4P1EA

Crystal structure of a trap periplasmic solute binding protein from escherichia fergusonii (efer_1530), target efi-510119, apo open structure, phased with iodide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
296
Chain Sequence
AESLNVSTSLSPDDPIYKGLQSFKKGVESRTNGEVKIKLFSQLGADNELLQHAQAGSNVGVVVDGARLAQFVPEFAIIPAPFVFKDYTTLKKFISSPVFAQWSEQMSSKSGLTPLSFNWYQGARMLVTQKPVSKPSDLNGVRVRALEAPVTIETIKCMGGSPTPLSWSEIYSSIQTGVVDAAEAQPTAVYGSKLYEITKHITKTNHIHLMTGIIVSQKWLSSLTAEQQTILREEAQKNGDIASENTILAGDKMLDEMAKKGMTISEVDTQPFIDGCRYVPEKLGLSEAYKQVNSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Escherichia fergusonii
total genus 100
structure length 296
sequence length 298
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p1eA00
4N6DA 2HZLA 4MNIA 4YZZA 2VPOA 2PFZA 4P56A 4OVSA 4MEVA 4PGPA 4PFRA 4YICA 4PAKA 4O94A 4P1EA 4X8RA 4NAPA 2ZZWA 4PGNA 4LN5A 2XXKA 2WYPA 4PCDA 4MHFA 4MAGA 4DI3D 4N15A 4MCOA 4NQ8A 4PF6A 4NG7A 4N8GA 4P9KA 4N17A 5I7IA 2CEXA 2XWVA 2XWIA 4PFIA 4P47A 4PBHA 3U65A 4NX1A 5IGAA 2HZKA 2CEYA 2XWKA 4OANA 2WX9A 4OVQA 4NF0A 4XEQA 3GYYA 4PDDA 4PBQA 4PF8A 4N4UA 2PFYA 5IZZA 4MNPA 4OVTA 4N8YA 4N6KA 4X04A 4XF5A 2V4CA 4XFEA 4O8MA 4OA4A 4MMPA 2WYKA 4NGUA 4PETA 4OVRA 4N91A 4PC9A 4UABA 5IM2A 2XWOA 4MNCA 4PFBA 4P1LA 4DI4B 3B50A 4PDHA 2ZZXA 4NHBA 4PE3A 2HPGA 5I5PA 4MIJA 5CM6A 4P8BA 4PAIA 4O7MA 5LTCA 4NN3A 3FXBA 4OVPA 2XA5A 2VPNA 4PAFA 2ZZVA 4MX6A 4P3LA
chains in the Genus database with same CATH superfamily
3TUSA 5LDZA 1UTHB 3MUQA 4HW8A 2XXYA 1N3XA 3RY3A 3E4RA 4PGPA 1YXIA 3MW0A 4X8RA 3IOTA 5J16A 2UVHA 4LN5A 1JEUA 5TP9B 4GX6A 1XHYA 1YZ0A 1NV5A 4ECFA 3G7WA 2FHYA 3W15C 4YU0A 2ZYMA 4KYEA 5B70A 2HXRA 3K4UA 1AH5A 3O2AA 5KCJA 4OFJA 1DSNA 5I59A 4DIGA 1B5JA 4P11A 4G8NA 1PBPA 2OCUA 3D4CA 1JVXA 5JEIA 3EF7A 3S9EA 1XOCA 3UGWA 1DPEA 2AIXA 3C4MA 3MBPA 4PE5B 3S4UA 1MQGA 3SZPA 4NWDA 1B1XA 4F3PA 4MNCA 3OXNA 3H6VA 3MPLA 3T96B 3E79A 1MQHA 5L9SA 3CFLA 1ZJLA 1UTHA 1S9TA 3ILTB 3O9PA 5KDTB 2HXWA 3U93A 3MVZA 4F2QA 5TP9A 3TDJA 4H45A 3M8UA 2O84X 3N26A 5FBPA 4NF4B 3H3GA 4IGRA 2XXXA 4RXLA 3HV1A 1N7WA 1NV6A 3CRBA 1LFHA 5ET6A 3HCQA 3IORA 2QS2A 4O94A 1IXCA 4RNSA 4JSOA 1ZIUA 1LAFE 2NVUB 1JW5A 4R6HA 1EYKA 4DZ1A 2G29A 4G8MA 4ND9A 4ELPA 4EXKA 1FJ9A 2F35A 4GWUA 4X9TA 3USDA 2OBGA 1ZLQA 1I6AA 2XX7A 2FVZA 3N6TA 1QW0A 2OWZA 4DCYA 5IKBA 2UYFA 1MDQA 1FPDA 4FEBA 3BFUA 3TODA 4OANA 1B3FA 2R9JA 4NF0A 1PDAA 1B58A 4GWSA 4ZEBA 4XKQA 2Q8JA 5H8QB 1M5BA 5AE4A 1MY2A 3V89B 1FQAA 1EZOA 1EYJA 4KYDA 3UK4A 3VXBA 4RPOA 5KDTA 2YPNA 3RT8A 5L8DA 2DWHA 3UIFA 2ANJA 1JEVA 5ICTA 4PC9A 4NF4A 3CG1A 4DI4B 1PB9A 3VXCA 4H0WA 5CMBA 3H06B 1EH3A 3S9LC 1SW1A 4IB2A 1RDYA 3FJ7A 3TTNA 2FIEA 1D3KA 1BIYA 3EN3A 2HEUA 4NMYA 1HSLA 3PD8A 4OMBA 3LUYA 1XC1A 3C35A 4F29A 2P1SA 1Y3PA 3PPRA 2Y7PA 1LFIA 4DCXA 2Y84A 3CI8A 4X1BA 1MPCA 4ELRA 1QULA 2ZZWA 4FE8A 3A09A 1K9YA 3C9HA 3MPKA 1QJMA 1NNTA 4AS5A 3NOHA 4PFYA 3MVWA 4F18A 3LSLA 4ZS9A 2I3WA 4Q0CA 4QHQA 1URSA 1FTOA 4IO2A 5H8QA 2CZLA 5CBRA 2OX3A 1DBZA 4GVOA 4N81A 4YB6A 3N5LA 5ITPA 1RKMA 1DMBA 1IMAA 3C36A 1MM7A 3SETA 3TFLA 5F24A 4XEQA 3JYRA 2YJPA 3RYDA 1RDZA 1B5HA 2X26A 4JWOA 3IB1A 4MNPA 4U22A 5DEXB 4QSDA 5ET5A 4ZE9A 3G3JA 3FVGA 3IAZA 3WAFA 1M5DA 4OERA 2CZIA 2P2AA 1UIVA 4HCWA 3ZKKA 5I56B 3KOSA 4NEDA 2XXHA 2E1SA 1FCKA 5ELVA 1IUDA 4GL0A 1VSOA 3O29A 1N3WA 1LBXA 5K2YA 2RF1A 3SEYA 2CZHA 2ONKE 4FORA 1NKXA 5BUUA 1WODA 5ET8A 1GV8A 4DLDA 3PTYA 3E3KA 5LTCA 1VFDA 3FXBA 4HTGA 4F3SA 4ZEIA 2YLNA 3RLFE 2HFBA 1JW4A 1D4NA 1Y1ZA 4F19A 2ZYOA 3V5AA 4IO3A 4YICA 4P1EA 1B46A 2Z22A 1PB8A 5I2KB 3U8QA 4MCOA 4GXAA 4F1VA 4X1DA 2I0CA 3MZBA 1MXYA 3R6UA 4IY5A 3IR1A 4GIZA 3HPIA 3FASA 2XWIA 5DEXA 3UORA 1FRPA 2DXYA 3HHFA 2QMWA 2KLFA 4JXIA 1YPNA 1NL5A 3IFAA 1MG1A 2D3IA 3E9XA 5I56A 3PUVE 1QUKA 4XXUA 3Q25A 2NUVA 1LAXA 4N4UA 5AA1A 1SW5A 1SI1A 4FAJA 4N6PA 2UVGA 5A5XB 4N8YA 1D9VA 2QFLA 4WKMA 2V4CA 4O8MA 3TTRA 4NGUA 2IEEA 5H8NB 3B6WA 3P7IA 1P99A 3U92A 3C32A 5H8SA 1VR5A 2DSFA 3MZ9A 3RPLA 2OZZA 4R2BA 1UTBA 2PBWA 3BKIB 1IMDA 4OYVA 5K2XA 4P8BA 2DWAA 2ZYNA 1B7ZA 3TCFA 4KCCA 5I2KA 1ZMGA 1NV1A 1QVSA 4TLLB 1AMFA 1INPA 2V3UA 3TTMA 3O6HA 4NF6B 1BKAA 5HPQA 3KZGA 4F1YA 4OFOA 1FBCA 3ECRA 4XTCQ 4PGNA 5LOMA 4UACA 2DP8A 3CFXA 2F6PA 3TKDA 1MDP1 4RA1A 2FNCA 1R6ZA 4BDQA 1LSTA 3FXUA 1SBPA 4F22A 4Q8RA 4H8JA 4BDOA 5A5XA 1JQFA 4OESA 4POWA 4Q5TA 2THIA 1FW0A 3PMXA 3IB0A 1D9QA 1TT1A 2DXRA 5H8NA 2I49A 5ISUA 4PF8A 3LR1A 3F11A 4F2OA 1SW2A 2Q2CA 3E78A 4X04A 3T9HB 3O66A 1ZU0A 1N84A 2ABHA 2CMOA 2OJTA 4MMPA 4GX4A 1MY3A 4N07A 4KD5A 4GBWA 1DCUA 3IOVA 2XXPA 4N91A 3EHSA 4GLIA 2UVIA 3LV0A 4RYAA 4GBVA 4NF6A 3OEKA 5KCJB 2DYXA 4PE3A 2F6GA 2R6GE 5DVJA 1I6QA 3C34A 4I9DA 1AL3A 4GD5A 3T9VA 3B6TA 1A40A 1MXUA 1RYXA 3RPWA 2DWIA 4G68B 3DLNA 1NFTA 2XXVA 2QS3A 3TZAA 1IXHA 4ESWA 3QSLA 2L5VA 1D9YA 1OLAA 3B7DA 2RC9A 1FBDA 4QFLA 3MQ9A 4QFNA 5AA2B 2WYPA 3CVGA 1Y1MA 3O97A 1TXFA 2H99A 4R72A 4QSEA 1FQFA 3GXAA 1ATGA 2WBDA 1KA0A 2PYYA 4BDLA 3FXRA 1FTLA 4OTEA 4R6KA 4LQ2A 5DT6A 2MKZA 3VVDA 4PTKA 2AYSA 2O7IA 3QXMA 5JTYB 2O69A 2I4BA 3PUXE 4ZZAA 3ILUB 5I57B 1FQDA 5AA4B 1IEJA 3VDFA 2H9BA 1J1NA 4U1ZA 1IMFA 3CR9A 2DDKA 1MXZA 4FEDA 1LBYA 2Z8FA 4OVRA 4IR8A 4Q30B 4G77A 2Y7RA 2LAOA 3TCGA 3FV1A 4G68A 4QXDA 3KBZA 3FD3A 4PP0A 2I6EA 2F5XA 2PVUA 5CBSA 1B51A 1MS7A 1FBPA 1HSJA 1MY4A 3HFUA 4O7MA 4I3YA 1EZPA 3CSBA 4P0GA 5AA2A 1Q35A 3R26A 2AL4A 3FJMA 4R73A 2P0SA 4YZZA 2VPOA 3ROJA 4XKRA 4Z0IA 5AA3A 1NNFA 4LP2B 4R75A 2VT5A 4H5GA 4MHFA 5JTYA 5ET7A 2DS9A 3TAJA 3DP4A 1NV0A 5I57A 4POXA 5AA4A 4OHNA 3L6HA 1A7LA 3T22A 1B40A 1FTKA 5AA2D 4JSDA 3K1NA 2XXWA 2QS1A 2GHAA 3K6UA 3QK6A 2GFEA 1MQDA 3OD7A 3PD9A 1JP4A 3E13X 4RK2A 3UN6A 5EHSA 3QYTA 2A5SA 1LLSA 4DXUA 1P1NA 2ZNTA 4THIA 1KZ8A 4GWXA 2FYIA 3IO4A 4OZ9A 4KXPA 2QSXA 1QUJA 4EQ7A 1HSEA 1LFGA 4X48A 4YKJA 4PFBA 3ZS6A 1JW1A 2HQ0A 1LB9A 1MH3A 3MVXA 3H03A 3SEWA 2D5WA 3K2DA 4LZ8A 4JWXA 3L6GA 4H8IA 3KSXA 3T9UA 4U4XA 2ZNUA 1NV2A 1B1HA 2H5YA 2GQ1A 3FVOA 3U94A 1GTKA 5EQ7A 3T93B 1SQYA 2QMXA 1IIWA 3QIMA 2D21A 2XXKA 3U72A 1OQGA 1Z7ME 4PF6A 4NQ8A 1MRPA 1FQEA 2B3FA 2RCAA 1NI9A 4ZZEA 1NUYA 4TQUQ 3G3KA 5H8HB 1B05A 4MJOA 3PUYE 4WEPA 4HE0A 5DVFA 3MWBA 2BJIA 3K6WA 3GLBA 3D1RA 4H6DA 4QRZA 1IMCA 1NV3A 1B0LA 3KOTA 4GQOA 3IX1A 4ESXA 5B7DA 1S50A 3OO6A 2Q2AA 5I58B 1FPKA 1NUWA 3QUFA 1B3LA 2XD3A 2Y7WA 4XIGQ 1CE2A 3CG3A 1FSAA 3KGCA 3THIA 4LZ7A 2DWJA 1FTMA 4ELQA 4LA9A 5EYHA 3FJGA 4NF5B 3IL1B 3MYUA 1MPBA 3MZ1A 3ZSFA 3MC2A 3V83A 2ZZXA 4JVDA 3PPQA 3IOUA 1Z7NE 2XXTA 1BLFA 4OVPA 1IMBA 1B5IA 4PAFA 1B0HA 2XX8A 4FECA 2W7YA 1WDNA 3FATA 3ODBA 1JVYA 4OVSA 5H8HA 4U2RA 5EQ8A 1URGA 3K1PA 1FQBA 3DP6A 5FHMA 4ZDMA 4MAGA 3TEPA 3EHTA 2R71A 2HAVA 2PT1A 3CIJA 4GWWA 4OEVA 4YKPA 4YMBA 5A5LA 3H7MA 3TPAA 1LCFA 4G8HA 3RPLB 2I58A 3GBAA 5TU0A 3MAMA 1USYE 1UTBB 4F3GA 5I58A 5HBCA 5EYFA 2Q8MA 2NWJA 2RCBA 4O3AA 5I3SA 3WAEA 3OOAA 4BDRA 2VGQA 2FIXA 4C1TA 1SDXA 2ALUA 3KEIA 1I6BA 5EQAA 4NF5A 1RDXA 3LBSA 2FA7A 2F78A 2GRVA 1GVCA 4HXVA 4RY1A 3SEUA 3FBPA 3TCHA 2CZKA 3V8XB 1LAGE 2H4IA 1Y4TA 3PV0E 2O6AA 1NNKA 2DE4A 1URDA 1A55A 3KN8A 4G4PA 2F3DA 2PT2A 3MJNA 2UYEA 3TQWA 5I2NB 4DXCA 4GRKA 3Q27A 4U4SA 3FVKA 2I4CA 4MLVA 4EQBA 2HPGA 2AL5A 5IAIA 2QL3A 5H8FB 2V3TA 3S2VA 3T1BA 2HZLA 4I3EA 4GWYA 4H46A 3FVNA 2OWTA 4GWZA 4N13A 4IO7A 3B6QA 4QSCA 2H98A 1UIUA 2V93A 1H45A 1NUZA 4KCDA 3Q26A 3TTLA 3SKPA 4HCYA 4GFRA 3MSTA 3T9XB 4R74A 1IXIA 1Y3NA 3PUWE 1P1UA 4QFOA 1FTJA 1A8EA 4LQ5A 1B2HA 2Z8EA 3LSWA 2WBBA 1LGBC 2Y5LA 4NE4A 1B4HA 4GWOA 1SYHA 2XXUA 2CEYA 4M1VA 1TWYA 3I6VA 2F8DA 3GYYA 5CMCA 1M5CA 3OENA 1O63A 4GXSB 1ZKBA 2G93A 5I2NA 2OK2A 2Q89A 4OEUA 2GHBA 5EQ9A 1F9BA 2V84A 4XFEA 1NH8A 4OA4A 3KSJA 4OETA 2HHMA 2HAUA 3K00A 5H8FA 3VLVA 3IK6B 1POTA 4LVQA 4UABA 4FATA 1LB8A 5CI5A 5FHNA 4JVIA 1QGXA 3N6UA 2KR0A 2QVRA 2P3NA 3LSFB 3FGSA 5CM6A 1B4ZA 3EKIA 3KC1A 1LAHE 3UP9A 1N76A 1KWHA 2PX1A 4MX6A 4OQOA 2RINA 1ANFA 1A54A 4PFRA 2VOZA 3HSTA 2R8TA 5CRYA 1R9QA 4K3FA 4ZE8A 3PPPA 4GX3A 2XHDA 3RGYA 4OENA 4QBAA 1Y9UA 1NV7A 2B3BA 5F1QA 2F7CA 1POY1 5ITOA 1B7HA 5TPAB 3PMWA 3KFMA 4N17A 3OSQA 4MLQA 1MH4A 4ZEDA 4ZEFA 1LBZA 3OSRA 3KJTA 1MXVA 4WEDA 1MXXA 5F7VA 2HZKA 1FTAA 4H1XA 5DVIA 3JZJA 3FIRA 2QRYA 3O6GA 4JB7A 4GF8A 1S7YA 4PBQA 4TLMB 4LONB 4YAHX 3MP8A 3KG2A 5ESYA 1XT8A 2P3VA 3AXFA 4F3BA 4EF1A 4AQ4A 1FBHA 1FPGA 1CB6A 4DDDA 1DK4A 1FBGA 3RTWB 1VFEA 1XVYA 3D4GA 5J1DA 4DXBA 4PFTA 5I5PA 1L5TA 4YB5A 1KA1A 5ICQA 3QMFA 4AB6A 4KPTA 3S9MC 2Y7KA 3ZKLA 3PPOA 4ZECA 3TELA 4G68C 2ZXTA 2PFZA 5HM4B 2FBPA 5TPAA 2UXAA 1NH7A 4MEVA 1IQ7A 4G61A 3W9VA 4NAPA 3VFJA 4O7IA 4R2FA 1FPLA 4FBPA 2PMSA 5FTHA 4XKPA 4I1DA 3RUMA 1NNPA 3KBRA 4N15A 3CSGA 1GGGA 3K6VA 1B7UA 2GH9A 2I3VA 1B3EA 1NUXA 2Z23A 1JNFA 2XXIA 3JV9A 3W9WA 4E0XA 1MXWA 3U65A 4NX1A 3H6TA 2UVJA 3N94A 4OVQA 4FJPA 2M8CA 1MY1A 1B32A 3VE1B 2QPQA 4PDDA 3MVYA 4IY6A 3RQTA 2F7AA 1USYH 3C33A 3PGFA 1B3GA 1ZBMA 3KN3A 4XF5A 1T0KA 3KJ7A 3O28A 4FIMA 3G3GA 3SESA 3MP1A 1DTGA 1N0TA 3G3HA 4MFIA 1MPDA 2XXQA 4YB7A 1AWBA 2OLBA 1B3HA 1FPIA 3G3FA 1SVXB 4RK9A 1WVJA 3K6XA 3B8BA 3GBBA 4PDHA 1PBQA 2ZNSA 3OO7A 1IITA 3GZGA 4EDPA 3Q29A 4R9GA 2Y5KA 2VP1A 1MQJA 1FPJA 1II5A 1MM6A 2DE2A 1LCTA 4H67A 1NMUA 1VDWA 1OIBA 1IMEA 3FXQA 3HHGA 4PCDA 4C1UA 3BIGA 1YTVA 4UA8A 4P9KA 3H4ZA 4QFKA 3EQ1A 4IO5A 3ISPA 1TFDA 5L9MA 1A8FA 1OVTA 4P47A 3KN7A 2Z8DA 3PU5A 5IGAA 3H6UA 5JK4A 4OVJA 1G0IA 3IJXB 2ZYKA 1GR2A 2F7BA 1XI6A 2Q88A 1QKAA 5CC2A 4IO4A 2VD3A 1H43A 2IA4A 2WYKA 3K0VA 2H25A 4C0RA 1P1OA 4R9FA 3CFZA 3UA8A 4DE8A 4ONYA 4ELOA 2X7QA 3QAXA 4E0WA 3VVFA 2A5TB 5I84A 4NHBA 4YKIA 4TOZA 2I0BA 1Y3QA 3KC0A 3VLUA 2XA5A 1YCJA 3BBRA 1QKBA 1US5A 4N6DA 1IXGA 2Y7IA 4PQJA 2F3BA 5T3JA 4YKKA 1EU8A 5CMKA 3R7XA 3TQLA 1P1WA 3TTKA 4KYSA 4PAKA 1YYZA 1FBEA 3BFTA 2B4MA 3DP8A 4RPNA 3ONMA 1AOVA 4IGTA 2O51A 4I62A 4YMAA 3DELB 5DW8A 5DYHA 2ZMBA 4O3BA 4NG7A 1OVBA 4N8GA 1FQCA 5L9OA 1SYIA 1SPIA 2DVZA 2Q74A 1MY0A 1M5EA 3HN0A 4KQPA 1NV4A 1SD3A 2VHAA 1SW4A 3PMVA 4M4GA 5EHMA 3Q28A 2REGA 3K01A 3SEXA 1IZ1A 5IZZA 5CMMA 3OMBA 2A5TA 4EXLA 2B4LA 2V3QA 2QVUA 3VVEA 1QUIA 1FBFA 3FV2A 1EYIA 5DTBA 4L17A 3M3KA 1ELJA 3PPNA 1A99A 2JJKA 3I5OA 4P1LA 4EF2A 2QVVA 4LATA 3CHGA 4G2ZA 3B50A 4I40A 3VV5A 3IO6A 3H6WA 1H44A 2KQZA 4U23A 4BDMA 3O6IA 4MIJA 3C31A 1LBBA 4PAIA 3FZVA 4PFUA 1LEVA 3EPEA 5EYGA 2VPNA 1FJ6A 4P0IA 2ZZVA 4MBPA 3IFCA 4F1UA 4P3LA 1LBVA 2O68A 4MNIA 1DPPA 3A29A 4JBZA 4MF3A 4HE1A 1XVXA 3SERA 4F31B 2DOJA 4BLAA 3S9NC 1CNQA 1PEBA 4HS7A 2X7PA 3I3VA 1OLCA 2F34A 4GL8A 2WKYA 4GOTA 3RTFB 4DI3D 4R6YA 2O1MA 4H5FA 4JWYA 4EQ9A 4NF8B 2CEXA 3HO7A 3LSXA 1M5FA 4F39A 3QUJA 1EZ9A 4WXJA 2NXOA 4IO6A 3IJOB 3MP6A 2QS4A 5IZ1A 2XX9A 2ONSA 2OWSA 3OELA 3RN8A 3PUZE 5KZTA 4EUOA 4XKNA 3LUZA 1SI0A 3LC8A 1R9LA 2PFYA 4OVTA 1BK4A 4PFWA 1BTJA 1B6HA 2HCAA 2QJEA 3TYHA 5FTIA 2XXRA 3IOWA 1OQHA 3A3CA 4AS4A 1N04A 3K02A 4MH5A 4RJZA 4KR5A 1BP5A 2B65A 1G0HA 2XWOA 1Q9DA 4OXVA 3DM0A 4LUBA 1FPBA 2ONRA 1O7TA 1RYOA 1R1NA 5BWJA 4HE2A 1B9JA 4JVCA 2Q9TA 4AB5A 2RKMA 2DQVA 3M3FA 5IZ3B 2O1LA 1FPFA 1ZTYA 4NTLA 3BIHA 2F36A 4P56A 3TMGA 4NF8A 1VE4A 3T66A 1P1QA 3EHUA 2O7UA 2V25A 4I8CA 4KHZE 4QFPA 1K9ZA 3M3LA 4QF9A 2XD2A 5M2VA 1N7XA 1PC3A 4U1OA 2NOOA 2ESNA 2RC8A 5I7IA 4JDFA 4LZ5A 2XWVA 1LBWA 1AIVA 4ISUA 4PFIA 2RC7A 2VD2A 2BJJX 3VLWA 4PBHA 2WEFA 2E0SA 3G3IA 2PCRA 4ZEKA 1YAEA 2XWKA 2WX9A 1PB7A 3RT6B 4Z7EA 1US4A 4KI0E 4H65A 3A3UA 1LBCA 3IB2A 3K1MA 4U21A 5I59B 4N6KA 1FPEA 1OMPA 3SDFA 4OWDA 1JETA 4O3CA 1Y20A 1B52A 3OO8A 1H3DA 2DE3A 4PETA 5FHOA 5IZ3A 1XS5A 2DVCA 5IM2A 3RNNA 3U1OA 1Y4CA 1UQWA 4BDNA 1DOTA 2REJA 3OO9A 1DTZA 3SEVA 4KFQA 1O64A 1I69A 3FUZA 3OEMA 4NN3A 1TFAA 1H76A 3T0JA 4OFLA 4NWCA 1Q1KA 2F97A 1MQIA 2I48A
chains in the Genus database with same CATH topology
1INPA 5LDZA 4OVSA 1FPJA 4PGPA 1YXIA 5EQ8A 4X8RA 2DE2A 1FBCA 5J16A 4PGNA 4LN5A 1VDWA 1IMEA 4GX6A 4PCDA 1YZ0A 4MAGA 3BIGA 1NV5A 4GWWA 5A5LA 2FHYA 3RPLB 4P9KA 3ISPA 2Q8MA 2HXRA 5I3SA 4P47A 2FIXA 5IGAA 1D9QA 5JK4A 5EQAA 1G0IA 1RDXA 4PF8A 4HXVA 1XI6A 3FBPA 3E78A 4X04A 2CZKA 4MMPA 2WYKA 4GX4A 2DE4A 3SZPA 2F3DA 4GBWA 1DCUA 4N91A 4MNCA 3E79A 3LV0A 4GBVA 4NHBA 4PE3A 2HPGA 3KC0A 2XA5A 4H45A 5FBPA 3T1BA 4N6DA 2HZLA 4I3EA 4GWYA 2F3BA 4H46A 5T3JA 1NV6A 5ET6A 4GWZA 4PAKA 2L5VA 1YYZA 4O94A 1FBEA 2B4MA 1FBDA 2WYPA 1EYKA 1NUZA 5DW8A 1FJ9A 4NG7A 4N8GA 4GWUA 2WBDA 4HCYA 1KA0A 3MSTA 4X9TA 1SPIA 2DVZA 2Q74A 2FVZA 2MKZA 2OWZA 4PTKA 1NV4A 2WBBA 2Y5LA 1FPDA 2CEYA 4M1VA 4OANA 4NF0A 3GYYA 4GWSA 5IZZA 1IMFA 1EYJA 5EQ9A 2B4LA 4XFEA 2DDKA 2V3QA 2QVUA 4OA4A 1FBFA 1EYIA 2HHMA 1LBYA 4OVRA 4IR8A 2JJKA 4PC9A 4UABA 4P1LA 4QXDA 2QVVA 3KBZA 4DI4B 3CHGA 3B50A 4I40A 4JVIA 1QGXA 2KR0A 2QVRA 2F5XA 2P3NA 2KQZA 4MIJA 5CM6A 1FBPA 3HFUA 4PAIA 1RDYA 4O7MA 4I3YA 3EKIA 1LEVA 3KC1A 5EYGA 2VPNA 1FJ6A 2FIEA 2ZZVA 3IFCA 4F1UA 4MX6A 4P3LA 1LBVA 4MNIA 4YZZA 2VPOA 3A29A 4HE1A 3ROJA 4PFRA 1CNQA 2ZZWA 2R8TA 1K9YA 2VT5A 4GX3A 4MHFA 5ET7A 4QBAA 1NV7A 4DI3D 4AS5A 1NV0A 3NOHA 4F18A 4N17A 2CEXA 2OX3A 1DBZA 4N81A 1LBZA 1IMAA 5IZ1A 2HZKA 1FTAA 1JP4A 5F24A 4XEQA 3RYDA 1RDZA 4PBQA 3LUZA 2PFYA 4MNPA 5ESYA 4OVTA 1BK4A 5ET5A 2P3VA 1KZ8A 4GWXA 4AS4A 2CZIA 4KXPA 4HCWA 1FBHA 1FPGA 1G0HA 2XWOA 1Q9DA 4PFBA 1DK4A 1LBXA 1FBGA 2CZHA 1FPBA 5ET8A 5J1DA 5I5PA 1KA1A 3PTYA 4HE2A 4JVCA 5LTCA 2Q9TA 3FXBA 3QMFA 1NV2A 5IZ3B 1FPFA 2GQ1A 3BIHA 2PFZA 4P56A 2FBPA 5EQ7A 4F19A 4MEVA 4G61A 4YICA 4P1EA 3W9VA 4NAPA 2XXKA 1K9ZA 4O7IA 1FPLA 4FBPA 4N15A 4MCOA 4NQ8A 4PF6A 4F1VA 1NI9A 1NUYA 1NUXA 5I7IA 4MJOA 2XWVA 1LBWA 3W9WA 4HE0A 2XWIA 4PFIA 1FRPA 4PBHA 2WEFA 2BJIA 3U65A 4NX1A 3D1RA 2PCRA 3IFAA 1IMCA 1NV3A 2XWKA 2WX9A 4OVQA 2QPQA 4PDDA 4N4UA 1FPKA 1NUWA 4N8YA 4N6KA 2QFLA 4XF5A 2V4CA 1FPEA 4O8MA 1FSAA 4NGUA 2DE3A 4PETA 5EYHA 5IZ3A 1AWBA 5IM2A 3RPLA 1FPIA 3MYUA 4PDHA 3B8BA 2ZZXA 1IMDA 4JVDA 4P8BA 4NN3A 4OVPA 1IMBA 4PAFA 1NV1A 3T0JA 2Y5KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4N6D A;  2HZL A;  4MNI A;  4YZZ A;  2VPO A;  2PFZ A;  4P56 A;  4OVS A;  4MEV A;  4PGP A;  4PFR A;  4YIC A;  4PAK A;  4O94 A;  4P1E A;  4X8R A;  4NAP A;  2ZZW A;  4PGN A;  4LN5 A;  2XXK A;  2WYP A;  4PCD A;  4MHF A;  4MAG A;  4DI3 D;  4N15 A;  4MCO A;  4NQ8 A;  4PF6 A;  4NG7 A;  4N8G A;  4P9K A;  4N17 A;  5I7I A;  2CEX A;  2XWV A;  2XWI A;  4PFI A;  4P47 A;  4PBH A;  3U65 A;  4NX1 A;  5IGA A;  2HZK A;  2CEY A;  2XWK A;  4OAN A;  2WX9 A;  4OVQ A;  4NF0 A;  4XEQ A;  3GYY A;  4PDD A;  4PBQ A;  4PF8 A;  4N4U A;  2PFY A;  5IZZ A;  4MNP A;  4OVT A;  4N8Y A;  4N6K A;  4X04 A;  4XF5 A;  2V4C A;  4XFE A;  4O8M A;  4OA4 A;  4MMP A;  2WYK A;  4NGU A;  4PET A;  4OVR A;  4N91 A;  4PC9 A;  4UAB A;  5IM2 A;  2XWO A;  4MNC A;  4PFB A;  4P1L A;  4DI4 B;  3B50 A;  4PDH A;  2ZZX A;  4NHB A;  4PE3 A;  2HPG A;  5I5P A;  4MIJ A;  5CM6 A;  4P8B A;  4PAI A;  4O7M A;  5LTC A;  4NN3 A;  3FXB A;  4OVP A;  2XA5 A;  2VPN A;  4PAF A;  2ZZV A;  4MX6 A;  4P3L A; 
#chains in the Genus database with same CATH topology
 3TUS A;  5LDZ A;  1UTH B;  3MUQ A;  4HW8 A;  2XXY A;  1N3X A;  3RY3 A;  3E4R A;  4PGP A;  1YXI A;  3MW0 A;  4X8R A;  3IOT A;  5J16 A;  2UVH A;  4LN5 A;  1JEU A;  5TP9 B;  4GX6 A;  1XHY A;  1YZ0 A;  1NV5 A;  4ECF A;  3G7W A;  2FHY A;  3W15 C;  4YU0 A;  2ZYM A;  4KYE A;  5B70 A;  2HXR A;  3K4U A;  1AH5 A;  3O2A A;  5KCJ A;  4OFJ A;  1DSN A;  5I59 A;  4DIG A;  1B5J A;  4P11 A;  4G8N A;  1PBP A;  2OCU A;  3D4C A;  1JVX A;  5JEI A;  3EF7 A;  3S9E A;  1XOC A;  3UGW A;  1DPE A;  2AIX A;  3C4M A;  3MBP A;  4PE5 B;  3S4U A;  1MQG A;  3SZP A;  4NWD A;  1B1X A;  4F3P A;  4MNC A;  3OXN A;  3H6V A;  3MPL A;  3T96 B;  3E79 A;  1MQH A;  5L9S A;  3CFL A;  1ZJL A;  1UTH A;  1S9T A;  3ILT B;  3O9P A;  5KDT B;  2HXW A;  3U93 A;  3MVZ A;  4F2Q A;  5TP9 A;  3TDJ A;  4H45 A;  3M8U A;  2O84 X;  3N26 A;  5FBP A;  4NF4 B;  3H3G A;  4IGR A;  2XXX A;  4RXL A;  3HV1 A;  1N7W A;  1NV6 A;  3CRB A;  1LFH A;  5ET6 A;  3HCQ A;  3IOR A;  2QS2 A;  4O94 A;  1IXC A;  4RNS A;  4JSO A;  1ZIU A;  1LAF E;  2NVU B;  1JW5 A;  4R6H A;  1EYK A;  4DZ1 A;  2G29 A;  4G8M A;  4ND9 A;  4ELP A;  4EXK A;  1FJ9 A;  2F35 A;  4GWU A;  4X9T A;  3USD A;  2OBG A;  1ZLQ A;  1I6A A;  2XX7 A;  2FVZ A;  3N6T A;  1QW0 A;  2OWZ A;  4DCY A;  5IKB A;  2UYF A;  1MDQ A;  1FPD A;  4FEB A;  3BFU A;  3TOD A;  4OAN A;  1B3F A;  2R9J A;  4NF0 A;  1PDA A;  1B58 A;  4GWS A;  4ZEB A;  4XKQ A;  2Q8J A;  5H8Q B;  1M5B A;  5AE4 A;  1MY2 A;  3V89 B;  1FQA A;  1EZO A;  1EYJ A;  4KYD A;  3UK4 A;  3VXB A;  4RPO A;  5KDT A;  2YPN A;  3RT8 A;  5L8D A;  2DWH A;  3UIF A;  2ANJ A;  1JEV A;  5ICT A;  4PC9 A;  4NF4 A;  3CG1 A;  4DI4 B;  1PB9 A;  3VXC A;  4H0W A;  5CMB A;  3H06 B;  1EH3 A;  3S9L C;  1SW1 A;  4IB2 A;  1RDY A;  3FJ7 A;  3TTN A;  2FIE A;  1D3K A;  1BIY A;  3EN3 A;  2HEU A;  4NMY A;  1HSL A;  3PD8 A;  4OMB A;  3LUY A;  1XC1 A;  3C35 A;  4F29 A;  2P1S A;  1Y3P A;  3PPR A;  2Y7P A;  1LFI A;  4DCX A;  2Y84 A;  3CI8 A;  4X1B A;  1MPC A;  4ELR A;  1QUL A;  2ZZW A;  4FE8 A;  3A09 A;  1K9Y A;  3C9H A;  3MPK A;  1QJM A;  1NNT A;  4AS5 A;  3NOH A;  4PFY A;  3MVW A;  4F18 A;  3LSL A;  4ZS9 A;  2I3W A;  4Q0C A;  4QHQ A;  1URS A;  1FTO A;  4IO2 A;  5H8Q A;  2CZL A;  5CBR A;  2OX3 A;  1DBZ A;  4GVO A;  4N81 A;  4YB6 A;  3N5L A;  5ITP A;  1RKM A;  1DMB A;  1IMA A;  3C36 A;  1MM7 A;  3SET A;  3TFL A;  5F24 A;  4XEQ A;  3JYR A;  2YJP A;  3RYD A;  1RDZ A;  1B5H A;  2X26 A;  4JWO A;  3IB1 A;  4MNP A;  4U22 A;  5DEX B;  4QSD A;  5ET5 A;  4ZE9 A;  3G3J A;  3FVG A;  3IAZ A;  3WAF A;  1M5D A;  4OER A;  2CZI A;  2P2A A;  1UIV A;  4HCW A;  3ZKK A;  5I56 B;  3KOS A;  4NED A;  2XXH A;  2E1S A;  1FCK A;  5ELV A;  1IUD A;  4GL0 A;  1VSO A;  3O29 A;  1N3W A;  1LBX A;  5K2Y A;  2RF1 A;  3SEY A;  2CZH A;  2ONK E;  4FOR A;  1NKX A;  5BUU A;  1WOD A;  5ET8 A;  1GV8 A;  4DLD A;  3PTY A;  3E3K A;  5LTC A;  1VFD A;  3FXB A;  4HTG A;  4F3S A;  4ZEI A;  2YLN A;  3RLF E;  2HFB A;  1JW4 A;  1D4N A;  1Y1Z A;  4F19 A;  2ZYO A;  3V5A A;  4IO3 A;  4YIC A;  4P1E A;  1B46 A;  2Z22 A;  1PB8 A;  5I2K B;  3U8Q A;  4MCO A;  4GXA A;  4F1V A;  4X1D A;  2I0C A;  3MZB A;  1MXY A;  3R6U A;  4IY5 A;  3IR1 A;  4GIZ A;  3HPI A;  3FAS A;  2XWI A;  5DEX A;  3UOR A;  1FRP A;  2DXY A;  3HHF A;  2QMW A;  2KLF A;  4JXI A;  1YPN A;  1NL5 A;  3IFA A;  1MG1 A;  2D3I A;  3E9X A;  5I56 A;  3PUV E;  1QUK A;  4XXU A;  3Q25 A;  2NUV A;  1LAX A;  4N4U A;  5AA1 A;  1SW5 A;  1SI1 A;  4FAJ A;  4N6P A;  2UVG A;  5A5X B;  4N8Y A;  1D9V A;  2QFL A;  4WKM A;  2V4C A;  4O8M A;  3TTR A;  4NGU A;  2IEE A;  5H8N B;  3B6W A;  3P7I A;  1P99 A;  3U92 A;  3C32 A;  5H8S A;  1VR5 A;  2DSF A;  3MZ9 A;  3RPL A;  2OZZ A;  4R2B A;  1UTB A;  2PBW A;  3BKI B;  1IMD A;  4OYV A;  5K2X A;  4P8B A;  2DWA A;  2ZYN A;  1B7Z A;  3TCF A;  4KCC A;  5I2K A;  1ZMG A;  1NV1 A;  1QVS A;  4TLL B;  1AMF A;  1INP A;  2V3U A;  3TTM A;  3O6H A;  4NF6 B;  1BKA A;  5HPQ A;  3KZG A;  4F1Y A;  4OFO A;  1FBC A;  3ECR A;  4XTC Q;  4PGN A;  5LOM A;  4UAC A;  2DP8 A;  3CFX A;  2F6P A;  3TKD A;  1MDP 1;  4RA1 A;  2FNC A;  1R6Z A;  4BDQ A;  1LST A;  3FXU A;  1SBP A;  4F22 A;  4Q8R A;  4H8J A;  4BDO A;  5A5X A;  1JQF A;  4OES A;  4POW A;  4Q5T A;  2THI A;  1FW0 A;  3PMX A;  3IB0 A;  1D9Q A;  1TT1 A;  2DXR A;  5H8N A;  2I49 A;  5ISU A;  4PF8 A;  3LR1 A;  3F11 A;  4F2O A;  1SW2 A;  2Q2C A;  3E78 A;  4X04 A;  3T9H B;  3O66 A;  1ZU0 A;  1N84 A;  2ABH A;  2CMO A;  2OJT A;  4MMP A;  4GX4 A;  1MY3 A;  4N07 A;  4KD5 A;  4GBW A;  1DCU A;  3IOV A;  2XXP A;  4N91 A;  3EHS A;  4GLI A;  2UVI A;  3LV0 A;  4RYA A;  4GBV A;  4NF6 A;  3OEK A;  5KCJ B;  2DYX A;  4PE3 A;  2F6G A;  2R6G E;  5DVJ A;  1I6Q A;  3C34 A;  4I9D A;  1AL3 A;  4GD5 A;  3T9V A;  3B6T A;  1A40 A;  1MXU A;  1RYX A;  3RPW A;  2DWI A;  4G68 B;  3DLN A;  1NFT A;  2XXV A;  2QS3 A;  3TZA A;  1IXH A;  4ESW A;  3QSL A;  2L5V A;  1D9Y A;  1OLA A;  3B7D A;  2RC9 A;  1FBD A;  4QFL A;  3MQ9 A;  4QFN A;  5AA2 B;  2WYP A;  3CVG A;  1Y1M A;  3O97 A;  1TXF A;  2H99 A;  4R72 A;  4QSE A;  1FQF A;  3GXA A;  1ATG A;  2WBD A;  1KA0 A;  2PYY A;  4BDL A;  3FXR A;  1FTL A;  4OTE A;  4R6K A;  4LQ2 A;  5DT6 A;  2MKZ A;  3VVD A;  4PTK A;  2AYS A;  2O7I A;  3QXM A;  5JTY B;  2O69 A;  2I4B A;  3PUX E;  4ZZA A;  3ILU B;  5I57 B;  1FQD A;  5AA4 B;  1IEJ A;  3VDF A;  2H9B A;  1J1N A;  4U1Z A;  1IMF A;  3CR9 A;  2DDK A;  1MXZ A;  4FED A;  1LBY A;  2Z8F A;  4OVR A;  4IR8 A;  4Q30 B;  4G77 A;  2Y7R A;  2LAO A;  3TCG A;  3FV1 A;  4G68 A;  4QXD A;  3KBZ A;  3FD3 A;  4PP0 A;  2I6E A;  2F5X A;  2PVU A;  5CBS A;  1B51 A;  1MS7 A;  1FBP A;  1HSJ A;  1MY4 A;  3HFU A;  4O7M A;  4I3Y A;  1EZP A;  3CSB A;  4P0G A;  5AA2 A;  1Q35 A;  3R26 A;  2AL4 A;  3FJM A;  4R73 A;  2P0S A;  4YZZ A;  2VPO A;  3ROJ A;  4XKR A;  4Z0I A;  5AA3 A;  1NNF A;  4LP2 B;  4R75 A;  2VT5 A;  4H5G A;  4MHF A;  5JTY A;  5ET7 A;  2DS9 A;  3TAJ A;  3DP4 A;  1NV0 A;  5I57 A;  4POX A;  5AA4 A;  4OHN A;  3L6H A;  1A7L A;  3T22 A;  1B40 A;  1FTK A;  5AA2 D;  4JSD A;  3K1N A;  2XXW A;  2QS1 A;  2GHA A;  3K6U A;  3QK6 A;  2GFE A;  1MQD A;  3OD7 A;  3PD9 A;  1JP4 A;  3E13 X;  4RK2 A;  3UN6 A;  5EHS A;  3QYT A;  2A5S A;  1LLS A;  4DXU A;  1P1N A;  2ZNT A;  4THI A;  1KZ8 A;  4GWX A;  2FYI A;  3IO4 A;  4OZ9 A;  4KXP A;  2QSX A;  1QUJ A;  4EQ7 A;  1HSE A;  1LFG A;  4X48 A;  4YKJ A;  4PFB A;  3ZS6 A;  1JW1 A;  2HQ0 A;  1LB9 A;  1MH3 A;  3MVX A;  3H03 A;  3SEW A;  2D5W A;  3K2D A;  4LZ8 A;  4JWX A;  3L6G A;  4H8I A;  3KSX A;  3T9U A;  4U4X A;  2ZNU A;  1NV2 A;  1B1H A;  2H5Y A;  2GQ1 A;  3FVO A;  3U94 A;  1GTK A;  5EQ7 A;  3T93 B;  1SQY A;  2QMX A;  1IIW A;  3QIM A;  2D21 A;  2XXK A;  3U72 A;  1OQG A;  1Z7M E;  4PF6 A;  4NQ8 A;  1MRP A;  1FQE A;  2B3F A;  2RCA A;  1NI9 A;  4ZZE A;  1NUY A;  4TQU Q;  3G3K A;  5H8H B;  1B05 A;  4MJO A;  3PUY E;  4WEP A;  4HE0 A;  5DVF A;  3MWB A;  2BJI A;  3K6W A;  3GLB A;  3D1R A;  4H6D A;  4QRZ A;  1IMC A;  1NV3 A;  1B0L A;  3KOT A;  4GQO A;  3IX1 A;  4ESX A;  5B7D A;  1S50 A;  3OO6 A;  2Q2A A;  5I58 B;  1FPK A;  1NUW A;  3QUF A;  1B3L A;  2XD3 A;  2Y7W A;  4XIG Q;  1CE2 A;  3CG3 A;  1FSA A;  3KGC A;  3THI A;  4LZ7 A;  2DWJ A;  1FTM A;  4ELQ A;  4LA9 A;  5EYH A;  3FJG A;  4NF5 B;  3IL1 B;  3MYU A;  1MPB A;  3MZ1 A;  3ZSF A;  3MC2 A;  3V83 A;  2ZZX A;  4JVD A;  3PPQ A;  3IOU A;  1Z7N E;  2XXT A;  1BLF A;  4OVP A;  1IMB A;  1B5I A;  4PAF A;  1B0H A;  2XX8 A;  4FEC A;  2W7Y A;  1WDN A;  3FAT A;  3ODB A;  1JVY A;  4OVS A;  5H8H A;  4U2R A;  5EQ8 A;  1URG A;  3K1P A;  1FQB A;  3DP6 A;  5FHM A;  4ZDM A;  4MAG A;  3TEP A;  3EHT A;  2R71 A;  2HAV A;  2PT1 A;  3CIJ A;  4GWW A;  4OEV A;  4YKP A;  4YMB A;  5A5L A;  3H7M A;  3TPA A;  1LCF A;  4G8H A;  3RPL B;  2I58 A;  3GBA A;  5TU0 A;  3MAM A;  1USY E;  1UTB B;  4F3G A;  5I58 A;  5HBC A;  5EYF A;  2Q8M A;  2NWJ A;  2RCB A;  4O3A A;  5I3S A;  3WAE A;  3OOA A;  4BDR A;  2VGQ A;  2FIX A;  4C1T A;  1SDX A;  2ALU A;  3KEI A;  1I6B A;  5EQA A;  4NF5 A;  1RDX A;  3LBS A;  2FA7 A;  2F78 A;  2GRV A;  1GVC A;  4HXV A;  4RY1 A;  3SEU A;  3FBP A;  3TCH A;  2CZK A;  3V8X B;  1LAG E;  2H4I A;  1Y4T A;  3PV0 E;  2O6A A;  1NNK A;  2DE4 A;  1URD A;  1A55 A;  3KN8 A;  4G4P A;  2F3D A;  2PT2 A;  3MJN A;  2UYE A;  3TQW A;  5I2N B;  4DXC A;  4GRK A;  3Q27 A;  4U4S A;  3FVK A;  2I4C A;  4MLV A;  4EQB A;  2HPG A;  2AL5 A;  5IAI A;  2QL3 A;  5H8F B;  2V3T A;  3S2V A;  3T1B A;  2HZL A;  4I3E A;  4GWY A;  4H46 A;  3FVN A;  2OWT A;  4GWZ A;  4N13 A;  4IO7 A;  3B6Q A;  4QSC A;  2H98 A;  1UIU A;  2V93 A;  1H45 A;  1NUZ A;  4KCD A;  3Q26 A;  3TTL A;  3SKP A;  4HCY A;  4GFR A;  3MST A;  3T9X B;  4R74 A;  1IXI A;  1Y3N A;  3PUW E;  1P1U A;  4QFO A;  1FTJ A;  1A8E A;  4LQ5 A;  1B2H A;  2Z8E A;  3LSW A;  2WBB A;  1LGB C;  2Y5L A;  4NE4 A;  1B4H A;  4GWO A;  1SYH A;  2XXU A;  2CEY A;  4M1V A;  1TWY A;  3I6V A;  2F8D A;  3GYY A;  5CMC A;  1M5C A;  3OEN A;  1O63 A;  4GXS B;  1ZKB A;  2G93 A;  5I2N A;  2OK2 A;  2Q89 A;  4OEU A;  2GHB A;  5EQ9 A;  1F9B A;  2V84 A;  4XFE A;  1NH8 A;  4OA4 A;  3KSJ A;  4OET A;  2HHM A;  2HAU A;  3K00 A;  5H8F A;  3VLV A;  3IK6 B;  1POT A;  4LVQ A;  4UAB A;  4FAT A;  1LB8 A;  5CI5 A;  5FHN A;  4JVI A;  1QGX A;  3N6U A;  2KR0 A;  2QVR A;  2P3N A;  3LSF B;  3FGS A;  5CM6 A;  1B4Z A;  3EKI A;  3KC1 A;  1LAH E;  3UP9 A;  1N76 A;  1KWH A;  2PX1 A;  4MX6 A;  4OQO A;  2RIN A;  1ANF A;  1A54 A;  4PFR A;  2VOZ A;  3HST A;  2R8T A;  5CRY A;  1R9Q A;  4K3F A;  4ZE8 A;  3PPP A;  4GX3 A;  2XHD A;  3RGY A;  4OEN A;  4QBA A;  1Y9U A;  1NV7 A;  2B3B A;  5F1Q A;  2F7C A;  1POY 1;  5ITO A;  1B7H A;  5TPA B;  3PMW A;  3KFM A;  4N17 A;  3OSQ A;  4MLQ A;  1MH4 A;  4ZED A;  4ZEF A;  1LBZ A;  3OSR A;  3KJT A;  1MXV A;  4WED A;  1MXX A;  5F7V A;  2HZK A;  1FTA A;  4H1X A;  5DVI A;  3JZJ A;  3FIR A;  2QRY A;  3O6G A;  4JB7 A;  4GF8 A;  1S7Y A;  4PBQ A;  4TLM B;  4LON B;  4YAH X;  3MP8 A;  3KG2 A;  5ESY A;  1XT8 A;  2P3V A;  3AXF A;  4F3B A;  4EF1 A;  4AQ4 A;  1FBH A;  1FPG A;  1CB6 A;  4DDD A;  1DK4 A;  1FBG A;  3RTW B;  1VFE A;  1XVY A;  3D4G A;  5J1D A;  4DXB A;  4PFT A;  5I5P A;  1L5T A;  4YB5 A;  1KA1 A;  5ICQ A;  3QMF A;  4AB6 A;  4KPT A;  3S9M C;  2Y7K A;  3ZKL A;  3PPO A;  4ZEC A;  3TEL A;  4G68 C;  2ZXT A;  2PFZ A;  5HM4 B;  2FBP A;  5TPA A;  2UXA A;  1NH7 A;  4MEV A;  1IQ7 A;  4G61 A;  3W9V A;  4NAP A;  3VFJ A;  4O7I A;  4R2F A;  1FPL A;  4FBP A;  2PMS A;  5FTH A;  4XKP A;  4I1D A;  3RUM A;  1NNP A;  3KBR A;  4N15 A;  3CSG A;  1GGG A;  3K6V A;  1B7U A;  2GH9 A;  2I3V A;  1B3E A;  1NUX A;  2Z23 A;  1JNF A;  2XXI A;  3JV9 A;  3W9W A;  4E0X A;  1MXW A;  3U65 A;  4NX1 A;  3H6T A;  2UVJ A;  3N94 A;  4OVQ A;  4FJP A;  2M8C A;  1MY1 A;  1B32 A;  3VE1 B;  2QPQ A;  4PDD A;  3MVY A;  4IY6 A;  3RQT A;  2F7A A;  1USY H;  3C33 A;  3PGF A;  1B3G A;  1ZBM A;  3KN3 A;  4XF5 A;  1T0K A;  3KJ7 A;  3O28 A;  4FIM A;  3G3G A;  3SES A;  3MP1 A;  1DTG A;  1N0T A;  3G3H A;  4MFI A;  1MPD A;  2XXQ A;  4YB7 A;  1AWB A;  2OLB A;  1B3H A;  1FPI A;  3G3F A;  1SVX B;  4RK9 A;  1WVJ A;  3K6X A;  3B8B A;  3GBB A;  4PDH A;  1PBQ A;  2ZNS A;  3OO7 A;  1IIT A;  3GZG A;  4EDP A;  3Q29 A;  4R9G A;  2Y5K A;  2VP1 A;  1MQJ A;  1FPJ A;  1II5 A;  1MM6 A;  2DE2 A;  1LCT A;  4H67 A;  1NMU A;  1VDW A;  1OIB A;  1IME A;  3FXQ A;  3HHG A;  4PCD A;  4C1U A;  3BIG A;  1YTV A;  4UA8 A;  4P9K A;  3H4Z A;  4QFK A;  3EQ1 A;  4IO5 A;  3ISP A;  1TFD A;  5L9M A;  1A8F A;  1OVT A;  4P47 A;  3KN7 A;  2Z8D A;  3PU5 A;  5IGA A;  3H6U A;  5JK4 A;  4OVJ A;  1G0I A;  3IJX B;  2ZYK A;  1GR2 A;  2F7B A;  1XI6 A;  2Q88 A;  1QKA A;  5CC2 A;  4IO4 A;  2VD3 A;  1H43 A;  2IA4 A;  2WYK A;  3K0V A;  2H25 A;  4C0R A;  1P1O A;  4R9F A;  3CFZ A;  3UA8 A;  4DE8 A;  4ONY A;  4ELO A;  2X7Q A;  3QAX A;  4E0W A;  3VVF A;  2A5T B;  5I84 A;  4NHB A;  4YKI A;  4TOZ A;  2I0B A;  1Y3Q A;  3KC0 A;  3VLU A;  2XA5 A;  1YCJ A;  3BBR A;  1QKB A;  1US5 A;  4N6D A;  1IXG A;  2Y7I A;  4PQJ A;  2F3B A;  5T3J A;  4YKK A;  1EU8 A;  5CMK A;  3R7X A;  3TQL A;  1P1W A;  3TTK A;  4KYS A;  4PAK A;  1YYZ A;  1FBE A;  3BFT A;  2B4M A;  3DP8 A;  4RPN A;  3ONM A;  1AOV A;  4IGT A;  2O51 A;  4I62 A;  4YMA A;  3DEL B;  5DW8 A;  5DYH A;  2ZMB A;  4O3B A;  4NG7 A;  1OVB A;  4N8G A;  1FQC A;  5L9O A;  1SYI A;  1SPI A;  2DVZ A;  2Q74 A;  1MY0 A;  1M5E A;  3HN0 A;  4KQP A;  1NV4 A;  1SD3 A;  2VHA A;  1SW4 A;  3PMV A;  4M4G A;  5EHM A;  3Q28 A;  2REG A;  3K01 A;  3SEX A;  1IZ1 A;  5IZZ A;  5CMM A;  3OMB A;  2A5T A;  4EXL A;  2B4L A;  2V3Q A;  2QVU A;  3VVE A;  1QUI A;  1FBF A;  3FV2 A;  1EYI A;  5DTB A;  4L17 A;  3M3K A;  1ELJ A;  3PPN A;  1A99 A;  2JJK A;  3I5O A;  4P1L A;  4EF2 A;  2QVV A;  4LAT A;  3CHG A;  4G2Z A;  3B50 A;  4I40 A;  3VV5 A;  3IO6 A;  3H6W A;  1H44 A;  2KQZ A;  4U23 A;  4BDM A;  3O6I A;  4MIJ A;  3C31 A;  1LBB A;  4PAI A;  3FZV A;  4PFU A;  1LEV A;  3EPE A;  5EYG A;  2VPN A;  1FJ6 A;  4P0I A;  2ZZV A;  4MBP A;  3IFC A;  4F1U A;  4P3L A;  1LBV A;  2O68 A;  4MNI A;  1DPP A;  3A29 A;  4JBZ A;  4MF3 A;  4HE1 A;  1XVX A;  3SER A;  4F31 B;  2DOJ A;  4BLA A;  3S9N C;  1CNQ A;  1PEB A;  4HS7 A;  2X7P A;  3I3V A;  1OLC A;  2F34 A;  4GL8 A;  2WKY A;  4GOT A;  3RTF B;  4DI3 D;  4R6Y A;  2O1M A;  4H5F A;  4JWY A;  4EQ9 A;  4NF8 B;  2CEX A;  3HO7 A;  3LSX A;  1M5F A;  4F39 A;  3QUJ A;  1EZ9 A;  4WXJ A;  2NXO A;  4IO6 A;  3IJO B;  3MP6 A;  2QS4 A;  5IZ1 A;  2XX9 A;  2ONS A;  2OWS A;  3OEL A;  3RN8 A;  3PUZ E;  5KZT A;  4EUO A;  4XKN A;  3LUZ A;  1SI0 A;  3LC8 A;  1R9L A;  2PFY A;  4OVT A;  1BK4 A;  4PFW A;  1BTJ A;  1B6H A;  2HCA A;  2QJE A;  3TYH A;  5FTI A;  2XXR A;  3IOW A;  1OQH A;  3A3C A;  4AS4 A;  1N04 A;  3K02 A;  4MH5 A;  4RJZ A;  4KR5 A;  1BP5 A;  2B65 A;  1G0H A;  2XWO A;  1Q9D A;  4OXV A;  3DM0 A;  4LUB A;  1FPB A;  2ONR A;  1O7T A;  1RYO A;  1R1N A;  5BWJ A;  4HE2 A;  1B9J A;  4JVC A;  2Q9T A;  4AB5 A;  2RKM A;  2DQV A;  3M3F A;  5IZ3 B;  2O1L A;  1FPF A;  1ZTY A;  4NTL A;  3BIH A;  2F36 A;  4P56 A;  3TMG A;  4NF8 A;  1VE4 A;  3T66 A;  1P1Q A;  3EHU A;  2O7U A;  2V25 A;  4I8C A;  4KHZ E;  4QFP A;  1K9Z A;  3M3L A;  4QF9 A;  2XD2 A;  5M2V A;  1N7X A;  1PC3 A;  4U1O A;  2NOO A;  2ESN A;  2RC8 A;  5I7I A;  4JDF A;  4LZ5 A;  2XWV A;  1LBW A;  1AIV A;  4ISU A;  4PFI A;  2RC7 A;  2VD2 A;  2BJJ X;  3VLW A;  4PBH A;  2WEF A;  2E0S A;  3G3I A;  2PCR A;  4ZEK A;  1YAE A;  2XWK A;  2WX9 A;  1PB7 A;  3RT6 B;  4Z7E A;  1US4 A;  4KI0 E;  4H65 A;  3A3U A;  1LBC A;  3IB2 A;  3K1M A;  4U21 A;  5I59 B;  4N6K A;  1FPE A;  1OMP A;  3SDF A;  4OWD A;  1JET A;  4O3C A;  1Y20 A;  1B52 A;  3OO8 A;  1H3D A;  2DE3 A;  4PET A;  5FHO A;  5IZ3 A;  1XS5 A;  2DVC A;  5IM2 A;  3RNN A;  3U1O A;  1Y4C A;  1UQW A;  4BDN A;  1DOT A;  2REJ A;  3OO9 A;  1DTZ A;  3SEV A;  4KFQ A;  1O64 A;  1I69 A;  3FUZ A;  3OEM A;  4NN3 A;  1TFA A;  1H76 A;  3T0J A;  4OFL A;  4NWC A;  1Q1K A;  2F97 A;  1MQI A;  2I48 A; 
#chains in the Genus database with same CATH homology
 1INP A;  5LDZ A;  4OVS A;  1FPJ A;  4PGP A;  1YXI A;  5EQ8 A;  4X8R A;  2DE2 A;  1FBC A;  5J16 A;  4PGN A;  4LN5 A;  1VDW A;  1IME A;  4GX6 A;  4PCD A;  1YZ0 A;  4MAG A;  3BIG A;  1NV5 A;  4GWW A;  5A5L A;  2FHY A;  3RPL B;  4P9K A;  3ISP A;  2Q8M A;  2HXR A;  5I3S A;  4P47 A;  2FIX A;  5IGA A;  1D9Q A;  5JK4 A;  5EQA A;  1G0I A;  1RDX A;  4PF8 A;  4HXV A;  1XI6 A;  3FBP A;  3E78 A;  4X04 A;  2CZK A;  4MMP A;  2WYK A;  4GX4 A;  2DE4 A;  3SZP A;  2F3D A;  4GBW A;  1DCU A;  4N91 A;  4MNC A;  3E79 A;  3LV0 A;  4GBV A;  4NHB A;  4PE3 A;  2HPG A;  3KC0 A;  2XA5 A;  4H45 A;  5FBP A;  3T1B A;  4N6D A;  2HZL A;  4I3E A;  4GWY A;  2F3B A;  4H46 A;  5T3J A;  1NV6 A;  5ET6 A;  4GWZ A;  4PAK A;  2L5V A;  1YYZ A;  4O94 A;  1FBE A;  2B4M A;  1FBD A;  2WYP A;  1EYK A;  1NUZ A;  5DW8 A;  1FJ9 A;  4NG7 A;  4N8G A;  4GWU A;  2WBD A;  4HCY A;  1KA0 A;  3MST A;  4X9T A;  1SPI A;  2DVZ A;  2Q74 A;  2FVZ A;  2MKZ A;  2OWZ A;  4PTK A;  1NV4 A;  2WBB A;  2Y5L A;  1FPD A;  2CEY A;  4M1V A;  4OAN A;  4NF0 A;  3GYY A;  4GWS A;  5IZZ A;  1IMF A;  1EYJ A;  5EQ9 A;  2B4L A;  4XFE A;  2DDK A;  2V3Q A;  2QVU A;  4OA4 A;  1FBF A;  1EYI A;  2HHM A;  1LBY A;  4OVR A;  4IR8 A;  2JJK A;  4PC9 A;  4UAB A;  4P1L A;  4QXD A;  2QVV A;  3KBZ A;  4DI4 B;  3CHG A;  3B50 A;  4I40 A;  4JVI A;  1QGX A;  2KR0 A;  2QVR A;  2F5X A;  2P3N A;  2KQZ A;  4MIJ A;  5CM6 A;  1FBP A;  3HFU A;  4PAI A;  1RDY A;  4O7M A;  4I3Y A;  3EKI A;  1LEV A;  3KC1 A;  5EYG A;  2VPN A;  1FJ6 A;  2FIE A;  2ZZV A;  3IFC A;  4F1U A;  4MX6 A;  4P3L A;  1LBV A;  4MNI A;  4YZZ A;  2VPO A;  3A29 A;  4HE1 A;  3ROJ A;  4PFR A;  1CNQ A;  2ZZW A;  2R8T A;  1K9Y A;  2VT5 A;  4GX3 A;  4MHF A;  5ET7 A;  4QBA A;  1NV7 A;  4DI3 D;  4AS5 A;  1NV0 A;  3NOH A;  4F18 A;  4N17 A;  2CEX A;  2OX3 A;  1DBZ A;  4N81 A;  1LBZ A;  1IMA A;  5IZ1 A;  2HZK A;  1FTA A;  1JP4 A;  5F24 A;  4XEQ A;  3RYD A;  1RDZ A;  4PBQ A;  3LUZ A;  2PFY A;  4MNP A;  5ESY A;  4OVT A;  1BK4 A;  5ET5 A;  2P3V A;  1KZ8 A;  4GWX A;  4AS4 A;  2CZI A;  4KXP A;  4HCW A;  1FBH A;  1FPG A;  1G0H A;  2XWO A;  1Q9D A;  4PFB A;  1DK4 A;  1LBX A;  1FBG A;  2CZH A;  1FPB A;  5ET8 A;  5J1D A;  5I5P A;  1KA1 A;  3PTY A;  4HE2 A;  4JVC A;  5LTC A;  2Q9T A;  3FXB A;  3QMF A;  1NV2 A;  5IZ3 B;  1FPF A;  2GQ1 A;  3BIH A;  2PFZ A;  4P56 A;  2FBP A;  5EQ7 A;  4F19 A;  4MEV A;  4G61 A;  4YIC A;  4P1E A;  3W9V A;  4NAP A;  2XXK A;  1K9Z A;  4O7I A;  1FPL A;  4FBP A;  4N15 A;  4MCO A;  4NQ8 A;  4PF6 A;  4F1V A;  1NI9 A;  1NUY A;  1NUX A;  5I7I A;  4MJO A;  2XWV A;  1LBW A;  3W9W A;  4HE0 A;  2XWI A;  4PFI A;  1FRP A;  4PBH A;  2WEF A;  2BJI A;  3U65 A;  4NX1 A;  3D1R A;  2PCR A;  3IFA A;  1IMC A;  1NV3 A;  2XWK A;  2WX9 A;  4OVQ A;  2QPQ A;  4PDD A;  4N4U A;  1FPK A;  1NUW A;  4N8Y A;  4N6K A;  2QFL A;  4XF5 A;  2V4C A;  1FPE A;  4O8M A;  1FSA A;  4NGU A;  2DE3 A;  4PET A;  5EYH A;  5IZ3 A;  1AWB A;  5IM2 A;  3RPL A;  1FPI A;  3MYU A;  4PDH A;  3B8B A;  2ZZX A;  1IMD A;  4JVD A;  4P8B A;  4NN3 A;  4OVP A;  1IMB A;  4PAF A;  1NV1 A;  3T0J A;  2Y5K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...