4P1EA

Crystal structure of a trap periplasmic solute binding protein from escherichia fergusonii (efer_1530), target efi-510119, apo open structure, phased with iodide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
296
Chain Sequence
AESLNVSTSLSPDDPIYKGLQSFKKGVESRTNGEVKIKLFSQLGADNELLQHAQAGSNVGVVVDGARLAQFVPEFAIIPAPFVFKDYTTLKKFISSPVFAQWSEQMSSKSGLTPLSFNWYQGARMLVTQKPVSKPSDLNGVRVRALEAPVTIETIKCMGGSPTPLSWSEIYSSIQTGVVDAAEAQPTAVYGSKLYEITKHITKTNHIHLMTGIIVSQKWLSSLTAEQQTILREEAQKNGDIASENTILAGDKMLDEMAKKGMTISEVDTQPFIDGCRYVPEKLGLSEAYKQVNSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Escherichia fergusonii
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 100
structure length 296
sequence length 298
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p1eA00
2ZZVA 3FXBA 4O7MA 2XWVA 4P56A 2WYKA 2V4CA 4OVSA 4OVRA 2ZZWA 5LTCA 2PFZA 2PFYA 5IGAA 4N6KA 4YICA 4P47A 2XWKA 3B50A 4NF0A 4LN5A 4PFBA 4MX6A 5I5PA 2XXKA 4PFIA 4PGNA 4YZZA 3GYYA 4PF6A 4P1EA 4XEQA 4PFRA 5IM2A 4MNIA 4P1LA 2VPNA 4MNCA 2WX9A 4N91A 4MMPA 4OANA 4O94A 4NN3A 5CM6A 4NGUA 4P3LA 4NHBA 4PAIA 3U65A 4MHFA 2XWOA 2XWIA 4PF8A 2CEYA 4NG7A 4N17A 2VPOA 4NAPA 4PDHA 4PAFA 4N15A 4MEVA 4PE3A 4PBHA 4P8BA 4N6DA 4MCOA 2HPGA 4N8GA 4XFEA 2HZKA 4P9KA 4PBQA 4MNPA 4UABA 4XF5A 4NX1A 4PDDA 4MAGA 4NQ8A 4PGPA 4OVTA 4O8MA 2HZLA 4DI3D 4PETA 5IZZA 4OA4A 2XA5A 4OVPA 4PAKA 4N8YA 4PC9A 4X04A 4N4UA 4X8RA 4DI4B 4MIJA 4OVQA 5I7IA 2ZZXA 4PCDA 2WYPA 2CEXA
chains in the Genus database with same CATH superfamily
2ZZVA 5I57B 4Q0CA 4JSOA 1SVXB 1ZMGA 4TOZA 2Y7PA 1IMBA 1UTBB 3KC0A 2MKZA 3G7WA 5JEIA 1I6AA 2B4LA 4GWXA 1F9BA 3OSQA 5I5PA 2F34A 3GYYA 2GFEA 4KYSA 4ISUA 2PX1A 3PV0E 4XXUA 5ET5A 4KPTA 1LLSA 4P0GA 2CZHA 5FHOA 3W9WA 1FTMA 5ITPA 1IZ1A 2XXQA 3TPAA 2A5SA 4R6YA 1US4A 1SDXA 3O6GA 1INPA 5AA4A 4FAJA 2L5VA 1MM7A 1P1UA 3KSXA 1OLCA 1PB8A 3CFZA 2I0CA 2D5WA 3KOTA 4NF4A 1HSLA 4N6PA 4EXKA 2ZYMA 3K4UA 5TPAA 3TMGA 5ET7A 3FJMA 5FBPA 2F36A 1SQYA 1Z7NE 4JB7A 1FPLA 1BTJA 2OK2A 3CG1A 1NV6A 4H46A 4OHNA 4ZEKA 4OVTA 3PMVA 4HE2A 4AS4A 2CZIA 3KJ7A 3H6UA 4Q30B 2Q9TA 4U23A 2OWSA 1MY1A 2Y5LA 3FXUA 3IB1A 4I62A 1PDAA 3FJGA 3E79A 1N84A 2XWVA 2I3VA 1AIVA 1US5A 1B4HA 3MPKA 4X9TA 5AA3A 3K01A 5IAIA 5B7DA 2VT5A 5JTYA 2Q74A 1LGBC 4N07A 3O97A 1LAFE 3SERA 3CVGA 1SBPA 2YPNA 5DVIA 1K9ZA 4IB2A 1A40A 1BLFA 3ILUB 3SDFA 4E0XA 3MAMA 4ZE9A 5AA1A 4DE8A 1IMFA 3NOHA 3IB0A 4XKRA 3PUXE 1IEJA 2ZYKA 3KN7A 5CM6A 4OQOA 4L17A 4ZZAA 4NGUA 1S9TA 4NHBA 5J1DA 1B0LA 1NUXA 4MBPA 1POY1 4DXCA 3I5OA 1SW2A 3SEVA 1LFIA 1JNFA 3TKDA 1FBCA 4NAPA 4ECFA 3VV5A 1XI6A 3U94A 5JK4A 1FQDA 2OLBA 3LSWA 1IUDA 4M4GA 4MNPA 1XS5A 3O6HA 4KYDA 2P0SA 1PEBA 3IOTA 3VXCA 3T9VA 3UGWA 2Q8JA 3FV2A 2XA5A 2OBGA 4EXLA 1ZKBA 2ZNUA 4PAKA 5T3JA 3EPEA 4DI4B 1JQFA 1B3LA 1SYHA 4OVJA 2Q8MA 3MZ9A 4I3YA 1MQIA 2B3BA 5B70A 2VD2A 1FPKA 4F18A 2QSXA 3UA8A 3KG2A 1SYIA 3MW0A 2HAUA 1B05A 1A8FA 4GX4A 4NEDA 4LQ2A 3M3LA 4QXDA 2XHDA 1H3DA 4YZZA 2I0BA 4GWYA 1VFDA 2O84X 4G61A 2V3UA 4R74A 3FXRA 1EZ9A 1NV4A 4IO7A 1FBDA 5IZ3B 4OANA 4ZS9A 3LUYA 1Y4CA 4EQBA 2DWJA 1NNFA 3IOVA 1PB7A 3HCQA 4Q8RA 3O66A 4GL0A 2IEEA 4PFYA 4XKPA 4NG7A 3RPLA 1GTKA 5CMMA 2FNCA 1N7WA 5J16A 5FTIA 3KFMA 3T9UA 1POTA 4MFIA 2P1SA 1URGA 3CR9A 3THIA 4IGTA 1SD3A 5F7VA 3K6UA 2QJEA 3CSGA 4NQ8A 5ICQA 5ET8A 4GL8A 3E9XA 2OX3A 2ZZXA 4BDLA 2DE2A 1KZ8A 5I59A 3OEKA 5DW8A 2V3QA 1LBXA 4XKNA 3BFUA 2D3IA 4G68A 4OVRA 3KJTA 3Q25A 1KA1A 1LFHA 2CZKA 1N76A 5I3SA 3OO8A 3OOAA 2B65A 1MXZA 2ZYOA 5I56A 4PF6A 4PFRA 4P1LA 4YB6A 2VPNA 1B7UA 4H65A 3ODBA 4ZE8A 1LFGA 3MP6A 1Y1ZA 3PD9A 1FCKA 2F6GA 2RC9A 5I58A 4FJPA 3RQTA 4O3AA 3VLVA 2WKYA 4K3FA 2FHYA 1YCJA 3TTNA 4YAHX 5EYHA 2PT2A 3CI8A 2DWAA 3FJ7A 4IY5A 4DXBA 1M5EA 4PAFA 2DVZA 2QFLA 3FVNA 2QVVA 3IAZA 1MPCA 2DP8A 4N6DA 1ZTYA 3AXFA 4NE4A 1GVCA 2RF1A 1CE2A 2E1SA 2QMXA 4DCXA 2XXWA 4U22A 1WODA 1LCTA 4FIMA 1Y1MA 4RXLA 3O6IA 4PGPA 1OQGA 3TTLA 3B7DA 1N3XA 3UP9A 2Y5KA 3OEMA 3S4UA 1SW4A 3DP8A 3G3IA 4PC9A 3A09A 5H8NB 3A3CA 1EYKA 2UXAA 2KLFA 4MH5A 1AMFA 1BKAA 4P56A 2O7UA 3DELB 2XD2A 2V84A 4QFKA 3T1BA 1N3WA 3MC2A 4QFLA 3N5LA 4JXIA 4GVOA 2PFYA 4GWUA 2ZNSA 1AH5A 1XC1A 2HAVA 3S2VA 5IGAA 3JYRA 4OENA 4P47A 1MQGA 4XKQA 3O28A 5IZ3A 4ZDMA 4PP0A 3TEPA 1SW1A 3G3KA 2P2AA 4DIGA 3MP8A 5I2NB 4R2FA 2I6EA 3B6WA 4MLQA 2VOZA 1EYJA 5AE4A 2ZYNA 3C32A 2O1MA 4DDDA 4DCYA 1B3GA 3O29A 4MMPA 3S9EA 4F1VA 4WXJA 3L6GA 1SW5A 3VVEA 3TTRA 1FJ6A 1P1NA 1A7LA 5H8FA 2Q2AA 5CC2A 2B4MA 3IFCA 4N17A 1FBEA 4PDHA 3TCFA 1B32A 3SKPA 3GBBA 1IMAA 4WEDA 3FBPA 2FYIA 1YTVA 3FGSA 4O3CA 3MVWA 4QFPA 4F3GA 4LQ5A 4F22A 1FBGA 4GFRA 4THIA 2DVCA 4QRZA 5F24A 4YKJA 1MG1A 4BLAA 5KDTB 1H43A 3C36A 2F8DA 2HZLA 3Q27A 1SPIA 4OTEA 5AA2B 5IZZA 3WAFA 1LSTA 2DYXA 2QS2A 3I3VA 2QS3A 4X04A 1AWBA 1B58A 3T22A 1TFAA 1DK4A 1JP4A 3VDFA 1USYH 4EDPA 3FXBA 3I6VA 1LAGE 4GD5A 3MBPA 1MY4A 2ZZWA 1BK4A 3TCGA 5I59B 2CZLA 3QUJA 5ISUA 1BIYA 4G2ZA 4RYAA 4QSCA 3LC8A 3K0VA 4PFBA 2Y7IA 5A5LA 3B8BA 3A3UA 3T66A 3H6VA 1P1QA 5CBSA 4F1UA 5CI5A 3MVZA 4GXAA 5DT6A 4GWOA 5ESYA 2QS1A 3SZPA 2R6GE 3K02A 4HW8A 3D4CA 5M2VA 3RY3A 1NV3A 3IO6A 1D9VA 3PU5A 1QULA 4FECA 1A54A 1NI9A 3SEUA 3ZS6A 3K00A 3EN3A 1RDYA 1A55A 2O51A 4IO6A 3EHSA 4QFNA 3FIRA 1D9YA 4XTCQ 1VSOA 5EYFA 3SEYA 1JETA 2KQZA 4RY1A 2OCUA 1QUJA 4X48A 3CSBA 5L9OA 4UACA 3PPPA 1R1NA 1NNPA 2F7BA 4JBZA 5FHMA 4NF6A 3SESA 2FVZA 4ND9A 4GWZA 2DXRA 4G8HA 4F29A 3C4MA 2WBDA 4H45A 1B6HA 2PMSA 4ZEIA 2NOOA 5AA2D 2PT1A 4F39A 1GGGA 3PPNA 1S7YA 3U1OA 2GHAA 4BDQA 4LN5A 4MX6A 4KQPA 2Y7KA 5DEXB 2DWHA 1T0KA 1B51A 5EQ9A 4YB5A 1Q1KA 1JW5A 1H44A 3VLWA 5KCJB 2HCAA 5L9SA 2AL5A 2X7PA 1I6QA 4I1DA 4FE8A 4X1BA 4LVQA 2QVRA 1I69A 4PAIA 3RYDA 4O7IA 5H8QB 3W15C 4KYEA 2XWIA 1H45A 4NF5A 4GF8A 1XVYA 2DDKA 1NUWA 3QXMA 2ZXTA 2DXYA 3BIHA 1N0TA 4U1OA 4RPOA 3V83A 3OENA 1B9JA 3PTYA 3TQWA 4ELQA 1VDWA 4GLIA 2HZKA 4PFWA 2OWTA 3RN8A 1NV1A 3UORA 2O1LA 3FD3A 1YAEA 3IR1A 4OWDA 3PD8A 3MP1A 3IB2A 1IXIA 4ZECA 3TQLA 3CFXA 5CMCA 3ROJA 1MQJA 3G3HA 3UIFA 1CNQA 5CMBA 4JWXA 2V4CA 5AA4B 3TYHA 1Y20A 3QAXA 3TFLA 2XWKA 2FA7A 1NH7A 4Q5TA 2XXKA 1URDA 1MXUA 2HXRA 2REGA 2I4BA 4LZ8A 4OEUA 5JTYB 4OETA 2DSFA 3QSLA 3FASA 1MS7A 3LR1A 4KCDA 2F3DA 3USDA 5H8HB 4O94A 5FTHA 3BIGA 3QYTA 4YU0A 2A5TA 5CRYA 1NV5A 5DVFA 3D1RA 2CEYA 1DOTA 4NWCA 4R6KA 5DYHA 4QSDA 5I2KA 3FVGA 1P99A 3MQ9A 1FBPA 4POXA 5EQ7A 4JWOA 4ELOA 1FBHA 4DLDA 1MH4A 3TELA 3QIMA 2Q2CA 1B1HA 2I58A 4KD5A 4O3BA 4GIZA 4O8MA 5CMKA 1JW1A 1DCUA 1O63A 2HQ0A 2RC7A 1A99A 4EF1A 1N04A 4U2RA 3MVYA 4Z0IA 1ZJLA 1UIUA 4R75A 2R71A 3E3KA 2Z8FA 2X26A 1AOVA 3HN0A 4AQ4A 4G8MA 4DXUA 3R26A 1EH3A 3FV1A 3K6VA 1B40A 1VFEA 2PFZA 4HS7A 4KI0E 1GV8A 4IY6A 4PFTA 4JDFA 1B5IA 3VXBA 4I8CA 1P1OA 3HFUA 1DBZA 4KHZE 5L8DA 1IMCA 5L9MA 3VVDA 2WEFA 1RDZA 1Q9DA 3H4ZA 2H25A 2BJIA 3S9NC 4NWDA 1B1XA 5IM2A 1IITA 5BUUA 2WX9A 2RCBA 2DS9A 1FPJA 4DZ1A 4G77A 3HHGA 2M8CA 4QHQA 3QMFA 4YB7A 3U65A 3OO6A 3QUFA 2LAOA 1IXHA 2F7AA 4MJOA 4ZZEA 1GR2A 2V93A 3KEIA 2VP1A 1B7ZA 4F19A 1TT1A 4PBHA 3C9HA 2F78A 5EYGA 1HSEA 1NUZA 1MH3A 2F97A 1JW4A 3H7MA 2KR0A 3ECRA 2QL3A 4P9KA 3PUVE 1B4ZA 3V8XB 3CFLA 4U4SA 3O9PA 3MVXA 1LBWA 3CHGA 5FHNA 4FATA 1MRPA 3N94A 1XOCA 2NUVA 3EHTA 3T9XB 4X1DA 4F31B 4RK2A 5I7IA 2B3FA 3KZGA 4RPNA 5KZTA 3RNNA 1EZOA 2Y84A 1OIBA 4FORA 4JWYA 1HSJA 4LP2B 1EYIA 2HEUA 3K1MA 4OXVA 3E4RA 1BP5A 1NNKA 4LATA 5I84A 1NUYA 2FIXA 2XX7A 2JJKA 4JVIA 3T9HB 1UQWA 3B6TA 4ONYA 3B50A 4NF0A 1DPPA 2GRVA 3PMWA 3LSLA 4LUBA 2UVHA 5IKBA 2DOJA 2XXPA 2F7CA 3C33A 4MNIA 3HHFA 1NL5A 4WEPA 3LUZA 4U21A 4R6HA 1Y4TA 3N6UA 1MXXA 1G0IA 4P0IA 1G0HA 2Z22A 4R9FA 4BDNA 1B5JA 5ITOA 5K2YA 3V89B 3F11A 4WKMA 1ELJA 5K2XA 1ZBMA 1R9QA 4AB6A 4PE5B 4H5FA 4LZ5A 4RA1A 2A5TB 3M3KA 1NNTA 3MYUA 4OERA 3IJXB 1M5FA 3FZVA 4PBQA 1R6ZA 2XXYA 5I2KB 1UTHB 3TCHA 3MSTA 4PETA 4HCWA 4OVPA 5TP9A 1OLAA 1FQCA 4R73A 3O2AA 1L5TA 4ZEDA 3G3GA 1MQHA 3RPLB 3EKIA 3LV0A 2QPQA 2XD3A 4GOTA 1WDNA 2O6AA 3SEXA 4YKKA 1FTJA 4GBWA 3V5AA 4ZEFA 3RUMA 1NFTA 5DEXA 4NF6B 4G4PA 4U4XA 2I49A 2ONSA 4LZ7A 5KDTA 2P3NA 4ESWA 1SI1A 3W9VA 4GQOA 4H0WA 4PGNA 1MY2A 4P1EA 5EHSA 4QBAA 2H9BA 2RC8A 1D9QA 3PMXA 1NKXA 3GBAA 1MM6A 1UIVA 3N6TA 4QF9A 1H76A 5LOMA 3PGFA 4NN3A 3A29A 1MXYA 2OZZA 3BKIB 1Q35A 1Y3QA 3FVOA 2DE3A 4H8IA 4FEDA 2VPOA 1MPDA 1OMPA 4H6DA 1B3HA 2NVUB 5LDZA 2OWZA 2YJPA 1NV2A 1MPBA 4GX6A 3IOWA 4N8GA 4XFEA 1MXWA 1FTOA 1R9LA 3T96B 4H8JA 3OSRA 3BBRA 3K2DA 3Q26A 3HPIA 3MJNA 3IX1A 3H03A 3OXNA 1QKAA 1FPGA 4BDOA 4MIJA 4C0RA 4H5GA 3S9MC 1FPFA 3LSFB 5AA2A 1Y3NA 1B52A 2Y7WA 3FVKA 3U93A 3WAEA 3TUSA 2QVUA 4FBPA 1A8EA 4MLVA 4ESXA 4F3PA 2P3VA 2RKMA 2UYEA 4YMAA 1O7TA 3ONMA 3QK6A 1DPEA 1JEUA 1O64A 5DTBA 3EQ1A 2HFBA 4EQ9A 4KXPA 4I3EA 4F3BA 4IGRA 5I56B 2ONRA 2VGQA 4G8NA 3TTKA 4RNSA 3SEWA 4E0WA 3T93B 3IORA 1FSAA 1IXCA 3IFAA 1M5DA 4MHFA 2PYYA 1UTBA 2XWOA 3H06B 4F2OA 2Z23A 4I40A 3H6WA 1DTGA 2DQVA 3HSTA 3MZ1A 3N26A 4GRKA 3ISPA 1XVXA 1J1NA 2ZMBA 2HPGA 1YZ0A 5A5XB 1MY0A 2UYFA 4UABA 2AIXA 1FQBA 1Y9UA 1FPEA 4QSEA 1XHYA 1LBVA 4IO2A 2RINA 2V3TA 3B6QA 3FATA 1MDP1 4NTLA 4HTGA 3KN8A 2FBPA 4GWWA 1NV7A 1MQDA 2PCRA 2WYPA 2CEXA 4OESA 3TDJA 4F1YA 1B2HA 3OELA 2Z8DA 2QRYA 4OVSA 4R2BA 2H5YA 1YYZA 2XXIA 3ZKLA 3KN3A 2I48A 1QJMA 4IO4A 2O69A 1URSA 1IQ7A 4N6KA 3JZJA 1NH8A 3RT6B 1S50A 4F2QA 4I9DA 4JVDA 5EQAA 1IIWA 1QUIA 1FTKA 3L6HA 1AL3A 3GLBA 2RCAA 3D4GA 2E0SA 3PUWE 3RTFB 3CRBA 4PFUA 4NF5B 3MUQA 1RKMA 2ANJA 2Q88A 4R9GA 3TTMA 1ZLQA 4XIGQ 3H6TA 2F6PA 3RT8A 2F5XA 4LA9A 2D21A 2FIEA 4C1UA 1IMDA 4MF3A 1LBZA 4GWSA 2ALUA 1DTZA 3IO4A 3MZBA 3E13X 1OQHA 5EQ8A 2AL4A 2DWIA 3LBSA 1B46A 4N15A 4UA8A 1FPIA 1XT8A 3DLNA 3RTWB 3IK6B 2NWJA 2DE4A 4OFOA 1IMEA 2HHMA 3PUZE 1FQEA 1QKBA 2OJTA 1QVSA 2H99A 2UVIA 1EZPA 2GHBA 1JVXA 4DI3D 4AS5A 4NF8A 3VE1B 4QFOA 2VHAA 1PBQA 4U1ZA 4JVCA 3K6XA 4NMYA 2R8TA 4HCYA 2I3WA 1WVJA 1YPNA 4N13A 1PBPA 5HPQA 4RK9A 3DP6A 1K9YA 1QW0A 1LEVA 2F3BA 1PC3A 3PPQA 5LTCA 5H8FB 3K1PA 3PPRA 1YXIA 4OMBA 4YICA 1B7HA 1IXGA 3TODA 1ANFA 3VLUA 5HBCA 4XEQA 3KOSA 5H8SA 1EU8A 3MWBA 3GXAA 2XXHA 5IZ1A 3KBZA 1SI0A 4N91A 3U92A 4EUOA 2XXTA 4ELRA 4TLLB 4YKPA 1LBYA 3RPWA 1B0HA 4OFJA 2G93A 5ICTA 4IR8A 3EF7A 4PF8A 1MXVA 3EHUA 3R7XA 4KCCA 2XXXA 5F1QA 4OYVA 4OZ9A 4PE3A 2CMOA 4P8BA 4BDRA 2GH9A 3S9LC 3KGCA 3VVFA 1PB9A 1LAXA 3BFTA 4HE1A 5I2NA 1FPDA 1MDQA 4MCOA 1B3FA 1CB6A 3CIJA 4GBVA 3DM0A 3TAJA 2UVGA 1QGXA 4JSDA 3ZSFA 1FPBA 3T0JA 4NX1A 2Q89A 1QUKA 3H3GA 3JV9A 3LSXA 4IO3A 3RGYA 3Q29A 1II5A 3KBRA 2XXVA 3FUZA 4GX3A 4N8YA 5CBRA 2VD3A 4BDMA 4OVQA 2ONKE 3IJOB 1M5BA 4EQ7A 2YLNA 1Y3PA 5ELVA 3G3JA 5TPAB 1DMBA 1FW0A 2IA4A 2WYKA 4H1XA 5BWJA 1OVTA 4PQJA 3FXQA 2R9JA 2I4CA 3IOUA 2V25A 1FQAA 4PFIA 1N7XA 3ILTB 1FBFA 5A5XA 1JEVA 4M1VA 3C34A 4YKIA 4RJZA 2H4IA 4TQUQ 2QS4A 3MPLA 2NXOA 1RDXA 3U72A 1VR5A 1D4NA 1FTAA 4NF4B 2THIA 1VE4A 3HV1A 2ABHA 4P3LA 4KFQA 1MY3A 3IL1B 3SETA 3ZKKA 1TXFA 4PTKA 1KA0A 1LB9A 5I57A 2Y7RA 1LBCA 2AYSA 2REJA 4MEVA 3KC1A 5H8QA 2UVJA 3U8QA 1I6BA 1KWHA 2XXRA 4POWA 3KSJA 4XF5A 3VFJA 5HM4B 1LCFA 4H67A 3OO7A 2XX9A 1USYE 4TLMB 2XXUA 4OA4A 5I58B 1NV0A 3P7IA 1ZIUA 4N4UA 2X7QA 3PPOA 4X8RA 4G68B 3UN6A 3E78A 3PUYE 3GZGA 1DSNA 2HXWA 5KCJA 4KR5A 4NF8B 4ELPA 4O7MA 3C35A 2O68A 2PBWA 1Z7ME 4EF2A 4N81A 4FEBA 4F3SA 3Q28A 3OD7A 1ZU0A 1RYOA 1TWYA 5TU0A 4YMBA 3CG3A 2H98A 1LBBA 2F35A 2G29A 5DVJA 3M3FA 1TFDA 2O7IA 3HO7A 4Z7EA 1OVBA 1RYXA 3K6WA 3TZAA 3C31A 2PVUA 3G3FA 5H8NA 4AB5A 1B3EA 4MNCA 3K1NA 4R72A 4OEVA 1FTLA 2ESNA 1JVYA 4HXVA 1FQFA 3R6UA 4G68C 1ATGA 1FRPA 4LONB 4OFLA 1P1WA 5ET6A 5H8HA 1M5CA 1NMUA 5EHMA 2Z8EA 2W7YA 2XX8A 4P11A 1LAHE 1LB8A 1FJ9A 4ZEBA 2WBBA 3OO9A 2QMWA 2GQ1A 1D3KA 5TP9B 4PDDA 4GXSB 4MAGA 4IO5A 3UK4A 1B5HA 2BJJX 3OMBA 2ZNTA 4HE0A 1UTHA 3DP4A 4PCDA 4C1TA 3M8UA 3RLFE
chains in the Genus database with same CATH topology
2ZZVA 4HCYA 1CNQA 1KZ8A 3LV0A 3FXBA 5DW8A 2V3QA 2Q8MA 4O7MA 4I3YA 2FVZA 2QPQA 3E79A 2XWVA 4P56A 1EYIA 2WYKA 1LBXA 4GWZA 1K9YA 1FPKA 2V4CA 2WBDA 4H45A 4F18A 4N81A 3T1BA 4OVSA 1LEVA 2QVUA 4OVRA 1YYZA 4GBWA 4X9TA 2F3BA 1IMBA 2ZZWA 4FBPA 5LTCA 1KA1A 2PFZA 1NUYA 2FIXA 1BK4A 2CZKA 2PFYA 3KC0A 2P3VA 1YXIA 2JJKA 4GWUA 2MKZA 4JVIA 3HFUA 5IGAA 4GX4A 4N6KA 1DBZA 5I3SA 2VT5A 4YICA 2B4LA 4GWXA 1IMCA 4P47A 2XWKA 2WEFA 3B50A 4NF0A 1RDZA 2P3NA 2Q74A 1Q9DA 4JVDA 4QXDA 4LN5A 3W9VA 4PFBA 5EQAA 4MX6A 5A5LA 5IZ3A 5I5PA 2XXKA 4PFIA 4PGNA 4YZZA 2BJIA 3GYYA 4GWYA 1FPFA 4PF6A 4P1EA 3B8BA 2HXRA 4G61A 4XEQA 5ET5A 4PFRA 5IM2A 4MNIA 1FBFA 1K9ZA 4P1LA 5EQ9A 4QBAA 5IZ1A 4KXPA 4I3EA 2VPNA 1EYJA 4F1UA 1D9QA 2CZHA 3KBZA 4M1VA 4MNCA 3LUZA 2WX9A 1NV4A 3W9WA 4N91A 2R8TA 1IMFA 1FBDA 3NOHA 5IZ3B 2F3DA 1RDXA 4MMPA 1FPJA 4OANA 4F1VA 1LBYA 4O94A 4NN3A 3A29A 5CM6A 2QVRA 1G0IA 1FTAA 5ESYA 1FSAA 4NGUA 4HXVA 4P3LA 1G0HA 3SZPA 1INPA 4NHBA 3QMFA 3IFAA 2F5XA 3BIGA 4PAIA 3RYDA 2L5VA 1FJ6A 4O7IA 4MHFA 3U65A 1NUXA 2FIEA 1IMDA 2XWOA 1NV5A 4IR8A 1LBZA 1FRPA 2FHYA 4PTKA 4GWSA 2XWIA 2B4MA 2DE3A 3D1RA 3IFCA 4MJOA 4PF8A 1KA0A 5EYHA 5ET6A 1FBCA 2CEYA 4NG7A 4N17A 3RPLA 1NV3A 2VPOA 4NAPA 5J16A 2DDKA 1FBEA 1NUWA 4PDHA 5EQ8A 4I40A 3BIHA 4PAFA 2DVZA 2QFLA 4N15A 4F19A 1IMAA 1XI6A 4MEVA 4PE3A 1NI9A 3FBPA 3KC1A 4PBHA 4P8BA 1FPIA 5LDZA 5EYGA 2QVVA 2OWZA 5ET7A 5JK4A 1FBPA 1NUZA 3ISPA 3MYUA 4HE1A 1NV2A 1FPDA 5FBPA 4N6DA 5EQ7A 1RDYA 1FJ9A 3PTYA 4GX6A 4MCOA 2DE4A 1FBGA 2HPGA 2KR0A 2WBBA 1FBHA 4GBVA 1YZ0A 1VDWA 4N8GA 4XFEA 2HZKA 1IMEA 2HHMA 1QGXA 4MNPA 4P9KA 4PBQA 1NV1A 4UABA 5F24A 1FPLA 1FPBA 2GQ1A 4XF5A 4NX1A 3T0JA 4PDDA 2WYPA 3EKIA 1NV6A 4MAGA 1FPEA 3MSTA 4H46A 1LBWA 3CHGA 4NQ8A 4PGPA 4OVTA 1LBVA 5ET8A 4O8MA 2HZLA 4DI3D 2KQZA 4HE2A 4PETA 1SPIA 4AS5A 4HCWA 4OA4A 4AS4A 2XA5A 5IZZA 4OVPA 2CZIA 2OX3A 2Y5KA 4GX3A 4PAKA 1NV0A 4N8YA 4PC9A 1DCUA 1FPGA 4X04A 5T3JA 4N4UA 4HE0A 1AWBA 4X8RA 3ROJA 4DI4B 2Q9TA 2FBPA 4MIJA 4OVQA 3E78A 5I7IA 4GWWA 5J1DA 2ZZXA 4JVCA 1EYKA 1NV7A 2Y5LA 1DK4A 2PCRA 2CEXA 4PCDA 3RPLB 1JP4A 2DE2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZV A;  3FXB A;  4O7M A;  2XWV A;  4P56 A;  2WYK A;  2V4C A;  4OVS A;  4OVR A;  2ZZW A;  5LTC A;  2PFZ A;  2PFY A;  5IGA A;  4N6K A;  4YIC A;  4P47 A;  2XWK A;  3B50 A;  4NF0 A;  4LN5 A;  4PFB A;  4MX6 A;  5I5P A;  2XXK A;  4PFI A;  4PGN A;  4YZZ A;  3GYY A;  4PF6 A;  4P1E A;  4XEQ A;  4PFR A;  5IM2 A;  4MNI A;  4P1L A;  2VPN A;  4MNC A;  2WX9 A;  4N91 A;  4MMP A;  4OAN A;  4O94 A;  4NN3 A;  5CM6 A;  4NGU A;  4P3L A;  4NHB A;  4PAI A;  3U65 A;  4MHF A;  2XWO A;  2XWI A;  4PF8 A;  2CEY A;  4NG7 A;  4N17 A;  2VPO A;  4NAP A;  4PDH A;  4PAF A;  4N15 A;  4MEV A;  4PE3 A;  4PBH A;  4P8B A;  4N6D A;  4MCO A;  2HPG A;  4N8G A;  4XFE A;  2HZK A;  4P9K A;  4PBQ A;  4MNP A;  4UAB A;  4XF5 A;  4NX1 A;  4PDD A;  4MAG A;  4NQ8 A;  4PGP A;  4OVT A;  4O8M A;  2HZL A;  4DI3 D;  4PET A;  5IZZ A;  4OA4 A;  2XA5 A;  4OVP A;  4PAK A;  4N8Y A;  4PC9 A;  4X04 A;  4N4U A;  4X8R A;  4DI4 B;  4MIJ A;  4OVQ A;  5I7I A;  2ZZX A;  4PCD A;  2WYP A;  2CEX A; 
#chains in the Genus database with same CATH topology
 2ZZV A;  5I57 B;  4Q0C A;  4JSO A;  1SVX B;  1ZMG A;  4TOZ A;  2Y7P A;  1IMB A;  1UTB B;  3KC0 A;  2MKZ A;  3G7W A;  5JEI A;  1I6A A;  2B4L A;  4GWX A;  1F9B A;  3OSQ A;  5I5P A;  2F34 A;  3GYY A;  2GFE A;  4KYS A;  4ISU A;  2PX1 A;  3PV0 E;  4XXU A;  5ET5 A;  4KPT A;  1LLS A;  4P0G A;  2CZH A;  5FHO A;  3W9W A;  1FTM A;  5ITP A;  1IZ1 A;  2XXQ A;  3TPA A;  2A5S A;  4R6Y A;  1US4 A;  1SDX A;  3O6G A;  1INP A;  5AA4 A;  4FAJ A;  2L5V A;  1MM7 A;  1P1U A;  3KSX A;  1OLC A;  1PB8 A;  3CFZ A;  2I0C A;  2D5W A;  3KOT A;  4NF4 A;  1HSL A;  4N6P A;  4EXK A;  2ZYM A;  3K4U A;  5TPA A;  3TMG A;  5ET7 A;  3FJM A;  5FBP A;  2F36 A;  1SQY A;  1Z7N E;  4JB7 A;  1FPL A;  1BTJ A;  2OK2 A;  3CG1 A;  1NV6 A;  4H46 A;  4OHN A;  4ZEK A;  4OVT A;  3PMV A;  4HE2 A;  4AS4 A;  2CZI A;  3KJ7 A;  3H6U A;  4Q30 B;  2Q9T A;  4U23 A;  2OWS A;  1MY1 A;  2Y5L A;  3FXU A;  3IB1 A;  4I62 A;  1PDA A;  3FJG A;  3E79 A;  1N84 A;  2XWV A;  2I3V A;  1AIV A;  1US5 A;  1B4H A;  3MPK A;  4X9T A;  5AA3 A;  3K01 A;  5IAI A;  5B7D A;  2VT5 A;  5JTY A;  2Q74 A;  1LGB C;  4N07 A;  3O97 A;  1LAF E;  3SER A;  3CVG A;  1SBP A;  2YPN A;  5DVI A;  1K9Z A;  4IB2 A;  1A40 A;  1BLF A;  3ILU B;  3SDF A;  4E0X A;  3MAM A;  4ZE9 A;  5AA1 A;  4DE8 A;  1IMF A;  3NOH A;  3IB0 A;  4XKR A;  3PUX E;  1IEJ A;  2ZYK A;  3KN7 A;  5CM6 A;  4OQO A;  4L17 A;  4ZZA A;  4NGU A;  1S9T A;  4NHB A;  5J1D A;  1B0L A;  1NUX A;  4MBP A;  1POY 1;  4DXC A;  3I5O A;  1SW2 A;  3SEV A;  1LFI A;  1JNF A;  3TKD A;  1FBC A;  4NAP A;  4ECF A;  3VV5 A;  1XI6 A;  3U94 A;  5JK4 A;  1FQD A;  2OLB A;  3LSW A;  1IUD A;  4M4G A;  4MNP A;  1XS5 A;  3O6H A;  4KYD A;  2P0S A;  1PEB A;  3IOT A;  3VXC A;  3T9V A;  3UGW A;  2Q8J A;  3FV2 A;  2XA5 A;  2OBG A;  4EXL A;  1ZKB A;  2ZNU A;  4PAK A;  5T3J A;  3EPE A;  4DI4 B;  1JQF A;  1B3L A;  1SYH A;  4OVJ A;  2Q8M A;  3MZ9 A;  4I3Y A;  1MQI A;  2B3B A;  5B70 A;  2VD2 A;  1FPK A;  4F18 A;  2QSX A;  3UA8 A;  3KG2 A;  1SYI A;  3MW0 A;  2HAU A;  1B05 A;  1A8F A;  4GX4 A;  4NED A;  4LQ2 A;  3M3L A;  4QXD A;  2XHD A;  1H3D A;  4YZZ A;  2I0B A;  4GWY A;  1VFD A;  2O84 X;  4G61 A;  2V3U A;  4R74 A;  3FXR A;  1EZ9 A;  1NV4 A;  4IO7 A;  1FBD A;  5IZ3 B;  4OAN A;  4ZS9 A;  3LUY A;  1Y4C A;  4EQB A;  2DWJ A;  1NNF A;  3IOV A;  1PB7 A;  3HCQ A;  4Q8R A;  3O66 A;  4GL0 A;  2IEE A;  4PFY A;  4XKP A;  4NG7 A;  3RPL A;  1GTK A;  5CMM A;  2FNC A;  1N7W A;  5J16 A;  5FTI A;  3KFM A;  3T9U A;  1POT A;  4MFI A;  2P1S A;  1URG A;  3CR9 A;  3THI A;  4IGT A;  1SD3 A;  5F7V A;  3K6U A;  2QJE A;  3CSG A;  4NQ8 A;  5ICQ A;  5ET8 A;  4GL8 A;  3E9X A;  2OX3 A;  2ZZX A;  4BDL A;  2DE2 A;  1KZ8 A;  5I59 A;  3OEK A;  5DW8 A;  2V3Q A;  1LBX A;  4XKN A;  3BFU A;  2D3I A;  4G68 A;  4OVR A;  3KJT A;  3Q25 A;  1KA1 A;  1LFH A;  2CZK A;  1N76 A;  5I3S A;  3OO8 A;  3OOA A;  2B65 A;  1MXZ A;  2ZYO A;  5I56 A;  4PF6 A;  4PFR A;  4P1L A;  4YB6 A;  2VPN A;  1B7U A;  4H65 A;  3ODB A;  4ZE8 A;  1LFG A;  3MP6 A;  1Y1Z A;  3PD9 A;  1FCK A;  2F6G A;  2RC9 A;  5I58 A;  4FJP A;  3RQT A;  4O3A A;  3VLV A;  2WKY A;  4K3F A;  2FHY A;  1YCJ A;  3TTN A;  4YAH X;  5EYH A;  2PT2 A;  3CI8 A;  2DWA A;  3FJ7 A;  4IY5 A;  4DXB A;  1M5E A;  4PAF A;  2DVZ A;  2QFL A;  3FVN A;  2QVV A;  3IAZ A;  1MPC A;  2DP8 A;  4N6D A;  1ZTY A;  3AXF A;  4NE4 A;  1GVC A;  2RF1 A;  1CE2 A;  2E1S A;  2QMX A;  4DCX A;  2XXW A;  4U22 A;  1WOD A;  1LCT A;  4FIM A;  1Y1M A;  4RXL A;  3O6I A;  4PGP A;  1OQG A;  3TTL A;  3B7D A;  1N3X A;  3UP9 A;  2Y5K A;  3OEM A;  3S4U A;  1SW4 A;  3DP8 A;  3G3I A;  4PC9 A;  3A09 A;  5H8N B;  3A3C A;  1EYK A;  2UXA A;  2KLF A;  4MH5 A;  1AMF A;  1BKA A;  4P56 A;  2O7U A;  3DEL B;  2XD2 A;  2V84 A;  4QFK A;  3T1B A;  1N3W A;  3MC2 A;  4QFL A;  3N5L A;  4JXI A;  4GVO A;  2PFY A;  4GWU A;  2ZNS A;  1AH5 A;  1XC1 A;  2HAV A;  3S2V A;  5IGA A;  3JYR A;  4OEN A;  4P47 A;  1MQG A;  4XKQ A;  3O28 A;  5IZ3 A;  4ZDM A;  4PP0 A;  3TEP A;  1SW1 A;  3G3K A;  2P2A A;  4DIG A;  3MP8 A;  5I2N B;  4R2F A;  2I6E A;  3B6W A;  4MLQ A;  2VOZ A;  1EYJ A;  5AE4 A;  2ZYN A;  3C32 A;  2O1M A;  4DDD A;  4DCY A;  1B3G A;  3O29 A;  4MMP A;  3S9E A;  4F1V A;  4WXJ A;  3L6G A;  1SW5 A;  3VVE A;  3TTR A;  1FJ6 A;  1P1N A;  1A7L A;  5H8F A;  2Q2A A;  5CC2 A;  2B4M A;  3IFC A;  4N17 A;  1FBE A;  4PDH A;  3TCF A;  1B32 A;  3SKP A;  3GBB A;  1IMA A;  4WED A;  3FBP A;  2FYI A;  1YTV A;  3FGS A;  4O3C A;  3MVW A;  4QFP A;  4F3G A;  4LQ5 A;  4F22 A;  1FBG A;  4GFR A;  4THI A;  2DVC A;  4QRZ A;  5F24 A;  4YKJ A;  1MG1 A;  4BLA A;  5KDT B;  1H43 A;  3C36 A;  2F8D A;  2HZL A;  3Q27 A;  1SPI A;  4OTE A;  5AA2 B;  5IZZ A;  3WAF A;  1LST A;  2DYX A;  2QS2 A;  3I3V A;  2QS3 A;  4X04 A;  1AWB A;  1B58 A;  3T22 A;  1TFA A;  1DK4 A;  1JP4 A;  3VDF A;  1USY H;  4EDP A;  3FXB A;  3I6V A;  1LAG E;  4GD5 A;  3MBP A;  1MY4 A;  2ZZW A;  1BK4 A;  3TCG A;  5I59 B;  2CZL A;  3QUJ A;  5ISU A;  1BIY A;  4G2Z A;  4RYA A;  4QSC A;  3LC8 A;  3K0V A;  4PFB A;  2Y7I A;  5A5L A;  3B8B A;  3A3U A;  3T66 A;  3H6V A;  1P1Q A;  5CBS A;  4F1U A;  5CI5 A;  3MVZ A;  4GXA A;  5DT6 A;  4GWO A;  5ESY A;  2QS1 A;  3SZP A;  2R6G E;  3K02 A;  4HW8 A;  3D4C A;  5M2V A;  3RY3 A;  1NV3 A;  3IO6 A;  1D9V A;  3PU5 A;  1QUL A;  4FEC A;  1A54 A;  1NI9 A;  3SEU A;  3ZS6 A;  3K00 A;  3EN3 A;  1RDY A;  1A55 A;  2O51 A;  4IO6 A;  3EHS A;  4QFN A;  3FIR A;  1D9Y A;  4XTC Q;  1VSO A;  5EYF A;  3SEY A;  1JET A;  2KQZ A;  4RY1 A;  2OCU A;  1QUJ A;  4X48 A;  3CSB A;  5L9O A;  4UAC A;  3PPP A;  1R1N A;  1NNP A;  2F7B A;  4JBZ A;  5FHM A;  4NF6 A;  3SES A;  2FVZ A;  4ND9 A;  4GWZ A;  2DXR A;  4G8H A;  4F29 A;  3C4M A;  2WBD A;  4H45 A;  1B6H A;  2PMS A;  4ZEI A;  2NOO A;  5AA2 D;  2PT1 A;  4F39 A;  1GGG A;  3PPN A;  1S7Y A;  3U1O A;  2GHA A;  4BDQ A;  4LN5 A;  4MX6 A;  4KQP A;  2Y7K A;  5DEX B;  2DWH A;  1T0K A;  1B51 A;  5EQ9 A;  4YB5 A;  1Q1K A;  1JW5 A;  1H44 A;  3VLW A;  5KCJ B;  2HCA A;  5L9S A;  2AL5 A;  2X7P A;  1I6Q A;  4I1D A;  4FE8 A;  4X1B A;  4LVQ A;  2QVR A;  1I69 A;  4PAI A;  3RYD A;  4O7I A;  5H8Q B;  3W15 C;  4KYE A;  2XWI A;  1H45 A;  4NF5 A;  4GF8 A;  1XVY A;  2DDK A;  1NUW A;  3QXM A;  2ZXT A;  2DXY A;  3BIH A;  1N0T A;  4U1O A;  4RPO A;  3V83 A;  3OEN A;  1B9J A;  3PTY A;  3TQW A;  4ELQ A;  1VDW A;  4GLI A;  2HZK A;  4PFW A;  2OWT A;  3RN8 A;  1NV1 A;  3UOR A;  2O1L A;  3FD3 A;  1YAE A;  3IR1 A;  4OWD A;  3PD8 A;  3MP1 A;  3IB2 A;  1IXI A;  4ZEC A;  3TQL A;  3CFX A;  5CMC A;  3ROJ A;  1MQJ A;  3G3H A;  3UIF A;  1CNQ A;  5CMB A;  4JWX A;  2V4C A;  5AA4 B;  3TYH A;  1Y20 A;  3QAX A;  3TFL A;  2XWK A;  2FA7 A;  1NH7 A;  4Q5T A;  2XXK A;  1URD A;  1MXU A;  2HXR A;  2REG A;  2I4B A;  4LZ8 A;  4OEU A;  5JTY B;  4OET A;  2DSF A;  3QSL A;  3FAS A;  1MS7 A;  3LR1 A;  4KCD A;  2F3D A;  3USD A;  5H8H B;  4O94 A;  5FTH A;  3BIG A;  3QYT A;  4YU0 A;  2A5T A;  5CRY A;  1NV5 A;  5DVF A;  3D1R A;  2CEY A;  1DOT A;  4NWC A;  4R6K A;  5DYH A;  4QSD A;  5I2K A;  3FVG A;  1P99 A;  3MQ9 A;  1FBP A;  4POX A;  5EQ7 A;  4JWO A;  4ELO A;  1FBH A;  4DLD A;  1MH4 A;  3TEL A;  3QIM A;  2Q2C A;  1B1H A;  2I58 A;  4KD5 A;  4O3B A;  4GIZ A;  4O8M A;  5CMK A;  1JW1 A;  1DCU A;  1O63 A;  2HQ0 A;  2RC7 A;  1A99 A;  4EF1 A;  1N04 A;  4U2R A;  3MVY A;  4Z0I A;  1ZJL A;  1UIU A;  4R75 A;  2R71 A;  3E3K A;  2Z8F A;  2X26 A;  1AOV A;  3HN0 A;  4AQ4 A;  4G8M A;  4DXU A;  3R26 A;  1EH3 A;  3FV1 A;  3K6V A;  1B40 A;  1VFE A;  2PFZ A;  4HS7 A;  4KI0 E;  1GV8 A;  4IY6 A;  4PFT A;  4JDF A;  1B5I A;  3VXB A;  4I8C A;  1P1O A;  3HFU A;  1DBZ A;  4KHZ E;  5L8D A;  1IMC A;  5L9M A;  3VVD A;  2WEF A;  1RDZ A;  1Q9D A;  3H4Z A;  2H25 A;  2BJI A;  3S9N C;  4NWD A;  1B1X A;  5IM2 A;  1IIT A;  5BUU A;  2WX9 A;  2RCB A;  2DS9 A;  1FPJ A;  4DZ1 A;  4G77 A;  3HHG A;  2M8C A;  4QHQ A;  3QMF A;  4YB7 A;  3U65 A;  3OO6 A;  3QUF A;  2LAO A;  1IXH A;  2F7A A;  4MJO A;  4ZZE A;  1GR2 A;  2V93 A;  3KEI A;  2VP1 A;  1B7Z A;  4F19 A;  1TT1 A;  4PBH A;  3C9H A;  2F78 A;  5EYG A;  1HSE A;  1NUZ A;  1MH3 A;  2F97 A;  1JW4 A;  3H7M A;  2KR0 A;  3ECR A;  2QL3 A;  4P9K A;  3PUV E;  1B4Z A;  3V8X B;  3CFL A;  4U4S A;  3O9P A;  3MVX A;  1LBW A;  3CHG A;  5FHN A;  4FAT A;  1MRP A;  3N94 A;  1XOC A;  2NUV A;  3EHT A;  3T9X B;  4X1D A;  4F31 B;  4RK2 A;  5I7I A;  2B3F A;  3KZG A;  4RPN A;  5KZT A;  3RNN A;  1EZO A;  2Y84 A;  1OIB A;  4FOR A;  4JWY A;  1HSJ A;  4LP2 B;  1EYI A;  2HEU A;  3K1M A;  4OXV A;  3E4R A;  1BP5 A;  1NNK A;  4LAT A;  5I84 A;  1NUY A;  2FIX A;  2XX7 A;  2JJK A;  4JVI A;  3T9H B;  1UQW A;  3B6T A;  4ONY A;  3B50 A;  4NF0 A;  1DPP A;  2GRV A;  3PMW A;  3LSL A;  4LUB A;  2UVH A;  5IKB A;  2DOJ A;  2XXP A;  2F7C A;  3C33 A;  4MNI A;  3HHF A;  1NL5 A;  4WEP A;  3LUZ A;  4U21 A;  4R6H A;  1Y4T A;  3N6U A;  1MXX A;  1G0I A;  4P0I A;  1G0H A;  2Z22 A;  4R9F A;  4BDN A;  1B5J A;  5ITO A;  5K2Y A;  3V89 B;  3F11 A;  4WKM A;  1ELJ A;  5K2X A;  1ZBM A;  1R9Q A;  4AB6 A;  4PE5 B;  4H5F A;  4LZ5 A;  4RA1 A;  2A5T B;  3M3K A;  1NNT A;  3MYU A;  4OER A;  3IJX B;  1M5F A;  3FZV A;  4PBQ A;  1R6Z A;  2XXY A;  5I2K B;  1UTH B;  3TCH A;  3MST A;  4PET A;  4HCW A;  4OVP A;  5TP9 A;  1OLA A;  1FQC A;  4R73 A;  3O2A A;  1L5T A;  4ZED A;  3G3G A;  1MQH A;  3RPL B;  3EKI A;  3LV0 A;  2QPQ A;  2XD3 A;  4GOT A;  1WDN A;  2O6A A;  3SEX A;  4YKK A;  1FTJ A;  4GBW A;  3V5A A;  4ZEF A;  3RUM A;  1NFT A;  5DEX A;  4NF6 B;  4G4P A;  4U4X A;  2I49 A;  2ONS A;  4LZ7 A;  5KDT A;  2P3N A;  4ESW A;  1SI1 A;  3W9V A;  4GQO A;  4H0W A;  4PGN A;  1MY2 A;  4P1E A;  5EHS A;  4QBA A;  2H9B A;  2RC8 A;  1D9Q A;  3PMX A;  1NKX A;  3GBA A;  1MM6 A;  1UIV A;  3N6T A;  4QF9 A;  1H76 A;  5LOM A;  3PGF A;  4NN3 A;  3A29 A;  1MXY A;  2OZZ A;  3BKI B;  1Q35 A;  1Y3Q A;  3FVO A;  2DE3 A;  4H8I A;  4FED A;  2VPO A;  1MPD A;  1OMP A;  4H6D A;  1B3H A;  2NVU B;  5LDZ A;  2OWZ A;  2YJP A;  1NV2 A;  1MPB A;  4GX6 A;  3IOW A;  4N8G A;  4XFE A;  1MXW A;  1FTO A;  1R9L A;  3T96 B;  4H8J A;  3OSR A;  3BBR A;  3K2D A;  3Q26 A;  3HPI A;  3MJN A;  3IX1 A;  3H03 A;  3OXN A;  1QKA A;  1FPG A;  4BDO A;  4MIJ A;  4C0R A;  4H5G A;  3S9M C;  1FPF A;  3LSF B;  5AA2 A;  1Y3N A;  1B52 A;  2Y7W A;  3FVK A;  3U93 A;  3WAE A;  3TUS A;  2QVU A;  4FBP A;  1A8E A;  4MLV A;  4ESX A;  4F3P A;  2P3V A;  2RKM A;  2UYE A;  4YMA A;  1O7T A;  3ONM A;  3QK6 A;  1DPE A;  1JEU A;  1O64 A;  5DTB A;  3EQ1 A;  2HFB A;  4EQ9 A;  4KXP A;  4I3E A;  4F3B A;  4IGR A;  5I56 B;  2ONR A;  2VGQ A;  4G8N A;  3TTK A;  4RNS A;  3SEW A;  4E0W A;  3T93 B;  3IOR A;  1FSA A;  1IXC A;  3IFA A;  1M5D A;  4MHF A;  2PYY A;  1UTB A;  2XWO A;  3H06 B;  4F2O A;  2Z23 A;  4I40 A;  3H6W A;  1DTG A;  2DQV A;  3HST A;  3MZ1 A;  3N26 A;  4GRK A;  3ISP A;  1XVX A;  1J1N A;  2ZMB A;  2HPG A;  1YZ0 A;  5A5X B;  1MY0 A;  2UYF A;  4UAB A;  2AIX A;  1FQB A;  1Y9U A;  1FPE A;  4QSE A;  1XHY A;  1LBV A;  4IO2 A;  2RIN A;  2V3T A;  3B6Q A;  3FAT A;  1MDP 1;  4NTL A;  4HTG A;  3KN8 A;  2FBP A;  4GWW A;  1NV7 A;  1MQD A;  2PCR A;  2WYP A;  2CEX A;  4OES A;  3TDJ A;  4F1Y A;  1B2H A;  3OEL A;  2Z8D A;  2QRY A;  4OVS A;  4R2B A;  2H5Y A;  1YYZ A;  2XXI A;  3ZKL A;  3KN3 A;  2I48 A;  1QJM A;  4IO4 A;  2O69 A;  1URS A;  1IQ7 A;  4N6K A;  3JZJ A;  1NH8 A;  3RT6 B;  1S50 A;  4F2Q A;  4I9D A;  4JVD A;  5EQA A;  1IIW A;  1QUI A;  1FTK A;  3L6H A;  1AL3 A;  3GLB A;  2RCA A;  3D4G A;  2E0S A;  3PUW E;  3RTF B;  3CRB A;  4PFU A;  4NF5 B;  3MUQ A;  1RKM A;  2ANJ A;  2Q88 A;  4R9G A;  3TTM A;  1ZLQ A;  4XIG Q;  3H6T A;  2F6P A;  3RT8 A;  2F5X A;  4LA9 A;  2D21 A;  2FIE A;  4C1U A;  1IMD A;  4MF3 A;  1LBZ A;  4GWS A;  2ALU A;  1DTZ A;  3IO4 A;  3MZB A;  3E13 X;  1OQH A;  5EQ8 A;  2AL4 A;  2DWI A;  3LBS A;  1B46 A;  4N15 A;  4UA8 A;  1FPI A;  1XT8 A;  3DLN A;  3RTW B;  3IK6 B;  2NWJ A;  2DE4 A;  4OFO A;  1IME A;  2HHM A;  3PUZ E;  1FQE A;  1QKB A;  2OJT A;  1QVS A;  2H99 A;  2UVI A;  1EZP A;  2GHB A;  1JVX A;  4DI3 D;  4AS5 A;  4NF8 A;  3VE1 B;  4QFO A;  2VHA A;  1PBQ A;  4U1Z A;  4JVC A;  3K6X A;  4NMY A;  2R8T A;  4HCY A;  2I3W A;  1WVJ A;  1YPN A;  4N13 A;  1PBP A;  5HPQ A;  4RK9 A;  3DP6 A;  1K9Y A;  1QW0 A;  1LEV A;  2F3B A;  1PC3 A;  3PPQ A;  5LTC A;  5H8F B;  3K1P A;  3PPR A;  1YXI A;  4OMB A;  4YIC A;  1B7H A;  1IXG A;  3TOD A;  1ANF A;  3VLU A;  5HBC A;  4XEQ A;  3KOS A;  5H8S A;  1EU8 A;  3MWB A;  3GXA A;  2XXH A;  5IZ1 A;  3KBZ A;  1SI0 A;  4N91 A;  3U92 A;  4EUO A;  2XXT A;  4ELR A;  4TLL B;  4YKP A;  1LBY A;  3RPW A;  1B0H A;  4OFJ A;  2G93 A;  5ICT A;  4IR8 A;  3EF7 A;  4PF8 A;  1MXV A;  3EHU A;  3R7X A;  4KCC A;  2XXX A;  5F1Q A;  4OYV A;  4OZ9 A;  4PE3 A;  2CMO A;  4P8B A;  4BDR A;  2GH9 A;  3S9L C;  3KGC A;  3VVF A;  1PB9 A;  1LAX A;  3BFT A;  4HE1 A;  5I2N A;  1FPD A;  1MDQ A;  4MCO A;  1B3F A;  1CB6 A;  3CIJ A;  4GBV A;  3DM0 A;  3TAJ A;  2UVG A;  1QGX A;  4JSD A;  3ZSF A;  1FPB A;  3T0J A;  4NX1 A;  2Q89 A;  1QUK A;  3H3G A;  3JV9 A;  3LSX A;  4IO3 A;  3RGY A;  3Q29 A;  1II5 A;  3KBR A;  2XXV A;  3FUZ A;  4GX3 A;  4N8Y A;  5CBR A;  2VD3 A;  4BDM A;  4OVQ A;  2ONK E;  3IJO B;  1M5B A;  4EQ7 A;  2YLN A;  1Y3P A;  5ELV A;  3G3J A;  5TPA B;  1DMB A;  1FW0 A;  2IA4 A;  2WYK A;  4H1X A;  5BWJ A;  1OVT A;  4PQJ A;  3FXQ A;  2R9J A;  2I4C A;  3IOU A;  2V25 A;  1FQA A;  4PFI A;  1N7X A;  3ILT B;  1FBF A;  5A5X A;  1JEV A;  4M1V A;  3C34 A;  4YKI A;  4RJZ A;  2H4I A;  4TQU Q;  2QS4 A;  3MPL A;  2NXO A;  1RDX A;  3U72 A;  1VR5 A;  1D4N A;  1FTA A;  4NF4 B;  2THI A;  1VE4 A;  3HV1 A;  2ABH A;  4P3L A;  4KFQ A;  1MY3 A;  3IL1 B;  3SET A;  3ZKK A;  1TXF A;  4PTK A;  1KA0 A;  1LB9 A;  5I57 A;  2Y7R A;  1LBC A;  2AYS A;  2REJ A;  4MEV A;  3KC1 A;  5H8Q A;  2UVJ A;  3U8Q A;  1I6B A;  1KWH A;  2XXR A;  4POW A;  3KSJ A;  4XF5 A;  3VFJ A;  5HM4 B;  1LCF A;  4H67 A;  3OO7 A;  2XX9 A;  1USY E;  4TLM B;  2XXU A;  4OA4 A;  5I58 B;  1NV0 A;  3P7I A;  1ZIU A;  4N4U A;  2X7Q A;  3PPO A;  4X8R A;  4G68 B;  3UN6 A;  3E78 A;  3PUY E;  3GZG A;  1DSN A;  2HXW A;  5KCJ A;  4KR5 A;  4NF8 B;  4ELP A;  4O7M A;  3C35 A;  2O68 A;  2PBW A;  1Z7M E;  4EF2 A;  4N81 A;  4FEB A;  4F3S A;  3Q28 A;  3OD7 A;  1ZU0 A;  1RYO A;  1TWY A;  5TU0 A;  4YMB A;  3CG3 A;  2H98 A;  1LBB A;  2F35 A;  2G29 A;  5DVJ A;  3M3F A;  1TFD A;  2O7I A;  3HO7 A;  4Z7E A;  1OVB A;  1RYX A;  3K6W A;  3TZA A;  3C31 A;  2PVU A;  3G3F A;  5H8N A;  4AB5 A;  1B3E A;  4MNC A;  3K1N A;  4R72 A;  4OEV A;  1FTL A;  2ESN A;  1JVY A;  4HXV A;  1FQF A;  3R6U A;  4G68 C;  1ATG A;  1FRP A;  4LON B;  4OFL A;  1P1W A;  5ET6 A;  5H8H A;  1M5C A;  1NMU A;  5EHM A;  2Z8E A;  2W7Y A;  2XX8 A;  4P11 A;  1LAH E;  1LB8 A;  1FJ9 A;  4ZEB A;  2WBB A;  3OO9 A;  2QMW A;  2GQ1 A;  1D3K A;  5TP9 B;  4PDD A;  4GXS B;  4MAG A;  4IO5 A;  3UK4 A;  1B5H A;  2BJJ X;  3OMB A;  2ZNT A;  4HE0 A;  1UTH A;  3DP4 A;  4PCD A;  4C1T A;  3M8U A;  3RLF E; 
#chains in the Genus database with same CATH homology
 2ZZV A;  4HCY A;  1CNQ A;  1KZ8 A;  3LV0 A;  3FXB A;  5DW8 A;  2V3Q A;  2Q8M A;  4O7M A;  4I3Y A;  2FVZ A;  2QPQ A;  3E79 A;  2XWV A;  4P56 A;  1EYI A;  2WYK A;  1LBX A;  4GWZ A;  1K9Y A;  1FPK A;  2V4C A;  2WBD A;  4H45 A;  4F18 A;  4N81 A;  3T1B A;  4OVS A;  1LEV A;  2QVU A;  4OVR A;  1YYZ A;  4GBW A;  4X9T A;  2F3B A;  1IMB A;  2ZZW A;  4FBP A;  5LTC A;  1KA1 A;  2PFZ A;  1NUY A;  2FIX A;  1BK4 A;  2CZK A;  2PFY A;  3KC0 A;  2P3V A;  1YXI A;  2JJK A;  4GWU A;  2MKZ A;  4JVI A;  3HFU A;  5IGA A;  4GX4 A;  4N6K A;  1DBZ A;  5I3S A;  2VT5 A;  4YIC A;  2B4L A;  4GWX A;  1IMC A;  4P47 A;  2XWK A;  2WEF A;  3B50 A;  4NF0 A;  1RDZ A;  2P3N A;  2Q74 A;  1Q9D A;  4JVD A;  4QXD A;  4LN5 A;  3W9V A;  4PFB A;  5EQA A;  4MX6 A;  5A5L A;  5IZ3 A;  5I5P A;  2XXK A;  4PFI A;  4PGN A;  4YZZ A;  2BJI A;  3GYY A;  4GWY A;  1FPF A;  4PF6 A;  4P1E A;  3B8B A;  2HXR A;  4G61 A;  4XEQ A;  5ET5 A;  4PFR A;  5IM2 A;  4MNI A;  1FBF A;  1K9Z A;  4P1L A;  5EQ9 A;  4QBA A;  5IZ1 A;  4KXP A;  4I3E A;  2VPN A;  1EYJ A;  4F1U A;  1D9Q A;  2CZH A;  3KBZ A;  4M1V A;  4MNC A;  3LUZ A;  2WX9 A;  1NV4 A;  3W9W A;  4N91 A;  2R8T A;  1IMF A;  1FBD A;  3NOH A;  5IZ3 B;  2F3D A;  1RDX A;  4MMP A;  1FPJ A;  4OAN A;  4F1V A;  1LBY A;  4O94 A;  4NN3 A;  3A29 A;  5CM6 A;  2QVR A;  1G0I A;  1FTA A;  5ESY A;  1FSA A;  4NGU A;  4HXV A;  4P3L A;  1G0H A;  3SZP A;  1INP A;  4NHB A;  3QMF A;  3IFA A;  2F5X A;  3BIG A;  4PAI A;  3RYD A;  2L5V A;  1FJ6 A;  4O7I A;  4MHF A;  3U65 A;  1NUX A;  2FIE A;  1IMD A;  2XWO A;  1NV5 A;  4IR8 A;  1LBZ A;  1FRP A;  2FHY A;  4PTK A;  4GWS A;  2XWI A;  2B4M A;  2DE3 A;  3D1R A;  3IFC A;  4MJO A;  4PF8 A;  1KA0 A;  5EYH A;  5ET6 A;  1FBC A;  2CEY A;  4NG7 A;  4N17 A;  3RPL A;  1NV3 A;  2VPO A;  4NAP A;  5J16 A;  2DDK A;  1FBE A;  1NUW A;  4PDH A;  5EQ8 A;  4I40 A;  3BIH A;  4PAF A;  2DVZ A;  2QFL A;  4N15 A;  4F19 A;  1IMA A;  1XI6 A;  4MEV A;  4PE3 A;  1NI9 A;  3FBP A;  3KC1 A;  4PBH A;  4P8B A;  1FPI A;  5LDZ A;  5EYG A;  2QVV A;  2OWZ A;  5ET7 A;  5JK4 A;  1FBP A;  1NUZ A;  3ISP A;  3MYU A;  4HE1 A;  1NV2 A;  1FPD A;  5FBP A;  4N6D A;  5EQ7 A;  1RDY A;  1FJ9 A;  3PTY A;  4GX6 A;  4MCO A;  2DE4 A;  1FBG A;  2HPG A;  2KR0 A;  2WBB A;  1FBH A;  4GBV A;  1YZ0 A;  1VDW A;  4N8G A;  4XFE A;  2HZK A;  1IME A;  2HHM A;  1QGX A;  4MNP A;  4P9K A;  4PBQ A;  1NV1 A;  4UAB A;  5F24 A;  1FPL A;  1FPB A;  2GQ1 A;  4XF5 A;  4NX1 A;  3T0J A;  4PDD A;  2WYP A;  3EKI A;  1NV6 A;  4MAG A;  1FPE A;  3MST A;  4H46 A;  1LBW A;  3CHG A;  4NQ8 A;  4PGP A;  4OVT A;  1LBV A;  5ET8 A;  4O8M A;  2HZL A;  4DI3 D;  2KQZ A;  4HE2 A;  4PET A;  1SPI A;  4AS5 A;  4HCW A;  4OA4 A;  4AS4 A;  2XA5 A;  5IZZ A;  4OVP A;  2CZI A;  2OX3 A;  2Y5K A;  4GX3 A;  4PAK A;  1NV0 A;  4N8Y A;  4PC9 A;  1DCU A;  1FPG A;  4X04 A;  5T3J A;  4N4U A;  4HE0 A;  1AWB A;  4X8R A;  3ROJ A;  4DI4 B;  2Q9T A;  2FBP A;  4MIJ A;  4OVQ A;  3E78 A;  5I7I A;  4GWW A;  5J1D A;  2ZZX A;  4JVC A;  1EYK A;  1NV7 A;  2Y5L A;  1DK4 A;  2PCR A;  2CEX A;  4PCD A;  3RPL B;  1JP4 A;  2DE2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...