1H43A

R210e n-terminal lobe human lactoferrin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
309
Chain Sequence
SVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIEESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LACTOFERRIN
publication title "Dilysine Trigger" in Transferrins Probed by Mutagenesis of Lactoferrin: Crystal Structures of the R210G, R210E, and R210L Mutants of Human Lactoferrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
total genus 83
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h43A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h43A02
2I3VA 3TZAA 1ZIUA 5H8NB 4G2ZA 4IO3A 4EQ7A 3TTMA 4U1OA 3O9PA 3LSLA 4BDQA 3RTWB 3FVOA 4BDOA 2V25A 4ESXA 1YTVA 3SEXA 3IB2A 2YJPA 4ELPA 5EHMA 1I6QA 4ZEBA 4DCXA 5DT6A 3SERA 5DVIA 2AL4A 2VOZA 3G7WA 4F19A 4MBPA 2Z8EA 1ZTYA 1B7HA 4NEDA 4KR5A 5JEIA 3IJXB 3USDA 5A5XA 5AA2A 1PDAA 3TAJA 1EZPA 1LAGE 4THIA 3TTKA 4GL8A 4H8IA 1Y4TA 4AQ4A 3KN8A 3VXBA 4H5GA 1B0HA 1B5IA 4YKIA 3FV1A 4I9DA 1Z7ME 5TU0A 4BLAA 4XTCQ 1IIWA 2XXPA 2W7YA 5CRYA 5CI5A 3MVZA 2Y7IA 1LBBA 1XHYA 3VXCA 3LSFB 1MY2A 1FQDA 4U2RA 3N94A 1MDQA 4YKPA 1F9BA 3KOTA 1EH3A 3MW0A 4F3GA 2R9JA 3IX1A 4Q0CA 5L9SA 3FVKA 3C31A 4OHNA 3IO4A 1VSOA 3OEKA 4YAHX 5I59B 3ZSFA 1B9JA 4LUBA 1LB8A 2XXRA 2X26A 3G3JA 3UIFA 2ZYMA 4GRKA 2F34A 1B5JA 1MQJA 2XXIA 3GBBA 1SD3A 3VLVA 4M4GA 3ILTB 3LC8A 2X7QA 3EHTA 5KCJB 4Z0IA 3EPEA 3VVEA 2B3FA 1BIYA 4WXJA 2PT1A 3PU5A 1UTBB 1MM7A 3A3UA 5AA3A 2UXAA 1MPDA 4I8CA 3THIA 3PUXE 3QXMA 3KEIA 1Y20A 1N0TA 3KSJA 2ONKE 3K1PA 1J1NA 3IJOB 1SQYA 3SESA 1R6ZA 1TWYA 1B46A 1XVXA 3O97A 3OD7A 3PPQA 4ZEFA 1IXHA 2I0CA 3M3KA 4R75A 4P11A 2CMOA 1TFAA 4Q30B 4LQ5A 1AH5A 1Q1KA 3RLFE 1MY3A 1NH7A 4IY6A 2PYYA 4RPNA 1JW1A 3B6QA 1QUIA 4ZEIA 1B4HA 2QS4A 3PUWE 1JETA 3HV1A 4NWDA 4NF5A 2DWAA 1MXVA 3C36A 2NXOA 1B3GA 4OTEA 4ZEDA 1MH3A 3ECRA 4R72A 3TYHA 1MM6A 2DE2A 5I58B 4E0XA 4G77A 1PB9A 3T9UA 2RC9A 4G68A 4F18A 5BWJA 2PVUA 2VP1A 5TP9A 1NNFA 2RCAA 2F36A 1N7XA 3T22A 3L6GA 1FQCA 1Y3PA 2IA4A 1P1WA 5TPAA 2QJEA 3QSLA 1QJMA 4G8NA 1S9TA 1UTHB 4F2OA 1ZMGA 4FEDA 5CMMA 1JW5A 4PE5B 4FEBA 2DE3A 1TXFA 3O66A 3T96B 1HSLA 4F1UA 5I56B 3OO8A 2HZLA 2I4BA 1WDNA 5H8QA 3G3IA 3IOTA 3S2VA 3BFTA 1MY4A 3RNNA 2DVCA 2F6GA 3IOVA 3MC2A 1LAXA 2ZYKA 1OLCA 2HQ0A 4JXIA 1URGA 1N76A 2VD3A 2RCBA 3TTRA 2H4IA 2XD3A 3E9XA 4KD5A 4YMBA 1FTJA 4F31B 3C33A 3Q29A 3U72A 4GF8A 1FTOA 2D3IA 4FECA 1NH8A 4IGTA 3V83A 3QUJA 1UIUA 3T9HB 5DEXA 5CBRA 1MXWA 4F3PA 4G8HA 3IOWA 3FGSA 1FQEA 4FAJA 1XVYA 4JWOA 1MPCA 3MUQA 1MQDA 1IXGA 4MH5A 4ZZAA 2Q88A 1SI0A 2THIA 4RXLA 2AL5A 3EQ1A 2REJA 2G29A 3ONMA 2DYXA 1RYOA 4EUOA 3TELA 5M2VA 1MRPA 4FIMA 3SEVA 4RK9A 2NWJA 4U21A 2E1SA 3UK4A 1B3FA 1OLAA 3KBRA 2XXXA 4EDPA 3FJGA 4I62A 1LFHA 1L5TA 3T93B 1SYIA 1POTA 5I2NB 4UA8A 2UVHA 4BDMA 4TLLB 4YB7A 2NOOA 3Q28A 1H3DA 4U4SA 2F6PA 3B7DA 4QFLA 1GVCA 1N04A 2PBWA 3CG1A 3LSXA 4ZS9A 1SYHA 3HCQA 5FHOA 4F3SA 1FTMA 4HCYA 5L9OA 3V89B 5JTYA 4NF6B 5EYFA 2P0SA 4MFIA 2A5SA 3MP8A 1XS5A 1B05A 2DWJA 3GZGA 2GH9A 2Q8JA 3FV2A 4HS7A 3VVDA 4IO2A 5CM6A 4QRZA 2ZYOA 2ZXTA 4Q5TA 3UP9A 1ZBMA 2NUVA 4IO7A 1EZ9A 1MQHA 4ELRA 3K2DA 4EQ9A 1IXCA 2Q89A 3FZVA 2H98A 4DLDA 5AA1A 1OQGA 1PBQA 4MLVA 3IORA 3PPPA 4YB6A 1SW2A 3JYRA 1A8EA 3HN0A 4PETA 4RA1A 2XXYA 3MZ9A 4IY5A 1AL3A 1LSTA 3Q27A 1PC3A 1DSNA 1B3LA 5L8DA 1LFGA 5F7VA 3K00A 2I49A 3K02A 2HCAA 1FQAA 4DXUA 1MQIA 1B40A 1HSJA 1CE2A 2QPQA 1JEUA 2Z8FA 4F1YA 3EHSA 3D4CA 3MQ9A 4G68C 1QUKA 1H44A 1MDP1 4N13A 1MXZA 4H6DA 2QL3A 1QULA 3TDJA 4GL0A 3LR1A 4NTLA 1B0LA 3SDFA 3PMWA 4QHQA 3HO7A 5AA2D 3MZBA 4POWA 4DE8A 1ZLQA 4I1DA 1XC1A 4ZE9A 4H67A 4WEDA 2DVZA 2DXYA 5J1DA 4H5FA 1O64A 1S7YA 4PFUA 3W15C 3ILUB 3LUYA 3UGWA 4ESWA 2Q9TA 4AB6A 1GR2A 3F11A 4ZDMA 3FXRA 4BDNA 3WAEA 3PPOA 3QAXA 3S9MC 3TMGA 2R6GE 3H7MA 3RY3A 1LGBC 3QIMA 1VFEA 1TT1A 3HHGA 1B5HA 1JW4A 4KQPA 4OEVA 2A5TA 1I6AA 4X1DA 3B6WA 1RYXA 1OQHA 5CMCA 4KYEA 2B65A 3Q26A 3N5LA 2F78A 2OWSA 4PFWA 3S4UA 2QMXA 2ZNTA 4R9GA 3H6TA 1NFTA 4RPOA 2GHAA 1DPPA 4PP0A 1D9VA 3W9VA 4R6HA 5AE4A 1JEVA 3TFLA 2HFBA 5ICTA 5AA4A 3TPAA 2F35A 1ANFA 1M5BA 5F1QA 3K6WA 1A40A 1JQFA 2DQVA 2ZYNA 1BTJA 3TTLA 3RPWA 5I2KA 5I57A 1B58A 2O7IA 5HBCA 4KHZE 3PV0E 5ISUA 3CSBA 3I3VA 1ZJLA 1O63A 1OVBA 3RQTA 5HM4B 3FXQA 3FXUA 2BJJX 3PPRA 4RY1A 2GFEA 1B1HA 1EU8A 1SDXA 1NNKA 2QS1A 4H1XA 4LQ2A 4IO5A 4ISUA 1D3KA 4POXA 1MXUA 3IL1B 4LVQA 1WODA 4ZZEA 1ATGA 2XD2A 2UYEA 2DWHA 4MF3A 2DOJA 4IGRA 1MG1A 1FW0A 5H8FA 1DTZA 1P1QA 4ZE8A 5K2YA 4R6YA 3O6GA 3OO9A 3TKDA 3CFZA 3VFJA 3D4GA 1AOVA 3N26A 4NF8A 1N84A 3T66A 3PD9A 2XX9A 1O7TA 1A55A 1IITA 4U22A 3RUMA 4R6KA 5B70A 1CB6A 2XXVA 3PGFA 1PB7A 1I69A 3TEPA 3TCGA 3B6TA 5A5XB 5AA2B 3M3FA 3A09A 1M5CA 3E3KA 3UN6A 2F5XA 3CFLA 4KPTA 5ITOA 3C9HA 3PUZE 2I6EA 4ELQA 3CIJA 1N7WA 3TTNA 5L9MA 2P2AA 2H5YA 5CMKA 1LAHE 4IB2A 4GOTA 5BUUA 3T9XB 2OBGA 2VHAA 1LB9A 4H65A 3CSGA 1MQGA 3KFMA 3DM0A 2Q2CA 2DE4A 3PUVE 4YKJA 5H8SA 4RK2A 4F39A 1LBCA 1QVSA 2H25A 4LZ5A 4QFPA 4P0IA 3HSTA 3AXFA 2ABHA 3GLBA 1BLFA 1B7UA 2OZZA 2VGQA 5DYHA 4KFQA 1P99A 3K6VA 2I0BA 4LONB 1USYE 3SKPA 4OFOA 3JV9A 1Z7NE 3R26A 4F22A 2DXRA 2WKYA 3U94A 3GBAA 3PPNA 4LZ8A 1M5EA 3C4MA 4NF4A 1ZKBA 4LA9A 5H8NA 3CR9A 3LBSA 1IUDA 1VR5A 3BBRA 1A7LA 4YICA 1QUJA 1FTKA 3CG3A 4OMBA 1B3EA 2RC8A 3FD3A 2OJTA 3N6UA 3WAFA 3LSWA 3E13X 3L6HA 3FIRA 3M8UA 2ZNUA 3H3GA 4XXUA 5ICQA 4OFLA 4JWXA 3KJ7A 1ELJA 4F1VA 2UVGA 3FATA 4HTGA 2RC7A 1XT8A 2QSXA 3G3HA 3RN8A 2FNCA 1BKAA 1DMBA 3VV5A 4BDRA 4JDFA 4ELOA 1YCJA 2GRVA 4H8JA 3MBPA 4HW8A 2REGA 3H6WA 4H0WA 3OEMA 3RTFB 4XKRA 1LFIA 5FTIA 4R74A 2XX8A 3M3LA 1MH4A 1MPBA 2YLNA 3SEUA 3MPLA 2ALUA 3O6IA 5FTHA 4FJPA 3SEYA 2M8CA 2ZMBA 2V3TA 4NF5B 5H8HA 2XXTA 3K01A 2Y7WA 1YAEA 1IXIA 2F7CA 3P7IA 4EF2A 4R73A 3OELA 3OMBA 4Q8RA 4IO4A 3E4RA 4G68B 1MXYA 3S9LC 4G4PA 3FVGA 3VVFA 3KG2A 5TP9B 4C1TA 1NL5A 1P1OA 1I6BA 5TPAB 2XHDA 1JNFA 1A8FA 4UACA 3MVXA 5FHNA 1DPEA 4FORA 5I59A 1POY1 4NWCA 2PX1A 4OFJA 5ELVA 3VLWA 1GTKA 4GXSB 3H03A 5LOMA 5FHMA 2DP8A 3EHUA 2O51A 4Z7EA 3OO7A 2O7UA 5H8QB 3ODBA 4QSDA 3CI8A 3TQWA 2OCUA 1IEJA 3RGYA 2F8DA 1DTGA 1LAFE 3K1MA 5JK4A 4KYDA 4QSCA 4U4XA 1MY1A 5KCJA 4F3BA 2AIXA 1GV8A 3MWBA 4YKKA 2UVJA 3DP4A 4EQBA 3KOSA 1UTBA 3Q25A 2QMWA 1MY0A 4C1UA 2NVUB 5DEXB 5CC2A 3C35A 1RKMA 3IB1A 4GLIA 3QK6A 2D5WA 4ECFA 3MAMA 4ND9A 3O29A 5B7DA 1MS7A 4XKPA 2V93A 1SI1A 4OERA 1LCTA 2Z22A 3FASA 3U93A 1EZOA 1PBPA 2DSFA 1SW5A 1IZ1A 5KZTA 2DS9A 3OXNA 2QS2A 2ANJA 4LP2B 1R9LA 1SVXB 3KN3A 3HHFA 4ZECA 4KCDA 2HAUA 4DXBA 3PMXA 1D9YA 3EF7A 4EXKA 4NMYA 5I58A 4K3FA 1LCFA 5CBSA 3VLUA 4N07A 3U92A 2KLFA 4OQOA 2DWIA 1PB8A 2QRYA 4MLQA 2PT2A 5H8HB 4IO6A 4C0RA 4JBZA 1XOCA 2IEEA 5KDTA 3K0VA 1URDA 3CVGA 4WEPA 1SW4A 3IO6A 4WKMA 4QFKA 4X9TA 3ZKLA 3EN3A 5JTYB 1UTHA 3K6UA 4JWYA 4RYAA 1B2HA 1N3XA 1VFDA 4OENA 1JVYA 4OETA 1QKAA 4EXLA 2VD2A 4ONYA 5I56A 2O6AA 3TQLA 3A3CA 2R71A 3U8QA 3MVWA 2HEUA 4DDDA 1A99A 4OESA 2QS3A 2O1LA 2O1MA 3G3FA 4QF9A 2OK2A 2FYIA 3JZJA 4EF1A 4KYSA 4O3CA 1VE4A 1Y4CA 5CMBA 1Y3QA 1NKXA 3IAZA 4OEUA 3G3KA 3UA8A 1HSEA 2OWTA 3H06B 3KZGA 1QW0A 3I5OA 3OSQA 1UQWA 3RT6B 2AYSA 3PMVA 4FATA 3TODA 1FQFA 2V3UA 1PEBA 4QSEA 1AIVA 2UYFA 1BP5A 1R9QA 5I84A 1ZU0A 1II5A 2ONSA 5DVFA 1FTLA 4TQUQ 2Y84A 4HCWA 2O69A 1B52A 1FQBA 4R2BA 3K4UA 2H99A 1Q35A 3MP1A 3H6VA 5I2NA 4TLMB 2XXHA 2F97A 5IKBA 2F7AA 1M5FA 1OIBA 3PUYE 4X1BA 4OXVA 3O6HA 4PQJA 4GFRA 2CZLA 3GXAA 1AMFA 3KN7A 4JSOA 4RJZA 3MVYA 2B3BA 3O2AA 4DCYA 2GHBA 4N6PA 5ITPA 4NF6A 2RF1A 4R9FA 4YZZA 4YMAA 1B51A 2UVIA 2X7PA 1US5A 3CFXA 2A5TB 1Y1MA 5KDTB 1QKBA 1B3HA 4LZ7A 4OVJA 2G93A 3O28A 4PFTA 4GD5A 3U1OA 3ZS6A 1DOTA 1MXXA 4GIZA 1KWHA 1B4ZA 1H45A 3DP8A 1P1UA 4TOZA 3UORA 2FA7A 3VDFA 3W9WA 4AB5A 2Q2AA 3DELB 3IR1A 5AA4B 4O3AA 4GWOA 3FUZA 2LAOA 4XKNA 1B32A 1Y3NA 2ZNSA 1IQ7A 4F29A 3BKIB 4DZ1A 4GXAA 3TCHA 3I6VA 5I2KB 5I57B 4U1ZA 3G3GA 2HZKA 3TUSA 1TFDA 3OSRA 4PFYA 4X48A 1H43A 1N3WA 3KGCA 1WVJA 3R6UA 5HPQA 4F2QA 3SETA 3PD8A 4NE4A 3QYTA 4QFNA 4U23A 3MZ1A 3H6UA 1T0KA 2OLBA 1R1NA 3K6XA 1H76A 1UIVA 4JB7A 4YB5A 3QUFA 2H9BA 4QFOA 3K1NA 1JVXA 2E0SA 3OOAA 3MJNA 1USYH 3FVNA 4XIGQ 2XXWA 2D21A 1US4A 4KI0E 4E0WA 4DIGA 2HXWA 5H8FB 5IAIA 3R7XA 2O84X 4KCCA 3H4ZA 3HPIA 1B7ZA 2Z8DA 2V3QA 4NF8B 4L17A 4RNSA 1NNPA 4OYVA 3BFUA 1NNTA 2YPNA 4LATA 2RKMA 3KJTA 2I58A 3RT8A 2V84A 3TCFA 3T9VA 5DTBA 1OMPA 2XXUA 2Y7PA 2XXQA 3V8XB 4YU0A 3C32A 2P1SA 3ZKKA 1FCKA 3OO6A 1SW1A 3VE1B 2Y7KA 5EHSA 3DLNA 3MPKA 4JSDA 2I3WA 4P0GA 2HAVA 4DXCA 4BDLA 3DP6A 1Y9UA 4GQOA 2I48A 1B6HA 5K2XA 1P1NA 4FE8A 3OENA 1D4NA 1GGGA 3IB0A 4GVOA 2I4CA 4OZ9A 2Z23A 4G8MA 4ZEKA 5DVJA 2RINA 1SBPA 3FJMA 3KSXA 3CRBA 1OVTA 2O68A 2ESNA 2PMSA 2XX7A 3MP6A 4XKQA 1LLSA 2F7BA 2ONRA 1YPNA 3V5AA 1M5DA 4OWDA 3N6TA 1A54A 1B1XA 4R2FA 4M1VA 3IOUA 1Y1ZA 3IK6B 1S50A 4O3BA 3S9NC 3SEWA 2Y7RA 3FJ7A 3C34A 4NF4B 3S9EA 1NMUA 1URSA
chains in the Genus database with same CATH superfamily
2I3VA 3TZAA 1ZIUA 5H8NB 4G2ZA 4IO3A 4EQ7A 3TTMA 2FBPA 5I3SA 2CZKA 4U1OA 3O9PA 3LSLA 5ET6A 4NN3A 4BDQA 3RTWB 3FVOA 4P1EA 4BDOA 2Q8MA 2V25A 4ESXA 1YTVA 3SEXA 3IB2A 2YJPA 4ELPA 5EHMA 1I6QA 4ZEBA 4DCXA 5DT6A 3SERA 4H45A 2XWOA 5DVIA 2AL4A 2VOZA 3G7WA 4F19A 4O8MA 4MBPA 2Z8EA 1ZTYA 1B7HA 4NEDA 4KR5A 5JEIA 3IJXB 3USDA 5A5XA 5AA2A 1PDAA 2WYKA 3TAJA 1EZPA 1LAGE 4GWUA 4THIA 3TTKA 4GL8A 4H8IA 1Y4TA 4AQ4A 3KN8A 3VXBA 1FJ9A 4H5GA 1B0HA 1B5IA 4YKIA 5ESYA 3FV1A 4I9DA 1Z7ME 5TU0A 4BLAA 4XTCQ 1IIWA 2XXPA 2W7YA 5CRYA 5F24A 5CI5A 2JJKA 2Y7IA 3MVZA 1LBBA 1XHYA 3VXCA 3LSFB 1MY2A 1FQDA 2Y5LA 4U2RA 3N94A 1MDQA 4YKPA 1F9BA 3KOTA 4N17A 1EH3A 3MW0A 4F3GA 4PBHA 2R9JA 2VPOA 3IX1A 4Q0CA 5L9SA 3FVKA 3C31A 4OHNA 3IO4A 1VSOA 4XF5A 3OEKA 4YAHX 5I59B 3ZSFA 1B9JA 4LUBA 1LB8A 2XXRA 2X26A 3G3JA 3UIFA 2ZYMA 3IFCA 5FBPA 4GRKA 2F34A 1B5JA 1MQJA 2XXIA 3GBBA 1EYJA 4X8RA 1SD3A 3VLVA 4O7MA 1SPIA 4M4GA 1JP4A 3ILTB 3LC8A 2X7QA 3EHTA 3D1RA 5KCJB 4Z0IA 3EPEA 3VVEA 2B3FA 1LEVA 1BIYA 2XWKA 4WXJA 2PT1A 3PU5A 1UTBB 1MM7A 3A3UA 5AA3A 2UXAA 1MPDA 4I8CA 3THIA 3PUXE 3QXMA 3KEIA 1Y20A 1N0TA 4PAIA 3KSJA 2ONKE 3K1PA 1J1NA 3IJOB 1SQYA 3SESA 1R6ZA 1TWYA 1B46A 1XVXA 3O97A 3OD7A 3PPQA 4ZEFA 1FPEA 1IXHA 2I0CA 3M3KA 3MYUA 4R75A 4P11A 2CMOA 1TFAA 1EYIA 4Q30B 2WBBA 4LQ5A 1AH5A 1Q1KA 4N81A 3RLFE 1MY3A 1NH7A 4IY6A 4PAKA 2PYYA 4RPNA 1JW1A 3B6QA 1QUIA 4ZEIA 1B4HA 5T3JA 2QS4A 3PUWE 2F3BA 1JETA 3HV1A 4NWDA 4NF5A 2XA5A 2DWAA 1MXVA 3C36A 2HXRA 2NXOA 1B3GA 4OTEA 4ZEDA 1MH3A 3ECRA 4R72A 1MM6A 3TYHA 2DE2A 5I58B 4E0XA 4G77A 1FBHA 1PB9A 3T9UA 2RC9A 4G68A 4F18A 5BWJA 1DK4A 2PVUA 2VP1A 5TP9A 1NNFA 2RCAA 3MSTA 2F36A 1N7XA 3T22A 3L6GA 1FQCA 1Y3PA 4FBPA 2IA4A 1P1WA 5TPAA 2QJEA 1FPKA 3QSLA 1QJMA 2WBDA 4G8NA 1S9TA 1UTHB 4F2OA 1ZMGA 4JVCA 4N8GA 4FEDA 4P1LA 5CMMA 1JW5A 4PE5B 4FEBA 2DE3A 1TXFA 3O66A 3T96B 4PCDA 1HSLA 4F1UA 4N6DA 5I56B 3OO8A 2HZLA 2I4BA 4N91A 1WDNA 5H8QA 3G3IA 3IOTA 2CZHA 3S2VA 3BFTA 1MY4A 3RNNA 2DVCA 2F6GA 4P56A 3IOVA 3MC2A 1LAXA 2ZYKA 4MX6A 1OLCA 2HQ0A 4JXIA 1URGA 1N76A 2VD3A 2RCBA 3TTRA 4P47A 2H4IA 2XD3A 3E9XA 4KD5A 4YMBA 1FTJA 1NUZA 3C33A 4F31B 3Q29A 3U72A 4GF8A 1FTOA 3RPLB 2D3IA 4FECA 5ET5A 1NH8A 4IGTA 3V83A 3QUJA 4GWWA 1UIUA 3T9HB 5DEXA 4OVTA 5CBRA 1MXWA 2VPNA 4F3PA 4G8HA 4OANA 1KZ8A 3IOWA 3FGSA 5EQ9A 1FQEA 4FAJA 1XVYA 4JWOA 1MPCA 3T0JA 3LUZA 3MUQA 1MQDA 1IXGA 4MH5A 4ZZAA 2Q88A 1SI0A 2THIA 4RXLA 2AL5A 3EQ1A 2REJA 2G29A 3ONMA 5EQ8A 2DYXA 4MHFA 1RYOA 4N8YA 4EUOA 3TELA 5M2VA 1MRPA 4FIMA 1D9QA 3ISPA 3SEVA 4RK9A 2NWJA 4U21A 5IZ3A 2E1SA 3UK4A 1B3FA 1OLAA 3KBRA 2XXXA 4EDPA 3FJGA 4I62A 1LFHA 1L5TA 3T93B 4NF0A 4PF8A 1SYIA 4GX3A 1POTA 5LDZA 5I2NB 4UA8A 2UVHA 1FBFA 4BDMA 4TLLB 4YB7A 2NOOA 4GWXA 3Q28A 1H3DA 4P9KA 2F6PA 4U4SA 3B7DA 4QFLA 1GVCA 1N04A 2PBWA 4GWYA 3CG1A 3LSXA 4ZS9A 1SYHA 3HCQA 5FHOA 4JVIA 4F3SA 1FTMA 4HCYA 5L9OA 3V89B 5JTYA 4NHBA 2OX3A 4NF6B 5EYFA 2P0SA 4MFIA 2A5SA 3MP8A 1XS5A 1B05A 2DWJA 3GZGA 1YZ0A 2GH9A 2Q8JA 3FV2A 4HS7A 1DBZA 3VVDA 4IO2A 1LBWA 4NG7A 1FPDA 4JVDA 1NV3A 5CM6A 1LBXA 4QRZA 2ZYOA 2ZXTA 4Q5TA 3UP9A 1ZBMA 2NUVA 4IO7A 1EZ9A 1MQHA 4ELRA 3K2DA 4EQ9A 1IXCA 2Q89A 3FZVA 2H98A 4DLDA 5AA1A 1NV4A 1OQGA 1PBQA 4MLVA 2FVZA 2VT5A 3IORA 3PPPA 4YB6A 3GYYA 1SW2A 3JYRA 1A8EA 3HN0A 4PETA 4RA1A 2XXYA 3MZ9A 4IY5A 1AL3A 1LSTA 3Q27A 1PC3A 1DSNA 1B3LA 5L8DA 1LFGA 5F7VA 3K00A 2PCRA 5IZZA 4HE2A 2I49A 3K02A 2HCAA 1FQAA 4DXUA 1MQIA 1B40A 1HSJA 1CE2A 2QPQA 1JEUA 2Z8FA 4F1YA 3EHSA 3D4CA 3MQ9A 1G0HA 4N6KA 4G68C 2ZZXA 1QUKA 1H44A 1LBZA 1MDP1 4N13A 1MXZA 4H6DA 2QL3A 1QULA 3TDJA 4GL0A 3LR1A 4NTLA 1B0LA 3SDFA 3PMWA 4QHQA 3HO7A 2BJIA 3MZBA 5AA2D 4POWA 2PFYA 4DE8A 1ZLQA 4I1DA 3FXBA 1XC1A 4ZE9A 4H67A 4WEDA 2DVZA 2DXYA 5J1DA 4H5FA 1O64A 1S7YA 5J16A 4PFUA 3W15C 4XEQA 3ILUB 3LUYA 4NX1A 3UGWA 4ESWA 2Q9TA 4AB6A 1GR2A 3F11A 5ET7A 4ZDMA 3FXRA 4BDNA 3WAEA 3PPOA 3QAXA 3S9MC 3TMGA 2R6GE 3H7MA 3RY3A 1LGBC 3QIMA 1VFEA 1TT1A 4I3YA 3HHGA 1B5HA 1JW4A 4KQPA 4OEVA 2A5TA 1I6AA 4X1DA 3B6WA 2XXKA 1RYXA 1OQHA 5CMCA 4KYEA 2B65A 3Q26A 3N5LA 2F78A 2OWSA 4PFWA 3S4UA 2QMXA 2ZNTA 4R9GA 3H6TA 2Q74A 1NFTA 1XI6A 4RPOA 2GHAA 1DPPA 5I7IA 4PP0A 1D9VA 3W9VA 4R6HA 5AE4A 1JEVA 3TFLA 2HFBA 5ICTA 5AA4A 4PTKA 3TPAA 2F35A 1ANFA 4PFIA 1M5BA 5F1QA 3K6WA 3LV0A 1BK4A 4MMPA 1A40A 1FPLA 1JQFA 2DQVA 2ZYNA 1NUXA 1BTJA 3TTLA 3RPWA 5I2KA 3U65A 5I57A 1B58A 2O7IA 5HBCA 4KHZE 3PV0E 5ISUA 4N4UA 3CSBA 3I3VA 1ZJLA 1FBDA 1O63A 5EQAA 1OVBA 3RQTA 5HM4B 3FXQA 3FXUA 2BJJX 3PPRA 4RY1A 2GFEA 1B1HA 1KA1A 1EU8A 1SDXA 1NNKA 2QS1A 4H1XA 4LQ2A 4IO5A 4ISUA 1D3KA 4POXA 4I3EA 1MXUA 3HFUA 3IL1B 1EYKA 4LVQA 1WODA 4ZZEA 1ATGA 2XD2A 2UYEA 2DWHA 4MF3A 2DOJA 4IGRA 1MG1A 1FW0A 5H8FA 1DTZA 3NOHA 1P1QA 4ZE8A 5K2YA 4R6YA 3O6GA 3OO9A 3TKDA 3CFZA 3VFJA 3D4GA 1AOVA 3N26A 4NF8A 1N84A 3T66A 3PD9A 2XX9A 1O7TA 1A55A 1IITA 2ZZVA 4U22A 3RUMA 4R6KA 5B70A 4QBAA 4PFRA 1CB6A 2XXVA 3PGFA 1PB7A 1I69A 3TEPA 3TCGA 3EKIA 3B6TA 5A5XB 5AA2B 3M3FA 3A09A 4P8BA 1M5CA 3E3KA 3UN6A 2F5XA 3CFLA 4KPTA 5ITOA 3C9HA 3PUZE 1NV2A 2I6EA 4ELQA 3CIJA 1N7WA 1INPA 3TTNA 5L9MA 2P2AA 2H5YA 5CMKA 1LAHE 4IB2A 4GOTA 5BUUA 3T9XB 2OBGA 4HXVA 1K9YA 2VHAA 1LB9A 4H65A 3CSGA 4LN5A 4PE3A 1MQGA 3E78A 5IZ1A 4IR8A 3KFMA 3DM0A 2Q2CA 2DE4A 3PUVE 4YKJA 5H8SA 4RK2A 4F39A 1FSAA 1LBCA 1QVSA 2XWIA 2H25A 4LZ5A 4QFPA 4GBVA 1FBCA 4P0IA 3HSTA 2FIXA 3AXFA 2ABHA 3GLBA 1BLFA 1B7UA 2OZZA 2VGQA 5DYHA 4KFQA 1P99A 3K6VA 2I0BA 4LONB 1USYE 4UABA 1RDYA 3SKPA 4OFOA 3JV9A 1Z7NE 3R26A 1AWBA 4F22A 2DXRA 2WKYA 3U94A 3GBAA 3PPNA 4LZ8A 3A29A 1M5EA 3C4MA 4NF4A 1ZKBA 4LA9A 5H8NA 3CR9A 3LBSA 1IUDA 1VR5A 2PFZA 3BBRA 1A7LA 4YICA 1QUJA 1FTKA 3CG3A 4OMBA 1B3EA 2RC8A 3FD3A 2OJTA 3N6UA 3WAFA 3LSWA 3E13X 3L6HA 3FIRA 3M8UA 2ZNUA 3H3GA 4XXUA 5ICQA 4OFLA 1KA0A 4JWXA 3KJ7A 1FPJA 1ELJA 4F1VA 2UVGA 3FATA 4HTGA 2RC7A 1XT8A 2QSXA 3G3HA 4MCOA 3RN8A 2FNCA 1BKAA 1DMBA 3VV5A 4BDRA 4JDFA 4ELOA 1YCJA 2GRVA 4H8JA 4PGNA 3MBPA 4HW8A 2REGA 3H6WA 4H0WA 3OEMA 3RTFB 4XKRA 1LFIA 5FTIA 4PGPA 4R74A 2XX8A 3M3LA 4DI4B 1MH4A 1MPBA 2YLNA 3SEUA 3MPLA 2ALUA 1YXIA 3O6IA 3IFAA 5FTHA 4FJPA 3SEYA 2HHMA 5EYGA 2M8CA 2ZMBA 2V3TA 4NF5B 5H8HA 2XXTA 3K01A 2XWVA 2Y7WA 1YAEA 1IXIA 4AS5A 2F7CA 3P7IA 4EF2A 4R73A 3OELA 3OMBA 4Q8RA 2KR0A 4IO4A 1IMCA 3E4RA 4O94A 2QFLA 4G68B 1MXYA 3S9LC 4G4PA 3FVGA 3VVFA 3KG2A 5TP9B 4C1TA 1NL5A 4AS4A 3SZPA 1P1OA 1I6BA 5TPAB 2XHDA 1JNFA 3ROJA 1A8FA 4UACA 3MVXA 2V4CA 5FHNA 1DPEA 4FORA 5I59A 2FHYA 1POY1 4NWCA 2PX1A 4GBWA 5IM2A 4OFJA 5ELVA 2P3VA 3VLWA 1GTKA 4GXSB 3H03A 5LOMA 5FHMA 2DP8A 3EHUA 2O51A 4Z7EA 3OO7A 2O7UA 5H8QB 3ODBA 3QMFA 4QSDA 2CEXA 3CI8A 3TQWA 2OCUA 1IEJA 3RGYA 2F8DA 1DTGA 1LAFE 3K1MA 5JK4A 4KYDA 4QSCA 4U4XA 1MY1A 5KCJA 4NAPA 2FIEA 4MNCA 4F3BA 2AIXA 1GV8A 4OVPA 3MWBA 4YKKA 2UVJA 3B8BA 3DP4A 4PDHA 4EQBA 3T1BA 2WX9A 3KOSA 4NQ8A 1UTBA 3Q25A 2QMWA 2WYPA 1MY0A 4C1UA 2NVUB 5DEXB 4G61A 1QGXA 5CC2A 3C35A 1RKMA 3IB1A 4GLIA 3QK6A 2D5WA 4ECFA 2DDKA 3MAMA 4MNPA 3O29A 4ND9A 5B7DA 1MS7A 4XKPA 2V93A 1SI1A 4OERA 1LCTA 2Z22A 3FASA 3U93A 1EZOA 1NI9A 1PBPA 3FBPA 2DSFA 1SW5A 1IZ1A 5KZTA 2DS9A 4I40A 3OXNA 1FPBA 2QS2A 2ANJA 4LP2B 4OA4A 5IZ3B 2B4LA 1R9LA 1SVXB 3KN3A 3HHFA 4ZECA 4PBQA 4KCDA 2HAUA 4DXBA 3PMXA 3CHGA 1D9YA 3EF7A 4EXKA 4NMYA 5I58A 4K3FA 1LCFA 5CBSA 3VLUA 4N07A 3U92A 2KLFA 4PF6A 4OQOA 2DWIA 1PB8A 2QRYA 4MLQA 4O7IA 2PT2A 4OVSA 5H8HB 4IO6A 4C0RA 4JBZA 1XOCA 2IEEA 5KDTA 3K0VA 1URDA 3CVGA 2ZZWA 1IMDA 4WEPA 1SW4A 3IO6A 1NUYA 4WKMA 4QFKA 4X9TA 3ZKLA 3EN3A 5JTYB 1UTHA 2WEFA 3K6UA 4P3LA 4JWYA 4RYAA 1B2HA 1N3XA 1VFDA 4OENA 1JVYA 4OETA 1QKAA 4EXLA 2VD2A 4ONYA 5I56A 1NV5A 2O6AA 4MIJA 3TQLA 3A3CA 5EYHA 2R71A 3U8QA 4MNIA 3MVWA 5ET8A 2HEUA 4DDDA 1A99A 4OESA 2QS3A 2O1LA 2O1MA 3G3FA 4QF9A 2OK2A 2FYIA 3JZJA 4PDDA 4EF1A 4KYSA 4O3CA 1VE4A 1Y4CA 5CMBA 1Y3QA 1NKXA 3IAZA 4OEUA 3G3KA 3UA8A 4QXDA 1HSEA 5I5PA 2OWTA 3H06B 3KZGA 3RPLA 1QW0A 2Y5KA 3I5OA 2OWZA 3OSQA 1UQWA 3RT6B 2AYSA 5LTCA 3PMVA 1NV1A 2HPGA 4FATA 3TODA 1FQFA 2V3UA 1IMAA 4GX6A 1PEBA 4QSEA 1AIVA 5DW8A 2UYFA 1BP5A 1K9ZA 1R9QA 5I84A 1ZU0A 1II5A 2ONSA 4KXPA 2QVVA 5DVFA 1FTLA 4TQUQ 5EQ7A 2Y84A 4HCWA 2O69A 1B52A 1FQBA 4R2BA 3K4UA 2H99A 1Q35A 3KC1A 3MP1A 3H6VA 5I2NA 4TLMB 4PC9A 2XXHA 4H46A 2F97A 5IKBA 2F7AA 1M5FA 1OIBA 3PUYE 4X1BA 4OXVA 3O6HA 4PQJA 4GFRA 5A5LA 2CZLA 3GXAA 4XFEA 1AMFA 2MKZA 3KN7A 4JSOA 4RJZA 3MVYA 2B4MA 3RYDA 2B3BA 3O2AA 1FPGA 4DCYA 2GHBA 4HE0A 4N6PA 5ITPA 4NF6A 2RF1A 4R9FA 4YZZA 4YMAA 1B51A 2UVIA 2X7PA 1US5A 3CFXA 1CNQA 3E79A 2A5TB 2GQ1A 1Y1MA 5KDTB 4X04A 1QKBA 1B3HA 4LZ7A 4OVJA 2R8TA 2G93A 3O28A 4PFTA 2CEYA 4GD5A 3U1OA 3ZS6A 1FPIA 1DOTA 1MXXA 4GIZA 1KWHA 1B4ZA 1H45A 3DP8A 1FJ6A 1P1UA 1G0IA 4TOZA 3UORA 2FA7A 2QVRA 3VDFA 3W9WA 4AB5A 2Q2AA 3DELB 3IR1A 5AA4B 4O3AA 4GWOA 3FUZA 2LAOA 1IMFA 4XKNA 1B32A 1Y3NA 4DI3D 2ZNSA 1FPFA 1IQ7A 1FTAA 4F29A 3BKIB 4DZ1A 4GXAA 3TCHA 3I6VA 5I2KB 5I57B 4U1ZA 3G3GA 2HZKA 1IMEA 3TUSA 1TFDA 1DCUA 3OSRA 4PFYA 1NV7A 4X48A 1NV6A 1H43A 3PTYA 1N3WA 3KGCA 1WVJA 3R6UA 5HPQA 4F2QA 4OVQA 3SETA 3KBZA 1FRPA 3PD8A 4NE4A 1YYZA 3QYTA 4QFNA 4U23A 2QVUA 3MZ1A 3H6UA 4MEVA 1T0KA 2OLBA 1R1NA 3K6XA 1H76A 1UIVA 4JB7A 3QUFA 4QFOA 2H9BA 4YB5A 3K1NA 1LBVA 1JVXA 2E0SA 3OOAA 3MJNA 1USYH 3FVNA 4XIGQ 2XXWA 2D21A 1US4A 4KI0E 4E0WA 4DIGA 2HXWA 5H8FB 5IAIA 3R7XA 2O84X 2F3DA 4KCCA 3H4ZA 3HPIA 4OVRA 1B7ZA 1RDZA 2Z8DA 4NF8B 2V3QA 2L5VA 4L17A 4RNSA 1NNPA 4OYVA 3BFUA 1NNTA 2YPNA 1LBYA 4LATA 4PFBA 2RKMA 3KJTA 2I58A 3RT8A 2V84A 3TCFA 3T9VA 1Q9DA 5DTBA 1OMPA 2XXUA 2Y7PA 2XXQA 1IMBA 3V8XB 4YU0A 1FBPA 3C32A 4GWZA 3BIHA 2CZIA 2P1SA 4N15A 3ZKKA 1FCKA 3OO6A 1SW1A 3VE1B 2Y7KA 1VDWA 5EHSA 3DLNA 3MPKA 4JSDA 2I3WA 4P0GA 2HAVA 4DXCA 4BDLA 3DP6A 1Y9UA 4GQOA 2I48A 1RDXA 1FBGA 1B6HA 5K2XA 1P1NA 4FE8A 3OENA 4HE1A 4PAFA 1D4NA 1GGGA 3IB0A 4GVOA 2I4CA 4NGUA 4OZ9A 2Z23A 4G8MA 4ZEKA 1NV0A 5DVJA 2RINA 1SBPA 3FJMA 3KSXA 3CRBA 3KC0A 1OVTA 2O68A 2ESNA 4GWSA 2PMSA 2XX7A 3MP6A 2KQZA 4XKQA 5IGAA 1FBEA 1NUWA 1LLSA 4GX4A 2F7BA 2ONRA 1YPNA 3V5AA 1M5DA 4OWDA 3N6TA 1A54A 4MJOA 2P3NA 1B1XA 3B50A 4R2FA 4M1VA 3IOUA 1Y1ZA 3IK6B 1S50A 4MAGA 4O3BA 3S9NC 3SEWA 2Y7RA 3FJ7A 3C34A 4NF4B 3S9EA 3BIGA 1NMUA 1URSA
chains in the Genus database with same CATH topology
2I3VA 3TZAA 1ZIUA 5H8NB 4G2ZA 4IO3A 4EQ7A 3TTMA 4U1OA 3O9PA 3LSLA 4BDQA 3RTWB 3FVOA 4BDOA 2V25A 4ESXA 1YTVA 3SEXA 3IB2A 2YJPA 4ELPA 5EHMA 1I6QA 4ZEBA 4DCXA 5DT6A 3SERA 5DVIA 2AL4A 2VOZA 3G7WA 4F19A 4MBPA 2Z8EA 1ZTYA 1B7HA 4NEDA 4KR5A 5JEIA 3IJXB 3USDA 5A5XA 5AA2A 1PDAA 3TAJA 1EZPA 1LAGE 4THIA 3TTKA 4GL8A 4H8IA 1Y4TA 4AQ4A 3KN8A 3VXBA 4H5GA 1B0HA 1B5IA 4YKIA 3FV1A 4I9DA 1Z7ME 5TU0A 4BLAA 4XTCQ 1IIWA 2XXPA 2W7YA 5CRYA 5CI5A 3MVZA 2Y7IA 1LBBA 1XHYA 3VXCA 3LSFB 1MY2A 1FQDA 4U2RA 3N94A 1MDQA 4YKPA 1F9BA 3KOTA 1EH3A 3MW0A 4F3GA 2R9JA 3IX1A 4Q0CA 5L9SA 3FVKA 3C31A 4OHNA 3IO4A 1VSOA 3OEKA 4YAHX 5I59B 3ZSFA 1B9JA 4LUBA 1LB8A 2XXRA 2X26A 3G3JA 3UIFA 2ZYMA 4GRKA 2F34A 1B5JA 1MQJA 2XXIA 3GBBA 1SD3A 3VLVA 4M4GA 3ILTB 3LC8A 2X7QA 3EHTA 5KCJB 4Z0IA 3EPEA 3VVEA 2B3FA 1BIYA 4WXJA 2PT1A 3PU5A 1UTBB 1MM7A 3A3UA 5AA3A 2UXAA 1MPDA 4I8CA 3THIA 3PUXE 3QXMA 3KEIA 1Y20A 1N0TA 3KSJA 2ONKE 3K1PA 1J1NA 3IJOB 1SQYA 3SESA 1R6ZA 1TWYA 1B46A 1XVXA 3O97A 3OD7A 3PPQA 4ZEFA 1IXHA 2I0CA 3M3KA 4R75A 4P11A 2CMOA 1TFAA 4Q30B 4LQ5A 1AH5A 1Q1KA 3RLFE 1MY3A 1NH7A 4IY6A 2PYYA 4RPNA 1JW1A 3B6QA 1QUIA 4ZEIA 1B4HA 2QS4A 3PUWE 1JETA 3HV1A 4NWDA 4NF5A 2DWAA 1MXVA 3C36A 2NXOA 1B3GA 4OTEA 4ZEDA 1MH3A 3ECRA 4R72A 3TYHA 1MM6A 2DE2A 5I58B 4E0XA 4G77A 1PB9A 3T9UA 2RC9A 4G68A 4F18A 5BWJA 2PVUA 2VP1A 5TP9A 1NNFA 2RCAA 2F36A 1N7XA 3T22A 3L6GA 1FQCA 1Y3PA 2IA4A 1P1WA 5TPAA 2QJEA 3QSLA 1QJMA 4G8NA 1S9TA 1UTHB 4F2OA 1ZMGA 4FEDA 5CMMA 1JW5A 4PE5B 4FEBA 2DE3A 1TXFA 3O66A 3T96B 1HSLA 4F1UA 5I56B 3OO8A 2HZLA 2I4BA 1WDNA 5H8QA 3G3IA 3IOTA 3S2VA 3BFTA 1MY4A 3RNNA 2DVCA 2F6GA 3IOVA 3MC2A 1LAXA 2ZYKA 1OLCA 2HQ0A 4JXIA 1URGA 1N76A 2VD3A 2RCBA 3TTRA 2H4IA 2XD3A 3E9XA 4KD5A 4YMBA 1FTJA 4F31B 3C33A 3Q29A 3U72A 4GF8A 1FTOA 2D3IA 4FECA 1NH8A 4IGTA 3V83A 3QUJA 1UIUA 3T9HB 5DEXA 5CBRA 1MXWA 4F3PA 4G8HA 3IOWA 3FGSA 1FQEA 4FAJA 1XVYA 4JWOA 1MPCA 3MUQA 1MQDA 1IXGA 4MH5A 4ZZAA 2Q88A 1SI0A 2THIA 4RXLA 2AL5A 3EQ1A 2REJA 2G29A 3ONMA 2DYXA 1RYOA 4EUOA 3TELA 5M2VA 1MRPA 4FIMA 3SEVA 4RK9A 2NWJA 4U21A 2E1SA 3UK4A 1B3FA 1OLAA 3KBRA 2XXXA 4EDPA 3FJGA 4I62A 1LFHA 1L5TA 3T93B 1SYIA 1POTA 5I2NB 4UA8A 2UVHA 4BDMA 4TLLB 4YB7A 2NOOA 3Q28A 1H3DA 4U4SA 2F6PA 3B7DA 4QFLA 1GVCA 1N04A 2PBWA 3CG1A 3LSXA 4ZS9A 1SYHA 3HCQA 5FHOA 4F3SA 1FTMA 4HCYA 5L9OA 3V89B 5JTYA 4NF6B 5EYFA 2P0SA 4MFIA 2A5SA 3MP8A 1XS5A 1B05A 2DWJA 3GZGA 2GH9A 2Q8JA 3FV2A 4HS7A 3VVDA 4IO2A 5CM6A 4QRZA 2ZYOA 2ZXTA 4Q5TA 3UP9A 1ZBMA 2NUVA 4IO7A 1EZ9A 1MQHA 4ELRA 3K2DA 4EQ9A 1IXCA 2Q89A 3FZVA 2H98A 4DLDA 5AA1A 1OQGA 1PBQA 4MLVA 3IORA 3PPPA 4YB6A 1SW2A 3JYRA 1A8EA 3HN0A 4PETA 4RA1A 2XXYA 3MZ9A 4IY5A 1AL3A 1LSTA 3Q27A 1PC3A 1DSNA 1B3LA 5L8DA 1LFGA 5F7VA 3K00A 2I49A 3K02A 2HCAA 1FQAA 4DXUA 1MQIA 1B40A 1HSJA 1CE2A 2QPQA 1JEUA 2Z8FA 4F1YA 3EHSA 3D4CA 3MQ9A 4G68C 1QUKA 1H44A 1MDP1 4N13A 1MXZA 4H6DA 2QL3A 1QULA 3TDJA 4GL0A 3LR1A 4NTLA 1B0LA 3SDFA 3PMWA 4QHQA 3HO7A 5AA2D 3MZBA 4POWA 4DE8A 1ZLQA 4I1DA 1XC1A 4ZE9A 4H67A 4WEDA 2DVZA 2DXYA 5J1DA 4H5FA 1O64A 1S7YA 4PFUA 3W15C 3ILUB 3LUYA 3UGWA 4ESWA 2Q9TA 4AB6A 1GR2A 3F11A 4ZDMA 3FXRA 4BDNA 3WAEA 3PPOA 3QAXA 3S9MC 3TMGA 2R6GE 3H7MA 3RY3A 1LGBC 3QIMA 1VFEA 1TT1A 3HHGA 1B5HA 1JW4A 4KQPA 4OEVA 2A5TA 1I6AA 4X1DA 3B6WA 1RYXA 1OQHA 5CMCA 4KYEA 2B65A 3Q26A 3N5LA 2F78A 2OWSA 4PFWA 3S4UA 2QMXA 2ZNTA 4R9GA 3H6TA 1NFTA 4RPOA 2GHAA 1DPPA 4PP0A 1D9VA 3W9VA 4R6HA 5AE4A 1JEVA 3TFLA 2HFBA 5ICTA 5AA4A 3TPAA 2F35A 1ANFA 1M5BA 5F1QA 3K6WA 1A40A 1JQFA 2DQVA 2ZYNA 1BTJA 3TTLA 3RPWA 5I2KA 5I57A 1B58A 2O7IA 5HBCA 4KHZE 3PV0E 5ISUA 3CSBA 3I3VA 1ZJLA 1O63A 1OVBA 3RQTA 5HM4B 3FXQA 3FXUA 2BJJX 3PPRA 4RY1A 2GFEA 1B1HA 1EU8A 1SDXA 1NNKA 2QS1A 4H1XA 4LQ2A 4IO5A 4ISUA 1D3KA 4POXA 1MXUA 3IL1B 4LVQA 1WODA 4ZZEA 1ATGA 2XD2A 2UYEA 2DWHA 4MF3A 2DOJA 4IGRA 1MG1A 1FW0A 5H8FA 1DTZA 1P1QA 4ZE8A 5K2YA 4R6YA 3O6GA 3OO9A 3TKDA 3CFZA 3VFJA 3D4GA 1AOVA 3N26A 4NF8A 1N84A 3T66A 3PD9A 2XX9A 1O7TA 1A55A 1IITA 4U22A 3RUMA 4R6KA 5B70A 1CB6A 2XXVA 3PGFA 1PB7A 1I69A 3TEPA 3TCGA 3B6TA 5A5XB 5AA2B 3M3FA 3A09A 1M5CA 3E3KA 3UN6A 2F5XA 3CFLA 4KPTA 5ITOA 3C9HA 3PUZE 2I6EA 4ELQA 3CIJA 1N7WA 3TTNA 5L9MA 2P2AA 2H5YA 5CMKA 1LAHE 4IB2A 4GOTA 5BUUA 3T9XB 2OBGA 2VHAA 1LB9A 4H65A 3CSGA 1MQGA 3KFMA 3DM0A 2Q2CA 2DE4A 3PUVE 4YKJA 5H8SA 4RK2A 4F39A 1LBCA 1QVSA 2H25A 4LZ5A 4QFPA 4P0IA 3HSTA 3AXFA 2ABHA 3GLBA 1BLFA 1B7UA 2OZZA 2VGQA 5DYHA 4KFQA 1P99A 3K6VA 2I0BA 4LONB 1USYE 3SKPA 4OFOA 3JV9A 1Z7NE 3R26A 4F22A 2DXRA 2WKYA 3U94A 3GBAA 3PPNA 4LZ8A 1M5EA 3C4MA 4NF4A 1ZKBA 4LA9A 5H8NA 3CR9A 3LBSA 1IUDA 1VR5A 3BBRA 1A7LA 4YICA 1QUJA 1FTKA 3CG3A 4OMBA 1B3EA 2RC8A 3FD3A 2OJTA 3N6UA 3WAFA 3LSWA 3E13X 3L6HA 3FIRA 3M8UA 2ZNUA 3H3GA 4XXUA 5ICQA 4OFLA 4JWXA 3KJ7A 1ELJA 4F1VA 2UVGA 3FATA 4HTGA 2RC7A 1XT8A 2QSXA 3G3HA 3RN8A 2FNCA 1BKAA 1DMBA 3VV5A 4BDRA 4JDFA 4ELOA 1YCJA 2GRVA 4H8JA 3MBPA 4HW8A 2REGA 3H6WA 4H0WA 3OEMA 3RTFB 4XKRA 1LFIA 5FTIA 4R74A 2XX8A 3M3LA 1MH4A 1MPBA 2YLNA 3SEUA 3MPLA 2ALUA 3O6IA 5FTHA 4FJPA 3SEYA 2M8CA 2ZMBA 2V3TA 4NF5B 5H8HA 2XXTA 3K01A 2Y7WA 1YAEA 1IXIA 2F7CA 3P7IA 4EF2A 4R73A 3OELA 3OMBA 4Q8RA 4IO4A 3E4RA 4G68B 1MXYA 3S9LC 4G4PA 3FVGA 3VVFA 3KG2A 5TP9B 4C1TA 1NL5A 1P1OA 1I6BA 5TPAB 2XHDA 1JNFA 1A8FA 4UACA 3MVXA 5FHNA 1DPEA 4FORA 5I59A 1POY1 4NWCA 2PX1A 4OFJA 5ELVA 3VLWA 1GTKA 4GXSB 3H03A 5LOMA 5FHMA 2DP8A 3EHUA 2O51A 4Z7EA 3OO7A 2O7UA 5H8QB 3ODBA 4QSDA 3CI8A 3TQWA 2OCUA 1IEJA 3RGYA 2F8DA 1DTGA 1LAFE 3K1MA 5JK4A 4KYDA 4QSCA 4U4XA 1MY1A 5KCJA 4F3BA 2AIXA 1GV8A 3MWBA 4YKKA 2UVJA 3DP4A 4EQBA 3KOSA 1UTBA 3Q25A 2QMWA 1MY0A 4C1UA 2NVUB 5DEXB 5CC2A 3C35A 1RKMA 3IB1A 4GLIA 3QK6A 2D5WA 4ECFA 3MAMA 4ND9A 3O29A 5B7DA 1MS7A 4XKPA 2V93A 1SI1A 4OERA 1LCTA 2Z22A 3FASA 3U93A 1EZOA 1PBPA 2DSFA 1SW5A 1IZ1A 5KZTA 2DS9A 3OXNA 2QS2A 2ANJA 4LP2B 1R9LA 1SVXB 3KN3A 3HHFA 4ZECA 4KCDA 2HAUA 4DXBA 3PMXA 1D9YA 3EF7A 4EXKA 4NMYA 5I58A 4K3FA 1LCFA 5CBSA 3VLUA 4N07A 3U92A 2KLFA 4OQOA 2DWIA 1PB8A 2QRYA 4MLQA 2PT2A 5H8HB 4IO6A 4C0RA 4JBZA 1XOCA 2IEEA 5KDTA 3K0VA 1URDA 3CVGA 4WEPA 1SW4A 3IO6A 4WKMA 4QFKA 4X9TA 3ZKLA 3EN3A 5JTYB 1UTHA 3K6UA 4JWYA 4RYAA 1B2HA 1N3XA 1VFDA 4OENA 1JVYA 4OETA 1QKAA 4EXLA 2VD2A 4ONYA 5I56A 2O6AA 3TQLA 3A3CA 2R71A 3U8QA 3MVWA 2HEUA 4DDDA 1A99A 4OESA 2QS3A 2O1LA 2O1MA 3G3FA 4QF9A 2OK2A 2FYIA 3JZJA 4EF1A 4KYSA 4O3CA 1VE4A 1Y4CA 5CMBA 1Y3QA 1NKXA 3IAZA 4OEUA 3G3KA 3UA8A 1HSEA 2OWTA 3H06B 3KZGA 1QW0A 3I5OA 3OSQA 1UQWA 3RT6B 2AYSA 3PMVA 4FATA 3TODA 1FQFA 2V3UA 1PEBA 4QSEA 1AIVA 2UYFA 1BP5A 1R9QA 5I84A 1ZU0A 1II5A 2ONSA 5DVFA 1FTLA 4TQUQ 2Y84A 4HCWA 2O69A 1B52A 1FQBA 4R2BA 3K4UA 2H99A 1Q35A 3MP1A 3H6VA 5I2NA 4TLMB 2XXHA 2F97A 5IKBA 2F7AA 1M5FA 1OIBA 3PUYE 4X1BA 4OXVA 3O6HA 4PQJA 4GFRA 2CZLA 3GXAA 1AMFA 3KN7A 4JSOA 4RJZA 3MVYA 2B3BA 3O2AA 4DCYA 2GHBA 4N6PA 5ITPA 4NF6A 2RF1A 4R9FA 4YZZA 4YMAA 1B51A 2UVIA 2X7PA 1US5A 3CFXA 2A5TB 1Y1MA 5KDTB 1QKBA 1B3HA 4LZ7A 4OVJA 2G93A 3O28A 4PFTA 4GD5A 3U1OA 3ZS6A 1DOTA 1MXXA 4GIZA 1KWHA 1B4ZA 1H45A 3DP8A 1P1UA 4TOZA 3UORA 2FA7A 3VDFA 3W9WA 4AB5A 2Q2AA 3DELB 3IR1A 5AA4B 4O3AA 4GWOA 3FUZA 2LAOA 4XKNA 1B32A 1Y3NA 2ZNSA 1IQ7A 4F29A 3BKIB 4DZ1A 4GXAA 3TCHA 3I6VA 5I2KB 5I57B 4U1ZA 3G3GA 2HZKA 3TUSA 1TFDA 3OSRA 4PFYA 4X48A 1H43A 1N3WA 3KGCA 1WVJA 3R6UA 5HPQA 4F2QA 3SETA 3PD8A 4NE4A 3QYTA 4QFNA 4U23A 3MZ1A 3H6UA 1T0KA 2OLBA 1R1NA 3K6XA 1H76A 1UIVA 4JB7A 4YB5A 3QUFA 2H9BA 4QFOA 3K1NA 1JVXA 2E0SA 3OOAA 3MJNA 1USYH 3FVNA 4XIGQ 2XXWA 2D21A 1US4A 4KI0E 4E0WA 4DIGA 2HXWA 5H8FB 5IAIA 3R7XA 2O84X 4KCCA 3H4ZA 3HPIA 1B7ZA 2Z8DA 2V3QA 4NF8B 4L17A 4RNSA 1NNPA 4OYVA 3BFUA 1NNTA 2YPNA 4LATA 2RKMA 3KJTA 2I58A 3RT8A 2V84A 3TCFA 3T9VA 5DTBA 1OMPA 2XXUA 2Y7PA 2XXQA 3V8XB 4YU0A 3C32A 2P1SA 3ZKKA 1FCKA 3OO6A 1SW1A 3VE1B 2Y7KA 5EHSA 3DLNA 3MPKA 4JSDA 2I3WA 4P0GA 2HAVA 4DXCA 4BDLA 3DP6A 1Y9UA 4GQOA 2I48A 1B6HA 5K2XA 1P1NA 4FE8A 3OENA 1D4NA 1GGGA 3IB0A 4GVOA 2I4CA 4OZ9A 2Z23A 4G8MA 4ZEKA 5DVJA 2RINA 1SBPA 3FJMA 3KSXA 3CRBA 1OVTA 2O68A 2ESNA 2PMSA 2XX7A 3MP6A 4XKQA 1LLSA 2F7BA 2ONRA 1YPNA 3V5AA 1M5DA 4OWDA 3N6TA 1A54A 1B1XA 4R2FA 4M1VA 3IOUA 1Y1ZA 3IK6B 1S50A 4O3BA 3S9NC 3SEWA 2Y7RA 3FJ7A 3C34A 4NF4B 3S9EA 1NMUA 1URSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2I3V A;  3TZA A;  1ZIU A;  5H8N B;  4G2Z A;  4IO3 A;  4EQ7 A;  3TTM A;  4U1O A;  3O9P A;  3LSL A;  4BDQ A;  3RTW B;  3FVO A;  4BDO A;  2V25 A;  4ESX A;  1YTV A;  3SEX A;  3IB2 A;  2YJP A;  4ELP A;  5EHM A;  1I6Q A;  4ZEB A;  4DCX A;  5DT6 A;  3SER A;  5DVI A;  2AL4 A;  2VOZ A;  3G7W A;  4F19 A;  4MBP A;  2Z8E A;  1ZTY A;  1B7H A;  4NED A;  4KR5 A;  5JEI A;  3IJX B;  3USD A;  5A5X A;  5AA2 A;  1PDA A;  3TAJ A;  1EZP A;  1LAG E;  4THI A;  3TTK A;  4GL8 A;  4H8I A;  1Y4T A;  4AQ4 A;  3KN8 A;  3VXB A;  4H5G A;  1B0H A;  1B5I A;  4YKI A;  3FV1 A;  4I9D A;  1Z7M E;  5TU0 A;  4BLA A;  4XTC Q;  1IIW A;  2XXP A;  2W7Y A;  5CRY A;  5CI5 A;  3MVZ A;  2Y7I A;  1LBB A;  1XHY A;  3VXC A;  3LSF B;  1MY2 A;  1FQD A;  4U2R A;  3N94 A;  1MDQ A;  4YKP A;  1F9B A;  3KOT A;  1EH3 A;  3MW0 A;  4F3G A;  2R9J A;  3IX1 A;  4Q0C A;  5L9S A;  3FVK A;  3C31 A;  4OHN A;  3IO4 A;  1VSO A;  3OEK A;  4YAH X;  5I59 B;  3ZSF A;  1B9J A;  4LUB A;  1LB8 A;  2XXR A;  2X26 A;  3G3J A;  3UIF A;  2ZYM A;  4GRK A;  2F34 A;  1B5J A;  1MQJ A;  2XXI A;  3GBB A;  1SD3 A;  3VLV A;  4M4G A;  3ILT B;  3LC8 A;  2X7Q A;  3EHT A;  5KCJ B;  4Z0I A;  3EPE A;  3VVE A;  2B3F A;  1BIY A;  4WXJ A;  2PT1 A;  3PU5 A;  1UTB B;  1MM7 A;  3A3U A;  5AA3 A;  2UXA A;  1MPD A;  4I8C A;  3THI A;  3PUX E;  3QXM A;  3KEI A;  1Y20 A;  1N0T A;  3KSJ A;  2ONK E;  3K1P A;  1J1N A;  3IJO B;  1SQY A;  3SES A;  1R6Z A;  1TWY A;  1B46 A;  1XVX A;  3O97 A;  3OD7 A;  3PPQ A;  4ZEF A;  1IXH A;  2I0C A;  3M3K A;  4R75 A;  4P11 A;  2CMO A;  1TFA A;  4Q30 B;  4LQ5 A;  1AH5 A;  1Q1K A;  3RLF E;  1MY3 A;  1NH7 A;  4IY6 A;  2PYY A;  4RPN A;  1JW1 A;  3B6Q A;  1QUI A;  4ZEI A;  1B4H A;  2QS4 A;  3PUW E;  1JET A;  3HV1 A;  4NWD A;  4NF5 A;  2DWA A;  1MXV A;  3C36 A;  2NXO A;  1B3G A;  4OTE A;  4ZED A;  1MH3 A;  3ECR A;  4R72 A;  3TYH A;  1MM6 A;  2DE2 A;  5I58 B;  4E0X A;  4G77 A;  1PB9 A;  3T9U A;  2RC9 A;  4G68 A;  4F18 A;  5BWJ A;  2PVU A;  2VP1 A;  5TP9 A;  1NNF A;  2RCA A;  2F36 A;  1N7X A;  3T22 A;  3L6G A;  1FQC A;  1Y3P A;  2IA4 A;  1P1W A;  5TPA A;  2QJE A;  3QSL A;  1QJM A;  4G8N A;  1S9T A;  1UTH B;  4F2O A;  1ZMG A;  4FED A;  5CMM A;  1JW5 A;  4PE5 B;  4FEB A;  2DE3 A;  1TXF A;  3O66 A;  3T96 B;  1HSL A;  4F1U A;  5I56 B;  3OO8 A;  2HZL A;  2I4B A;  1WDN A;  5H8Q A;  3G3I A;  3IOT A;  3S2V A;  3BFT A;  1MY4 A;  3RNN A;  2DVC A;  2F6G A;  3IOV A;  3MC2 A;  1LAX A;  2ZYK A;  1OLC A;  2HQ0 A;  4JXI A;  1URG A;  1N76 A;  2VD3 A;  2RCB A;  3TTR A;  2H4I A;  2XD3 A;  3E9X A;  4KD5 A;  4YMB A;  1FTJ A;  4F31 B;  3C33 A;  3Q29 A;  3U72 A;  4GF8 A;  1FTO A;  2D3I A;  4FEC A;  1NH8 A;  4IGT A;  3V83 A;  3QUJ A;  1UIU A;  3T9H B;  5DEX A;  5CBR A;  1MXW A;  4F3P A;  4G8H A;  3IOW A;  3FGS A;  1FQE A;  4FAJ A;  1XVY A;  4JWO A;  1MPC A;  3MUQ A;  1MQD A;  1IXG A;  4MH5 A;  4ZZA A;  2Q88 A;  1SI0 A;  2THI A;  4RXL A;  2AL5 A;  3EQ1 A;  2REJ A;  2G29 A;  3ONM A;  2DYX A;  1RYO A;  4EUO A;  3TEL A;  5M2V A;  1MRP A;  4FIM A;  3SEV A;  4RK9 A;  2NWJ A;  4U21 A;  2E1S A;  3UK4 A;  1B3F A;  1OLA A;  3KBR A;  2XXX A;  4EDP A;  3FJG A;  4I62 A;  1LFH A;  1L5T A;  3T93 B;  1SYI A;  1POT A;  5I2N B;  4UA8 A;  2UVH A;  4BDM A;  4TLL B;  4YB7 A;  2NOO A;  3Q28 A;  1H3D A;  4U4S A;  2F6P A;  3B7D A;  4QFL A;  1GVC A;  1N04 A;  2PBW A;  3CG1 A;  3LSX A;  4ZS9 A;  1SYH A;  3HCQ A;  5FHO A;  4F3S A;  1FTM A;  4HCY A;  5L9O A;  3V89 B;  5JTY A;  4NF6 B;  5EYF A;  2P0S A;  4MFI A;  2A5S A;  3MP8 A;  1XS5 A;  1B05 A;  2DWJ A;  3GZG A;  2GH9 A;  2Q8J A;  3FV2 A;  4HS7 A;  3VVD A;  4IO2 A;  5CM6 A;  4QRZ A;  2ZYO A;  2ZXT A;  4Q5T A;  3UP9 A;  1ZBM A;  2NUV A;  4IO7 A;  1EZ9 A;  1MQH A;  4ELR A;  3K2D A;  4EQ9 A;  1IXC A;  2Q89 A;  3FZV A;  2H98 A;  4DLD A;  5AA1 A;  1OQG A;  1PBQ A;  4MLV A;  3IOR A;  3PPP A;  4YB6 A;  1SW2 A;  3JYR A;  1A8E A;  3HN0 A;  4PET A;  4RA1 A;  2XXY A;  3MZ9 A;  4IY5 A;  1AL3 A;  1LST A;  3Q27 A;  1PC3 A;  1DSN A;  1B3L A;  5L8D A;  1LFG A;  5F7V A;  3K00 A;  2I49 A;  3K02 A;  2HCA A;  1FQA A;  4DXU A;  1MQI A;  1B40 A;  1HSJ A;  1CE2 A;  2QPQ A;  1JEU A;  2Z8F A;  4F1Y A;  3EHS A;  3D4C A;  3MQ9 A;  4G68 C;  1QUK A;  1H44 A;  1MDP 1;  4N13 A;  1MXZ A;  4H6D A;  2QL3 A;  1QUL A;  3TDJ A;  4GL0 A;  3LR1 A;  4NTL A;  1B0L A;  3SDF A;  3PMW A;  4QHQ A;  3HO7 A;  5AA2 D;  3MZB A;  4POW A;  4DE8 A;  1ZLQ A;  4I1D A;  1XC1 A;  4ZE9 A;  4H67 A;  4WED A;  2DVZ A;  2DXY A;  5J1D A;  4H5F A;  1O64 A;  1S7Y A;  4PFU A;  3W15 C;  3ILU B;  3LUY A;  3UGW A;  4ESW A;  2Q9T A;  4AB6 A;  1GR2 A;  3F11 A;  4ZDM A;  3FXR A;  4BDN A;  3WAE A;  3PPO A;  3QAX A;  3S9M C;  3TMG A;  2R6G E;  3H7M A;  3RY3 A;  1LGB C;  3QIM A;  1VFE A;  1TT1 A;  3HHG A;  1B5H A;  1JW4 A;  4KQP A;  4OEV A;  2A5T A;  1I6A A;  4X1D A;  3B6W A;  1RYX A;  1OQH A;  5CMC A;  4KYE A;  2B65 A;  3Q26 A;  3N5L A;  2F78 A;  2OWS A;  4PFW A;  3S4U A;  2QMX A;  2ZNT A;  4R9G A;  3H6T A;  1NFT A;  4RPO A;  2GHA A;  1DPP A;  4PP0 A;  1D9V A;  3W9V A;  4R6H A;  5AE4 A;  1JEV A;  3TFL A;  2HFB A;  5ICT A;  5AA4 A;  3TPA A;  2F35 A;  1ANF A;  1M5B A;  5F1Q A;  3K6W A;  1A40 A;  1JQF A;  2DQV A;  2ZYN A;  1BTJ A;  3TTL A;  3RPW A;  5I2K A;  5I57 A;  1B58 A;  2O7I A;  5HBC A;  4KHZ E;  3PV0 E;  5ISU A;  3CSB A;  3I3V A;  1ZJL A;  1O63 A;  1OVB A;  3RQT A;  5HM4 B;  3FXQ A;  3FXU A;  2BJJ X;  3PPR A;  4RY1 A;  2GFE A;  1B1H A;  1EU8 A;  1SDX A;  1NNK A;  2QS1 A;  4H1X A;  4LQ2 A;  4IO5 A;  4ISU A;  1D3K A;  4POX A;  1MXU A;  3IL1 B;  4LVQ A;  1WOD A;  4ZZE A;  1ATG A;  2XD2 A;  2UYE A;  2DWH A;  4MF3 A;  2DOJ A;  4IGR A;  1MG1 A;  1FW0 A;  5H8F A;  1DTZ A;  1P1Q A;  4ZE8 A;  5K2Y A;  4R6Y A;  3O6G A;  3OO9 A;  3TKD A;  3CFZ A;  3VFJ A;  3D4G A;  1AOV A;  3N26 A;  4NF8 A;  1N84 A;  3T66 A;  3PD9 A;  2XX9 A;  1O7T A;  1A55 A;  1IIT A;  4U22 A;  3RUM A;  4R6K A;  5B70 A;  1CB6 A;  2XXV A;  3PGF A;  1PB7 A;  1I69 A;  3TEP A;  3TCG A;  3B6T A;  5A5X B;  5AA2 B;  3M3F A;  3A09 A;  1M5C A;  3E3K A;  3UN6 A;  2F5X A;  3CFL A;  4KPT A;  5ITO A;  3C9H A;  3PUZ E;  2I6E A;  4ELQ A;  3CIJ A;  1N7W A;  3TTN A;  5L9M A;  2P2A A;  2H5Y A;  5CMK A;  1LAH E;  4IB2 A;  4GOT A;  5BUU A;  3T9X B;  2OBG A;  2VHA A;  1LB9 A;  4H65 A;  3CSG A;  1MQG A;  3KFM A;  3DM0 A;  2Q2C A;  2DE4 A;  3PUV E;  4YKJ A;  5H8S A;  4RK2 A;  4F39 A;  1LBC A;  1QVS A;  2H25 A;  4LZ5 A;  4QFP A;  4P0I A;  3HST A;  3AXF A;  2ABH A;  3GLB A;  1BLF A;  1B7U A;  2OZZ A;  2VGQ A;  5DYH A;  4KFQ A;  1P99 A;  3K6V A;  2I0B A;  4LON B;  1USY E;  3SKP A;  4OFO A;  3JV9 A;  1Z7N E;  3R26 A;  4F22 A;  2DXR A;  2WKY A;  3U94 A;  3GBA A;  3PPN A;  4LZ8 A;  1M5E A;  3C4M A;  4NF4 A;  1ZKB A;  4LA9 A;  5H8N A;  3CR9 A;  3LBS A;  1IUD A;  1VR5 A;  3BBR A;  1A7L A;  4YIC A;  1QUJ A;  1FTK A;  3CG3 A;  4OMB A;  1B3E A;  2RC8 A;  3FD3 A;  2OJT A;  3N6U A;  3WAF A;  3LSW A;  3E13 X;  3L6H A;  3FIR A;  3M8U A;  2ZNU A;  3H3G A;  4XXU A;  5ICQ A;  4OFL A;  4JWX A;  3KJ7 A;  1ELJ A;  4F1V A;  2UVG A;  3FAT A;  4HTG A;  2RC7 A;  1XT8 A;  2QSX A;  3G3H A;  3RN8 A;  2FNC A;  1BKA A;  1DMB A;  3VV5 A;  4BDR A;  4JDF A;  4ELO A;  1YCJ A;  2GRV A;  4H8J A;  3MBP A;  4HW8 A;  2REG A;  3H6W A;  4H0W A;  3OEM A;  3RTF B;  4XKR A;  1LFI A;  5FTI A;  4R74 A;  2XX8 A;  3M3L A;  1MH4 A;  1MPB A;  2YLN A;  3SEU A;  3MPL A;  2ALU A;  3O6I A;  5FTH A;  4FJP A;  3SEY A;  2M8C A;  2ZMB A;  2V3T A;  4NF5 B;  5H8H A;  2XXT A;  3K01 A;  2Y7W A;  1YAE A;  1IXI A;  2F7C A;  3P7I A;  4EF2 A;  4R73 A;  3OEL A;  3OMB A;  4Q8R A;  4IO4 A;  3E4R A;  4G68 B;  1MXY A;  3S9L C;  4G4P A;  3FVG A;  3VVF A;  3KG2 A;  5TP9 B;  4C1T A;  1NL5 A;  1P1O A;  1I6B A;  5TPA B;  2XHD A;  1JNF A;  1A8F A;  4UAC A;  3MVX A;  5FHN A;  1DPE A;  4FOR A;  5I59 A;  1POY 1;  4NWC A;  2PX1 A;  4OFJ A;  5ELV A;  3VLW A;  1GTK A;  4GXS B;  3H03 A;  5LOM A;  5FHM A;  2DP8 A;  3EHU A;  2O51 A;  4Z7E A;  3OO7 A;  2O7U A;  5H8Q B;  3ODB A;  4QSD A;  3CI8 A;  3TQW A;  2OCU A;  1IEJ A;  3RGY A;  2F8D A;  1DTG A;  1LAF E;  3K1M A;  5JK4 A;  4KYD A;  4QSC A;  4U4X A;  1MY1 A;  5KCJ A;  4F3B A;  2AIX A;  1GV8 A;  3MWB A;  4YKK A;  2UVJ A;  3DP4 A;  4EQB A;  3KOS A;  1UTB A;  3Q25 A;  2QMW A;  1MY0 A;  4C1U A;  2NVU B;  5DEX B;  5CC2 A;  3C35 A;  1RKM A;  3IB1 A;  4GLI A;  3QK6 A;  2D5W A;  4ECF A;  3MAM A;  4ND9 A;  3O29 A;  5B7D A;  1MS7 A;  4XKP A;  2V93 A;  1SI1 A;  4OER A;  1LCT A;  2Z22 A;  3FAS A;  3U93 A;  1EZO A;  1PBP A;  2DSF A;  1SW5 A;  1IZ1 A;  5KZT A;  2DS9 A;  3OXN A;  2QS2 A;  2ANJ A;  4LP2 B;  1R9L A;  1SVX B;  3KN3 A;  3HHF A;  4ZEC A;  4KCD A;  2HAU A;  4DXB A;  3PMX A;  1D9Y A;  3EF7 A;  4EXK A;  4NMY A;  5I58 A;  4K3F A;  1LCF A;  5CBS A;  3VLU A;  4N07 A;  3U92 A;  2KLF A;  4OQO A;  2DWI A;  1PB8 A;  2QRY A;  4MLQ A;  2PT2 A;  5H8H B;  4IO6 A;  4C0R A;  4JBZ A;  1XOC A;  2IEE A;  5KDT A;  3K0V A;  1URD A;  3CVG A;  4WEP A;  1SW4 A;  3IO6 A;  4WKM A;  4QFK A;  4X9T A;  3ZKL A;  3EN3 A;  5JTY B;  1UTH A;  3K6U A;  4JWY A;  4RYA A;  1B2H A;  1N3X A;  1VFD A;  4OEN A;  1JVY A;  4OET A;  1QKA A;  4EXL A;  2VD2 A;  4ONY A;  5I56 A;  2O6A A;  3TQL A;  3A3C A;  2R71 A;  3U8Q A;  3MVW A;  2HEU A;  4DDD A;  1A99 A;  4OES A;  2QS3 A;  2O1L A;  2O1M A;  3G3F A;  4QF9 A;  2OK2 A;  2FYI A;  3JZJ A;  4EF1 A;  4KYS A;  4O3C A;  1VE4 A;  1Y4C A;  5CMB A;  1Y3Q A;  1NKX A;  3IAZ A;  4OEU A;  3G3K A;  3UA8 A;  1HSE A;  2OWT A;  3H06 B;  3KZG A;  1QW0 A;  3I5O A;  3OSQ A;  1UQW A;  3RT6 B;  2AYS A;  3PMV A;  4FAT A;  3TOD A;  1FQF A;  2V3U A;  1PEB A;  4QSE A;  1AIV A;  2UYF A;  1BP5 A;  1R9Q A;  5I84 A;  1ZU0 A;  1II5 A;  2ONS A;  5DVF A;  1FTL A;  4TQU Q;  2Y84 A;  4HCW A;  2O69 A;  1B52 A;  1FQB A;  4R2B A;  3K4U A;  2H99 A;  1Q35 A;  3MP1 A;  3H6V A;  5I2N A;  4TLM B;  2XXH A;  2F97 A;  5IKB A;  2F7A A;  1M5F A;  1OIB A;  3PUY E;  4X1B A;  4OXV A;  3O6H A;  4PQJ A;  4GFR A;  2CZL A;  3GXA A;  1AMF A;  3KN7 A;  4JSO A;  4RJZ A;  3MVY A;  2B3B A;  3O2A A;  4DCY A;  2GHB A;  4N6P A;  5ITP A;  4NF6 A;  2RF1 A;  4R9F A;  4YZZ A;  4YMA A;  1B51 A;  2UVI A;  2X7P A;  1US5 A;  3CFX A;  2A5T B;  1Y1M A;  5KDT B;  1QKB A;  1B3H A;  4LZ7 A;  4OVJ A;  2G93 A;  3O28 A;  4PFT A;  4GD5 A;  3U1O A;  3ZS6 A;  1DOT A;  1MXX A;  4GIZ A;  1KWH A;  1B4Z A;  1H45 A;  3DP8 A;  1P1U A;  4TOZ A;  3UOR A;  2FA7 A;  3VDF A;  3W9W A;  4AB5 A;  2Q2A A;  3DEL B;  3IR1 A;  5AA4 B;  4O3A A;  4GWO A;  3FUZ A;  2LAO A;  4XKN A;  1B32 A;  1Y3N A;  2ZNS A;  1IQ7 A;  4F29 A;  3BKI B;  4DZ1 A;  4GXA A;  3TCH A;  3I6V A;  5I2K B;  5I57 B;  4U1Z A;  3G3G A;  2HZK A;  3TUS A;  1TFD A;  3OSR A;  4PFY A;  4X48 A;  1H43 A;  1N3W A;  3KGC A;  1WVJ A;  3R6U A;  5HPQ A;  4F2Q A;  3SET A;  3PD8 A;  4NE4 A;  3QYT A;  4QFN A;  4U23 A;  3MZ1 A;  3H6U A;  1T0K A;  2OLB A;  1R1N A;  3K6X A;  1H76 A;  1UIV A;  4JB7 A;  4YB5 A;  3QUF A;  2H9B A;  4QFO A;  3K1N A;  1JVX A;  2E0S A;  3OOA A;  3MJN A;  1USY H;  3FVN A;  4XIG Q;  2XXW A;  2D21 A;  1US4 A;  4KI0 E;  4E0W A;  4DIG A;  2HXW A;  5H8F B;  5IAI A;  3R7X A;  2O84 X;  4KCC A;  3H4Z A;  3HPI A;  1B7Z A;  2Z8D A;  2V3Q A;  4NF8 B;  4L17 A;  4RNS A;  1NNP A;  4OYV A;  3BFU A;  1NNT A;  2YPN A;  4LAT A;  2RKM A;  3KJT A;  2I58 A;  3RT8 A;  2V84 A;  3TCF A;  3T9V A;  5DTB A;  1OMP A;  2XXU A;  2Y7P A;  2XXQ A;  3V8X B;  4YU0 A;  3C32 A;  2P1S A;  3ZKK A;  1FCK A;  3OO6 A;  1SW1 A;  3VE1 B;  2Y7K A;  5EHS A;  3DLN A;  3MPK A;  4JSD A;  2I3W A;  4P0G A;  2HAV A;  4DXC A;  4BDL A;  3DP6 A;  1Y9U A;  4GQO A;  2I48 A;  1B6H A;  5K2X A;  1P1N A;  4FE8 A;  3OEN A;  1D4N A;  1GGG A;  3IB0 A;  4GVO A;  2I4C A;  4OZ9 A;  2Z23 A;  4G8M A;  4ZEK A;  5DVJ A;  2RIN A;  1SBP A;  3FJM A;  3KSX A;  3CRB A;  1OVT A;  2O68 A;  2ESN A;  2PMS A;  2XX7 A;  3MP6 A;  4XKQ A;  1LLS A;  2F7B A;  2ONR A;  1YPN A;  3V5A A;  1M5D A;  4OWD A;  3N6T A;  1A54 A;  1B1X A;  4R2F A;  4M1V A;  3IOU A;  1Y1Z A;  3IK6 B;  1S50 A;  4O3B A;  3S9N C;  3SEW A;  2Y7R A;  3FJ7 A;  3C34 A;  4NF4 B;  3S9E A;  1NMU A;  1URS A; 
#chains in the Genus database with same CATH topology
 2I3V A;  3TZA A;  1ZIU A;  5H8N B;  4G2Z A;  4IO3 A;  4EQ7 A;  3TTM A;  2FBP A;  5I3S A;  2CZK A;  4U1O A;  3O9P A;  3LSL A;  5ET6 A;  4NN3 A;  4BDQ A;  3RTW B;  3FVO A;  4P1E A;  4BDO A;  2Q8M A;  2V25 A;  4ESX A;  1YTV A;  3SEX A;  3IB2 A;  2YJP A;  4ELP A;  5EHM A;  1I6Q A;  4ZEB A;  4DCX A;  5DT6 A;  3SER A;  4H45 A;  2XWO A;  5DVI A;  2AL4 A;  2VOZ A;  3G7W A;  4F19 A;  4O8M A;  4MBP A;  2Z8E A;  1ZTY A;  1B7H A;  4NED A;  4KR5 A;  5JEI A;  3IJX B;  3USD A;  5A5X A;  5AA2 A;  1PDA A;  2WYK A;  3TAJ A;  1EZP A;  1LAG E;  4GWU A;  4THI A;  3TTK A;  4GL8 A;  4H8I A;  1Y4T A;  4AQ4 A;  3KN8 A;  3VXB A;  1FJ9 A;  4H5G A;  1B0H A;  1B5I A;  4YKI A;  5ESY A;  3FV1 A;  4I9D A;  1Z7M E;  5TU0 A;  4BLA A;  4XTC Q;  1IIW A;  2XXP A;  2W7Y A;  5CRY A;  5F24 A;  5CI5 A;  2JJK A;  2Y7I A;  3MVZ A;  1LBB A;  1XHY A;  3VXC A;  3LSF B;  1MY2 A;  1FQD A;  2Y5L A;  4U2R A;  3N94 A;  1MDQ A;  4YKP A;  1F9B A;  3KOT A;  4N17 A;  1EH3 A;  3MW0 A;  4F3G A;  4PBH A;  2R9J A;  2VPO A;  3IX1 A;  4Q0C A;  5L9S A;  3FVK A;  3C31 A;  4OHN A;  3IO4 A;  1VSO A;  4XF5 A;  3OEK A;  4YAH X;  5I59 B;  3ZSF A;  1B9J A;  4LUB A;  1LB8 A;  2XXR A;  2X26 A;  3G3J A;  3UIF A;  2ZYM A;  3IFC A;  5FBP A;  4GRK A;  2F34 A;  1B5J A;  1MQJ A;  2XXI A;  3GBB A;  1EYJ A;  4X8R A;  1SD3 A;  3VLV A;  4O7M A;  1SPI A;  4M4G A;  1JP4 A;  3ILT B;  3LC8 A;  2X7Q A;  3EHT A;  3D1R A;  5KCJ B;  4Z0I A;  3EPE A;  3VVE A;  2B3F A;  1LEV A;  1BIY A;  2XWK A;  4WXJ A;  2PT1 A;  3PU5 A;  1UTB B;  1MM7 A;  3A3U A;  5AA3 A;  2UXA A;  1MPD A;  4I8C A;  3THI A;  3PUX E;  3QXM A;  3KEI A;  1Y20 A;  1N0T A;  4PAI A;  3KSJ A;  2ONK E;  3K1P A;  1J1N A;  3IJO B;  1SQY A;  3SES A;  1R6Z A;  1TWY A;  1B46 A;  1XVX A;  3O97 A;  3OD7 A;  3PPQ A;  4ZEF A;  1FPE A;  1IXH A;  2I0C A;  3M3K A;  3MYU A;  4R75 A;  4P11 A;  2CMO A;  1TFA A;  1EYI A;  4Q30 B;  2WBB A;  4LQ5 A;  1AH5 A;  1Q1K A;  4N81 A;  3RLF E;  1MY3 A;  1NH7 A;  4IY6 A;  4PAK A;  2PYY A;  4RPN A;  1JW1 A;  3B6Q A;  1QUI A;  4ZEI A;  1B4H A;  5T3J A;  2QS4 A;  3PUW E;  2F3B A;  1JET A;  3HV1 A;  4NWD A;  4NF5 A;  2XA5 A;  2DWA A;  1MXV A;  3C36 A;  2HXR A;  2NXO A;  1B3G A;  4OTE A;  4ZED A;  1MH3 A;  3ECR A;  4R72 A;  1MM6 A;  3TYH A;  2DE2 A;  5I58 B;  4E0X A;  4G77 A;  1FBH A;  1PB9 A;  3T9U A;  2RC9 A;  4G68 A;  4F18 A;  5BWJ A;  1DK4 A;  2PVU A;  2VP1 A;  5TP9 A;  1NNF A;  2RCA A;  3MST A;  2F36 A;  1N7X A;  3T22 A;  3L6G A;  1FQC A;  1Y3P A;  4FBP A;  2IA4 A;  1P1W A;  5TPA A;  2QJE A;  1FPK A;  3QSL A;  1QJM A;  2WBD A;  4G8N A;  1S9T A;  1UTH B;  4F2O A;  1ZMG A;  4JVC A;  4N8G A;  4FED A;  4P1L A;  5CMM A;  1JW5 A;  4PE5 B;  4FEB A;  2DE3 A;  1TXF A;  3O66 A;  3T96 B;  4PCD A;  1HSL A;  4F1U A;  4N6D A;  5I56 B;  3OO8 A;  2HZL A;  2I4B A;  4N91 A;  1WDN A;  5H8Q A;  3G3I A;  3IOT A;  2CZH A;  3S2V A;  3BFT A;  1MY4 A;  3RNN A;  2DVC A;  2F6G A;  4P56 A;  3IOV A;  3MC2 A;  1LAX A;  2ZYK A;  4MX6 A;  1OLC A;  2HQ0 A;  4JXI A;  1URG A;  1N76 A;  2VD3 A;  2RCB A;  3TTR A;  4P47 A;  2H4I A;  2XD3 A;  3E9X A;  4KD5 A;  4YMB A;  1FTJ A;  1NUZ A;  3C33 A;  4F31 B;  3Q29 A;  3U72 A;  4GF8 A;  1FTO A;  3RPL B;  2D3I A;  4FEC A;  5ET5 A;  1NH8 A;  4IGT A;  3V83 A;  3QUJ A;  4GWW A;  1UIU A;  3T9H B;  5DEX A;  4OVT A;  5CBR A;  1MXW A;  2VPN A;  4F3P A;  4G8H A;  4OAN A;  1KZ8 A;  3IOW A;  3FGS A;  5EQ9 A;  1FQE A;  4FAJ A;  1XVY A;  4JWO A;  1MPC A;  3T0J A;  3LUZ A;  3MUQ A;  1MQD A;  1IXG A;  4MH5 A;  4ZZA A;  2Q88 A;  1SI0 A;  2THI A;  4RXL A;  2AL5 A;  3EQ1 A;  2REJ A;  2G29 A;  3ONM A;  5EQ8 A;  2DYX A;  4MHF A;  1RYO A;  4N8Y A;  4EUO A;  3TEL A;  5M2V A;  1MRP A;  4FIM A;  1D9Q A;  3ISP A;  3SEV A;  4RK9 A;  2NWJ A;  4U21 A;  5IZ3 A;  2E1S A;  3UK4 A;  1B3F A;  1OLA A;  3KBR A;  2XXX A;  4EDP A;  3FJG A;  4I62 A;  1LFH A;  1L5T A;  3T93 B;  4NF0 A;  4PF8 A;  1SYI A;  4GX3 A;  1POT A;  5LDZ A;  5I2N B;  4UA8 A;  2UVH A;  1FBF A;  4BDM A;  4TLL B;  4YB7 A;  2NOO A;  4GWX A;  3Q28 A;  1H3D A;  4P9K A;  2F6P A;  4U4S A;  3B7D A;  4QFL A;  1GVC A;  1N04 A;  2PBW A;  4GWY A;  3CG1 A;  3LSX A;  4ZS9 A;  1SYH A;  3HCQ A;  5FHO A;  4JVI A;  4F3S A;  1FTM A;  4HCY A;  5L9O A;  3V89 B;  5JTY A;  4NHB A;  2OX3 A;  4NF6 B;  5EYF A;  2P0S A;  4MFI A;  2A5S A;  3MP8 A;  1XS5 A;  1B05 A;  2DWJ A;  3GZG A;  1YZ0 A;  2GH9 A;  2Q8J A;  3FV2 A;  4HS7 A;  1DBZ A;  3VVD A;  4IO2 A;  1LBW A;  4NG7 A;  1FPD A;  4JVD A;  1NV3 A;  5CM6 A;  1LBX A;  4QRZ A;  2ZYO A;  2ZXT A;  4Q5T A;  3UP9 A;  1ZBM A;  2NUV A;  4IO7 A;  1EZ9 A;  1MQH A;  4ELR A;  3K2D A;  4EQ9 A;  1IXC A;  2Q89 A;  3FZV A;  2H98 A;  4DLD A;  5AA1 A;  1NV4 A;  1OQG A;  1PBQ A;  4MLV A;  2FVZ A;  2VT5 A;  3IOR A;  3PPP A;  4YB6 A;  3GYY A;  1SW2 A;  3JYR A;  1A8E A;  3HN0 A;  4PET A;  4RA1 A;  2XXY A;  3MZ9 A;  4IY5 A;  1AL3 A;  1LST A;  3Q27 A;  1PC3 A;  1DSN A;  1B3L A;  5L8D A;  1LFG A;  5F7V A;  3K00 A;  2PCR A;  5IZZ A;  4HE2 A;  2I49 A;  3K02 A;  2HCA A;  1FQA A;  4DXU A;  1MQI A;  1B40 A;  1HSJ A;  1CE2 A;  2QPQ A;  1JEU A;  2Z8F A;  4F1Y A;  3EHS A;  3D4C A;  3MQ9 A;  1G0H A;  4N6K A;  4G68 C;  2ZZX A;  1QUK A;  1H44 A;  1LBZ A;  1MDP 1;  4N13 A;  1MXZ A;  4H6D A;  2QL3 A;  1QUL A;  3TDJ A;  4GL0 A;  3LR1 A;  4NTL A;  1B0L A;  3SDF A;  3PMW A;  4QHQ A;  3HO7 A;  2BJI A;  3MZB A;  5AA2 D;  4POW A;  2PFY A;  4DE8 A;  1ZLQ A;  4I1D A;  3FXB A;  1XC1 A;  4ZE9 A;  4H67 A;  4WED A;  2DVZ A;  2DXY A;  5J1D A;  4H5F A;  1O64 A;  1S7Y A;  5J16 A;  4PFU A;  3W15 C;  4XEQ A;  3ILU B;  3LUY A;  4NX1 A;  3UGW A;  4ESW A;  2Q9T A;  4AB6 A;  1GR2 A;  3F11 A;  5ET7 A;  4ZDM A;  3FXR A;  4BDN A;  3WAE A;  3PPO A;  3QAX A;  3S9M C;  3TMG A;  2R6G E;  3H7M A;  3RY3 A;  1LGB C;  3QIM A;  1VFE A;  1TT1 A;  4I3Y A;  3HHG A;  1B5H A;  1JW4 A;  4KQP A;  4OEV A;  2A5T A;  1I6A A;  4X1D A;  3B6W A;  2XXK A;  1RYX A;  1OQH A;  5CMC A;  4KYE A;  2B65 A;  3Q26 A;  3N5L A;  2F78 A;  2OWS A;  4PFW A;  3S4U A;  2QMX A;  2ZNT A;  4R9G A;  3H6T A;  2Q74 A;  1NFT A;  1XI6 A;  4RPO A;  2GHA A;  1DPP A;  5I7I A;  4PP0 A;  1D9V A;  3W9V A;  4R6H A;  5AE4 A;  1JEV A;  3TFL A;  2HFB A;  5ICT A;  5AA4 A;  4PTK A;  3TPA A;  2F35 A;  1ANF A;  4PFI A;  1M5B A;  5F1Q A;  3K6W A;  3LV0 A;  1BK4 A;  4MMP A;  1A40 A;  1FPL A;  1JQF A;  2DQV A;  2ZYN A;  1NUX A;  1BTJ A;  3TTL A;  3RPW A;  5I2K A;  3U65 A;  5I57 A;  1B58 A;  2O7I A;  5HBC A;  4KHZ E;  3PV0 E;  5ISU A;  4N4U A;  3CSB A;  3I3V A;  1ZJL A;  1FBD A;  1O63 A;  5EQA A;  1OVB A;  3RQT A;  5HM4 B;  3FXQ A;  3FXU A;  2BJJ X;  3PPR A;  4RY1 A;  2GFE A;  1B1H A;  1KA1 A;  1EU8 A;  1SDX A;  1NNK A;  2QS1 A;  4H1X A;  4LQ2 A;  4IO5 A;  4ISU A;  1D3K A;  4POX A;  4I3E A;  1MXU A;  3HFU A;  3IL1 B;  1EYK A;  4LVQ A;  1WOD A;  4ZZE A;  1ATG A;  2XD2 A;  2UYE A;  2DWH A;  4MF3 A;  2DOJ A;  4IGR A;  1MG1 A;  1FW0 A;  5H8F A;  1DTZ A;  3NOH A;  1P1Q A;  4ZE8 A;  5K2Y A;  4R6Y A;  3O6G A;  3OO9 A;  3TKD A;  3CFZ A;  3VFJ A;  3D4G A;  1AOV A;  3N26 A;  4NF8 A;  1N84 A;  3T66 A;  3PD9 A;  2XX9 A;  1O7T A;  1A55 A;  1IIT A;  2ZZV A;  4U22 A;  3RUM A;  4R6K A;  5B70 A;  4QBA A;  4PFR A;  1CB6 A;  2XXV A;  3PGF A;  1PB7 A;  1I69 A;  3TEP A;  3TCG A;  3EKI A;  3B6T A;  5A5X B;  5AA2 B;  3M3F A;  3A09 A;  4P8B A;  1M5C A;  3E3K A;  3UN6 A;  2F5X A;  3CFL A;  4KPT A;  5ITO A;  3C9H A;  3PUZ E;  1NV2 A;  2I6E A;  4ELQ A;  3CIJ A;  1N7W A;  1INP A;  3TTN A;  5L9M A;  2P2A A;  2H5Y A;  5CMK A;  1LAH E;  4IB2 A;  4GOT A;  5BUU A;  3T9X B;  2OBG A;  4HXV A;  1K9Y A;  2VHA A;  1LB9 A;  4H65 A;  3CSG A;  4LN5 A;  4PE3 A;  1MQG A;  3E78 A;  5IZ1 A;  4IR8 A;  3KFM A;  3DM0 A;  2Q2C A;  2DE4 A;  3PUV E;  4YKJ A;  5H8S A;  4RK2 A;  4F39 A;  1FSA A;  1LBC A;  1QVS A;  2XWI A;  2H25 A;  4LZ5 A;  4QFP A;  4GBV A;  1FBC A;  4P0I A;  3HST A;  2FIX A;  3AXF A;  2ABH A;  3GLB A;  1BLF A;  1B7U A;  2OZZ A;  2VGQ A;  5DYH A;  4KFQ A;  1P99 A;  3K6V A;  2I0B A;  4LON B;  1USY E;  4UAB A;  1RDY A;  3SKP A;  4OFO A;  3JV9 A;  1Z7N E;  3R26 A;  1AWB A;  4F22 A;  2DXR A;  2WKY A;  3U94 A;  3GBA A;  3PPN A;  4LZ8 A;  3A29 A;  1M5E A;  3C4M A;  4NF4 A;  1ZKB A;  4LA9 A;  5H8N A;  3CR9 A;  3LBS A;  1IUD A;  1VR5 A;  2PFZ A;  3BBR A;  1A7L A;  4YIC A;  1QUJ A;  1FTK A;  3CG3 A;  4OMB A;  1B3E A;  2RC8 A;  3FD3 A;  2OJT A;  3N6U A;  3WAF A;  3LSW A;  3E13 X;  3L6H A;  3FIR A;  3M8U A;  2ZNU A;  3H3G A;  4XXU A;  5ICQ A;  4OFL A;  1KA0 A;  4JWX A;  3KJ7 A;  1FPJ A;  1ELJ A;  4F1V A;  2UVG A;  3FAT A;  4HTG A;  2RC7 A;  1XT8 A;  2QSX A;  3G3H A;  4MCO A;  3RN8 A;  2FNC A;  1BKA A;  1DMB A;  3VV5 A;  4BDR A;  4JDF A;  4ELO A;  1YCJ A;  2GRV A;  4H8J A;  4PGN A;  3MBP A;  4HW8 A;  2REG A;  3H6W A;  4H0W A;  3OEM A;  3RTF B;  4XKR A;  1LFI A;  5FTI A;  4PGP A;  4R74 A;  2XX8 A;  3M3L A;  4DI4 B;  1MH4 A;  1MPB A;  2YLN A;  3SEU A;  3MPL A;  2ALU A;  1YXI A;  3O6I A;  3IFA A;  5FTH A;  4FJP A;  3SEY A;  2HHM A;  5EYG A;  2M8C A;  2ZMB A;  2V3T A;  4NF5 B;  5H8H A;  2XXT A;  3K01 A;  2XWV A;  2Y7W A;  1YAE A;  1IXI A;  4AS5 A;  2F7C A;  3P7I A;  4EF2 A;  4R73 A;  3OEL A;  3OMB A;  4Q8R A;  2KR0 A;  4IO4 A;  1IMC A;  3E4R A;  4O94 A;  2QFL A;  4G68 B;  1MXY A;  3S9L C;  4G4P A;  3FVG A;  3VVF A;  3KG2 A;  5TP9 B;  4C1T A;  1NL5 A;  4AS4 A;  3SZP A;  1P1O A;  1I6B A;  5TPA B;  2XHD A;  1JNF A;  3ROJ A;  1A8F A;  4UAC A;  3MVX A;  2V4C A;  5FHN A;  1DPE A;  4FOR A;  5I59 A;  2FHY A;  1POY 1;  4NWC A;  2PX1 A;  4GBW A;  5IM2 A;  4OFJ A;  5ELV A;  2P3V A;  3VLW A;  1GTK A;  4GXS B;  3H03 A;  5LOM A;  5FHM A;  2DP8 A;  3EHU A;  2O51 A;  4Z7E A;  3OO7 A;  2O7U A;  5H8Q B;  3ODB A;  3QMF A;  4QSD A;  2CEX A;  3CI8 A;  3TQW A;  2OCU A;  1IEJ A;  3RGY A;  2F8D A;  1DTG A;  1LAF E;  3K1M A;  5JK4 A;  4KYD A;  4QSC A;  4U4X A;  1MY1 A;  5KCJ A;  4NAP A;  2FIE A;  4MNC A;  4F3B A;  2AIX A;  1GV8 A;  4OVP A;  3MWB A;  4YKK A;  2UVJ A;  3B8B A;  3DP4 A;  4PDH A;  4EQB A;  3T1B A;  2WX9 A;  3KOS A;  4NQ8 A;  1UTB A;  3Q25 A;  2QMW A;  2WYP A;  1MY0 A;  4C1U A;  2NVU B;  5DEX B;  4G61 A;  1QGX A;  5CC2 A;  3C35 A;  1RKM A;  3IB1 A;  4GLI A;  3QK6 A;  2D5W A;  4ECF A;  2DDK A;  3MAM A;  4MNP A;  3O29 A;  4ND9 A;  5B7D A;  1MS7 A;  4XKP A;  2V93 A;  1SI1 A;  4OER A;  1LCT A;  2Z22 A;  3FAS A;  3U93 A;  1EZO A;  1NI9 A;  1PBP A;  3FBP A;  2DSF A;  1SW5 A;  1IZ1 A;  5KZT A;  2DS9 A;  4I40 A;  3OXN A;  1FPB A;  2QS2 A;  2ANJ A;  4LP2 B;  4OA4 A;  5IZ3 B;  2B4L A;  1R9L A;  1SVX B;  3KN3 A;  3HHF A;  4ZEC A;  4PBQ A;  4KCD A;  2HAU A;  4DXB A;  3PMX A;  3CHG A;  1D9Y A;  3EF7 A;  4EXK A;  4NMY A;  5I58 A;  4K3F A;  1LCF A;  5CBS A;  3VLU A;  4N07 A;  3U92 A;  2KLF A;  4PF6 A;  4OQO A;  2DWI A;  1PB8 A;  2QRY A;  4MLQ A;  4O7I A;  2PT2 A;  4OVS A;  5H8H B;  4IO6 A;  4C0R A;  4JBZ A;  1XOC A;  2IEE A;  5KDT A;  3K0V A;  1URD A;  3CVG A;  2ZZW A;  1IMD A;  4WEP A;  1SW4 A;  3IO6 A;  1NUY A;  4WKM A;  4QFK A;  4X9T A;  3ZKL A;  3EN3 A;  5JTY B;  1UTH A;  2WEF A;  3K6U A;  4P3L A;  4JWY A;  4RYA A;  1B2H A;  1N3X A;  1VFD A;  4OEN A;  1JVY A;  4OET A;  1QKA A;  4EXL A;  2VD2 A;  4ONY A;  5I56 A;  1NV5 A;  2O6A A;  4MIJ A;  3TQL A;  3A3C A;  5EYH A;  2R71 A;  3U8Q A;  4MNI A;  3MVW A;  5ET8 A;  2HEU A;  4DDD A;  1A99 A;  4OES A;  2QS3 A;  2O1L A;  2O1M A;  3G3F A;  4QF9 A;  2OK2 A;  2FYI A;  3JZJ A;  4PDD A;  4EF1 A;  4KYS A;  4O3C A;  1VE4 A;  1Y4C A;  5CMB A;  1Y3Q A;  1NKX A;  3IAZ A;  4OEU A;  3G3K A;  3UA8 A;  4QXD A;  1HSE A;  5I5P A;  2OWT A;  3H06 B;  3KZG A;  3RPL A;  1QW0 A;  2Y5K A;  3I5O A;  2OWZ A;  3OSQ A;  1UQW A;  3RT6 B;  2AYS A;  5LTC A;  3PMV A;  1NV1 A;  2HPG A;  4FAT A;  3TOD A;  1FQF A;  2V3U A;  1IMA A;  4GX6 A;  1PEB A;  4QSE A;  1AIV A;  5DW8 A;  2UYF A;  1BP5 A;  1K9Z A;  1R9Q A;  5I84 A;  1ZU0 A;  1II5 A;  2ONS A;  4KXP A;  2QVV A;  5DVF A;  1FTL A;  4TQU Q;  5EQ7 A;  2Y84 A;  4HCW A;  2O69 A;  1B52 A;  1FQB A;  4R2B A;  3K4U A;  2H99 A;  1Q35 A;  3KC1 A;  3MP1 A;  3H6V A;  5I2N A;  4TLM B;  4PC9 A;  2XXH A;  4H46 A;  2F97 A;  5IKB A;  2F7A A;  1M5F A;  1OIB A;  3PUY E;  4X1B A;  4OXV A;  3O6H A;  4PQJ A;  4GFR A;  5A5L A;  2CZL A;  3GXA A;  4XFE A;  1AMF A;  2MKZ A;  3KN7 A;  4JSO A;  4RJZ A;  3MVY A;  2B4M A;  3RYD A;  2B3B A;  3O2A A;  1FPG A;  4DCY A;  2GHB A;  4HE0 A;  4N6P A;  5ITP A;  4NF6 A;  2RF1 A;  4R9F A;  4YZZ A;  4YMA A;  1B51 A;  2UVI A;  2X7P A;  1US5 A;  3CFX A;  1CNQ A;  3E79 A;  2A5T B;  2GQ1 A;  1Y1M A;  5KDT B;  4X04 A;  1QKB A;  1B3H A;  4LZ7 A;  4OVJ A;  2R8T A;  2G93 A;  3O28 A;  4PFT A;  2CEY A;  4GD5 A;  3U1O A;  3ZS6 A;  1FPI A;  1DOT A;  1MXX A;  4GIZ A;  1KWH A;  1B4Z A;  1H45 A;  3DP8 A;  1FJ6 A;  1P1U A;  1G0I A;  4TOZ A;  3UOR A;  2FA7 A;  2QVR A;  3VDF A;  3W9W A;  4AB5 A;  2Q2A A;  3DEL B;  3IR1 A;  5AA4 B;  4O3A A;  4GWO A;  3FUZ A;  2LAO A;  1IMF A;  4XKN A;  1B32 A;  1Y3N A;  4DI3 D;  2ZNS A;  1FPF A;  1IQ7 A;  1FTA A;  4F29 A;  3BKI B;  4DZ1 A;  4GXA A;  3TCH A;  3I6V A;  5I2K B;  5I57 B;  4U1Z A;  3G3G A;  2HZK A;  1IME A;  3TUS A;  1TFD A;  1DCU A;  3OSR A;  4PFY A;  1NV7 A;  4X48 A;  1NV6 A;  1H43 A;  3PTY A;  1N3W A;  3KGC A;  1WVJ A;  3R6U A;  5HPQ A;  4F2Q A;  4OVQ A;  3SET A;  3KBZ A;  1FRP A;  3PD8 A;  4NE4 A;  1YYZ A;  3QYT A;  4QFN A;  4U23 A;  2QVU A;  3MZ1 A;  3H6U A;  4MEV A;  1T0K A;  2OLB A;  1R1N A;  3K6X A;  1H76 A;  1UIV A;  4JB7 A;  3QUF A;  4QFO A;  2H9B A;  4YB5 A;  3K1N A;  1LBV A;  1JVX A;  2E0S A;  3OOA A;  3MJN A;  1USY H;  3FVN A;  4XIG Q;  2XXW A;  2D21 A;  1US4 A;  4KI0 E;  4E0W A;  4DIG A;  2HXW A;  5H8F B;  5IAI A;  3R7X A;  2O84 X;  2F3D A;  4KCC A;  3H4Z A;  3HPI A;  4OVR A;  1B7Z A;  1RDZ A;  2Z8D A;  4NF8 B;  2V3Q A;  2L5V A;  4L17 A;  4RNS A;  1NNP A;  4OYV A;  3BFU A;  1NNT A;  2YPN A;  1LBY A;  4LAT A;  4PFB A;  2RKM A;  3KJT A;  2I58 A;  3RT8 A;  2V84 A;  3TCF A;  3T9V A;  1Q9D A;  5DTB A;  1OMP A;  2XXU A;  2Y7P A;  2XXQ A;  1IMB A;  3V8X B;  4YU0 A;  1FBP A;  3C32 A;  4GWZ A;  3BIH A;  2CZI A;  2P1S A;  4N15 A;  3ZKK A;  1FCK A;  3OO6 A;  1SW1 A;  3VE1 B;  2Y7K A;  1VDW A;  5EHS A;  3DLN A;  3MPK A;  4JSD A;  2I3W A;  4P0G A;  2HAV A;  4DXC A;  4BDL A;  3DP6 A;  1Y9U A;  4GQO A;  2I48 A;  1RDX A;  1FBG A;  1B6H A;  5K2X A;  1P1N A;  4FE8 A;  3OEN A;  4HE1 A;  4PAF A;  1D4N A;  1GGG A;  3IB0 A;  4GVO A;  2I4C A;  4NGU A;  4OZ9 A;  2Z23 A;  4G8M A;  4ZEK A;  1NV0 A;  5DVJ A;  2RIN A;  1SBP A;  3FJM A;  3KSX A;  3CRB A;  3KC0 A;  1OVT A;  2O68 A;  2ESN A;  4GWS A;  2PMS A;  2XX7 A;  3MP6 A;  2KQZ A;  4XKQ A;  5IGA A;  1FBE A;  1NUW A;  1LLS A;  4GX4 A;  2F7B A;  2ONR A;  1YPN A;  3V5A A;  1M5D A;  4OWD A;  3N6T A;  1A54 A;  4MJO A;  2P3N A;  1B1X A;  3B50 A;  4R2F A;  4M1V A;  3IOU A;  1Y1Z A;  3IK6 B;  1S50 A;  4MAG A;  4O3B A;  3S9N C;  3SEW A;  2Y7R A;  3FJ7 A;  3C34 A;  4NF4 B;  3S9E A;  3BIG A;  1NMU A;  1URS A; 
#chains in the Genus database with same CATH homology
 2I3V A;  3TZA A;  1ZIU A;  5H8N B;  4G2Z A;  4IO3 A;  4EQ7 A;  3TTM A;  4U1O A;  3O9P A;  3LSL A;  4BDQ A;  3RTW B;  3FVO A;  4BDO A;  2V25 A;  4ESX A;  1YTV A;  3SEX A;  3IB2 A;  2YJP A;  4ELP A;  5EHM A;  1I6Q A;  4ZEB A;  4DCX A;  5DT6 A;  3SER A;  5DVI A;  2AL4 A;  2VOZ A;  3G7W A;  4F19 A;  4MBP A;  2Z8E A;  1ZTY A;  1B7H A;  4NED A;  4KR5 A;  5JEI A;  3IJX B;  3USD A;  5A5X A;  5AA2 A;  1PDA A;  3TAJ A;  1EZP A;  1LAG E;  4THI A;  3TTK A;  4GL8 A;  4H8I A;  1Y4T A;  4AQ4 A;  3KN8 A;  3VXB A;  4H5G A;  1B0H A;  1B5I A;  4YKI A;  3FV1 A;  4I9D A;  1Z7M E;  5TU0 A;  4BLA A;  4XTC Q;  1IIW A;  2XXP A;  2W7Y A;  5CRY A;  5CI5 A;  3MVZ A;  2Y7I A;  1LBB A;  1XHY A;  3VXC A;  3LSF B;  1MY2 A;  1FQD A;  4U2R A;  3N94 A;  1MDQ A;  4YKP A;  1F9B A;  3KOT A;  1EH3 A;  3MW0 A;  4F3G A;  2R9J A;  3IX1 A;  4Q0C A;  5L9S A;  3FVK A;  3C31 A;  4OHN A;  3IO4 A;  1VSO A;  3OEK A;  4YAH X;  5I59 B;  3ZSF A;  1B9J A;  4LUB A;  1LB8 A;  2XXR A;  2X26 A;  3G3J A;  3UIF A;  2ZYM A;  4GRK A;  2F34 A;  1B5J A;  1MQJ A;  2XXI A;  3GBB A;  1SD3 A;  3VLV A;  4M4G A;  3ILT B;  3LC8 A;  2X7Q A;  3EHT A;  5KCJ B;  4Z0I A;  3EPE A;  3VVE A;  2B3F A;  1BIY A;  4WXJ A;  2PT1 A;  3PU5 A;  1UTB B;  1MM7 A;  3A3U A;  5AA3 A;  2UXA A;  1MPD A;  4I8C A;  3THI A;  3PUX E;  3QXM A;  3KEI A;  1Y20 A;  1N0T A;  3KSJ A;  2ONK E;  3K1P A;  1J1N A;  3IJO B;  1SQY A;  3SES A;  1R6Z A;  1TWY A;  1B46 A;  1XVX A;  3O97 A;  3OD7 A;  3PPQ A;  4ZEF A;  1IXH A;  2I0C A;  3M3K A;  4R75 A;  4P11 A;  2CMO A;  1TFA A;  4Q30 B;  4LQ5 A;  1AH5 A;  1Q1K A;  3RLF E;  1MY3 A;  1NH7 A;  4IY6 A;  2PYY A;  4RPN A;  1JW1 A;  3B6Q A;  1QUI A;  4ZEI A;  1B4H A;  2QS4 A;  3PUW E;  1JET A;  3HV1 A;  4NWD A;  4NF5 A;  2DWA A;  1MXV A;  3C36 A;  2NXO A;  1B3G A;  4OTE A;  4ZED A;  1MH3 A;  3ECR A;  4R72 A;  3TYH A;  1MM6 A;  2DE2 A;  5I58 B;  4E0X A;  4G77 A;  1PB9 A;  3T9U A;  2RC9 A;  4G68 A;  4F18 A;  5BWJ A;  2PVU A;  2VP1 A;  5TP9 A;  1NNF A;  2RCA A;  2F36 A;  1N7X A;  3T22 A;  3L6G A;  1FQC A;  1Y3P A;  2IA4 A;  1P1W A;  5TPA A;  2QJE A;  3QSL A;  1QJM A;  4G8N A;  1S9T A;  1UTH B;  4F2O A;  1ZMG A;  4FED A;  5CMM A;  1JW5 A;  4PE5 B;  4FEB A;  2DE3 A;  1TXF A;  3O66 A;  3T96 B;  1HSL A;  4F1U A;  5I56 B;  3OO8 A;  2HZL A;  2I4B A;  1WDN A;  5H8Q A;  3G3I A;  3IOT A;  3S2V A;  3BFT A;  1MY4 A;  3RNN A;  2DVC A;  2F6G A;  3IOV A;  3MC2 A;  1LAX A;  2ZYK A;  1OLC A;  2HQ0 A;  4JXI A;  1URG A;  1N76 A;  2VD3 A;  2RCB A;  3TTR A;  2H4I A;  2XD3 A;  3E9X A;  4KD5 A;  4YMB A;  1FTJ A;  4F31 B;  3C33 A;  3Q29 A;  3U72 A;  4GF8 A;  1FTO A;  2D3I A;  4FEC A;  1NH8 A;  4IGT A;  3V83 A;  3QUJ A;  1UIU A;  3T9H B;  5DEX A;  5CBR A;  1MXW A;  4F3P A;  4G8H A;  3IOW A;  3FGS A;  1FQE A;  4FAJ A;  1XVY A;  4JWO A;  1MPC A;  3MUQ A;  1MQD A;  1IXG A;  4MH5 A;  4ZZA A;  2Q88 A;  1SI0 A;  2THI A;  4RXL A;  2AL5 A;  3EQ1 A;  2REJ A;  2G29 A;  3ONM A;  2DYX A;  1RYO A;  4EUO A;  3TEL A;  5M2V A;  1MRP A;  4FIM A;  3SEV A;  4RK9 A;  2NWJ A;  4U21 A;  2E1S A;  3UK4 A;  1B3F A;  1OLA A;  3KBR A;  2XXX A;  4EDP A;  3FJG A;  4I62 A;  1LFH A;  1L5T A;  3T93 B;  1SYI A;  1POT A;  5I2N B;  4UA8 A;  2UVH A;  4BDM A;  4TLL B;  4YB7 A;  2NOO A;  3Q28 A;  1H3D A;  4U4S A;  2F6P A;  3B7D A;  4QFL A;  1GVC A;  1N04 A;  2PBW A;  3CG1 A;  3LSX A;  4ZS9 A;  1SYH A;  3HCQ A;  5FHO A;  4F3S A;  1FTM A;  4HCY A;  5L9O A;  3V89 B;  5JTY A;  4NF6 B;  5EYF A;  2P0S A;  4MFI A;  2A5S A;  3MP8 A;  1XS5 A;  1B05 A;  2DWJ A;  3GZG A;  2GH9 A;  2Q8J A;  3FV2 A;  4HS7 A;  3VVD A;  4IO2 A;  5CM6 A;  4QRZ A;  2ZYO A;  2ZXT A;  4Q5T A;  3UP9 A;  1ZBM A;  2NUV A;  4IO7 A;  1EZ9 A;  1MQH A;  4ELR A;  3K2D A;  4EQ9 A;  1IXC A;  2Q89 A;  3FZV A;  2H98 A;  4DLD A;  5AA1 A;  1OQG A;  1PBQ A;  4MLV A;  3IOR A;  3PPP A;  4YB6 A;  1SW2 A;  3JYR A;  1A8E A;  3HN0 A;  4PET A;  4RA1 A;  2XXY A;  3MZ9 A;  4IY5 A;  1AL3 A;  1LST A;  3Q27 A;  1PC3 A;  1DSN A;  1B3L A;  5L8D A;  1LFG A;  5F7V A;  3K00 A;  2I49 A;  3K02 A;  2HCA A;  1FQA A;  4DXU A;  1MQI A;  1B40 A;  1HSJ A;  1CE2 A;  2QPQ A;  1JEU A;  2Z8F A;  4F1Y A;  3EHS A;  3D4C A;  3MQ9 A;  4G68 C;  1QUK A;  1H44 A;  1MDP 1;  4N13 A;  1MXZ A;  4H6D A;  2QL3 A;  1QUL A;  3TDJ A;  4GL0 A;  3LR1 A;  4NTL A;  1B0L A;  3SDF A;  3PMW A;  4QHQ A;  3HO7 A;  5AA2 D;  3MZB A;  4POW A;  4DE8 A;  1ZLQ A;  4I1D A;  1XC1 A;  4ZE9 A;  4H67 A;  4WED A;  2DVZ A;  2DXY A;  5J1D A;  4H5F A;  1O64 A;  1S7Y A;  4PFU A;  3W15 C;  3ILU B;  3LUY A;  3UGW A;  4ESW A;  2Q9T A;  4AB6 A;  1GR2 A;  3F11 A;  4ZDM A;  3FXR A;  4BDN A;  3WAE A;  3PPO A;  3QAX A;  3S9M C;  3TMG A;  2R6G E;  3H7M A;  3RY3 A;  1LGB C;  3QIM A;  1VFE A;  1TT1 A;  3HHG A;  1B5H A;  1JW4 A;  4KQP A;  4OEV A;  2A5T A;  1I6A A;  4X1D A;  3B6W A;  1RYX A;  1OQH A;  5CMC A;  4KYE A;  2B65 A;  3Q26 A;  3N5L A;  2F78 A;  2OWS A;  4PFW A;  3S4U A;  2QMX A;  2ZNT A;  4R9G A;  3H6T A;  1NFT A;  4RPO A;  2GHA A;  1DPP A;  4PP0 A;  1D9V A;  3W9V A;  4R6H A;  5AE4 A;  1JEV A;  3TFL A;  2HFB A;  5ICT A;  5AA4 A;  3TPA A;  2F35 A;  1ANF A;  1M5B A;  5F1Q A;  3K6W A;  1A40 A;  1JQF A;  2DQV A;  2ZYN A;  1BTJ A;  3TTL A;  3RPW A;  5I2K A;  5I57 A;  1B58 A;  2O7I A;  5HBC A;  4KHZ E;  3PV0 E;  5ISU A;  3CSB A;  3I3V A;  1ZJL A;  1O63 A;  1OVB A;  3RQT A;  5HM4 B;  3FXQ A;  3FXU A;  2BJJ X;  3PPR A;  4RY1 A;  2GFE A;  1B1H A;  1EU8 A;  1SDX A;  1NNK A;  2QS1 A;  4H1X A;  4LQ2 A;  4IO5 A;  4ISU A;  1D3K A;  4POX A;  1MXU A;  3IL1 B;  4LVQ A;  1WOD A;  4ZZE A;  1ATG A;  2XD2 A;  2UYE A;  2DWH A;  4MF3 A;  2DOJ A;  4IGR A;  1MG1 A;  1FW0 A;  5H8F A;  1DTZ A;  1P1Q A;  4ZE8 A;  5K2Y A;  4R6Y A;  3O6G A;  3OO9 A;  3TKD A;  3CFZ A;  3VFJ A;  3D4G A;  1AOV A;  3N26 A;  4NF8 A;  1N84 A;  3T66 A;  3PD9 A;  2XX9 A;  1O7T A;  1A55 A;  1IIT A;  4U22 A;  3RUM A;  4R6K A;  5B70 A;  1CB6 A;  2XXV A;  3PGF A;  1PB7 A;  1I69 A;  3TEP A;  3TCG A;  3B6T A;  5A5X B;  5AA2 B;  3M3F A;  3A09 A;  1M5C A;  3E3K A;  3UN6 A;  2F5X A;  3CFL A;  4KPT A;  5ITO A;  3C9H A;  3PUZ E;  2I6E A;  4ELQ A;  3CIJ A;  1N7W A;  3TTN A;  5L9M A;  2P2A A;  2H5Y A;  5CMK A;  1LAH E;  4IB2 A;  4GOT A;  5BUU A;  3T9X B;  2OBG A;  2VHA A;  1LB9 A;  4H65 A;  3CSG A;  1MQG A;  3KFM A;  3DM0 A;  2Q2C A;  2DE4 A;  3PUV E;  4YKJ A;  5H8S A;  4RK2 A;  4F39 A;  1LBC A;  1QVS A;  2H25 A;  4LZ5 A;  4QFP A;  4P0I A;  3HST A;  3AXF A;  2ABH A;  3GLB A;  1BLF A;  1B7U A;  2OZZ A;  2VGQ A;  5DYH A;  4KFQ A;  1P99 A;  3K6V A;  2I0B A;  4LON B;  1USY E;  3SKP A;  4OFO A;  3JV9 A;  1Z7N E;  3R26 A;  4F22 A;  2DXR A;  2WKY A;  3U94 A;  3GBA A;  3PPN A;  4LZ8 A;  1M5E A;  3C4M A;  4NF4 A;  1ZKB A;  4LA9 A;  5H8N A;  3CR9 A;  3LBS A;  1IUD A;  1VR5 A;  3BBR A;  1A7L A;  4YIC A;  1QUJ A;  1FTK A;  3CG3 A;  4OMB A;  1B3E A;  2RC8 A;  3FD3 A;  2OJT A;  3N6U A;  3WAF A;  3LSW A;  3E13 X;  3L6H A;  3FIR A;  3M8U A;  2ZNU A;  3H3G A;  4XXU A;  5ICQ A;  4OFL A;  4JWX A;  3KJ7 A;  1ELJ A;  4F1V A;  2UVG A;  3FAT A;  4HTG A;  2RC7 A;  1XT8 A;  2QSX A;  3G3H A;  3RN8 A;  2FNC A;  1BKA A;  1DMB A;  3VV5 A;  4BDR A;  4JDF A;  4ELO A;  1YCJ A;  2GRV A;  4H8J A;  3MBP A;  4HW8 A;  2REG A;  3H6W A;  4H0W A;  3OEM A;  3RTF B;  4XKR A;  1LFI A;  5FTI A;  4R74 A;  2XX8 A;  3M3L A;  1MH4 A;  1MPB A;  2YLN A;  3SEU A;  3MPL A;  2ALU A;  3O6I A;  5FTH A;  4FJP A;  3SEY A;  2M8C A;  2ZMB A;  2V3T A;  4NF5 B;  5H8H A;  2XXT A;  3K01 A;  2Y7W A;  1YAE A;  1IXI A;  2F7C A;  3P7I A;  4EF2 A;  4R73 A;  3OEL A;  3OMB A;  4Q8R A;  4IO4 A;  3E4R A;  4G68 B;  1MXY A;  3S9L C;  4G4P A;  3FVG A;  3VVF A;  3KG2 A;  5TP9 B;  4C1T A;  1NL5 A;  1P1O A;  1I6B A;  5TPA B;  2XHD A;  1JNF A;  1A8F A;  4UAC A;  3MVX A;  5FHN A;  1DPE A;  4FOR A;  5I59 A;  1POY 1;  4NWC A;  2PX1 A;  4OFJ A;  5ELV A;  3VLW A;  1GTK A;  4GXS B;  3H03 A;  5LOM A;  5FHM A;  2DP8 A;  3EHU A;  2O51 A;  4Z7E A;  3OO7 A;  2O7U A;  5H8Q B;  3ODB A;  4QSD A;  3CI8 A;  3TQW A;  2OCU A;  1IEJ A;  3RGY A;  2F8D A;  1DTG A;  1LAF E;  3K1M A;  5JK4 A;  4KYD A;  4QSC A;  4U4X A;  1MY1 A;  5KCJ A;  4F3B A;  2AIX A;  1GV8 A;  3MWB A;  4YKK A;  2UVJ A;  3DP4 A;  4EQB A;  3KOS A;  1UTB A;  3Q25 A;  2QMW A;  1MY0 A;  4C1U A;  2NVU B;  5DEX B;  5CC2 A;  3C35 A;  1RKM A;  3IB1 A;  4GLI A;  3QK6 A;  2D5W A;  4ECF A;  3MAM A;  4ND9 A;  3O29 A;  5B7D A;  1MS7 A;  4XKP A;  2V93 A;  1SI1 A;  4OER A;  1LCT A;  2Z22 A;  3FAS A;  3U93 A;  1EZO A;  1PBP A;  2DSF A;  1SW5 A;  1IZ1 A;  5KZT A;  2DS9 A;  3OXN A;  2QS2 A;  2ANJ A;  4LP2 B;  1R9L A;  1SVX B;  3KN3 A;  3HHF A;  4ZEC A;  4KCD A;  2HAU A;  4DXB A;  3PMX A;  1D9Y A;  3EF7 A;  4EXK A;  4NMY A;  5I58 A;  4K3F A;  1LCF A;  5CBS A;  3VLU A;  4N07 A;  3U92 A;  2KLF A;  4OQO A;  2DWI A;  1PB8 A;  2QRY A;  4MLQ A;  2PT2 A;  5H8H B;  4IO6 A;  4C0R A;  4JBZ A;  1XOC A;  2IEE A;  5KDT A;  3K0V A;  1URD A;  3CVG A;  4WEP A;  1SW4 A;  3IO6 A;  4WKM A;  4QFK A;  4X9T A;  3ZKL A;  3EN3 A;  5JTY B;  1UTH A;  3K6U A;  4JWY A;  4RYA A;  1B2H A;  1N3X A;  1VFD A;  4OEN A;  1JVY A;  4OET A;  1QKA A;  4EXL A;  2VD2 A;  4ONY A;  5I56 A;  2O6A A;  3TQL A;  3A3C A;  2R71 A;  3U8Q A;  3MVW A;  2HEU A;  4DDD A;  1A99 A;  4OES A;  2QS3 A;  2O1L A;  2O1M A;  3G3F A;  4QF9 A;  2OK2 A;  2FYI A;  3JZJ A;  4EF1 A;  4KYS A;  4O3C A;  1VE4 A;  1Y4C A;  5CMB A;  1Y3Q A;  1NKX A;  3IAZ A;  4OEU A;  3G3K A;  3UA8 A;  1HSE A;  2OWT A;  3H06 B;  3KZG A;  1QW0 A;  3I5O A;  3OSQ A;  1UQW A;  3RT6 B;  2AYS A;  3PMV A;  4FAT A;  3TOD A;  1FQF A;  2V3U A;  1PEB A;  4QSE A;  1AIV A;  2UYF A;  1BP5 A;  1R9Q A;  5I84 A;  1ZU0 A;  1II5 A;  2ONS A;  5DVF A;  1FTL A;  4TQU Q;  2Y84 A;  4HCW A;  2O69 A;  1B52 A;  1FQB A;  4R2B A;  3K4U A;  2H99 A;  1Q35 A;  3MP1 A;  3H6V A;  5I2N A;  4TLM B;  2XXH A;  2F97 A;  5IKB A;  2F7A A;  1M5F A;  1OIB A;  3PUY E;  4X1B A;  4OXV A;  3O6H A;  4PQJ A;  4GFR A;  2CZL A;  3GXA A;  1AMF A;  3KN7 A;  4JSO A;  4RJZ A;  3MVY A;  2B3B A;  3O2A A;  4DCY A;  2GHB A;  4N6P A;  5ITP A;  4NF6 A;  2RF1 A;  4R9F A;  4YZZ A;  4YMA A;  1B51 A;  2UVI A;  2X7P A;  1US5 A;  3CFX A;  2A5T B;  1Y1M A;  5KDT B;  1QKB A;  1B3H A;  4LZ7 A;  4OVJ A;  2G93 A;  3O28 A;  4PFT A;  4GD5 A;  3U1O A;  3ZS6 A;  1DOT A;  1MXX A;  4GIZ A;  1KWH A;  1B4Z A;  1H45 A;  3DP8 A;  1P1U A;  4TOZ A;  3UOR A;  2FA7 A;  3VDF A;  3W9W A;  4AB5 A;  2Q2A A;  3DEL B;  3IR1 A;  5AA4 B;  4O3A A;  4GWO A;  3FUZ A;  2LAO A;  4XKN A;  1B32 A;  1Y3N A;  2ZNS A;  1IQ7 A;  4F29 A;  3BKI B;  4DZ1 A;  4GXA A;  3TCH A;  3I6V A;  5I2K B;  5I57 B;  4U1Z A;  3G3G A;  2HZK A;  3TUS A;  1TFD A;  3OSR A;  4PFY A;  4X48 A;  1H43 A;  1N3W A;  3KGC A;  1WVJ A;  3R6U A;  5HPQ A;  4F2Q A;  3SET A;  3PD8 A;  4NE4 A;  3QYT A;  4QFN A;  4U23 A;  3MZ1 A;  3H6U A;  1T0K A;  2OLB A;  1R1N A;  3K6X A;  1H76 A;  1UIV A;  4JB7 A;  4YB5 A;  3QUF A;  2H9B A;  4QFO A;  3K1N A;  1JVX A;  2E0S A;  3OOA A;  3MJN A;  1USY H;  3FVN A;  4XIG Q;  2XXW A;  2D21 A;  1US4 A;  4KI0 E;  4E0W A;  4DIG A;  2HXW A;  5H8F B;  5IAI A;  3R7X A;  2O84 X;  4KCC A;  3H4Z A;  3HPI A;  1B7Z A;  2Z8D A;  2V3Q A;  4NF8 B;  4L17 A;  4RNS A;  1NNP A;  4OYV A;  3BFU A;  1NNT A;  2YPN A;  4LAT A;  2RKM A;  3KJT A;  2I58 A;  3RT8 A;  2V84 A;  3TCF A;  3T9V A;  5DTB A;  1OMP A;  2XXU A;  2Y7P A;  2XXQ A;  3V8X B;  4YU0 A;  3C32 A;  2P1S A;  3ZKK A;  1FCK A;  3OO6 A;  1SW1 A;  3VE1 B;  2Y7K A;  5EHS A;  3DLN A;  3MPK A;  4JSD A;  2I3W A;  4P0G A;  2HAV A;  4DXC A;  4BDL A;  3DP6 A;  1Y9U A;  4GQO A;  2I48 A;  1B6H A;  5K2X A;  1P1N A;  4FE8 A;  3OEN A;  1D4N A;  1GGG A;  3IB0 A;  4GVO A;  2I4C A;  4OZ9 A;  2Z23 A;  4G8M A;  4ZEK A;  5DVJ A;  2RIN A;  1SBP A;  3FJM A;  3KSX A;  3CRB A;  1OVT A;  2O68 A;  2ESN A;  2PMS A;  2XX7 A;  3MP6 A;  4XKQ A;  1LLS A;  2F7B A;  2ONR A;  1YPN A;  3V5A A;  1M5D A;  4OWD A;  3N6T A;  1A54 A;  1B1X A;  4R2F A;  4M1V A;  3IOU A;  1Y1Z A;  3IK6 B;  1S50 A;  4O3B A;  3S9N C;  3SEW A;  2Y7R A;  3FJ7 A;  3C34 A;  4NF4 B;  3S9E A;  1NMU A;  1URS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...