1H43A

R210e n-terminal lobe human lactoferrin
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
309
structure length
309
Chain Sequence
SVQWCAVSQPEATKCFQWQRNMRRVRGPPVSCIKRDSPIQCIQAIAENRADAVTLDGGFIYEAGLAPYKLRPVAAEVYGTERQPRTHYYAVAVVKKGGSFQLNELQGLKSCHTGLRRTAGWNVPIGTLRPFLNWTGPPEPIEAAVARFFSASCVPGADKGQFPNLCRLCAGTGENKCAFSSQEPYFSYSGAFKCLRDGAGDVAFIEESTVFEDLSDEAERDEYELLCPDNTRKPVDKFKDCHLARVPSHAVVARSVNGKEDAIWNLLRQAQEKFGKDKSPKFQLFGSPSGQKDLLFKDSAIGFSRVPPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title "Dilysine Trigger" in Transferrins Probed by Mutagenesis of Lactoferrin: Crystal Structures of the R210G, R210E, and R210L Mutants of Human Lactoferrin
pubmed doi rcsb
source organism Homo sapiens
molecule tags Metal transport
molecule keywords LACTOFERRIN
total genus 83
structure length 309
sequence length 309
ec nomenclature
pdb deposition date 2002-10-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00405 Transferrin Transferrin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h43A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1h43A02
1P1UA 4H8IA 4R72A 2RINA 3A09A 1BIYA 1IXHA 3F11A 4BDQA 3BFUA 1IXCA 5DT6A 2I3WA 3GZGA 4F3PA 1I6BA 4OETA 4IO7A 4ND9A 2F7CA 3CFZA 5CMMA 3MAMA 3IO4A 4QRZA 3S2VA 3K00A 3T22A 4LQ2A 2GFEA 4ESXA 2ZNUA 4MLQA 3PV0E 4OVJA 5L9MA 3FD3A 4FORA 3PPQA 4PE5B 3PD8A 3SKPA 5CI5A 1MQIA 4BDOA 3CI8A 1P1OA 3KEIA 1QKAA 3PPRA 4GIZA 2QMWA 4MLVA 1R9LA 3TQLA 5I56A 3FVGA 1O7TA 3IL1B 3K6UA 4EF2A 2HAUA 3V89B 4WXJA 3SETA 3TPAA 1JVXA 3RT8A 3C34A 3HO7A 3LBSA 1SW4A 4FEDA 4NF5B 3RTFB 3K6VA 3FXQA 1UTHB 2CMOA 3G7WA 4LATA 5DTBA 5H8FB 1FQBA 4IGRA 3MZ1A 3LSXA 1A7LA 2O84X 3TYHA 3UGWA 3VLWA 2DS9A 3H7MA 5ICQA 3MVWA 1FTLA 2UVJA 1B6HA 1CB6A 5CC2A 1B2HA 1PB9A 3O6IA 4JWXA 4RPOA 4KHZE 5H8HB 3RT6B 3W15C 3CG1A 4ZZEA 4EQ9A 3H03A 3IAZA 3IJXB 1B52A 3OEKA 1Y3NA 2XXUA 3ZS6A 4I1DA 2VOZA 1PB7A 2V3UA 3TDJA 1S7YA 3FV1A 4PFUA 3PD9A 5IKBA 1JVYA 3Q26A 1SI1A 3K6WA 4N13A 4C0RA 2V3QA 1R6ZA 2HFBA 1N7XA 3C33A 4KCCA 3TTLA 4QFKA 3MWBA 4F3SA 3OEMA 3KN7A 4U1OA 1MY1A 5I2KA 1UTBA 4BDLA 3R7XA 1LAXA 1S9TA 4LZ5A 5KZTA 4RA1A 1D4NA 1JQFA 2WKYA 1MPDA 4ZS9A 5I59B 3GBBA 3PUVE 1GTKA 1XC1A 2Q2AA 3LSFB 3QUFA 1TFDA 3EHSA 4IO5A 4OXVA 1MXUA 2OK2A 4F29A 2AL4A 4H8JA 4ZECA 2O1MA 4IO4A 5LOMA 4Z0IA 3QXMA 5I58B 1SYIA 2GHBA 3ZKKA 3IO6A 1POY1 2ONRA 1N3XA 3M8UA 3U92A 2DE4A 2G93A 3HHFA 3USDA 1A55A 5L9OA 4OTEA 2Q9TA 4KCDA 4NF6A 4QHQA 2NWJA 2F97A 4LQ5A 3QUJA 1WDNA 2QS2A 4PQJA 4HW8A 4IO6A 3HSTA 1WODA 2AL5A 4EQBA 4POWA 1VFDA 4EUOA 1SDXA 2X26A 2V25A 1JETA 2Y84A 4PFWA 5DEXB 1IIWA 4G68C 1YCJA 5JTYA 4RYAA 5ELVA 3VDFA 3VVDA 5B7DA 3FVKA 1QUKA 4U1ZA 3PU5A 1LB8A 4ISUA 3MJNA 5EHMA 2QSXA 3K0VA 3MZ9A 4NF4B 3IB2A 2QL3A 3OSRA 5H8HA 1B5HA 2PVUA 2F78A 4MFIA 3Q29A 4PP0A 3IB0A 3IOWA 4G2ZA 1B9JA 1I69A 1RYXA 1MQGA 1YAEA 2F5XA 2DWHA 3OENA 2O51A 5H8QB 4BDRA 1BLFA 2UYEA 4R6YA 5K2YA 3S9NC 3PPNA 1B58A 4F2QA 4ZE9A 1AIVA 5A5XB 1UTHA 1ZMGA 3FASA 1JW5A 2PT2A 4GRKA 2QS4A 3MP8A 4KFQA 5F7VA 4PETA 4ZDMA 3FXUA 4ELQA 4GFRA 4GXAA 1IXIA 2Z8EA 1GVCA 1USYE 3RGYA 5TP9B 3TMGA 3ONMA 4MF3A 5L9SA 5AA2A 1A40A 3OD7A 3PMVA 1JEVA 4ZEFA 1Y20A 3DP6A 3RLFE 1HSLA 1MH4A 1MDP1 3FVOA 1FTMA 3U94A 3PGFA 5HPQA 3DELB 3AXFA 3VXCA 1MRPA 1ZBMA 2F35A 1B7UA 3CRBA 4I9DA 5CMCA 5I56B 1NL5A 2XD2A 4M1VA 3R6UA 1FW0A 4THIA 4ZEBA 3TQWA 1LBCA 4GF8A 1POTA 4OEVA 1NNKA 2QJEA 4YB5A 5JEIA 1H76A 2ZNTA 3H4ZA 3FJGA 1YPNA 4X1BA 5I57A 4JSDA 2ALUA 4DE8A 2DE2A 1SW2A 3U93A 4ZZAA 1T0KA 3SEXA 3CSBA 5ITOA 1SYHA 1A99A 4HS7A 3I6VA 4H0WA 2F7AA 3ZSFA 4IO2A 4C1UA 3IX1A 1M5BA 2V84A 1MQDA 3E3KA 3HPIA 3HHGA 5KDTA 1B3LA 2XXHA 1SW5A 4LUBA 2IA4A 4E0XA 1PEBA 3L6HA 3CVGA 1TT1A 4EF1A 2NVUB 1FTJA 3G3GA 3I3VA 2ZNSA 4G68B 1B7HA 1UQWA 3K01A 3N26A 1PB8A 4QFPA 4ZEKA 5TPAA 1JW4A 2UVHA 3ODBA 1EZ9A 3FJ7A 3MQ9A 4G8NA 4DXBA 4YICA 5I2KB 1AOVA 2X7QA 2ZYKA 2I58A 4RJZA 4R9GA 4IY6A 2OCUA 4X48A 3T9UA 1DPEA 2AIXA 4U4XA 1EU8A 3DM0A 4QFNA 4UACA 3TODA 2VGQA 2Z8FA 1MQJA 3T9VA 4RPNA 1NMUA 2Z8DA 1H45A 3R26A 1LGBC 4Q0CA 4YB7A 1QKBA 1OMPA 3K1PA 4FECA 4YU0A 1TWYA 1LCTA 4P11A 3ILTB 4TOZA 4G68A 4YAHX 4KYDA 1AL3A 1S50A 5L8DA 2Q8JA 1XS5A 2ABHA 1D9YA 2OWTA 2GH9A 4LP2B 1Y1MA 4DIGA 4O3CA 5JK4A 3HCQA 1MY0A 1OQGA 2F7BA 4G77A 2ONSA 4GXSB 5H8FA 5KDTB 2XXIA 2P0SA 2YPNA 3IORA 1H43A 4OEUA 1B32A 2Z23A 1DOTA 1P1NA 1ZLQA 5I84A 2H4IA 3TCFA 2ZYNA 3C35A 3PMXA 3KJ7A 4H5GA 3KSXA 1JNFA 2B3BA 3S4UA 3EHTA 3SDFA 3VVFA 4KI0E 4K3FA 1LB9A 3SEWA 3BBRA 5DVJA 1MH3A 1P99A 3MPLA 2E0SA 3THIA 3LR1A 1O63A 1B5IA 3KN3A 1NNPA 4HCYA 3W9VA 3MPKA 1J1NA 1DTGA 3MBPA 2ANJA 3CIJA 3QAXA 5FHOA 3MW0A 4H6DA 1B0HA 1QUJA 2HCAA 4HTGA 4ONYA 4GLIA 4JSOA 1MPBA 4LZ7A 1NFTA 2VHAA 1MQHA 4GQOA 3HN0A 2E1SA 3CSGA 1M5EA 2DQVA 3IK6B 1N76A 5CMKA 3S9LC 1BP5A 3CFLA 2PT1A 3BKIB 4F19A 4OENA 4OHNA 1ANFA 4WEDA 3MVZA 4ZE8A 4NF5A 2QS1A 3T93B 1B3GA 3H6VA 2XXYA 2VD2A 5H8QA 4DDDA 1Q35A 2XXWA 2OJTA 4PFYA 1CE2A 2BJJX 3JV9A 1B3EA 1DTZA 2XXQA 3B6TA 3IB1A 5TU0A 1SQYA 1LFGA 3GXAA 3TAJA 1FQFA 3U8QA 1Y3PA 1M5DA 4P0GA 4OWDA 3N94A 1A8EA 2Y7KA 1Y4CA 5ITPA 2D21A 2XX7A 3SEYA 2QPQA 5I2NB 1I6AA 2RCBA 4KYEA 1B4ZA 1B51A 4JWYA 4OESA 4BDMA 5DEXA 3G3KA 3E9XA 5DVFA 4F39A 1LFIA 1R1NA 1SW1A 1UIUA 3OXNA 2RKMA 2ZYOA 4NTLA 4R75A 1ZU0A 4R9FA 3SERA 4DXUA 4GL0A 5EYFA 2I4CA 5AE4A 3EN3A 1N3WA 4U21A 5HBCA 4FE8A 1B05A 1M5CA 4XKPA 3U72A 2UYFA 1B46A 1LAFE 4IB2A 3K02A 2ESNA 3E4RA 2VP1A 3KGCA 2LAOA 3KN8A 1LAGE 3UN6A 2XXPA 3K6XA 2REJA 2H25A 4I62A 2ZXTA 4XTCQ 2O7IA 4XIGQ 3H3GA 5I59A 4GL8A 3OOAA 3G3IA 2DXYA 2H99A 1EH3A 1MG1A 3M3FA 4ELPA 4F1UA 3C36A 5FHNA 4F2OA 1R9QA 3EF7A 2ONKE 1BTJA 1AMFA 1IEJA 1IUDA 3B6WA 4QFOA 1YTVA 4YMAA 2PX1A 4GWOA 4F3GA 3C4MA 1P1QA 4IGTA 3TTMA 1OVTA 3O66A 2REGA 1UIVA 4MH5A 1RKMA 5I2NA 2Z22A 5KCJB 4F18A 3G3FA 3IOUA 5CRYA 4RK9A 3O6HA 4U22A 3OO6A 3KBRA 3VXBA 4POXA 4JBZA 4QSCA 3JZJA 3TELA 3OSQA 4QFLA 3FJMA 2HAVA 1M5FA 1ZTYA 4OERA 1FQAA 5TPAB 1N84A 5TP9A 1RYOA 4OYVA 4QF9A 4DLDA 5CBSA 3H6UA 3ZKLA 3U1OA 1US5A 3EPEA 1PC3A 1Y9UA 1B4HA 2QS3A 3PUYE 4Q5TA 4XXUA 1VR5A 2I4BA 1XVYA 1GV8A 3T96B 1MXWA 3V5AA 1TXFA 1JEUA 2DWJA 3KJTA 3UA8A 2IEEA 2XHDA 4IO3A 1PBQA 1Y1ZA 3RN8A 1MY3A 1OLAA 2I49A 3MZBA 1MXZA 2HXWA 3N6TA 4YKIA 1D9VA 4BDNA 3TUSA 3G3HA 2A5SA 3QSLA 3O2AA 4YKKA 4KQPA 4GD5A 5FTIA 3IJOB 1DSNA 2D5WA 2HQ0A 1TFAA 3VE1B 4DZ1A 5I57B 2HEUA 1OVBA 4KYSA 3L6GA 5DYHA 2OZZA 4N6PA 3RY3A 2QRYA 3K4UA 2GRVA 1AH5A 4O3AA 5JTYB 5ISUA 3IR1A 4N07A 1FTKA 1MY4A 3FXRA 1SVXB 2O68A 4YB6A 1WVJA 3V83A 4EXLA 5AA2B 1XVXA 3TCHA 1EZOA 1VFEA 3K1NA 3CFXA 1MM6A 1MXXA 1QULA 3C32A 4Q30B 2FA7A 3D4CA 4R2BA 2B65A 3VVEA 5HM4B 2PYYA 5I58A 1B3HA 3IOVA 3TFLA 2Y7WA 4PFTA 5A5XA 4H67A 3P7IA 4F31B 1LFHA 4RK2A 2XXTA 3QK6A 3O97A 2OBGA 4I8CA 2I0BA 3RTWB 5H8NB 3RQTA 4JWOA 4DCXA 4L17A 2DXRA 3T66A 2KLFA 4YMBA 1ZKBA 1Y4TA 1QW0A 3H6WA 5F1QA 1H3DA 3RNNA 4U2RA 5CBRA 3MC2A 1Z7NE 2D3IA 1L5TA 3UORA 4ELRA 4RNSA 1SBPA 2V93A 1N04A 2XXVA 4QSEA 3DP8A 1JW1A 5FHMA 2HZLA 2RC8A 1KWHA 3G3JA 4IY5A 2B3FA 1ZIUA 2RCAA 4MBPA 4H1XA 1OLCA 4G8MA 3TCGA 5KCJA 2XX8A 1ELJA 2R6GE 4FEBA 4YKPA 2F8DA 1FCKA 1QUIA 2G29A 4ECFA 2I3VA 3TTKA 4Q8RA 5K2XA 2ZYMA 3OELA 2OLBA 2P2AA 1FTOA 4NF6B 4BLAA 4M4GA 2YLNA 4GVOA 3A3UA 4EXKA 1Y3QA 2FNCA 3GLBA 2W7YA 1B3FA 4C1TA 2OWSA 3VLVA 3H6TA 4R6HA 1VSOA 4OQOA 4UA8A 3UK4A 3DP4A 1II5A 2DWAA 3O9PA 3K1MA 3IOTA 1PDAA 4F1YA 4OZ9A 3KFMA 3KOTA 4R2FA 3I5OA 3FV2A 3N5LA 4EQ7A 3LSWA 3B7DA 1MY2A 1LBBA 1OIBA 1XOCA 3MVYA 3V8XB 1SD3A 2F6GA 1B0LA 1A8FA 3O29A 2DE3A 2FYIA 4NF8B 1GR2A 2GHAA 2Y7RA 3C31A 4OMBA 1MM7A 1Q1KA 1SI0A 2UVGA 4AQ4A 2H5YA 2M8CA 3SEUA 2RC9A 3KSJA 1IQ7A 4FIMA 4G4PA 2Q2CA 2R71A 3CR9A 5H8NA 4XKRA 2NUVA 1Z7ME 4TLMB 2XX9A 1OQHA 3Q28A 2P1SA 4F1VA 3OO7A 3O6GA 5AA4A 2QMXA 3EHUA 3GBAA 5ICTA 1ZJLA 3MP1A 4HCWA 4GOTA 4R74A 2XXRA 4ZEIA 3SEVA 3EQ1A 2I6EA 4EDPA 4ZEDA 4R73A 1ATGA 3M3LA 4NE4A 3TTNA 3VV5A 1B40A 3DLNA 4FATA 1NNTA 1MXYA 3KZGA 1A54A 3KG2A 2NOOA 1IXGA 2O7UA 2O1LA 4TLLB 1B1XA 2DVZA 5BWJA 4JB7A 4H65A 2CZLA 3TZAA 1MXVA 2Y7IA 3LSLA 3WAFA 4Z7EA 1B7ZA 4WEPA 1GGGA 2X7PA 3UP9A 4ELOA 4F22A 4F3BA 4TQUQ 3OMBA 1USYH 2Q88A 4NF4A 3C9HA 3T9XB 4JXIA 2R9JA 4LA9A 1XT8A 1IZ1A 1D3KA 1LSTA 1US4A 3OO9A 4NMYA 4OFOA 4RY1A 5AA1A 4DXCA 5BUUA 1MS7A 3OO8A 3UIFA 2H98A 2RC7A 4ESWA 1P1WA 3H06B 5AA4B 3MVXA 2UXAA 5EHSA 3ECRA 1NH8A 3D4GA 3RPWA 2PBWA 2H9BA 3MUQA 1BKAA 3JYRA 4LVQA 1DMBA 2V3TA 3CG3A 4AB5A 4E0WA 3QIMA 1IITA 1VE4A 2PMSA 3K2DA 5M2VA 1MDQA 4DCYA 3Q27A 4X1DA 4KD5A 4NF8A 3WAEA 1DPPA 4P0IA 1LLSA 1HSEA 1NNFA 1H44A 4YZZA 1MPCA 3LUYA 3KOSA 4NWDA 4XKQA 2RF1A 4KR5A 4QSDA 1F9BA 2I0CA 2A5TA 1B5JA 3PPOA 2HZKA 1PBPA 4RXLA 4U23A 2THIA 1N7WA 4XKNA 3TKDA 1NH7A 1O64A 2DYXA 1N0TA 2YJPA 4NEDA 4NWCA 3S9MC 3TEPA 3T9HB 3PPPA 2VD3A 4R6KA 1B1HA 1I6QA 3N6UA 1QJMA 3FIRA 2O69A 3FVNA 1UTBB 3ILUB 3QYTA 4FJPA 4O3BA 4OFJA 4U4SA 2UVIA 5AA3A 3PUZE 1URDA 3LC8A 3M3KA 1EZPA 4JDFA 2F6PA 1HSJA 1FQEA 5DVIA 3TTRA 4G8HA 4X9TA 4KPTA 3W9WA 5J1DA 4OFLA 3SESA 3FZVA 3FUZA 3HV1A 2XD3A 4H5FA 3FATA 3BFTA 1QVSA 3MP6A 5AA2D 3A3CA 3O28A 2AYSA 2DSFA 2DOJA 4AB6A 1XHYA 3VFJA 4FAJA 2ZMBA 1LCFA 2Y7PA 3PUXE 5B70A 1FQCA 3VLUA 2I48A 4WKMA 1NKXA 3FGSA 3E13X 4LONB 2Q89A 5H8SA 2DWIA 2NXOA 5CM6A 1URSA 2A5TB 3PUWE 3B6QA 3S9EA 2O6AA 5CMBA 2XXXA 3PMWA 2F36A 2DP8A 3Q25A 1LAHE 4YKJA 4LZ8A 1URGA 2F34A 3RUMA 2DVCA 1FQDA 5IAIA 5FTHA
chains in the Genus database with same CATH superfamily
1P1UA 5ESYA 4F3PA 3GZGA 4ND9A 3IO4A 4QRZA 4LQ2A 2GFEA 5IM2A 3FBPA 3FD3A 4PE5B 3KEIA 1QKAA 5I56A 1R9LA 3IL1B 4EF2A 3V89B 1FPDA 1SW4A 3RTFB 3K6VA 3FXQA 3G7WA 2CMOA 3IFCA 3TYHA 3UGWA 2P3NA 3MVWA 2GQ1A 1B2HA 5H8HB 4KHZE 3IAZA 3IJXB 4OA4A 2V3UA 4PFUA 5IKBA 4N13A 2HFBA 4KCCA 3MWBA 4F3SA 3OEMA 4RA1A 1D4NA 1JQFA 2CEXA 2PFYA 1GTKA 3QUFA 4JVIA 4PC9A 1MXUA 4DI3D 4IO4A 2FBPA 3QXMA 3ZKKA 3U92A 3USDA 4OTEA 4QHQA 4POWA 1IIWA 4G68C 1QUKA 4U1ZA 3RYDA 4NF4B 3A29A 2QL3A 3OSRA 4MFIA 4PP0A 1MQGA 1YAEA 5H8QB 2O51A 3PPNA 4ZE9A 1AIVA 1UTHA 1ZMGA 4GXAA 1IXIA 2Z8EA 3TMGA 4MF3A 1A40A 1Y20A 2CEYA 3DP6A 5HPQA 3DELB 3AXFA 1FBCA 2B4LA 4I9DA 4M1VA 3R6UA 4ZEBA 4OEVA 1POTA 4X1BA 1YPNA 2ALUA 1T0KA 4HE0A 4H0WA 2F7AA 3ZSFA 4N8YA 4NAPA 2XXHA 2IA4A 4FBPA 3L6HA 1FTJA 3G3GA 2ZNSA 1UQWA 4GWYA 5TPAA 3ODBA 2I58A 4IY6A 2OCUA 4UACA 2PCRA 3T9VA 4RPNA 2Z8DA 1H45A 4Q0CA 3MYUA 1QKBA 1TWYA 1LCTA 4GWSA 1S50A 4PFBA 4DIGA 5JK4A 2GH9A 1Y1MA 1OQGA 2ONSA 4GXSB 2XXIA 1NUZA 2P0SA 2YPNA 1B32A 3PMXA 3KJ7A 3KSXA 4H45A 2E0SA 1O63A 2XXKA 1RDYA 4HCYA 4NHBA 2HCAA 4ONYA 4JSOA 1MPBA 4LZ7A 1NFTA 4O94A 5ET7A 3HN0A 4X8RA 2FHYA 2DQVA 1N76A 3CFLA 2PT1A 4F19A 1ANFA 4WEDA 2QS1A 2XXYA 2VD2A 4NGUA 2XXWA 4PFYA 1B3EA 3B6TA 5TU0A 3U8QA 2Y7KA 2D21A 1RDZA 5I2NB 3LUZA 4KYEA 1B4ZA 4OESA 4F39A 1LFIA 1R1NA 4NQ8A 2QVRA 3OXNA 5EYFA 2I4CA 4U21A 2HHMA 4MNIA 3U72A 1LAFE 3KGCA 2LAOA 2REJA 4I62A 2ZXTA 4GX3A 4MNPA 1FBGA 2DXYA 4GWUA 3M3FA 1R9QA 4YMAA 2PX1A 1OVTA 2REGA 1UIVA 4P8BA 1RKMA 2Z22A 5CRYA 3OO6A 3KBRA 4JBZA 3JZJA 4QFLA 3FJMA 5TPAB 3H6UA 3ZKLA 2Q74A 3U1OA 1US5A 1PC3A 1Y9UA 2QS3A 4Q5TA 3V5AA 2I4BA 1TXFA 3KJTA 3UA8A 4IO3A 3N6TA 1D9VA 3TUSA 5FTIA 1DSNA 1TFAA 3VE1B 4DZ1A 4KYSA 2QRYA 3K4UA 4O3AA 3IR1A 4N07A 3B8BA 1MY4A 2OX3A 3FXRA 1IMAA 2O68A 3V83A 1MM6A 1MXXA 2FA7A 5HM4B 3VVEA 2WBBA 1B3HA 1NUWA 1XI6A 1FPBA 1LFHA 4RK2A 3QK6A 4I8CA 4DCXA 3T66A 1FBDA 1Y4TA 3RNNA 3H6WA 1H3DA 3MC2A 2D3IA 1DBZA 1N04A 3DP8A 3G3JA 3TCGA 2B3FA 2RCAA 5IZ3B 2XX8A 1QUIA 2P2AA 4GVOA 3A3UA 4EXKA 1Y3QA 1B3FA 3VLVA 3H6TA 3K1MA 3KOTA 1MY2A 1XOCA 3IFAA 1SD3A 5EQ8A 1A8FA 3O29A 4O7MA 4AQ4A 4OMBA 1SI0A 2R8TA 2RC9A 2Q2CA 4XKRA 2XX9A 3O6GA 3MP1A 4HCWA 4R74A 4GOTA 3KC0A 4R73A 1B40A 3KG2A 2NOOA 3PTYA 4DI4B 2O7UA 2O1LA 2DVZA 4H65A 3TZAA 1MXVA 4Z7EA 1GGGA 2X7PA 3UP9A 4ELOA 4F3BA 1USYH 3T9XB 3ISPA 3OO9A 4PTKA 1FPEA 3KBZA 3MVXA 2H9BA 1EYKA 3CG3A 4E0WA 2PMSA 4MNCA 4KD5A 4P0IA 2Y5LA 3LUYA 3KOSA 2I0CA 3PPOA 3CHGA 2HZKA 3TKDA 2B4MA 4NWCA 3T9HB 4ESWA 2VD3A 1UTBB 3PUZE 4NN3A 5T3JA 1FQEA 4G8HA 5J1DA 3SESA 3FUZA 3BFTA 4AB6A 4FAJA 3BIGA 1LBZA 2DWIA 2NXOA 1NI9A 3Q25A 2DP8A 4LZ8A 1URGA 2DVCA 1I6BA 1FQDA 1CNQA 1IXHA 4BDQA 2I3WA 4OETA 4IO7A 2F7CA 4P56A 3K00A 1LBVA 2ZNUA 4MLQA 3PV0E 4OVJA 5L9MA 4KXPA 1MQIA 1P1OA 4GIZA 4MCOA 1FPKA 3FVGA 1O7TA 4WXJA 3HO7A 1NV5A 3EKIA 4PFIA 4NF5B 5H8FB 2DS9A 3H7MA 5I5PA 2UVJA 5CC2A 3SZPA 1PB9A 3O6IA 4JWXA 1KZ8A 3ZS6A 1Y3NA 4I1DA 2VOZA 1PB7A 3TDJA 3FV1A 1SI1A 3K6WA 1N7XA 1EYJA 1MY1A 1UTBA 1LAXA 4PBQA 4P3LA 4ZS9A 3GBBA 3LSFB 3EHSA 4OXVA 2F3BA 4PGNA 2O1MA 5LOMA 1N3XA 1FPLA 2DE4A 2G93A 4KCDA 4NF6A 4LQ5A 2QS2A 1KA0A 4EQBA 1VFDA 1SDXA 5JTYA 2Q8MA 3VDFA 3VVDA 5B7DA 3FVKA 4ISUA 1LB8A 1NUYA 2QSXA 3K0VA 3S4UA 3IB2A 3SDFA 1B5HA 3IOWA 4UABA 5CMKA 2F5XA 3OENA 1BLFA 3S9NC 4F2QA 5A5XB 3FASA 1JW5A 2ZZVA 2QS4A 5F7VA 3ONMA 5L9SA 1JEVA 4ZEFA 1MH4A 3FVOA 1FSAA 1FTMA 5LTCA 2QFLA 3CRBA 4DE8A 1M5BA 4XEQA 1B3LA 1SW5A 4E0XA 3CVGA 3I3VA 4QFPA 4ZEKA 2UVHA 1EZ9A 4G8NA 4X48A 3T9UA 2AIXA 4U4XA 4GWWA 4N17A 2VGQA 1MQJA 1G0HA 1LGBC 1OMPA 3K1PA 1DK4A 4FECA 4P11A 5IGAA 3RPLA 5L8DA 2Q8JA 2ABHA 4LP2B 2OWTA 3BIHA 4OEUA 1DOTA 1P1NA 4I3YA 3TCFA 2ZYNA 3C35A 4KI0E 5DVJA 3QAXA 3CIJA 5FHOA 3MW0A 1QUJA 4GLIA 4MEVA 1LBYA 1LBWA 2E1SA 3CSGA 3IK6B 3S9LC 4IR8A 3T0JA 4OENA 3T93B 1B3GA 3H6VA 2KR0A 4DDDA 1NV6A 2OJTA 2BJJX 3JV9A 3IB1A 1LFGA 4N6KA 1VDWA 2WX9A 1M5DA 4BDMA 3E9XA 5DVFA 4NTLA 2RKMA 4NF0A 4R9FA 1ZU0A 3SERA 3K02A 1LAGE 4XTCQ 4XIGQ 5EYHA 1MG1A 3C36A 5FHNA 3EF7A 2HXRA 4MH5A 3E78A 5I2NA 3G3FA 3IOUA 3VXBA 4N4UA 1ZTYA 5TP9A 5CBSA 4AS5A 3EPEA 1GV8A 4XXUA 1VR5A 1KA1A 5FBPA 1JEUA 2DWJA 1MY3A 3MZBA 1MXZA 4BDNA 4YKKA 4HXVA 4KQPA 2HQ0A 1OVBA 4GX6A 3L6GA 2OZZA 5ISUA 4PF8A 1WVJA 3GYYA 4EXLA 5AA2B 1XVXA 1VFEA 4R2BA 4MJOA 1YXIA 3IOVA 2BJIA 2Y7WA 4PFTA 3P7IA 4F31B 2OBGA 2DXRA 4YMBA 2KQZA 1QW0A 1Z7NE 4PDHA 4RNSA 1SBPA 5FHMA 1NV7A 4RY1A 4H1XA 4G8MA 4OVQA 2R6GE 4FEBA 2F8DA 2G29A 2I3VA 5K2XA 3OELA 2OLBA 4O8MA 1FTOA 4BLAA 2YLNA 1IMFA 2OWSA 4OQOA 2WYKA 3KFMA 3I5OA 1FPJA 3FV2A 3KC1A 1OIBA 2ZZXA 4N91A 4NF8B 2P3VA 2GHAA 2Y7RA 1Q1KA 2UVGA 4G4PA 3CR9A 5H8NA 2NUVA 2HPGA 5AA4A 3OO7A 4OVPA 2XXRA 4EDPA 4NE4A 4P47A 1NNTA 3KZGA 1IXGA 5BWJA 4WEPA 4F22A 3OMBA 4NF4A 4N8GA 4JXIA 4PAKA 5BUUA 3OO8A 2H98A 2RC7A 1AWBA 3RPWA 3MUQA 3JYRA 4LVQA 1DMBA 1IITA 3Q27A 4X1DA 4H46A 1NNFA 4PF6A 4G61A 4XKQA 4KR5A 2A5TA 2THIA 1N7WA 2DYXA 2VPOA 4R6KA 3PPPA 1EZOA 1QJMA 3ILUB 3FVNA 4OVTA 2PFZA 4PAFA 5AA3A 3LC8A 2F6PA 5EQ9A 3TTRA 3HV1A 2XD3A 3FATA 1QVSA 3O28A 1XHYA 2Y7PA 4GBVA 1FBFA 3E13X 2Q89A 1URSA 2O6AA 3PMWA 3RUMA 4YKJA 5FTHA 3F11A 1IXCA 3MAMA 3S2VA 4FORA 3CI8A 2FVZA 2QMWA 3K6UA 1LBXA 3LBSA 3MSTA 4FEDA 3B50A 4LATA 1FQBA 3MZ1A 3LSXA 2O84X 3VLWA 5ICQA 5A5LA 1B6HA 1CB6A 3W15C 3CG1A 4ZZEA 3H03A 3OEKA 3PD9A 1JVYA 3Q26A 4DXUA 4XFEA 1R6ZA 3C33A 2XWKA 5I2KA 4BDLA 1IMBA 4LZ5A 4N6DA 2WKYA 3PUVE 1XC1A 1TFDA 1FPFA 2OK2A 4F29A 2AL4A 4PE3A 5I58B 1SYIA 2GHBA 1FJ9A 2ONRA 3M8UA 4O7IA 2Q9TA 5I3SA 1D9QA 2NWJA 3QUJA 1WDNA 4HW8A 3HSTA 4EUOA 2X26A 2V25A 1JP4A 1YCJA 5ELVA 3PU5A 3MJNA 2PVUA 2F78A 3Q29A 3IB0A 4G2ZA 1RYXA 2DWHA 4BDRA 2V4CA 2UYEA 4R6YA 2CZIA 1B58A 2PT2A 4GRKA 4KFQA 3MP8A 2CZKA 3FXUA 1USYE 3RLFE 5L9OA 1QGXA 1HSLA 5F24A 3PGFA 5KCJA 2XD2A 1FW0A 1LBCA 4GF8A 2QJEA 5JEIA 3H4ZA 2ZNTA 5I57A 4JSDA 2DE2A 1SW2A 5J16A 4ZZAA 3SEXA 4LN5A 2QVUA 4HS7A 3IX1A 1MQDA 3E3KA 3HHGA 5KDTA 3RPLB 4G68B 3K01A 3N26A 3MQ9A 4PDDA 4YICA 5I2KB 2ZYKA 3T1BA 4AS4A 1DPEA 3DM0A 3U65A 3TODA 4YU0A 4TOZA 1DCUA 4KYDA 1AL3A 4O3CA 2CZHA 3HCQA 1MY0A 3IORA 2Z23A 1ZLQA 2H4IA 4H5GA 1JNFA 4OVRA 4K3FA 3BBRA 3MPLA 3THIA 1B5IA 1NNPA 4MIJA 3W9VA 1J1NA 4H6DA 1B0HA 2VHAA 4GQOA 1M5EA 1NV2A 4QXDA 1Q35A 5EQAA 3S9MC 3TEPA 1DTZA 2XXQA 1SQYA 3TAJA 4P9KA 4OWDA 1A8EA 4P1EA 2QPQA 1B51A 4JWYA 5DEXA 4R75A 2ZYOA 4GL0A 3EN3A 1N3WA 4FE8A 4XKPA 3LV0A 2UYFA 1B46A 4IB2A 3KN8A 2XXPA 2H25A 3H3GA 5I59A 3OOAA 4PCDA 4F1UA 4F2OA 2ONKE 1BTJA 1AMFA 1IEJA 3B6WA 4GWOA 4F3GA 1P1QA 4IGTA 3O66A 5KCJB 4F18A 4U22A 4POXA 3OSQA 2HAVA 4I3EA 4OERA 1N84A 1RYOA 1XVYA 1MXWA 2IEEA 1PBQA 2WYPA 3RN8A 2I49A 1OLAA 2HXWA 3O2AA 3IJOB 5I57B 2GRVA 1SVXB 3TCHA 1NV0A 3K1NA 3CFXA 3C32A 4Q30B 2B65A 3QMFA 2PYYA 5I58A 4H67A 1G0IA 2XXTA 3O97A 2I0BA 2JJKA 4JWOA 4L17A 2WEFA 4I40A 4U2RA 1L5TA 3UORA 2V93A 4QSEA 1JW1A 1IMCA 1ZIUA 1ELJA 2FIEA 5H8NB 4Q8RA 3TTKA 2ZYMA 4JVCA 2FNCA 3D1RA 4R6HA 4UA8A 3UK4A 2DDKA 3DP4A 2DWAA 3IOTA 4R2FA 3N5LA 4EQ7A 3B7DA 1LBBA 2F6GA 2DE3A 2FYIA 1GR2A 4N15A 2Y5KA 1Z7ME 4TLMB 1OQHA 3Q28A 2P1SA 3GBAA 3SEVA 4ZEIA 4ZEDA 2I6EA 2FIXA 4GWXA 1MXYA 4QBAA 4TLLB 2CZLA 2Y7IA 3LSLA 1B7ZA 2Q88A 3C9HA 2R9JA 1XT8A 1LSTA 4OFOA 4NMYA 5AA1A 4OANA 1MS7A 3UIFA 2QVVA 3H06B 2UXAA 5EHSA 3ECRA 1NH8A 3D4GA 2PBWA 1BKAA 2V3TA 4AB5A 1VE4A 4DCYA 4MMPA 1DPPA 1LLSA 1HSEA 4NWDA 2RF1A 1B5JA 4U23A 4RXLA 1NH7A 1O64A 1N0TA 1I6QA 2XWOA 3FIRA 2XWVA 3QYTA 4U4SA 4FJPA 4O3BA 4OFJA 1EZPA 5DVIA 4KPTA 3W9WA 3A3CA 2AYSA 5B70A 1FQCA 3VLUA 2I48A 3FGSA 5H8SA 2A5TB 3PUWE 3B6QA 2XXXA 4PBHA 2F36A 4HE1A 2XXVA 5IAIA 4H8IA 4R72A 2RINA 3A09A 1BIYA 2ZZWA 3BFUA 5DT6A 1NV4A 3CFZA 5CMMA 3T22A 4ESXA 3SKPA 3PPQA 3PD8A 5CI5A 4BDOA 3PPRA 4MLVA 3TQLA 2XWIA 2HAUA 3SETA 3TPAA 1JVXA 5EQ7A 3RT8A 3C34A 1RDXA 3HFUA 1UTHB 5DTBA 4IGRA 1A7LA 4JVDA 1FTLA 3RT6B 4EQ9A 1B52A 2XXUA 4NX1A 1S7YA 4C0RA 4PAIA 2V3QA 3TTLA 4QFKA 3KN7A 2WBDA 4U1OA 4GBWA 3R7XA 1S9TA 5KZTA 1MPDA 5I59B 2Q2AA 3NOHA 4IO5A 4H8JA 4ZECA 4Z0IA 3IO6A 1POY1 1FPGA 2XA5A 3HHFA 1A55A 1EYIA 3FXBA 2F97A 4PQJA 4IO6A 1WODA 2AL5A 1LEVA 4PFWA 2Y84A 1JETA 5DEXB 4RYAA 5EHMA 3MZ9A 5H8HA 1B9JA 1I69A 4F1YA 1NV3A 4P1LA 5K2YA 2VT5A 4PETA 4ZDMA 4ELQA 4GFRA 1GVCA 3RGYA 2L5VA 5TP9B 4X04A 5AA2A 3OD7A 3PMVA 3U94A 1MDP1 3VXCA 5CMCA 1MRPA 1ZBMA 1B7UA 2F35A 5I56B 1NL5A 4THIA 1NV1A 3TQWA 1NNKA 4YB5A 1H76A 3FJGA 1K9YA 3U93A 3CSBA 5ITOA 1SYHA 1A99A 3I6VA 4IO2A 4C1UA 2V84A 3HPIA 4LUBA 1PEBA 1TT1A 4EF1A 2NVUB 5ET5A 1B7HA 1PB8A 1JW4A 3FJ7A 4DXBA 1AOVA 2X7QA 4RJZA 4R9GA 1EU8A 4QFNA 2Z8FA 1NMUA 3R26A 4YB7A 3ILTB 1YZ0A 4G68A 4YAHX 4NG7A 1XS5A 1D9YA 4N81A 4G77A 2F7BA 5KDTB 5H8FA 4GWZA 1H43A 1FBHA 4MHFA 2B3BA 3EHTA 3VVFA 1LB9A 3SEWA 1MH3A 1P99A 3LR1A 3KN3A 3MPKA 1DTGA 3MBPA 2ANJA 4HTGA 1MQHA 5I7IA 1BP5A 3BKIB 1IMEA 4OHNA 5DW8A 3MVZA 4ZE8A 4NF5A 5H8QA 1CE2A 3GXAA 1FQFA 5ET6A 1NUXA 1Y3PA 4XF5A 4P0GA 3N94A 5ITPA 1Y4CA 4PGPA 2XX7A 1Q9DA 3SEYA 1I6AA 2RCBA 3G3KA 1SW1A 1UIUA 5AE4A 3ROJA 1FBEA 4GX4A 5HBCA 1B05A 1M5CA 2ESNA 3E4RA 2VP1A 3UN6A 3K6XA 1FPIA 2O7IA 4GL8A 3G3IA 2H99A 1EH3A 4ELPA 4QFOA 1IUDA 1YTVA 3C4MA 1K9ZA 3TTMA 5IZ1A 4RK9A 3O6HA 1FJ6A 4QSCA 3TELA 1M5FA 1FQAA 4OYVA 4DLDA 4QF9A 5LDZA 1B4HA 3PUYE 3T96B 2XHDA 1Y1ZA 5I84A 4YKIA 3G3HA 2A5SA 3QSLA 4GD5A 2D5WA 2HEUA 5DYHA 3RY3A 4N6PA 1AH5A 5JTYB 3E79A 1FTKA 4YB6A 1QULA 3D4CA 4HE2A 3TFLA 5A5XA 3RTWB 3RQTA 2KLFA 1ZKBA 5CBRA 5F1QA 2VPNA 4PFRA 1IMDA 4ELRA 1INPA 2HZLA 2RC8A 1KWHA 4IY5A 4MBPA 1OLCA 5ET8A 4YKPA 4ECFA 1FCKA 4NF6B 4M4GA 5IZ3A 5EYGA 3GLBA 2W7YA 4C1TA 4MAGA 1VSOA 1FRPA 1II5A 3O9PA 1PDAA 4OZ9A 3LSWA 2OWZA 3MVYA 3V8XB 1B0LA 4OVSA 2MKZA 3C31A 1MM7A 2H5YA 2M8CA 3SEUA 3KSJA 1IQ7A 4FIMA 2R71A 4F1VA 2QMXA 3EHUA 5ICTA 1ZJLA 3EQ1A 1ATGA 3M3LA 3TTNA 3VV5A 3DLNA 4FATA 1A54A 1BK4A 1B1XA 4JB7A 1FBPA 3WAFA 4TQUQ 4LA9A 1IZ1A 1D3KA 1US4A 4DXCA 1P1WA 5AA4B 4MX6A 3QIMA 3K2DA 5M2VA 1MDQA 3WAEA 4NF8A 1H44A 4YZZA 1MPCA 5IZZA 4QSDA 1F9BA 1PBPA 4XKNA 4NEDA 2YJPA 2F3DA 1B1HA 4RPOA 3N6UA 2O69A 2UVIA 1URDA 3M3KA 4JDFA 1HSJA 4X9TA 1FTAA 4OFLA 3FZVA 4H5FA 3MP6A 5AA2D 2DSFA 2DOJA 3VFJA 2ZMBA 1LCFA 3PUXE 4WKMA 1NKXA 4LONB 5CM6A 1SPIA 3S9EA 5CMBA 1YYZA 1LAHE 2F34A
chains in the Genus database with same CATH topology
1P1UA 4H8IA 4R72A 2RINA 3A09A 1BIYA 1IXHA 3F11A 4BDQA 3BFUA 1IXCA 5DT6A 2I3WA 3GZGA 4F3PA 1I6BA 4OETA 4IO7A 4ND9A 2F7CA 3CFZA 5CMMA 3MAMA 3IO4A 4QRZA 3S2VA 3K00A 3T22A 4LQ2A 2GFEA 4ESXA 2ZNUA 4MLQA 3PV0E 4OVJA 5L9MA 3FD3A 4FORA 3PPQA 4PE5B 3PD8A 3SKPA 5CI5A 1MQIA 4BDOA 3CI8A 1P1OA 3KEIA 1QKAA 3PPRA 4GIZA 2QMWA 4MLVA 1R9LA 3TQLA 5I56A 3FVGA 1O7TA 3IL1B 3K6UA 4EF2A 2HAUA 3V89B 4WXJA 3SETA 3TPAA 1JVXA 3RT8A 3C34A 3HO7A 3LBSA 1SW4A 4FEDA 4NF5B 3RTFB 3K6VA 3FXQA 1UTHB 2CMOA 3G7WA 4LATA 5DTBA 5H8FB 1FQBA 4IGRA 3MZ1A 3LSXA 1A7LA 2O84X 3TYHA 3UGWA 3VLWA 2DS9A 3H7MA 5ICQA 3MVWA 1FTLA 2UVJA 1B6HA 1CB6A 5CC2A 1B2HA 1PB9A 3O6IA 4JWXA 4RPOA 4KHZE 5H8HB 3RT6B 3W15C 3CG1A 4ZZEA 4EQ9A 3H03A 3IAZA 3IJXB 1B52A 3OEKA 1Y3NA 2XXUA 3ZS6A 4I1DA 2VOZA 1PB7A 2V3UA 3TDJA 1S7YA 3FV1A 4PFUA 3PD9A 5IKBA 1JVYA 3Q26A 1SI1A 3K6WA 4N13A 4C0RA 2V3QA 1R6ZA 2HFBA 1N7XA 3C33A 4KCCA 3TTLA 4QFKA 3MWBA 4F3SA 3OEMA 3KN7A 4U1OA 1MY1A 5I2KA 1UTBA 4BDLA 3R7XA 1LAXA 1S9TA 4LZ5A 5KZTA 4RA1A 1D4NA 1JQFA 2WKYA 1MPDA 4ZS9A 5I59B 3GBBA 3PUVE 1GTKA 1XC1A 2Q2AA 3LSFB 3QUFA 1TFDA 3EHSA 4IO5A 4OXVA 1MXUA 2OK2A 4F29A 2AL4A 4H8JA 4ZECA 2O1MA 4IO4A 5LOMA 4Z0IA 3QXMA 5I58B 1SYIA 2GHBA 3ZKKA 3IO6A 1POY1 2ONRA 1N3XA 3M8UA 3U92A 2DE4A 2G93A 3HHFA 3USDA 1A55A 5L9OA 4OTEA 2Q9TA 4KCDA 4NF6A 4QHQA 2NWJA 2F97A 4LQ5A 3QUJA 1WDNA 2QS2A 4PQJA 4HW8A 4IO6A 3HSTA 1WODA 2AL5A 4EQBA 4POWA 1VFDA 4EUOA 1SDXA 2X26A 2V25A 1JETA 2Y84A 4PFWA 5DEXB 1IIWA 4G68C 1YCJA 5JTYA 4RYAA 5ELVA 3VDFA 3VVDA 5B7DA 3FVKA 1QUKA 4U1ZA 3PU5A 1LB8A 4ISUA 3MJNA 5EHMA 2QSXA 3K0VA 3MZ9A 4NF4B 3IB2A 2QL3A 3OSRA 5H8HA 1B5HA 2PVUA 2F78A 4MFIA 3Q29A 4PP0A 3IB0A 3IOWA 4G2ZA 1B9JA 1I69A 1RYXA 1MQGA 1YAEA 2F5XA 2DWHA 3OENA 2O51A 5H8QB 4BDRA 1BLFA 2UYEA 4R6YA 5K2YA 3S9NC 3PPNA 1B58A 4F2QA 4ZE9A 1AIVA 5A5XB 1UTHA 1ZMGA 3FASA 1JW5A 2PT2A 4GRKA 2QS4A 3MP8A 4KFQA 5F7VA 4PETA 4ZDMA 3FXUA 4ELQA 4GFRA 4GXAA 1IXIA 2Z8EA 1GVCA 1USYE 3RGYA 5TP9B 3TMGA 3ONMA 4MF3A 5L9SA 5AA2A 1A40A 3OD7A 3PMVA 1JEVA 4ZEFA 1Y20A 3DP6A 3RLFE 1HSLA 1MH4A 1MDP1 3FVOA 1FTMA 3U94A 3PGFA 5HPQA 3DELB 3AXFA 3VXCA 1MRPA 1ZBMA 2F35A 1B7UA 3CRBA 4I9DA 5CMCA 5I56B 1NL5A 2XD2A 4M1VA 3R6UA 1FW0A 4THIA 4ZEBA 3TQWA 1LBCA 4GF8A 1POTA 4OEVA 1NNKA 2QJEA 4YB5A 5JEIA 1H76A 2ZNTA 3H4ZA 3FJGA 1YPNA 4X1BA 5I57A 4JSDA 2ALUA 4DE8A 2DE2A 1SW2A 3U93A 4ZZAA 1T0KA 3SEXA 3CSBA 5ITOA 1SYHA 1A99A 4HS7A 3I6VA 4H0WA 2F7AA 3ZSFA 4IO2A 4C1UA 3IX1A 1M5BA 2V84A 1MQDA 3E3KA 3HPIA 3HHGA 5KDTA 1B3LA 2XXHA 1SW5A 4LUBA 2IA4A 4E0XA 1PEBA 3L6HA 3CVGA 1TT1A 4EF1A 2NVUB 1FTJA 3G3GA 3I3VA 2ZNSA 4G68B 1B7HA 1UQWA 3K01A 3N26A 1PB8A 4QFPA 4ZEKA 5TPAA 1JW4A 2UVHA 3ODBA 1EZ9A 3FJ7A 3MQ9A 4G8NA 4DXBA 4YICA 5I2KB 1AOVA 2X7QA 2ZYKA 2I58A 4RJZA 4R9GA 4IY6A 2OCUA 4X48A 3T9UA 1DPEA 2AIXA 4U4XA 1EU8A 3DM0A 4QFNA 4UACA 3TODA 2VGQA 2Z8FA 1MQJA 3T9VA 4RPNA 1NMUA 2Z8DA 1H45A 3R26A 1LGBC 4Q0CA 4YB7A 1QKBA 1OMPA 3K1PA 4FECA 4YU0A 1TWYA 1LCTA 4P11A 3ILTB 4TOZA 4G68A 4YAHX 4KYDA 1AL3A 1S50A 5L8DA 2Q8JA 1XS5A 2ABHA 1D9YA 2OWTA 2GH9A 4LP2B 1Y1MA 4DIGA 4O3CA 5JK4A 3HCQA 1MY0A 1OQGA 2F7BA 4G77A 2ONSA 4GXSB 5H8FA 5KDTB 2XXIA 2P0SA 2YPNA 3IORA 1H43A 4OEUA 1B32A 2Z23A 1DOTA 1P1NA 1ZLQA 5I84A 2H4IA 3TCFA 2ZYNA 3C35A 3PMXA 3KJ7A 4H5GA 3KSXA 1JNFA 2B3BA 3S4UA 3EHTA 3SDFA 3VVFA 4KI0E 4K3FA 1LB9A 3SEWA 3BBRA 5DVJA 1MH3A 1P99A 3MPLA 2E0SA 3THIA 3LR1A 1O63A 1B5IA 3KN3A 1NNPA 4HCYA 3W9VA 3MPKA 1J1NA 1DTGA 3MBPA 2ANJA 3CIJA 3QAXA 5FHOA 3MW0A 4H6DA 1B0HA 1QUJA 2HCAA 4HTGA 4ONYA 4GLIA 4JSOA 1MPBA 4LZ7A 1NFTA 2VHAA 1MQHA 4GQOA 3HN0A 2E1SA 3CSGA 1M5EA 2DQVA 3IK6B 1N76A 5CMKA 3S9LC 1BP5A 3CFLA 2PT1A 3BKIB 4F19A 4OENA 4OHNA 1ANFA 4WEDA 3MVZA 4ZE8A 4NF5A 2QS1A 3T93B 1B3GA 3H6VA 2XXYA 2VD2A 5H8QA 4DDDA 1Q35A 2XXWA 2OJTA 4PFYA 1CE2A 2BJJX 3JV9A 1B3EA 1DTZA 2XXQA 3B6TA 3IB1A 5TU0A 1SQYA 1LFGA 3GXAA 3TAJA 1FQFA 3U8QA 1Y3PA 1M5DA 4P0GA 4OWDA 3N94A 1A8EA 2Y7KA 1Y4CA 5ITPA 2D21A 2XX7A 3SEYA 2QPQA 5I2NB 1I6AA 2RCBA 4KYEA 1B4ZA 1B51A 4JWYA 4OESA 4BDMA 5DEXA 3G3KA 3E9XA 5DVFA 4F39A 1LFIA 1R1NA 1SW1A 1UIUA 3OXNA 2RKMA 2ZYOA 4NTLA 4R75A 1ZU0A 4R9FA 3SERA 4DXUA 4GL0A 5EYFA 2I4CA 5AE4A 3EN3A 1N3WA 4U21A 5HBCA 4FE8A 1B05A 1M5CA 4XKPA 3U72A 2UYFA 1B46A 1LAFE 4IB2A 3K02A 2ESNA 3E4RA 2VP1A 3KGCA 2LAOA 3KN8A 1LAGE 3UN6A 2XXPA 3K6XA 2REJA 2H25A 4I62A 2ZXTA 4XTCQ 2O7IA 4XIGQ 3H3GA 5I59A 4GL8A 3OOAA 3G3IA 2DXYA 2H99A 1EH3A 1MG1A 3M3FA 4ELPA 4F1UA 3C36A 5FHNA 4F2OA 1R9QA 3EF7A 2ONKE 1BTJA 1AMFA 1IEJA 1IUDA 3B6WA 4QFOA 1YTVA 4YMAA 2PX1A 4GWOA 4F3GA 3C4MA 1P1QA 4IGTA 3TTMA 1OVTA 3O66A 2REGA 1UIVA 4MH5A 1RKMA 5I2NA 2Z22A 5KCJB 4F18A 3G3FA 3IOUA 5CRYA 4RK9A 3O6HA 4U22A 3OO6A 3KBRA 3VXBA 4POXA 4JBZA 4QSCA 3JZJA 3TELA 3OSQA 4QFLA 3FJMA 2HAVA 1M5FA 1ZTYA 4OERA 1FQAA 5TPAB 1N84A 5TP9A 1RYOA 4OYVA 4QF9A 4DLDA 5CBSA 3H6UA 3ZKLA 3U1OA 1US5A 3EPEA 1PC3A 1Y9UA 1B4HA 2QS3A 3PUYE 4Q5TA 4XXUA 1VR5A 2I4BA 1XVYA 1GV8A 3T96B 1MXWA 3V5AA 1TXFA 1JEUA 2DWJA 3KJTA 3UA8A 2IEEA 2XHDA 4IO3A 1PBQA 1Y1ZA 3RN8A 1MY3A 1OLAA 2I49A 3MZBA 1MXZA 2HXWA 3N6TA 4YKIA 1D9VA 4BDNA 3TUSA 3G3HA 2A5SA 3QSLA 3O2AA 4YKKA 4KQPA 4GD5A 5FTIA 3IJOB 1DSNA 2D5WA 2HQ0A 1TFAA 3VE1B 4DZ1A 5I57B 2HEUA 1OVBA 4KYSA 3L6GA 5DYHA 2OZZA 4N6PA 3RY3A 2QRYA 3K4UA 2GRVA 1AH5A 4O3AA 5JTYB 5ISUA 3IR1A 4N07A 1FTKA 1MY4A 3FXRA 1SVXB 2O68A 4YB6A 1WVJA 3V83A 4EXLA 5AA2B 1XVXA 3TCHA 1EZOA 1VFEA 3K1NA 3CFXA 1MM6A 1MXXA 1QULA 3C32A 4Q30B 2FA7A 3D4CA 4R2BA 2B65A 3VVEA 5HM4B 2PYYA 5I58A 1B3HA 3IOVA 3TFLA 2Y7WA 4PFTA 5A5XA 4H67A 3P7IA 4F31B 1LFHA 4RK2A 2XXTA 3QK6A 3O97A 2OBGA 4I8CA 2I0BA 3RTWB 5H8NB 3RQTA 4JWOA 4DCXA 4L17A 2DXRA 3T66A 2KLFA 4YMBA 1ZKBA 1Y4TA 1QW0A 3H6WA 5F1QA 1H3DA 3RNNA 4U2RA 5CBRA 3MC2A 1Z7NE 2D3IA 1L5TA 3UORA 4ELRA 4RNSA 1SBPA 2V93A 1N04A 2XXVA 4QSEA 3DP8A 1JW1A 5FHMA 2HZLA 2RC8A 1KWHA 3G3JA 4IY5A 2B3FA 1ZIUA 2RCAA 4MBPA 4H1XA 1OLCA 4G8MA 3TCGA 5KCJA 2XX8A 1ELJA 2R6GE 4FEBA 4YKPA 2F8DA 1FCKA 1QUIA 2G29A 4ECFA 2I3VA 3TTKA 4Q8RA 5K2XA 2ZYMA 3OELA 2OLBA 2P2AA 1FTOA 4NF6B 4BLAA 4M4GA 2YLNA 4GVOA 3A3UA 4EXKA 1Y3QA 2FNCA 3GLBA 2W7YA 1B3FA 4C1TA 2OWSA 3VLVA 3H6TA 4R6HA 1VSOA 4OQOA 4UA8A 3UK4A 3DP4A 1II5A 2DWAA 3O9PA 3K1MA 3IOTA 1PDAA 4F1YA 4OZ9A 3KFMA 3KOTA 4R2FA 3I5OA 3FV2A 3N5LA 4EQ7A 3LSWA 3B7DA 1MY2A 1LBBA 1OIBA 1XOCA 3MVYA 3V8XB 1SD3A 2F6GA 1B0LA 1A8FA 3O29A 2DE3A 2FYIA 4NF8B 1GR2A 2GHAA 2Y7RA 3C31A 4OMBA 1MM7A 1Q1KA 1SI0A 2UVGA 4AQ4A 2H5YA 2M8CA 3SEUA 2RC9A 3KSJA 1IQ7A 4FIMA 4G4PA 2Q2CA 2R71A 3CR9A 5H8NA 4XKRA 2NUVA 1Z7ME 4TLMB 2XX9A 1OQHA 3Q28A 2P1SA 4F1VA 3OO7A 3O6GA 5AA4A 2QMXA 3EHUA 3GBAA 5ICTA 1ZJLA 3MP1A 4HCWA 4GOTA 4R74A 2XXRA 4ZEIA 3SEVA 3EQ1A 2I6EA 4EDPA 4ZEDA 4R73A 1ATGA 3M3LA 4NE4A 3TTNA 3VV5A 1B40A 3DLNA 4FATA 1NNTA 1MXYA 3KZGA 1A54A 3KG2A 2NOOA 1IXGA 2O7UA 2O1LA 4TLLB 1B1XA 2DVZA 5BWJA 4JB7A 4H65A 2CZLA 3TZAA 1MXVA 2Y7IA 3LSLA 3WAFA 4Z7EA 1B7ZA 4WEPA 1GGGA 2X7PA 3UP9A 4ELOA 4F22A 4F3BA 4TQUQ 3OMBA 1USYH 2Q88A 4NF4A 3C9HA 3T9XB 4JXIA 2R9JA 4LA9A 1XT8A 1IZ1A 1D3KA 1LSTA 1US4A 3OO9A 4NMYA 4OFOA 4RY1A 5AA1A 4DXCA 5BUUA 1MS7A 3OO8A 3UIFA 2H98A 2RC7A 4ESWA 1P1WA 3H06B 5AA4B 3MVXA 2UXAA 5EHSA 3ECRA 1NH8A 3D4GA 3RPWA 2PBWA 2H9BA 3MUQA 1BKAA 3JYRA 4LVQA 1DMBA 2V3TA 3CG3A 4AB5A 4E0WA 3QIMA 1IITA 1VE4A 2PMSA 3K2DA 5M2VA 1MDQA 4DCYA 3Q27A 4X1DA 4KD5A 4NF8A 3WAEA 1DPPA 4P0IA 1LLSA 1HSEA 1NNFA 1H44A 4YZZA 1MPCA 3LUYA 3KOSA 4NWDA 4XKQA 2RF1A 4KR5A 4QSDA 1F9BA 2I0CA 2A5TA 1B5JA 3PPOA 2HZKA 1PBPA 4RXLA 4U23A 2THIA 1N7WA 4XKNA 3TKDA 1NH7A 1O64A 2DYXA 1N0TA 2YJPA 4NEDA 4NWCA 3S9MC 3TEPA 3T9HB 3PPPA 2VD3A 4R6KA 1B1HA 1I6QA 3N6UA 1QJMA 3FIRA 2O69A 3FVNA 1UTBB 3ILUB 3QYTA 4FJPA 4O3BA 4OFJA 4U4SA 2UVIA 5AA3A 3PUZE 1URDA 3LC8A 3M3KA 1EZPA 4JDFA 2F6PA 1HSJA 1FQEA 5DVIA 3TTRA 4G8HA 4X9TA 4KPTA 3W9WA 5J1DA 4OFLA 3SESA 3FZVA 3FUZA 3HV1A 2XD3A 4H5FA 3FATA 3BFTA 1QVSA 3MP6A 5AA2D 3A3CA 3O28A 2AYSA 2DSFA 2DOJA 4AB6A 1XHYA 3VFJA 4FAJA 2ZMBA 1LCFA 2Y7PA 3PUXE 5B70A 1FQCA 3VLUA 2I48A 4WKMA 1NKXA 3FGSA 3E13X 4LONB 2Q89A 5H8SA 2DWIA 2NXOA 5CM6A 1URSA 2A5TB 3PUWE 3B6QA 3S9EA 2O6AA 5CMBA 2XXXA 3PMWA 2F36A 2DP8A 3Q25A 1LAHE 4YKJA 4LZ8A 1URGA 2F34A 3RUMA 2DVCA 1FQDA 5IAIA 5FTHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P1U A;  4H8I A;  4R72 A;  2RIN A;  3A09 A;  1BIY A;  1IXH A;  3F11 A;  4BDQ A;  3BFU A;  1IXC A;  5DT6 A;  2I3W A;  3GZG A;  4F3P A;  1I6B A;  4OET A;  4IO7 A;  4ND9 A;  2F7C A;  3CFZ A;  5CMM A;  3MAM A;  3IO4 A;  4QRZ A;  3S2V A;  3K00 A;  3T22 A;  4LQ2 A;  2GFE A;  4ESX A;  2ZNU A;  4MLQ A;  3PV0 E;  4OVJ A;  5L9M A;  3FD3 A;  4FOR A;  3PPQ A;  4PE5 B;  3PD8 A;  3SKP A;  5CI5 A;  1MQI A;  4BDO A;  3CI8 A;  1P1O A;  3KEI A;  1QKA A;  3PPR A;  4GIZ A;  2QMW A;  4MLV A;  1R9L A;  3TQL A;  5I56 A;  3FVG A;  1O7T A;  3IL1 B;  3K6U A;  4EF2 A;  2HAU A;  3V89 B;  4WXJ A;  3SET A;  3TPA A;  1JVX A;  3RT8 A;  3C34 A;  3HO7 A;  3LBS A;  1SW4 A;  4FED A;  4NF5 B;  3RTF B;  3K6V A;  3FXQ A;  1UTH B;  2CMO A;  3G7W A;  4LAT A;  5DTB A;  5H8F B;  1FQB A;  4IGR A;  3MZ1 A;  3LSX A;  1A7L A;  2O84 X;  3TYH A;  3UGW A;  3VLW A;  2DS9 A;  3H7M A;  5ICQ A;  3MVW A;  1FTL A;  2UVJ A;  1B6H A;  1CB6 A;  5CC2 A;  1B2H A;  1PB9 A;  3O6I A;  4JWX A;  4RPO A;  4KHZ E;  5H8H B;  3RT6 B;  3W15 C;  3CG1 A;  4ZZE A;  4EQ9 A;  3H03 A;  3IAZ A;  3IJX B;  1B52 A;  3OEK A;  1Y3N A;  2XXU A;  3ZS6 A;  4I1D A;  2VOZ A;  1PB7 A;  2V3U A;  3TDJ A;  1S7Y A;  3FV1 A;  4PFU A;  3PD9 A;  5IKB A;  1JVY A;  3Q26 A;  1SI1 A;  3K6W A;  4N13 A;  4C0R A;  2V3Q A;  1R6Z A;  2HFB A;  1N7X A;  3C33 A;  4KCC A;  3TTL A;  4QFK A;  3MWB A;  4F3S A;  3OEM A;  3KN7 A;  4U1O A;  1MY1 A;  5I2K A;  1UTB A;  4BDL A;  3R7X A;  1LAX A;  1S9T A;  4LZ5 A;  5KZT A;  4RA1 A;  1D4N A;  1JQF A;  2WKY A;  1MPD A;  4ZS9 A;  5I59 B;  3GBB A;  3PUV E;  1GTK A;  1XC1 A;  2Q2A A;  3LSF B;  3QUF A;  1TFD A;  3EHS A;  4IO5 A;  4OXV A;  1MXU A;  2OK2 A;  4F29 A;  2AL4 A;  4H8J A;  4ZEC A;  2O1M A;  4IO4 A;  5LOM A;  4Z0I A;  3QXM A;  5I58 B;  1SYI A;  2GHB A;  3ZKK A;  3IO6 A;  1POY 1;  2ONR A;  1N3X A;  3M8U A;  3U92 A;  2DE4 A;  2G93 A;  3HHF A;  3USD A;  1A55 A;  5L9O A;  4OTE A;  2Q9T A;  4KCD A;  4NF6 A;  4QHQ A;  2NWJ A;  2F97 A;  4LQ5 A;  3QUJ A;  1WDN A;  2QS2 A;  4PQJ A;  4HW8 A;  4IO6 A;  3HST A;  1WOD A;  2AL5 A;  4EQB A;  4POW A;  1VFD A;  4EUO A;  1SDX A;  2X26 A;  2V25 A;  1JET A;  2Y84 A;  4PFW A;  5DEX B;  1IIW A;  4G68 C;  1YCJ A;  5JTY A;  4RYA A;  5ELV A;  3VDF A;  3VVD A;  5B7D A;  3FVK A;  1QUK A;  4U1Z A;  3PU5 A;  1LB8 A;  4ISU A;  3MJN A;  5EHM A;  2QSX A;  3K0V A;  3MZ9 A;  4NF4 B;  3IB2 A;  2QL3 A;  3OSR A;  5H8H A;  1B5H A;  2PVU A;  2F78 A;  4MFI A;  3Q29 A;  4PP0 A;  3IB0 A;  3IOW A;  4G2Z A;  1B9J A;  1I69 A;  1RYX A;  1MQG A;  1YAE A;  2F5X A;  2DWH A;  3OEN A;  2O51 A;  5H8Q B;  4BDR A;  1BLF A;  2UYE A;  4R6Y A;  5K2Y A;  3S9N C;  3PPN A;  1B58 A;  4F2Q A;  4ZE9 A;  1AIV A;  5A5X B;  1UTH A;  1ZMG A;  3FAS A;  1JW5 A;  2PT2 A;  4GRK A;  2QS4 A;  3MP8 A;  4KFQ A;  5F7V A;  4PET A;  4ZDM A;  3FXU A;  4ELQ A;  4GFR A;  4GXA A;  1IXI A;  2Z8E A;  1GVC A;  1USY E;  3RGY A;  5TP9 B;  3TMG A;  3ONM A;  4MF3 A;  5L9S A;  5AA2 A;  1A40 A;  3OD7 A;  3PMV A;  1JEV A;  4ZEF A;  1Y20 A;  3DP6 A;  3RLF E;  1HSL A;  1MH4 A;  1MDP 1;  3FVO A;  1FTM A;  3U94 A;  3PGF A;  5HPQ A;  3DEL B;  3AXF A;  3VXC A;  1MRP A;  1ZBM A;  2F35 A;  1B7U A;  3CRB A;  4I9D A;  5CMC A;  5I56 B;  1NL5 A;  2XD2 A;  4M1V A;  3R6U A;  1FW0 A;  4THI A;  4ZEB A;  3TQW A;  1LBC A;  4GF8 A;  1POT A;  4OEV A;  1NNK A;  2QJE A;  4YB5 A;  5JEI A;  1H76 A;  2ZNT A;  3H4Z A;  3FJG A;  1YPN A;  4X1B A;  5I57 A;  4JSD A;  2ALU A;  4DE8 A;  2DE2 A;  1SW2 A;  3U93 A;  4ZZA A;  1T0K A;  3SEX A;  3CSB A;  5ITO A;  1SYH A;  1A99 A;  4HS7 A;  3I6V A;  4H0W A;  2F7A A;  3ZSF A;  4IO2 A;  4C1U A;  3IX1 A;  1M5B A;  2V84 A;  1MQD A;  3E3K A;  3HPI A;  3HHG A;  5KDT A;  1B3L A;  2XXH A;  1SW5 A;  4LUB A;  2IA4 A;  4E0X A;  1PEB A;  3L6H A;  3CVG A;  1TT1 A;  4EF1 A;  2NVU B;  1FTJ A;  3G3G A;  3I3V A;  2ZNS A;  4G68 B;  1B7H A;  1UQW A;  3K01 A;  3N26 A;  1PB8 A;  4QFP A;  4ZEK A;  5TPA A;  1JW4 A;  2UVH A;  3ODB A;  1EZ9 A;  3FJ7 A;  3MQ9 A;  4G8N A;  4DXB A;  4YIC A;  5I2K B;  1AOV A;  2X7Q A;  2ZYK A;  2I58 A;  4RJZ A;  4R9G A;  4IY6 A;  2OCU A;  4X48 A;  3T9U A;  1DPE A;  2AIX A;  4U4X A;  1EU8 A;  3DM0 A;  4QFN A;  4UAC A;  3TOD A;  2VGQ A;  2Z8F A;  1MQJ A;  3T9V A;  4RPN A;  1NMU A;  2Z8D A;  1H45 A;  3R26 A;  1LGB C;  4Q0C A;  4YB7 A;  1QKB A;  1OMP A;  3K1P A;  4FEC A;  4YU0 A;  1TWY A;  1LCT A;  4P11 A;  3ILT B;  4TOZ A;  4G68 A;  4YAH X;  4KYD A;  1AL3 A;  1S50 A;  5L8D A;  2Q8J A;  1XS5 A;  2ABH A;  1D9Y A;  2OWT A;  2GH9 A;  4LP2 B;  1Y1M A;  4DIG A;  4O3C A;  5JK4 A;  3HCQ A;  1MY0 A;  1OQG A;  2F7B A;  4G77 A;  2ONS A;  4GXS B;  5H8F A;  5KDT B;  2XXI A;  2P0S A;  2YPN A;  3IOR A;  1H43 A;  4OEU A;  1B32 A;  2Z23 A;  1DOT A;  1P1N A;  1ZLQ A;  5I84 A;  2H4I A;  3TCF A;  2ZYN A;  3C35 A;  3PMX A;  3KJ7 A;  4H5G A;  3KSX A;  1JNF A;  2B3B A;  3S4U A;  3EHT A;  3SDF A;  3VVF A;  4KI0 E;  4K3F A;  1LB9 A;  3SEW A;  3BBR A;  5DVJ A;  1MH3 A;  1P99 A;  3MPL A;  2E0S A;  3THI A;  3LR1 A;  1O63 A;  1B5I A;  3KN3 A;  1NNP A;  4HCY A;  3W9V A;  3MPK A;  1J1N A;  1DTG A;  3MBP A;  2ANJ A;  3CIJ A;  3QAX A;  5FHO A;  3MW0 A;  4H6D A;  1B0H A;  1QUJ A;  2HCA A;  4HTG A;  4ONY A;  4GLI A;  4JSO A;  1MPB A;  4LZ7 A;  1NFT A;  2VHA A;  1MQH A;  4GQO A;  3HN0 A;  2E1S A;  3CSG A;  1M5E A;  2DQV A;  3IK6 B;  1N76 A;  5CMK A;  3S9L C;  1BP5 A;  3CFL A;  2PT1 A;  3BKI B;  4F19 A;  4OEN A;  4OHN A;  1ANF A;  4WED A;  3MVZ A;  4ZE8 A;  4NF5 A;  2QS1 A;  3T93 B;  1B3G A;  3H6V A;  2XXY A;  2VD2 A;  5H8Q A;  4DDD A;  1Q35 A;  2XXW A;  2OJT A;  4PFY A;  1CE2 A;  2BJJ X;  3JV9 A;  1B3E A;  1DTZ A;  2XXQ A;  3B6T A;  3IB1 A;  5TU0 A;  1SQY A;  1LFG A;  3GXA A;  3TAJ A;  1FQF A;  3U8Q A;  1Y3P A;  1M5D A;  4P0G A;  4OWD A;  3N94 A;  1A8E A;  2Y7K A;  1Y4C A;  5ITP A;  2D21 A;  2XX7 A;  3SEY A;  2QPQ A;  5I2N B;  1I6A A;  2RCB A;  4KYE A;  1B4Z A;  1B51 A;  4JWY A;  4OES A;  4BDM A;  5DEX A;  3G3K A;  3E9X A;  5DVF A;  4F39 A;  1LFI A;  1R1N A;  1SW1 A;  1UIU A;  3OXN A;  2RKM A;  2ZYO A;  4NTL A;  4R75 A;  1ZU0 A;  4R9F A;  3SER A;  4DXU A;  4GL0 A;  5EYF A;  2I4C A;  5AE4 A;  3EN3 A;  1N3W A;  4U21 A;  5HBC A;  4FE8 A;  1B05 A;  1M5C A;  4XKP A;  3U72 A;  2UYF A;  1B46 A;  1LAF E;  4IB2 A;  3K02 A;  2ESN A;  3E4R A;  2VP1 A;  3KGC A;  2LAO A;  3KN8 A;  1LAG E;  3UN6 A;  2XXP A;  3K6X A;  2REJ A;  2H25 A;  4I62 A;  2ZXT A;  4XTC Q;  2O7I A;  4XIG Q;  3H3G A;  5I59 A;  4GL8 A;  3OOA A;  3G3I A;  2DXY A;  2H99 A;  1EH3 A;  1MG1 A;  3M3F A;  4ELP A;  4F1U A;  3C36 A;  5FHN A;  4F2O A;  1R9Q A;  3EF7 A;  2ONK E;  1BTJ A;  1AMF A;  1IEJ A;  1IUD A;  3B6W A;  4QFO A;  1YTV A;  4YMA A;  2PX1 A;  4GWO A;  4F3G A;  3C4M A;  1P1Q A;  4IGT A;  3TTM A;  1OVT A;  3O66 A;  2REG A;  1UIV A;  4MH5 A;  1RKM A;  5I2N A;  2Z22 A;  5KCJ B;  4F18 A;  3G3F A;  3IOU A;  5CRY A;  4RK9 A;  3O6H A;  4U22 A;  3OO6 A;  3KBR A;  3VXB A;  4POX A;  4JBZ A;  4QSC A;  3JZJ A;  3TEL A;  3OSQ A;  4QFL A;  3FJM A;  2HAV A;  1M5F A;  1ZTY A;  4OER A;  1FQA A;  5TPA B;  1N84 A;  5TP9 A;  1RYO A;  4OYV A;  4QF9 A;  4DLD A;  5CBS A;  3H6U A;  3ZKL A;  3U1O A;  1US5 A;  3EPE A;  1PC3 A;  1Y9U A;  1B4H A;  2QS3 A;  3PUY E;  4Q5T A;  4XXU A;  1VR5 A;  2I4B A;  1XVY A;  1GV8 A;  3T96 B;  1MXW A;  3V5A A;  1TXF A;  1JEU A;  2DWJ A;  3KJT A;  3UA8 A;  2IEE A;  2XHD A;  4IO3 A;  1PBQ A;  1Y1Z A;  3RN8 A;  1MY3 A;  1OLA A;  2I49 A;  3MZB A;  1MXZ A;  2HXW A;  3N6T A;  4YKI A;  1D9V A;  4BDN A;  3TUS A;  3G3H A;  2A5S A;  3QSL A;  3O2A A;  4YKK A;  4KQP A;  4GD5 A;  5FTI A;  3IJO B;  1DSN A;  2D5W A;  2HQ0 A;  1TFA A;  3VE1 B;  4DZ1 A;  5I57 B;  2HEU A;  1OVB A;  4KYS A;  3L6G A;  5DYH A;  2OZZ A;  4N6P A;  3RY3 A;  2QRY A;  3K4U A;  2GRV A;  1AH5 A;  4O3A A;  5JTY B;  5ISU A;  3IR1 A;  4N07 A;  1FTK A;  1MY4 A;  3FXR A;  1SVX B;  2O68 A;  4YB6 A;  1WVJ A;  3V83 A;  4EXL A;  5AA2 B;  1XVX A;  3TCH A;  1EZO A;  1VFE A;  3K1N A;  3CFX A;  1MM6 A;  1MXX A;  1QUL A;  3C32 A;  4Q30 B;  2FA7 A;  3D4C A;  4R2B A;  2B65 A;  3VVE A;  5HM4 B;  2PYY A;  5I58 A;  1B3H A;  3IOV A;  3TFL A;  2Y7W A;  4PFT A;  5A5X A;  4H67 A;  3P7I A;  4F31 B;  1LFH A;  4RK2 A;  2XXT A;  3QK6 A;  3O97 A;  2OBG A;  4I8C A;  2I0B A;  3RTW B;  5H8N B;  3RQT A;  4JWO A;  4DCX A;  4L17 A;  2DXR A;  3T66 A;  2KLF A;  4YMB A;  1ZKB A;  1Y4T A;  1QW0 A;  3H6W A;  5F1Q A;  1H3D A;  3RNN A;  4U2R A;  5CBR A;  3MC2 A;  1Z7N E;  2D3I A;  1L5T A;  3UOR A;  4ELR A;  4RNS A;  1SBP A;  2V93 A;  1N04 A;  2XXV A;  4QSE A;  3DP8 A;  1JW1 A;  5FHM A;  2HZL A;  2RC8 A;  1KWH A;  3G3J A;  4IY5 A;  2B3F A;  1ZIU A;  2RCA A;  4MBP A;  4H1X A;  1OLC A;  4G8M A;  3TCG A;  5KCJ A;  2XX8 A;  1ELJ A;  2R6G E;  4FEB A;  4YKP A;  2F8D A;  1FCK A;  1QUI A;  2G29 A;  4ECF A;  2I3V A;  3TTK A;  4Q8R A;  5K2X A;  2ZYM A;  3OEL A;  2OLB A;  2P2A A;  1FTO A;  4NF6 B;  4BLA A;  4M4G A;  2YLN A;  4GVO A;  3A3U A;  4EXK A;  1Y3Q A;  2FNC A;  3GLB A;  2W7Y A;  1B3F A;  4C1T A;  2OWS A;  3VLV A;  3H6T A;  4R6H A;  1VSO A;  4OQO A;  4UA8 A;  3UK4 A;  3DP4 A;  1II5 A;  2DWA A;  3O9P A;  3K1M A;  3IOT A;  1PDA A;  4F1Y A;  4OZ9 A;  3KFM A;  3KOT A;  4R2F A;  3I5O A;  3FV2 A;  3N5L A;  4EQ7 A;  3LSW A;  3B7D A;  1MY2 A;  1LBB A;  1OIB A;  1XOC A;  3MVY A;  3V8X B;  1SD3 A;  2F6G A;  1B0L A;  1A8F A;  3O29 A;  2DE3 A;  2FYI A;  4NF8 B;  1GR2 A;  2GHA A;  2Y7R A;  3C31 A;  4OMB A;  1MM7 A;  1Q1K A;  1SI0 A;  2UVG A;  4AQ4 A;  2H5Y A;  2M8C A;  3SEU A;  2RC9 A;  3KSJ A;  1IQ7 A;  4FIM A;  4G4P A;  2Q2C A;  2R71 A;  3CR9 A;  5H8N A;  4XKR A;  2NUV A;  1Z7M E;  4TLM B;  2XX9 A;  1OQH A;  3Q28 A;  2P1S A;  4F1V A;  3OO7 A;  3O6G A;  5AA4 A;  2QMX A;  3EHU A;  3GBA A;  5ICT A;  1ZJL A;  3MP1 A;  4HCW A;  4GOT A;  4R74 A;  2XXR A;  4ZEI A;  3SEV A;  3EQ1 A;  2I6E A;  4EDP A;  4ZED A;  4R73 A;  1ATG A;  3M3L A;  4NE4 A;  3TTN A;  3VV5 A;  1B40 A;  3DLN A;  4FAT A;  1NNT A;  1MXY A;  3KZG A;  1A54 A;  3KG2 A;  2NOO A;  1IXG A;  2O7U A;  2O1L A;  4TLL B;  1B1X A;  2DVZ A;  5BWJ A;  4JB7 A;  4H65 A;  2CZL A;  3TZA A;  1MXV A;  2Y7I A;  3LSL A;  3WAF A;  4Z7E A;  1B7Z A;  4WEP A;  1GGG A;  2X7P A;  3UP9 A;  4ELO A;  4F22 A;  4F3B A;  4TQU Q;  3OMB A;  1USY H;  2Q88 A;  4NF4 A;  3C9H A;  3T9X B;  4JXI A;  2R9J A;  4LA9 A;  1XT8 A;  1IZ1 A;  1D3K A;  1LST A;  1US4 A;  3OO9 A;  4NMY A;  4OFO A;  4RY1 A;  5AA1 A;  4DXC A;  5BUU A;  1MS7 A;  3OO8 A;  3UIF A;  2H98 A;  2RC7 A;  4ESW A;  1P1W A;  3H06 B;  5AA4 B;  3MVX A;  2UXA A;  5EHS A;  3ECR A;  1NH8 A;  3D4G A;  3RPW A;  2PBW A;  2H9B A;  3MUQ A;  1BKA A;  3JYR A;  4LVQ A;  1DMB A;  2V3T A;  3CG3 A;  4AB5 A;  4E0W A;  3QIM A;  1IIT A;  1VE4 A;  2PMS A;  3K2D A;  5M2V A;  1MDQ A;  4DCY A;  3Q27 A;  4X1D A;  4KD5 A;  4NF8 A;  3WAE A;  1DPP A;  4P0I A;  1LLS A;  1HSE A;  1NNF A;  1H44 A;  4YZZ A;  1MPC A;  3LUY A;  3KOS A;  4NWD A;  4XKQ A;  2RF1 A;  4KR5 A;  4QSD A;  1F9B A;  2I0C A;  2A5T A;  1B5J A;  3PPO A;  2HZK A;  1PBP A;  4RXL A;  4U23 A;  2THI A;  1N7W A;  4XKN A;  3TKD A;  1NH7 A;  1O64 A;  2DYX A;  1N0T A;  2YJP A;  4NED A;  4NWC A;  3S9M C;  3TEP A;  3T9H B;  3PPP A;  2VD3 A;  4R6K A;  1B1H A;  1I6Q A;  3N6U A;  1QJM A;  3FIR A;  2O69 A;  3FVN A;  1UTB B;  3ILU B;  3QYT A;  4FJP A;  4O3B A;  4OFJ A;  4U4S A;  2UVI A;  5AA3 A;  3PUZ E;  1URD A;  3LC8 A;  3M3K A;  1EZP A;  4JDF A;  2F6P A;  1HSJ A;  1FQE A;  5DVI A;  3TTR A;  4G8H A;  4X9T A;  4KPT A;  3W9W A;  5J1D A;  4OFL A;  3SES A;  3FZV A;  3FUZ A;  3HV1 A;  2XD3 A;  4H5F A;  3FAT A;  3BFT A;  1QVS A;  3MP6 A;  5AA2 D;  3A3C A;  3O28 A;  2AYS A;  2DSF A;  2DOJ A;  4AB6 A;  1XHY A;  3VFJ A;  4FAJ A;  2ZMB A;  1LCF A;  2Y7P A;  3PUX E;  5B70 A;  1FQC A;  3VLU A;  2I48 A;  4WKM A;  1NKX A;  3FGS A;  3E13 X;  4LON B;  2Q89 A;  5H8S A;  2DWI A;  2NXO A;  5CM6 A;  1URS A;  2A5T B;  3PUW E;  3B6Q A;  3S9E A;  2O6A A;  5CMB A;  2XXX A;  3PMW A;  2F36 A;  2DP8 A;  3Q25 A;  1LAH E;  4YKJ A;  4LZ8 A;  1URG A;  2F34 A;  3RUM A;  2DVC A;  1FQD A;  5IAI A;  5FTH A; 
#chains in the Genus database with same CATH topology
 1P1U A;  5ESY A;  4F3P A;  3GZG A;  4ND9 A;  3IO4 A;  4QRZ A;  4LQ2 A;  2GFE A;  5IM2 A;  3FBP A;  3FD3 A;  4PE5 B;  3KEI A;  1QKA A;  5I56 A;  1R9L A;  3IL1 B;  4EF2 A;  3V89 B;  1FPD A;  1SW4 A;  3RTF B;  3K6V A;  3FXQ A;  3G7W A;  2CMO A;  3IFC A;  3TYH A;  3UGW A;  2P3N A;  3MVW A;  2GQ1 A;  1B2H A;  5H8H B;  4KHZ E;  3IAZ A;  3IJX B;  4OA4 A;  2V3U A;  4PFU A;  5IKB A;  4N13 A;  2HFB A;  4KCC A;  3MWB A;  4F3S A;  3OEM A;  4RA1 A;  1D4N A;  1JQF A;  2CEX A;  2PFY A;  1GTK A;  3QUF A;  4JVI A;  4PC9 A;  1MXU A;  4DI3 D;  4IO4 A;  2FBP A;  3QXM A;  3ZKK A;  3U92 A;  3USD A;  4OTE A;  4QHQ A;  4POW A;  1IIW A;  4G68 C;  1QUK A;  4U1Z A;  3RYD A;  4NF4 B;  3A29 A;  2QL3 A;  3OSR A;  4MFI A;  4PP0 A;  1MQG A;  1YAE A;  5H8Q B;  2O51 A;  3PPN A;  4ZE9 A;  1AIV A;  1UTH A;  1ZMG A;  4GXA A;  1IXI A;  2Z8E A;  3TMG A;  4MF3 A;  1A40 A;  1Y20 A;  2CEY A;  3DP6 A;  5HPQ A;  3DEL B;  3AXF A;  1FBC A;  2B4L A;  4I9D A;  4M1V A;  3R6U A;  4ZEB A;  4OEV A;  1POT A;  4X1B A;  1YPN A;  2ALU A;  1T0K A;  4HE0 A;  4H0W A;  2F7A A;  3ZSF A;  4N8Y A;  4NAP A;  2XXH A;  2IA4 A;  4FBP A;  3L6H A;  1FTJ A;  3G3G A;  2ZNS A;  1UQW A;  4GWY A;  5TPA A;  3ODB A;  2I58 A;  4IY6 A;  2OCU A;  4UAC A;  2PCR A;  3T9V A;  4RPN A;  2Z8D A;  1H45 A;  4Q0C A;  3MYU A;  1QKB A;  1TWY A;  1LCT A;  4GWS A;  1S50 A;  4PFB A;  4DIG A;  5JK4 A;  2GH9 A;  1Y1M A;  1OQG A;  2ONS A;  4GXS B;  2XXI A;  1NUZ A;  2P0S A;  2YPN A;  1B32 A;  3PMX A;  3KJ7 A;  3KSX A;  4H45 A;  2E0S A;  1O63 A;  2XXK A;  1RDY A;  4HCY A;  4NHB A;  2HCA A;  4ONY A;  4JSO A;  1MPB A;  4LZ7 A;  1NFT A;  4O94 A;  5ET7 A;  3HN0 A;  4X8R A;  2FHY A;  2DQV A;  1N76 A;  3CFL A;  2PT1 A;  4F19 A;  1ANF A;  4WED A;  2QS1 A;  2XXY A;  2VD2 A;  4NGU A;  2XXW A;  4PFY A;  1B3E A;  3B6T A;  5TU0 A;  3U8Q A;  2Y7K A;  2D21 A;  1RDZ A;  5I2N B;  3LUZ A;  4KYE A;  1B4Z A;  4OES A;  4F39 A;  1LFI A;  1R1N A;  4NQ8 A;  2QVR A;  3OXN A;  5EYF A;  2I4C A;  4U21 A;  2HHM A;  4MNI A;  3U72 A;  1LAF E;  3KGC A;  2LAO A;  2REJ A;  4I62 A;  2ZXT A;  4GX3 A;  4MNP A;  1FBG A;  2DXY A;  4GWU A;  3M3F A;  1R9Q A;  4YMA A;  2PX1 A;  1OVT A;  2REG A;  1UIV A;  4P8B A;  1RKM A;  2Z22 A;  5CRY A;  3OO6 A;  3KBR A;  4JBZ A;  3JZJ A;  4QFL A;  3FJM A;  5TPA B;  3H6U A;  3ZKL A;  2Q74 A;  3U1O A;  1US5 A;  1PC3 A;  1Y9U A;  2QS3 A;  4Q5T A;  3V5A A;  2I4B A;  1TXF A;  3KJT A;  3UA8 A;  4IO3 A;  3N6T A;  1D9V A;  3TUS A;  5FTI A;  1DSN A;  1TFA A;  3VE1 B;  4DZ1 A;  4KYS A;  2QRY A;  3K4U A;  4O3A A;  3IR1 A;  4N07 A;  3B8B A;  1MY4 A;  2OX3 A;  3FXR A;  1IMA A;  2O68 A;  3V83 A;  1MM6 A;  1MXX A;  2FA7 A;  5HM4 B;  3VVE A;  2WBB A;  1B3H A;  1NUW A;  1XI6 A;  1FPB A;  1LFH A;  4RK2 A;  3QK6 A;  4I8C A;  4DCX A;  3T66 A;  1FBD A;  1Y4T A;  3RNN A;  3H6W A;  1H3D A;  3MC2 A;  2D3I A;  1DBZ A;  1N04 A;  3DP8 A;  3G3J A;  3TCG A;  2B3F A;  2RCA A;  5IZ3 B;  2XX8 A;  1QUI A;  2P2A A;  4GVO A;  3A3U A;  4EXK A;  1Y3Q A;  1B3F A;  3VLV A;  3H6T A;  3K1M A;  3KOT A;  1MY2 A;  1XOC A;  3IFA A;  1SD3 A;  5EQ8 A;  1A8F A;  3O29 A;  4O7M A;  4AQ4 A;  4OMB A;  1SI0 A;  2R8T A;  2RC9 A;  2Q2C A;  4XKR A;  2XX9 A;  3O6G A;  3MP1 A;  4HCW A;  4R74 A;  4GOT A;  3KC0 A;  4R73 A;  1B40 A;  3KG2 A;  2NOO A;  3PTY A;  4DI4 B;  2O7U A;  2O1L A;  2DVZ A;  4H65 A;  3TZA A;  1MXV A;  4Z7E A;  1GGG A;  2X7P A;  3UP9 A;  4ELO A;  4F3B A;  1USY H;  3T9X B;  3ISP A;  3OO9 A;  4PTK A;  1FPE A;  3KBZ A;  3MVX A;  2H9B A;  1EYK A;  3CG3 A;  4E0W A;  2PMS A;  4MNC A;  4KD5 A;  4P0I A;  2Y5L A;  3LUY A;  3KOS A;  2I0C A;  3PPO A;  3CHG A;  2HZK A;  3TKD A;  2B4M A;  4NWC A;  3T9H B;  4ESW A;  2VD3 A;  1UTB B;  3PUZ E;  4NN3 A;  5T3J A;  1FQE A;  4G8H A;  5J1D A;  3SES A;  3FUZ A;  3BFT A;  4AB6 A;  4FAJ A;  3BIG A;  1LBZ A;  2DWI A;  2NXO A;  1NI9 A;  3Q25 A;  2DP8 A;  4LZ8 A;  1URG A;  2DVC A;  1I6B A;  1FQD A;  1CNQ A;  1IXH A;  4BDQ A;  2I3W A;  4OET A;  4IO7 A;  2F7C A;  4P56 A;  3K00 A;  1LBV A;  2ZNU A;  4MLQ A;  3PV0 E;  4OVJ A;  5L9M A;  4KXP A;  1MQI A;  1P1O A;  4GIZ A;  4MCO A;  1FPK A;  3FVG A;  1O7T A;  4WXJ A;  3HO7 A;  1NV5 A;  3EKI A;  4PFI A;  4NF5 B;  5H8F B;  2DS9 A;  3H7M A;  5I5P A;  2UVJ A;  5CC2 A;  3SZP A;  1PB9 A;  3O6I A;  4JWX A;  1KZ8 A;  3ZS6 A;  1Y3N A;  4I1D A;  2VOZ A;  1PB7 A;  3TDJ A;  3FV1 A;  1SI1 A;  3K6W A;  1N7X A;  1EYJ A;  1MY1 A;  1UTB A;  1LAX A;  4PBQ A;  4P3L A;  4ZS9 A;  3GBB A;  3LSF B;  3EHS A;  4OXV A;  2F3B A;  4PGN A;  2O1M A;  5LOM A;  1N3X A;  1FPL A;  2DE4 A;  2G93 A;  4KCD A;  4NF6 A;  4LQ5 A;  2QS2 A;  1KA0 A;  4EQB A;  1VFD A;  1SDX A;  5JTY A;  2Q8M A;  3VDF A;  3VVD A;  5B7D A;  3FVK A;  4ISU A;  1LB8 A;  1NUY A;  2QSX A;  3K0V A;  3S4U A;  3IB2 A;  3SDF A;  1B5H A;  3IOW A;  4UAB A;  5CMK A;  2F5X A;  3OEN A;  1BLF A;  3S9N C;  4F2Q A;  5A5X B;  3FAS A;  1JW5 A;  2ZZV A;  2QS4 A;  5F7V A;  3ONM A;  5L9S A;  1JEV A;  4ZEF A;  1MH4 A;  3FVO A;  1FSA A;  1FTM A;  5LTC A;  2QFL A;  3CRB A;  4DE8 A;  1M5B A;  4XEQ A;  1B3L A;  1SW5 A;  4E0X A;  3CVG A;  3I3V A;  4QFP A;  4ZEK A;  2UVH A;  1EZ9 A;  4G8N A;  4X48 A;  3T9U A;  2AIX A;  4U4X A;  4GWW A;  4N17 A;  2VGQ A;  1MQJ A;  1G0H A;  1LGB C;  1OMP A;  3K1P A;  1DK4 A;  4FEC A;  4P11 A;  5IGA A;  3RPL A;  5L8D A;  2Q8J A;  2ABH A;  4LP2 B;  2OWT A;  3BIH A;  4OEU A;  1DOT A;  1P1N A;  4I3Y A;  3TCF A;  2ZYN A;  3C35 A;  4KI0 E;  5DVJ A;  3QAX A;  3CIJ A;  5FHO A;  3MW0 A;  1QUJ A;  4GLI A;  4MEV A;  1LBY A;  1LBW A;  2E1S A;  3CSG A;  3IK6 B;  3S9L C;  4IR8 A;  3T0J A;  4OEN A;  3T93 B;  1B3G A;  3H6V A;  2KR0 A;  4DDD A;  1NV6 A;  2OJT A;  2BJJ X;  3JV9 A;  3IB1 A;  1LFG A;  4N6K A;  1VDW A;  2WX9 A;  1M5D A;  4BDM A;  3E9X A;  5DVF A;  4NTL A;  2RKM A;  4NF0 A;  4R9F A;  1ZU0 A;  3SER A;  3K02 A;  1LAG E;  4XTC Q;  4XIG Q;  5EYH A;  1MG1 A;  3C36 A;  5FHN A;  3EF7 A;  2HXR A;  4MH5 A;  3E78 A;  5I2N A;  3G3F A;  3IOU A;  3VXB A;  4N4U A;  1ZTY A;  5TP9 A;  5CBS A;  4AS5 A;  3EPE A;  1GV8 A;  4XXU A;  1VR5 A;  1KA1 A;  5FBP A;  1JEU A;  2DWJ A;  1MY3 A;  3MZB A;  1MXZ A;  4BDN A;  4YKK A;  4HXV A;  4KQP A;  2HQ0 A;  1OVB A;  4GX6 A;  3L6G A;  2OZZ A;  5ISU A;  4PF8 A;  1WVJ A;  3GYY A;  4EXL A;  5AA2 B;  1XVX A;  1VFE A;  4R2B A;  4MJO A;  1YXI A;  3IOV A;  2BJI A;  2Y7W A;  4PFT A;  3P7I A;  4F31 B;  2OBG A;  2DXR A;  4YMB A;  2KQZ A;  1QW0 A;  1Z7N E;  4PDH A;  4RNS A;  1SBP A;  5FHM A;  1NV7 A;  4RY1 A;  4H1X A;  4G8M A;  4OVQ A;  2R6G E;  4FEB A;  2F8D A;  2G29 A;  2I3V A;  5K2X A;  3OEL A;  2OLB A;  4O8M A;  1FTO A;  4BLA A;  2YLN A;  1IMF A;  2OWS A;  4OQO A;  2WYK A;  3KFM A;  3I5O A;  1FPJ A;  3FV2 A;  3KC1 A;  1OIB A;  2ZZX A;  4N91 A;  4NF8 B;  2P3V A;  2GHA A;  2Y7R A;  1Q1K A;  2UVG A;  4G4P A;  3CR9 A;  5H8N A;  2NUV A;  2HPG A;  5AA4 A;  3OO7 A;  4OVP A;  2XXR A;  4EDP A;  4NE4 A;  4P47 A;  1NNT A;  3KZG A;  1IXG A;  5BWJ A;  4WEP A;  4F22 A;  3OMB A;  4NF4 A;  4N8G A;  4JXI A;  4PAK A;  5BUU A;  3OO8 A;  2H98 A;  2RC7 A;  1AWB A;  3RPW A;  3MUQ A;  3JYR A;  4LVQ A;  1DMB A;  1IIT A;  3Q27 A;  4X1D A;  4H46 A;  1NNF A;  4PF6 A;  4G61 A;  4XKQ A;  4KR5 A;  2A5T A;  2THI A;  1N7W A;  2DYX A;  2VPO A;  4R6K A;  3PPP A;  1EZO A;  1QJM A;  3ILU B;  3FVN A;  4OVT A;  2PFZ A;  4PAF A;  5AA3 A;  3LC8 A;  2F6P A;  5EQ9 A;  3TTR A;  3HV1 A;  2XD3 A;  3FAT A;  1QVS A;  3O28 A;  1XHY A;  2Y7P A;  4GBV A;  1FBF A;  3E13 X;  2Q89 A;  1URS A;  2O6A A;  3PMW A;  3RUM A;  4YKJ A;  5FTH A;  3F11 A;  1IXC A;  3MAM A;  3S2V A;  4FOR A;  3CI8 A;  2FVZ A;  2QMW A;  3K6U A;  1LBX A;  3LBS A;  3MST A;  4FED A;  3B50 A;  4LAT A;  1FQB A;  3MZ1 A;  3LSX A;  2O84 X;  3VLW A;  5ICQ A;  5A5L A;  1B6H A;  1CB6 A;  3W15 C;  3CG1 A;  4ZZE A;  3H03 A;  3OEK A;  3PD9 A;  1JVY A;  3Q26 A;  4DXU A;  4XFE A;  1R6Z A;  3C33 A;  2XWK A;  5I2K A;  4BDL A;  1IMB A;  4LZ5 A;  4N6D A;  2WKY A;  3PUV E;  1XC1 A;  1TFD A;  1FPF A;  2OK2 A;  4F29 A;  2AL4 A;  4PE3 A;  5I58 B;  1SYI A;  2GHB A;  1FJ9 A;  2ONR A;  3M8U A;  4O7I A;  2Q9T A;  5I3S A;  1D9Q A;  2NWJ A;  3QUJ A;  1WDN A;  4HW8 A;  3HST A;  4EUO A;  2X26 A;  2V25 A;  1JP4 A;  1YCJ A;  5ELV A;  3PU5 A;  3MJN A;  2PVU A;  2F78 A;  3Q29 A;  3IB0 A;  4G2Z A;  1RYX A;  2DWH A;  4BDR A;  2V4C A;  2UYE A;  4R6Y A;  2CZI A;  1B58 A;  2PT2 A;  4GRK A;  4KFQ A;  3MP8 A;  2CZK A;  3FXU A;  1USY E;  3RLF E;  5L9O A;  1QGX A;  1HSL A;  5F24 A;  3PGF A;  5KCJ A;  2XD2 A;  1FW0 A;  1LBC A;  4GF8 A;  2QJE A;  5JEI A;  3H4Z A;  2ZNT A;  5I57 A;  4JSD A;  2DE2 A;  1SW2 A;  5J16 A;  4ZZA A;  3SEX A;  4LN5 A;  2QVU A;  4HS7 A;  3IX1 A;  1MQD A;  3E3K A;  3HHG A;  5KDT A;  3RPL B;  4G68 B;  3K01 A;  3N26 A;  3MQ9 A;  4PDD A;  4YIC A;  5I2K B;  2ZYK A;  3T1B A;  4AS4 A;  1DPE A;  3DM0 A;  3U65 A;  3TOD A;  4YU0 A;  4TOZ A;  1DCU A;  4KYD A;  1AL3 A;  4O3C A;  2CZH A;  3HCQ A;  1MY0 A;  3IOR A;  2Z23 A;  1ZLQ A;  2H4I A;  4H5G A;  1JNF A;  4OVR A;  4K3F A;  3BBR A;  3MPL A;  3THI A;  1B5I A;  1NNP A;  4MIJ A;  3W9V A;  1J1N A;  4H6D A;  1B0H A;  2VHA A;  4GQO A;  1M5E A;  1NV2 A;  4QXD A;  1Q35 A;  5EQA A;  3S9M C;  3TEP A;  1DTZ A;  2XXQ A;  1SQY A;  3TAJ A;  4P9K A;  4OWD A;  1A8E A;  4P1E A;  2QPQ A;  1B51 A;  4JWY A;  5DEX A;  4R75 A;  2ZYO A;  4GL0 A;  3EN3 A;  1N3W A;  4FE8 A;  4XKP A;  3LV0 A;  2UYF A;  1B46 A;  4IB2 A;  3KN8 A;  2XXP A;  2H25 A;  3H3G A;  5I59 A;  3OOA A;  4PCD A;  4F1U A;  4F2O A;  2ONK E;  1BTJ A;  1AMF A;  1IEJ A;  3B6W A;  4GWO A;  4F3G A;  1P1Q A;  4IGT A;  3O66 A;  5KCJ B;  4F18 A;  4U22 A;  4POX A;  3OSQ A;  2HAV A;  4I3E A;  4OER A;  1N84 A;  1RYO A;  1XVY A;  1MXW A;  2IEE A;  1PBQ A;  2WYP A;  3RN8 A;  2I49 A;  1OLA A;  2HXW A;  3O2A A;  3IJO B;  5I57 B;  2GRV A;  1SVX B;  3TCH A;  1NV0 A;  3K1N A;  3CFX A;  3C32 A;  4Q30 B;  2B65 A;  3QMF A;  2PYY A;  5I58 A;  4H67 A;  1G0I A;  2XXT A;  3O97 A;  2I0B A;  2JJK A;  4JWO A;  4L17 A;  2WEF A;  4I40 A;  4U2R A;  1L5T A;  3UOR A;  2V93 A;  4QSE A;  1JW1 A;  1IMC A;  1ZIU A;  1ELJ A;  2FIE A;  5H8N B;  4Q8R A;  3TTK A;  2ZYM A;  4JVC A;  2FNC A;  3D1R A;  4R6H A;  4UA8 A;  3UK4 A;  2DDK A;  3DP4 A;  2DWA A;  3IOT A;  4R2F A;  3N5L A;  4EQ7 A;  3B7D A;  1LBB A;  2F6G A;  2DE3 A;  2FYI A;  1GR2 A;  4N15 A;  2Y5K A;  1Z7M E;  4TLM B;  1OQH A;  3Q28 A;  2P1S A;  3GBA A;  3SEV A;  4ZEI A;  4ZED A;  2I6E A;  2FIX A;  4GWX A;  1MXY A;  4QBA A;  4TLL B;  2CZL A;  2Y7I A;  3LSL A;  1B7Z A;  2Q88 A;  3C9H A;  2R9J A;  1XT8 A;  1LST A;  4OFO A;  4NMY A;  5AA1 A;  4OAN A;  1MS7 A;  3UIF A;  2QVV A;  3H06 B;  2UXA A;  5EHS A;  3ECR A;  1NH8 A;  3D4G A;  2PBW A;  1BKA A;  2V3T A;  4AB5 A;  1VE4 A;  4DCY A;  4MMP A;  1DPP A;  1LLS A;  1HSE A;  4NWD A;  2RF1 A;  1B5J A;  4U23 A;  4RXL A;  1NH7 A;  1O64 A;  1N0T A;  1I6Q A;  2XWO A;  3FIR A;  2XWV A;  3QYT A;  4U4S A;  4FJP A;  4O3B A;  4OFJ A;  1EZP A;  5DVI A;  4KPT A;  3W9W A;  3A3C A;  2AYS A;  5B70 A;  1FQC A;  3VLU A;  2I48 A;  3FGS A;  5H8S A;  2A5T B;  3PUW E;  3B6Q A;  2XXX A;  4PBH A;  2F36 A;  4HE1 A;  2XXV A;  5IAI A;  4H8I A;  4R72 A;  2RIN A;  3A09 A;  1BIY A;  2ZZW A;  3BFU A;  5DT6 A;  1NV4 A;  3CFZ A;  5CMM A;  3T22 A;  4ESX A;  3SKP A;  3PPQ A;  3PD8 A;  5CI5 A;  4BDO A;  3PPR A;  4MLV A;  3TQL A;  2XWI A;  2HAU A;  3SET A;  3TPA A;  1JVX A;  5EQ7 A;  3RT8 A;  3C34 A;  1RDX A;  3HFU A;  1UTH B;  5DTB A;  4IGR A;  1A7L A;  4JVD A;  1FTL A;  3RT6 B;  4EQ9 A;  1B52 A;  2XXU A;  4NX1 A;  1S7Y A;  4C0R A;  4PAI A;  2V3Q A;  3TTL A;  4QFK A;  3KN7 A;  2WBD A;  4U1O A;  4GBW A;  3R7X A;  1S9T A;  5KZT A;  1MPD A;  5I59 B;  2Q2A A;  3NOH A;  4IO5 A;  4H8J A;  4ZEC A;  4Z0I A;  3IO6 A;  1POY 1;  1FPG A;  2XA5 A;  3HHF A;  1A55 A;  1EYI A;  3FXB A;  2F97 A;  4PQJ A;  4IO6 A;  1WOD A;  2AL5 A;  1LEV A;  4PFW A;  2Y84 A;  1JET A;  5DEX B;  4RYA A;  5EHM A;  3MZ9 A;  5H8H A;  1B9J A;  1I69 A;  4F1Y A;  1NV3 A;  4P1L A;  5K2Y A;  2VT5 A;  4PET A;  4ZDM A;  4ELQ A;  4GFR A;  1GVC A;  3RGY A;  2L5V A;  5TP9 B;  4X04 A;  5AA2 A;  3OD7 A;  3PMV A;  3U94 A;  1MDP 1;  3VXC A;  5CMC A;  1MRP A;  1ZBM A;  1B7U A;  2F35 A;  5I56 B;  1NL5 A;  4THI A;  1NV1 A;  3TQW A;  1NNK A;  4YB5 A;  1H76 A;  3FJG A;  1K9Y A;  3U93 A;  3CSB A;  5ITO A;  1SYH A;  1A99 A;  3I6V A;  4IO2 A;  4C1U A;  2V84 A;  3HPI A;  4LUB A;  1PEB A;  1TT1 A;  4EF1 A;  2NVU B;  5ET5 A;  1B7H A;  1PB8 A;  1JW4 A;  3FJ7 A;  4DXB A;  1AOV A;  2X7Q A;  4RJZ A;  4R9G A;  1EU8 A;  4QFN A;  2Z8F A;  1NMU A;  3R26 A;  4YB7 A;  3ILT B;  1YZ0 A;  4G68 A;  4YAH X;  4NG7 A;  1XS5 A;  1D9Y A;  4N81 A;  4G77 A;  2F7B A;  5KDT B;  5H8F A;  4GWZ A;  1H43 A;  1FBH A;  4MHF A;  2B3B A;  3EHT A;  3VVF A;  1LB9 A;  3SEW A;  1MH3 A;  1P99 A;  3LR1 A;  3KN3 A;  3MPK A;  1DTG A;  3MBP A;  2ANJ A;  4HTG A;  1MQH A;  5I7I A;  1BP5 A;  3BKI B;  1IME A;  4OHN A;  5DW8 A;  3MVZ A;  4ZE8 A;  4NF5 A;  5H8Q A;  1CE2 A;  3GXA A;  1FQF A;  5ET6 A;  1NUX A;  1Y3P A;  4XF5 A;  4P0G A;  3N94 A;  5ITP A;  1Y4C A;  4PGP A;  2XX7 A;  1Q9D A;  3SEY A;  1I6A A;  2RCB A;  3G3K A;  1SW1 A;  1UIU A;  5AE4 A;  3ROJ A;  1FBE A;  4GX4 A;  5HBC A;  1B05 A;  1M5C A;  2ESN A;  3E4R A;  2VP1 A;  3UN6 A;  3K6X A;  1FPI A;  2O7I A;  4GL8 A;  3G3I A;  2H99 A;  1EH3 A;  4ELP A;  4QFO A;  1IUD A;  1YTV A;  3C4M A;  1K9Z A;  3TTM A;  5IZ1 A;  4RK9 A;  3O6H A;  1FJ6 A;  4QSC A;  3TEL A;  1M5F A;  1FQA A;  4OYV A;  4DLD A;  4QF9 A;  5LDZ A;  1B4H A;  3PUY E;  3T96 B;  2XHD A;  1Y1Z A;  5I84 A;  4YKI A;  3G3H A;  2A5S A;  3QSL A;  4GD5 A;  2D5W A;  2HEU A;  5DYH A;  3RY3 A;  4N6P A;  1AH5 A;  5JTY B;  3E79 A;  1FTK A;  4YB6 A;  1QUL A;  3D4C A;  4HE2 A;  3TFL A;  5A5X A;  3RTW B;  3RQT A;  2KLF A;  1ZKB A;  5CBR A;  5F1Q A;  2VPN A;  4PFR A;  1IMD A;  4ELR A;  1INP A;  2HZL A;  2RC8 A;  1KWH A;  4IY5 A;  4MBP A;  1OLC A;  5ET8 A;  4YKP A;  4ECF A;  1FCK A;  4NF6 B;  4M4G A;  5IZ3 A;  5EYG A;  3GLB A;  2W7Y A;  4C1T A;  4MAG A;  1VSO A;  1FRP A;  1II5 A;  3O9P A;  1PDA A;  4OZ9 A;  3LSW A;  2OWZ A;  3MVY A;  3V8X B;  1B0L A;  4OVS A;  2MKZ A;  3C31 A;  1MM7 A;  2H5Y A;  2M8C A;  3SEU A;  3KSJ A;  1IQ7 A;  4FIM A;  2R71 A;  4F1V A;  2QMX A;  3EHU A;  5ICT A;  1ZJL A;  3EQ1 A;  1ATG A;  3M3L A;  3TTN A;  3VV5 A;  3DLN A;  4FAT A;  1A54 A;  1BK4 A;  1B1X A;  4JB7 A;  1FBP A;  3WAF A;  4TQU Q;  4LA9 A;  1IZ1 A;  1D3K A;  1US4 A;  4DXC A;  1P1W A;  5AA4 B;  4MX6 A;  3QIM A;  3K2D A;  5M2V A;  1MDQ A;  3WAE A;  4NF8 A;  1H44 A;  4YZZ A;  1MPC A;  5IZZ A;  4QSD A;  1F9B A;  1PBP A;  4XKN A;  4NED A;  2YJP A;  2F3D A;  1B1H A;  4RPO A;  3N6U A;  2O69 A;  2UVI A;  1URD A;  3M3K A;  4JDF A;  1HSJ A;  4X9T A;  1FTA A;  4OFL A;  3FZV A;  4H5F A;  3MP6 A;  5AA2 D;  2DSF A;  2DOJ A;  3VFJ A;  2ZMB A;  1LCF A;  3PUX E;  4WKM A;  1NKX A;  4LON B;  5CM6 A;  1SPI A;  3S9E A;  5CMB A;  1YYZ A;  1LAH E;  2F34 A; 
#chains in the Genus database with same CATH homology
 1P1U A;  4H8I A;  4R72 A;  2RIN A;  3A09 A;  1BIY A;  1IXH A;  3F11 A;  4BDQ A;  3BFU A;  1IXC A;  5DT6 A;  2I3W A;  3GZG A;  4F3P A;  1I6B A;  4OET A;  4IO7 A;  4ND9 A;  2F7C A;  3CFZ A;  5CMM A;  3MAM A;  3IO4 A;  4QRZ A;  3S2V A;  3K00 A;  3T22 A;  4LQ2 A;  2GFE A;  4ESX A;  2ZNU A;  4MLQ A;  3PV0 E;  4OVJ A;  5L9M A;  3FD3 A;  4FOR A;  3PPQ A;  4PE5 B;  3PD8 A;  3SKP A;  5CI5 A;  1MQI A;  4BDO A;  3CI8 A;  1P1O A;  3KEI A;  1QKA A;  3PPR A;  4GIZ A;  2QMW A;  4MLV A;  1R9L A;  3TQL A;  5I56 A;  3FVG A;  1O7T A;  3IL1 B;  3K6U A;  4EF2 A;  2HAU A;  3V89 B;  4WXJ A;  3SET A;  3TPA A;  1JVX A;  3RT8 A;  3C34 A;  3HO7 A;  3LBS A;  1SW4 A;  4FED A;  4NF5 B;  3RTF B;  3K6V A;  3FXQ A;  1UTH B;  2CMO A;  3G7W A;  4LAT A;  5DTB A;  5H8F B;  1FQB A;  4IGR A;  3MZ1 A;  3LSX A;  1A7L A;  2O84 X;  3TYH A;  3UGW A;  3VLW A;  2DS9 A;  3H7M A;  5ICQ A;  3MVW A;  1FTL A;  2UVJ A;  1B6H A;  1CB6 A;  5CC2 A;  1B2H A;  1PB9 A;  3O6I A;  4JWX A;  4RPO A;  4KHZ E;  5H8H B;  3RT6 B;  3W15 C;  3CG1 A;  4ZZE A;  4EQ9 A;  3H03 A;  3IAZ A;  3IJX B;  1B52 A;  3OEK A;  1Y3N A;  2XXU A;  3ZS6 A;  4I1D A;  2VOZ A;  1PB7 A;  2V3U A;  3TDJ A;  1S7Y A;  3FV1 A;  4PFU A;  3PD9 A;  5IKB A;  1JVY A;  3Q26 A;  1SI1 A;  3K6W A;  4N13 A;  4C0R A;  2V3Q A;  1R6Z A;  2HFB A;  1N7X A;  3C33 A;  4KCC A;  3TTL A;  4QFK A;  3MWB A;  4F3S A;  3OEM A;  3KN7 A;  4U1O A;  1MY1 A;  5I2K A;  1UTB A;  4BDL A;  3R7X A;  1LAX A;  1S9T A;  4LZ5 A;  5KZT A;  4RA1 A;  1D4N A;  1JQF A;  2WKY A;  1MPD A;  4ZS9 A;  5I59 B;  3GBB A;  3PUV E;  1GTK A;  1XC1 A;  2Q2A A;  3LSF B;  3QUF A;  1TFD A;  3EHS A;  4IO5 A;  4OXV A;  1MXU A;  2OK2 A;  4F29 A;  2AL4 A;  4H8J A;  4ZEC A;  2O1M A;  4IO4 A;  5LOM A;  4Z0I A;  3QXM A;  5I58 B;  1SYI A;  2GHB A;  3ZKK A;  3IO6 A;  1POY 1;  2ONR A;  1N3X A;  3M8U A;  3U92 A;  2DE4 A;  2G93 A;  3HHF A;  3USD A;  1A55 A;  5L9O A;  4OTE A;  2Q9T A;  4KCD A;  4NF6 A;  4QHQ A;  2NWJ A;  2F97 A;  4LQ5 A;  3QUJ A;  1WDN A;  2QS2 A;  4PQJ A;  4HW8 A;  4IO6 A;  3HST A;  1WOD A;  2AL5 A;  4EQB A;  4POW A;  1VFD A;  4EUO A;  1SDX A;  2X26 A;  2V25 A;  1JET A;  2Y84 A;  4PFW A;  5DEX B;  1IIW A;  4G68 C;  1YCJ A;  5JTY A;  4RYA A;  5ELV A;  3VDF A;  3VVD A;  5B7D A;  3FVK A;  1QUK A;  4U1Z A;  3PU5 A;  1LB8 A;  4ISU A;  3MJN A;  5EHM A;  2QSX A;  3K0V A;  3MZ9 A;  4NF4 B;  3IB2 A;  2QL3 A;  3OSR A;  5H8H A;  1B5H A;  2PVU A;  2F78 A;  4MFI A;  3Q29 A;  4PP0 A;  3IB0 A;  3IOW A;  4G2Z A;  1B9J A;  1I69 A;  1RYX A;  1MQG A;  1YAE A;  2F5X A;  2DWH A;  3OEN A;  2O51 A;  5H8Q B;  4BDR A;  1BLF A;  2UYE A;  4R6Y A;  5K2Y A;  3S9N C;  3PPN A;  1B58 A;  4F2Q A;  4ZE9 A;  1AIV A;  5A5X B;  1UTH A;  1ZMG A;  3FAS A;  1JW5 A;  2PT2 A;  4GRK A;  2QS4 A;  3MP8 A;  4KFQ A;  5F7V A;  4PET A;  4ZDM A;  3FXU A;  4ELQ A;  4GFR A;  4GXA A;  1IXI A;  2Z8E A;  1GVC A;  1USY E;  3RGY A;  5TP9 B;  3TMG A;  3ONM A;  4MF3 A;  5L9S A;  5AA2 A;  1A40 A;  3OD7 A;  3PMV A;  1JEV A;  4ZEF A;  1Y20 A;  3DP6 A;  3RLF E;  1HSL A;  1MH4 A;  1MDP 1;  3FVO A;  1FTM A;  3U94 A;  3PGF A;  5HPQ A;  3DEL B;  3AXF A;  3VXC A;  1MRP A;  1ZBM A;  2F35 A;  1B7U A;  3CRB A;  4I9D A;  5CMC A;  5I56 B;  1NL5 A;  2XD2 A;  4M1V A;  3R6U A;  1FW0 A;  4THI A;  4ZEB A;  3TQW A;  1LBC A;  4GF8 A;  1POT A;  4OEV A;  1NNK A;  2QJE A;  4YB5 A;  5JEI A;  1H76 A;  2ZNT A;  3H4Z A;  3FJG A;  1YPN A;  4X1B A;  5I57 A;  4JSD A;  2ALU A;  4DE8 A;  2DE2 A;  1SW2 A;  3U93 A;  4ZZA A;  1T0K A;  3SEX A;  3CSB A;  5ITO A;  1SYH A;  1A99 A;  4HS7 A;  3I6V A;  4H0W A;  2F7A A;  3ZSF A;  4IO2 A;  4C1U A;  3IX1 A;  1M5B A;  2V84 A;  1MQD A;  3E3K A;  3HPI A;  3HHG A;  5KDT A;  1B3L A;  2XXH A;  1SW5 A;  4LUB A;  2IA4 A;  4E0X A;  1PEB A;  3L6H A;  3CVG A;  1TT1 A;  4EF1 A;  2NVU B;  1FTJ A;  3G3G A;  3I3V A;  2ZNS A;  4G68 B;  1B7H A;  1UQW A;  3K01 A;  3N26 A;  1PB8 A;  4QFP A;  4ZEK A;  5TPA A;  1JW4 A;  2UVH A;  3ODB A;  1EZ9 A;  3FJ7 A;  3MQ9 A;  4G8N A;  4DXB A;  4YIC A;  5I2K B;  1AOV A;  2X7Q A;  2ZYK A;  2I58 A;  4RJZ A;  4R9G A;  4IY6 A;  2OCU A;  4X48 A;  3T9U A;  1DPE A;  2AIX A;  4U4X A;  1EU8 A;  3DM0 A;  4QFN A;  4UAC A;  3TOD A;  2VGQ A;  2Z8F A;  1MQJ A;  3T9V A;  4RPN A;  1NMU A;  2Z8D A;  1H45 A;  3R26 A;  1LGB C;  4Q0C A;  4YB7 A;  1QKB A;  1OMP A;  3K1P A;  4FEC A;  4YU0 A;  1TWY A;  1LCT A;  4P11 A;  3ILT B;  4TOZ A;  4G68 A;  4YAH X;  4KYD A;  1AL3 A;  1S50 A;  5L8D A;  2Q8J A;  1XS5 A;  2ABH A;  1D9Y A;  2OWT A;  2GH9 A;  4LP2 B;  1Y1M A;  4DIG A;  4O3C A;  5JK4 A;  3HCQ A;  1MY0 A;  1OQG A;  2F7B A;  4G77 A;  2ONS A;  4GXS B;  5H8F A;  5KDT B;  2XXI A;  2P0S A;  2YPN A;  3IOR A;  1H43 A;  4OEU A;  1B32 A;  2Z23 A;  1DOT A;  1P1N A;  1ZLQ A;  5I84 A;  2H4I A;  3TCF A;  2ZYN A;  3C35 A;  3PMX A;  3KJ7 A;  4H5G A;  3KSX A;  1JNF A;  2B3B A;  3S4U A;  3EHT A;  3SDF A;  3VVF A;  4KI0 E;  4K3F A;  1LB9 A;  3SEW A;  3BBR A;  5DVJ A;  1MH3 A;  1P99 A;  3MPL A;  2E0S A;  3THI A;  3LR1 A;  1O63 A;  1B5I A;  3KN3 A;  1NNP A;  4HCY A;  3W9V A;  3MPK A;  1J1N A;  1DTG A;  3MBP A;  2ANJ A;  3CIJ A;  3QAX A;  5FHO A;  3MW0 A;  4H6D A;  1B0H A;  1QUJ A;  2HCA A;  4HTG A;  4ONY A;  4GLI A;  4JSO A;  1MPB A;  4LZ7 A;  1NFT A;  2VHA A;  1MQH A;  4GQO A;  3HN0 A;  2E1S A;  3CSG A;  1M5E A;  2DQV A;  3IK6 B;  1N76 A;  5CMK A;  3S9L C;  1BP5 A;  3CFL A;  2PT1 A;  3BKI B;  4F19 A;  4OEN A;  4OHN A;  1ANF A;  4WED A;  3MVZ A;  4ZE8 A;  4NF5 A;  2QS1 A;  3T93 B;  1B3G A;  3H6V A;  2XXY A;  2VD2 A;  5H8Q A;  4DDD A;  1Q35 A;  2XXW A;  2OJT A;  4PFY A;  1CE2 A;  2BJJ X;  3JV9 A;  1B3E A;  1DTZ A;  2XXQ A;  3B6T A;  3IB1 A;  5TU0 A;  1SQY A;  1LFG A;  3GXA A;  3TAJ A;  1FQF A;  3U8Q A;  1Y3P A;  1M5D A;  4P0G A;  4OWD A;  3N94 A;  1A8E A;  2Y7K A;  1Y4C A;  5ITP A;  2D21 A;  2XX7 A;  3SEY A;  2QPQ A;  5I2N B;  1I6A A;  2RCB A;  4KYE A;  1B4Z A;  1B51 A;  4JWY A;  4OES A;  4BDM A;  5DEX A;  3G3K A;  3E9X A;  5DVF A;  4F39 A;  1LFI A;  1R1N A;  1SW1 A;  1UIU A;  3OXN A;  2RKM A;  2ZYO A;  4NTL A;  4R75 A;  1ZU0 A;  4R9F A;  3SER A;  4DXU A;  4GL0 A;  5EYF A;  2I4C A;  5AE4 A;  3EN3 A;  1N3W A;  4U21 A;  5HBC A;  4FE8 A;  1B05 A;  1M5C A;  4XKP A;  3U72 A;  2UYF A;  1B46 A;  1LAF E;  4IB2 A;  3K02 A;  2ESN A;  3E4R A;  2VP1 A;  3KGC A;  2LAO A;  3KN8 A;  1LAG E;  3UN6 A;  2XXP A;  3K6X A;  2REJ A;  2H25 A;  4I62 A;  2ZXT A;  4XTC Q;  2O7I A;  4XIG Q;  3H3G A;  5I59 A;  4GL8 A;  3OOA A;  3G3I A;  2DXY A;  2H99 A;  1EH3 A;  1MG1 A;  3M3F A;  4ELP A;  4F1U A;  3C36 A;  5FHN A;  4F2O A;  1R9Q A;  3EF7 A;  2ONK E;  1BTJ A;  1AMF A;  1IEJ A;  1IUD A;  3B6W A;  4QFO A;  1YTV A;  4YMA A;  2PX1 A;  4GWO A;  4F3G A;  3C4M A;  1P1Q A;  4IGT A;  3TTM A;  1OVT A;  3O66 A;  2REG A;  1UIV A;  4MH5 A;  1RKM A;  5I2N A;  2Z22 A;  5KCJ B;  4F18 A;  3G3F A;  3IOU A;  5CRY A;  4RK9 A;  3O6H A;  4U22 A;  3OO6 A;  3KBR A;  3VXB A;  4POX A;  4JBZ A;  4QSC A;  3JZJ A;  3TEL A;  3OSQ A;  4QFL A;  3FJM A;  2HAV A;  1M5F A;  1ZTY A;  4OER A;  1FQA A;  5TPA B;  1N84 A;  5TP9 A;  1RYO A;  4OYV A;  4QF9 A;  4DLD A;  5CBS A;  3H6U A;  3ZKL A;  3U1O A;  1US5 A;  3EPE A;  1PC3 A;  1Y9U A;  1B4H A;  2QS3 A;  3PUY E;  4Q5T A;  4XXU A;  1VR5 A;  2I4B A;  1XVY A;  1GV8 A;  3T96 B;  1MXW A;  3V5A A;  1TXF A;  1JEU A;  2DWJ A;  3KJT A;  3UA8 A;  2IEE A;  2XHD A;  4IO3 A;  1PBQ A;  1Y1Z A;  3RN8 A;  1MY3 A;  1OLA A;  2I49 A;  3MZB A;  1MXZ A;  2HXW A;  3N6T A;  4YKI A;  1D9V A;  4BDN A;  3TUS A;  3G3H A;  2A5S A;  3QSL A;  3O2A A;  4YKK A;  4KQP A;  4GD5 A;  5FTI A;  3IJO B;  1DSN A;  2D5W A;  2HQ0 A;  1TFA A;  3VE1 B;  4DZ1 A;  5I57 B;  2HEU A;  1OVB A;  4KYS A;  3L6G A;  5DYH A;  2OZZ A;  4N6P A;  3RY3 A;  2QRY A;  3K4U A;  2GRV A;  1AH5 A;  4O3A A;  5JTY B;  5ISU A;  3IR1 A;  4N07 A;  1FTK A;  1MY4 A;  3FXR A;  1SVX B;  2O68 A;  4YB6 A;  1WVJ A;  3V83 A;  4EXL A;  5AA2 B;  1XVX A;  3TCH A;  1EZO A;  1VFE A;  3K1N A;  3CFX A;  1MM6 A;  1MXX A;  1QUL A;  3C32 A;  4Q30 B;  2FA7 A;  3D4C A;  4R2B A;  2B65 A;  3VVE A;  5HM4 B;  2PYY A;  5I58 A;  1B3H A;  3IOV A;  3TFL A;  2Y7W A;  4PFT A;  5A5X A;  4H67 A;  3P7I A;  4F31 B;  1LFH A;  4RK2 A;  2XXT A;  3QK6 A;  3O97 A;  2OBG A;  4I8C A;  2I0B A;  3RTW B;  5H8N B;  3RQT A;  4JWO A;  4DCX A;  4L17 A;  2DXR A;  3T66 A;  2KLF A;  4YMB A;  1ZKB A;  1Y4T A;  1QW0 A;  3H6W A;  5F1Q A;  1H3D A;  3RNN A;  4U2R A;  5CBR A;  3MC2 A;  1Z7N E;  2D3I A;  1L5T A;  3UOR A;  4ELR A;  4RNS A;  1SBP A;  2V93 A;  1N04 A;  2XXV A;  4QSE A;  3DP8 A;  1JW1 A;  5FHM A;  2HZL A;  2RC8 A;  1KWH A;  3G3J A;  4IY5 A;  2B3F A;  1ZIU A;  2RCA A;  4MBP A;  4H1X A;  1OLC A;  4G8M A;  3TCG A;  5KCJ A;  2XX8 A;  1ELJ A;  2R6G E;  4FEB A;  4YKP A;  2F8D A;  1FCK A;  1QUI A;  2G29 A;  4ECF A;  2I3V A;  3TTK A;  4Q8R A;  5K2X A;  2ZYM A;  3OEL A;  2OLB A;  2P2A A;  1FTO A;  4NF6 B;  4BLA A;  4M4G A;  2YLN A;  4GVO A;  3A3U A;  4EXK A;  1Y3Q A;  2FNC A;  3GLB A;  2W7Y A;  1B3F A;  4C1T A;  2OWS A;  3VLV A;  3H6T A;  4R6H A;  1VSO A;  4OQO A;  4UA8 A;  3UK4 A;  3DP4 A;  1II5 A;  2DWA A;  3O9P A;  3K1M A;  3IOT A;  1PDA A;  4F1Y A;  4OZ9 A;  3KFM A;  3KOT A;  4R2F A;  3I5O A;  3FV2 A;  3N5L A;  4EQ7 A;  3LSW A;  3B7D A;  1MY2 A;  1LBB A;  1OIB A;  1XOC A;  3MVY A;  3V8X B;  1SD3 A;  2F6G A;  1B0L A;  1A8F A;  3O29 A;  2DE3 A;  2FYI A;  4NF8 B;  1GR2 A;  2GHA A;  2Y7R A;  3C31 A;  4OMB A;  1MM7 A;  1Q1K A;  1SI0 A;  2UVG A;  4AQ4 A;  2H5Y A;  2M8C A;  3SEU A;  2RC9 A;  3KSJ A;  1IQ7 A;  4FIM A;  4G4P A;  2Q2C A;  2R71 A;  3CR9 A;  5H8N A;  4XKR A;  2NUV A;  1Z7M E;  4TLM B;  2XX9 A;  1OQH A;  3Q28 A;  2P1S A;  4F1V A;  3OO7 A;  3O6G A;  5AA4 A;  2QMX A;  3EHU A;  3GBA A;  5ICT A;  1ZJL A;  3MP1 A;  4HCW A;  4GOT A;  4R74 A;  2XXR A;  4ZEI A;  3SEV A;  3EQ1 A;  2I6E A;  4EDP A;  4ZED A;  4R73 A;  1ATG A;  3M3L A;  4NE4 A;  3TTN A;  3VV5 A;  1B40 A;  3DLN A;  4FAT A;  1NNT A;  1MXY A;  3KZG A;  1A54 A;  3KG2 A;  2NOO A;  1IXG A;  2O7U A;  2O1L A;  4TLL B;  1B1X A;  2DVZ A;  5BWJ A;  4JB7 A;  4H65 A;  2CZL A;  3TZA A;  1MXV A;  2Y7I A;  3LSL A;  3WAF A;  4Z7E A;  1B7Z A;  4WEP A;  1GGG A;  2X7P A;  3UP9 A;  4ELO A;  4F22 A;  4F3B A;  4TQU Q;  3OMB A;  1USY H;  2Q88 A;  4NF4 A;  3C9H A;  3T9X B;  4JXI A;  2R9J A;  4LA9 A;  1XT8 A;  1IZ1 A;  1D3K A;  1LST A;  1US4 A;  3OO9 A;  4NMY A;  4OFO A;  4RY1 A;  5AA1 A;  4DXC A;  5BUU A;  1MS7 A;  3OO8 A;  3UIF A;  2H98 A;  2RC7 A;  4ESW A;  1P1W A;  3H06 B;  5AA4 B;  3MVX A;  2UXA A;  5EHS A;  3ECR A;  1NH8 A;  3D4G A;  3RPW A;  2PBW A;  2H9B A;  3MUQ A;  1BKA A;  3JYR A;  4LVQ A;  1DMB A;  2V3T A;  3CG3 A;  4AB5 A;  4E0W A;  3QIM A;  1IIT A;  1VE4 A;  2PMS A;  3K2D A;  5M2V A;  1MDQ A;  4DCY A;  3Q27 A;  4X1D A;  4KD5 A;  4NF8 A;  3WAE A;  1DPP A;  4P0I A;  1LLS A;  1HSE A;  1NNF A;  1H44 A;  4YZZ A;  1MPC A;  3LUY A;  3KOS A;  4NWD A;  4XKQ A;  2RF1 A;  4KR5 A;  4QSD A;  1F9B A;  2I0C A;  2A5T A;  1B5J A;  3PPO A;  2HZK A;  1PBP A;  4RXL A;  4U23 A;  2THI A;  1N7W A;  4XKN A;  3TKD A;  1NH7 A;  1O64 A;  2DYX A;  1N0T A;  2YJP A;  4NED A;  4NWC A;  3S9M C;  3TEP A;  3T9H B;  3PPP A;  2VD3 A;  4R6K A;  1B1H A;  1I6Q A;  3N6U A;  1QJM A;  3FIR A;  2O69 A;  3FVN A;  1UTB B;  3ILU B;  3QYT A;  4FJP A;  4O3B A;  4OFJ A;  4U4S A;  2UVI A;  5AA3 A;  3PUZ E;  1URD A;  3LC8 A;  3M3K A;  1EZP A;  4JDF A;  2F6P A;  1HSJ A;  1FQE A;  5DVI A;  3TTR A;  4G8H A;  4X9T A;  4KPT A;  3W9W A;  5J1D A;  4OFL A;  3SES A;  3FZV A;  3FUZ A;  3HV1 A;  2XD3 A;  4H5F A;  3FAT A;  3BFT A;  1QVS A;  3MP6 A;  5AA2 D;  3A3C A;  3O28 A;  2AYS A;  2DSF A;  2DOJ A;  4AB6 A;  1XHY A;  3VFJ A;  4FAJ A;  2ZMB A;  1LCF A;  2Y7P A;  3PUX E;  5B70 A;  1FQC A;  3VLU A;  2I48 A;  4WKM A;  1NKX A;  3FGS A;  3E13 X;  4LON B;  2Q89 A;  5H8S A;  2DWI A;  2NXO A;  5CM6 A;  1URS A;  2A5T B;  3PUW E;  3B6Q A;  3S9E A;  2O6A A;  5CMB A;  2XXX A;  3PMW A;  2F36 A;  2DP8 A;  3Q25 A;  1LAH E;  4YKJ A;  4LZ8 A;  1URG A;  2F34 A;  3RUM A;  2DVC A;  1FQD A;  5IAI A;  5FTH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...