA 3MZ9A 4JBZA 1DTZA 4NWDA 4GRKA 4PFIA 5JTYA 4X48A 4I1DA 4PQJA 4F18A 3VE1B 2DWAA 1UQWA 3S9MC 3HCQA 3ONMA 4ELPA 2QSXA 5I58B 4G8MA 3ZS6A 1SW1A 3I6VA 3PU5A 3U92A 3T93B 2ZMBA 5I56B 2F3DA 4O8MA 5EYFA 2FNCA 4R73A 4MNCA 1IMCA 1S50A 4DI3D 1NL5A 5EQAA 3PPOA 2ABHA 4XKNA 3C4MA 3OEMA 3ODBA 1AL3A 2DXRA 5DTBA 3V83A 4PDHA 4MAGA 4BLAA 3JV9A 1RDZA 4H46A 3T9XB 2Z22A 4N6PA 4G2ZA 1ZU0A 4QFPA 4PF8A 4FEDA 1IMFA 3Q27A 1MH4A 2XXXA 1UTBB 4R72A 1VE4A 5TP9A 3RQTA 1USYE 2XXHA 4G77A 2WX9A 4YZZA 2O84X 3N26A 4WEPA 1IITA 3K6VA 4ZEDA 2I4CA 3PUYE 1MQDA 5H8SA 3VFJA 3MW0A 2L5VA 4FIMA 4PTKA 1UTHA 1YYZA 4MNIA 3MUQA 3MWBA 3R7XA 4ZEBA 3OSQA 1L5TA 1A8FA 4DCXA 3RGYA 3K1NA 3OMBA 5F24A 2HAVA 1Z7ME 5JK4A 4H5FA 5A5XA 4PAFA 4U4XA 4ESWA 4M1VA 3TTKA 4C1UA 1ZBMA 5K2YA 3DM0A 5EQ9A 3MP6A 4KYDA 5LTCA 1HSJA 3HO7A 3QYTA 3L6HA 4P47A 3DP8A 1VFDA 3TMGA 2REGA 5I58A 1MM6A 2DE2A 2OWZA 1POTA 3VVFA 3IR1A 4YICA 3E78A 3IX1A 3H03A 2WYPA 1HSLA 1FTLA 4JWYA 1P99A 4MFIA 4Q0CA 2OCUA 5EYHA 2QFLA 1K9ZA 3QK6A 5I56A 3H4ZA 2UVHA 2QVRA 4EQ9A 2I48A 5CMMA 3KG2A 1LCTA 4P3LA 3I3VA 2XA5A 2UYEA 1A40A 2HZLA 4I3YA 4YB7A 3TEPA 2ZNSA 2YPNA 1D9YA 1M5BA 3G7WA 2Z8DA 4PF6A 4O7IA 4F1UA 4QFOA 4UACA 2Q2CA 1M5EA 1N04A 5ELVA 2W7YA 1MPBA 3HV1A 4IO6A 1PB8A 3VVEA 4H45A 4MJOA 3IB0A 1UTBA 4FATA 5JEIA 1XI6A 1QKAA 5BWJA 4KQPA 5ITPA 2VPOA 3O28A 3QSLA 3TCGA 3HPIA 3VLUA 1B7ZA 3TPAA 4OFOA 1AWBA 5HM4B 3MVZA 4AQ4A 3IO4A 4ZEIA 1MXYA 4GWXA 2I3VA 1MQHA 1FBEA 1OIBA 3CRBA 2QRYA 2B3FA 2UVIA 3UN6A 3IL1B 1VFEA 2UYFA 1GGGA 3Q29A 4OXVA 5L9OA 3U65A 3ILUB 3SEVA 2I0CA 1B51A 1RDYA 1LB9A 2F7BA 1A55A 3K6XA 4AS4A 4QHQA
chains in the Genus database with same CATH topology
3OOAA 4LZ5A 3VDFA 3S2VA 1BLFA 4MLVA 4X1DA 1AIVA 4IO2A 1M5DA 1IXCA 3C9HA 1ZJLA 1Y20A 1LBBA 4YMAA 2X26A 3IOWA 1B7HA 3TFLA 2F7AA 3MVXA 1TT1A 5DEXA 1I69A 1US4A 3TUSA 4PP0A 2PX1A 1CB6A 3N5LA 4TQUQ 4F31B 4KI0E 3MJNA 3KN7A 3QXMA 2H98A 2Y7WA 2F78A 4ESXA 4OVJA 4R2BA 4JB7A 2XXYA 2B65A 1FQBA 3CVGA 2NOOA 3B6TA 4ZECA 3TAJA 2ZXTA 5L9SA 4OTEA 1EZPA 2DXYA 4EQ7A 4JXIA 1ANFA 1ELJA 2XHDA 1R1NA 5AA2D 2PMSA 4MF3A 5IAIA 4PETA 4G68B 5F7VA 1FTMA 2I6EA 4KHZE 2I3WA 2XXRA 3UP9A 1R9QA 4BDMA 1MXXA 4DXCA 1FQEA 2V25A 2HQ0A 4GF8A 4OFJA 3SEWA 3H7MA 4I8CA 1FTOA 3FV1A 3AXFA 1MPCA 3S9LC 4NF4B 4YKPA 4UA8A 2ANJA 2OWTA 5TPAB 4RA1A 1ZMGA 4HS7A 2V3UA 1B3HA 2GH9A 2Z23A 3UGWA 3RTFB 1SBPA 1BKAA 3DP4A 3H6WA 4HW8A 3FJGA 3V89B 2B3BA 5EHMA 1O63A 5I2NA 1H3DA 1BTJA 3E9XA 5CMCA 1RYOA 4Q8RA 1B4ZA 1SD3A 4GOTA 3DLNA 4KYEA 2DWHA 3IOUA 2YLNA 1CE2A 2AL5A 4RY1A 4F19A 4DLDA 3LSWA 4GXAA 1URGA 3MVYA 3K01A 1MQIA 3RT6B 4IY5A 1EU8A 2Q9TA 4HCYA 5AE4A 3GBAA 4JDFA 3VLVA 3HHFA 1DSNA 4LA9A 4ZE8A 1BIYA 1O64A 3KSXA 1I6BA 2V3TA 1JEVA 4YKJA 2VGQA 2THIA 3MC2A 4RXLA 3K4UA 2XXUA 2H9BA 3MAMA 3VXCA 1S7YA 3GLBA 1Q1KA 1LAHE 3BBRA 3FD3A 4XKPA 2G93A 2PBWA 3CFZA 4YKIA 4G68C 2HEUA 4RK2A 4FE8A 2H25A 4ZEFA 1TXFA 2OK2A 4H6DA 3UIFA 2Y7KA 3K02A 5IKBA 3RLFE 2ONRA 4NF6A 4F1YA 2OJTA 3SEYA 4NF4A 4O3CA 3T9VA 1FTKA 4ZEKA 3T22A 5I59B 4IY6A 1N0TA 4LUBA 4Q30B 3M8UA 3PUWE 3W9VA 1AOVA 4F3SA 3OSRA 3P7IA 3IORA 3O9PA 1PEBA 1OLAA 2VD2A 1LLSA 5A5XB 1SDXA 1A54A 3KEIA 1MH3A 4GXSB 1WODA 1D3KA 4PFYA 1FQAA 3E13X 3C31A 3KJTA 5FHMA 2QS2A 2H99A 2AYSA 2RC7A 4BDOA 2HZKA 1B3GA 4MLQA 2PYYA 4XKRA 3K6WA 2IA4A 1QJMA 3N6UA 4KCCA 4JSDA 1H43A 1IXGA 3PPNA 1B6HA 2UVGA 3K6UA 3VV5A 3RTWB 4E0WA 1P1NA 2ZYNA 1WVJA 4MBPA 3CR9A 4LZ7A 3OELA 3O6GA 1A7LA 4R6YA 5CC2A 1QULA 3MZBA 1ZKBA 3IOTA 2DE4A 3TTNA 1Y3PA 3HN0A 4ECFA 1B1HA 2QMWA 1MY4A 4EUOA 4R6KA 1NFTA 3GBBA 2DVZA 1H44A 4K3FA 3PD8A 1B0LA 4F22A 2Q8JA 3SETA 5AA1A 5I59A 4BDNA 3G3KA 4BDLA 3QAXA 1D4NA 3VXBA 2VP1A 4XIGQ 2O1MA 4F3BA 3S9NC 1MY3A 3MZ1A 3PUZE 1KWHA 1QKBA 1B46A 2IEEA 4X1BA 1TFAA 3KOTA 4H65A 1SW5A 1MY1A 2ZYOA 3A3UA 4GIZA 4DIGA 4GQOA 4DE8A 2P2AA 4YB6A 3DELB 3MPKA 3KOSA 2X7PA 2ALUA 2ZNUA 3FZVA 4QFNA 5I57A 1PDAA 1SYIA 1URSA 4POWA 1ZTYA 4OETA 3IB1A 3ILTB 1A8EA 1GVCA 3RNNA 2G29A 2DE3A 1MXUA 4IO4A 1P1UA 2H5YA 4NF5B 4QF9A 2AIXA 1NH7A 4AB5A 5DEXB 3WAFA 3TCFA 4NF8B 1I6AA 2XXPA 3FXUA 4I62A 1Y3QA 2D3IA 3LBSA 1EZ9A 4OFLA 4OMBA 3G3HA 1ZIUA 5KCJB 2D5WA 2DOJA 4RPOA 2QJEA 3H3GA 4QSDA 5H8QB 4YMBA 2ONKE 4BDQA 2E1SA 2FYIA 3UK4A 4F39A 1IQ7A 5HPQA 1DPEA 4H67A 3ZKKA 4F2OA 3SERA 3FV2A 4EF1A 1FQDA 1RKMA 4R6HA 4YU0A 2DWIA 4EXLA 4NEDA 5CMBA 2QS4A 3KBRA 3PPQA 1M5FA 1WDNA 1Y1MA 1N84A 4RK9A 3K0VA 1MG1A 3V5AA 5I2KA 1D9VA 2I4BA 2M8CA 1UIVA 4IB2A 2E0SA 3QUFA 3O6HA 5L9MA 2PVUA 1N76A 3IOVA 5AA2A 5BUUA 4TLLB 2I58A 3OD7A 4U2RA 1DPPA 1MXZA 1LFGA 1XS5A 1SI0A 2DSFA 1B0HA 2ZYMA 3FJMA 4NF5A 4R2FA 1Y1ZA 4RNSA 3K1MA 5I2NB 4NF8A 2Q88A 4OEVA 1XT8A 2Q2AA 4OQOA 3QUJA 1B7UA 3QIMA 3KN8A 3OEKA 1S9TA 2XXWA 5KCJA 3BKIB 4WEDA 1OQGA 4LZ8A 3CSBA 5H8QA 3CIJA 4IO7A 1AH5A 1A99A 4IO5A 1MS7A 5B70A 3OO8A 1EZOA 4QFLA 5M2VA 4ISUA 4G8HA 2YJPA 3TYHA 3T9HB 3FGSA 3SDFA 4KFQA 3M3FA 3GXAA 3DP6A 3D4CA 4OZ9A 1MDQA 1NKXA 1I6QA 3KN3A 1PB9A 5H8NA 2RINA 3D4GA 3FASA 3W9WA 4XKQA 2NVUB 4NF6B 5EHSA 2OLBA 4F1VA 2O68A 4NMYA 3PPRA 2H4IA 3T66A 4U23A 4FECA 2I0BA 1VSOA 4GL0A 1B9JA 4XTCQ 2DVCA 3WAEA 3N6TA 2RF1A 3JYRA 5F1QA 5DVIA 3H6VA 4R9GA 1FW0A 1EH3A 2Y7RA 2PT2A 3CFLA 4AB6A 1QUKA 2NUVA 4C0RA 1ZLQA 3RUMA 2I49A 4GL8A 5CBRA 3KFMA 3MPLA 1P1OA 3KJ7A 4ZE9A 1ATGA 2DYXA 4H0WA 4U22A 4YAHX 1IIWA 2F8DA 3K2DA 5FTHA 3PPPA 4ELRA 2R6GE 1MM7A 4E0XA 3FVKA 3SEXA 4Z7EA 1PBQA 3CG1A 1B4HA 5FTIA 3F11A 4R74A 3JZJA 5HBCA 2HFBA 3MP8A 4GVOA 5DT6A 1OMPA 3OO9A 2F6PA 2AL4A 4U1OA 5L8DA 3IO6A 4KD5A 2R71A 2XD3A 1IXHA 2RC9A 4THIA 1YAEA 3B6QA 1P1WA 2OBGA 2XX7A 1UIUA 1Y4TA 4HCWA 1XHYA 4EF2A 3BFUA 3TTRA 1MY2A 1NNKA 1NH8A 2VD3A 5DYHA 3H6TA 2KLFA 2XX8A 2DWJA 3HHGA 5ICQA 3G3IA 2D21A 2BJJX 2GRVA 3T96B 3VVDA 2XD2A 4M4GA 2A5TB 2QMXA 2ZNTA 4LATA 3O66A 1B5IA 1SVXB 1MQGA 5AA4B 1B5JA 3UORA 4F3GA 3H6UA 1AMFA 1DTGA 4OWDA 3CG3A 3IJOB 3S4UA 5ITOA 1SW4A 1QVSA 3FATA 2UVJA 1LB8A 2P0SA 3PMWA 4ELOA 3LSXA 5I57B 4PFWA 4GD5A 1R6ZA 4GFRA 3U1OA 1P1QA 4F2QA 1OVBA 4WXJA 3Q26A 1POY1 2Y7IA 1OQHA 3OENA 4BDRA 5CM6A 3G3FA 2O51A 2NXOA 3LUYA 4U21A 1B2HA 4OERA 3TODA 4F3PA 2RKMA 5FHOA 4NWCA 3C35A 4JSOA 4ZS9A 1MPDA 3A09A 1MY0A 3H06B 3V8XB 5H8HB 3EHTA 1LSTA 5FHNA 4LQ5A 1LCFA 3FIRA 3PUVE 1LAXA 2A5SA 2XXQA 3IK6B 4Q5TA 1XVXA 2RCAA 3B6WA 4POXA 3C34A 3EN3A 4EQBA 1HSEA 4ND9A 2F6GA 1MXWA 2A5TA 1N7WA 3CFXA 2Q89A 3C32A 4X9TA 1NMUA 5AA4A 3OXNA 3FXQA 3Q28A 2Y7PA 5I2KB 3A3CA 1IZ1A 3U94A 2XXVA 4QFKA 5KDTA 4DDDA 1QUJA 1SYHA 5CMKA 3L6GA 3FVOA 2CZLA 4IGTA 2XX9A 4ZZAA 3KGCA 2ONSA 4OESA 1Y4CA 2RC8A 3K00A 5AA2B 1N3XA 2ZYKA 5CI5A 3TDJA 3MQ9A 1H45A 1MRPA 3I5OA 1B3LA 3LR1A 1FTJA 3SKPA 1IEJA 1SQYA 3MVWA 3O29A 1OLCA 1II5A 4HTGA 2O1LA 3E4RA 4PE5B 1VR5A 4OENA 3PD9A 4LP2B 3C36A 2VOZA 3EHUA 3LSLA 2FA7A 5CBSA 1R9LA 1N3WA 2CMOA 4O3BA 1YTVA 5J1DA 4U4SA 4XXUA 3TQLA 4OYVA 1XC1A 5H8HA 4ZDMA 2HCAA 1GV8A 2QS3A 2F35A 4JWOA 1YPNA 4FAJA 1B1XA 1SW2A 3OO7A 3EPEA 2XXTA 1QW0A 1RYXA 4KYSA 3GZGA 1JVYA 4NE4A 4G4PA 4LVQA 3G3GA 5TU0A 2F34A 1LBCA 3VLWA 2O6AA 2F97A 1NNFA 4Z0IA 2VHAA 1JW1A 2GHAA 3FUZA 4TLMB 4RJZA 1Y9UA 3TTMA 4O3AA 2ESNA 4FORA 5H8NB 4P0GA 4I9DA 1B3EA 4DZ1A 4PFUA 2OWSA 5B7DA 3M3LA 3KZGA 4ELQA 1LGBC 4GWOA 3TCHA 5KZTA 1LFIA 3EHSA 4H8IA 4YB5A 3THIA 3TQWA 1Y3NA 4FEBA 1FQFA 1OVTA 4PFTA 1B05A 4U1ZA 1JNFA 3IB2A 3TKDA 3M3KA 4ONYA 3HSTA 3FVNA 3IAZA 3RT8A 5DVJA 4WKMA 1NNTA 1NNPA 4DXBA 2O69A 1FCKA 3RY3A 1PB7A 1BP5A 3EF7A 4MH5A 1QUIA 3N94A 3TTLA 1JQFA 3R26A 1SI1A 3U72A 3OO6A 1LFHA 2O7UA 2DP8A 1J1NA 3O97A 2UXAA 1YCJA 1TFDA 2NWJA 2F7CA 3U8QA 2P1SA 1JEUA 1XVYA 3PGFA 3CI8A 5H8FB 3E3KA 3EQ1A 3PMXA 4JWXA 4N13A 4ZZEA 3K1PA 2Z8FA 3IJXB 1B40A 5K2XA 1MXVA 3B7DA 2PT1A 2OZZA 5DVFA 4KPTA 3TZAA 4FJPA 1MQJA 3S9EA 1B52A 3O2AA 3TELA 1H76A 1PBPA 3C33A 1MDP1 3MP1A 5ICTA 1LAFE 1O7TA 4DCYA 4KR5A 2XXIA 4RYAA 2GFEA 3T9UA 3LC8A 4NTLA 2LAOA 2X7QA 1DOTA 4RPNA 2Z8EA 3RN8A 4R75A 4TOZA 3MBPA 1JETA 3SESA 3RPWA 4EXKA 3FXRA 2V84A 1IXIA 4QSEA 2HXWA 2QL3A 3U93A 5JTYB 2V93A 3W15C 5LOMA 2WKYA 1Z7NE 4L17A 2Y84A 4QRZA 2GHBA 3Q25A 3R6UA 3SEUA 1FQCA 2V3QA 3LSFB 4OEUA 3FVGA 2R9JA 1IUDA 2F5XA 4C1TA 3ZSFA 1DMBA 4H5GA 2QS1A 5H8FA 4P11A 3PV0E 1B3FA 5I84A 4G68A 4LONB 1PC3A 3ECRA 1Q35A 2REJA 4GLIA 4OHNA 3PMVA 4KCDA 4YKKA 1B32A 1US5A 3ZKLA 1GR2A 3PUXE 1B58A 1URDA 1JW4A 1JW5A 1LAGE 1XOCA 1B5HA 2O7IA 1GTKA 4P0IA 5TP9B 4EDPA 1USYH 5AA3A 4G8NA 1JVXA 3KSJA 4F29A 4N07A 4LQ2A 1N7XA 3BFTA 4IO3A 5CRYA 5TPAA 3FJ7A 4H8JA 3USDA 4R9FA 1UTHB 5KDTB 2F36A 4QSCA 2QPQA 1TWYA 2RCBA 4IGRA 2DS9A 4DXUA 3CSGA 3UA8A 5ISUA 2DQVA 2HAUA 3G3JA 4H1XA 1M5CA 3O6IA 1T0KA 1F9BA 3MZ9A 4JBZA 1DTZA 4NWDA 4GRKA 5JTYA 4X48A 4I1DA 4PQJA 4F18A 3VE1B 2DWAA 1UQWA 3S9MC 3HCQA 3ONMA 4ELPA 2QSXA 5I58B 4G8MA 3ZS6A 1SW1A 3I6VA 3PU5A 3U92A 3T93B 2ZMBA 5I56B 5EYFA 2FNCA 4R73A 1S50A 1NL5A 3PPOA 2ABHA 4XKNA 3C4MA 3OEMA 3ODBA 1AL3A 2DXRA 5DTBA 3V83A 4BLAA 3JV9A 3T9XB 2Z22A 4N6PA 4G2ZA 1ZU0A 4QFPA 4FEDA 3Q27A 1MH4A 2XXXA 1UTBB 4R72A 1VE4A 5TP9A 3RQTA 1USYE 2XXHA 4G77A 4YZZA 2O84X 3N26A 4WEPA 1IITA 3K6VA 4ZEDA 2I4CA 3PUYE 1MQDA 5H8SA 3VFJA 3MW0A 4FIMA 1UTHA 3MUQA 3MWBA 3R7XA 4ZEBA 3OSQA 1L5TA 1A8FA 4DCXA 3RGYA 3K1NA 3OMBA 2HAVA 1Z7ME 5JK4A 4H5FA 5A5XA 4ESWA 4U4XA 4M1VA 3TTKA 4C1UA 1ZBMA 5K2YA 3DM0A 3MP6A 4KYDA 1HSJA 3HO7A 3QYTA 3L6HA 3DP8A 1VFDA 3TMGA 2REGA 5I58A 1MM6A 2DE2A 1POTA 3VVFA 3IR1A 4YICA 3IX1A 3H03A 1HSLA 1FTLA 4JWYA 1P99A 4MFIA 4Q0CA 2OCUA 3QK6A 5I56A 3H4ZA 2UVHA 4EQ9A 2I48A 5CMMA 3KG2A 1LCTA 3I3VA 2UYEA 1A40A 2HZLA 4YB7A 3TEPA 2ZNSA 2YPNA 1D9YA 1M5BA 3G7WA 2Z8DA 4F1UA 4QFOA 4UACA 2Q2CA 1M5EA 1N04A 5ELVA 2W7YA 1MPBA 3HV1A 4IO6A 1PB8A 3VVEA 3IB0A 1UTBA 4FATA 5JEIA 1QKAA 5BWJA 4KQPA 5ITPA 3O28A 3QSLA 3TCGA 3HPIA 3VLUA 1B7ZA 3TPAA 4OFOA 5HM4B 3MVZA 4AQ4A 3IO4A 4ZEIA 1MXYA 2I3VA 1MQHA 1OIBA 3CRBA 2QRYA 2B3FA 2UVIA 3UN6A 3IL1B 1VFEA 2UYFA 1GGGA 3Q29A 4OXVA 5L9OA 3ILUB 3SEVA 2I0CA 1B51A 1LB9A 2F7BA 1A55A 3K6XA 4QHQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOA A;  4LZ5 A;  3VDF A;  3S2V A;  1BLF A;  4MLV A;  4X1D A;  1AIV A;  4IO2 A;  1M5D A;  1IXC A;  3C9H A;  1ZJL A;  1Y20 A;  1LBB A;  4YMA A;  2X26 A;  3IOW A;  1B7H A;  3TFL A;  2F7A A;  3MVX A;  1TT1 A;  5DEX A;  1I69 A;  1US4 A;  3TUS A;  4PP0 A;  2PX1 A;  1CB6 A;  3N5L A;  4TQU Q;  4F31 B;  4KI0 E;  3MJN A;  3KN7 A;  3QXM A;  2H98 A;  2Y7W A;  2F78 A;  4ESX A;  4OVJ A;  4R2B A;  4JB7 A;  2XXY A;  2B65 A;  1FQB A;  3CVG A;  2NOO A;  3B6T A;  4ZEC A;  3TAJ A;  2ZXT A;  5L9S A;  4OTE A;  1EZP A;  2DXY A;  4EQ7 A;  4JXI A;  1ANF A;  1ELJ A;  2XHD A;  1R1N A;  5AA2 D;  2PMS A;  4MF3 A;  5IAI A;  4PET A;  4G68 B;  5F7V A;  1FTM A;  2I6E A;  4KHZ E;  2I3W A;  2XXR A;  3UP9 A;  1R9Q A;  4BDM A;  1MXX A;  4DXC A;  1FQE A;  2V25 A;  2HQ0 A;  4GF8 A;  4OFJ A;  3SEW A;  3H7M A;  4I8C A;  1FTO A;  3FV1 A;  3AXF A;  1MPC A;  3S9L C;  4NF4 B;  4YKP A;  4UA8 A;  2ANJ A;  2OWT A;  5TPA B;  4RA1 A;  1ZMG A;  4HS7 A;  2V3U A;  1B3H A;  2GH9 A;  2Z23 A;  3UGW A;  3RTF B;  1SBP A;  1BKA A;  3DP4 A;  3H6W A;  4HW8 A;  3FJG A;  3V89 B;  2B3B A;  5EHM A;  1O63 A;  5I2N A;  1H3D A;  1BTJ A;  3E9X A;  5CMC A;  1RYO A;  4Q8R A;  1B4Z A;  1SD3 A;  4GOT A;  3DLN A;  4KYE A;  2DWH A;  3IOU A;  2YLN A;  1CE2 A;  2AL5 A;  4RY1 A;  4F19 A;  4DLD A;  3LSW A;  4GXA A;  1URG A;  3MVY A;  3K01 A;  1MQI A;  3RT6 B;  4IY5 A;  1EU8 A;  2Q9T A;  4HCY A;  5AE4 A;  3GBA A;  4JDF A;  3VLV A;  3HHF A;  1DSN A;  4LA9 A;  4ZE8 A;  1BIY A;  1O64 A;  3KSX A;  1I6B A;  2V3T A;  1JEV A;  4YKJ A;  2VGQ A;  2THI A;  3MC2 A;  4RXL A;  3K4U A;  2XXU A;  2H9B A;  3MAM A;  3VXC A;  1S7Y A;  3GLB A;  1Q1K A;  1LAH E;  3BBR A;  3FD3 A;  4XKP A;  2G93 A;  2PBW A;  3CFZ A;  4YKI A;  4G68 C;  2HEU A;  4RK2 A;  4FE8 A;  2H25 A;  4ZEF A;  1TXF A;  2OK2 A;  4H6D A;  3UIF A;  2Y7K A;  3K02 A;  5IKB A;  3RLF E;  2ONR A;  4NF6 A;  4F1Y A;  2OJT A;  3SEY A;  4NF4 A;  4O3C A;  3T9V A;  1FTK A;  4ZEK A;  3T22 A;  5I59 B;  4IY6 A;  1N0T A;  4LUB A;  4Q30 B;  3M8U A;  3PUW E;  3W9V A;  1AOV A;  4F3S A;  3OSR A;  3P7I A;  3IOR A;  3O9P A;  1PEB A;  1OLA A;  2VD2 A;  1LLS A;  5A5X B;  1SDX A;  1A54 A;  3KEI A;  1MH3 A;  4GXS B;  1WOD A;  1D3K A;  4PFY A;  1FQA A;  3E13 X;  3C31 A;  3KJT A;  5FHM A;  2QS2 A;  2H99 A;  2AYS A;  2RC7 A;  4BDO A;  2HZK A;  1B3G A;  4MLQ A;  2PYY A;  4XKR A;  3K6W A;  2IA4 A;  1QJM A;  3N6U A;  4KCC A;  4JSD A;  1H43 A;  1IXG A;  3PPN A;  1B6H A;  2UVG A;  3K6U A;  3VV5 A;  3RTW B;  4E0W A;  1P1N A;  2ZYN A;  1WVJ A;  4MBP A;  3CR9 A;  4LZ7 A;  3OEL A;  3O6G A;  1A7L A;  4R6Y A;  5CC2 A;  1QUL A;  3MZB A;  1ZKB A;  3IOT A;  2DE4 A;  3TTN A;  1Y3P A;  3HN0 A;  4ECF A;  1B1H A;  2QMW A;  1MY4 A;  4EUO A;  4R6K A;  1NFT A;  3GBB A;  2DVZ A;  1H44 A;  4K3F A;  3PD8 A;  1B0L A;  4F22 A;  2Q8J A;  3SET A;  5AA1 A;  5I59 A;  4BDN A;  3G3K A;  4BDL A;  3QAX A;  1D4N A;  3VXB A;  2VP1 A;  4XIG Q;  2O1M A;  4F3B A;  3S9N C;  1MY3 A;  3MZ1 A;  3PUZ E;  1KWH A;  1QKB A;  1B46 A;  2IEE A;  4X1B A;  1TFA A;  3KOT A;  4H65 A;  1SW5 A;  1MY1 A;  2ZYO A;  3A3U A;  4GIZ A;  4DIG A;  4GQO A;  4DE8 A;  2P2A A;  4YB6 A;  3DEL B;  3MPK A;  3KOS A;  2X7P A;  2ALU A;  2ZNU A;  3FZV A;  4QFN A;  5I57 A;  1PDA A;  1SYI A;  1URS A;  4POW A;  1ZTY A;  4OET A;  3IB1 A;  3ILT B;  1A8E A;  1GVC A;  3RNN A;  2G29 A;  2DE3 A;  1MXU A;  4IO4 A;  1P1U A;  2H5Y A;  4NF5 B;  4QF9 A;  2AIX A;  1NH7 A;  4AB5 A;  5DEX B;  3WAF A;  3TCF A;  4NF8 B;  1I6A A;  2XXP A;  3FXU A;  4I62 A;  1Y3Q A;  2D3I A;  3LBS A;  1EZ9 A;  4OFL A;  4OMB A;  3G3H A;  1ZIU A;  5KCJ B;  2D5W A;  2DOJ A;  4RPO A;  2QJE A;  3H3G A;  4QSD A;  5H8Q B;  4YMB A;  2ONK E;  4BDQ A;  2E1S A;  2FYI A;  3UK4 A;  4F39 A;  1IQ7 A;  5HPQ A;  1DPE A;  4H67 A;  3ZKK A;  4F2O A;  3SER A;  3FV2 A;  4EF1 A;  1FQD A;  1RKM A;  4R6H A;  4YU0 A;  2DWI A;  4EXL A;  4NED A;  5CMB A;  2QS4 A;  3KBR A;  3PPQ A;  1M5F A;  1WDN A;  1Y1M A;  1N84 A;  4RK9 A;  3K0V A;  1MG1 A;  3V5A A;  5I2K A;  1D9V A;  2I4B A;  2M8C A;  1UIV A;  4IB2 A;  2E0S A;  3QUF A;  3O6H A;  5L9M A;  2PVU A;  1N76 A;  3IOV A;  5AA2 A;  5BUU A;  4TLL B;  2I58 A;  3OD7 A;  4U2R A;  1DPP A;  1MXZ A;  1LFG A;  1XS5 A;  1SI0 A;  2DSF A;  1B0H A;  2ZYM A;  3FJM A;  4NF5 A;  4R2F A;  1Y1Z A;  4RNS A;  3K1M A;  5I2N B;  4NF8 A;  2Q88 A;  4OEV A;  1XT8 A;  2Q2A A;  4OQO A;  3QUJ A;  1B7U A;  3QIM A;  3KN8 A;  3OEK A;  1S9T A;  2XXW A;  5KCJ A;  3BKI B;  4WED A;  1OQG A;  4LZ8 A;  3CSB A;  5H8Q A;  3CIJ A;  4IO7 A;  1AH5 A;  1A99 A;  4IO5 A;  1MS7 A;  5B70 A;  3OO8 A;  1EZO A;  4QFL A;  5M2V A;  4ISU A;  4G8H A;  2YJP A;  3TYH A;  3T9H B;  3FGS A;  3SDF A;  4KFQ A;  3M3F A;  3GXA A;  3DP6 A;  3D4C A;  4OZ9 A;  1MDQ A;  1NKX A;  1I6Q A;  3KN3 A;  1PB9 A;  5H8N A;  2RIN A;  3D4G A;  3FAS A;  3W9W A;  4XKQ A;  2NVU B;  4NF6 B;  5EHS A;  2OLB A;  4F1V A;  2O68 A;  4NMY A;  3PPR A;  2H4I A;  3T66 A;  4U23 A;  4FEC A;  2I0B A;  1VSO A;  4GL0 A;  1B9J A;  4XTC Q;  2DVC A;  3WAE A;  3N6T A;  2RF1 A;  3JYR A;  5F1Q A;  5DVI A;  3H6V A;  4R9G A;  1FW0 A;  1EH3 A;  2Y7R A;  2PT2 A;  3CFL A;  4AB6 A;  1QUK A;  2NUV A;  4C0R A;  1ZLQ A;  3RUM A;  2I49 A;  4GL8 A;  5CBR A;  3KFM A;  3MPL A;  1P1O A;  3KJ7 A;  4ZE9 A;  1ATG A;  2DYX A;  4H0W A;  4U22 A;  4YAH X;  1IIW A;  2F8D A;  3K2D A;  5FTH A;  3PPP A;  4ELR A;  2R6G E;  1MM7 A;  4E0X A;  3FVK A;  3SEX A;  4Z7E A;  1PBQ A;  3CG1 A;  1B4H A;  5FTI A;  3F11 A;  4R74 A;  3JZJ A;  5HBC A;  2HFB A;  3MP8 A;  4GVO A;  5DT6 A;  1OMP A;  3OO9 A;  2F6P A;  2AL4 A;  4U1O A;  5L8D A;  3IO6 A;  4KD5 A;  2R71 A;  2XD3 A;  1IXH A;  2RC9 A;  4THI A;  1YAE A;  3B6Q A;  1P1W A;  2OBG A;  2XX7 A;  1UIU A;  1Y4T A;  4HCW A;  1XHY A;  4EF2 A;  3BFU A;  3TTR A;  1MY2 A;  1NNK A;  1NH8 A;  2VD3 A;  5DYH A;  3H6T A;  2KLF A;  2XX8 A;  2DWJ A;  3HHG A;  5ICQ A;  3G3I A;  2D21 A;  2BJJ X;  2GRV A;  3T96 B;  3VVD A;  2XD2 A;  4M4G A;  2A5T B;  2QMX A;  2ZNT A;  4LAT A;  3O66 A;  1B5I A;  1SVX B;  1MQG A;  5AA4 B;  1B5J A;  3UOR A;  4F3G A;  3H6U A;  1AMF A;  1DTG A;  4OWD A;  3CG3 A;  3IJO B;  3S4U A;  5ITO A;  1SW4 A;  1QVS A;  3FAT A;  2UVJ A;  1LB8 A;  2P0S A;  3PMW A;  4ELO A;  3LSX A;  5I57 B;  4PFW A;  4GD5 A;  1R6Z A;  4GFR A;  3U1O A;  1P1Q A;  4F2Q A;  1OVB A;  4WXJ A;  3Q26 A;  1POY 1;  2Y7I A;  1OQH A;  3OEN A;  4BDR A;  5CM6 A;  3G3F A;  2O51 A;  2NXO A;  3LUY A;  4U21 A;  1B2H A;  4OER A;  3TOD A;  4F3P A;  2RKM A;  5FHO A;  4NWC A;  3C35 A;  4JSO A;  4ZS9 A;  1MPD A;  3A09 A;  1MY0 A;  3H06 B;  3V8X B;  5H8H B;  3EHT A;  1LST A;  5FHN A;  4LQ5 A;  1LCF A;  3FIR A;  3PUV E;  1LAX A;  2A5S A;  2XXQ A;  3IK6 B;  4Q5T A;  1XVX A;  2RCA A;  3B6W A;  4POX A;  3C34 A;  3EN3 A;  4EQB A;  1HSE A;  4ND9 A;  2F6G A;  1MXW A;  2A5T A;  1N7W A;  3CFX A;  2Q89 A;  3C32 A;  4X9T A;  1NMU A;  5AA4 A;  3OXN A;  3FXQ A;  3Q28 A;  2Y7P A;  5I2K B;  3A3C A;  1IZ1 A;  3U94 A;  2XXV A;  4QFK A;  5KDT A;  4DDD A;  1QUJ A;  1SYH A;  5CMK A;  3L6G A;  3FVO A;  2CZL A;  4IGT A;  2XX9 A;  4ZZA A;  3KGC A;  2ONS A;  4OES A;  1Y4C A;  2RC8 A;  3K00 A;  5AA2 B;  1N3X A;  2ZYK A;  5CI5 A;  3TDJ A;  3MQ9 A;  1H45 A;  1MRP A;  3I5O A;  1B3L A;  3LR1 A;  1FTJ A;  3SKP A;  1IEJ A;  1SQY A;  3MVW A;  3O29 A;  1OLC A;  1II5 A;  4HTG A;  2O1L A;  3E4R A;  4PE5 B;  1VR5 A;  4OEN A;  3PD9 A;  4LP2 B;  3C36 A;  2VOZ A;  3EHU A;  3LSL A;  2FA7 A;  5CBS A;  1R9L A;  1N3W A;  2CMO A;  4O3B A;  1YTV A;  5J1D A;  4U4S A;  4XXU A;  3TQL A;  4OYV A;  1XC1 A;  5H8H A;  4ZDM A;  2HCA A;  1GV8 A;  2QS3 A;  2F35 A;  4JWO A;  1YPN A;  4FAJ A;  1B1X A;  1SW2 A;  3OO7 A;  3EPE A;  2XXT A;  1QW0 A;  1RYX A;  4KYS A;  3GZG A;  1JVY A;  4NE4 A;  4G4P A;  4LVQ A;  3G3G A;  5TU0 A;  2F34 A;  1LBC A;  3VLW A;  2O6A A;  2F97 A;  1NNF A;  4Z0I A;  2VHA A;  1JW1 A;  2GHA A;  3FUZ A;  4TLM B;  4RJZ A;  1Y9U A;  3TTM A;  4O3A A;  2ESN A;  4FOR A;  5H8N B;  4P0G A;  4I9D A;  1B3E A;  4DZ1 A;  4PFU A;  2OWS A;  5B7D A;  3M3L A;  3KZG A;  4ELQ A;  1LGB C;  4GWO A;  3TCH A;  5KZT A;  1LFI A;  3EHS A;  4H8I A;  4YB5 A;  3THI A;  3TQW A;  1Y3N A;  4FEB A;  1FQF A;  1OVT A;  4PFT A;  1B05 A;  4U1Z A;  1JNF A;  3IB2 A;  3TKD A;  3M3K A;  4ONY A;  3HST A;  3FVN A;  3IAZ A;  3RT8 A;  5DVJ A;  4WKM A;  1NNT A;  1NNP A;  4DXB A;  2O69 A;  1FCK A;  3RY3 A;  1PB7 A;  1BP5 A;  3EF7 A;  4MH5 A;  1QUI A;  3N94 A;  3TTL A;  1JQF A;  3R26 A;  1SI1 A;  3U72 A;  3OO6 A;  1LFH A;  2O7U A;  2DP8 A;  1J1N A;  3O97 A;  2UXA A;  1YCJ A;  1TFD A;  2NWJ A;  2F7C A;  3U8Q A;  2P1S A;  1JEU A;  1XVY A;  3PGF A;  3CI8 A;  5H8F B;  3E3K A;  3EQ1 A;  3PMX A;  4JWX A;  4N13 A;  4ZZE A;  3K1P A;  2Z8F A;  3IJX B;  1B40 A;  5K2X A;  1MXV A;  3B7D A;  2PT1 A;  2OZZ A;  5DVF A;  4KPT A;  3TZA A;  4FJP A;  1MQJ A;  3S9E A;  1B52 A;  3O2A A;  3TEL A;  1H76 A;  1PBP A;  3C33 A;  1MDP 1;  3MP1 A;  5ICT A;  1LAF E;  1O7T A;  4DCY A;  4KR5 A;  2XXI A;  4RYA A;  2GFE A;  3T9U A;  3LC8 A;  4NTL A;  2LAO A;  2X7Q A;  1DOT A;  4RPN A;  2Z8E A;  3RN8 A;  4R75 A;  4TOZ A;  3MBP A;  1JET A;  3SES A;  3RPW A;  4EXK A;  3FXR A;  2V84 A;  1IXI A;  4QSE A;  2HXW A;  2QL3 A;  3U93 A;  5JTY B;  2V93 A;  3W15 C;  5LOM A;  2WKY A;  1Z7N E;  4L17 A;  2Y84 A;  4QRZ A;  2GHB A;  3Q25 A;  3R6U A;  3SEU A;  1FQC A;  2V3Q A;  3LSF B;  4OEU A;  3FVG A;  2R9J A;  1IUD A;  2F5X A;  4C1T A;  3ZSF A;  1DMB A;  4H5G A;  2QS1 A;  5H8F A;  4P11 A;  3PV0 E;  1B3F A;  5I84 A;  4G68 A;  4LON B;  1PC3 A;  3ECR A;  1Q35 A;  2REJ A;  4GLI A;  4OHN A;  3PMV A;  4KCD A;  4YKK A;  1B32 A;  1US5 A;  3ZKL A;  1GR2 A;  3PUX E;  1B58 A;  1URD A;  1JW4 A;  1JW5 A;  1LAG E;  1XOC A;  1B5H A;  2O7I A;  1GTK A;  4P0I A;  5TP9 B;  4EDP A;  1USY H;  5AA3 A;  4G8N A;  1JVX A;  3KSJ A;  4F29 A;  4N07 A;  4LQ2 A;  1N7X A;  3BFT A;  4IO3 A;  5CRY A;  5TPA A;  3FJ7 A;  4H8J A;  3USD A;  4R9F A;  1UTH B;  5KDT B;  2F36 A;  4QSC A;  2QPQ A;  1TWY A;  2RCB A;  4IGR A;  2DS9 A;  4DXU A;  3CSG A;  3UA8 A;  5ISU A;  2DQV A;  2HAU A;  3G3J A;  4H1X A;  1M5C A;  3O6I A;  1T0K A;  1F9B A;  3MZ9 A;  4JBZ A;  1DTZ A;  4NWD A;  4GRK A;  5JTY A;  4X48 A;  4I1D A;  4PQJ A;  4F18 A;  3VE1 B;  2DWA A;  1UQW A;  3S9M C;  3HCQ A;  3ONM A;  4ELP A;  2QSX A;  5I58 B;  4G8M A;  3ZS6 A;  1SW1 A;  3I6V A;  3PU5 A;  3U92 A;  3T93 B;  2ZMB A;  5I56 B;  5EYF A;  2FNC A;  4R73 A;  1S50 A;  1NL5 A;  3PPO A;  2ABH A;  4XKN A;  3C4M A;  3OEM A;  3ODB A;  1AL3 A;  2DXR A;  5DTB A;  3V83 A;  4BLA A;  3JV9 A;  3T9X B;  2Z22 A;  4N6P A;  4G2Z A;  1ZU0 A;  4QFP A;  4FED A;  3Q27 A;  1MH4 A;  2XXX A;  1UTB B;  4R72 A;  1VE4 A;  5TP9 A;  3RQT A;  1USY E;  2XXH A;  4G77 A;  4YZZ A;  2O84 X;  3N26 A;  4WEP A;  1IIT A;  3K6V A;  4ZED A;  2I4C A;  3PUY E;  1MQD A;  5H8S A;  3VFJ A;  3MW0 A;  4FIM A;  1UTH A;  3MUQ A;  3MWB A;  3R7X A;  4ZEB A;  3OSQ A;  1L5T A;  1A8F A;  4DCX A;  3RGY A;  3K1N A;  3OMB A;  2HAV A;  1Z7M E;  5JK4 A;  4H5F A;  5A5X A;  4ESW A;  4U4X A;  4M1V A;  3TTK A;  4C1U A;  1ZBM A;  5K2Y A;  3DM0 A;  3MP6 A;  4KYD A;  1HSJ A;  3HO7 A;  3QYT A;  3L6H A;  3DP8 A;  1VFD A;  3TMG A;  2REG A;  5I58 A;  1MM6 A;  2DE2 A;  1POT A;  3VVF A;  3IR1 A;  4YIC A;  3IX1 A;  3H03 A;  1HSL A;  1FTL A;  4JWY A;  1P99 A;  4MFI A;  4Q0C A;  2OCU A;  3QK6 A;  5I56 A;  3H4Z A;  2UVH A;  4EQ9 A;  2I48 A;  5CMM A;  3KG2 A;  1LCT A;  3I3V A;  2UYE A;  1A40 A;  2HZL A;  4YB7 A;  3TEP A;  2ZNS A;  2YPN A;  1D9Y A;  1M5B A;  3G7W A;  2Z8D A;  4F1U A;  4QFO A;  4UAC A;  2Q2C A;  1M5E A;  1N04 A;  5ELV A;  2W7Y A;  1MPB A;  3HV1 A;  4IO6 A;  1PB8 A;  3VVE A;  3IB0 A;  1UTB A;  4FAT A;  5JEI A;  1QKA A;  5BWJ A;  4KQP A;  5ITP A;  3O28 A;  3QSL A;  3TCG A;  3HPI A;  3VLU A;  1B7Z A;  3TPA A;  4OFO A;  5HM4 B;  3MVZ A;  4AQ4 A;  3IO4 A;  4ZEI A;  1MXY A;  2I3V A;  1MQH A;  1OIB A;  3CRB A;  2QRY A;  2B3F A;  2UVI A;  3UN6 A;  3IL1 B;  1VFE A;  2UYF A;  1GGG A;  3Q29 A;  4OXV A;  5L9O A;  3ILU B;  3SEV A;  2I0C A;  1B51 A;  1LB9 A;  2F7B A;  1A55 A;  3K6X A;  4QHQ A; 
#chains in the Genus database with same CATH topology
 3OOA A;  4LZ5 A;  3PTY A;  3VDF A;  4PE3 A;  3S2V A;  1BLF A;  4MLV A;  2V4C A;  5A5L A;  4X1D A;  2R8T A;  4IO2 A;  1AIV A;  1M5D A;  2P3V A;  1IXC A;  3C9H A;  1BK4 A;  1ZJL A;  1Y20 A;  1LBB A;  4YMA A;  2X26 A;  3IOW A;  4OVR A;  1B7H A;  3TFL A;  2F7A A;  3MVX A;  1TT1 A;  5DEX A;  1I69 A;  4PBH A;  2JJK A;  4DI4 B;  4N4U A;  1US4 A;  3TUS A;  4PP0 A;  2PX1 A;  1CB6 A;  3N5L A;  4TQU Q;  4F31 B;  4KI0 E;  3MJN A;  3KN7 A;  3QXM A;  2H98 A;  2Y7W A;  2F78 A;  4ESX A;  4OVJ A;  4R2B A;  4JB7 A;  2XXY A;  1FJ6 A;  2B65 A;  1FQB A;  1FBG A;  3CVG A;  2NOO A;  3B6T A;  4ZEC A;  3TAJ A;  2ZXT A;  5L9S A;  4OTE A;  1EZP A;  1YZ0 A;  2DXY A;  4EQ7 A;  1LBZ A;  4JXI A;  1ANF A;  1ELJ A;  2XHD A;  1R1N A;  5AA2 D;  2PMS A;  4MF3 A;  5IAI A;  4PET A;  4G68 B;  5F7V A;  1FTM A;  2I6E A;  4KHZ E;  2I3W A;  2XXR A;  3UP9 A;  1R9Q A;  4BDM A;  1MXX A;  4DXC A;  1LBW A;  1EYI A;  1FQE A;  2V25 A;  2HQ0 A;  4GF8 A;  4OFJ A;  3SEW A;  3H7M A;  3MST A;  4I8C A;  1FTO A;  3FV1 A;  3AXF A;  2CEX A;  1MPC A;  3S9L C;  2FHY A;  1LBX A;  4NF4 B;  1DCU A;  4YKP A;  5IZ3 A;  4UA8 A;  2ANJ A;  2OWT A;  5TPA B;  4RA1 A;  1ZMG A;  4GWU A;  4HS7 A;  2V3U A;  1B3H A;  2GH9 A;  2Z23 A;  3UGW A;  3RTF B;  1SBP A;  1BKA A;  3DP4 A;  3FXB A;  1NUY A;  3H6W A;  4HW8 A;  3FJG A;  3V89 B;  2B3B A;  5EHM A;  1O63 A;  4QBA A;  5I2N A;  1H3D A;  1BTJ A;  3E9X A;  5CMC A;  5ET8 A;  1RYO A;  4Q8R A;  1B4Z A;  1SD3 A;  5IM2 A;  4GOT A;  2FIE A;  3HFU A;  3DLN A;  4KYE A;  2DWH A;  3IOU A;  2YLN A;  1CE2 A;  2AL5 A;  5T3J A;  4RY1 A;  4F19 A;  4DLD A;  3LSW A;  4GXA A;  4PBQ A;  1URG A;  3MVY A;  3K01 A;  1MQI A;  3RT6 B;  4IY5 A;  1EU8 A;  2Q9T A;  2WEF A;  4HCY A;  5AE4 A;  3GBA A;  4JDF A;  3VLV A;  3HHF A;  1DSN A;  1IMA A;  4LA9 A;  4ZE8 A;  1BIY A;  1O64 A;  3KSX A;  1I6B A;  5EYG A;  2V3T A;  1JEV A;  1EYJ A;  3A29 A;  4YKJ A;  2VGQ A;  2THI A;  3MC2 A;  4RXL A;  3K4U A;  2XXU A;  2H9B A;  3MAM A;  3VXC A;  1S7Y A;  3GLB A;  1Q1K A;  1LAH E;  3BBR A;  3FD3 A;  4XKP A;  2G93 A;  2PBW A;  3CFZ A;  3SZP A;  2WBD A;  4YKI A;  4G68 C;  2HEU A;  4RK2 A;  4FE8 A;  2H25 A;  4ZEF A;  1TXF A;  2OK2 A;  4H6D A;  4N8G A;  3UIF A;  2Y7K A;  3K02 A;  5IKB A;  3RLF E;  2ONR A;  4NF6 A;  4F1Y A;  2OJT A;  3SEY A;  4NF4 A;  4O3C A;  3T9V A;  1FTK A;  2Q8M A;  1D9Q A;  1NI9 A;  4ZEK A;  3T22 A;  5I59 B;  4IY6 A;  1FPF A;  1N0T A;  4LUB A;  4Q30 B;  3M8U A;  3PUW E;  3W9V A;  3FBP A;  1AOV A;  4F3S A;  3OSR A;  3B50 A;  2B4L A;  3P7I A;  3IOR A;  3O9P A;  1PEB A;  3GYY A;  4PGP A;  1OLA A;  2VD2 A;  1LLS A;  5A5X B;  1SDX A;  1A54 A;  3KEI A;  1MH3 A;  4GXS B;  1WOD A;  4N8Y A;  1D3K A;  4PFY A;  1FQA A;  4JVD A;  3E13 X;  3C31 A;  3KJT A;  5FHM A;  2QS2 A;  2H99 A;  2AYS A;  2XWI A;  2RC7 A;  4BDO A;  2HZK A;  1B3G A;  4MLQ A;  2PYY A;  4XKR A;  3K6W A;  2IA4 A;  1QJM A;  3N6U A;  4KCC A;  4JSD A;  1H43 A;  1IXG A;  3PPN A;  1B6H A;  2UVG A;  3K6U A;  3KBZ A;  3VV5 A;  3RTW B;  4E0W A;  1FPB A;  1P1N A;  2ZYN A;  1WVJ A;  4MBP A;  3RPL A;  3CR9 A;  5J16 A;  4LZ7 A;  3OEL A;  4XF5 A;  3O6G A;  1A7L A;  4R6Y A;  5CC2 A;  1QUL A;  3MZB A;  1ZKB A;  3IOT A;  2DE4 A;  3TTN A;  1Y3P A;  3HN0 A;  4ECF A;  1B1H A;  2QMW A;  1MY4 A;  4EUO A;  4NGU A;  4JVI A;  4R6K A;  1NFT A;  3GBB A;  2DVZ A;  4MNP A;  1H44 A;  4K3F A;  3PD8 A;  1B0L A;  4F22 A;  2Q8J A;  3SET A;  5AA1 A;  5I59 A;  4BDN A;  3G3K A;  5EQ8 A;  4MIJ A;  4BDL A;  3QAX A;  1D4N A;  3VXB A;  2VP1 A;  4XIG Q;  2O1M A;  4F3B A;  3KC1 A;  3S9N C;  1MY3 A;  3MZ1 A;  3PUZ E;  1KWH A;  1QKB A;  2KQZ A;  1FPG A;  1B46 A;  2IEE A;  4X1B A;  1TFA A;  3KOT A;  4H65 A;  1SW5 A;  1MY1 A;  2ZYO A;  3A3U A;  4GIZ A;  4DIG A;  4GQO A;  2PFZ A;  4DE8 A;  2P2A A;  4YB6 A;  3DEL B;  4OVS A;  3MPK A;  3KOS A;  2X7P A;  1FJ9 A;  2ALU A;  4P1E A;  2ZNU A;  3FZV A;  4QFN A;  3LUZ A;  5I57 A;  2OX3 A;  1PDA A;  1SYI A;  1URS A;  1NV2 A;  4OVT A;  4POW A;  1ZTY A;  2PFY A;  4OET A;  3IB1 A;  3ILT B;  1A8E A;  1FBH A;  1GVC A;  3RNN A;  2G29 A;  2DE3 A;  1MXU A;  2ZZW A;  4IO4 A;  1P1U A;  4HE1 A;  2H5Y A;  4NF5 B;  4QF9 A;  2AIX A;  1NH7 A;  4AB5 A;  4GBV A;  5DEX B;  3WAF A;  3TCF A;  3NOH A;  4NF8 B;  1I6A A;  2XXP A;  3FXU A;  4I62 A;  1Y3Q A;  2D3I A;  3LBS A;  1EZ9 A;  4MMP A;  4OFL A;  4OMB A;  2CZI A;  1ZIU A;  3G3H A;  5KCJ B;  2D5W A;  2DOJ A;  4RPO A;  2QJE A;  3H3G A;  4QSD A;  5H8Q B;  4YMB A;  2ONK E;  4BDQ A;  2E1S A;  2FYI A;  3UK4 A;  2GQ1 A;  4F39 A;  1IQ7 A;  5HPQ A;  1DPE A;  4H67 A;  3ZKK A;  4F2O A;  3SER A;  1DK4 A;  3FV2 A;  4EF1 A;  1FQD A;  2MKZ A;  1RKM A;  4P56 A;  4R6H A;  4PCD A;  4PFB A;  4YU0 A;  2DWI A;  4EXL A;  4NED A;  5CMB A;  2QS4 A;  2VT5 A;  3KBR A;  4OA4 A;  3PPQ A;  1M5F A;  1WDN A;  1Y1M A;  1N84 A;  4RK9 A;  3K0V A;  1NV3 A;  1MG1 A;  3V5A A;  5I2K A;  1D9V A;  2I4B A;  3LV0 A;  2M8C A;  5FBP A;  1QGX A;  5ET7 A;  1UIV A;  4IB2 A;  2E0S A;  3QUF A;  4QXD A;  3O6H A;  2QVU A;  5L9M A;  2PVU A;  5IZ3 B;  1N76 A;  3IOV A;  5AA2 A;  5BUU A;  4TLL B;  4PC9 A;  2I58 A;  3OD7 A;  4U2R A;  1DPP A;  1MXZ A;  1LFG A;  1XS5 A;  1SI0 A;  2DSF A;  1B0H A;  2WBB A;  2ZYM A;  3FJM A;  4PFR A;  4NF5 A;  4R2F A;  1Y1Z A;  3B8B A;  4RNS A;  3K1M A;  1Q9D A;  5I2N B;  1FTA A;  4NF8 A;  2Q88 A;  4OEV A;  1XT8 A;  2Q2A A;  4OQO A;  3QUJ A;  4PAI A;  2HPG A;  1B7U A;  3QIM A;  4AS5 A;  3KN8 A;  3OEK A;  1S9T A;  2XXW A;  5IZ1 A;  5KCJ A;  3BKI B;  4WED A;  1OQG A;  4LZ8 A;  3CSB A;  5H8Q A;  3CIJ A;  4IO7 A;  1AH5 A;  1A99 A;  4IO5 A;  1MS7 A;  5B70 A;  4X8R A;  2ZZX A;  3OO8 A;  4NQ8 A;  1EZO A;  3IFA A;  4QFL A;  5M2V A;  1NV0 A;  4ISU A;  4G8H A;  3ROJ A;  5IGA A;  2YJP A;  2BJI A;  3TYH A;  3T9H B;  4P9K A;  1NV6 A;  3FGS A;  3SDF A;  2Q74 A;  4KFQ A;  1NUX A;  3M3F A;  3GXA A;  3DP6 A;  1NUZ A;  3D4C A;  4OZ9 A;  1MDQ A;  1NKX A;  1I6Q A;  3KN3 A;  4XEQ A;  4N81 A;  4PAK A;  1PB9 A;  5H8N A;  2RIN A;  1FBC A;  3D4G A;  3FAS A;  3RYD A;  4XKQ A;  4HE2 A;  3W9W A;  1FPJ A;  2NVU B;  4NF6 B;  5EHS A;  2OLB A;  4F1V A;  2O68 A;  4NMY A;  3PPR A;  4O7M A;  4GWY A;  2H4I A;  3T66 A;  4U23 A;  3CHG A;  4FEC A;  2I0B A;  1VSO A;  4GL0 A;  1B9J A;  4XTC Q;  2DVC A;  3WAE A;  2QVV A;  3N6T A;  3T0J A;  2RF1 A;  3JYR A;  5F1Q A;  5DVI A;  4N91 A;  3H6V A;  4R9G A;  1FW0 A;  1EH3 A;  1INP A;  2Y7R A;  2PT2 A;  3CFL A;  4AB6 A;  1QUK A;  2NUV A;  4C0R A;  1ZLQ A;  3RUM A;  2I49 A;  4GL8 A;  5CBR A;  3KFM A;  3MPL A;  1P1O A;  4N6K A;  3KJ7 A;  4ZE9 A;  1ATG A;  2DYX A;  4H0W A;  4U22 A;  4YAH X;  1IIW A;  2F8D A;  3K2D A;  5FTH A;  3PPP A;  4ELR A;  2R6G E;  1MM7 A;  5ESY A;  4E0X A;  3FVK A;  3SEX A;  4Z7E A;  1PBQ A;  4NAP A;  3CG1 A;  1B4H A;  1NV4 A;  5FTI A;  3F11 A;  1FPD A;  4R74 A;  3JZJ A;  5HBC A;  2HFB A;  2HHM A;  3MP8 A;  4GVO A;  5DT6 A;  3E79 A;  1OMP A;  3OO9 A;  2F6P A;  2AL4 A;  4U1O A;  5L8D A;  3IO6 A;  4KD5 A;  1KZ8 A;  2R71 A;  2XD3 A;  1IXH A;  1EYK A;  2RC9 A;  3RPL B;  4THI A;  1YAE A;  3B6Q A;  1P1W A;  1K9Y A;  2OBG A;  2XX7 A;  1UIU A;  1Y4T A;  4HCW A;  1XHY A;  4EF2 A;  5DW8 A;  3BFU A;  3TTR A;  1MY2 A;  1NNK A;  1NH8 A;  2VD3 A;  1SPI A;  5DYH A;  1RDX A;  3H6T A;  2KLF A;  2XX8 A;  2DWJ A;  1FSA A;  3HHG A;  5ICQ A;  3G3I A;  2D21 A;  2BJJ X;  4G61 A;  2GRV A;  3ISP A;  3T96 B;  3VVD A;  1G0I A;  2XD2 A;  4M4G A;  2A5T B;  2QMX A;  2ZNT A;  4MCO A;  4OVQ A;  4LAT A;  3O66 A;  1B5I A;  1FBP A;  1SVX B;  1MQG A;  5AA4 B;  4NN3 A;  3QMF A;  4NG7 A;  5IZZ A;  1B5J A;  3UOR A;  4F3G A;  3H6U A;  1AMF A;  1DTG A;  4OWD A;  2FIX A;  3CG3 A;  3IJO B;  3S4U A;  5ITO A;  1SW4 A;  4XFE A;  1QVS A;  1FBF A;  3FAT A;  2UVJ A;  1LB8 A;  2P0S A;  3PMW A;  3T1B A;  4ELO A;  3LSX A;  5I57 B;  4PFW A;  4GD5 A;  5ET6 A;  4N6D A;  1R6Z A;  4GFR A;  3U1O A;  1P1Q A;  4F2Q A;  1OVB A;  4WXJ A;  3Q26 A;  1NV1 A;  1POY 1;  2XWK A;  1NUW A;  2Y7I A;  1OQH A;  3OEN A;  4BDR A;  1KA1 A;  5CM6 A;  2XXK A;  1YXI A;  3G3F A;  2O51 A;  2NXO A;  1FPI A;  3LUY A;  4U21 A;  1B2H A;  4OER A;  3TOD A;  4F3P A;  2RKM A;  5FHO A;  4NWC A;  3C35 A;  4JSO A;  4ZS9 A;  1MPD A;  3A09 A;  1MY0 A;  3H06 B;  4GX6 A;  3V8X B;  5H8H B;  3EHT A;  1LST A;  5FHN A;  4LQ5 A;  1LCF A;  3FIR A;  3PUV E;  1LAX A;  2A5S A;  2XXQ A;  3IK6 B;  4Q5T A;  1XVX A;  2RCA A;  3B6W A;  4POX A;  3C34 A;  3EN3 A;  2Y5K A;  4EQB A;  4JVC A;  1HSE A;  4ND9 A;  2F6G A;  1MXW A;  2VPN A;  2A5T A;  1N7W A;  3CFX A;  2Q89 A;  3C32 A;  4X9T A;  1NMU A;  5AA4 A;  3OXN A;  5I3S A;  1VDW A;  3FXQ A;  3Q28 A;  4OAN A;  2Y7P A;  4PDD A;  5I2K B;  2XWV A;  3A3C A;  4GWZ A;  1IZ1 A;  3U94 A;  2XXV A;  4QFK A;  5KDT A;  4DDD A;  1QUJ A;  4MHF A;  1SYH A;  5CMK A;  3L6G A;  4NF0 A;  3FVO A;  4P1L A;  2CZL A;  1NV7 A;  4IGT A;  4GBW A;  2XX9 A;  4ZZA A;  3IFC A;  3KGC A;  2ONS A;  4OES A;  1Y4C A;  1LBV A;  2RC8 A;  3K00 A;  5AA2 B;  1N3X A;  5I5P A;  2ZYK A;  5CI5 A;  4PGN A;  3TDJ A;  3MQ9 A;  1H45 A;  1MRP A;  3I5O A;  1B3L A;  3LR1 A;  1FTJ A;  2PCR A;  3SKP A;  1IEJ A;  1SQY A;  3MVW A;  3O29 A;  1OLC A;  1II5 A;  4HTG A;  2O1L A;  3E4R A;  4PE5 B;  1VR5 A;  4OEN A;  3PD9 A;  4LP2 B;  3C36 A;  2VOZ A;  3EHU A;  3LSL A;  2FA7 A;  5CBS A;  1R9L A;  1N3W A;  2CMO A;  4O3B A;  1YTV A;  5J1D A;  4U4S A;  2FBP A;  3KC0 A;  5I7I A;  4XXU A;  3TQL A;  2CZH A;  4OYV A;  1XC1 A;  2WYK A;  5H8H A;  4ZDM A;  2HCA A;  1GV8 A;  2QS3 A;  2F35 A;  4JWO A;  1YPN A;  4FAJ A;  1B1X A;  1SW2 A;  3OO7 A;  3EPE A;  1IMD A;  2XXT A;  1QW0 A;  1RYX A;  4KYS A;  3GZG A;  1JVY A;  4NE4 A;  4G4P A;  2B4M A;  4LVQ A;  3G3G A;  5TU0 A;  2F34 A;  1LBC A;  2ZZV A;  3VLW A;  2O6A A;  2F97 A;  1NNF A;  2P3N A;  4Z0I A;  4I3E A;  2VHA A;  1JW1 A;  2GHA A;  3FUZ A;  4TLM B;  4RJZ A;  1Y9U A;  3TTM A;  4O3A A;  2ESN A;  4FOR A;  5H8N B;  4P0G A;  4I9D A;  1B3E A;  4DZ1 A;  4PFU A;  2OWS A;  5B7D A;  3M3L A;  3KZG A;  4ELQ A;  1LGB C;  4GWO A;  3TCH A;  5KZT A;  1LFI A;  3EHS A;  4H8I A;  4YB5 A;  3THI A;  3TQW A;  1Y3N A;  4FEB A;  1FQF A;  1OVT A;  4PFT A;  1B05 A;  4OVP A;  4U1Z A;  1JNF A;  4HE0 A;  3IB2 A;  4NX1 A;  3TKD A;  3M3K A;  1NV5 A;  4ONY A;  3HST A;  3FVN A;  3IAZ A;  1FPK A;  4O94 A;  4X04 A;  5DVJ A;  3RT8 A;  4WKM A;  1NNT A;  1NNP A;  4DXB A;  2O69 A;  1FCK A;  3RY3 A;  4NHB A;  1PB7 A;  1BP5 A;  3EF7 A;  4MX6 A;  4N17 A;  4MH5 A;  1QUI A;  3N94 A;  1KA0 A;  3TTL A;  3MYU A;  1JQF A;  3R26 A;  1SI1 A;  3U72 A;  3OO6 A;  4IR8 A;  1LFH A;  2O7U A;  2DP8 A;  4HXV A;  1J1N A;  3O97 A;  2UXA A;  1YCJ A;  1TFD A;  4FBP A;  2NWJ A;  2F7C A;  3U8Q A;  2FVZ A;  2P1S A;  1JEU A;  1XVY A;  3PGF A;  3CI8 A;  5H8F B;  5EQ7 A;  3E3K A;  3EQ1 A;  3PMX A;  4JWX A;  4N13 A;  4ZZE A;  3K1P A;  2Z8F A;  3IJX B;  1B40 A;  5K2X A;  2CEY A;  4UAB A;  1MXV A;  3B7D A;  2PT1 A;  2OZZ A;  5DVF A;  4KPT A;  3TZA A;  4FJP A;  1MQJ A;  3S9E A;  1B52 A;  3O2A A;  1FPL A;  1G0H A;  1JP4 A;  3TEL A;  1H76 A;  1PBP A;  3D1R A;  3BIG A;  1FRP A;  3C33 A;  1MDP 1;  2F3B A;  3MP1 A;  5ICT A;  1LAF E;  4I40 A;  1O7T A;  4DCY A;  4KR5 A;  2XXI A;  4RYA A;  2GFE A;  3T9U A;  3LC8 A;  4NTL A;  2LAO A;  2X7Q A;  1DOT A;  4RPN A;  2Z8E A;  3RN8 A;  4R75 A;  4TOZ A;  3MBP A;  4GWW A;  1JET A;  3SES A;  3RPW A;  4EXK A;  3FXR A;  2V84 A;  1IXI A;  4QSE A;  2HXW A;  2QL3 A;  2KR0 A;  1CNQ A;  3BIH A;  3U93 A;  4P8B A;  5JTY B;  2V93 A;  3W15 C;  5LOM A;  2WKY A;  1Z7N E;  2HXR A;  4GWS A;  4L17 A;  2Y84 A;  4QRZ A;  1LBY A;  2GHB A;  2CZK A;  3Q25 A;  3R6U A;  3SEU A;  1FQC A;  2V3Q A;  4GX4 A;  3LSF B;  2DDK A;  4OEU A;  4KXP A;  3FVG A;  2R9J A;  1IUD A;  2F5X A;  4C1T A;  3ZSF A;  1DMB A;  4H5G A;  2QS1 A;  5H8F A;  1FBD A;  4P11 A;  1FPE A;  3PV0 E;  1B3F A;  5I84 A;  4G68 A;  4LON B;  1PC3 A;  2Y5L A;  4MEV A;  3ECR A;  1Q35 A;  2REJ A;  4GLI A;  4OHN A;  3PMV A;  4KCD A;  4YKK A;  1B32 A;  1US5 A;  3ZKL A;  1GR2 A;  3PUX E;  1B58 A;  3EKI A;  1URD A;  1JW4 A;  1JW5 A;  1LAG E;  1XOC A;  4N15 A;  1LEV A;  4GX3 A;  1B5H A;  2O7I A;  1GTK A;  4P0I A;  5TP9 B;  4EDP A;  1IME A;  1USY H;  5AA3 A;  5LDZ A;  4G8N A;  4LN5 A;  1JVX A;  3KSJ A;  4F29 A;  2XWO A;  4N07 A;  4LQ2 A;  1IMB A;  1N7X A;  3BFT A;  4IO3 A;  5CRY A;  5TPA A;  3FJ7 A;  4H8J A;  3USD A;  4R9F A;  1UTH B;  5KDT B;  2F36 A;  4QSC A;  2QPQ A;  1TWY A;  2RCB A;  5ET5 A;  4IGR A;  1DBZ A;  2DS9 A;  4DXU A;  3CSG A;  3UA8 A;  5ISU A;  2DQV A;  2HAU A;  3G3J A;  4H1X A;  1M5C A;  3O6I A;  1T0K A;  1F9B A;  3MZ9 A;  4JBZ A;  1DTZ A;  4NWD A;  4GRK A;  4PFI A;  5JTY A;  4X48 A;  4I1D A;  4PQJ A;  4F18 A;  3VE1 B;  2DWA A;  1UQW A;  3S9M C;  3HCQ A;  3ONM A;  4ELP A;  2QSX A;  5I58 B;  4G8M A;  3ZS6 A;  1SW1 A;  3I6V A;  3PU5 A;  3U92 A;  3T93 B;  2ZMB A;  5I56 B;  2F3D A;  4O8M A;  5EYF A;  2FNC A;  4R73 A;  4MNC A;  1IMC A;  1S50 A;  4DI3 D;  1NL5 A;  5EQA A;  3PPO A;  2ABH A;  4XKN A;  3C4M A;  3OEM A;  3ODB A;  1AL3 A;  2DXR A;  5DTB A;  3V83 A;  4PDH A;  4MAG A;  4BLA A;  3JV9 A;  1RDZ A;  4H46 A;  3T9X B;  2Z22 A;  4N6P A;  4G2Z A;  1ZU0 A;  4QFP A;  4PF8 A;  4FED A;  1IMF A;  3Q27 A;  1MH4 A;  2XXX A;  1UTB B;  4R72 A;  1VE4 A;  5TP9 A;  3RQT A;  1USY E;  2XXH A;  4G77 A;  2WX9 A;  4YZZ A;  2O84 X;  3N26 A;  4WEP A;  1IIT A;  3K6V A;  4ZED A;  2I4C A;  3PUY E;  1MQD A;  5H8S A;  3VFJ A;  3MW0 A;  2L5V A;  4FIM A;  4PTK A;  1UTH A;  1YYZ A;  4MNI A;  3MUQ A;  3MWB A;  3R7X A;  4ZEB A;  3OSQ A;  1L5T A;  1A8F A;  4DCX A;  3RGY A;  3K1N A;  3OMB A;  5F24 A;  2HAV A;  1Z7M E;  5JK4 A;  4H5F A;  5A5X A;  4PAF A;  4U4X A;  4ESW A;  4M1V A;  3TTK A;  4C1U A;  1ZBM A;  5K2Y A;  3DM0 A;  5EQ9 A;  3MP6 A;  4KYD A;  5LTC A;  1HSJ A;  3HO7 A;  3QYT A;  3L6H A;  4P47 A;  3DP8 A;  1VFD A;  3TMG A;  2REG A;  5I58 A;  1MM6 A;  2DE2 A;  2OWZ A;  1POT A;  3VVF A;  3IR1 A;  4YIC A;  3E78 A;  3IX1 A;  3H03 A;  2WYP A;  1HSL A;  1FTL A;  4JWY A;  1P99 A;  4MFI A;  4Q0C A;  2OCU A;  5EYH A;  2QFL A;  1K9Z A;  3QK6 A;  5I56 A;  3H4Z A;  2UVH A;  2QVR A;  4EQ9 A;  2I48 A;  5CMM A;  3KG2 A;  1LCT A;  4P3L A;  3I3V A;  2XA5 A;  2UYE A;  1A40 A;  2HZL A;  4I3Y A;  4YB7 A;  3TEP A;  2ZNS A;  2YPN A;  1D9Y A;  1M5B A;  3G7W A;  2Z8D A;  4PF6 A;  4O7I A;  4F1U A;  4QFO A;  4UAC A;  2Q2C A;  1M5E A;  1N04 A;  5ELV A;  2W7Y A;  1MPB A;  3HV1 A;  4IO6 A;  1PB8 A;  3VVE A;  4H45 A;  4MJO A;  3IB0 A;  1UTB A;  4FAT A;  5JEI A;  1XI6 A;  1QKA A;  5BWJ A;  4KQP A;  5ITP A;  2VPO A;  3O28 A;  3QSL A;  3TCG A;  3HPI A;  3VLU A;  1B7Z A;  3TPA A;  4OFO A;  1AWB A;  5HM4 B;  3MVZ A;  4AQ4 A;  3IO4 A;  4ZEI A;  1MXY A;  4GWX A;  2I3V A;  1MQH A;  1FBE A;  1OIB A;  3CRB A;  2QRY A;  2B3F A;  2UVI A;  3UN6 A;  3IL1 B;  1VFE A;  2UYF A;  1GGG A;  3Q29 A;  4OXV A;  5L9O A;  3U65 A;  3ILU B;  3SEV A;  2I0C A;  1B51 A;  1RDY A;  1LB9 A;  2F7B A;  1A55 A;  3K6X A;  4AS4 A;  4QHQ A; 
#chains in the Genus database with same CATH homology
 3OOA A;  4LZ5 A;  3VDF A;  3S2V A;  1BLF A;  4MLV A;  4X1D A;  1AIV A;  4IO2 A;  1M5D A;  1IXC A;  3C9H A;  1ZJL A;  1Y20 A;  1LBB A;  4YMA A;  2X26 A;  3IOW A;  1B7H A;  3TFL A;  2F7A A;  3MVX A;  1TT1 A;  5DEX A;  1I69 A;  1US4 A;  3TUS A;  4PP0 A;  2PX1 A;  1CB6 A;  3N5L A;  4TQU Q;  4F31 B;  4KI0 E;  3MJN A;  3KN7 A;  3QXM A;  2H98 A;  2Y7W A;  2F78 A;  4ESX A;  4OVJ A;  4R2B A;  4JB7 A;  2XXY A;  2B65 A;  1FQB A;  3CVG A;  2NOO A;  3B6T A;  4ZEC A;  3TAJ A;  2ZXT A;  5L9S A;  4OTE A;  1EZP A;  2DXY A;  4EQ7 A;  4JXI A;  1ANF A;  1ELJ A;  2XHD A;  1R1N A;  5AA2 D;  2PMS A;  4MF3 A;  5IAI A;  4PET A;  4G68 B;  5F7V A;  1FTM A;  2I6E A;  4KHZ E;  2I3W A;  2XXR A;  3UP9 A;  1R9Q A;  4BDM A;  1MXX A;  4DXC A;  1FQE A;  2V25 A;  2HQ0 A;  4GF8 A;  4OFJ A;  3SEW A;  3H7M A;  4I8C A;  1FTO A;  3FV1 A;  3AXF A;  1MPC A;  3S9L C;  4NF4 B;  4YKP A;  4UA8 A;  2ANJ A;  2OWT A;  5TPA B;  4RA1 A;  1ZMG A;  4HS7 A;  2V3U A;  1B3H A;  2GH9 A;  2Z23 A;  3UGW A;  3RTF B;  1SBP A;  1BKA A;  3DP4 A;  3H6W A;  4HW8 A;  3FJG A;  3V89 B;  2B3B A;  5EHM A;  1O63 A;  5I2N A;  1H3D A;  1BTJ A;  3E9X A;  5CMC A;  1RYO A;  4Q8R A;  1B4Z A;  1SD3 A;  4GOT A;  3DLN A;  4KYE A;  2DWH A;  3IOU A;  2YLN A;  1CE2 A;  2AL5 A;  4RY1 A;  4F19 A;  4DLD A;  3LSW A;  4GXA A;  1URG A;  3MVY A;  3K01 A;  1MQI A;  3RT6 B;  4IY5 A;  1EU8 A;  2Q9T A;  4HCY A;  5AE4 A;  3GBA A;  4JDF A;  3VLV A;  3HHF A;  1DSN A;  4LA9 A;  4ZE8 A;  1BIY A;  1O64 A;  3KSX A;  1I6B A;  2V3T A;  1JEV A;  4YKJ A;  2VGQ A;  2THI A;  3MC2 A;  4RXL A;  3K4U A;  2XXU A;  2H9B A;  3MAM A;  3VXC A;  1S7Y A;  3GLB A;  1Q1K A;  1LAH E;  3BBR A;  3FD3 A;  4XKP A;  2G93 A;  2PBW A;  3CFZ A;  4YKI A;  4G68 C;  2HEU A;  4RK2 A;  4FE8 A;  2H25 A;  4ZEF A;  1TXF A;  2OK2 A;  4H6D A;  3UIF A;  2Y7K A;  3K02 A;  5IKB A;  3RLF E;  2ONR A;  4NF6 A;  4F1Y A;  2OJT A;  3SEY A;  4NF4 A;  4O3C A;  3T9V A;  1FTK A;  4ZEK A;  3T22 A;  5I59 B;  4IY6 A;  1N0T A;  4LUB A;  4Q30 B;  3M8U A;  3PUW E;  3W9V A;  1AOV A;  4F3S A;  3OSR A;  3P7I A;  3IOR A;  3O9P A;  1PEB A;  1OLA A;  2VD2 A;  1LLS A;  5A5X B;  1SDX A;  1A54 A;  3KEI A;  1MH3 A;  4GXS B;  1WOD A;  1D3K A;  4PFY A;  1FQA A;  3E13 X;  3C31 A;  3KJT A;  5FHM A;  2QS2 A;  2H99 A;  2AYS A;  2RC7 A;  4BDO A;  2HZK A;  1B3G A;  4MLQ A;  2PYY A;  4XKR A;  3K6W A;  2IA4 A;  1QJM A;  3N6U A;  4KCC A;  4JSD A;  1H43 A;  1IXG A;  3PPN A;  1B6H A;  2UVG A;  3K6U A;  3VV5 A;  3RTW B;  4E0W A;  1P1N A;  2ZYN A;  1WVJ A;  4MBP A;  3CR9 A;  4LZ7 A;  3OEL A;  3O6G A;  1A7L A;  4R6Y A;  5CC2 A;  1QUL A;  3MZB A;  1ZKB A;  3IOT A;  2DE4 A;  3TTN A;  1Y3P A;  3HN0 A;  4ECF A;  1B1H A;  2QMW A;  1MY4 A;  4EUO A;  4R6K A;  1NFT A;  3GBB A;  2DVZ A;  1H44 A;  4K3F A;  3PD8 A;  1B0L A;  4F22 A;  2Q8J A;  3SET A;  5AA1 A;  5I59 A;  4BDN A;  3G3K A;  4BDL A;  3QAX A;  1D4N A;  3VXB A;  2VP1 A;  4XIG Q;  2O1M A;  4F3B A;  3S9N C;  1MY3 A;  3MZ1 A;  3PUZ E;  1KWH A;  1QKB A;  1B46 A;  2IEE A;  4X1B A;  1TFA A;  3KOT A;  4H65 A;  1SW5 A;  1MY1 A;  2ZYO A;  3A3U A;  4GIZ A;  4DIG A;  4GQO A;  4DE8 A;  2P2A A;  4YB6 A;  3DEL B;  3MPK A;  3KOS A;  2X7P A;  2ALU A;  2ZNU A;  3FZV A;  4QFN A;  5I57 A;  1PDA A;  1SYI A;  1URS A;  4POW A;  1ZTY A;  4OET A;  3IB1 A;  3ILT B;  1A8E A;  1GVC A;  3RNN A;  2G29 A;  2DE3 A;  1MXU A;  4IO4 A;  1P1U A;  2H5Y A;  4NF5 B;  4QF9 A;  2AIX A;  1NH7 A;  4AB5 A;  5DEX B;  3WAF A;  3TCF A;  4NF8 B;  1I6A A;  2XXP A;  3FXU A;  4I62 A;  1Y3Q A;  2D3I A;  3LBS A;  1EZ9 A;  4OFL A;  4OMB A;  3G3H A;  1ZIU A;  5KCJ B;  2D5W A;  2DOJ A;  4RPO A;  2QJE A;  3H3G A;  4QSD A;  5H8Q B;  4YMB A;  2ONK E;  4BDQ A;  2E1S A;  2FYI A;  3UK4 A;  4F39 A;  1IQ7 A;  5HPQ A;  1DPE A;  4H67 A;  3ZKK A;  4F2O A;  3SER A;  3FV2 A;  4EF1 A;  1FQD A;  1RKM A;  4R6H A;  4YU0 A;  2DWI A;  4EXL A;  4NED A;  5CMB A;  2QS4 A;  3KBR A;  3PPQ A;  1M5F A;  1WDN A;  1Y1M A;  1N84 A;  4RK9 A;  3K0V A;  1MG1 A;  3V5A A;  5I2K A;  1D9V A;  2I4B A;  2M8C A;  1UIV A;  4IB2 A;  2E0S A;  3QUF A;  3O6H A;  5L9M A;  2PVU A;  1N76 A;  3IOV A;  5AA2 A;  5BUU A;  4TLL B;  2I58 A;  3OD7 A;  4U2R A;  1DPP A;  1MXZ A;  1LFG A;  1XS5 A;  1SI0 A;  2DSF A;  1B0H A;  2ZYM A;  3FJM A;  4NF5 A;  4R2F A;  1Y1Z A;  4RNS A;  3K1M A;  5I2N B;  4NF8 A;  2Q88 A;  4OEV A;  1XT8 A;  2Q2A A;  4OQO A;  3QUJ A;  1B7U A;  3QIM A;  3KN8 A;  3OEK A;  1S9T A;  2XXW A;  5KCJ A;  3BKI B;  4WED A;  1OQG A;  4LZ8 A;  3CSB A;  5H8Q A;  3CIJ A;  4IO7 A;  1AH5 A;  1A99 A;  4IO5 A;  1MS7 A;  5B70 A;  3OO8 A;  1EZO A;  4QFL A;  5M2V A;  4ISU A;  4G8H A;  2YJP A;  3TYH A;  3T9H B;  3FGS A;  3SDF A;  4KFQ A;  3M3F A;  3GXA A;  3DP6 A;  3D4C A;  4OZ9 A;  1MDQ A;  1NKX A;  1I6Q A;  3KN3 A;  1PB9 A;  5H8N A;  2RIN A;  3D4G A;  3FAS A;  3W9W A;  4XKQ A;  2NVU B;  4NF6 B;  5EHS A;  2OLB A;  4F1V A;  2O68 A;  4NMY A;  3PPR A;  2H4I A;  3T66 A;  4U23 A;  4FEC A;  2I0B A;  1VSO A;  4GL0 A;  1B9J A;  4XTC Q;  2DVC A;  3WAE A;  3N6T A;  2RF1 A;  3JYR A;  5F1Q A;  5DVI A;  3H6V A;  4R9G A;  1FW0 A;  1EH3 A;  2Y7R A;  2PT2 A;  3CFL A;  4AB6 A;  1QUK A;  2NUV A;  4C0R A;  1ZLQ A;  3RUM A;  2I49 A;  4GL8 A;  5CBR A;  3KFM A;  3MPL A;  1P1O A;  3KJ7 A;  4ZE9 A;  1ATG A;  2DYX A;  4H0W A;  4U22 A;  4YAH X;  1IIW A;  2F8D A;  3K2D A;  5FTH A;  3PPP A;  4ELR A;  2R6G E;  1MM7 A;  4E0X A;  3FVK A;  3SEX A;  4Z7E A;  1PBQ A;  3CG1 A;  1B4H A;  5FTI A;  3F11 A;  4R74 A;  3JZJ A;  5HBC A;  2HFB A;  3MP8 A;  4GVO A;  5DT6 A;  1OMP A;  3OO9 A;  2F6P A;  2AL4 A;  4U1O A;  5L8D A;  3IO6 A;  4KD5 A;  2R71 A;  2XD3 A;  1IXH A;  2RC9 A;  4THI A;  1YAE A;  3B6Q A;  1P1W A;  2OBG A;  2XX7 A;  1UIU A;  1Y4T A;  4HCW A;  1XHY A;  4EF2 A;  3BFU A;  3TTR A;  1MY2 A;  1NNK A;  1NH8 A;  2VD3 A;  5DYH A;  3H6T A;  2KLF A;  2XX8 A;  2DWJ A;  3HHG A;  5ICQ A;  3G3I A;  2D21 A;  2BJJ X;  2GRV A;  3T96 B;  3VVD A;  2XD2 A;  4M4G A;  2A5T B;  2QMX A;  2ZNT A;  4LAT A;  3O66 A;  1B5I A;  1SVX B;  1MQG A;  5AA4 B;  1B5J A;  3UOR A;  4F3G A;  3H6U A;  1AMF A;  1DTG A;  4OWD A;  3CG3 A;  3IJO B;  3S4U A;  5ITO A;  1SW4 A;  1QVS A;  3FAT A;  2UVJ A;  1LB8 A;  2P0S A;  3PMW A;  4ELO A;  3LSX A;  5I57 B;  4PFW A;  4GD5 A;  1R6Z A;  4GFR A;  3U1O A;  1P1Q A;  4F2Q A;  1OVB A;  4WXJ A;  3Q26 A;  1POY 1;  2Y7I A;  1OQH A;  3OEN A;  4BDR A;  5CM6 A;  3G3F A;  2O51 A;  2NXO A;  3LUY A;  4U21 A;  1B2H A;  4OER A;  3TOD A;  4F3P A;  2RKM A;  5FHO A;  4NWC A;  3C35 A;  4JSO A;  4ZS9 A;  1MPD A;  3A09 A;  1MY0 A;  3H06 B;  3V8X B;  5H8H B;  3EHT A;  1LST A;  5FHN A;  4LQ5 A;  1LCF A;  3FIR A;  3PUV E;  1LAX A;  2A5S A;  2XXQ A;  3IK6 B;  4Q5T A;  1XVX A;  2RCA A;  3B6W A;  4POX A;  3C34 A;  3EN3 A;  4EQB A;  1HSE A;  4ND9 A;  2F6G A;  1MXW A;  2A5T A;  1N7W A;  3CFX A;  2Q89 A;  3C32 A;  4X9T A;  1NMU A;  5AA4 A;  3OXN A;  3FXQ A;  3Q28 A;  2Y7P A;  5I2K B;  3A3C A;  1IZ1 A;  3U94 A;  2XXV A;  4QFK A;  5KDT A;  4DDD A;  1QUJ A;  1SYH A;  5CMK A;  3L6G A;  3FVO A;  2CZL A;  4IGT A;  2XX9 A;  4ZZA A;  3KGC A;  2ONS A;  4OES A;  1Y4C A;  2RC8 A;  3K00 A;  5AA2 B;  1N3X A;  2ZYK A;  5CI5 A;  3TDJ A;  3MQ9 A;  1H45 A;  1MRP A;  3I5O A;  1B3L A;  3LR1 A;  1FTJ A;  3SKP A;  1IEJ A;  1SQY A;  3MVW A;  3O29 A;  1OLC A;  1II5 A;  4HTG A;  2O1L A;  3E4R A;  4PE5 B;  1VR5 A;  4OEN A;  3PD9 A;  4LP2 B;  3C36 A;  2VOZ A;  3EHU A;  3LSL A;  2FA7 A;  5CBS A;  1R9L A;  1N3W A;  2CMO A;  4O3B A;  1YTV A;  5J1D A;  4U4S A;  4XXU A;  3TQL A;  4OYV A;  1XC1 A;  5H8H A;  4ZDM A;  2HCA A;  1GV8 A;  2QS3 A;  2F35 A;  4JWO A;  1YPN A;  4FAJ A;  1B1X A;  1SW2 A;  3OO7 A;  3EPE A;  2XXT A;  1QW0 A;  1RYX A;  4KYS A;  3GZG A;  1JVY A;  4NE4 A;  4G4P A;  4LVQ A;  3G3G A;  5TU0 A;  2F34 A;  1LBC A;  3VLW A;  2O6A A;  2F97 A;  1NNF A;  4Z0I A;  2VHA A;  1JW1 A;  2GHA A;  3FUZ A;  4TLM B;  4RJZ A;  1Y9U A;  3TTM A;  4O3A A;  2ESN A;  4FOR A;  5H8N B;  4P0G A;  4I9D A;  1B3E A;  4DZ1 A;  4PFU A;  2OWS A;  5B7D A;  3M3L A;  3KZG A;  4ELQ A;  1LGB C;  4GWO A;  3TCH A;  5KZT A;  1LFI A;  3EHS A;  4H8I A;  4YB5 A;  3THI A;  3TQW A;  1Y3N A;  4FEB A;  1FQF A;  1OVT A;  4PFT A;  1B05 A;  4U1Z A;  1JNF A;  3IB2 A;  3TKD A;  3M3K A;  4ONY A;  3HST A;  3FVN A;  3IAZ A;  3RT8 A;  5DVJ A;  4WKM A;  1NNT A;  1NNP A;  4DXB A;  2O69 A;  1FCK A;  3RY3 A;  1PB7 A;  1BP5 A;  3EF7 A;  4MH5 A;  1QUI A;  3N94 A;  3TTL A;  1JQF A;  3R26 A;  1SI1 A;  3U72 A;  3OO6 A;  1LFH A;  2O7U A;  2DP8 A;  1J1N A;  3O97 A;  2UXA A;  1YCJ A;  1TFD A;  2NWJ A;  2F7C A;  3U8Q A;  2P1S A;  1JEU A;  1XVY A;  3PGF A;  3CI8 A;  5H8F B;  3E3K A;  3EQ1 A;  3PMX A;  4JWX A;  4N13 A;  4ZZE A;  3K1P A;  2Z8F A;  3IJX B;  1B40 A;  5K2X A;  1MXV A;  3B7D A;  2PT1 A;  2OZZ A;  5DVF A;  4KPT A;  3TZA A;  4FJP A;  1MQJ A;  3S9E A;  1B52 A;  3O2A A;  3TEL A;  1H76 A;  1PBP A;  3C33 A;  1MDP 1;  3MP1 A;  5ICT A;  1LAF E;  1O7T A;  4DCY A;  4KR5 A;  2XXI A;  4RYA A;  2GFE A;  3T9U A;  3LC8 A;  4NTL A;  2LAO A;  2X7Q A;  1DOT A;  4RPN A;  2Z8E A;  3RN8 A;  4R75 A;  4TOZ A;  3MBP A;  1JET A;  3SES A;  3RPW A;  4EXK A;  3FXR A;  2V84 A;  1IXI A;  4QSE A;  2HXW A;  2QL3 A;  3U93 A;  5JTY B;  2V93 A;  3W15 C;  5LOM A;  2WKY A;  1Z7N E;  4L17 A;  2Y84 A;  4QRZ A;  2GHB A;  3Q25 A;  3R6U A;  3SEU A;  1FQC A;  2V3Q A;  3LSF B;  4OEU A;  3FVG A;  2R9J A;  1IUD A;  2F5X A;  4C1T A;  3ZSF A;  1DMB A;  4H5G A;  2QS1 A;  5H8F A;  4P11 A;  3PV0 E;  1B3F A;  5I84 A;  4G68 A;  4LON B;  1PC3 A;  3ECR A;  1Q35 A;  2REJ A;  4GLI A;  4OHN A;  3PMV A;  4KCD A;  4YKK A;  1B32 A;  1US5 A;  3ZKL A;  1GR2 A;  3PUX E;  1B58 A;  1URD A;  1JW4 A;  1JW5 A;  1LAG E;  1XOC A;  1B5H A;  2O7I A;  1GTK A;  4P0I A;  5TP9 B;  4EDP A;  1USY H;  5AA3 A;  4G8N A;  1JVX A;  3KSJ A;  4F29 A;  4N07 A;  4LQ2 A;  1N7X A;  3BFT A;  4IO3 A;  5CRY A;  5TPA A;  3FJ7 A;  4H8J A;  3USD A;  4R9F A;  1UTH B;  5KDT B;  2F36 A;  4QSC A;  2QPQ A;  1TWY A;  2RCB A;  4IGR A;  2DS9 A;  4DXU A;  3CSG A;  3UA8 A;  5ISU A;  2DQV A;  2HAU A;  3G3J A;  4H1X A;  1M5C A;  3O6I A;  1T0K A;  1F9B A;  3MZ9 A;  4JBZ A;  1DTZ A;  4NWD A;  4GRK A;  5JTY A;  4X48 A;  4I1D A;  4PQJ A;  4F18 A;  3VE1 B;  2DWA A;  1UQW A;  3S9M C;  3HCQ A;  3ONM A;  4ELP A;  2QSX A;  5I58 B;  4G8M A;  3ZS6 A;  1SW1 A;  3I6V A;  3PU5 A;  3U92 A;  3T93 B;  2ZMB A;  5I56 B;  5EYF A;  2FNC A;  4R73 A;  1S50 A;  1NL5 A;  3PPO A;  2ABH A;  4XKN A;  3C4M A;  3OEM A;  3ODB A;  1AL3 A;  2DXR A;  5DTB A;  3V83 A;  4BLA A;  3JV9 A;  3T9X B;  2Z22 A;  4N6P A;  4G2Z A;  1ZU0 A;  4QFP A;  4FED A;  3Q27 A;  1MH4 A;  2XXX A;  1UTB B;  4R72 A;  1VE4 A;  5TP9 A;  3RQT A;  1USY E;  2XXH A;  4G77 A;  4YZZ A;  2O84 X;  3N26 A;  4WEP A;  1IIT A;  3K6V A;  4ZED A;  2I4C A;  3PUY E;  1MQD A;  5H8S A;  3VFJ A;  3MW0 A;  4FIM A;  1UTH A;  3MUQ A;  3MWB A;  3R7X A;  4ZEB A;  3OSQ A;  1L5T A;  1A8F A;  4DCX A;  3RGY A;  3K1N A;  3OMB A;  2HAV A;  1Z7M E;  5JK4 A;  4H5F A;  5A5X A;  4ESW A;  4U4X A;  4M1V A;  3TTK A;  4C1U A;  1ZBM A;  5K2Y A;  3DM0 A;  3MP6 A;  4KYD A;  1HSJ A;  3HO7 A;  3QYT A;  3L6H A;  3DP8 A;  1VFD A;  3TMG A;  2REG A;  5I58 A;  1MM6 A;  2DE2 A;  1POT A;  3VVF A;  3IR1 A;  4YIC A;  3IX1 A;  3H03 A;  1HSL A;  1FTL A;  4JWY A;  1P99 A;  4MFI A;  4Q0C A;  2OCU A;  3QK6 A;  5I56 A;  3H4Z A;  2UVH A;  4EQ9 A;  2I48 A;  5CMM A;  3KG2 A;  1LCT A;  3I3V A;  2UYE A;  1A40 A;  2HZL A;  4YB7 A;  3TEP A;  2ZNS A;  2YPN A;  1D9Y A;  1M5B A;  3G7W A;  2Z8D A;  4F1U A;  4QFO A;  4UAC A;  2Q2C A;  1M5E A;  1N04 A;  5ELV A;  2W7Y A;  1MPB A;  3HV1 A;  4IO6 A;  1PB8 A;  3VVE A;  3IB0 A;  1UTB A;  4FAT A;  5JEI A;  1QKA A;  5BWJ A;  4KQP A;  5ITP A;  3O28 A;  3QSL A;  3TCG A;  3HPI A;  3VLU A;  1B7Z A;  3TPA A;  4OFO A;  5HM4 B;  3MVZ A;  4AQ4 A;  3IO4 A;  4ZEI A;  1MXY A;  2I3V A;  1MQH A;  1OIB A;  3CRB A;  2QRY A;  2B3F A;  2UVI A;  3UN6 A;  3IL1 B;  1VFE A;  2UYF A;  1GGG A;  3Q29 A;  4OXV A;  5L9O A;  3ILU B;  3SEV A;  2I0C A;  1B51 A;  1LB9 A;  2F7B A;  1A55 A;  3K6X A;  4QHQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...