4P1EA

Crystal structure of a trap periplasmic solute binding protein from escherichia fergusonii (efer_1530), target efi-510119, apo open structure, phased with iodide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
296
Chain Sequence
AESLNVSTSLSPDDPIYKGLQSFKKGVESRTNGEVKIKLFSQLGADNELLQHAQAGSNVGVVVDGARLAQFVPEFAIIPAPFVFKDYTTLKKFISSPVFAQWSEQMSSKSGLTPLSFNWYQGARMLVTQKPVSKPSDLNGVRVRALEAPVTIETIKCMGGSPTPLSWSEIYSSIQTGVVDAAEAQPTAVYGSKLYEITKHITKTNHIHLMTGIIVSQKWLSSLTAEQQTILREEAQKNGDIASENTILAGDKMLDEMAKKGMTISEVDTQPFIDGCRYVPEKLGLSEAYKQVNSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Escherichia fergusonii
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 100
structure length 296
sequence length 298
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p1eA00
2XXKA 4P47A 4UABA 2CEXA 2PFYA 5I7IA 4MNIA 4MIJA 2PFZA 2WYPA 4NGUA 2ZZXA 4PAIA 4P1EA 4PFBA 2XWOA 4OVRA 4YICA 4P9KA 2XWIA 4LN5A 5CM6A 2CEYA 4OVTA 4PAFA 5I5PA 4NF0A 2V4CA 4NAPA 4NG7A 4N91A 4PE3A 4O94A 2VPOA 4PAKA 4OVSA 4MNCA 2VPNA 4DI3D 2ZZVA 4MAGA 4PDDA 4YZZA 4PGNA 4PC9A 4PETA 3FXBA 2XWKA 4PGPA 4XEQA 2HZKA 4N8YA 4P1LA 4OANA 4PBQA 3U65A 4MCOA 4PDHA 5IM2A 3GYYA 4MNPA 4NHBA 2HPGA 4PFIA 4PBHA 4N4UA 4N6DA 4MEVA 4PCDA 4N8GA 2XA5A 2WX9A 5IZZA 4MMPA 4XF5A 4X04A 2WYKA 4O7MA 4NX1A 4X8RA 4NQ8A 5LTCA 4MX6A 4O8MA 2ZZWA 3B50A 4N17A 2HZLA 4OVPA 4NN3A 4OA4A 4N6KA 4OVQA 4P8BA 4P3LA 4PF8A 4XFEA 4N15A 4PFRA 2XWVA 4PF6A 4P56A 4DI4B 5IGAA 4MHFA
chains in the Genus database with same CATH superfamily
2CEXA 1MH4A 4EUOA 1P1UA 2WYPA 4HXVA 2ZZXA 4KD5A 2CZKA 2B4LA 1MDP1 2V93A 3EHUA 2Q88A 5CM6A 1D9VA 3BIGA 3RYDA 2X7PA 3TQLA 4F2OA 3VLWA 3MZ9A 4OZ9A 2IA4A 1BLFA 1A8EA 2GRVA 1URDA 4O94A 5A5XB 3OEMA 1ZIUA 1UQWA 4YZZA 3BIHA 1JQFA 4OESA 1Q9DA 1LAGE 1NNKA 2KQZA 4HE0A 4N8YA 1SVXB 3MUQA 4I3EA 5CRYA 4FEBA 1FPEA 4GL8A 2OLBA 2XD3A 1G0IA 1VFEA 4QFKA 2ZXTA 1LFHA 3SDFA 1BIYA 3SEVA 5HBCA 2PX1A 1NV0A 2CZHA 1FCKA 2W7YA 4LZ8A 2DSFA 1QVSA 4XIGQ 5AA2A 1XI6A 5TP9B 1LBZA 3Q28A 1A55A 1MY3A 4I62A 4O3CA 4BDNA 2Q2CA 5ET5A 4PP0A 3V5AA 2QPQA 3FBPA 4XFEA 4MLVA 1FPIA 1S9TA 1UTBA 1B32A 4RXLA 3OOAA 5EYHA 5ICQA 2LAOA 3U92A 4KXPA 3KN8A 4JXIA 1IXGA 1SYIA 2QFLA 2VD3A 4KI0E 1EZ9A 2F3DA 4PQJA 2O51A 3KN3A 3U72A 5BWJA 4P9KA 3H6VA 4L17A 1FPGA 2I3WA 4UA8A 2I49A 3RQTA 1K9ZA 3Q25A 1MQGA 4PAFA 4NF4B 4ND9A 3G3KA 3H4ZA 1SPIA 2I3VA 2QRYA 1XVYA 4U4XA 2GH9A 1US4A 5CMMA 3E79A 1FW0A 1B52A 2V3QA 5DW8A 5AA1A 3GBBA 4JVDA 4JDFA 3S2VA 4IO2A 4G8HA 4EQBA 3ILTB 4JB7A 1Y3NA 4I8CA 2F7AA 3I5OA 5H8FA 2M8CA 3VXCA 1Y20A 2NWJA 2F36A 3MAMA 2P3NA 4R9FA 2HEUA 4E0WA 4GD5A 1B0HA 4THIA 5B70A 5CI5A 2XHDA 3QUJA 1NV7A 3VVFA 4ZEKA 2OCUA 2QMXA 4DZ1A 1O64A 1TFDA 4GWXA 3O29A 3OO6A 4PFRA 2H5YA 3ZSFA 1D3KA 4OFOA 1QW0A 3VLVA 2QS3A 2O1MA 3SZPA 4GFRA 3C4MA 4HE2A 3O6HA 2AL5A 1NV3A 2PFYA 1B40A 5EYGA 3CR9A 5DEXB 4G2ZA 4POWA 4BDOA 1WVJA 1I69A 5AE4A 1B3LA 1BTJA 3TKDA 3PD9A 1YPNA 4R9GA 4R2BA 2F5XA 1ELJA 1OVBA 1ZTYA 4PE3A 1H43A 2VPOA 3MZ1A 5LOMA 4X1BA 1R9QA 1FBEA 3MQ9A 3PGFA 4PETA 2WBBA 3K4UA 4K3FA 4R75A 3TUSA 4XKRA 2NUVA 1YXIA 1LAXA 1H3DA 4IO5A 2HPGA 3EN3A 5EYFA 2DS9A 4WKMA 3JZJA 3D1RA 1S50A 2P0SA 3C31A 4PCDA 2B3BA 5I58A 5IZZA 2DWAA 1QJMA 2ZNUA 3FXUA 1JETA 3THIA 1ZLQA 4ZE9A 5EQ8A 1L5TA 2H98A 5EQ9A 1B2HA 3KEIA 3K1NA 4H0WA 3BFTA 5IKBA 2OBGA 4EXLA 3IOVA 4H5GA 1CB6A 3QAXA 2F7BA 2XXWA 1SW2A 4C0RA 4JVIA 3UK4A 4JWOA 3T9UA 3CVGA 4LN5A 5H8QB 3IO6A 4OEVA 5L9SA 3W9VA 3QSLA 1IMBA 4HCYA 1B4HA 3KSXA 2CZIA 3PUYE 2Z23A 4FJPA 4PAKA 4ECFA 3KGCA 3VV5A 5A5LA 4M4GA 3N5LA 2FHYA 3PUWE 1SQYA 3KC1A 4QFPA 1FBFA 2RINA 2HHMA 1Z7ME 4N07A 3SESA 2DOJA 2P1SA 3KBRA 1O7TA 1PB9A 2FYIA 3CSGA 5KCJA 4GBWA 1MXXA 4G68A 2F7CA 2FA7A 2Q74A 5F24A 3M8UA 5H8SA 3OELA 2Q2AA 1QUJA 1MXVA 2QVVA 1FBDA 1KA1A 2JJKA 4U22A 3SERA 3H7MA 4DXCA 3UORA 4LA9A 4XXUA 4F39A 4XKPA 1A99A 2DWHA 1MPCA 1EYJA 5K2XA 5KDTA 5FHOA 1FQFA 2DWIA 3D4CA 3SEXA 3TELA 3TQWA 4RPNA 4NGUA 2F6PA 4ZZAA 1GV8A 4PFBA 3K1PA 2I4BA 1B3GA 3C9HA 2CEYA 1M5BA 3FVGA 3CI8A 2XX9A 4YKIA 2XXXA 1P99A 2XXYA 3MZBA 4U21A 1TXFA 3LSWA 3IOUA 1JP4A 1DCUA 4XKQA 1M5FA 3MBPA 3SEWA 1SI0A 1N0TA 3ROJA 4PGNA 3I3VA 2Y5LA 3L6HA 4PC9A 2XXPA 3R26A 4PBQA 2HXWA 3U65A 2ESNA 4GBVA 1YAEA 3BBRA 3T93B 3HV1A 4HW8A 4NHBA 1B5IA 3TTMA 2R6GE 3VDFA 1S7YA 4PFIA 2I6EA 1UIVA 2GQ1A 3IFAA 4RK2A 3VE1B 3FVKA 2P2AA 3TPAA 4M1VA 5FBPA 4BDMA 2QVRA 1A7LA 3PUVE 2B3FA 2V3UA 3M3KA 1MXYA 3DM0A 3UIFA 4YMBA 3TTLA 2OZZA 5EQ7A 4NX1A 1D9QA 5ET6A 5EHSA 3FXQA 3T9VA 2B65A 1I6BA 1M5DA 2PCRA 1NNFA 2Z8DA 1GVCA 4FEDA 1FQBA 2XWVA 2Y7RA 3TAJA 4QFLA 3IJXB 1MQIA 5FHNA 3OSQA 1B58A 1ZBMA 5I2KA 1NMUA 1H45A 3KJTA 5H8FB 2QL3A 4RNSA 4EF1A 2VHAA 3IB0A 1Y9UA 1Y1MA 3MSTA 4I1DA 4GIZA 4IY6A 4YICA 5I56B 2A5TA 2Y7PA 1I6AA 4OVJA 2THIA 3PU5A 4OERA 4DIGA 4FORA 2DYXA 2XXVA 3MYUA 1LGBC 1VE4A 1VDWA 3TZAA 4F31B 4NMYA 3B7DA 4LZ5A 3HPIA 4QFOA 1HSEA 2DWJA 1B0LA 2P3VA 4NE4A 3S9MC 4DE8A 1LBBA 4Q5TA 3S9NC 4OANA 2ONSA 5L9MA 3GYYA 1FTAA 3RGYA 1UIUA 4NF8B 5AA4B 3A09A 5H8HA 1IXHA 3PPOA 1ZJLA 3KG2A 3IO4A 4IO7A 3UN6A 3D4GA 1NH7A 1OLAA 2AYSA 4BLAA 2WYKA 5IZ3A 1B7UA 4AB6A 4GX4A 1P1QA 4YB7A 4F1VA 1ZU0A 2NXOA 4NEDA 4F3BA 2UYEA 1OIBA 2RF1A 1OLCA 1OQGA 4TQUQ 3CHGA 3Q27A 1RDYA 4KPTA 4QHQA 2Y7WA 2D21A 4JWYA 4QSEA 1RYOA 3IORA 5I58B 2DXRA 1A8FA 4Z7EA 4F1YA 3H6TA 5A5XA 5I59B 3C35A 1FPJA 2F78A 4OYVA 1FQEA 4KYEA 3FV2A 3TTRA 2VGQA 1NUYA 3T66A 4MNCA 5B7DA 4MFIA 2R71A 3LR1A 2XXTA 3RPWA 2O7UA 3FXBA 3LSLA 2ZYMA 1FTKA 4XEQA 3TCFA 4YAHX 4KQPA 3KN7A 4ELRA 4X1DA 1B7HA 1BKAA 1CE2A 5H8NA 3S9EA 2ZYKA 1BP5A 4IO4A 1NV6A 1IUDA 1IQ7A 1OVTA 4PE5B 4MH5A 5JEIA 4X48A 1IMCA 2YPNA 2V84A 4X04A 3T22A 1SDXA 3KOSA 4R6YA 1TWYA 4GXSB 3HHFA 2UXAA 4OVQA 1WODA 2Q8MA 2Y7IA 4ELQA 1MDQA 3PPPA 4JVCA 2RCBA 5CMBA 4RPOA 4QRZA 3E3KA 3G3IA 1FTOA 3R7XA 3WAEA 4NF6A 5F7VA 4UABA 1ZMGA 4YB6A 5KCJB 1XC1A 4NF4A 4PAIA 3ODBA 1MXWA 3EHTA 1LEVA 3EPEA 1UTHB 3JYRA 1JVYA 3DP8A 1D4NA 2B4MA 5AA3A 5J1DA 1EYKA 4PFTA 1JVXA 3QXMA 2F97A 3PPNA 1OMPA 1URSA 3K6UA 2VT5A 4R6HA 1VR5A 2QMWA 1MXUA 2ANJA 5KDTB 5JTYA 1DK4A 1VFDA 1N3WA 4F1UA 1PC3A 1O63A 1FTJA 3L6GA 3FVOA 2XXHA 2UYFA 2ONRA 4N6DA 3ZKKA 3U1OA 2F34A 3IAZA 4N6PA 2WBDA 3KC0A 2O6AA 5ICTA 1RDZA 5L8DA 5K2YA 5CBSA 4ZDMA 1Y1ZA 2G29A 2MKZA 4POXA 4U4SA 2WX9A 1MG1A 2HXRA 3PUXE 2OK2A 4XF5A 5TP9A 1PDAA 1Y4CA 4QSDA 3ZKLA 3Q26A 2OJTA 2DQVA 5I57B 3TDJA 3A3CA 1NL5A 1B05A 2KR0A 1NV2A 1ANFA 4LVQA 4NN3A 4U1OA 4TLMB 2PVUA 4O7IA 3RUMA 1DBZA 5I3SA 2DP8A 4GXAA 5IZ1A 4MHFA 1LCTA 1FPLA 4GF8A 1Y3QA 3DP4A 4Z0IA 3T9XB 5I7IA 4OETA 2H4IA 1Y4TA 4EXKA 3OSRA 2GFEA 1NH8A 3Q29A 3O28A 4LP2B 3CIJA 3LBSA 1DSNA 1IITA 3PV0E 4O3AA 1SW4A 3PPQA 3VVDA 4R6KA 3PMWA 2CZLA 4LATA 2I0CA 4R72A 2QS1A 2DE3A 2KLFA 4AQ4A 3ZS6A 1FQCA 3QYTA 2F3BA 4KHZE 2VPNA 3GZGA 3C32A 4MAGA 4PDDA 3K00A 2DE4A 1RYXA 4F3SA 1EZPA 4JSOA 4YKJA 4PGPA 4RJZA 3F11A 4PDHA 2Y84A 4FAJA 1GTKA 1B1HA 2A5TB 1PBQA 1FBCA 4JSDA 1M5EA 1FBGA 2RKMA 3K0VA 2R9JA 4RYAA 1XHYA 1AWBA 1YYZA 3FIRA 1USYE 5T3JA 3V89B 4NF5B 4WEPA 1B5HA 1MM7A 4X9TA 3CFZA 1MRPA 4GLIA 4MBPA 4I40A 2ZZWA 3KOTA 2WKYA 3MWBA 3K1MA 4H6DA 3IX1A 1SYHA 4H45A 2FNCA 3LSFB 3O6GA 4DLDA 3T9HB 3IR1A 4QF9A 4P56A 4FATA 1LBWA 5KZTA 5FTHA 4KR5A 2QS4A 5IAIA 1LBCA 4MNIA 1UTHA 3B6QA 2XWOA 1QULA 3OXNA 2QVUA 4RK9A 2Z8EA 4DXUA 1IXIA 2IEEA 5JK4A 1B1XA 4NF0A 4GOTA 2V4CA 3P7IA 1HSLA 2QS2A 1QGXA 4R2FA 4OVSA 3TYHA 4EQ7A 4F3PA 1MPBA 3DLNA 2ZZVA 3CSBA 4HTGA 2H9BA 4MF3A 2D3IA 3H6WA 3IOTA 1RKMA 4GX3A 2HZKA 4G8MA 2I4CA 2Q8JA 4KFQA 3H3GA 1POY1 1XOCA 1DPPA 3C34A 1LBXA 4O3BA 3RTWB 3RLFE 4YKKA 3W9WA 1USYH 4H1XA 3MVWA 3A29A 3C33A 3W15C 4IY5A 2H99A 3FUZA 1AH5A 3MVYA 3OO9A 4BDQA 2VD2A 2OWSA 2UVJA 3IOWA 1TT1A 4ONYA 1A40A 4O7MA 3CFXA 4WXJA 3A3UA 4KYDA 2QJEA 2RC8A 4R74A 3E78A 2D5WA 2DVZA 1DMBA 2XXIA 4N15A 1FRPA 3VLUA 3SKPA 2Q89A 1LSTA 5AA4A 4I9DA 2UVHA 5H8NB 4DI4B 3N6TA 4C1TA 3E13X 5CC2A 2XXKA 3QIMA 3K2DA 4DXBA 3IK6B 2CMOA 1LB9A 2NVUB 2PFZA 4LONB 5L9OA 4P1EA 4IO6A 3EHSA 3EQ1A 3S9LC 3G7WA 4H8JA 2BJIA 3TMGA 4G68B 5TU0A 3O2AA 4NAPA 1XVXA 2WEFA 4QBAA 2ZNTA 4ZEIA 2FBPA 2HFBA 3ILUB 3MPKA 1NUXA 2HAUA 4P1LA 1AIVA 1QKBA 1MY2A 2XD2A 5I2KB 2L5VA 5HM4B 1OQHA 3CRBA 2DDKA 3VFJA 1IIWA 4KCCA 3K01A 1XS5A 3O97A 1MQHA 3BKIB 3K6WA 3CFLA 2YJPA 1DOTA 2GHAA 4N8GA 2XA5A 4H5FA 5CBRA 3HHGA 1B46A 4NQ8A 1NV1A 4MX6A 5AA2B 5DYHA 1IMEA 1LCFA 1MPDA 3VXBA 2YLNA 5ESYA 2R8TA 3USDA 1INPA 4GWYA 1MQJA 3PUZE 3O66A 2XXQA 4GWUA 4WEDA 1XT8A 4GWSA 3KJ7A 4NF8A 1DPEA 1N76A 4OVRA 1T0KA 1FBPA 1Q35A 3M3FA 1PEBA 3RN8A 4LUBA 3FJGA 2E1SA 1D9YA 4F29A 5I5PA 5ITOA 4NG7A 1IMAA 4G77A 2X26A 4IR8A 1F9BA 3RPLA 4DI3D 5DT6A 3T96B 2V3TA 3KSJA 5DTBA 3FJMA 2Z22A 3GXAA 1II5A 1SI1A 3MP1A 3BFUA 2DVCA 2REGA 4N81A 4F18A 4OHNA 1I6QA 4TLLB 3FD3A 2REJA 4RY1A 5DVJA 4LQ2A 4UACA 4MNPA 2Z8FA 3RTFB 1PB8A 1JEUA 1R6ZA 2XXUA 3OO8A 5ISUA 4KCDA 4NWCA 1FSAA 2FIXA 4H67A 3N6UA 4Q0CA 4G4PA 5EQAA 3ISPA 5EHMA 4O8MA 1GGGA 4YMAA 3SEYA 2DXYA 1LBYA 4OVPA 4N6KA 1PB7A 4H46A 2Q9TA 3PMXA 1P1WA 1K9YA 1RDXA 4PF6A 3VVEA 1R1NA 4ELOA 2XXRA 4ESWA 2F6GA 3B6TA 1N84A 4EQ9A 3FVNA 3OENA 4F19A 4JBZA 4XKNA 4P47A 1M5CA 3OO7A 2RCAA 3NOHA 3T1BA 1IXCA 2PBWA 4OMBA 3UP9A 4AS5A 1FJ9A 5H8HB 3TEPA 3CG3A 4GL0A 2FVZA 1VSOA 3R6UA 1IEJA 2HAVA 3S4UA 3TFLA 4Q8RA 4U2RA 5ITPA 1LAFE 4N91A 4KYSA 3ECRA 4OFLA 1NUWA 1LFGA 5ET8A 4ZE8A 1B51A 2E0SA 1N7XA 1NFTA 4U1ZA 4GWOA 3M3LA 3U93A 3QMFA 4OQOA 1IZ1A 4FECA 4P11A 3DP6A 3E4RA 4MCOA 2UVGA 5IM2A 1AOVA 1QUKA 4JWXA 4YKPA 3FGSA 4AS4A 4NF6B 3H03A 1UTBB 1FPFA 2G93A 1FPBA 5H8QA 3QUFA 1CNQA 3MW0A 5I59A 3H6UA 4TOZA 1KA0A 1B3EA 5FTIA 1MH3A 5FHMA 3B50A 1HSJA 1NV4A 4OTEA 1URGA 3E9XA 1YTVA 1PBPA 3V8XB 4RA1A 2HQ0A 2O84X 2VOZA 1FPDA 2Y5KA 2O69A 3SETA 5IGAA 4GX6A 1FPKA 3OMBA 4G68C 3ONMA 3KZGA 3HN0A 1FQDA 4NF5A 4MIJA 4PTKA 1B6HA 5I56A 1YCJA 3HO7A 3B6WA 4GWWA 4BDRA 1POTA 2XWIA 3U94A 2I0BA 2NOOA 4OVTA 3UGWA 4XTCQ 4PFUA 1QKAA 1JW4A 4OENA 1FQAA 3RPLB 1G0HA 5CMCA 2GHBA 4G8NA 4ZEBA 3IB1A 4DCXA 1DTZA 1H76A 4G61A 4ZZEA 2F8DA 5I2NA 1NV5A 3OD7A 3PMVA 4ZS9A 1B3HA 3OEKA 4Q30B 3FASA 3LC8A 1JNFA 5TPAB 3SEUA 4GQOA 1LBVA 3G3FA 3TTKA 1MXZA 3RNNA 2V25A 3KFMA 4ZEDA 3RT8A 2ZYNA 1JW1A 4GVOA 3G3JA 3B8BA 4PBHA 4OXVA 1LFIA 4ELPA 2BJJX 4HS7A 3IB2A 2FIEA 1B4ZA 5IZ3B 4ZEFA 1EU8A 4FBPA 3MC2A 3V83A 4NTLA 4X8RA 3MVXA 2HCAA 5LTCA 4IGRA 4E0XA 1N3XA 4FIMA 1P1NA 1SD3A 4U23A 1FTMA 2ONKE 3LUYA 1FTLA 3FJ7A 4C1UA 4HE1A 5DVFA 4IGTA 2ABHA 4OEUA 3LUZA 1MQDA 3PD8A 2XX8A 3WAFA 1P1OA 4AB5A 1TFAA 5AA2D 2PT2A 2O68A 4QFNA 5ELVA 2O7IA 1NI9A 1Y3PA 2I48A 3MP6A 3O6IA 3GLBA 4DDDA 1NNPA 2RC7A 3G3GA 2OX3A 5DVIA 4YB5A 3O9PA 1US5A 2PYYA 3HCQA 2H25A 5CMKA 1B3FA 3PTYA 1IMDA 4YU0A 3IJOB 2O1LA 1N7WA 2XWKA 3HFUA 3TCHA 1BK4A 4P0GA 2OWTA 1Q1KA 5BUUA 3JV9A 4F2QA 3AXFA 1LLSA 1EYIA 1R9LA 1QUIA 3C36A 4F3GA 4MJOA 4N4UA 1H44A 2AL4A 3FZVA 3T0JA 1KZ8A 4DCYA 4HCWA 3IL1B 4MEVA 4EF2A 3H06B 3RT6B 4BDLA 1SW1A 4I3YA 3K6XA 4MLQA 5J16A 5DEXA 2VP1A 2I58A 1YZ0A 1GR2A 4OWDA 3FXRA 1MM6A 4IB2A 3LV0A 3GBAA 3HSTA 1N04A 4EDPA 4PFYA 3RY3A 1MS7A 4QXDA 4OA4A 4P8BA 3TTNA 4P3LA 2RC9A 1LB8A 1LAHE 2ZNSA 3G3HA 4F22A 1A54A 4IO3A 4QSCA 3U8QA 1KWHA 2Y7KA 5HPQA 5F1QA 4NWDA 3K6VA 1B5JA 2ALUA 3UA8A 3MJNA 3EKIA 1WDNA 5I2NB 1NUZA 2DE2A 1NKXA 3K02A 2XX7A 1AMFA 3MVZA 5ET7A 1MY1A 2QSXA 1B7ZA 3LSXA 3EF7A 1MY0A 5TPAA 1EH3A 4LQ5A 3I6VA 4ZECA 3IFCA 5JTYB 1ZKBA 3TODA 2A5SA 3MP8A 1ATGA 3N94A 1JW5A 4ESXA 3N26A 4H8IA 2ZYOA 4GRKA 1FBHA 1EZOA 2PMSA 4H65A 3CG1A 1SW5A 1Z7NE 3PPRA 1AL3A 2ZMBA 4P0IA 3FV1A 1SBPA 2X7QA 4PFWA 4MMPA 3MPLA 4LZ7A 5M2VA 3KBZA 5I84A 1B9JA 4OFJA 5I57A 3DELB 1FJ6A 4N17A 2HZLA 1IMFA 2AIXA 4PF8A 3FATA 4R73A 1DTGA 2UVIA 5LDZA 1JEVA 4N13A 4ISUA 4GWZA 2PT1A 4FE8A 1MY4A 1NNTA 3QK6A 2F35A 2OWZA 3TCGA 1J1NA
chains in the Genus database with same CATH topology
1FPLA 1LBWA 4HE2A 4GX6A 4HE1A 1FPKA 4F19A 4KXPA 3CHGA 4GWUA 4O8MA 1RDYA 1NV3A 2XXKA 4P47A 4UABA 2CEXA 2QFLA 2PFYA 4GWSA 5I7IA 3LUZA 3NOHA 4JVIA 3T1BA 5LTCA 3MSTA 2F3DA 4MNIA 4MIJA 2PFZA 2WYPA 4AS5A 4NGUA 5EYGA 1FJ9A 4HXVA 2ZZXA 4F18A 4PTKA 4PAIA 4P1EA 2CZKA 2XWOA 4OVRA 2B4LA 4PFBA 4YICA 1FBPA 4P9KA 4GWWA 2BJIA 1FPGA 2XWIA 2FVZA 1LEVA 4LN5A 2QVUA 5CM6A 2CEYA 3BIGA 4OVTA 3RYDA 2B4MA 3EKIA 1K9ZA 1NI9A 5J1DA 1EYKA 3W9VA 4PAFA 1FPJA 1NUZA 2DE2A 5JK4A 3RPLB 5I5PA 4NF0A 1IMBA 1G0HA 2V4CA 3MYUA 4NAPA 2F5XA 4HCYA 1VDWA 2DE3A 1JP4A 1QGXA 2WEFA 4N91A 4NG7A 4PE3A 2OX3A 2CZIA 4QBAA 1SPIA 5ET7A 1IMAA 1DCUA 2F3BA 4G61A 1NUWA 4O94A 2VPOA 1NV5A 4PAKA 1NUYA 2VT5A 4OVSA 4IR8A 2FBPA 5ET8A 4MNCA 2VPNA 3RPLA 4DI3D 2ZZVA 3ROJA 4MAGA 4PDDA 4YZZA 1FBEA 3QMFA 4PGNA 3BIHA 2P3VA 2DE4A 2Y5LA 3IFCA 3E79A 4PC9A 1Q9DA 3PTYA 1IMDA 4PETA 3FXBA 1NUXA 4GX3A 2WBBA 2V3QA 1DK4A 2XWKA 2KQZA 2HZKA 3HFUA 4HE0A 4JVDA 4N81A 4N8YA 4P1LA 4OANA 4XEQA 1BK4A 4I3EA 4PBQA 1LBVA 3U65A 4MCOA 4PDHA 4F1UA 4GBVA 5IM2A 4PGPA 3GYYA 2FHYA 1FTAA 1FBHA 3KC1A 1YXIA 2L5VA 1FPEA 4MNPA 1LBXA 4NHBA 1EYIA 1FBFA 1G0IA 2HPGA 4AS4A 3B8BA 4PFIA 2HHMA 4PBHA 2DDKA 4MJOA 4N4UA 3W9WA 4N6DA 1FBCA 3D1RA 1FBGA 1FPFA 1NV6A 2GQ1A 3A29A 3IFAA 2WBDA 3T0JA 1KZ8A 1NV0A 2CZHA 3KC0A 4HCWA 4MEVA 1AWBA 1YYZA 2P3NA 1FPBA 1RDZA 4PCDA 4N8GA 4M1VA 5FBPA 2XA5A 1CNQA 4GBWA 2MKZA 2QVRA 5T3JA 5A5LA 1FSAA 1XI6A 4I3YA 2FIXA 2WX9A 2FIEA 5IZ1A 5J16A 2Q74A 4MMPA 5ET5A 4X9TA 5IZZA 5F24A 1IMCA 2HXRA 4XF5A 1LBZA 1YZ0A 3KBZA 1KA0A 5DW8A 5EQAA 5IZ3B 3ISPA 4X04A 4FBPA 1NV7A 2WYKA 5IZ3A 4O7MA 5EQ7A 3LV0A 4NX1A 4X8RA 5ET6A 4NQ8A 5EQ8A 1D9QA 1NV1A 2QVVA 4I40A 4MX6A 1FBDA 1KA1A 2JJKA 2KR0A 1FJ6A 2ZZWA 1NV2A 3B50A 4N17A 5EQ9A 1LBYA 1IMEA 1NV4A 2HZLA 4GX4A 2QPQA 4OVPA 4QXDA 3E78A 1IMFA 4NN3A 4GWXA 4OA4A 4N6KA 4OVQA 2DVZA 4P8BA 3FBPA 4H46A 4O7IA 4P3LA 2PCRA 4PF8A 1DBZA 4XFEA 5ESYA 2Q8MA 4N15A 2Q9TA 1FRPA 4PFRA 2R8TA 4F1VA 4H45A 5LDZA 1FPIA 2XWVA 1K9YA 1RDXA 4PF6A 4JVCA 5I3SA 5EYHA 1FPDA 2Y5KA 1INPA 1EYJA 4GWZA 4GWYA 3SZPA 2OWZA 4P56A 4DI4B 5IGAA 4MHFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XXK A;  4P47 A;  4UAB A;  2CEX A;  2PFY A;  5I7I A;  4MNI A;  4MIJ A;  2PFZ A;  2WYP A;  4NGU A;  2ZZX A;  4PAI A;  4P1E A;  4PFB A;  2XWO A;  4OVR A;  4YIC A;  4P9K A;  2XWI A;  4LN5 A;  5CM6 A;  2CEY A;  4OVT A;  4PAF A;  5I5P A;  4NF0 A;  2V4C A;  4NAP A;  4NG7 A;  4N91 A;  4PE3 A;  4O94 A;  2VPO A;  4PAK A;  4OVS A;  4MNC A;  2VPN A;  4DI3 D;  2ZZV A;  4MAG A;  4PDD A;  4YZZ A;  4PGN A;  4PC9 A;  4PET A;  3FXB A;  2XWK A;  4PGP A;  4XEQ A;  2HZK A;  4N8Y A;  4P1L A;  4OAN A;  4PBQ A;  3U65 A;  4MCO A;  4PDH A;  5IM2 A;  3GYY A;  4MNP A;  4NHB A;  2HPG A;  4PFI A;  4PBH A;  4N4U A;  4N6D A;  4MEV A;  4PCD A;  4N8G A;  2XA5 A;  2WX9 A;  5IZZ A;  4MMP A;  4XF5 A;  4X04 A;  2WYK A;  4O7M A;  4NX1 A;  4X8R A;  4NQ8 A;  5LTC A;  4MX6 A;  4O8M A;  2ZZW A;  3B50 A;  4N17 A;  2HZL A;  4OVP A;  4NN3 A;  4OA4 A;  4N6K A;  4OVQ A;  4P8B A;  4P3L A;  4PF8 A;  4XFE A;  4N15 A;  4PFR A;  2XWV A;  4PF6 A;  4P56 A;  4DI4 B;  5IGA A;  4MHF A; 
#chains in the Genus database with same CATH topology
 2CEX A;  1MH4 A;  4EUO A;  1P1U A;  2WYP A;  4HXV A;  2ZZX A;  4KD5 A;  2CZK A;  2B4L A;  1MDP 1;  2V93 A;  3EHU A;  2Q88 A;  5CM6 A;  1D9V A;  3BIG A;  3RYD A;  2X7P A;  3TQL A;  4F2O A;  3VLW A;  3MZ9 A;  4OZ9 A;  2IA4 A;  1BLF A;  1A8E A;  2GRV A;  1URD A;  4O94 A;  5A5X B;  3OEM A;  1ZIU A;  1UQW A;  4YZZ A;  3BIH A;  1JQF A;  4OES A;  1Q9D A;  1LAG E;  1NNK A;  2KQZ A;  4HE0 A;  4N8Y A;  1SVX B;  3MUQ A;  4I3E A;  5CRY A;  4FEB A;  1FPE A;  4GL8 A;  2OLB A;  2XD3 A;  1G0I A;  1VFE A;  4QFK A;  2ZXT A;  1LFH A;  3SDF A;  1BIY A;  3SEV A;  5HBC A;  2PX1 A;  1NV0 A;  2CZH A;  1FCK A;  2W7Y A;  4LZ8 A;  2DSF A;  1QVS A;  4XIG Q;  5AA2 A;  1XI6 A;  5TP9 B;  1LBZ A;  3Q28 A;  1A55 A;  1MY3 A;  4I62 A;  4O3C A;  4BDN A;  2Q2C A;  5ET5 A;  4PP0 A;  3V5A A;  2QPQ A;  3FBP A;  4XFE A;  4MLV A;  1FPI A;  1S9T A;  1UTB A;  1B32 A;  4RXL A;  3OOA A;  5EYH A;  5ICQ A;  2LAO A;  3U92 A;  4KXP A;  3KN8 A;  4JXI A;  1IXG A;  1SYI A;  2QFL A;  2VD3 A;  4KI0 E;  1EZ9 A;  2F3D A;  4PQJ A;  2O51 A;  3KN3 A;  3U72 A;  5BWJ A;  4P9K A;  3H6V A;  4L17 A;  1FPG A;  2I3W A;  4UA8 A;  2I49 A;  3RQT A;  1K9Z A;  3Q25 A;  1MQG A;  4PAF A;  4NF4 B;  4ND9 A;  3G3K A;  3H4Z A;  1SPI A;  2I3V A;  2QRY A;  1XVY A;  4U4X A;  2GH9 A;  1US4 A;  5CMM A;  3E79 A;  1FW0 A;  1B52 A;  2V3Q A;  5DW8 A;  5AA1 A;  3GBB A;  4JVD A;  4JDF A;  3S2V A;  4IO2 A;  4G8H A;  4EQB A;  3ILT B;  4JB7 A;  1Y3N A;  4I8C A;  2F7A A;  3I5O A;  5H8F A;  2M8C A;  3VXC A;  1Y20 A;  2NWJ A;  2F36 A;  3MAM A;  2P3N A;  4R9F A;  2HEU A;  4E0W A;  4GD5 A;  1B0H A;  4THI A;  5B70 A;  5CI5 A;  2XHD A;  3QUJ A;  1NV7 A;  3VVF A;  4ZEK A;  2OCU A;  2QMX A;  4DZ1 A;  1O64 A;  1TFD A;  4GWX A;  3O29 A;  3OO6 A;  4PFR A;  2H5Y A;  3ZSF A;  1D3K A;  4OFO A;  1QW0 A;  3VLV A;  2QS3 A;  2O1M A;  3SZP A;  4GFR A;  3C4M A;  4HE2 A;  3O6H A;  2AL5 A;  1NV3 A;  2PFY A;  1B40 A;  5EYG A;  3CR9 A;  5DEX B;  4G2Z A;  4POW A;  4BDO A;  1WVJ A;  1I69 A;  5AE4 A;  1B3L A;  1BTJ A;  3TKD A;  3PD9 A;  1YPN A;  4R9G A;  4R2B A;  2F5X A;  1ELJ A;  1OVB A;  1ZTY A;  4PE3 A;  1H43 A;  2VPO A;  3MZ1 A;  5LOM A;  4X1B A;  1R9Q A;  1FBE A;  3MQ9 A;  3PGF A;  4PET A;  2WBB A;  3K4U A;  4K3F A;  4R75 A;  3TUS A;  4XKR A;  2NUV A;  1YXI A;  1LAX A;  1H3D A;  4IO5 A;  2HPG A;  3EN3 A;  5EYF A;  2DS9 A;  4WKM A;  3JZJ A;  3D1R A;  1S50 A;  2P0S A;  3C31 A;  4PCD A;  2B3B A;  5I58 A;  5IZZ A;  2DWA A;  1QJM A;  2ZNU A;  3FXU A;  1JET A;  3THI A;  1ZLQ A;  4ZE9 A;  5EQ8 A;  1L5T A;  2H98 A;  5EQ9 A;  1B2H A;  3KEI A;  3K1N A;  4H0W A;  3BFT A;  5IKB A;  2OBG A;  4EXL A;  3IOV A;  4H5G A;  1CB6 A;  3QAX A;  2F7B A;  2XXW A;  1SW2 A;  4C0R A;  4JVI A;  3UK4 A;  4JWO A;  3T9U A;  3CVG A;  4LN5 A;  5H8Q B;  3IO6 A;  4OEV A;  5L9S A;  3W9V A;  3QSL A;  1IMB A;  4HCY A;  1B4H A;  3KSX A;  2CZI A;  3PUY E;  2Z23 A;  4FJP A;  4PAK A;  4ECF A;  3KGC A;  3VV5 A;  5A5L A;  4M4G A;  3N5L A;  2FHY A;  3PUW E;  1SQY A;  3KC1 A;  4QFP A;  1FBF A;  2RIN A;  2HHM A;  1Z7M E;  4N07 A;  3SES A;  2DOJ A;  2P1S A;  3KBR A;  1O7T A;  1PB9 A;  2FYI A;  3CSG A;  5KCJ A;  4GBW A;  1MXX A;  4G68 A;  2F7C A;  2FA7 A;  2Q74 A;  5F24 A;  3M8U A;  5H8S A;  3OEL A;  2Q2A A;  1QUJ A;  1MXV A;  2QVV A;  1FBD A;  1KA1 A;  2JJK A;  4U22 A;  3SER A;  3H7M A;  4DXC A;  3UOR A;  4LA9 A;  4XXU A;  4F39 A;  4XKP A;  1A99 A;  2DWH A;  1MPC A;  1EYJ A;  5K2X A;  5KDT A;  5FHO A;  1FQF A;  2DWI A;  3D4C A;  3SEX A;  3TEL A;  3TQW A;  4RPN A;  4NGU A;  2F6P A;  4ZZA A;  1GV8 A;  4PFB A;  3K1P A;  2I4B A;  1B3G A;  3C9H A;  2CEY A;  1M5B A;  3FVG A;  3CI8 A;  2XX9 A;  4YKI A;  2XXX A;  1P99 A;  2XXY A;  3MZB A;  4U21 A;  1TXF A;  3LSW A;  3IOU A;  1JP4 A;  1DCU A;  4XKQ A;  1M5F A;  3MBP A;  3SEW A;  1SI0 A;  1N0T A;  3ROJ A;  4PGN A;  3I3V A;  2Y5L A;  3L6H A;  4PC9 A;  2XXP A;  3R26 A;  4PBQ A;  2HXW A;  3U65 A;  2ESN A;  4GBV A;  1YAE A;  3BBR A;  3T93 B;  3HV1 A;  4HW8 A;  4NHB A;  1B5I A;  3TTM A;  2R6G E;  3VDF A;  1S7Y A;  4PFI A;  2I6E A;  1UIV A;  2GQ1 A;  3IFA A;  4RK2 A;  3VE1 B;  3FVK A;  2P2A A;  3TPA A;  4M1V A;  5FBP A;  4BDM A;  2QVR A;  1A7L A;  3PUV E;  2B3F A;  2V3U A;  3M3K A;  1MXY A;  3DM0 A;  3UIF A;  4YMB A;  3TTL A;  2OZZ A;  5EQ7 A;  4NX1 A;  1D9Q A;  5ET6 A;  5EHS A;  3FXQ A;  3T9V A;  2B65 A;  1I6B A;  1M5D A;  2PCR A;  1NNF A;  2Z8D A;  1GVC A;  4FED A;  1FQB A;  2XWV A;  2Y7R A;  3TAJ A;  4QFL A;  3IJX B;  1MQI A;  5FHN A;  3OSQ A;  1B58 A;  1ZBM A;  5I2K A;  1NMU A;  1H45 A;  3KJT A;  5H8F B;  2QL3 A;  4RNS A;  4EF1 A;  2VHA A;  3IB0 A;  1Y9U A;  1Y1M A;  3MST A;  4I1D A;  4GIZ A;  4IY6 A;  4YIC A;  5I56 B;  2A5T A;  2Y7P A;  1I6A A;  4OVJ A;  2THI A;  3PU5 A;  4OER A;  4DIG A;  4FOR A;  2DYX A;  2XXV A;  3MYU A;  1LGB C;  1VE4 A;  1VDW A;  3TZA A;  4F31 B;  4NMY A;  3B7D A;  4LZ5 A;  3HPI A;  4QFO A;  1HSE A;  2DWJ A;  1B0L A;  2P3V A;  4NE4 A;  3S9M C;  4DE8 A;  1LBB A;  4Q5T A;  3S9N C;  4OAN A;  2ONS A;  5L9M A;  3GYY A;  1FTA A;  3RGY A;  1UIU A;  4NF8 B;  5AA4 B;  3A09 A;  5H8H A;  1IXH A;  3PPO A;  1ZJL A;  3KG2 A;  3IO4 A;  4IO7 A;  3UN6 A;  3D4G A;  1NH7 A;  1OLA A;  2AYS A;  4BLA A;  2WYK A;  5IZ3 A;  1B7U A;  4AB6 A;  4GX4 A;  1P1Q A;  4YB7 A;  4F1V A;  1ZU0 A;  2NXO A;  4NED A;  4F3B A;  2UYE A;  1OIB A;  2RF1 A;  1OLC A;  1OQG A;  4TQU Q;  3CHG A;  3Q27 A;  1RDY A;  4KPT A;  4QHQ A;  2Y7W A;  2D21 A;  4JWY A;  4QSE A;  1RYO A;  3IOR A;  5I58 B;  2DXR A;  1A8F A;  4Z7E A;  4F1Y A;  3H6T A;  5A5X A;  5I59 B;  3C35 A;  1FPJ A;  2F78 A;  4OYV A;  1FQE A;  4KYE A;  3FV2 A;  3TTR A;  2VGQ A;  1NUY A;  3T66 A;  4MNC A;  5B7D A;  4MFI A;  2R71 A;  3LR1 A;  2XXT A;  3RPW A;  2O7U A;  3FXB A;  3LSL A;  2ZYM A;  1FTK A;  4XEQ A;  3TCF A;  4YAH X;  4KQP A;  3KN7 A;  4ELR A;  4X1D A;  1B7H A;  1BKA A;  1CE2 A;  5H8N A;  3S9E A;  2ZYK A;  1BP5 A;  4IO4 A;  1NV6 A;  1IUD A;  1IQ7 A;  1OVT A;  4PE5 B;  4MH5 A;  5JEI A;  4X48 A;  1IMC A;  2YPN A;  2V84 A;  4X04 A;  3T22 A;  1SDX A;  3KOS A;  4R6Y A;  1TWY A;  4GXS B;  3HHF A;  2UXA A;  4OVQ A;  1WOD A;  2Q8M A;  2Y7I A;  4ELQ A;  1MDQ A;  3PPP A;  4JVC A;  2RCB A;  5CMB A;  4RPO A;  4QRZ A;  3E3K A;  3G3I A;  1FTO A;  3R7X A;  3WAE A;  4NF6 A;  5F7V A;  4UAB A;  1ZMG A;  4YB6 A;  5KCJ B;  1XC1 A;  4NF4 A;  4PAI A;  3ODB A;  1MXW A;  3EHT A;  1LEV A;  3EPE A;  1UTH B;  3JYR A;  1JVY A;  3DP8 A;  1D4N A;  2B4M A;  5AA3 A;  5J1D A;  1EYK A;  4PFT A;  1JVX A;  3QXM A;  2F97 A;  3PPN A;  1OMP A;  1URS A;  3K6U A;  2VT5 A;  4R6H A;  1VR5 A;  2QMW A;  1MXU A;  2ANJ A;  5KDT B;  5JTY A;  1DK4 A;  1VFD A;  1N3W A;  4F1U A;  1PC3 A;  1O63 A;  1FTJ A;  3L6G A;  3FVO A;  2XXH A;  2UYF A;  2ONR A;  4N6D A;  3ZKK A;  3U1O A;  2F34 A;  3IAZ A;  4N6P A;  2WBD A;  3KC0 A;  2O6A A;  5ICT A;  1RDZ A;  5L8D A;  5K2Y A;  5CBS A;  4ZDM A;  1Y1Z A;  2G29 A;  2MKZ A;  4POX A;  4U4S A;  2WX9 A;  1MG1 A;  2HXR A;  3PUX E;  2OK2 A;  4XF5 A;  5TP9 A;  1PDA A;  1Y4C A;  4QSD A;  3ZKL A;  3Q26 A;  2OJT A;  2DQV A;  5I57 B;  3TDJ A;  3A3C A;  1NL5 A;  1B05 A;  2KR0 A;  1NV2 A;  1ANF A;  4LVQ A;  4NN3 A;  4U1O A;  4TLM B;  2PVU A;  4O7I A;  3RUM A;  1DBZ A;  5I3S A;  2DP8 A;  4GXA A;  5IZ1 A;  4MHF A;  1LCT A;  1FPL A;  4GF8 A;  1Y3Q A;  3DP4 A;  4Z0I A;  3T9X B;  5I7I A;  4OET A;  2H4I A;  1Y4T A;  4EXK A;  3OSR A;  2GFE A;  1NH8 A;  3Q29 A;  3O28 A;  4LP2 B;  3CIJ A;  3LBS A;  1DSN A;  1IIT A;  3PV0 E;  4O3A A;  1SW4 A;  3PPQ A;  3VVD A;  4R6K A;  3PMW A;  2CZL A;  4LAT A;  2I0C A;  4R72 A;  2QS1 A;  2DE3 A;  2KLF A;  4AQ4 A;  3ZS6 A;  1FQC A;  3QYT A;  2F3B A;  4KHZ E;  2VPN A;  3GZG A;  3C32 A;  4MAG A;  4PDD A;  3K00 A;  2DE4 A;  1RYX A;  4F3S A;  1EZP A;  4JSO A;  4YKJ A;  4PGP A;  4RJZ A;  3F11 A;  4PDH A;  2Y84 A;  4FAJ A;  1GTK A;  1B1H A;  2A5T B;  1PBQ A;  1FBC A;  4JSD A;  1M5E A;  1FBG A;  2RKM A;  3K0V A;  2R9J A;  4RYA A;  1XHY A;  1AWB A;  1YYZ A;  3FIR A;  1USY E;  5T3J A;  3V89 B;  4NF5 B;  4WEP A;  1B5H A;  1MM7 A;  4X9T A;  3CFZ A;  1MRP A;  4GLI A;  4MBP A;  4I40 A;  2ZZW A;  3KOT A;  2WKY A;  3MWB A;  3K1M A;  4H6D A;  3IX1 A;  1SYH A;  4H45 A;  2FNC A;  3LSF B;  3O6G A;  4DLD A;  3T9H B;  3IR1 A;  4QF9 A;  4P56 A;  4FAT A;  1LBW A;  5KZT A;  5FTH A;  4KR5 A;  2QS4 A;  5IAI A;  1LBC A;  4MNI A;  1UTH A;  3B6Q A;  2XWO A;  1QUL A;  3OXN A;  2QVU A;  4RK9 A;  2Z8E A;  4DXU A;  1IXI A;  2IEE A;  5JK4 A;  1B1X A;  4NF0 A;  4GOT A;  2V4C A;  3P7I A;  1HSL A;  2QS2 A;  1QGX A;  4R2F A;  4OVS A;  3TYH A;  4EQ7 A;  4F3P A;  1MPB A;  3DLN A;  2ZZV A;  3CSB A;  4HTG A;  2H9B A;  4MF3 A;  2D3I A;  3H6W A;  3IOT A;  1RKM A;  4GX3 A;  2HZK A;  4G8M A;  2I4C A;  2Q8J A;  4KFQ A;  3H3G A;  1POY 1;  1XOC A;  1DPP A;  3C34 A;  1LBX A;  4O3B A;  3RTW B;  3RLF E;  4YKK A;  3W9W A;  1USY H;  4H1X A;  3MVW A;  3A29 A;  3C33 A;  3W15 C;  4IY5 A;  2H99 A;  3FUZ A;  1AH5 A;  3MVY A;  3OO9 A;  4BDQ A;  2VD2 A;  2OWS A;  2UVJ A;  3IOW A;  1TT1 A;  4ONY A;  1A40 A;  4O7M A;  3CFX A;  4WXJ A;  3A3U A;  4KYD A;  2QJE A;  2RC8 A;  4R74 A;  3E78 A;  2D5W A;  2DVZ A;  1DMB A;  2XXI A;  4N15 A;  1FRP A;  3VLU A;  3SKP A;  2Q89 A;  1LST A;  5AA4 A;  4I9D A;  2UVH A;  5H8N B;  4DI4 B;  3N6T A;  4C1T A;  3E13 X;  5CC2 A;  2XXK A;  3QIM A;  3K2D A;  4DXB A;  3IK6 B;  2CMO A;  1LB9 A;  2NVU B;  2PFZ A;  4LON B;  5L9O A;  4P1E A;  4IO6 A;  3EHS A;  3EQ1 A;  3S9L C;  3G7W A;  4H8J A;  2BJI A;  3TMG A;  4G68 B;  5TU0 A;  3O2A A;  4NAP A;  1XVX A;  2WEF A;  4QBA A;  2ZNT A;  4ZEI A;  2FBP A;  2HFB A;  3ILU B;  3MPK A;  1NUX A;  2HAU A;  4P1L A;  1AIV A;  1QKB A;  1MY2 A;  2XD2 A;  5I2K B;  2L5V A;  5HM4 B;  1OQH A;  3CRB A;  2DDK A;  3VFJ A;  1IIW A;  4KCC A;  3K01 A;  1XS5 A;  3O97 A;  1MQH A;  3BKI B;  3K6W A;  3CFL A;  2YJP A;  1DOT A;  2GHA A;  4N8G A;  2XA5 A;  4H5F A;  5CBR A;  3HHG A;  1B46 A;  4NQ8 A;  1NV1 A;  4MX6 A;  5AA2 B;  5DYH A;  1IME A;  1LCF A;  1MPD A;  3VXB A;  2YLN A;  5ESY A;  2R8T A;  3USD A;  1INP A;  4GWY A;  1MQJ A;  3PUZ E;  3O66 A;  2XXQ A;  4GWU A;  4WED A;  1XT8 A;  4GWS A;  3KJ7 A;  4NF8 A;  1DPE A;  1N76 A;  4OVR A;  1T0K A;  1FBP A;  1Q35 A;  3M3F A;  1PEB A;  3RN8 A;  4LUB A;  3FJG A;  2E1S A;  1D9Y A;  4F29 A;  5I5P A;  5ITO A;  4NG7 A;  1IMA A;  4G77 A;  2X26 A;  4IR8 A;  1F9B A;  3RPL A;  4DI3 D;  5DT6 A;  3T96 B;  2V3T A;  3KSJ A;  5DTB A;  3FJM A;  2Z22 A;  3GXA A;  1II5 A;  1SI1 A;  3MP1 A;  3BFU A;  2DVC A;  2REG A;  4N81 A;  4F18 A;  4OHN A;  1I6Q A;  4TLL B;  3FD3 A;  2REJ A;  4RY1 A;  5DVJ A;  4LQ2 A;  4UAC A;  4MNP A;  2Z8F A;  3RTF B;  1PB8 A;  1JEU A;  1R6Z A;  2XXU A;  3OO8 A;  5ISU A;  4KCD A;  4NWC A;  1FSA A;  2FIX A;  4H67 A;  3N6U A;  4Q0C A;  4G4P A;  5EQA A;  3ISP A;  5EHM A;  4O8M A;  1GGG A;  4YMA A;  3SEY A;  2DXY A;  1LBY A;  4OVP A;  4N6K A;  1PB7 A;  4H46 A;  2Q9T A;  3PMX A;  1P1W A;  1K9Y A;  1RDX A;  4PF6 A;  3VVE A;  1R1N A;  4ELO A;  2XXR A;  4ESW A;  2F6G A;  3B6T A;  1N84 A;  4EQ9 A;  3FVN A;  3OEN A;  4F19 A;  4JBZ A;  4XKN A;  4P47 A;  1M5C A;  3OO7 A;  2RCA A;  3NOH A;  3T1B A;  1IXC A;  2PBW A;  4OMB A;  3UP9 A;  4AS5 A;  1FJ9 A;  5H8H B;  3TEP A;  3CG3 A;  4GL0 A;  2FVZ A;  1VSO A;  3R6U A;  1IEJ A;  2HAV A;  3S4U A;  3TFL A;  4Q8R A;  4U2R A;  5ITP A;  1LAF E;  4N91 A;  4KYS A;  3ECR A;  4OFL A;  1NUW A;  1LFG A;  5ET8 A;  4ZE8 A;  1B51 A;  2E0S A;  1N7X A;  1NFT A;  4U1Z A;  4GWO A;  3M3L A;  3U93 A;  3QMF A;  4OQO A;  1IZ1 A;  4FEC A;  4P11 A;  3DP6 A;  3E4R A;  4MCO A;  2UVG A;  5IM2 A;  1AOV A;  1QUK A;  4JWX A;  4YKP A;  3FGS A;  4AS4 A;  4NF6 B;  3H03 A;  1UTB B;  1FPF A;  2G93 A;  1FPB A;  5H8Q A;  3QUF A;  1CNQ A;  3MW0 A;  5I59 A;  3H6U A;  4TOZ A;  1KA0 A;  1B3E A;  5FTI A;  1MH3 A;  5FHM A;  3B50 A;  1HSJ A;  1NV4 A;  4OTE A;  1URG A;  3E9X A;  1YTV A;  1PBP A;  3V8X B;  4RA1 A;  2HQ0 A;  2O84 X;  2VOZ A;  1FPD A;  2Y5K A;  2O69 A;  3SET A;  5IGA A;  4GX6 A;  1FPK A;  3OMB A;  4G68 C;  3ONM A;  3KZG A;  3HN0 A;  1FQD A;  4NF5 A;  4MIJ A;  4PTK A;  1B6H A;  5I56 A;  1YCJ A;  3HO7 A;  3B6W A;  4GWW A;  4BDR A;  1POT A;  2XWI A;  3U94 A;  2I0B A;  2NOO A;  4OVT A;  3UGW A;  4XTC Q;  4PFU A;  1QKA A;  1JW4 A;  4OEN A;  1FQA A;  3RPL B;  1G0H A;  5CMC A;  2GHB A;  4G8N A;  4ZEB A;  3IB1 A;  4DCX A;  1DTZ A;  1H76 A;  4G61 A;  4ZZE A;  2F8D A;  5I2N A;  1NV5 A;  3OD7 A;  3PMV A;  4ZS9 A;  1B3H A;  3OEK A;  4Q30 B;  3FAS A;  3LC8 A;  1JNF A;  5TPA B;  3SEU A;  4GQO A;  1LBV A;  3G3F A;  3TTK A;  1MXZ A;  3RNN A;  2V25 A;  3KFM A;  4ZED A;  3RT8 A;  2ZYN A;  1JW1 A;  4GVO A;  3G3J A;  3B8B A;  4PBH A;  4OXV A;  1LFI A;  4ELP A;  2BJJ X;  4HS7 A;  3IB2 A;  2FIE A;  1B4Z A;  5IZ3 B;  4ZEF A;  1EU8 A;  4FBP A;  3MC2 A;  3V83 A;  4NTL A;  4X8R A;  3MVX A;  2HCA A;  5LTC A;  4IGR A;  4E0X A;  1N3X A;  4FIM A;  1P1N A;  1SD3 A;  4U23 A;  1FTM A;  2ONK E;  3LUY A;  1FTL A;  3FJ7 A;  4C1U A;  4HE1 A;  5DVF A;  4IGT A;  2ABH A;  4OEU A;  3LUZ A;  1MQD A;  3PD8 A;  2XX8 A;  3WAF A;  1P1O A;  4AB5 A;  1TFA A;  5AA2 D;  2PT2 A;  2O68 A;  4QFN A;  5ELV A;  2O7I A;  1NI9 A;  1Y3P A;  2I48 A;  3MP6 A;  3O6I A;  3GLB A;  4DDD A;  1NNP A;  2RC7 A;  3G3G A;  2OX3 A;  5DVI A;  4YB5 A;  3O9P A;  1US5 A;  2PYY A;  3HCQ A;  2H25 A;  5CMK A;  1B3F A;  3PTY A;  1IMD A;  4YU0 A;  3IJO B;  2O1L A;  1N7W A;  2XWK A;  3HFU A;  3TCH A;  1BK4 A;  4P0G A;  2OWT A;  1Q1K A;  5BUU A;  3JV9 A;  4F2Q A;  3AXF A;  1LLS A;  1EYI A;  1R9L A;  1QUI A;  3C36 A;  4F3G A;  4MJO A;  4N4U A;  1H44 A;  2AL4 A;  3FZV A;  3T0J A;  1KZ8 A;  4DCY A;  4HCW A;  3IL1 B;  4MEV A;  4EF2 A;  3H06 B;  3RT6 B;  4BDL A;  1SW1 A;  4I3Y A;  3K6X A;  4MLQ A;  5J16 A;  5DEX A;  2VP1 A;  2I58 A;  1YZ0 A;  1GR2 A;  4OWD A;  3FXR A;  1MM6 A;  4IB2 A;  3LV0 A;  3GBA A;  3HST A;  1N04 A;  4EDP A;  4PFY A;  3RY3 A;  1MS7 A;  4QXD A;  4OA4 A;  4P8B A;  3TTN A;  4P3L A;  2RC9 A;  1LB8 A;  1LAH E;  2ZNS A;  3G3H A;  4F22 A;  1A54 A;  4IO3 A;  4QSC A;  3U8Q A;  1KWH A;  2Y7K A;  5HPQ A;  5F1Q A;  4NWD A;  3K6V A;  1B5J A;  2ALU A;  3UA8 A;  3MJN A;  3EKI A;  1WDN A;  5I2N B;  1NUZ A;  2DE2 A;  1NKX A;  3K02 A;  2XX7 A;  1AMF A;  3MVZ A;  5ET7 A;  1MY1 A;  2QSX A;  1B7Z A;  3LSX A;  3EF7 A;  1MY0 A;  5TPA A;  1EH3 A;  4LQ5 A;  3I6V A;  4ZEC A;  3IFC A;  5JTY B;  1ZKB A;  3TOD A;  2A5S A;  3MP8 A;  1ATG A;  3N94 A;  1JW5 A;  4ESX A;  3N26 A;  4H8I A;  2ZYO A;  4GRK A;  1FBH A;  1EZO A;  2PMS A;  4H65 A;  3CG1 A;  1SW5 A;  1Z7N E;  3PPR A;  1AL3 A;  2ZMB A;  4P0I A;  3FV1 A;  1SBP A;  2X7Q A;  4PFW A;  4MMP A;  3MPL A;  4LZ7 A;  5M2V A;  3KBZ A;  5I84 A;  1B9J A;  4OFJ A;  5I57 A;  3DEL B;  1FJ6 A;  4N17 A;  2HZL A;  1IMF A;  2AIX A;  4PF8 A;  3FAT A;  4R73 A;  1DTG A;  2UVI A;  5LDZ A;  1JEV A;  4N13 A;  4ISU A;  4GWZ A;  2PT1 A;  4FE8 A;  1MY4 A;  1NNT A;  3QK6 A;  2F35 A;  2OWZ A;  3TCG A;  1J1N A; 
#chains in the Genus database with same CATH homology
 1FPL A;  1LBW A;  4HE2 A;  4GX6 A;  4HE1 A;  1FPK A;  4F19 A;  4KXP A;  3CHG A;  4GWU A;  4O8M A;  1RDY A;  1NV3 A;  2XXK A;  4P47 A;  4UAB A;  2CEX A;  2QFL A;  2PFY A;  4GWS A;  5I7I A;  3LUZ A;  3NOH A;  4JVI A;  3T1B A;  5LTC A;  3MST A;  2F3D A;  4MNI A;  4MIJ A;  2PFZ A;  2WYP A;  4AS5 A;  4NGU A;  5EYG A;  1FJ9 A;  4HXV A;  2ZZX A;  4F18 A;  4PTK A;  4PAI A;  4P1E A;  2CZK A;  2XWO A;  4OVR A;  2B4L A;  4PFB A;  4YIC A;  1FBP A;  4P9K A;  4GWW A;  2BJI A;  1FPG A;  2XWI A;  2FVZ A;  1LEV A;  4LN5 A;  2QVU A;  5CM6 A;  2CEY A;  3BIG A;  4OVT A;  3RYD A;  2B4M A;  3EKI A;  1K9Z A;  1NI9 A;  5J1D A;  1EYK A;  3W9V A;  4PAF A;  1FPJ A;  1NUZ A;  2DE2 A;  5JK4 A;  3RPL B;  5I5P A;  4NF0 A;  1IMB A;  1G0H A;  2V4C A;  3MYU A;  4NAP A;  2F5X A;  4HCY A;  1VDW A;  2DE3 A;  1JP4 A;  1QGX A;  2WEF A;  4N91 A;  4NG7 A;  4PE3 A;  2OX3 A;  2CZI A;  4QBA A;  1SPI A;  5ET7 A;  1IMA A;  1DCU A;  2F3B A;  4G61 A;  1NUW A;  4O94 A;  2VPO A;  1NV5 A;  4PAK A;  1NUY A;  2VT5 A;  4OVS A;  4IR8 A;  2FBP A;  5ET8 A;  4MNC A;  2VPN A;  3RPL A;  4DI3 D;  2ZZV A;  3ROJ A;  4MAG A;  4PDD A;  4YZZ A;  1FBE A;  3QMF A;  4PGN A;  3BIH A;  2P3V A;  2DE4 A;  2Y5L A;  3IFC A;  3E79 A;  4PC9 A;  1Q9D A;  3PTY A;  1IMD A;  4PET A;  3FXB A;  1NUX A;  4GX3 A;  2WBB A;  2V3Q A;  1DK4 A;  2XWK A;  2KQZ A;  2HZK A;  3HFU A;  4HE0 A;  4JVD A;  4N81 A;  4N8Y A;  4P1L A;  4OAN A;  4XEQ A;  1BK4 A;  4I3E A;  4PBQ A;  1LBV A;  3U65 A;  4MCO A;  4PDH A;  4F1U A;  4GBV A;  5IM2 A;  4PGP A;  3GYY A;  2FHY A;  1FTA A;  1FBH A;  3KC1 A;  1YXI A;  2L5V A;  1FPE A;  4MNP A;  1LBX A;  4NHB A;  1EYI A;  1FBF A;  1G0I A;  2HPG A;  4AS4 A;  3B8B A;  4PFI A;  2HHM A;  4PBH A;  2DDK A;  4MJO A;  4N4U A;  3W9W A;  4N6D A;  1FBC A;  3D1R A;  1FBG A;  1FPF A;  1NV6 A;  2GQ1 A;  3A29 A;  3IFA A;  2WBD A;  3T0J A;  1KZ8 A;  1NV0 A;  2CZH A;  3KC0 A;  4HCW A;  4MEV A;  1AWB A;  1YYZ A;  2P3N A;  1FPB A;  1RDZ A;  4PCD A;  4N8G A;  4M1V A;  5FBP A;  2XA5 A;  1CNQ A;  4GBW A;  2MKZ A;  2QVR A;  5T3J A;  5A5L A;  1FSA A;  1XI6 A;  4I3Y A;  2FIX A;  2WX9 A;  2FIE A;  5IZ1 A;  5J16 A;  2Q74 A;  4MMP A;  5ET5 A;  4X9T A;  5IZZ A;  5F24 A;  1IMC A;  2HXR A;  4XF5 A;  1LBZ A;  1YZ0 A;  3KBZ A;  1KA0 A;  5DW8 A;  5EQA A;  5IZ3 B;  3ISP A;  4X04 A;  4FBP A;  1NV7 A;  2WYK A;  5IZ3 A;  4O7M A;  5EQ7 A;  3LV0 A;  4NX1 A;  4X8R A;  5ET6 A;  4NQ8 A;  5EQ8 A;  1D9Q A;  1NV1 A;  2QVV A;  4I40 A;  4MX6 A;  1FBD A;  1KA1 A;  2JJK A;  2KR0 A;  1FJ6 A;  2ZZW A;  1NV2 A;  3B50 A;  4N17 A;  5EQ9 A;  1LBY A;  1IME A;  1NV4 A;  2HZL A;  4GX4 A;  2QPQ A;  4OVP A;  4QXD A;  3E78 A;  1IMF A;  4NN3 A;  4GWX A;  4OA4 A;  4N6K A;  4OVQ A;  2DVZ A;  4P8B A;  3FBP A;  4H46 A;  4O7I A;  4P3L A;  2PCR A;  4PF8 A;  1DBZ A;  4XFE A;  5ESY A;  2Q8M A;  4N15 A;  2Q9T A;  1FRP A;  4PFR A;  2R8T A;  4F1V A;  4H45 A;  5LDZ A;  1FPI A;  2XWV A;  1K9Y A;  1RDX A;  4PF6 A;  4JVC A;  5I3S A;  5EYH A;  1FPD A;  2Y5K A;  1INP A;  1EYJ A;  4GWZ A;  4GWY A;  3SZP A;  2OWZ A;  4P56 A;  4DI4 B;  5IGA A;  4MHF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...