1H43A

R210e n-terminal lobe human lactoferrin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
309
Chain Sequence
SVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIEESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal transport
molecule keywords LACTOFERRIN
publication title "Dilysine Trigger" in Transferrins Probed by Mutagenesis of Lactoferrin: Crystal Structures of the R210G, R210E, and R210L Mutants of Human Lactoferrin
pubmed doi rcsb
source organism Homo sapiens
total genus 83
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h43A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h43A02
4X1DA 1M5BA 1B1XA 3MP1A 3KJTA 2GHAA 5AA2A 2W7YA 4BDQA 1BP5A 2OLBA 3K6VA 2AYSA 3O6GA 5CRYA 4HS7A 4OZ9A 2G29A 4H5FA 2V3TA 3KZGA 1Y1ZA 4NE4A 3M3FA 3RN8A 3BFTA 1MDQA 4F19A 4H1XA 4HCYA 3JV9A 3HPIA 4RXLA 1DTZA 1URSA 2QS2A 4OMBA 2V84A 1Y3NA 5DVFA 3H6VA 1SQYA 4X1BA 2XXWA 4YB5A 1B1HA 2DVCA 3MZBA 4N07A 3UK4A 3VVFA 2FNCA 3RT6B 2O84X 3QK6A 4NF4A 1S50A 1AL3A 3U94A 2PX1A 4MF3A 3B6TA 2QS4A 1XVYA 5I84A 1O63A 3DP4A 5I59B 3PPQA 4P0IA 1PB8A 4JBZA 3OMBA 3E4RA 1JEVA 2XXRA 1FTMA 4ELQA 1FTLA 3KGCA 2YJPA 2GHBA 1ZTYA 2ZYOA 4ZE9A 5K2YA 3GBAA 3VLUA 4F18A 3V5AA 2Y7IA 1YAEA 2P2AA 3PMWA 2O68A 5FTIA 4ZEKA 4X9TA 2DE4A 3IL1B 3KSJA 1UIUA 3UIFA 3PV0E 2XHDA 3M8UA 4GF8A 1SI1A 5ICTA 3SEVA 3DM0A 3MPKA 1JVYA 2DP8A 3H03A 3RTWB 4YKKA 3WAFA 1LAGE 2PT1A 2H5YA 2M8CA 4QSDA 4U23A 4IO4A 4AB6A 3FXRA 2VD2A 4R6KA 3G3JA 5J1DA 1ATGA 4R73A 3SESA 2UXAA 3H7MA 4YAHX 5CI5A 3CSBA 1DPEA 4BLAA 1M5FA 1XVXA 1Y4TA 2ZYKA 5ITOA 1QKAA 2I4CA 4PP0A 4F1YA 3TKDA 3TYHA 2QMWA 2ONRA 1MQDA 1H3DA 2VP1A 5DVJA 1B58A 1L5TA 2ALUA 1POY1 1MY1A 4RY1A 2HZKA 4LATA 4F22A 3CG3A 1CB6A 5CMKA 3G3IA 1SW2A 3LSLA 3M3LA 3CIJA 1XOCA 3PPOA 2O7UA 4DXBA 5A5XA 4G68B 4NF8A 5TP9B 2I4BA 4XKQA 4OESA 2I0BA 2Y7KA 1FCKA 4DLDA 5DVIA 3HHGA 4ECFA 4YB7A 1B0HA 1ELJA 3R7XA 4QF9A 2GFEA 2V3UA 1ANFA 4MFIA 1MY0A 3T9HB 3MUQA 1A7LA 1EZPA 1B32A 3KN8A 1M5DA 2QPQA 4DCXA 3HN0A 3RTFB 1I6AA 4RNSA 1BTJA 2RCAA 1JW1A 2A5TB 2XD3A 3FJMA 2ZMBA 5ITPA 1DMBA 1YCJA 3PUZE 4LVQA 5H8QB 4U21A 3FV2A 4IY5A 4M4GA 3GXAA 2VGQA 1R6ZA 2Q8JA 4F39A 3G3HA 1MXVA 1ZMGA 3LSFB 3KOTA 4HW8A 5HBCA 3SERA 4RPOA 4U22A 2UVHA 5FHOA 2DSFA 1MXXA 3FIRA 3R6UA 4YB6A 2ZNUA 1FTKA 4MLQA 2DXYA 1DPPA 4XKRA 1MG1A 3MPLA 3FJGA 4P0GA 2O1LA 1YPNA 1Y9UA 2R71A 1MY3A 1MM7A 3EPEA 1FQCA 1Y3QA 4POWA 4OFLA 4H67A 3GZGA 1GGGA 4OFJA 5AA4B 4GXSB 2CZLA 1SI0A 5I2KA 2QRYA 3G3KA 1B5IA 1PBQA 4H6DA 4HTGA 4KCCA 2UVJA 1FQEA 3PU5A 3T22A 5H8FA 5KZTA 1P1OA 4YU0A 5KCJA 2XXXA 4E0XA 4WXJA 4KQPA 2F7CA 1XHYA 3SDFA 4DXCA 5KDTB 1US5A 2DOJA 1QULA 4NF6B 2QS3A 4POXA 3ONMA 2ESNA 2UVIA 3PPPA 2XX7A 3FASA 3K01A 1IXGA 1IQ7A 3USDA 1S7YA 1ZU0A 4QFNA 4NTLA 4ZEDA 3G7WA 3CG1A 3O28A 2XD2A 3ZSFA 3IK6B 3TQLA 5H8HB 1LAXA 4LA9A 4GWOA 4ELPA 4KYEA 3N26A 3UORA 5H8NB 4LZ5A 4NF5A 1IZ1A 1VFDA 1VSOA 3MZ9A 3OD7A 2UYEA 3EHTA 3VXCA 1R9LA 4H0WA 4DDDA 1USYH 1N84A 3MVXA 1UTBB 4XIGQ 3W15C 3KG2A 4RK2A 1A54A 4KPTA 2I3VA 1ZBMA 5HM4B 2AL5A 3TTKA 1FQBA 3RNNA 1JW4A 4FORA 3CFLA 4H8IA 5CMBA 5L9MA 3PD8A 4C0RA 1Q35A 5L9OA 2OZZA 1B2HA 5TPAA 1TFAA 3SKPA 2ZNSA 1QJMA 3GLBA 1QVSA 5I58A 3K0VA 2QL3A 2V93A 1IXHA 1MXWA 3FVOA 1UTHB 1PC3A 1B51A 5ISUA 1B4HA 3T66A 1TWYA 1P1WA 4Q5TA 3WAEA 1A99A 3MQ9A 3VVDA 5M2VA 3MC2A 2GH9A 3C36A 3SEWA 3E3KA 4UACA 1IITA 4ZE8A 4DIGA 1B40A 1GV8A 1MXUA 1EH3A 5L8DA 5FTHA 5TU0A 3FATA 4I1DA 3RQTA 3KN7A 3IOWA 3MWBA 1I6QA 1OLAA 3DELB 4F2OA 4P11A 3RY3A 1RYOA 3O6IA 3BKIB 2YLNA 4GD5A 1B0LA 3G3FA 3CVGA 4DZ1A 3C34A 4E0WA 2ABHA 2RINA 3THIA 1FTJA 4GVOA 5JK4A 4RA1A 1D9VA 1JNFA 3K1PA 3QXMA 1FQFA 1I69A 3LR1A 4G77A 5AE4A 4PE5B 4O3BA 5JTYB 1N7WA 1NNKA 2HFBA 2V25A 1Y3PA 3O97A 1QKBA 4FEDA 2D21A 3EHUA 3IORA 4ND9A 3OO8A 4ELRA 3IB2A 1AMFA 2NXOA 4GIZA 4OEUA 3TPAA 3HHFA 2R9JA 2DE3A 2NWJA 1LGBC 3BBRA 1LFIA 3EQ1A 2Q2CA 3T96B 3C31A 1LBCA 3N6TA 1GVCA 4F29A 4IY6A 1QUJA 3L6GA 5I57B 3PD9A 4WEPA 4YMBA 1O7TA 4YICA 1B3EA 3O2AA 1IEJA 1QUIA 2OBGA 3JZJA 3KFMA 2F34A 5H8SA 1M5CA 1MRPA 3B7DA 3Q27A 2I6EA 3VVEA 1MY2A 3FUZA 5BWJA 2ANJA 4RPNA 2B3BA 3IR1A 2XXUA 4Z0IA 4U1ZA 1LSTA 2XXPA 1MQHA 3LUYA 2Z8FA 1FTOA 3IB1A 1NH7A 1XS5A 1LLSA 4ELOA 4EQ9A 3UA8A 4KI0E 4H5GA 1MH3A 2RC8A 4JWOA 2D5WA 5DTBA 2ZXTA 2Y7PA 1H44A 2OJTA 4OENA 4GOTA 2DWJA 3PGFA 3ODBA 3E9XA 4JWYA 1TT1A 4KYDA 4EDPA 4FECA 1JETA 4LZ7A 3S9NC 2HQ0A 4LONB 3LSWA 4ISUA 2XXVA 4F2QA 4EXLA 3IX1A 4BDMA 2OCUA 5L9SA 2THIA 2Y7WA 3QIMA 4R6HA 5I59A 5FHMA 1SYIA 3HO7A 1MH4A 2YPNA 2VD3A 2F6GA 1LAHE 3EF7A 3TTRA 5KCJB 3MBPA 1NKXA 5DEXB 4IO7A 4OTEA 4JSDA 3U92A 1PB7A 3HCQA 1R9QA 1N3XA 4GXAA 3T9VA 2DWAA 3S4UA 3V83A 1SBPA 2REGA 1RKMA 2A5SA 3CFZA 4HCWA 1B3FA 4G8NA 2VOZA 4OXVA 4PFUA 2ZYNA 2H98A 2XX8A 5B70A 4BDOA 1ZIUA 4PFYA 3PUYE 4O3AA 1URDA 3RLFE 5ICQA 3KOSA 3EHSA 3Q29A 1SYHA 1CE2A 4TOZA 1T0KA 3QYTA 1NNFA 3G3GA 2XXQA 3K4UA 3UN6A 4F1VA 3T9UA 1OQHA 4QSEA 4MH5A 4H8JA 1MQJA 4JWXA 2ONSA 5ELVA 3W9VA 4FJPA 2Z8EA 4O3CA 2Y84A 4EF2A 3F11A 2KLFA 3IO6A 2I58A 4TLLB 2F78A 1BLFA 3FD3A 1WVJA 5EHMA 3MP8A 3TCFA 2RCBA 2B65A 1P99A 3N6UA 4K3FA 2I49A 5LOMA 4IO5A 3RPWA 5I56B 1NH8A 3QUFA 5CC2A 5HPQA 4XXUA 1WODA 1B4ZA 3MZ1A 4G68A 4ZZEA 1JVXA 3R26A 3IOUA 2I3WA 5I2NA 1HSEA 2QJEA 3TUSA 1FQDA 3IOTA 2F35A 5AA2B 4KCDA 4PFWA 1MY4A 5I58B 1UQWA 2XXIA 4WEDA 3UGWA 4TLMB 2F5XA 2O1MA 2PYYA 4ZECA 3VLVA 1BKAA 1H76A 5AA3A 3EN3A 4QFLA 1QW0A 3CRBA 2X7QA 2XXYA 4IB2A 2IEEA 3B6QA 1NNTA 3S9LC 1B05A 4ZEFA 4ZEBA 3FGSA 4OQOA 3LBSA 4MLVA 1AOVA 1Z7NE 5F7VA 4ZDMA 4RK9A 3I3VA 1TXFA 3S9EA 1D9YA 4F31B 2PBWA 4NEDA 3SEYA 3IJOB 4XTCQ 1YTVA 2DS9A 3SETA 4YZZA 1QUKA 1B7ZA 3U72A 3KEIA 4NF4B 1SD3A 1EZOA 2DWIA 2XX9A 3TODA 3PUVE 1USYE 1P1UA 4OYVA 4Z7EA 3UP9A 2AIXA 3H3GA 1VR5A 3A3CA 2ZYMA 3QSLA 3T9XB 3TZAA 2H25A 3OSRA 3MVYA 2REJA 4G2ZA 3IJXB 3PMVA 4AQ4A 4LUBA 3C32A 2RC9A 3C35A 4G8HA 3I6VA 4F3BA 1S9TA 5JEIA 1TFDA 2Y7RA 2PT2A 1IIWA 3M3KA 4JXIA 3QUJA 5AA1A 3OO6A 3VLWA 3OEMA 5CBSA 4GFRA 4KYSA 5BUUA 2PMSA 4FIMA 3T93B 5DYHA 2DQVA 1MPBA 3S9MC 5CM6A 2RKMA 3KSXA 1D3KA 4H65A 4C1UA 4DE8A 2F36A 3FXUA 3TDJA 3TCGA 2HAVA 4QFKA 2DWHA 4BDLA 2F7AA 3BFUA 3O6HA 3C33A 3TTMA 5KDTA 1B3LA 4NF6A 3VE1B 1MDP1 4OVJA 3E13X 2Q88A 1A8FA 1SVXB 4IO3A 3DLNA 4KD5A 4I9DA 1Y4CA 3FJ7A 1Q1KA 4N6PA 3U8QA 2CMOA 5DT6A 2R6GE 4FAJA 3TELA 2F97A 1N0TA 4EQBA 5H8HA 5A5XB 1SW5A 4BDRA 3U93A 3RGYA 4NF8B 4LP2B 4EXKA 1NMUA 1MXZA 1LB8A 5H8NA 4U1OA 2F7BA 4NMYA 4BDNA 2NUVA 1HSJA 2H99A 3JYRA 4YKIA 4KHZE 2WKYA 3PPNA 1B5JA 3KJ7A 2HEUA 1B7HA 1FW0A 1UTBA 1XC1A 3ZKLA 3I5OA 3L6HA 1PBPA 5F1QA 1UIVA 2NVUB 3O29A 4QFOA 4Q30B 3S2VA 2QS1A 3CR9A 2Z23A 1N3WA 4DCYA 3KN3A 1RYXA 1OLCA 3FVNA 3RUMA 3LSXA 4RYAA 1B7UA 2PVUA 1B5HA 2DE2A 4OEVA 1IXIA 2I0CA 4LZ8A 4LQ5A 3ZKKA 4ESWA 5B7DA 3OXNA 1UTHA 4NWCA 3DP6A 2P0SA 4RJZA 4PETA 3ILUB 4FEBA 2F8DA 3H4ZA 1FQAA 2GRVA 3H6WA 3FZVA 2H9BA 2ZNTA 3IO4A 3MW0A 1IUDA 2XXHA 4R2BA 2HXWA 1B6HA 5CMCA 4R9FA 4IO2A 3IB0A 5EYFA 4F3PA 2O6AA 3OEKA 2XXTA 1II5A 1AIVA 2QSXA 3TQWA 1BIYA 4ONYA 3PMXA 1N04A 3H6TA 1H43A 5I2KB 4R72A 5CMMA 4Q8RA 1MQGA 4R2FA 4PQJA 2H4IA 1ZLQA 1H45A 3MVZA 3O9PA 1LBBA 5I2NB 5H8FB 3OO9A 3PUWE 3MJNA 3FVKA 2VHAA 2DVZA 2OWSA 4QHQA 3H6UA 4GRKA 4GQOA 4ESXA 3KBRA 3H06B 1OMPA 1MS7A 1A8EA 5JTYA 3ILTB 3A09A 2D3IA 5FHNA 2Z8DA 4R6YA 1Y1MA 1PDAA 1ZKBA 4U4XA 4GLIA 1US4A 3OO7A 3FVGA 1B52A 1NL5A 4IGTA 2X7PA 4OFOA 1MM6A 1LAFE 3HV1A 4R9GA 3ECRA 4KFQA 4R74A 4NWDA 4F1UA 4THIA 3AXFA 5I57A 4IO6A 3RT8A 4L17A 4G68C 4DXUA 1P1QA 3TCHA 1MPCA 2G93A 3CI8A 1J1NA 3IOVA 3V8XB 4NF5B 4F3SA 3TAJA 3DP8A 3N5LA 1JW5A 1N76A 3K00A 3VDFA 3K6XA 1PEBA 4U4SA 5CBRA 1LFHA 1MPDA 3K02A 1EU8A 3SEXA 4U2RA 3OOAA 2Q89A 1POTA 2B3FA 2ONKE 1XT8A 2F6PA 1F9BA 2Q2AA 1DOTA 4JDFA 2RC7A 1LCFA 4KR5A 1NFTA 1OVTA 4WKMA 3GBBA 3Q25A 1IXCA 3CSGA 2LAOA 1VE4A 2OK2A 2E0SA 4I8CA 2FA7A 3VXBA 1OVBA 1A40A 1D4NA 5TP9A 2O51A 5TPAB 2NOOA 2DXRA 4F3GA 4JB7A 1WDNA 1PB9A 4UA8A 5IAIA 4OETA 3OELA 4OERA 2HAUA 1B46A 2Z22A 1SW4A 3P7IA 3Q28A 5EHSA 1P1NA 4X48A 4YKJA 3MAMA 3PUXE 1B9JA 4FE8A 2QMXA 5DEXA 4QSCA 2IA4A 2DYXA 1MXYA 1I6BA 4ZZAA 2BJJX 3K6UA 1JEUA 4YMAA 3PPRA 2P1SA 3A3UA 1VFEA 4R75A 3SEUA 4IGRA 2RF1A 3OSQA 2A5TA 2Q9TA 4EQ7A 2FYIA 2HZLA 3MVWA 3FV1A 2HCAA 1EZ9A 1AH5A 3MP6A 2O7IA 4QRZA 3N94A 5H8QA 3VV5A 4XKPA 4M1VA 4GL8A 4LQ2A 3O66A 5IKBA 4Q0CA 1SW1A 1MQIA 3HSTA 1SDXA 4PFTA 4OWDA 1Y20A 3K1NA 4EF1A 3V89B 3TTLA 1B3HA 4QFPA 3U1OA 3B6WA 3ZS6A 1URGA 3C4MA 4TQUQ 1N7XA 3FXQA 3K6WA 1NNPA 3TTNA 3LC8A 1ZJLA 1A55A 4FATA 1LB9A 3W9WA 3IAZA 2O69A 3QAXA 4I62A 3OENA 3CFXA 1LCTA 2E1SA 4AB5A 4G8MA 2UYFA 4N13A 1Z7ME 2UVGA 4OHNA 4JSOA 1OIBA 4EUOA 1M5EA 3D4CA 2OWTA 2I48A 3K2DA 1OQGA 1DSNA 1LFGA 4XKNA 1GR2A 1R1NA 1DTGA 3Q26A 4ZS9A 4MBPA 5I56A 3D4GA 5K2XA 5AA2D 1GTKA 1O64A 3C9HA 5AA4A 4GL0A 3K1MA 2V3QA 3TMGA 1B3GA 4C1TA 2X26A 1HSLA 3VFJA 2AL4A 4YKPA 1KWHA 1JQFA 3TEPA 4ZEIA 3TFLA 4G4PA
chains in the Genus database with same CATH superfamily
4X1DA 1M5BA 1B1XA 3MP1A 3KJTA 3FXBA 5ET6A 2GHAA 5AA2A 2W7YA 4BDQA 1BP5A 2OLBA 4OVQA 3K6VA 2AYSA 3O6GA 5CRYA 4GBVA 4HS7A 4OZ9A 2G29A 4H5FA 2V3TA 3KZGA 1Y1ZA 4PFBA 4NE4A 3M3FA 3RN8A 4I3EA 3BFTA 1MDQA 4F19A 4H1XA 4HCYA 3JV9A 3HPIA 4RXLA 1DTZA 1URSA 4PAIA 4OVSA 2QS2A 4OMBA 2V84A 1Y3NA 4AS5A 4MAGA 5DVFA 1IMAA 3H6VA 1SQYA 4X1BA 2XXWA 4YB5A 1B1HA 4O94A 2DVCA 3MZBA 4N07A 3UK4A 3VVFA 1NUYA 3BIHA 2FNCA 3RT6B 2O84X 3QK6A 4NF4A 1S50A 1AL3A 3U94A 2PX1A 4P1EA 4MF3A 3B6TA 4N81A 2QS4A 1XVYA 5I84A 1O63A 3DP4A 5ET8A 3PPQA 5I59B 4P0IA 1PB8A 4JBZA 3OMBA 3E4RA 1DBZA 1FBGA 1JEVA 2XXRA 4GWZA 1FTMA 5I5PA 4ELQA 1FTLA 3KGCA 1IMFA 1LBWA 2GHBA 2YJPA 1ZTYA 2ZYOA 4ZE9A 5K2YA 3GBAA 3VLUA 4F18A 4N6KA 3V5AA 2Y7IA 1YAEA 2P2AA 1FSAA 2O68A 3PMWA 5FTIA 4ZEKA 4X9TA 2DE4A 3IL1B 3KSJA 1UIUA 3UIFA 3PV0E 2XHDA 3M8UA 4GF8A 1SI1A 5ICTA 3SEVA 3DM0A 2WBDA 3MPKA 1JVYA 2DP8A 3H03A 3RTWB 4YKKA 1RDZA 3WAFA 1LAGE 4MX6A 2PT1A 2H5YA 2M8CA 4NX1A 4QSDA 2FVZA 4U23A 4IO4A 5FBPA 4AB6A 3FXRA 2VD2A 4R6KA 3G3JA 5ET5A 5J1DA 1ATGA 4R73A 3SESA 2UXAA 3H7MA 4YAHX 5CI5A 3CSBA 1DPEA 4BLAA 1M5FA 1XVXA 1Y4TA 2ZYKA 5ITOA 2Q8MA 1QKAA 2I4CA 4PP0A 4F1YA 2B4LA 3TKDA 3TYHA 2QMWA 2ONRA 1MQDA 1H3DA 2VP1A 5DVJA 1B58A 1NUZA 1L5TA 4UABA 2CZIA 2ALUA 1POY1 1FBFA 1MY1A 4RY1A 2HZKA 4LATA 2KQZA 4F22A 3CG3A 1CB6A 5CMKA 3G3IA 1SW2A 3LSLA 3M3LA 3CIJA 1XOCA 3PPOA 2O7UA 1FTAA 4PGNA 4MNIA 4DXBA 5A5XA 4G68B 1NV2A 4NF8A 5TP9B 2I4BA 4XKQA 2KR0A 4OESA 2I0BA 2Y7KA 4GWSA 2QVRA 1FCKA 4DLDA 5DVIA 3HHGA 1Q9DA 4ECFA 4YB7A 1B0HA 1ELJA 3R7XA 4QF9A 2GFEA 4JVDA 2V3UA 1ANFA 4MFIA 1MY0A 3T9HB 3MUQA 1A7LA 1EZPA 1B32A 3KN8A 2P3NA 2JJKA 1M5DA 2QPQA 4DCXA 3HN0A 5EQ7A 3RTFB 1I6AA 4RNSA 1BTJA 4N8GA 2RCAA 1JW1A 2A5TB 2XD3A 3FJMA 2ZMBA 5ITPA 1DMBA 4O7IA 1YCJA 3PUZE 5T3JA 4LVQA 5H8QB 4U21A 3FV2A 1QGXA 4IY5A 2OX3A 4M4GA 2B4MA 3GXAA 4JVCA 2VGQA 1R6ZA 2Q8JA 4F39A 4P8BA 3G3HA 1FRPA 1MXVA 1ZMGA 3LSFB 3KOTA 4HW8A 1K9YA 5HBCA 1NV0A 3SERA 4RPOA 4U22A 2UVHA 5FHOA 2DSFA 1MXXA 3FIRA 3R6UA 4YB6A 2ZNUA 1FTKA 4MLQA 4P47A 2DXYA 1DPPA 4XKRA 1MG1A 2V4CA 3MPLA 3FJGA 4P0GA 2O1LA 1YPNA 1Y9UA 4MEVA 2R71A 1MY3A 1MM7A 3EPEA 1FQCA 2QVVA 2XWKA 1Y3QA 4POWA 4OFLA 4H67A 3GZGA 1GGGA 4OFJA 5AA4B 4GXSB 2CZLA 1SI0A 5I2KA 2QRYA 3G3KA 1B5IA 1FPEA 4QBAA 1PBQA 4H6DA 4HTGA 1IMEA 4KCCA 2UVJA 1FQEA 2F3BA 3PU5A 3T22A 5H8FA 5KZTA 1P1OA 4YU0A 5KCJA 1IMDA 4GBWA 2XXXA 4E0XA 4WXJA 4KQPA 4PBQA 2F7CA 1XHYA 3SDFA 4DXCA 5KDTB 1US5A 2DOJA 4OVRA 1QULA 4NF6B 2QS3A 4POXA 3ONMA 2ESNA 3MSTA 2UVIA 3PPPA 1KA1A 2XX7A 3FASA 1EYJA 3K01A 2P3VA 1IXGA 1FPDA 1IQ7A 3USDA 1S7YA 1ZU0A 4QFNA 4NTLA 4ZEDA 3G7WA 3CG1A 3O28A 2XWIA 2XD2A 3E79A 3ZSFA 3IK6B 3TQLA 5F24A 4OA4A 4GWWA 5H8HB 1LAXA 4LA9A 4GWOA 4ELPA 4KYEA 3N26A 3UORA 5H8NB 4LZ5A 4NF5A 5ESYA 3NOHA 1IZ1A 1VFDA 1LBZA 1VSOA 3MZ9A 3OD7A 2UYEA 3EHTA 2Y5LA 3VXCA 1R9LA 4H0WA 2HXRA 5A5LA 4DDDA 1USYH 1N84A 3MVXA 1UTBB 4XIGQ 5IM2A 3W15C 3KG2A 4RK2A 1A54A 4KPTA 2I3VA 1ZBMA 4NHBA 5HM4B 2AL5A 3TTKA 1FJ6A 2CEXA 1FQBA 4DI3D 3IFCA 4IR8A 3RNNA 1JW4A 4FORA 3CFLA 1IMBA 4H8IA 5CMBA 2HPGA 5L9MA 3PD8A 4C0RA 1Q35A 5L9OA 2OZZA 4XFEA 1B2HA 5TPAA 1LBXA 1TFAA 3SKPA 2ZNSA 1QJMA 3GLBA 1QVSA 5I58A 3K0VA 1CNQA 2QL3A 2V93A 1IXHA 1MXWA 3FVOA 1UTHB 1PC3A 1B51A 5ET7A 2CEYA 5ISUA 1B4HA 3T66A 1TWYA 1P1WA 4Q5TA 3WAEA 1A99A 3MQ9A 4MNPA 5M2VA 3VVDA 3MC2A 3LV0A 4QXDA 5IGAA 2GH9A 3C36A 2QVUA 4PTKA 3SEWA 3E3KA 4UACA 1IITA 4ZE8A 4DIGA 1B40A 1GV8A 1MXUA 1EH3A 4MCOA 5L8DA 3D1RA 5FTHA 5TU0A 3FATA 1NI9A 4I1DA 3RQTA 3RPLA 3KN7A 3IOWA 3MWBA 1OLAA 1I6QA 3DELB 4F2OA 4P11A 3RY3A 1JP4A 1RYOA 3O6IA 3BKIB 2YLNA 4GD5A 1B0LA 3G3FA 3CVGA 2OWZA 4DZ1A 3C34A 4E0WA 2ABHA 2RINA 3THIA 1FTJA 1FBDA 4GVOA 5JK4A 1DCUA 4RA1A 1D9VA 1JNFA 3K1PA 4O8MA 1YXIA 3QXMA 1FQFA 1I69A 3LR1A 4G77A 5AE4A 4PE5B 4O3BA 5JTYB 1N7WA 1FPJA 1NNKA 2HFBA 2V25A 1Y3PA 2XWOA 3O97A 1QKBA 4FEDA 2D21A 3EHUA 3IORA 4ND9A 3OO8A 4ELRA 3IB2A 3QMFA 1AMFA 2NXOA 4GIZA 4OEUA 3TPAA 3HHFA 2R9JA 1LBYA 2DE3A 2NWJA 2PFZA 1LGBC 3BBRA 1LFIA 3EQ1A 2Q2CA 3T96B 4KXPA 3C31A 1LBCA 3N6TA 1GVCA 4F29A 4IY6A 1QUJA 3L6GA 5I57B 3PD9A 4WEPA 2PCRA 4YMBA 1O7TA 4YICA 1B3EA 3O2AA 1IEJA 1QUIA 2OBGA 3JZJA 4HE1A 3KFMA 4PAKA 2FHYA 3IFAA 4DI4B 2F34A 5H8SA 1M5CA 1MRPA 3B7DA 3Q27A 4HE0A 2I6EA 3VVEA 1MY2A 3FUZA 5BWJA 2ANJA 4RPNA 4NG7A 2B3BA 3IR1A 4XEQA 5IZ3A 2XXUA 1NV7A 4Z0IA 4U1ZA 1LSTA 1DK4A 2XXPA 1MQHA 3LUYA 2Z8FA 1FTOA 3IB1A 1NH7A 5EQ8A 1XS5A 1LLSA 4ELOA 4EQ9A 1FPIA 3UA8A 4KI0E 4H5GA 1MH3A 2RC8A 4JWOA 2D5WA 1NUWA 5DTBA 2ZXTA 1RDXA 2Y7PA 1H44A 2OJTA 4OENA 4GOTA 2DWJA 3PGFA 3ODBA 3E9XA 4JWYA 1TT1A 4KYDA 4EDPA 4FECA 1JETA 4LZ7A 3S9NC 2HQ0A 4LONB 3LSWA 4ISUA 2XXVA 4F2QA 4EXLA 3IX1A 4BDMA 2VPNA 2OCUA 5L9SA 2THIA 2Y7WA 1NV3A 3QIMA 1FPKA 4R6HA 5I59A 5FHMA 2WEFA 1SYIA 3HO7A 1MH4A 2YPNA 4OVTA 2VD3A 2L5VA 2F6GA 2ZZWA 1LAHE 3EF7A 3TTRA 5KCJB 3MBPA 1NKXA 5DEXB 4NGUA 4IO7A 5EYHA 3LUZA 4OTEA 4JSDA 3U92A 1PB7A 3HCQA 1R9QA 1N3XA 4GXAA 3T9VA 2DWAA 3S4UA 3V83A 1SBPA 2REGA 1RKMA 2A5SA 3CFZA 4HCWA 1B3FA 1NV1A 4G8NA 4NN3A 1LBVA 3T0JA 2VOZA 4OXVA 4PFUA 2ZYNA 2H98A 2XX8A 5B70A 4BDOA 1ZIUA 4PFYA 3PUYE 4O3AA 1URDA 4N6DA 3RLFE 5ICQA 3KOSA 3EHSA 4N91A 3Q29A 1SYHA 1CE2A 4TOZA 1T0KA 3QYTA 1NNFA 3G3GA 4PDDA 2XXQA 4H45A 3K4UA 3UN6A 4F1VA 3T9UA 1OQHA 4QSEA 4MH5A 4H8JA 1KZ8A 1MQJA 2FIXA 4JWXA 2ONSA 5ELVA 3W9VA 4FJPA 2Z8EA 4O3CA 2Y84A 2DDKA 4EF2A 4PE3A 3F11A 2KLFA 3IO6A 2I58A 5DW8A 4TLLB 2F78A 3B50A 5J16A 1BLFA 1YZ0A 3FD3A 4NAPA 1WVJA 5EHMA 3MP8A 4PGPA 3TCFA 2RCBA 2B65A 1P99A 3N6UA 4K3FA 2I49A 5LOMA 4IO5A 1NV6A 3RPWA 5I56B 1NH8A 3QUFA 5CC2A 4N17A 5HPQA 4XXUA 1WODA 1B4ZA 3MZ1A 4G68A 4ZZEA 1JVXA 3R26A 3IOUA 2I3WA 5I2NA 1HSEA 2QJEA 3TUSA 1FQDA 3IOTA 2F35A 5AA2B 4KCDA 4PFWA 1MY4A 5I58B 1UQWA 1FBHA 2XXIA 4WEDA 3UGWA 4TLMB 2F5XA 2O1MA 2PYYA 4ZECA 4P9KA 3VLVA 1BKAA 1H76A 5AA3A 3EN3A 4QFLA 4PF8A 1QW0A 3CRBA 2X7QA 4O7MA 2XXYA 4IB2A 2IEEA 3B6QA 1NNTA 3S9LC 3U65A 1B05A 4ZEFA 4ZEBA 3FGSA 4OQOA 3LBSA 4MLVA 1AOVA 1Z7NE 5F7VA 4ZDMA 4RK9A 1NV4A 3GYYA 3I3VA 1TXFA 3S9EA 1D9YA 4F31B 2PBWA 4NEDA 3IJOB 3SEYA 3KBZA 4XTCQ 1YTVA 2DS9A 3SETA 4YZZA 1QUKA 1B7ZA 3U72A 3KEIA 4NF4B 1SD3A 3RPLB 1EZOA 2DWIA 2XX9A 3CHGA 2FBPA 3TODA 3PUVE 1USYE 1P1UA 4OYVA 4Z7EA 3UP9A 2AIXA 3H3GA 1VR5A 3A3CA 4HXVA 5LDZA 2ZYMA 3QSLA 3T9XB 2F3DA 3TZAA 2H25A 3OSRA 3MVYA 2REJA 4G2ZA 3IJXB 4NQ8A 4I40A 4FBPA 3PMVA 4AQ4A 4LUBA 3C32A 2RC9A 3C35A 4N4UA 4G8HA 3I6VA 4F3BA 1YYZA 1S9TA 5JEIA 1TFDA 2Y7RA 2PT2A 2MKZA 1IIWA 3M3KA 4JXIA 3QUJA 5AA1A 3OO6A 3VLWA 3OEMA 5CBSA 4GFRA 4KYSA 2PMSA 5BUUA 4FIMA 3T93B 5DYHA 2DQVA 1MPBA 2XWVA 3S9MC 5CM6A 2QFLA 2RKMA 3KSXA 1D3KA 1INPA 4H65A 4C1UA 4DE8A 2F36A 3B8BA 3FXUA 4GX3A 3TDJA 3TCGA 2HAVA 4QFKA 2DWHA 3E78A 3MYUA 4BDLA 2F7AA 3T1BA 3BFUA 1RDYA 3O6HA 3C33A 1VDWA 3TTMA 5KDTA 1B3LA 4NF6A 3VE1B 1MDP1 4OVJA 3E13X 2Q88A 1A8FA 1SVXB 4IO3A 4N8YA 3DLNA 4GX6A 4KD5A 5IZ3B 4I9DA 4P3LA 2HHMA 1Y4CA 3FJ7A 1FPLA 1Q1KA 5LTCA 4N6PA 3U8QA 2CMOA 5DT6A 2R6GE 4FAJA 3TELA 2F97A 1G0HA 2R8TA 1N0TA 4EQBA 5H8HA 5A5XB 1SW5A 1FJ9A 4BDRA 3U93A 3RGYA 4NF8B 4LP2B 4EXKA 2PFYA 1NMUA 1MXZA 1LB8A 5H8NA 4U1OA 1IMCA 2WX9A 4PFRA 2F7BA 4NMYA 4PCDA 4BDNA 2NUVA 1AWBA 1HSJA 2H99A 3JYRA 4YKIA 4KHZE 2WKYA 3PPNA 4G61A 1B5JA 4MNCA 3KJ7A 2HEUA 1B7HA 4AS4A 1FW0A 1UTBA 1XC1A 3ZKLA 3I5OA 3L6HA 1FBCA 1PBPA 5F1QA 1UIVA 2NVUB 3O29A 4QFOA 4Q30B 3S2VA 2QS1A 3CR9A 2Z23A 1N3WA 4DCYA 3KN3A 4H46A 2ZZXA 1RYXA 1OLCA 3FVNA 3RUMA 3A29A 3LSXA 1FBPA 3PTYA 5EYGA 1FBEA 4RYAA 1B7UA 2PVUA 2WBBA 3KC1A 1B5HA 2DE2A 4OEVA 1IXIA 2I0CA 2Q74A 5I3SA 4LZ8A 4LQ5A 1EYIA 3ZKKA 4ESWA 1FPGA 5B7DA 1D9QA 3OXNA 1UTHA 4NWCA 3DP6A 2P0SA 4RJZA 4XF5A 4PETA 3ILUB 4FEBA 2F8DA 4GWYA 3H4ZA 1FQAA 2GRVA 3H6WA 3FZVA 2H9BA 2ZNTA 3IO4A 3MW0A 1FPBA 1IUDA 4PFIA 2XXHA 4R2BA 2HXWA 2WYPA 1B6HA 5CMCA 1K9ZA 4R9FA 4IO2A 4P56A 3IB0A 5EYFA 4F3PA 2O6AA 3OEKA 2XXTA 1II5A 1AIVA 2QSXA 3KC0A 3TQWA 4N15A 1BIYA 1NV5A 4X8RA 4ONYA 3PMXA 2XXKA 2CZHA 1N04A 3H6TA 1H43A 5I2KB 4R72A 4PC9A 5CMMA 4Q8RA 1MQGA 4R2FA 4I3YA 4PQJA 1NUXA 5EQAA 2H4IA 1ZLQA 1H45A 3MVZA 3O9PA 1LBBA 5I2NB 5H8FB 3OO9A 3ISPA 3PUWE 3MJNA 4PDHA 3FVKA 2VHAA 2DVZA 2OWSA 2BJIA 4QHQA 2ZZVA 4HE2A 3H6UA 4GRKA 4GQOA 4ESXA 3KBRA 3H06B 1OMPA 1MS7A 1A8EA 5JTYA 3ILTB 3A09A 2D3IA 5FHNA 5I7IA 2Z8DA 4R6YA 1Y1MA 1PDAA 1ZKBA 4U4XA 2FIEA 1EYKA 4GLIA 1US4A 2VT5A 3OO7A 3FVGA 1B52A 1NL5A 4JVIA 4IGTA 2X7PA 3EKIA 4OFOA 1MM6A 1LAFE 3HV1A 4R9GA 3ECRA 4KFQA 4R74A 4NWDA 2XA5A 4F1UA 5IZ1A 4THIA 4X04A 3AXFA 5I57A 4IO6A 3RT8A 4L17A 4G68C 4DXUA 4MJOA 1P1QA 3TCHA 1MPCA 2G93A 4GX4A 3CI8A 1J1NA 3IOVA 3V8XB 4NF5B 4F3SA 3TAJA 3DP8A 1KA0A 3N5LA 1JW5A 1N76A 3K00A 3VDFA 3K6XA 1PEBA 4U4SA 4MMPA 5CBRA 1LFHA 1MPDA 3K02A 1EU8A 3SEXA 4U2RA 3OOAA 2Q89A 1POTA 2B3FA 2ONKE 1XT8A 2F6PA 4PBHA 1F9BA 2Q2AA 1DOTA 4JDFA 4PAFA 5EQ9A 4PF6A 2RC7A 1LCFA 4KR5A 2WYKA 1NFTA 1OVTA 4WKMA 3GBBA 3Q25A 1IXCA 3CSGA 2LAOA 4GWXA 1VE4A 2OK2A 2E0SA 4I8CA 2FA7A 3VXBA 1OVBA 1A40A 1D4NA 5TP9A 2O51A 5TPAB 2NOOA 2DXRA 4F3GA 4JB7A 1WDNA 1PB9A 4UA8A 2GQ1A 5IAIA 1LEVA 4OETA 3OELA 4OERA 2HAUA 1B46A 2Z22A 1FPFA 1SW4A 3P7IA 3Q28A 5EHSA 1P1NA 2VPOA 4X48A 4YKJA 3MAMA 3PUXE 1B9JA 4FE8A 2QMXA 5DEXA 4QSCA 2IA4A 2DYXA 1MXYA 1I6BA 4ZZAA 2BJJX 3K6UA 1JEUA 4YMAA 3PPRA 2P1SA 3A3UA 1VFEA 3FBPA 4R75A 3SEUA 4IGRA 2RF1A 3OSQA 2A5TA 2Q9TA 2CZKA 4EQ7A 2FYIA 2HZLA 3MVWA 3FV1A 2HCAA 1EZ9A 1AH5A 4P1LA 3MP6A 1G0IA 2O7IA 4QRZA 5IZZA 3N94A 5H8QA 3VV5A 4XKPA 4MHFA 4M1VA 4GL8A 1BK4A 4LQ2A 3O66A 5IKBA 4Q0CA 1SW1A 1MQIA 3HSTA 1SDXA 4PFTA 4OWDA 1Y20A 3SZPA 3K1NA 4EF1A 3V89B 3TTLA 1B3HA 4QFPA 3U1OA 3B6WA 3ZS6A 1URGA 3BIGA 3C4MA 4TQUQ 1N7XA 3FXQA 3K6WA 1NNPA 3TTNA 1XI6A 3LC8A 1ZJLA 1A55A 4FATA 1LB9A 3W9WA 3IAZA 2O69A 3QAXA 2Y5KA 4OANA 4I62A 3OENA 3CFXA 1LCTA 4OVPA 2E1SA 4AB5A 4G8MA 2UYFA 4N13A 1Z7ME 2UVGA 4OHNA 4JSOA 1OIBA 4EUOA 1M5EA 3D4CA 2OWTA 2I48A 3K2DA 1OQGA 1DSNA 1LFGA 4XKNA 1GR2A 1R1NA 1DTGA 3Q26A 4ZS9A 4MBPA 5I56A 3D4GA 5K2XA 5AA2D 4MIJA 1GTKA 1O64A 3C9HA 5AA4A 4GL0A 3K1MA 2V3QA 3TMGA 1B3GA 4C1TA 2X26A 1HSLA 3VFJA 2AL4A 4YKPA 1KWHA 4GWUA 1JQFA 3RYDA 3TEPA 4LN5A 1SPIA 3ROJA 4ZEIA 3TFLA 4G4PA 4NF0A 3HFUA
chains in the Genus database with same CATH topology
4X1DA 1M5BA 1B1XA 3MP1A 3KJTA 2GHAA 5AA2A 2W7YA 4BDQA 1BP5A 2OLBA 3K6VA 2AYSA 3O6GA 5CRYA 4HS7A 4OZ9A 2G29A 4H5FA 2V3TA 3KZGA 1Y1ZA 4NE4A 3M3FA 3RN8A 3BFTA 1MDQA 4F19A 4H1XA 4HCYA 3JV9A 3HPIA 4RXLA 1DTZA 1URSA 2QS2A 4OMBA 2V84A 1Y3NA 5DVFA 3H6VA 1SQYA 4X1BA 2XXWA 4YB5A 1B1HA 2DVCA 3MZBA 4N07A 3UK4A 3VVFA 2FNCA 3RT6B 2O84X 3QK6A 4NF4A 1S50A 1AL3A 3U94A 2PX1A 4MF3A 3B6TA 2QS4A 1XVYA 5I84A 1O63A 3DP4A 5I59B 3PPQA 4P0IA 1PB8A 4JBZA 3OMBA 3E4RA 1JEVA 2XXRA 1FTMA 4ELQA 1FTLA 3KGCA 2YJPA 2GHBA 1ZTYA 2ZYOA 4ZE9A 5K2YA 3GBAA 3VLUA 4F18A 3V5AA 2Y7IA 1YAEA 2P2AA 3PMWA 2O68A 5FTIA 4ZEKA 4X9TA 2DE4A 3IL1B 3KSJA 1UIUA 3UIFA 3PV0E 2XHDA 3M8UA 4GF8A 1SI1A 5ICTA 3SEVA 3DM0A 3MPKA 1JVYA 2DP8A 3H03A 3RTWB 4YKKA 3WAFA 1LAGE 2PT1A 2H5YA 2M8CA 4QSDA 4U23A 4IO4A 4AB6A 3FXRA 2VD2A 4R6KA 3G3JA 5J1DA 1ATGA 4R73A 3SESA 2UXAA 3H7MA 4YAHX 5CI5A 3CSBA 1DPEA 4BLAA 1M5FA 1XVXA 1Y4TA 2ZYKA 5ITOA 1QKAA 2I4CA 4PP0A 4F1YA 3TKDA 3TYHA 2QMWA 2ONRA 1MQDA 1H3DA 2VP1A 5DVJA 1B58A 1L5TA 2ALUA 1POY1 1MY1A 4RY1A 2HZKA 4LATA 4F22A 3CG3A 1CB6A 5CMKA 3G3IA 1SW2A 3LSLA 3M3LA 3CIJA 1XOCA 3PPOA 2O7UA 4DXBA 5A5XA 4G68B 4NF8A 5TP9B 2I4BA 4XKQA 4OESA 2I0BA 2Y7KA 1FCKA 4DLDA 5DVIA 3HHGA 4ECFA 4YB7A 1B0HA 1ELJA 3R7XA 4QF9A 2GFEA 2V3UA 1ANFA 4MFIA 1MY0A 3T9HB 3MUQA 1A7LA 1EZPA 1B32A 3KN8A 1M5DA 2QPQA 4DCXA 3HN0A 3RTFB 1I6AA 4RNSA 1BTJA 2RCAA 1JW1A 2A5TB 2XD3A 3FJMA 2ZMBA 5ITPA 1DMBA 1YCJA 3PUZE 4LVQA 5H8QB 4U21A 3FV2A 4IY5A 4M4GA 3GXAA 2VGQA 1R6ZA 2Q8JA 4F39A 3G3HA 1MXVA 1ZMGA 3LSFB 3KOTA 4HW8A 5HBCA 3SERA 4RPOA 4U22A 2UVHA 5FHOA 2DSFA 1MXXA 3FIRA 3R6UA 4YB6A 2ZNUA 1FTKA 4MLQA 2DXYA 1DPPA 4XKRA 1MG1A 3MPLA 3FJGA 4P0GA 2O1LA 1YPNA 1Y9UA 2R71A 1MY3A 1MM7A 3EPEA 1FQCA 1Y3QA 4POWA 4OFLA 4H67A 3GZGA 1GGGA 4OFJA 5AA4B 4GXSB 2CZLA 1SI0A 5I2KA 2QRYA 3G3KA 1B5IA 1PBQA 4H6DA 4HTGA 4KCCA 2UVJA 1FQEA 3PU5A 3T22A 5H8FA 5KZTA 1P1OA 4YU0A 5KCJA 2XXXA 4E0XA 4WXJA 4KQPA 2F7CA 1XHYA 3SDFA 4DXCA 5KDTB 1US5A 2DOJA 1QULA 4NF6B 2QS3A 4POXA 3ONMA 2ESNA 2UVIA 3PPPA 2XX7A 3FASA 3K01A 1IXGA 1IQ7A 3USDA 1S7YA 1ZU0A 4QFNA 4NTLA 4ZEDA 3G7WA 3CG1A 3O28A 2XD2A 3ZSFA 3IK6B 3TQLA 5H8HB 1LAXA 4LA9A 4GWOA 4ELPA 4KYEA 3N26A 3UORA 5H8NB 4LZ5A 4NF5A 1IZ1A 1VFDA 1VSOA 3MZ9A 3OD7A 2UYEA 3EHTA 3VXCA 1R9LA 4H0WA 4DDDA 1USYH 1N84A 3MVXA 1UTBB 4XIGQ 3W15C 3KG2A 4RK2A 1A54A 4KPTA 2I3VA 1ZBMA 5HM4B 2AL5A 3TTKA 1FQBA 3RNNA 1JW4A 4FORA 3CFLA 4H8IA 5CMBA 5L9MA 3PD8A 4C0RA 1Q35A 5L9OA 2OZZA 1B2HA 5TPAA 1TFAA 3SKPA 2ZNSA 1QJMA 3GLBA 1QVSA 5I58A 3K0VA 2QL3A 2V93A 1IXHA 1MXWA 3FVOA 1UTHB 1PC3A 1B51A 5ISUA 1B4HA 3T66A 1TWYA 1P1WA 4Q5TA 3WAEA 1A99A 3MQ9A 3VVDA 5M2VA 3MC2A 2GH9A 3C36A 3SEWA 3E3KA 4UACA 1IITA 4ZE8A 4DIGA 1B40A 1GV8A 1MXUA 1EH3A 5L8DA 5FTHA 5TU0A 3FATA 4I1DA 3RQTA 3KN7A 3IOWA 3MWBA 1I6QA 1OLAA 3DELB 4F2OA 4P11A 3RY3A 1RYOA 3O6IA 3BKIB 2YLNA 4GD5A 1B0LA 3G3FA 3CVGA 4DZ1A 3C34A 4E0WA 2ABHA 2RINA 3THIA 1FTJA 4GVOA 5JK4A 4RA1A 1D9VA 1JNFA 3K1PA 3QXMA 1FQFA 1I69A 3LR1A 4G77A 5AE4A 4PE5B 4O3BA 5JTYB 1N7WA 1NNKA 2HFBA 2V25A 1Y3PA 3O97A 1QKBA 4FEDA 2D21A 3EHUA 3IORA 4ND9A 3OO8A 4ELRA 3IB2A 1AMFA 2NXOA 4GIZA 4OEUA 3TPAA 3HHFA 2R9JA 2DE3A 2NWJA 1LGBC 3BBRA 1LFIA 3EQ1A 2Q2CA 3T96B 3C31A 1LBCA 3N6TA 1GVCA 4F29A 4IY6A 1QUJA 3L6GA 5I57B 3PD9A 4WEPA 4YMBA 1O7TA 4YICA 1B3EA 3O2AA 1IEJA 1QUIA 2OBGA 3JZJA 3KFMA 2F34A 5H8SA 1M5CA 1MRPA 3B7DA 3Q27A 2I6EA 3VVEA 1MY2A 3FUZA 5BWJA 2ANJA 4RPNA 2B3BA 3IR1A 2XXUA 4Z0IA 4U1ZA 1LSTA 2XXPA 1MQHA 3LUYA 2Z8FA 1FTOA 3IB1A 1NH7A 1XS5A 1LLSA 4ELOA 4EQ9A 3UA8A 4KI0E 4H5GA 1MH3A 2RC8A 4JWOA 2D5WA 5DTBA 2ZXTA 2Y7PA 1H44A 2OJTA 4OENA 4GOTA 2DWJA 3PGFA 3ODBA 3E9XA 4JWYA 1TT1A 4KYDA 4EDPA 4FECA 1JETA 4LZ7A 3S9NC 2HQ0A 4LONB 3LSWA 4ISUA 2XXVA 4F2QA 4EXLA 3IX1A 4BDMA 2OCUA 5L9SA 2THIA 2Y7WA 3QIMA 4R6HA 5I59A 5FHMA 1SYIA 3HO7A 1MH4A 2YPNA 2VD3A 2F6GA 1LAHE 3EF7A 3TTRA 5KCJB 3MBPA 1NKXA 5DEXB 4IO7A 4OTEA 4JSDA 3U92A 1PB7A 3HCQA 1R9QA 1N3XA 4GXAA 3T9VA 2DWAA 3S4UA 3V83A 1SBPA 2REGA 1RKMA 2A5SA 3CFZA 4HCWA 1B3FA 4G8NA 2VOZA 4OXVA 4PFUA 2ZYNA 2H98A 2XX8A 5B70A 4BDOA 1ZIUA 4PFYA 3PUYE 4O3AA 1URDA 3RLFE 5ICQA 3KOSA 3EHSA 3Q29A 1SYHA 1CE2A 4TOZA 1T0KA 3QYTA 1NNFA 3G3GA 2XXQA 3K4UA 3UN6A 4F1VA 3T9UA 1OQHA 4QSEA 4MH5A 4H8JA 1MQJA 4JWXA 2ONSA 5ELVA 3W9VA 4FJPA 2Z8EA 4O3CA 2Y84A 4EF2A 3F11A 2KLFA 3IO6A 2I58A 4TLLB 2F78A 1BLFA 3FD3A 1WVJA 5EHMA 3MP8A 3TCFA 2RCBA 2B65A 1P99A 3N6UA 4K3FA 2I49A 5LOMA 4IO5A 3RPWA 5I56B 1NH8A 3QUFA 5CC2A 5HPQA 4XXUA 1WODA 1B4ZA 3MZ1A 4G68A 4ZZEA 1JVXA 3R26A 3IOUA 2I3WA 5I2NA 1HSEA 2QJEA 3TUSA 1FQDA 3IOTA 2F35A 5AA2B 4KCDA 4PFWA 1MY4A 5I58B 1UQWA 2XXIA 4WEDA 3UGWA 4TLMB 2F5XA 2O1MA 2PYYA 4ZECA 3VLVA 1BKAA 1H76A 5AA3A 3EN3A 4QFLA 1QW0A 3CRBA 2X7QA 2XXYA 4IB2A 2IEEA 3B6QA 1NNTA 3S9LC 1B05A 4ZEFA 4ZEBA 3FGSA 4OQOA 3LBSA 4MLVA 1AOVA 1Z7NE 5F7VA 4ZDMA 4RK9A 3I3VA 1TXFA 3S9EA 1D9YA 4F31B 2PBWA 4NEDA 3SEYA 3IJOB 4XTCQ 1YTVA 2DS9A 3SETA 4YZZA 1QUKA 1B7ZA 3U72A 3KEIA 4NF4B 1SD3A 1EZOA 2DWIA 2XX9A 3TODA 3PUVE 1USYE 1P1UA 4OYVA 4Z7EA 3UP9A 2AIXA 3H3GA 1VR5A 3A3CA 2ZYMA 3QSLA 3T9XB 3TZAA 2H25A 3OSRA 3MVYA 2REJA 4G2ZA 3IJXB 3PMVA 4AQ4A 4LUBA 3C32A 2RC9A 3C35A 4G8HA 3I6VA 4F3BA 1S9TA 5JEIA 1TFDA 2Y7RA 2PT2A 1IIWA 3M3KA 4JXIA 3QUJA 5AA1A 3OO6A 3VLWA 3OEMA 5CBSA 4GFRA 4KYSA 5BUUA 2PMSA 4FIMA 3T93B 5DYHA 2DQVA 1MPBA 3S9MC 5CM6A 2RKMA 3KSXA 1D3KA 4H65A 4C1UA 4DE8A 2F36A 3FXUA 3TDJA 3TCGA 2HAVA 4QFKA 2DWHA 4BDLA 2F7AA 3BFUA 3O6HA 3C33A 3TTMA 5KDTA 1B3LA 4NF6A 3VE1B 1MDP1 4OVJA 3E13X 2Q88A 1A8FA 1SVXB 4IO3A 3DLNA 4KD5A 4I9DA 1Y4CA 3FJ7A 1Q1KA 4N6PA 3U8QA 2CMOA 5DT6A 2R6GE 4FAJA 3TELA 2F97A 1N0TA 4EQBA 5H8HA 5A5XB 1SW5A 4BDRA 3U93A 3RGYA 4NF8B 4LP2B 4EXKA 1NMUA 1MXZA 1LB8A 5H8NA 4U1OA 2F7BA 4NMYA 4BDNA 2NUVA 1HSJA 2H99A 3JYRA 4YKIA 4KHZE 2WKYA 3PPNA 1B5JA 3KJ7A 2HEUA 1B7HA 1FW0A 1UTBA 1XC1A 3ZKLA 3I5OA 3L6HA 1PBPA 5F1QA 1UIVA 2NVUB 3O29A 4QFOA 4Q30B 3S2VA 2QS1A 3CR9A 2Z23A 1N3WA 4DCYA 3KN3A 1RYXA 1OLCA 3FVNA 3RUMA 3LSXA 4RYAA 1B7UA 2PVUA 1B5HA 2DE2A 4OEVA 1IXIA 2I0CA 4LZ8A 4LQ5A 3ZKKA 4ESWA 5B7DA 3OXNA 1UTHA 4NWCA 3DP6A 2P0SA 4RJZA 4PETA 3ILUB 4FEBA 2F8DA 3H4ZA 1FQAA 2GRVA 3H6WA 3FZVA 2H9BA 2ZNTA 3IO4A 3MW0A 1IUDA 2XXHA 4R2BA 2HXWA 1B6HA 5CMCA 4R9FA 4IO2A 3IB0A 5EYFA 4F3PA 2O6AA 3OEKA 2XXTA 1II5A 1AIVA 2QSXA 3TQWA 1BIYA 4ONYA 3PMXA 1N04A 3H6TA 1H43A 5I2KB 4R72A 5CMMA 4Q8RA 1MQGA 4R2FA 4PQJA 2H4IA 1ZLQA 1H45A 3MVZA 3O9PA 1LBBA 5I2NB 5H8FB 3OO9A 3PUWE 3MJNA 3FVKA 2VHAA 2DVZA 2OWSA 4QHQA 3H6UA 4GRKA 4GQOA 4ESXA 3KBRA 3H06B 1OMPA 1MS7A 1A8EA 5JTYA 3ILTB 3A09A 2D3IA 5FHNA 2Z8DA 4R6YA 1Y1MA 1PDAA 1ZKBA 4U4XA 4GLIA 1US4A 3OO7A 3FVGA 1B52A 1NL5A 4IGTA 2X7PA 4OFOA 1MM6A 1LAFE 3HV1A 4R9GA 3ECRA 4KFQA 4R74A 4NWDA 4F1UA 4THIA 3AXFA 5I57A 4IO6A 3RT8A 4L17A 4G68C 4DXUA 1P1QA 3TCHA 1MPCA 2G93A 3CI8A 1J1NA 3IOVA 3V8XB 4NF5B 4F3SA 3TAJA 3DP8A 3N5LA 1JW5A 1N76A 3K00A 3VDFA 3K6XA 1PEBA 4U4SA 5CBRA 1LFHA 1MPDA 3K02A 1EU8A 3SEXA 4U2RA 3OOAA 2Q89A 1POTA 2B3FA 2ONKE 1XT8A 2F6PA 1F9BA 2Q2AA 1DOTA 4JDFA 2RC7A 1LCFA 4KR5A 1NFTA 1OVTA 4WKMA 3GBBA 3Q25A 1IXCA 3CSGA 2LAOA 1VE4A 2OK2A 2E0SA 4I8CA 2FA7A 3VXBA 1OVBA 1A40A 1D4NA 5TP9A 2O51A 5TPAB 2NOOA 2DXRA 4F3GA 4JB7A 1WDNA 1PB9A 4UA8A 5IAIA 4OETA 3OELA 4OERA 2HAUA 1B46A 2Z22A 1SW4A 3P7IA 3Q28A 5EHSA 1P1NA 4X48A 4YKJA 3MAMA 3PUXE 1B9JA 4FE8A 2QMXA 5DEXA 4QSCA 2IA4A 2DYXA 1MXYA 1I6BA 4ZZAA 2BJJX 3K6UA 1JEUA 4YMAA 3PPRA 2P1SA 3A3UA 1VFEA 4R75A 3SEUA 4IGRA 2RF1A 3OSQA 2A5TA 2Q9TA 4EQ7A 2FYIA 2HZLA 3MVWA 3FV1A 2HCAA 1EZ9A 1AH5A 3MP6A 2O7IA 4QRZA 3N94A 5H8QA 3VV5A 4XKPA 4M1VA 4GL8A 4LQ2A 3O66A 5IKBA 4Q0CA 1SW1A 1MQIA 3HSTA 1SDXA 4PFTA 4OWDA 1Y20A 3K1NA 4EF1A 3V89B 3TTLA 1B3HA 4QFPA 3U1OA 3B6WA 3ZS6A 1URGA 3C4MA 4TQUQ 1N7XA 3FXQA 3K6WA 1NNPA 3TTNA 3LC8A 1ZJLA 1A55A 4FATA 1LB9A 3W9WA 3IAZA 2O69A 3QAXA 4I62A 3OENA 3CFXA 1LCTA 2E1SA 4AB5A 4G8MA 2UYFA 4N13A 1Z7ME 2UVGA 4OHNA 4JSOA 1OIBA 4EUOA 1M5EA 3D4CA 2OWTA 2I48A 3K2DA 1OQGA 1DSNA 1LFGA 4XKNA 1GR2A 1R1NA 1DTGA 3Q26A 4ZS9A 4MBPA 5I56A 3D4GA 5K2XA 5AA2D 1GTKA 1O64A 3C9HA 5AA4A 4GL0A 3K1MA 2V3QA 3TMGA 1B3GA 4C1TA 2X26A 1HSLA 3VFJA 2AL4A 4YKPA 1KWHA 1JQFA 3TEPA 4ZEIA 3TFLA 4G4PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4X1D A;  1M5B A;  1B1X A;  3MP1 A;  3KJT A;  2GHA A;  5AA2 A;  2W7Y A;  4BDQ A;  1BP5 A;  2OLB A;  3K6V A;  2AYS A;  3O6G A;  5CRY A;  4HS7 A;  4OZ9 A;  2G29 A;  4H5F A;  2V3T A;  3KZG A;  1Y1Z A;  4NE4 A;  3M3F A;  3RN8 A;  3BFT A;  1MDQ A;  4F19 A;  4H1X A;  4HCY A;  3JV9 A;  3HPI A;  4RXL A;  1DTZ A;  1URS A;  2QS2 A;  4OMB A;  2V84 A;  1Y3N A;  5DVF A;  3H6V A;  1SQY A;  4X1B A;  2XXW A;  4YB5 A;  1B1H A;  2DVC A;  3MZB A;  4N07 A;  3UK4 A;  3VVF A;  2FNC A;  3RT6 B;  2O84 X;  3QK6 A;  4NF4 A;  1S50 A;  1AL3 A;  3U94 A;  2PX1 A;  4MF3 A;  3B6T A;  2QS4 A;  1XVY A;  5I84 A;  1O63 A;  3DP4 A;  5I59 B;  3PPQ A;  4P0I A;  1PB8 A;  4JBZ A;  3OMB A;  3E4R A;  1JEV A;  2XXR A;  1FTM A;  4ELQ A;  1FTL A;  3KGC A;  2YJP A;  2GHB A;  1ZTY A;  2ZYO A;  4ZE9 A;  5K2Y A;  3GBA A;  3VLU A;  4F18 A;  3V5A A;  2Y7I A;  1YAE A;  2P2A A;  3PMW A;  2O68 A;  5FTI A;  4ZEK A;  4X9T A;  2DE4 A;  3IL1 B;  3KSJ A;  1UIU A;  3UIF A;  3PV0 E;  2XHD A;  3M8U A;  4GF8 A;  1SI1 A;  5ICT A;  3SEV A;  3DM0 A;  3MPK A;  1JVY A;  2DP8 A;  3H03 A;  3RTW B;  4YKK A;  3WAF A;  1LAG E;  2PT1 A;  2H5Y A;  2M8C A;  4QSD A;  4U23 A;  4IO4 A;  4AB6 A;  3FXR A;  2VD2 A;  4R6K A;  3G3J A;  5J1D A;  1ATG A;  4R73 A;  3SES A;  2UXA A;  3H7M A;  4YAH X;  5CI5 A;  3CSB A;  1DPE A;  4BLA A;  1M5F A;  1XVX A;  1Y4T A;  2ZYK A;  5ITO A;  1QKA A;  2I4C A;  4PP0 A;  4F1Y A;  3TKD A;  3TYH A;  2QMW A;  2ONR A;  1MQD A;  1H3D A;  2VP1 A;  5DVJ A;  1B58 A;  1L5T A;  2ALU A;  1POY 1;  1MY1 A;  4RY1 A;  2HZK A;  4LAT A;  4F22 A;  3CG3 A;  1CB6 A;  5CMK A;  3G3I A;  1SW2 A;  3LSL A;  3M3L A;  3CIJ A;  1XOC A;  3PPO A;  2O7U A;  4DXB A;  5A5X A;  4G68 B;  4NF8 A;  5TP9 B;  2I4B A;  4XKQ A;  4OES A;  2I0B A;  2Y7K A;  1FCK A;  4DLD A;  5DVI A;  3HHG A;  4ECF A;  4YB7 A;  1B0H A;  1ELJ A;  3R7X A;  4QF9 A;  2GFE A;  2V3U A;  1ANF A;  4MFI A;  1MY0 A;  3T9H B;  3MUQ A;  1A7L A;  1EZP A;  1B32 A;  3KN8 A;  1M5D A;  2QPQ A;  4DCX A;  3HN0 A;  3RTF B;  1I6A A;  4RNS A;  1BTJ A;  2RCA A;  1JW1 A;  2A5T B;  2XD3 A;  3FJM A;  2ZMB A;  5ITP A;  1DMB A;  1YCJ A;  3PUZ E;  4LVQ A;  5H8Q B;  4U21 A;  3FV2 A;  4IY5 A;  4M4G A;  3GXA A;  2VGQ A;  1R6Z A;  2Q8J A;  4F39 A;  3G3H A;  1MXV A;  1ZMG A;  3LSF B;  3KOT A;  4HW8 A;  5HBC A;  3SER A;  4RPO A;  4U22 A;  2UVH A;  5FHO A;  2DSF A;  1MXX A;  3FIR A;  3R6U A;  4YB6 A;  2ZNU A;  1FTK A;  4MLQ A;  2DXY A;  1DPP A;  4XKR A;  1MG1 A;  3MPL A;  3FJG A;  4P0G A;  2O1L A;  1YPN A;  1Y9U A;  2R71 A;  1MY3 A;  1MM7 A;  3EPE A;  1FQC A;  1Y3Q A;  4POW A;  4OFL A;  4H67 A;  3GZG A;  1GGG A;  4OFJ A;  5AA4 B;  4GXS B;  2CZL A;  1SI0 A;  5I2K A;  2QRY A;  3G3K A;  1B5I A;  1PBQ A;  4H6D A;  4HTG A;  4KCC A;  2UVJ A;  1FQE A;  3PU5 A;  3T22 A;  5H8F A;  5KZT A;  1P1O A;  4YU0 A;  5KCJ A;  2XXX A;  4E0X A;  4WXJ A;  4KQP A;  2F7C A;  1XHY A;  3SDF A;  4DXC A;  5KDT B;  1US5 A;  2DOJ A;  1QUL A;  4NF6 B;  2QS3 A;  4POX A;  3ONM A;  2ESN A;  2UVI A;  3PPP A;  2XX7 A;  3FAS A;  3K01 A;  1IXG A;  1IQ7 A;  3USD A;  1S7Y A;  1ZU0 A;  4QFN A;  4NTL A;  4ZED A;  3G7W A;  3CG1 A;  3O28 A;  2XD2 A;  3ZSF A;  3IK6 B;  3TQL A;  5H8H B;  1LAX A;  4LA9 A;  4GWO A;  4ELP A;  4KYE A;  3N26 A;  3UOR A;  5H8N B;  4LZ5 A;  4NF5 A;  1IZ1 A;  1VFD A;  1VSO A;  3MZ9 A;  3OD7 A;  2UYE A;  3EHT A;  3VXC A;  1R9L A;  4H0W A;  4DDD A;  1USY H;  1N84 A;  3MVX A;  1UTB B;  4XIG Q;  3W15 C;  3KG2 A;  4RK2 A;  1A54 A;  4KPT A;  2I3V A;  1ZBM A;  5HM4 B;  2AL5 A;  3TTK A;  1FQB A;  3RNN A;  1JW4 A;  4FOR A;  3CFL A;  4H8I A;  5CMB A;  5L9M A;  3PD8 A;  4C0R A;  1Q35 A;  5L9O A;  2OZZ A;  1B2H A;  5TPA A;  1TFA A;  3SKP A;  2ZNS A;  1QJM A;  3GLB A;  1QVS A;  5I58 A;  3K0V A;  2QL3 A;  2V93 A;  1IXH A;  1MXW A;  3FVO A;  1UTH B;  1PC3 A;  1B51 A;  5ISU A;  1B4H A;  3T66 A;  1TWY A;  1P1W A;  4Q5T A;  3WAE A;  1A99 A;  3MQ9 A;  3VVD A;  5M2V A;  3MC2 A;  2GH9 A;  3C36 A;  3SEW A;  3E3K A;  4UAC A;  1IIT A;  4ZE8 A;  4DIG A;  1B40 A;  1GV8 A;  1MXU A;  1EH3 A;  5L8D A;  5FTH A;  5TU0 A;  3FAT A;  4I1D A;  3RQT A;  3KN7 A;  3IOW A;  3MWB A;  1I6Q A;  1OLA A;  3DEL B;  4F2O A;  4P11 A;  3RY3 A;  1RYO A;  3O6I A;  3BKI B;  2YLN A;  4GD5 A;  1B0L A;  3G3F A;  3CVG A;  4DZ1 A;  3C34 A;  4E0W A;  2ABH A;  2RIN A;  3THI A;  1FTJ A;  4GVO A;  5JK4 A;  4RA1 A;  1D9V A;  1JNF A;  3K1P A;  3QXM A;  1FQF A;  1I69 A;  3LR1 A;  4G77 A;  5AE4 A;  4PE5 B;  4O3B A;  5JTY B;  1N7W A;  1NNK A;  2HFB A;  2V25 A;  1Y3P A;  3O97 A;  1QKB A;  4FED A;  2D21 A;  3EHU A;  3IOR A;  4ND9 A;  3OO8 A;  4ELR A;  3IB2 A;  1AMF A;  2NXO A;  4GIZ A;  4OEU A;  3TPA A;  3HHF A;  2R9J A;  2DE3 A;  2NWJ A;  1LGB C;  3BBR A;  1LFI A;  3EQ1 A;  2Q2C A;  3T96 B;  3C31 A;  1LBC A;  3N6T A;  1GVC A;  4F29 A;  4IY6 A;  1QUJ A;  3L6G A;  5I57 B;  3PD9 A;  4WEP A;  4YMB A;  1O7T A;  4YIC A;  1B3E A;  3O2A A;  1IEJ A;  1QUI A;  2OBG A;  3JZJ A;  3KFM A;  2F34 A;  5H8S A;  1M5C A;  1MRP A;  3B7D A;  3Q27 A;  2I6E A;  3VVE A;  1MY2 A;  3FUZ A;  5BWJ A;  2ANJ A;  4RPN A;  2B3B A;  3IR1 A;  2XXU A;  4Z0I A;  4U1Z A;  1LST A;  2XXP A;  1MQH A;  3LUY A;  2Z8F A;  1FTO A;  3IB1 A;  1NH7 A;  1XS5 A;  1LLS A;  4ELO A;  4EQ9 A;  3UA8 A;  4KI0 E;  4H5G A;  1MH3 A;  2RC8 A;  4JWO A;  2D5W A;  5DTB A;  2ZXT A;  2Y7P A;  1H44 A;  2OJT A;  4OEN A;  4GOT A;  2DWJ A;  3PGF A;  3ODB A;  3E9X A;  4JWY A;  1TT1 A;  4KYD A;  4EDP A;  4FEC A;  1JET A;  4LZ7 A;  3S9N C;  2HQ0 A;  4LON B;  3LSW A;  4ISU A;  2XXV A;  4F2Q A;  4EXL A;  3IX1 A;  4BDM A;  2OCU A;  5L9S A;  2THI A;  2Y7W A;  3QIM A;  4R6H A;  5I59 A;  5FHM A;  1SYI A;  3HO7 A;  1MH4 A;  2YPN A;  2VD3 A;  2F6G A;  1LAH E;  3EF7 A;  3TTR A;  5KCJ B;  3MBP A;  1NKX A;  5DEX B;  4IO7 A;  4OTE A;  4JSD A;  3U92 A;  1PB7 A;  3HCQ A;  1R9Q A;  1N3X A;  4GXA A;  3T9V A;  2DWA A;  3S4U A;  3V83 A;  1SBP A;  2REG A;  1RKM A;  2A5S A;  3CFZ A;  4HCW A;  1B3F A;  4G8N A;  2VOZ A;  4OXV A;  4PFU A;  2ZYN A;  2H98 A;  2XX8 A;  5B70 A;  4BDO A;  1ZIU A;  4PFY A;  3PUY E;  4O3A A;  1URD A;  3RLF E;  5ICQ A;  3KOS A;  3EHS A;  3Q29 A;  1SYH A;  1CE2 A;  4TOZ A;  1T0K A;  3QYT A;  1NNF A;  3G3G A;  2XXQ A;  3K4U A;  3UN6 A;  4F1V A;  3T9U A;  1OQH A;  4QSE A;  4MH5 A;  4H8J A;  1MQJ A;  4JWX A;  2ONS A;  5ELV A;  3W9V A;  4FJP A;  2Z8E A;  4O3C A;  2Y84 A;  4EF2 A;  3F11 A;  2KLF A;  3IO6 A;  2I58 A;  4TLL B;  2F78 A;  1BLF A;  3FD3 A;  1WVJ A;  5EHM A;  3MP8 A;  3TCF A;  2RCB A;  2B65 A;  1P99 A;  3N6U A;  4K3F A;  2I49 A;  5LOM A;  4IO5 A;  3RPW A;  5I56 B;  1NH8 A;  3QUF A;  5CC2 A;  5HPQ A;  4XXU A;  1WOD A;  1B4Z A;  3MZ1 A;  4G68 A;  4ZZE A;  1JVX A;  3R26 A;  3IOU A;  2I3W A;  5I2N A;  1HSE A;  2QJE A;  3TUS A;  1FQD A;  3IOT A;  2F35 A;  5AA2 B;  4KCD A;  4PFW A;  1MY4 A;  5I58 B;  1UQW A;  2XXI A;  4WED A;  3UGW A;  4TLM B;  2F5X A;  2O1M A;  2PYY A;  4ZEC A;  3VLV A;  1BKA A;  1H76 A;  5AA3 A;  3EN3 A;  4QFL A;  1QW0 A;  3CRB A;  2X7Q A;  2XXY A;  4IB2 A;  2IEE A;  3B6Q A;  1NNT A;  3S9L C;  1B05 A;  4ZEF A;  4ZEB A;  3FGS A;  4OQO A;  3LBS A;  4MLV A;  1AOV A;  1Z7N E;  5F7V A;  4ZDM A;  4RK9 A;  3I3V A;  1TXF A;  3S9E A;  1D9Y A;  4F31 B;  2PBW A;  4NED A;  3SEY A;  3IJO B;  4XTC Q;  1YTV A;  2DS9 A;  3SET A;  4YZZ A;  1QUK A;  1B7Z A;  3U72 A;  3KEI A;  4NF4 B;  1SD3 A;  1EZO A;  2DWI A;  2XX9 A;  3TOD A;  3PUV E;  1USY E;  1P1U A;  4OYV A;  4Z7E A;  3UP9 A;  2AIX A;  3H3G A;  1VR5 A;  3A3C A;  2ZYM A;  3QSL A;  3T9X B;  3TZA A;  2H25 A;  3OSR A;  3MVY A;  2REJ A;  4G2Z A;  3IJX B;  3PMV A;  4AQ4 A;  4LUB A;  3C32 A;  2RC9 A;  3C35 A;  4G8H A;  3I6V A;  4F3B A;  1S9T A;  5JEI A;  1TFD A;  2Y7R A;  2PT2 A;  1IIW A;  3M3K A;  4JXI A;  3QUJ A;  5AA1 A;  3OO6 A;  3VLW A;  3OEM A;  5CBS A;  4GFR A;  4KYS A;  5BUU A;  2PMS A;  4FIM A;  3T93 B;  5DYH A;  2DQV A;  1MPB A;  3S9M C;  5CM6 A;  2RKM A;  3KSX A;  1D3K A;  4H65 A;  4C1U A;  4DE8 A;  2F36 A;  3FXU A;  3TDJ A;  3TCG A;  2HAV A;  4QFK A;  2DWH A;  4BDL A;  2F7A A;  3BFU A;  3O6H A;  3C33 A;  3TTM A;  5KDT A;  1B3L A;  4NF6 A;  3VE1 B;  1MDP 1;  4OVJ A;  3E13 X;  2Q88 A;  1A8F A;  1SVX B;  4IO3 A;  3DLN A;  4KD5 A;  4I9D A;  1Y4C A;  3FJ7 A;  1Q1K A;  4N6P A;  3U8Q A;  2CMO A;  5DT6 A;  2R6G E;  4FAJ A;  3TEL A;  2F97 A;  1N0T A;  4EQB A;  5H8H A;  5A5X B;  1SW5 A;  4BDR A;  3U93 A;  3RGY A;  4NF8 B;  4LP2 B;  4EXK A;  1NMU A;  1MXZ A;  1LB8 A;  5H8N A;  4U1O A;  2F7B A;  4NMY A;  4BDN A;  2NUV A;  1HSJ A;  2H99 A;  3JYR A;  4YKI A;  4KHZ E;  2WKY A;  3PPN A;  1B5J A;  3KJ7 A;  2HEU A;  1B7H A;  1FW0 A;  1UTB A;  1XC1 A;  3ZKL A;  3I5O A;  3L6H A;  1PBP A;  5F1Q A;  1UIV A;  2NVU B;  3O29 A;  4QFO A;  4Q30 B;  3S2V A;  2QS1 A;  3CR9 A;  2Z23 A;  1N3W A;  4DCY A;  3KN3 A;  1RYX A;  1OLC A;  3FVN A;  3RUM A;  3LSX A;  4RYA A;  1B7U A;  2PVU A;  1B5H A;  2DE2 A;  4OEV A;  1IXI A;  2I0C A;  4LZ8 A;  4LQ5 A;  3ZKK A;  4ESW A;  5B7D A;  3OXN A;  1UTH A;  4NWC A;  3DP6 A;  2P0S A;  4RJZ A;  4PET A;  3ILU B;  4FEB A;  2F8D A;  3H4Z A;  1FQA A;  2GRV A;  3H6W A;  3FZV A;  2H9B A;  2ZNT A;  3IO4 A;  3MW0 A;  1IUD A;  2XXH A;  4R2B A;  2HXW A;  1B6H A;  5CMC A;  4R9F A;  4IO2 A;  3IB0 A;  5EYF A;  4F3P A;  2O6A A;  3OEK A;  2XXT A;  1II5 A;  1AIV A;  2QSX A;  3TQW A;  1BIY A;  4ONY A;  3PMX A;  1N04 A;  3H6T A;  1H43 A;  5I2K B;  4R72 A;  5CMM A;  4Q8R A;  1MQG A;  4R2F A;  4PQJ A;  2H4I A;  1ZLQ A;  1H45 A;  3MVZ A;  3O9P A;  1LBB A;  5I2N B;  5H8F B;  3OO9 A;  3PUW E;  3MJN A;  3FVK A;  2VHA A;  2DVZ A;  2OWS A;  4QHQ A;  3H6U A;  4GRK A;  4GQO A;  4ESX A;  3KBR A;  3H06 B;  1OMP A;  1MS7 A;  1A8E A;  5JTY A;  3ILT B;  3A09 A;  2D3I A;  5FHN A;  2Z8D A;  4R6Y A;  1Y1M A;  1PDA A;  1ZKB A;  4U4X A;  4GLI A;  1US4 A;  3OO7 A;  3FVG A;  1B52 A;  1NL5 A;  4IGT A;  2X7P A;  4OFO A;  1MM6 A;  1LAF E;  3HV1 A;  4R9G A;  3ECR A;  4KFQ A;  4R74 A;  4NWD A;  4F1U A;  4THI A;  3AXF A;  5I57 A;  4IO6 A;  3RT8 A;  4L17 A;  4G68 C;  4DXU A;  1P1Q A;  3TCH A;  1MPC A;  2G93 A;  3CI8 A;  1J1N A;  3IOV A;  3V8X B;  4NF5 B;  4F3S A;  3TAJ A;  3DP8 A;  3N5L A;  1JW5 A;  1N76 A;  3K00 A;  3VDF A;  3K6X A;  1PEB A;  4U4S A;  5CBR A;  1LFH A;  1MPD A;  3K02 A;  1EU8 A;  3SEX A;  4U2R A;  3OOA A;  2Q89 A;  1POT A;  2B3F A;  2ONK E;  1XT8 A;  2F6P A;  1F9B A;  2Q2A A;  1DOT A;  4JDF A;  2RC7 A;  1LCF A;  4KR5 A;  1NFT A;  1OVT A;  4WKM A;  3GBB A;  3Q25 A;  1IXC A;  3CSG A;  2LAO A;  1VE4 A;  2OK2 A;  2E0S A;  4I8C A;  2FA7 A;  3VXB A;  1OVB A;  1A40 A;  1D4N A;  5TP9 A;  2O51 A;  5TPA B;  2NOO A;  2DXR A;  4F3G A;  4JB7 A;  1WDN A;  1PB9 A;  4UA8 A;  5IAI A;  4OET A;  3OEL A;  4OER A;  2HAU A;  1B46 A;  2Z22 A;  1SW4 A;  3P7I A;  3Q28 A;  5EHS A;  1P1N A;  4X48 A;  4YKJ A;  3MAM A;  3PUX E;  1B9J A;  4FE8 A;  2QMX A;  5DEX A;  4QSC A;  2IA4 A;  2DYX A;  1MXY A;  1I6B A;  4ZZA A;  2BJJ X;  3K6U A;  1JEU A;  4YMA A;  3PPR A;  2P1S A;  3A3U A;  1VFE A;  4R75 A;  3SEU A;  4IGR A;  2RF1 A;  3OSQ A;  2A5T A;  2Q9T A;  4EQ7 A;  2FYI A;  2HZL A;  3MVW A;  3FV1 A;  2HCA A;  1EZ9 A;  1AH5 A;  3MP6 A;  2O7I A;  4QRZ A;  3N94 A;  5H8Q A;  3VV5 A;  4XKP A;  4M1V A;  4GL8 A;  4LQ2 A;  3O66 A;  5IKB A;  4Q0C A;  1SW1 A;  1MQI A;  3HST A;  1SDX A;  4PFT A;  4OWD A;  1Y20 A;  3K1N A;  4EF1 A;  3V89 B;  3TTL A;  1B3H A;  4QFP A;  3U1O A;  3B6W A;  3ZS6 A;  1URG A;  3C4M A;  4TQU Q;  1N7X A;  3FXQ A;  3K6W A;  1NNP A;  3TTN A;  3LC8 A;  1ZJL A;  1A55 A;  4FAT A;  1LB9 A;  3W9W A;  3IAZ A;  2O69 A;  3QAX A;  4I62 A;  3OEN A;  3CFX A;  1LCT A;  2E1S A;  4AB5 A;  4G8M A;  2UYF A;  4N13 A;  1Z7M E;  2UVG A;  4OHN A;  4JSO A;  1OIB A;  4EUO A;  1M5E A;  3D4C A;  2OWT A;  2I48 A;  3K2D A;  1OQG A;  1DSN A;  1LFG A;  4XKN A;  1GR2 A;  1R1N A;  1DTG A;  3Q26 A;  4ZS9 A;  4MBP A;  5I56 A;  3D4G A;  5K2X A;  5AA2 D;  1GTK A;  1O64 A;  3C9H A;  5AA4 A;  4GL0 A;  3K1M A;  2V3Q A;  3TMG A;  1B3G A;  4C1T A;  2X26 A;  1HSL A;  3VFJ A;  2AL4 A;  4YKP A;  1KWH A;  1JQF A;  3TEP A;  4ZEI A;  3TFL A;  4G4P A; 
#chains in the Genus database with same CATH topology
 4X1D A;  1M5B A;  1B1X A;  3MP1 A;  3KJT A;  3FXB A;  5ET6 A;  2GHA A;  5AA2 A;  2W7Y A;  4BDQ A;  1BP5 A;  2OLB A;  4OVQ A;  3K6V A;  2AYS A;  3O6G A;  5CRY A;  4GBV A;  4HS7 A;  4OZ9 A;  2G29 A;  4H5F A;  2V3T A;  3KZG A;  1Y1Z A;  4PFB A;  4NE4 A;  3M3F A;  3RN8 A;  4I3E A;  3BFT A;  1MDQ A;  4F19 A;  4H1X A;  4HCY A;  3JV9 A;  3HPI A;  4RXL A;  1DTZ A;  1URS A;  4PAI A;  4OVS A;  2QS2 A;  4OMB A;  2V84 A;  1Y3N A;  4AS5 A;  4MAG A;  5DVF A;  1IMA A;  3H6V A;  1SQY A;  4X1B A;  2XXW A;  4YB5 A;  1B1H A;  4O94 A;  2DVC A;  3MZB A;  4N07 A;  3UK4 A;  3VVF A;  1NUY A;  3BIH A;  2FNC A;  3RT6 B;  2O84 X;  3QK6 A;  4NF4 A;  1S50 A;  1AL3 A;  3U94 A;  2PX1 A;  4P1E A;  4MF3 A;  3B6T A;  4N81 A;  2QS4 A;  1XVY A;  5I84 A;  1O63 A;  3DP4 A;  5ET8 A;  3PPQ A;  5I59 B;  4P0I A;  1PB8 A;  4JBZ A;  3OMB A;  3E4R A;  1DBZ A;  1FBG A;  1JEV A;  2XXR A;  4GWZ A;  1FTM A;  5I5P A;  4ELQ A;  1FTL A;  3KGC A;  1IMF A;  1LBW A;  2GHB A;  2YJP A;  1ZTY A;  2ZYO A;  4ZE9 A;  5K2Y A;  3GBA A;  3VLU A;  4F18 A;  4N6K A;  3V5A A;  2Y7I A;  1YAE A;  2P2A A;  1FSA A;  2O68 A;  3PMW A;  5FTI A;  4ZEK A;  4X9T A;  2DE4 A;  3IL1 B;  3KSJ A;  1UIU A;  3UIF A;  3PV0 E;  2XHD A;  3M8U A;  4GF8 A;  1SI1 A;  5ICT A;  3SEV A;  3DM0 A;  2WBD A;  3MPK A;  1JVY A;  2DP8 A;  3H03 A;  3RTW B;  4YKK A;  1RDZ A;  3WAF A;  1LAG E;  4MX6 A;  2PT1 A;  2H5Y A;  2M8C A;  4NX1 A;  4QSD A;  2FVZ A;  4U23 A;  4IO4 A;  5FBP A;  4AB6 A;  3FXR A;  2VD2 A;  4R6K A;  3G3J A;  5ET5 A;  5J1D A;  1ATG A;  4R73 A;  3SES A;  2UXA A;  3H7M A;  4YAH X;  5CI5 A;  3CSB A;  1DPE A;  4BLA A;  1M5F A;  1XVX A;  1Y4T A;  2ZYK A;  5ITO A;  2Q8M A;  1QKA A;  2I4C A;  4PP0 A;  4F1Y A;  2B4L A;  3TKD A;  3TYH A;  2QMW A;  2ONR A;  1MQD A;  1H3D A;  2VP1 A;  5DVJ A;  1B58 A;  1NUZ A;  1L5T A;  4UAB A;  2CZI A;  2ALU A;  1POY 1;  1FBF A;  1MY1 A;  4RY1 A;  2HZK A;  4LAT A;  2KQZ A;  4F22 A;  3CG3 A;  1CB6 A;  5CMK A;  3G3I A;  1SW2 A;  3LSL A;  3M3L A;  3CIJ A;  1XOC A;  3PPO A;  2O7U A;  1FTA A;  4PGN A;  4MNI A;  4DXB A;  5A5X A;  4G68 B;  1NV2 A;  4NF8 A;  5TP9 B;  2I4B A;  4XKQ A;  2KR0 A;  4OES A;  2I0B A;  2Y7K A;  4GWS A;  2QVR A;  1FCK A;  4DLD A;  5DVI A;  3HHG A;  1Q9D A;  4ECF A;  4YB7 A;  1B0H A;  1ELJ A;  3R7X A;  4QF9 A;  2GFE A;  4JVD A;  2V3U A;  1ANF A;  4MFI A;  1MY0 A;  3T9H B;  3MUQ A;  1A7L A;  1EZP A;  1B32 A;  3KN8 A;  2P3N A;  2JJK A;  1M5D A;  2QPQ A;  4DCX A;  3HN0 A;  5EQ7 A;  3RTF B;  1I6A A;  4RNS A;  1BTJ A;  4N8G A;  2RCA A;  1JW1 A;  2A5T B;  2XD3 A;  3FJM A;  2ZMB A;  5ITP A;  1DMB A;  4O7I A;  1YCJ A;  3PUZ E;  5T3J A;  4LVQ A;  5H8Q B;  4U21 A;  3FV2 A;  1QGX A;  4IY5 A;  2OX3 A;  4M4G A;  2B4M A;  3GXA A;  4JVC A;  2VGQ A;  1R6Z A;  2Q8J A;  4F39 A;  4P8B A;  3G3H A;  1FRP A;  1MXV A;  1ZMG A;  3LSF B;  3KOT A;  4HW8 A;  1K9Y A;  5HBC A;  1NV0 A;  3SER A;  4RPO A;  4U22 A;  2UVH A;  5FHO A;  2DSF A;  1MXX A;  3FIR A;  3R6U A;  4YB6 A;  2ZNU A;  1FTK A;  4MLQ A;  4P47 A;  2DXY A;  1DPP A;  4XKR A;  1MG1 A;  2V4C A;  3MPL A;  3FJG A;  4P0G A;  2O1L A;  1YPN A;  1Y9U A;  4MEV A;  2R71 A;  1MY3 A;  1MM7 A;  3EPE A;  1FQC A;  2QVV A;  2XWK A;  1Y3Q A;  4POW A;  4OFL A;  4H67 A;  3GZG A;  1GGG A;  4OFJ A;  5AA4 B;  4GXS B;  2CZL A;  1SI0 A;  5I2K A;  2QRY A;  3G3K A;  1B5I A;  1FPE A;  4QBA A;  1PBQ A;  4H6D A;  4HTG A;  1IME A;  4KCC A;  2UVJ A;  1FQE A;  2F3B A;  3PU5 A;  3T22 A;  5H8F A;  5KZT A;  1P1O A;  4YU0 A;  5KCJ A;  1IMD A;  4GBW A;  2XXX A;  4E0X A;  4WXJ A;  4KQP A;  4PBQ A;  2F7C A;  1XHY A;  3SDF A;  4DXC A;  5KDT B;  1US5 A;  2DOJ A;  4OVR A;  1QUL A;  4NF6 B;  2QS3 A;  4POX A;  3ONM A;  2ESN A;  3MST A;  2UVI A;  3PPP A;  1KA1 A;  2XX7 A;  3FAS A;  1EYJ A;  3K01 A;  2P3V A;  1IXG A;  1FPD A;  1IQ7 A;  3USD A;  1S7Y A;  1ZU0 A;  4QFN A;  4NTL A;  4ZED A;  3G7W A;  3CG1 A;  3O28 A;  2XWI A;  2XD2 A;  3E79 A;  3ZSF A;  3IK6 B;  3TQL A;  5F24 A;  4OA4 A;  4GWW A;  5H8H B;  1LAX A;  4LA9 A;  4GWO A;  4ELP A;  4KYE A;  3N26 A;  3UOR A;  5H8N B;  4LZ5 A;  4NF5 A;  5ESY A;  3NOH A;  1IZ1 A;  1VFD A;  1LBZ A;  1VSO A;  3MZ9 A;  3OD7 A;  2UYE A;  3EHT A;  2Y5L A;  3VXC A;  1R9L A;  4H0W A;  2HXR A;  5A5L A;  4DDD A;  1USY H;  1N84 A;  3MVX A;  1UTB B;  4XIG Q;  5IM2 A;  3W15 C;  3KG2 A;  4RK2 A;  1A54 A;  4KPT A;  2I3V A;  1ZBM A;  4NHB A;  5HM4 B;  2AL5 A;  3TTK A;  1FJ6 A;  2CEX A;  1FQB A;  4DI3 D;  3IFC A;  4IR8 A;  3RNN A;  1JW4 A;  4FOR A;  3CFL A;  1IMB A;  4H8I A;  5CMB A;  2HPG A;  5L9M A;  3PD8 A;  4C0R A;  1Q35 A;  5L9O A;  2OZZ A;  4XFE A;  1B2H A;  5TPA A;  1LBX A;  1TFA A;  3SKP A;  2ZNS A;  1QJM A;  3GLB A;  1QVS A;  5I58 A;  3K0V A;  1CNQ A;  2QL3 A;  2V93 A;  1IXH A;  1MXW A;  3FVO A;  1UTH B;  1PC3 A;  1B51 A;  5ET7 A;  2CEY A;  5ISU A;  1B4H A;  3T66 A;  1TWY A;  1P1W A;  4Q5T A;  3WAE A;  1A99 A;  3MQ9 A;  4MNP A;  5M2V A;  3VVD A;  3MC2 A;  3LV0 A;  4QXD A;  5IGA A;  2GH9 A;  3C36 A;  2QVU A;  4PTK A;  3SEW A;  3E3K A;  4UAC A;  1IIT A;  4ZE8 A;  4DIG A;  1B40 A;  1GV8 A;  1MXU A;  1EH3 A;  4MCO A;  5L8D A;  3D1R A;  5FTH A;  5TU0 A;  3FAT A;  1NI9 A;  4I1D A;  3RQT A;  3RPL A;  3KN7 A;  3IOW A;  3MWB A;  1OLA A;  1I6Q A;  3DEL B;  4F2O A;  4P11 A;  3RY3 A;  1JP4 A;  1RYO A;  3O6I A;  3BKI B;  2YLN A;  4GD5 A;  1B0L A;  3G3F A;  3CVG A;  2OWZ A;  4DZ1 A;  3C34 A;  4E0W A;  2ABH A;  2RIN A;  3THI A;  1FTJ A;  1FBD A;  4GVO A;  5JK4 A;  1DCU A;  4RA1 A;  1D9V A;  1JNF A;  3K1P A;  4O8M A;  1YXI A;  3QXM A;  1FQF A;  1I69 A;  3LR1 A;  4G77 A;  5AE4 A;  4PE5 B;  4O3B A;  5JTY B;  1N7W A;  1FPJ A;  1NNK A;  2HFB A;  2V25 A;  1Y3P A;  2XWO A;  3O97 A;  1QKB A;  4FED A;  2D21 A;  3EHU A;  3IOR A;  4ND9 A;  3OO8 A;  4ELR A;  3IB2 A;  3QMF A;  1AMF A;  2NXO A;  4GIZ A;  4OEU A;  3TPA A;  3HHF A;  2R9J A;  1LBY A;  2DE3 A;  2NWJ A;  2PFZ A;  1LGB C;  3BBR A;  1LFI A;  3EQ1 A;  2Q2C A;  3T96 B;  4KXP A;  3C31 A;  1LBC A;  3N6T A;  1GVC A;  4F29 A;  4IY6 A;  1QUJ A;  3L6G A;  5I57 B;  3PD9 A;  4WEP A;  2PCR A;  4YMB A;  1O7T A;  4YIC A;  1B3E A;  3O2A A;  1IEJ A;  1QUI A;  2OBG A;  3JZJ A;  4HE1 A;  3KFM A;  4PAK A;  2FHY A;  3IFA A;  4DI4 B;  2F34 A;  5H8S A;  1M5C A;  1MRP A;  3B7D A;  3Q27 A;  4HE0 A;  2I6E A;  3VVE A;  1MY2 A;  3FUZ A;  5BWJ A;  2ANJ A;  4RPN A;  4NG7 A;  2B3B A;  3IR1 A;  4XEQ A;  5IZ3 A;  2XXU A;  1NV7 A;  4Z0I A;  4U1Z A;  1LST A;  1DK4 A;  2XXP A;  1MQH A;  3LUY A;  2Z8F A;  1FTO A;  3IB1 A;  1NH7 A;  5EQ8 A;  1XS5 A;  1LLS A;  4ELO A;  4EQ9 A;  1FPI A;  3UA8 A;  4KI0 E;  4H5G A;  1MH3 A;  2RC8 A;  4JWO A;  2D5W A;  1NUW A;  5DTB A;  2ZXT A;  1RDX A;  2Y7P A;  1H44 A;  2OJT A;  4OEN A;  4GOT A;  2DWJ A;  3PGF A;  3ODB A;  3E9X A;  4JWY A;  1TT1 A;  4KYD A;  4EDP A;  4FEC A;  1JET A;  4LZ7 A;  3S9N C;  2HQ0 A;  4LON B;  3LSW A;  4ISU A;  2XXV A;  4F2Q A;  4EXL A;  3IX1 A;  4BDM A;  2VPN A;  2OCU A;  5L9S A;  2THI A;  2Y7W A;  1NV3 A;  3QIM A;  1FPK A;  4R6H A;  5I59 A;  5FHM A;  2WEF A;  1SYI A;  3HO7 A;  1MH4 A;  2YPN A;  4OVT A;  2VD3 A;  2L5V A;  2F6G A;  2ZZW A;  1LAH E;  3EF7 A;  3TTR A;  5KCJ B;  3MBP A;  1NKX A;  5DEX B;  4NGU A;  4IO7 A;  5EYH A;  3LUZ A;  4OTE A;  4JSD A;  3U92 A;  1PB7 A;  3HCQ A;  1R9Q A;  1N3X A;  4GXA A;  3T9V A;  2DWA A;  3S4U A;  3V83 A;  1SBP A;  2REG A;  1RKM A;  2A5S A;  3CFZ A;  4HCW A;  1B3F A;  1NV1 A;  4G8N A;  4NN3 A;  1LBV A;  3T0J A;  2VOZ A;  4OXV A;  4PFU A;  2ZYN A;  2H98 A;  2XX8 A;  5B70 A;  4BDO A;  1ZIU A;  4PFY A;  3PUY E;  4O3A A;  1URD A;  4N6D A;  3RLF E;  5ICQ A;  3KOS A;  3EHS A;  4N91 A;  3Q29 A;  1SYH A;  1CE2 A;  4TOZ A;  1T0K A;  3QYT A;  1NNF A;  3G3G A;  4PDD A;  2XXQ A;  4H45 A;  3K4U A;  3UN6 A;  4F1V A;  3T9U A;  1OQH A;  4QSE A;  4MH5 A;  4H8J A;  1KZ8 A;  1MQJ A;  2FIX A;  4JWX A;  2ONS A;  5ELV A;  3W9V A;  4FJP A;  2Z8E A;  4O3C A;  2Y84 A;  2DDK A;  4EF2 A;  4PE3 A;  3F11 A;  2KLF A;  3IO6 A;  2I58 A;  5DW8 A;  4TLL B;  2F78 A;  3B50 A;  5J16 A;  1BLF A;  1YZ0 A;  3FD3 A;  4NAP A;  1WVJ A;  5EHM A;  3MP8 A;  4PGP A;  3TCF A;  2RCB A;  2B65 A;  1P99 A;  3N6U A;  4K3F A;  2I49 A;  5LOM A;  4IO5 A;  1NV6 A;  3RPW A;  5I56 B;  1NH8 A;  3QUF A;  5CC2 A;  4N17 A;  5HPQ A;  4XXU A;  1WOD A;  1B4Z A;  3MZ1 A;  4G68 A;  4ZZE A;  1JVX A;  3R26 A;  3IOU A;  2I3W A;  5I2N A;  1HSE A;  2QJE A;  3TUS A;  1FQD A;  3IOT A;  2F35 A;  5AA2 B;  4KCD A;  4PFW A;  1MY4 A;  5I58 B;  1UQW A;  1FBH A;  2XXI A;  4WED A;  3UGW A;  4TLM B;  2F5X A;  2O1M A;  2PYY A;  4ZEC A;  4P9K A;  3VLV A;  1BKA A;  1H76 A;  5AA3 A;  3EN3 A;  4QFL A;  4PF8 A;  1QW0 A;  3CRB A;  2X7Q A;  4O7M A;  2XXY A;  4IB2 A;  2IEE A;  3B6Q A;  1NNT A;  3S9L C;  3U65 A;  1B05 A;  4ZEF A;  4ZEB A;  3FGS A;  4OQO A;  3LBS A;  4MLV A;  1AOV A;  1Z7N E;  5F7V A;  4ZDM A;  4RK9 A;  1NV4 A;  3GYY A;  3I3V A;  1TXF A;  3S9E A;  1D9Y A;  4F31 B;  2PBW A;  4NED A;  3IJO B;  3SEY A;  3KBZ A;  4XTC Q;  1YTV A;  2DS9 A;  3SET A;  4YZZ A;  1QUK A;  1B7Z A;  3U72 A;  3KEI A;  4NF4 B;  1SD3 A;  3RPL B;  1EZO A;  2DWI A;  2XX9 A;  3CHG A;  2FBP A;  3TOD A;  3PUV E;  1USY E;  1P1U A;  4OYV A;  4Z7E A;  3UP9 A;  2AIX A;  3H3G A;  1VR5 A;  3A3C A;  4HXV A;  5LDZ A;  2ZYM A;  3QSL A;  3T9X B;  2F3D A;  3TZA A;  2H25 A;  3OSR A;  3MVY A;  2REJ A;  4G2Z A;  3IJX B;  4NQ8 A;  4I40 A;  4FBP A;  3PMV A;  4AQ4 A;  4LUB A;  3C32 A;  2RC9 A;  3C35 A;  4N4U A;  4G8H A;  3I6V A;  4F3B A;  1YYZ A;  1S9T A;  5JEI A;  1TFD A;  2Y7R A;  2PT2 A;  2MKZ A;  1IIW A;  3M3K A;  4JXI A;  3QUJ A;  5AA1 A;  3OO6 A;  3VLW A;  3OEM A;  5CBS A;  4GFR A;  4KYS A;  2PMS A;  5BUU A;  4FIM A;  3T93 B;  5DYH A;  2DQV A;  1MPB A;  2XWV A;  3S9M C;  5CM6 A;  2QFL A;  2RKM A;  3KSX A;  1D3K A;  1INP A;  4H65 A;  4C1U A;  4DE8 A;  2F36 A;  3B8B A;  3FXU A;  4GX3 A;  3TDJ A;  3TCG A;  2HAV A;  4QFK A;  2DWH A;  3E78 A;  3MYU A;  4BDL A;  2F7A A;  3T1B A;  3BFU A;  1RDY A;  3O6H A;  3C33 A;  1VDW A;  3TTM A;  5KDT A;  1B3L A;  4NF6 A;  3VE1 B;  1MDP 1;  4OVJ A;  3E13 X;  2Q88 A;  1A8F A;  1SVX B;  4IO3 A;  4N8Y A;  3DLN A;  4GX6 A;  4KD5 A;  5IZ3 B;  4I9D A;  4P3L A;  2HHM A;  1Y4C A;  3FJ7 A;  1FPL A;  1Q1K A;  5LTC A;  4N6P A;  3U8Q A;  2CMO A;  5DT6 A;  2R6G E;  4FAJ A;  3TEL A;  2F97 A;  1G0H A;  2R8T A;  1N0T A;  4EQB A;  5H8H A;  5A5X B;  1SW5 A;  1FJ9 A;  4BDR A;  3U93 A;  3RGY A;  4NF8 B;  4LP2 B;  4EXK A;  2PFY A;  1NMU A;  1MXZ A;  1LB8 A;  5H8N A;  4U1O A;  1IMC A;  2WX9 A;  4PFR A;  2F7B A;  4NMY A;  4PCD A;  4BDN A;  2NUV A;  1AWB A;  1HSJ A;  2H99 A;  3JYR A;  4YKI A;  4KHZ E;  2WKY A;  3PPN A;  4G61 A;  1B5J A;  4MNC A;  3KJ7 A;  2HEU A;  1B7H A;  4AS4 A;  1FW0 A;  1UTB A;  1XC1 A;  3ZKL A;  3I5O A;  3L6H A;  1FBC A;  1PBP A;  5F1Q A;  1UIV A;  2NVU B;  3O29 A;  4QFO A;  4Q30 B;  3S2V A;  2QS1 A;  3CR9 A;  2Z23 A;  1N3W A;  4DCY A;  3KN3 A;  4H46 A;  2ZZX A;  1RYX A;  1OLC A;  3FVN A;  3RUM A;  3A29 A;  3LSX A;  1FBP A;  3PTY A;  5EYG A;  1FBE A;  4RYA A;  1B7U A;  2PVU A;  2WBB A;  3KC1 A;  1B5H A;  2DE2 A;  4OEV A;  1IXI A;  2I0C A;  2Q74 A;  5I3S A;  4LZ8 A;  4LQ5 A;  1EYI A;  3ZKK A;  4ESW A;  1FPG A;  5B7D A;  1D9Q A;  3OXN A;  1UTH A;  4NWC A;  3DP6 A;  2P0S A;  4RJZ A;  4XF5 A;  4PET A;  3ILU B;  4FEB A;  2F8D A;  4GWY A;  3H4Z A;  1FQA A;  2GRV A;  3H6W A;  3FZV A;  2H9B A;  2ZNT A;  3IO4 A;  3MW0 A;  1FPB A;  1IUD A;  4PFI A;  2XXH A;  4R2B A;  2HXW A;  2WYP A;  1B6H A;  5CMC A;  1K9Z A;  4R9F A;  4IO2 A;  4P56 A;  3IB0 A;  5EYF A;  4F3P A;  2O6A A;  3OEK A;  2XXT A;  1II5 A;  1AIV A;  2QSX A;  3KC0 A;  3TQW A;  4N15 A;  1BIY A;  1NV5 A;  4X8R A;  4ONY A;  3PMX A;  2XXK A;  2CZH A;  1N04 A;  3H6T A;  1H43 A;  5I2K B;  4R72 A;  4PC9 A;  5CMM A;  4Q8R A;  1MQG A;  4R2F A;  4I3Y A;  4PQJ A;  1NUX A;  5EQA A;  2H4I A;  1ZLQ A;  1H45 A;  3MVZ A;  3O9P A;  1LBB A;  5I2N B;  5H8F B;  3OO9 A;  3ISP A;  3PUW E;  3MJN A;  4PDH A;  3FVK A;  2VHA A;  2DVZ A;  2OWS A;  2BJI A;  4QHQ A;  2ZZV A;  4HE2 A;  3H6U A;  4GRK A;  4GQO A;  4ESX A;  3KBR A;  3H06 B;  1OMP A;  1MS7 A;  1A8E A;  5JTY A;  3ILT B;  3A09 A;  2D3I A;  5FHN A;  5I7I A;  2Z8D A;  4R6Y A;  1Y1M A;  1PDA A;  1ZKB A;  4U4X A;  2FIE A;  1EYK A;  4GLI A;  1US4 A;  2VT5 A;  3OO7 A;  3FVG A;  1B52 A;  1NL5 A;  4JVI A;  4IGT A;  2X7P A;  3EKI A;  4OFO A;  1MM6 A;  1LAF E;  3HV1 A;  4R9G A;  3ECR A;  4KFQ A;  4R74 A;  4NWD A;  2XA5 A;  4F1U A;  5IZ1 A;  4THI A;  4X04 A;  3AXF A;  5I57 A;  4IO6 A;  3RT8 A;  4L17 A;  4G68 C;  4DXU A;  4MJO A;  1P1Q A;  3TCH A;  1MPC A;  2G93 A;  4GX4 A;  3CI8 A;  1J1N A;  3IOV A;  3V8X B;  4NF5 B;  4F3S A;  3TAJ A;  3DP8 A;  1KA0 A;  3N5L A;  1JW5 A;  1N76 A;  3K00 A;  3VDF A;  3K6X A;  1PEB A;  4U4S A;  4MMP A;  5CBR A;  1LFH A;  1MPD A;  3K02 A;  1EU8 A;  3SEX A;  4U2R A;  3OOA A;  2Q89 A;  1POT A;  2B3F A;  2ONK E;  1XT8 A;  2F6P A;  4PBH A;  1F9B A;  2Q2A A;  1DOT A;  4JDF A;  4PAF A;  5EQ9 A;  4PF6 A;  2RC7 A;  1LCF A;  4KR5 A;  2WYK A;  1NFT A;  1OVT A;  4WKM A;  3GBB A;  3Q25 A;  1IXC A;  3CSG A;  2LAO A;  4GWX A;  1VE4 A;  2OK2 A;  2E0S A;  4I8C A;  2FA7 A;  3VXB A;  1OVB A;  1A40 A;  1D4N A;  5TP9 A;  2O51 A;  5TPA B;  2NOO A;  2DXR A;  4F3G A;  4JB7 A;  1WDN A;  1PB9 A;  4UA8 A;  2GQ1 A;  5IAI A;  1LEV A;  4OET A;  3OEL A;  4OER A;  2HAU A;  1B46 A;  2Z22 A;  1FPF A;  1SW4 A;  3P7I A;  3Q28 A;  5EHS A;  1P1N A;  2VPO A;  4X48 A;  4YKJ A;  3MAM A;  3PUX E;  1B9J A;  4FE8 A;  2QMX A;  5DEX A;  4QSC A;  2IA4 A;  2DYX A;  1MXY A;  1I6B A;  4ZZA A;  2BJJ X;  3K6U A;  1JEU A;  4YMA A;  3PPR A;  2P1S A;  3A3U A;  1VFE A;  3FBP A;  4R75 A;  3SEU A;  4IGR A;  2RF1 A;  3OSQ A;  2A5T A;  2Q9T A;  2CZK A;  4EQ7 A;  2FYI A;  2HZL A;  3MVW A;  3FV1 A;  2HCA A;  1EZ9 A;  1AH5 A;  4P1L A;  3MP6 A;  1G0I A;  2O7I A;  4QRZ A;  5IZZ A;  3N94 A;  5H8Q A;  3VV5 A;  4XKP A;  4MHF A;  4M1V A;  4GL8 A;  1BK4 A;  4LQ2 A;  3O66 A;  5IKB A;  4Q0C A;  1SW1 A;  1MQI A;  3HST A;  1SDX A;  4PFT A;  4OWD A;  1Y20 A;  3SZP A;  3K1N A;  4EF1 A;  3V89 B;  3TTL A;  1B3H A;  4QFP A;  3U1O A;  3B6W A;  3ZS6 A;  1URG A;  3BIG A;  3C4M A;  4TQU Q;  1N7X A;  3FXQ A;  3K6W A;  1NNP A;  3TTN A;  1XI6 A;  3LC8 A;  1ZJL A;  1A55 A;  4FAT A;  1LB9 A;  3W9W A;  3IAZ A;  2O69 A;  3QAX A;  2Y5K A;  4OAN A;  4I62 A;  3OEN A;  3CFX A;  1LCT A;  4OVP A;  2E1S A;  4AB5 A;  4G8M A;  2UYF A;  4N13 A;  1Z7M E;  2UVG A;  4OHN A;  4JSO A;  1OIB A;  4EUO A;  1M5E A;  3D4C A;  2OWT A;  2I48 A;  3K2D A;  1OQG A;  1DSN A;  1LFG A;  4XKN A;  1GR2 A;  1R1N A;  1DTG A;  3Q26 A;  4ZS9 A;  4MBP A;  5I56 A;  3D4G A;  5K2X A;  5AA2 D;  4MIJ A;  1GTK A;  1O64 A;  3C9H A;  5AA4 A;  4GL0 A;  3K1M A;  2V3Q A;  3TMG A;  1B3G A;  4C1T A;  2X26 A;  1HSL A;  3VFJ A;  2AL4 A;  4YKP A;  1KWH A;  4GWU A;  1JQF A;  3RYD A;  3TEP A;  4LN5 A;  1SPI A;  3ROJ A;  4ZEI A;  3TFL A;  4G4P A;  4NF0 A;  3HFU A; 
#chains in the Genus database with same CATH homology
 4X1D A;  1M5B A;  1B1X A;  3MP1 A;  3KJT A;  2GHA A;  5AA2 A;  2W7Y A;  4BDQ A;  1BP5 A;  2OLB A;  3K6V A;  2AYS A;  3O6G A;  5CRY A;  4HS7 A;  4OZ9 A;  2G29 A;  4H5F A;  2V3T A;  3KZG A;  1Y1Z A;  4NE4 A;  3M3F A;  3RN8 A;  3BFT A;  1MDQ A;  4F19 A;  4H1X A;  4HCY A;  3JV9 A;  3HPI A;  4RXL A;  1DTZ A;  1URS A;  2QS2 A;  4OMB A;  2V84 A;  1Y3N A;  5DVF A;  3H6V A;  1SQY A;  4X1B A;  2XXW A;  4YB5 A;  1B1H A;  2DVC A;  3MZB A;  4N07 A;  3UK4 A;  3VVF A;  2FNC A;  3RT6 B;  2O84 X;  3QK6 A;  4NF4 A;  1S50 A;  1AL3 A;  3U94 A;  2PX1 A;  4MF3 A;  3B6T A;  2QS4 A;  1XVY A;  5I84 A;  1O63 A;  3DP4 A;  5I59 B;  3PPQ A;  4P0I A;  1PB8 A;  4JBZ A;  3OMB A;  3E4R A;  1JEV A;  2XXR A;  1FTM A;  4ELQ A;  1FTL A;  3KGC A;  2YJP A;  2GHB A;  1ZTY A;  2ZYO A;  4ZE9 A;  5K2Y A;  3GBA A;  3VLU A;  4F18 A;  3V5A A;  2Y7I A;  1YAE A;  2P2A A;  3PMW A;  2O68 A;  5FTI A;  4ZEK A;  4X9T A;  2DE4 A;  3IL1 B;  3KSJ A;  1UIU A;  3UIF A;  3PV0 E;  2XHD A;  3M8U A;  4GF8 A;  1SI1 A;  5ICT A;  3SEV A;  3DM0 A;  3MPK A;  1JVY A;  2DP8 A;  3H03 A;  3RTW B;  4YKK A;  3WAF A;  1LAG E;  2PT1 A;  2H5Y A;  2M8C A;  4QSD A;  4U23 A;  4IO4 A;  4AB6 A;  3FXR A;  2VD2 A;  4R6K A;  3G3J A;  5J1D A;  1ATG A;  4R73 A;  3SES A;  2UXA A;  3H7M A;  4YAH X;  5CI5 A;  3CSB A;  1DPE A;  4BLA A;  1M5F A;  1XVX A;  1Y4T A;  2ZYK A;  5ITO A;  1QKA A;  2I4C A;  4PP0 A;  4F1Y A;  3TKD A;  3TYH A;  2QMW A;  2ONR A;  1MQD A;  1H3D A;  2VP1 A;  5DVJ A;  1B58 A;  1L5T A;  2ALU A;  1POY 1;  1MY1 A;  4RY1 A;  2HZK A;  4LAT A;  4F22 A;  3CG3 A;  1CB6 A;  5CMK A;  3G3I A;  1SW2 A;  3LSL A;  3M3L A;  3CIJ A;  1XOC A;  3PPO A;  2O7U A;  4DXB A;  5A5X A;  4G68 B;  4NF8 A;  5TP9 B;  2I4B A;  4XKQ A;  4OES A;  2I0B A;  2Y7K A;  1FCK A;  4DLD A;  5DVI A;  3HHG A;  4ECF A;  4YB7 A;  1B0H A;  1ELJ A;  3R7X A;  4QF9 A;  2GFE A;  2V3U A;  1ANF A;  4MFI A;  1MY0 A;  3T9H B;  3MUQ A;  1A7L A;  1EZP A;  1B32 A;  3KN8 A;  1M5D A;  2QPQ A;  4DCX A;  3HN0 A;  3RTF B;  1I6A A;  4RNS A;  1BTJ A;  2RCA A;  1JW1 A;  2A5T B;  2XD3 A;  3FJM A;  2ZMB A;  5ITP A;  1DMB A;  1YCJ A;  3PUZ E;  4LVQ A;  5H8Q B;  4U21 A;  3FV2 A;  4IY5 A;  4M4G A;  3GXA A;  2VGQ A;  1R6Z A;  2Q8J A;  4F39 A;  3G3H A;  1MXV A;  1ZMG A;  3LSF B;  3KOT A;  4HW8 A;  5HBC A;  3SER A;  4RPO A;  4U22 A;  2UVH A;  5FHO A;  2DSF A;  1MXX A;  3FIR A;  3R6U A;  4YB6 A;  2ZNU A;  1FTK A;  4MLQ A;  2DXY A;  1DPP A;  4XKR A;  1MG1 A;  3MPL A;  3FJG A;  4P0G A;  2O1L A;  1YPN A;  1Y9U A;  2R71 A;  1MY3 A;  1MM7 A;  3EPE A;  1FQC A;  1Y3Q A;  4POW A;  4OFL A;  4H67 A;  3GZG A;  1GGG A;  4OFJ A;  5AA4 B;  4GXS B;  2CZL A;  1SI0 A;  5I2K A;  2QRY A;  3G3K A;  1B5I A;  1PBQ A;  4H6D A;  4HTG A;  4KCC A;  2UVJ A;  1FQE A;  3PU5 A;  3T22 A;  5H8F A;  5KZT A;  1P1O A;  4YU0 A;  5KCJ A;  2XXX A;  4E0X A;  4WXJ A;  4KQP A;  2F7C A;  1XHY A;  3SDF A;  4DXC A;  5KDT B;  1US5 A;  2DOJ A;  1QUL A;  4NF6 B;  2QS3 A;  4POX A;  3ONM A;  2ESN A;  2UVI A;  3PPP A;  2XX7 A;  3FAS A;  3K01 A;  1IXG A;  1IQ7 A;  3USD A;  1S7Y A;  1ZU0 A;  4QFN A;  4NTL A;  4ZED A;  3G7W A;  3CG1 A;  3O28 A;  2XD2 A;  3ZSF A;  3IK6 B;  3TQL A;  5H8H B;  1LAX A;  4LA9 A;  4GWO A;  4ELP A;  4KYE A;  3N26 A;  3UOR A;  5H8N B;  4LZ5 A;  4NF5 A;  1IZ1 A;  1VFD A;  1VSO A;  3MZ9 A;  3OD7 A;  2UYE A;  3EHT A;  3VXC A;  1R9L A;  4H0W A;  4DDD A;  1USY H;  1N84 A;  3MVX A;  1UTB B;  4XIG Q;  3W15 C;  3KG2 A;  4RK2 A;  1A54 A;  4KPT A;  2I3V A;  1ZBM A;  5HM4 B;  2AL5 A;  3TTK A;  1FQB A;  3RNN A;  1JW4 A;  4FOR A;  3CFL A;  4H8I A;  5CMB A;  5L9M A;  3PD8 A;  4C0R A;  1Q35 A;  5L9O A;  2OZZ A;  1B2H A;  5TPA A;  1TFA A;  3SKP A;  2ZNS A;  1QJM A;  3GLB A;  1QVS A;  5I58 A;  3K0V A;  2QL3 A;  2V93 A;  1IXH A;  1MXW A;  3FVO A;  1UTH B;  1PC3 A;  1B51 A;  5ISU A;  1B4H A;  3T66 A;  1TWY A;  1P1W A;  4Q5T A;  3WAE A;  1A99 A;  3MQ9 A;  3VVD A;  5M2V A;  3MC2 A;  2GH9 A;  3C36 A;  3SEW A;  3E3K A;  4UAC A;  1IIT A;  4ZE8 A;  4DIG A;  1B40 A;  1GV8 A;  1MXU A;  1EH3 A;  5L8D A;  5FTH A;  5TU0 A;  3FAT A;  4I1D A;  3RQT A;  3KN7 A;  3IOW A;  3MWB A;  1I6Q A;  1OLA A;  3DEL B;  4F2O A;  4P11 A;  3RY3 A;  1RYO A;  3O6I A;  3BKI B;  2YLN A;  4GD5 A;  1B0L A;  3G3F A;  3CVG A;  4DZ1 A;  3C34 A;  4E0W A;  2ABH A;  2RIN A;  3THI A;  1FTJ A;  4GVO A;  5JK4 A;  4RA1 A;  1D9V A;  1JNF A;  3K1P A;  3QXM A;  1FQF A;  1I69 A;  3LR1 A;  4G77 A;  5AE4 A;  4PE5 B;  4O3B A;  5JTY B;  1N7W A;  1NNK A;  2HFB A;  2V25 A;  1Y3P A;  3O97 A;  1QKB A;  4FED A;  2D21 A;  3EHU A;  3IOR A;  4ND9 A;  3OO8 A;  4ELR A;  3IB2 A;  1AMF A;  2NXO A;  4GIZ A;  4OEU A;  3TPA A;  3HHF A;  2R9J A;  2DE3 A;  2NWJ A;  1LGB C;  3BBR A;  1LFI A;  3EQ1 A;  2Q2C A;  3T96 B;  3C31 A;  1LBC A;  3N6T A;  1GVC A;  4F29 A;  4IY6 A;  1QUJ A;  3L6G A;  5I57 B;  3PD9 A;  4WEP A;  4YMB A;  1O7T A;  4YIC A;  1B3E A;  3O2A A;  1IEJ A;  1QUI A;  2OBG A;  3JZJ A;  3KFM A;  2F34 A;  5H8S A;  1M5C A;  1MRP A;  3B7D A;  3Q27 A;  2I6E A;  3VVE A;  1MY2 A;  3FUZ A;  5BWJ A;  2ANJ A;  4RPN A;  2B3B A;  3IR1 A;  2XXU A;  4Z0I A;  4U1Z A;  1LST A;  2XXP A;  1MQH A;  3LUY A;  2Z8F A;  1FTO A;  3IB1 A;  1NH7 A;  1XS5 A;  1LLS A;  4ELO A;  4EQ9 A;  3UA8 A;  4KI0 E;  4H5G A;  1MH3 A;  2RC8 A;  4JWO A;  2D5W A;  5DTB A;  2ZXT A;  2Y7P A;  1H44 A;  2OJT A;  4OEN A;  4GOT A;  2DWJ A;  3PGF A;  3ODB A;  3E9X A;  4JWY A;  1TT1 A;  4KYD A;  4EDP A;  4FEC A;  1JET A;  4LZ7 A;  3S9N C;  2HQ0 A;  4LON B;  3LSW A;  4ISU A;  2XXV A;  4F2Q A;  4EXL A;  3IX1 A;  4BDM A;  2OCU A;  5L9S A;  2THI A;  2Y7W A;  3QIM A;  4R6H A;  5I59 A;  5FHM A;  1SYI A;  3HO7 A;  1MH4 A;  2YPN A;  2VD3 A;  2F6G A;  1LAH E;  3EF7 A;  3TTR A;  5KCJ B;  3MBP A;  1NKX A;  5DEX B;  4IO7 A;  4OTE A;  4JSD A;  3U92 A;  1PB7 A;  3HCQ A;  1R9Q A;  1N3X A;  4GXA A;  3T9V A;  2DWA A;  3S4U A;  3V83 A;  1SBP A;  2REG A;  1RKM A;  2A5S A;  3CFZ A;  4HCW A;  1B3F A;  4G8N A;  2VOZ A;  4OXV A;  4PFU A;  2ZYN A;  2H98 A;  2XX8 A;  5B70 A;  4BDO A;  1ZIU A;  4PFY A;  3PUY E;  4O3A A;  1URD A;  3RLF E;  5ICQ A;  3KOS A;  3EHS A;  3Q29 A;  1SYH A;  1CE2 A;  4TOZ A;  1T0K A;  3QYT A;  1NNF A;  3G3G A;  2XXQ A;  3K4U A;  3UN6 A;  4F1V A;  3T9U A;  1OQH A;  4QSE A;  4MH5 A;  4H8J A;  1MQJ A;  4JWX A;  2ONS A;  5ELV A;  3W9V A;  4FJP A;  2Z8E A;  4O3C A;  2Y84 A;  4EF2 A;  3F11 A;  2KLF A;  3IO6 A;  2I58 A;  4TLL B;  2F78 A;  1BLF A;  3FD3 A;  1WVJ A;  5EHM A;  3MP8 A;  3TCF A;  2RCB A;  2B65 A;  1P99 A;  3N6U A;  4K3F A;  2I49 A;  5LOM A;  4IO5 A;  3RPW A;  5I56 B;  1NH8 A;  3QUF A;  5CC2 A;  5HPQ A;  4XXU A;  1WOD A;  1B4Z A;  3MZ1 A;  4G68 A;  4ZZE A;  1JVX A;  3R26 A;  3IOU A;  2I3W A;  5I2N A;  1HSE A;  2QJE A;  3TUS A;  1FQD A;  3IOT A;  2F35 A;  5AA2 B;  4KCD A;  4PFW A;  1MY4 A;  5I58 B;  1UQW A;  2XXI A;  4WED A;  3UGW A;  4TLM B;  2F5X A;  2O1M A;  2PYY A;  4ZEC A;  3VLV A;  1BKA A;  1H76 A;  5AA3 A;  3EN3 A;  4QFL A;  1QW0 A;  3CRB A;  2X7Q A;  2XXY A;  4IB2 A;  2IEE A;  3B6Q A;  1NNT A;  3S9L C;  1B05 A;  4ZEF A;  4ZEB A;  3FGS A;  4OQO A;  3LBS A;  4MLV A;  1AOV A;  1Z7N E;  5F7V A;  4ZDM A;  4RK9 A;  3I3V A;  1TXF A;  3S9E A;  1D9Y A;  4F31 B;  2PBW A;  4NED A;  3SEY A;  3IJO B;  4XTC Q;  1YTV A;  2DS9 A;  3SET A;  4YZZ A;  1QUK A;  1B7Z A;  3U72 A;  3KEI A;  4NF4 B;  1SD3 A;  1EZO A;  2DWI A;  2XX9 A;  3TOD A;  3PUV E;  1USY E;  1P1U A;  4OYV A;  4Z7E A;  3UP9 A;  2AIX A;  3H3G A;  1VR5 A;  3A3C A;  2ZYM A;  3QSL A;  3T9X B;  3TZA A;  2H25 A;  3OSR A;  3MVY A;  2REJ A;  4G2Z A;  3IJX B;  3PMV A;  4AQ4 A;  4LUB A;  3C32 A;  2RC9 A;  3C35 A;  4G8H A;  3I6V A;  4F3B A;  1S9T A;  5JEI A;  1TFD A;  2Y7R A;  2PT2 A;  1IIW A;  3M3K A;  4JXI A;  3QUJ A;  5AA1 A;  3OO6 A;  3VLW A;  3OEM A;  5CBS A;  4GFR A;  4KYS A;  5BUU A;  2PMS A;  4FIM A;  3T93 B;  5DYH A;  2DQV A;  1MPB A;  3S9M C;  5CM6 A;  2RKM A;  3KSX A;  1D3K A;  4H65 A;  4C1U A;  4DE8 A;  2F36 A;  3FXU A;  3TDJ A;  3TCG A;  2HAV A;  4QFK A;  2DWH A;  4BDL A;  2F7A A;  3BFU A;  3O6H A;  3C33 A;  3TTM A;  5KDT A;  1B3L A;  4NF6 A;  3VE1 B;  1MDP 1;  4OVJ A;  3E13 X;  2Q88 A;  1A8F A;  1SVX B;  4IO3 A;  3DLN A;  4KD5 A;  4I9D A;  1Y4C A;  3FJ7 A;  1Q1K A;  4N6P A;  3U8Q A;  2CMO A;  5DT6 A;  2R6G E;  4FAJ A;  3TEL A;  2F97 A;  1N0T A;  4EQB A;  5H8H A;  5A5X B;  1SW5 A;  4BDR A;  3U93 A;  3RGY A;  4NF8 B;  4LP2 B;  4EXK A;  1NMU A;  1MXZ A;  1LB8 A;  5H8N A;  4U1O A;  2F7B A;  4NMY A;  4BDN A;  2NUV A;  1HSJ A;  2H99 A;  3JYR A;  4YKI A;  4KHZ E;  2WKY A;  3PPN A;  1B5J A;  3KJ7 A;  2HEU A;  1B7H A;  1FW0 A;  1UTB A;  1XC1 A;  3ZKL A;  3I5O A;  3L6H A;  1PBP A;  5F1Q A;  1UIV A;  2NVU B;  3O29 A;  4QFO A;  4Q30 B;  3S2V A;  2QS1 A;  3CR9 A;  2Z23 A;  1N3W A;  4DCY A;  3KN3 A;  1RYX A;  1OLC A;  3FVN A;  3RUM A;  3LSX A;  4RYA A;  1B7U A;  2PVU A;  1B5H A;  2DE2 A;  4OEV A;  1IXI A;  2I0C A;  4LZ8 A;  4LQ5 A;  3ZKK A;  4ESW A;  5B7D A;  3OXN A;  1UTH A;  4NWC A;  3DP6 A;  2P0S A;  4RJZ A;  4PET A;  3ILU B;  4FEB A;  2F8D A;  3H4Z A;  1FQA A;  2GRV A;  3H6W A;  3FZV A;  2H9B A;  2ZNT A;  3IO4 A;  3MW0 A;  1IUD A;  2XXH A;  4R2B A;  2HXW A;  1B6H A;  5CMC A;  4R9F A;  4IO2 A;  3IB0 A;  5EYF A;  4F3P A;  2O6A A;  3OEK A;  2XXT A;  1II5 A;  1AIV A;  2QSX A;  3TQW A;  1BIY A;  4ONY A;  3PMX A;  1N04 A;  3H6T A;  1H43 A;  5I2K B;  4R72 A;  5CMM A;  4Q8R A;  1MQG A;  4R2F A;  4PQJ A;  2H4I A;  1ZLQ A;  1H45 A;  3MVZ A;  3O9P A;  1LBB A;  5I2N B;  5H8F B;  3OO9 A;  3PUW E;  3MJN A;  3FVK A;  2VHA A;  2DVZ A;  2OWS A;  4QHQ A;  3H6U A;  4GRK A;  4GQO A;  4ESX A;  3KBR A;  3H06 B;  1OMP A;  1MS7 A;  1A8E A;  5JTY A;  3ILT B;  3A09 A;  2D3I A;  5FHN A;  2Z8D A;  4R6Y A;  1Y1M A;  1PDA A;  1ZKB A;  4U4X A;  4GLI A;  1US4 A;  3OO7 A;  3FVG A;  1B52 A;  1NL5 A;  4IGT A;  2X7P A;  4OFO A;  1MM6 A;  1LAF E;  3HV1 A;  4R9G A;  3ECR A;  4KFQ A;  4R74 A;  4NWD A;  4F1U A;  4THI A;  3AXF A;  5I57 A;  4IO6 A;  3RT8 A;  4L17 A;  4G68 C;  4DXU A;  1P1Q A;  3TCH A;  1MPC A;  2G93 A;  3CI8 A;  1J1N A;  3IOV A;  3V8X B;  4NF5 B;  4F3S A;  3TAJ A;  3DP8 A;  3N5L A;  1JW5 A;  1N76 A;  3K00 A;  3VDF A;  3K6X A;  1PEB A;  4U4S A;  5CBR A;  1LFH A;  1MPD A;  3K02 A;  1EU8 A;  3SEX A;  4U2R A;  3OOA A;  2Q89 A;  1POT A;  2B3F A;  2ONK E;  1XT8 A;  2F6P A;  1F9B A;  2Q2A A;  1DOT A;  4JDF A;  2RC7 A;  1LCF A;  4KR5 A;  1NFT A;  1OVT A;  4WKM A;  3GBB A;  3Q25 A;  1IXC A;  3CSG A;  2LAO A;  1VE4 A;  2OK2 A;  2E0S A;  4I8C A;  2FA7 A;  3VXB A;  1OVB A;  1A40 A;  1D4N A;  5TP9 A;  2O51 A;  5TPA B;  2NOO A;  2DXR A;  4F3G A;  4JB7 A;  1WDN A;  1PB9 A;  4UA8 A;  5IAI A;  4OET A;  3OEL A;  4OER A;  2HAU A;  1B46 A;  2Z22 A;  1SW4 A;  3P7I A;  3Q28 A;  5EHS A;  1P1N A;  4X48 A;  4YKJ A;  3MAM A;  3PUX E;  1B9J A;  4FE8 A;  2QMX A;  5DEX A;  4QSC A;  2IA4 A;  2DYX A;  1MXY A;  1I6B A;  4ZZA A;  2BJJ X;  3K6U A;  1JEU A;  4YMA A;  3PPR A;  2P1S A;  3A3U A;  1VFE A;  4R75 A;  3SEU A;  4IGR A;  2RF1 A;  3OSQ A;  2A5T A;  2Q9T A;  4EQ7 A;  2FYI A;  2HZL A;  3MVW A;  3FV1 A;  2HCA A;  1EZ9 A;  1AH5 A;  3MP6 A;  2O7I A;  4QRZ A;  3N94 A;  5H8Q A;  3VV5 A;  4XKP A;  4M1V A;  4GL8 A;  4LQ2 A;  3O66 A;  5IKB A;  4Q0C A;  1SW1 A;  1MQI A;  3HST A;  1SDX A;  4PFT A;  4OWD A;  1Y20 A;  3K1N A;  4EF1 A;  3V89 B;  3TTL A;  1B3H A;  4QFP A;  3U1O A;  3B6W A;  3ZS6 A;  1URG A;  3C4M A;  4TQU Q;  1N7X A;  3FXQ A;  3K6W A;  1NNP A;  3TTN A;  3LC8 A;  1ZJL A;  1A55 A;  4FAT A;  1LB9 A;  3W9W A;  3IAZ A;  2O69 A;  3QAX A;  4I62 A;  3OEN A;  3CFX A;  1LCT A;  2E1S A;  4AB5 A;  4G8M A;  2UYF A;  4N13 A;  1Z7M E;  2UVG A;  4OHN A;  4JSO A;  1OIB A;  4EUO A;  1M5E A;  3D4C A;  2OWT A;  2I48 A;  3K2D A;  1OQG A;  1DSN A;  1LFG A;  4XKN A;  1GR2 A;  1R1N A;  1DTG A;  3Q26 A;  4ZS9 A;  4MBP A;  5I56 A;  3D4G A;  5K2X A;  5AA2 D;  1GTK A;  1O64 A;  3C9H A;  5AA4 A;  4GL0 A;  3K1M A;  2V3Q A;  3TMG A;  1B3G A;  4C1T A;  2X26 A;  1HSL A;  3VFJ A;  2AL4 A;  4YKP A;  1KWH A;  1JQF A;  3TEP A;  4ZEI A;  3TFL A;  4G4P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...