4P1EA

Crystal structure of a trap periplasmic solute binding protein from escherichia fergusonii (efer_1530), target efi-510119, apo open structure, phased with iodide
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
298
structure length
296
Chain Sequence
AESLNVSTSLSPDDPIYKGLQSFKKGVESRTNGEVKIKLFSQLGADNELLQHAQAGSNVGVVVDGARLAQFVPEFAIIPAPFVFKDYTTLKKFISSPVFAQWSEQMSSKSGLTPLSFNWYQGARMLVTQKPVSKPSDLNGVRVRALEAPVTIETIKCMGGSPTPLSWSEIYSSIQTGVVDAAEAQPTAVYGSKLYEITKHITKTNHIHLMTGIIVSQKWLSSLTAEQQTILREEAQKNGDIASENTILAGDKMLDEMAKKGMTISEVDTQPFIDGCRYVPEKLGLSEAYKQVNSII
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Escherichia fergusonii
molecule tags Transport protein
total genus 100
structure length 296
sequence length 298
ec nomenclature
pdb deposition date 2014-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4p1eA00
4PAFA 4O94A 2CEXA 4N6KA 4PFBA 4X04A 2XWOA 4N6DA 2XA5A 4NHBA 4XFEA 5LTCA 2XWVA 4PDHA 4O7MA 2PFYA 4MAGA 4N4UA 4DI4B 4N17A 4P1EA 4UABA 4N91A 4OVRA 4PBQA 2XWIA 4NN3A 4N8GA 2XXKA 2VPNA 4MIJA 4PAKA 2ZZWA 4PE3A 4DI3D 3GYYA 4PFRA 4O8MA 4P56A 4PC9A 4PFIA 2VPOA 4OVSA 4MNCA 5IM2A 4MMPA 4PETA 2WYPA 2HPGA 2WX9A 4MNIA 2PFZA 4MHFA 4P3LA 4PCDA 4MCOA 4PDDA 2HZLA 2V4CA 4NF0A 4P1LA 4PF6A 5IGAA 4PGNA 4MNPA 4NG7A 4PGPA 4YICA 5IZZA 4MEVA 4PBHA 2WYKA 4LN5A 4YZZA 5I5PA 4N8YA 4NQ8A 4P9KA 4P47A 5I7IA 2ZZVA 4XEQA 4X8RA 4PF8A 2CEYA 4NX1A 4XF5A 4P8BA 3U65A 3FXBA 2HZKA 4NGUA 2XWKA 3B50A 4NAPA 4OVTA 4PAIA 4N15A 4OVPA 4OVQA 5CM6A 4MX6A 2ZZXA 4OANA 4OA4A
chains in the Genus database with same CATH superfamily
2XXHA 4U4XA 1BKAA 4ELPA 4Q5TA 1WODA 2H5YA 5FTIA 1P1WA 2XA5A 4NHBA 4P0GA 1SYIA 2V93A 1PBPA 2FIEA 5BWJA 4N81A 3TPAA 2DE3A 1FTLA 2ZNSA 3MC2A 3UGWA 1QKBA 1XVYA 3C4MA 1MRPA 3IK6B 2X26A 2VPNA 3RPWA 2ZXTA 1FPEA 3Q27A 2CMOA 2F34A 2DXRA 3R26A 3PMVA 2HXRA 4R6KA 2FA7A 3QIMA 2NOOA 3TMGA 3QK6A 1GVCA 1NH7A 3OD7A 2RCAA 3FXUA 1NNFA 1FPBA 4NG7A 3V89B 1XVXA 4DXBA 3KN7A 2BJIA 3TODA 1DBZA 4R2BA 1POTA 4OHNA 5TPAA 2GQ1A 2V3TA 1N3XA 1N0TA 3UN6A 2ABHA 4MJOA 3U8QA 4ND9A 1O64A 5TP9A 4OVQA 3KSJA 4BDRA 4OMBA 1US5A 4OEUA 3Q25A 1A40A 2DSFA 3TEPA 4RA1A 3K1PA 1AL3A 2GH9A 3DP6A 1JW5A 1LFGA 2OLBA 4O7IA 4UABA 4F29A 1FQCA 4JWYA 4PBQA 5TPAB 1IMDA 1M5DA 2QVVA 3BFUA 4F3GA 3T22A 4ONYA 1MDQA 4G4PA 5TP9B 4LZ7A 1FQDA 4PE5B 4DXUA 5B70A 4I62A 1R1NA 3I3VA 5CC2A 1INPA 4PC9A 3PUYE 5IM2A 3KC1A 1B7ZA 4ZS9A 4IO4A 2Q74A 4G8NA 2PT1A 2WX9A 4GWWA 3OMBA 3FVNA 5ICTA 3U72A 4F39A 4H8JA 1JVYA 1EZPA 2RKMA 2O7UA 1B6HA 4FE8A 2DWAA 4IY5A 3O6HA 3IOUA 3U94A 2B4MA 3FV1A 3B6WA 3PV0E 1B2HA 2DE4A 3RNNA 3IAZA 4JWOA 4ZECA 2DOJA 4KD5A 4DE8A 1B52A 4U1OA 1LAFE 2Z8EA 1LAXA 1LBVA 2KR0A 4R72A 2X7QA 5AA4B 4DCXA 1P1UA 3UP9A 3KJTA 1R9QA 4Z0IA 3OO8A 3HHFA 3MAMA 1PC3A 3FVGA 1O7TA 4EXLA 5H8SA 4BDOA 1QW0A 3LUZA 3OSRA 1JVXA 3VVDA 1QUJA 3A3UA 4O94A 3MPKA 5EHMA 3TDJA 4EUOA 2W7YA 3KGCA 4IO5A 4XXUA 4GRKA 3MVWA 1VE4A 4FEBA 3PGFA 1H76A 5DT6A 2L5VA 1R6ZA 1MG1A 4YU0A 3S9MC 4EQ9A 2VD3A 2ZYOA 5IZ3A 3PTYA 4F1UA 3SZPA 1QKAA 3ISPA 1Y1MA 2GFEA 1F9BA 2ZYKA 1FTKA 2F6PA 3KZGA 3SEYA 4C1TA 3H3GA 4ELRA 1NUZA 1TFAA 1NH8A 4I3EA 1FTAA 2Q8JA 3RPLA 5EHSA 4F18A 4MNIA 4LQ2A 5IZ3B 5ET6A 4GBVA 4GXSB 1Y4TA 1NV6A 4GLIA 4H5GA 4GWSA 3AXFA 2FYIA 1D9YA 4F3SA 4ELOA 1LBWA 4NF0A 3FUZA 5I59A 3IOWA 4MNPA 1EYJA 3EF7A 4MEVA 4YKIA 2O1MA 5K2YA 4IGRA 3RPLB 2I3WA 3EN3A 1AOVA 1IMAA 5JTYA 2Q88A 2I3VA 2HZKA 2HAUA 2A5TA 3DP4A 3JYRA 1ZLQA 1Y3NA 3DELB 1ZIUA 5JK4A 4GVOA 5I59B 2CEXA 3MJNA 3OENA 1D9VA 3MP6A 5I2KA 4ELQA 4RYAA 2UVHA 1JNFA 1URSA 5JTYB 4OVJA 1B3FA 2I4CA 4N13A 2A5TB 4KCDA 4GBWA 1G0IA 1PBQA 3P7IA 4HE0A 1NV5A 1A99A 1ZMGA 4P56A 1MXUA 4EXKA 1QULA 4ZEDA 3I5OA 4OENA 5F1QA 4NWDA 3T1BA 4EQBA 5I2KB 3THIA 2XXXA 3RTWB 3TTKA 4KCCA 4KYSA 3VE1B 4KYDA 4HXVA 2F3DA 5DVIA 3C36A 3W9WA 2E1SA 3RTFB 1A8FA 1KA0A 4OWDA 1B58A 1FQEA 2XXTA 3FV2A 4P1LA 5IGAA 5JEIA 1DPEA 3LR1A 4YICA 4IO7A 2O84X 3ILTB 4F19A 2QS4A 3SETA 5EQ9A 3B6QA 4RY1A 2O51A 1MPBA 2B3BA 4LZ8A 1B7HA 4XKRA 5ELVA 4QF9A 1CE2A 3VLUA 1Y4CA 4XF5A 3VV5A 4QFPA 2I49A 3LC8A 1XHYA 1H3DA 3BKIB 5CM6A 4ISUA 1T0KA 1DSNA 2P1SA 2OBGA 4KXPA 3MZ9A 4H8IA 4PFBA 1SI0A 1MQJA 3F11A 5CRYA 1A54A 3M3FA 1MM6A 1B1HA 4KQPA 2Q9TA 2D5WA 3S4UA 5AA2D 2Q8MA 4N91A 4HE2A 1ELJA 4L17A 3K6VA 4XKNA 3SKPA 2ZYMA 1B7UA 4POWA 3B7DA 4R74A 3IJOB 4BDQA 3IL1B 3V8XB 5DVJA 1LBBA 4OFLA 3EPEA 2OWSA 5KCJA 4C0RA 2YLNA 1PEBA 3QAXA 4QFNA 4FAJA 4N6PA 4XKQA 4MHFA 1OMPA 3UIFA 4EF2A 1N3WA 3H7MA 3E78A 1URGA 3QXMA 1FQFA 5I5PA 1VFEA 1QVSA 2V25A 4NF6A 4X1BA 2V3UA 5KCJB 2NXOA 4R6YA 1BIYA 4G8HA 4NTLA 3TTMA 5T3JA 1NV3A 2AIXA 4P8BA 4GWOA 2ZZXA 4OANA 2FNCA 1IZ1A 1MDP1 2F7BA 1USYE 3MUQA 3KBRA 3VLVA 3BBRA 4X04A 2HAVA 5B7DA 2D3IA 1XI6A 2XWOA 1BTJA 2Z22A 3FXQA 2IA4A 2HCAA 2PFYA 3BIGA 4N4UA 4EQ7A 2UYEA 1LBYA 3PD9A 1NMUA 1OLCA 1FTMA 4ESXA 1FBDA 4H6DA 3L6GA 3DM0A 3V5AA 2PVUA 4H1XA 4H65A 1RKMA 4U4SA 4QBAA 2ZZWA 3L6HA 2HXWA 1GR2A 3TQWA 1IXHA 4KPTA 3HSTA 2VGQA 1GGGA 2XXQA 2Q2AA 4KR5A 1ANFA 3PPQA 4RXLA 3R7XA 1Q1KA 1LEVA 1S7YA 1FTOA 3KG2A 4U23A 2PFZA 3GBBA 3RUMA 2Y7IA 2OK2A 3IJXB 4H45A 1B1XA 2ZNTA 2I4BA 1VSOA 4GWXA 1B0LA 3PPNA 3T9HB 4P47A 3N6UA 5M2VA 2IEEA 5CMKA 4R9FA 1FJ6A 1FJ9A 3O29A 4O3CA 2M8CA 1RYXA 2DVZA 3IX1A 1NKXA 3IO6A 4F1VA 3K2DA 2Q2CA 3FXBA 2RINA 1B9JA 2V84A 3NOHA 1TXFA 4NF8A 3RN8A 1B3LA 4GQOA 1MY3A 3CSGA 3EQ1A 3LBSA 3VVEA 1A8EA 4QFLA 1MY4A 1YPNA 4PQJA 1B0HA 2D21A 2LAOA 4MFIA 1LCTA 5IAIA 1L5TA 5H8NA 5CMMA 3OO7A 3CFXA 2B65A 4JVIA 2B4LA 1P1OA 3O66A 1QJMA 3Q29A 3SEWA 3HN0A 2XXKA 4NF8B 3KJ7A 1IXGA 2X7PA 3GYYA 4OXVA 3TYHA 1M5CA 2DQVA 3BIHA 2VPOA 3ZKKA 1SW1A 3G7WA 3PUZE 2F7CA 1R9LA 3N5LA 5H8NB 4OEVA 4AB5A 3BFTA 4NWCA 2QPQA 4LZ5A 1NV7A 1I6AA 2XXRA 1RDZA 1NUWA 3MVZA 1AIVA 2RC7A 3LUYA 3VVFA 3ODBA 5I58A 1H45A 1WVJA 2H25A 4IB2A 3LSFB 1MH4A 2UVJA 3R6UA 1MXXA 1UTHA 4OQOA 2HHMA 1LB9A 3E9XA 3TELA 1IMEA 4PF8A 4NF4A 4JB7A 2F5XA 1NUYA 1SW4A 4NAPA 4OVTA 2DDKA 2XXIA 1B4HA 3MP8A 5F7VA 2VP1A 5H8HA 3RY3A 4P11A 2UYFA 5ISUA 5I58B 2R8TA 2DWJA 1D3KA 2NVUB 2WBDA 4NF5A 1IITA 4LUBA 1IEJA 5CBRA 1UTHB 5LTCA 4PDHA 4EF1A 3IB2A 1Y20A 3E13X 4NF4B 3KN3A 2I58A 5TU0A 2REJA 2ZNUA 3IR1A 1FPKA 3PD8A 5H8HB 4XKPA 3TKDA 1NV2A 5LDZA 1J1NA 4JVCA 1NNPA 3CG1A 1IUDA 1B5JA 4NF5B 1B3EA 3O97A 1MXWA 2ONKE 1SW5A 2WYPA 1FQBA 2QRYA 4GFRA 1HSEA 3CG3A 3QYTA 5AA3A 2WBBA 3CVGA 1EYIA 1MPCA 2FBPA 1LFIA 3G3JA 2WKYA 1EZ9A 2H9BA 1IQ7A 3T9UA 1NL5A 4P3LA 1B3HA 4GX3A 1MS7A 2DWHA 4U2RA 4I40A 1URDA 1O63A 1VR5A 2QS2A 2PCRA 1D4NA 2R71A 2Z8DA 4ZE9A 1OVBA 3ZKLA 2FVZA 4QFKA 3M8UA 3ROJA 3SDFA 4U1ZA 1PB7A 5DTBA 4X48A 1FBGA 1JEUA 1M5EA 2YPNA 3IORA 3TAJA 2H99A 3IOVA 1H44A 4X1DA 3ZS6A 4HS7A 1DK4A 4MF3A 1A7LA 4G2ZA 3UORA 3OXNA 4FATA 3S9EA 4TLMB 5DVFA 3N26A 4HW8A 3H4ZA 1KWHA 2Y7PA 1LAHE 4BDMA 1NNKA 3H6WA 2HQ0A 1DOTA 1JW1A 2QMWA 2XXWA 4N8GA 4G77A 1MY2A 4TQUQ 3B6TA 4ESWA 1EU8A 4H67A 4OYVA 1N84A 2P0SA 1BP5A 1JETA 4F2QA 5I57A 3QUFA 5EYGA 1PB9A 1SW2A 1II5A 1SYHA 4GWUA 5I2NA 4QFOA 4IY6A 3LSWA 3RT8A 1MPDA 3GZGA 4JVDA 4ZEBA 4MLVA 3RLFE 3CRBA 3IB0A 3IB1A 1N76A 4I9DA 4PGPA 1K9ZA 1GV8A 5I57B 3CR9A 1Q35A 1S9TA 4LQ5A 1MXVA 2F78A 2RCBA 2F36A 2QJEA 5I84A 5IKBA 2KQZA 4KFQA 1XT8A 1LCFA 3G3GA 4LVQA 1TWYA 1S50A 2XWKA 4MX6A 1JEVA 1OIBA 3T96B 4NMYA 3H6UA 2THIA 5KDTA 1I69A 1FCKA 3DP8A 2XHDA 4FIMA 3OELA 4AB6A 3O2AA 4O7MA 4UA8A 4F22A 2R9JA 2VD2A 3T0JA 4OETA 1QUKA 4WEDA 2PBWA 4HE1A 4F1YA 1IMCA 4DI3D 3EHSA 4Z7EA 1B32A 4PFIA 5KDTB 3GXAA 4M4GA 4MMPA 2A5SA 1DPPA 1FPFA 4PFUA 2CZHA 5BUUA 3IO4A 1FBHA 3HCQA 3MBPA 4O3BA 4RK9A 1JP4A 3IFCA 3T9VA 4MBPA 1NI9A 4KYEA 2B3FA 4IO2A 4MCOA 3PUXE 1M5BA 1LGBC 3C34A 5FTHA 1FSAA 1UIVA 3OOAA 4GL8A 1RDXA 1FPLA 4KI0E 3M3KA 4R9GA 4LN5A 1LLSA 3H06B 2F35A 4NE4A 2FIXA 4R73A 3USDA 1P99A 3FJMA 4X8RA 3WAFA 1JQFA 1NFTA 1NV4A 1EZOA 5L9MA 1ZTYA 2CEYA 5J16A 3QMFA 2Z8FA 4GWYA 5FHOA 4Q0CA 2Q89A 5HM4B 4GXAA 3O6GA 3FATA 4I3YA 4PAFA 3IOTA 3PMWA 4E0XA 2F8DA 4FJPA 5L9SA 5EYFA 2UXAA 2OZZA 3TCHA 4XFEA 3A29A 3FVOA 5DYHA 5H8QA 1YTVA 1Y9UA 4G68C 1N04A 2VOZA 4MAGA 4M1VA 1LB8A 4FBPA 4LA9A 4F31B 4KHZE 5HPQA 2QVUA 4NN3A 2P3NA 3GLBA 3JV9A 2O1LA 4MIJA 1FPIA 1B3GA 4THIA 4ZZEA 3MVXA 3EHTA 1NV1A 1UTBA 4JXIA 4NF6B 1IIWA 3ONMA 4FECA 4DDDA 2R6GE 1EYKA 2V3QA 3MYUA 4RNSA 3M3LA 2ONRA 3CFZA 5H8QB 3KOTA 3LV0A 4ZEIA 4JSDA 1YCJA 1TFDA 4DCYA 1ZKBA 3SERA 3ZSFA 4OFJA 4FEDA 3RQTA 3PPRA 5CMCA 2XD2A 2V4CA 5HBCA 4PF6A 1I6QA 1UTBB 2CZLA 4TLLB 1B5HA 4H5FA 2F6GA 3K0VA 4PBHA 4EDPA 4MLQA 3W15C 2XD3A 3OO9A 5LOMA 4GF8A 3K6XA 1LSTA 3TCFA 2OWTA 4GX6A 2OX3A 4I1DA 3CSBA 4O3AA 3MPLA 4OFOA 1ATGA 3B50A 4PAIA 1GTKA 3TTNA 4PP0A 4OA4A 5EQAA 3FASA 3HV1A 5DEXA 5ET5A 1N7WA 2UVGA 1PDAA 1IXIA 4GWZA 3SEUA 3H6TA 1FPGA 1Z7ME 2ANJA 1KA1A 1FBEA 4N17A 3FJ7A 3I6VA 3PUVE 3TFLA 1FBPA 4E0WA 5AE4A 5ITOA 2DS9A 5DW8A 3OEKA 1MXYA 3UK4A 2AYSA 3H6VA 1DTGA 4IO3A 1UQWA 5A5XA 2G29A 3FJGA 5DEXB 4OVSA 5F24A 1D9QA 3MW0A 1SVXB 4ZZAA 3QSLA 2QMXA 4K3FA 3MWBA 4QSDA 1P1NA 4AQ4A 4YAHX 1LBZA 2RF1A 5FHNA 3C32A 1CNQA 4PDDA 4YB7A 2RC9A 2QL3A 4PGNA 1YXIA 5A5XB 3RGYA 2Z23A 1DCUA 3PU5A 1YYZA 4GIZA 2F3BA 1AWBA 3S9NC 5EQ8A 1B05A 4NX1A 4PFYA 3JZJA 3ILUB 4NGUA 1IMBA 4YKJA 4JBZA 4ZEFA 5ET7A 2QS1A 3FZVA 3PUWE 5ESYA 3FXRA 1Y3QA 3D4CA 3U92A 2XX7A 4QXDA 1XOCA 2GHBA 4R75A 3CHGA 3FBPA 4IR8A 4HCYA 2NWJA 4GL0A 3V83A 2PX1A 2RC8A 3PMXA 2XXPA 1QUIA 3VFJA 1MM7A 5ICQA 4OVRA 5AA4A 4ECFA 2Y5LA 4HCWA 3QUJA 4DLDA 1QGXA 3UA8A 2XX9A 2GRVA 3LSXA 3S9LC 3KC0A 4DXCA 4O8MA 3W9VA 5ITPA 4BLAA 5I56A 3DLNA 1NUXA 1ZJLA 3CIJA 2KLFA 3TTRA 3IFAA 4PETA 3RT6B 1PB8A 3KSXA 3C33A 1MH3A 1ZBMA 4RK2A 4OESA 1UIUA 3FGSA 3K6WA 2DE2A 1KZ8A 1LBCA 1MQDA 4X9TA 4PCDA 1YAEA 3OSQA 4H46A 4YKPA 3E4RA 5L9OA 1IXCA 4GD5A 5I56B 3CFLA 4YZZA 4LATA 3K4UA 5EQ7A 3C9HA 5FHMA 3C35A 5J1DA 4P9KA 2G93A 3U93A 3RYDA 5ET8A 3MVYA 4TOZA 3LSLA 2F7AA 1B51A 1JW4A 3N94A 4C1UA 4N07A 4DZ1A 4Q30B 2Y7WA 3D4GA 2O7IA 3PPOA 1NV0A 1SBPA 4WKMA 3T66A 2NUVA 2Y7KA 2DYXA 2QSXA 4N6DA 1FPDA 2VT5A 3A09A 2DWIA 2PYYA 5CMBA 3A3CA 2DP8A 3Q26A 3HO7A 1A55A 4F3PA 2I6EA 4PAKA 3H03A 2I0BA 2AL4A 1B5IA 4PFRA 3WAEA 4UACA 1M5FA 2ZMBA 1WDNA 3K00A 4AS5A 3O9PA 3C31A 5A5LA 3CI8A 1HSJA 2BJJX 2PMSA 2HPGA 1G0HA 2CZIA 5CBSA 1MQHA 1I6BA 5FBPA 3MQ9A 2WEFA 3TZAA 3T9XB 4U21A 1FTJA 5AA2A 1FRPA 3D1RA 1MQIA 3EKIA 5L8DA 4HTGA 4N8YA 5AA1A 5I7IA 2Y5KA 2ZZVA 4XEQA 1MQGA 1TT1A 4YKKA 4G68A 3T93B 4LP2B 4U22A 1Q9DA 3K01A 4OTEA 3SESA 1YZ0A 1RDYA 4QSCA 3E3KA 2ESNA 4F2OA 3MZBA 1AH5A 4OVPA 4BDLA 3KBZA 3N6TA 3FIRA 2DVCA 4IO6A 2YJPA 2ONSA 3KFMA 4MH5A 3O6IA 2F97A 4G8MA 3G3HA 4POXA 2P2AA 1OQHA 4RJZA 1LFHA 1BLFA 5AA2B 2OCUA 3TQLA 4I8CA 1MY0A 1USYH 3MSTA 3MP1A 4XTCQ 5I2NB 3FVKA 4YMAA 1BK4A 1SDXA 1EH3A 2H4IA 4YB6A 4F3BA 2ALUA 4G68B 4DI4B 4P1EA 4R2FA 2PT2A 1H43A 4ZDMA 3HHGA 1SPIA 1XC1A 1US4A 1IMFA 2E0SA 3TUSA 4FORA 3VLWA 4YB5A 4RPOA 5I3SA 4ZE8A 1HSLA 3G3FA 4R6HA 2VHAA 1Y3PA 3K02A 4PFWA 4GX4A 2CZKA 3E79A 2XXVA 1FBFA 2DXYA 4NEDA 1K9YA 3KEIA 3VDFA 3KN8A 2Y84A 2REGA 2ZYNA 3B8BA 4WXJA 4JWXA 4QHQA 3K1MA 2GHAA 5IZ1A 1B46A 4RPNA 5IZZA 2JJKA 1OVTA 1Y1ZA 1ZU0A 4LONB 2Y7RA 1MXZA 3GBAA 4Q8RA 4OZ9A 4G61A 5KZTA 1OLAA 4YMBA 1N7XA 1RYOA 5H8FA 5EYHA 3U65A 2UVIA 4IGTA 2QS3A 2OJTA 1LBXA 1FW0A 3TTLA 4N6KA 2XXYA 4PTKA 2MKZA 2XWVA 1Z7NE 2XX8A 2I48A 5H8FB 4JSOA 2O68A 3PPPA 4H0WA 1CB6A 2H98A 1AMFA 3G3IA 3HPIA 2XWIA 3EHUA 3K1NA 4QSEA 3ECRA 3SEVA 4PE3A 1FBCA 4AS4A 3OO6A 3K6UA 4WEPA 1B4ZA 1DMBA 3O28A 1OQGA 4MNCA 4XIGQ 1SI1A 3VXCA 1FPJA 1B40A 2AL5A 4ZEKA 3U1OA 1VFDA 3Q28A 2QVRA 3KOSA 3MZ1A 2O69A 3OEMA 1XS5A 1FQAA 1MY1A 1DTZA 2O6AA 5CI5A 2HEUA 2HZLA 3VXBA 3S2VA 1P1QA 3TCGA 2OWZA 4GOTA 2WYKA 4BDNA 4NQ8A 3FD3A 4PFTA 2XXUA 1POY1 3HFUA 3SEXA 5K2XA 1NNTA 1LAGE 1VDWA 1SQYA 2I0CA 2QFLA 3G3KA 4N15A 2HFBA 4DIGA 2FHYA 4QRZA 4P0IA 4JDFA 1SD3A 4OERA 2P3VA
chains in the Genus database with same CATH topology
1DK4A 4KXPA 4QXDA 3CHGA 4PFBA 3FBPA 4IR8A 4HCYA 2XA5A 4NHBA 2FIEA 4N81A 2Q9TA 2DE3A 2Q8MA 4N91A 4OVRA 4HE2A 2Y5LA 4HCWA 4N8GA 1QGXA 2VPNA 1FPEA 3KC0A 4O8MA 3W9VA 1NUXA 2HXRA 5EYGA 3IFAA 4PETA 4GWUA 2DE2A 1KZ8A 4JVDA 4MHFA 4X9TA 4PCDA 4H46A 1FPBA 3E78A 4NG7A 4PGPA 1K9ZA 4YZZA 5I5PA 5EQ7A 5J1DA 2BJIA 4P9KA 3RYDA 5ET8A 1DBZA 2KQZA 5T3JA 1NV3A 4P8BA 2GQ1A 2XWKA 4MX6A 4MJOA 2ZZXA 4OVQA 4OANA 1NV0A 4X04A 1XI6A 2XWOA 4N6DA 1FPDA 2VT5A 4O7MA 2PFYA 3BIGA 4N4UA 1LBYA 4O7IA 4UABA 1FBDA 3T0JA 4PBQA 1IMDA 2QVVA 4HE1A 1IMCA 4PAKA 4QBAA 2ZZWA 4DI3D 4PFRA 1INPA 4PC9A 4PFIA 5IM2A 3KC1A 4MMPA 4AS5A 5A5LA 1FPFA 2CZHA 2Q74A 2HPGA 2WX9A 1G0HA 2CZIA 4GWWA 1LEVA 1FBHA 5FBPA 1JP4A 3IFCA 2PFZA 2WEFA 1NI9A 2B4MA 4H45A 4MCOA 2DE4A 1FSAA 1FRPA 3D1RA 4GWXA 3EKIA 1RDXA 1FPLA 4LN5A 4N8YA 1LBVA 2KR0A 4P47A 2FIXA 5I7IA 2Y5KA 2ZZVA 4XEQA 4X8RA 1FJ6A 1FJ9A 2DVZA 1NV4A 1Q9DA 2CEYA 4F1VA 5J16A 3QMFA 1YZ0A 1RDYA 3FXBA 4GWYA 3NOHA 4OVPA 3KBZA 3LUZA 4I3YA 4PAFA 4O94A 3MSTA 4XFEA 3A29A 1BK4A 4MAGA 4DI4B 2L5VA 4M1VA 4P1EA 4FBPA 5IZ3A 3PTYA 4F1UA 3SZPA 4JVIA 2B4LA 3ISPA 2QVUA 4NN3A 2P3NA 2XXKA 4MIJA 1FPIA 1SPIA 3GYYA 1IMFA 1NV1A 1NUZA 3BIHA 4I3EA 5I3SA 2VPOA 1FTAA 1EYKA 2V3QA 3MYUA 3RPLA 4F18A 4GX4A 3LV0A 2QPQA 2CZKA 3E79A 4MNIA 5IZ3B 1NV7A 1FBFA 5ET6A 1RDZA 4GBVA 1NV6A 1NUWA 4GWSA 1K9YA 3B8BA 1LBWA 2V4CA 4NF0A 5IZ1A 4PF6A 4MNPA 5IZZA 2JJKA 1EYJA 4MEVA 4PBHA 3RPLB 4G61A 1IMAA 2HHMA 1IMEA 4PF8A 5EYHA 4GX6A 2OX3A 3U65A 2HZKA 2F5XA 1NUYA 3B50A 4NAPA 4OVTA 4PAIA 2DDKA 1LBXA 4OA4A 5JK4A 5EQAA 2CEXA 4N6KA 5ET5A 2R8TA 4GWZA 4PTKA 2WBDA 2MKZA 1FPGA 5LTCA 2XWVA 4PDHA 1KA1A 1FBEA 4N17A 1FBPA 4GBWA 2XWIA 1G0IA 4HE0A 1FPKA 5DW8A 4PE3A 1FBCA 1NV5A 4AS4A 1NV2A 5LDZA 4P56A 4JVCA 4OVSA 5F24A 4MNCA 3T1BA 1D9QA 1FPJA 2WYPA 4HXVA 2WBBA 1EYIA 2F3DA 1LBZA 2QVRA 2FBPA 3W9WA 1CNQA 4P3LA 4GX3A 1KA0A 4PDDA 2HZLA 4P1LA 5IGAA 4PGNA 4I40A 1YXIA 4YICA 2OWZA 1DCUA 4F19A 2WYKA 5EQ9A 1YYZA 2PCRA 4NQ8A 2F3BA 2FVZA 1AWBA 5EQ8A 3ROJA 3HFUA 4NX1A 4XF5A 1FBGA 4NGUA 1IMBA 1VDWA 2QFLA 4N15A 5ET7A 5CM6A 2FHYA 5ESYA 2P3VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PAF A;  4O94 A;  2CEX A;  4N6K A;  4PFB A;  4X04 A;  2XWO A;  4N6D A;  2XA5 A;  4NHB A;  4XFE A;  5LTC A;  2XWV A;  4PDH A;  4O7M A;  2PFY A;  4MAG A;  4N4U A;  4DI4 B;  4N17 A;  4P1E A;  4UAB A;  4N91 A;  4OVR A;  4PBQ A;  2XWI A;  4NN3 A;  4N8G A;  2XXK A;  2VPN A;  4MIJ A;  4PAK A;  2ZZW A;  4PE3 A;  4DI3 D;  3GYY A;  4PFR A;  4O8M A;  4P56 A;  4PC9 A;  4PFI A;  2VPO A;  4OVS A;  4MNC A;  5IM2 A;  4MMP A;  4PET A;  2WYP A;  2HPG A;  2WX9 A;  4MNI A;  2PFZ A;  4MHF A;  4P3L A;  4PCD A;  4MCO A;  4PDD A;  2HZL A;  2V4C A;  4NF0 A;  4P1L A;  4PF6 A;  5IGA A;  4PGN A;  4MNP A;  4NG7 A;  4PGP A;  4YIC A;  5IZZ A;  4MEV A;  4PBH A;  2WYK A;  4LN5 A;  4YZZ A;  5I5P A;  4N8Y A;  4NQ8 A;  4P9K A;  4P47 A;  5I7I A;  2ZZV A;  4XEQ A;  4X8R A;  4PF8 A;  2CEY A;  4NX1 A;  4XF5 A;  4P8B A;  3U65 A;  3FXB A;  2HZK A;  4NGU A;  2XWK A;  3B50 A;  4NAP A;  4OVT A;  4PAI A;  4N15 A;  4OVP A;  4OVQ A;  5CM6 A;  4MX6 A;  2ZZX A;  4OAN A;  4OA4 A; 
#chains in the Genus database with same CATH topology
 2XXH A;  4U4X A;  1BKA A;  4ELP A;  4Q5T A;  1WOD A;  2H5Y A;  5FTI A;  1P1W A;  2XA5 A;  4NHB A;  4P0G A;  1SYI A;  2V93 A;  1PBP A;  2FIE A;  5BWJ A;  4N81 A;  3TPA A;  2DE3 A;  1FTL A;  2ZNS A;  3MC2 A;  3UGW A;  1QKB A;  1XVY A;  3C4M A;  1MRP A;  3IK6 B;  2X26 A;  2VPN A;  3RPW A;  2ZXT A;  1FPE A;  3Q27 A;  2CMO A;  2F34 A;  2DXR A;  3R26 A;  3PMV A;  2HXR A;  4R6K A;  2FA7 A;  3QIM A;  2NOO A;  3TMG A;  3QK6 A;  1GVC A;  1NH7 A;  3OD7 A;  2RCA A;  3FXU A;  1NNF A;  1FPB A;  4NG7 A;  3V89 B;  1XVX A;  4DXB A;  3KN7 A;  2BJI A;  3TOD A;  1DBZ A;  4R2B A;  1POT A;  4OHN A;  5TPA A;  2GQ1 A;  2V3T A;  1N3X A;  1N0T A;  3UN6 A;  2ABH A;  4MJO A;  3U8Q A;  4ND9 A;  1O64 A;  5TP9 A;  4OVQ A;  3KSJ A;  4BDR A;  4OMB A;  1US5 A;  4OEU A;  3Q25 A;  1A40 A;  2DSF A;  3TEP A;  4RA1 A;  3K1P A;  1AL3 A;  2GH9 A;  3DP6 A;  1JW5 A;  1LFG A;  2OLB A;  4O7I A;  4UAB A;  4F29 A;  1FQC A;  4JWY A;  4PBQ A;  5TPA B;  1IMD A;  1M5D A;  2QVV A;  3BFU A;  4F3G A;  3T22 A;  4ONY A;  1MDQ A;  4G4P A;  5TP9 B;  4LZ7 A;  1FQD A;  4PE5 B;  4DXU A;  5B70 A;  4I62 A;  1R1N A;  3I3V A;  5CC2 A;  1INP A;  4PC9 A;  3PUY E;  5IM2 A;  3KC1 A;  1B7Z A;  4ZS9 A;  4IO4 A;  2Q74 A;  4G8N A;  2PT1 A;  2WX9 A;  4GWW A;  3OMB A;  3FVN A;  5ICT A;  3U72 A;  4F39 A;  4H8J A;  1JVY A;  1EZP A;  2RKM A;  2O7U A;  1B6H A;  4FE8 A;  2DWA A;  4IY5 A;  3O6H A;  3IOU A;  3U94 A;  2B4M A;  3FV1 A;  3B6W A;  3PV0 E;  1B2H A;  2DE4 A;  3RNN A;  3IAZ A;  4JWO A;  4ZEC A;  2DOJ A;  4KD5 A;  4DE8 A;  1B52 A;  4U1O A;  1LAF E;  2Z8E A;  1LAX A;  1LBV A;  2KR0 A;  4R72 A;  2X7Q A;  5AA4 B;  4DCX A;  1P1U A;  3UP9 A;  3KJT A;  1R9Q A;  4Z0I A;  3OO8 A;  3HHF A;  3MAM A;  1PC3 A;  3FVG A;  1O7T A;  4EXL A;  5H8S A;  4BDO A;  1QW0 A;  3LUZ A;  3OSR A;  1JVX A;  3VVD A;  1QUJ A;  3A3U A;  4O94 A;  3MPK A;  5EHM A;  3TDJ A;  4EUO A;  2W7Y A;  3KGC A;  4IO5 A;  4XXU A;  4GRK A;  3MVW A;  1VE4 A;  4FEB A;  3PGF A;  1H76 A;  5DT6 A;  2L5V A;  1R6Z A;  1MG1 A;  4YU0 A;  3S9M C;  4EQ9 A;  2VD3 A;  2ZYO A;  5IZ3 A;  3PTY A;  4F1U A;  3SZP A;  1QKA A;  3ISP A;  1Y1M A;  2GFE A;  1F9B A;  2ZYK A;  1FTK A;  2F6P A;  3KZG A;  3SEY A;  4C1T A;  3H3G A;  4ELR A;  1NUZ A;  1TFA A;  1NH8 A;  4I3E A;  1FTA A;  2Q8J A;  3RPL A;  5EHS A;  4F18 A;  4MNI A;  4LQ2 A;  5IZ3 B;  5ET6 A;  4GBV A;  4GXS B;  1Y4T A;  1NV6 A;  4GLI A;  4H5G A;  4GWS A;  3AXF A;  2FYI A;  1D9Y A;  4F3S A;  4ELO A;  1LBW A;  4NF0 A;  3FUZ A;  5I59 A;  3IOW A;  4MNP A;  1EYJ A;  3EF7 A;  4MEV A;  4YKI A;  2O1M A;  5K2Y A;  4IGR A;  3RPL B;  2I3W A;  3EN3 A;  1AOV A;  1IMA A;  5JTY A;  2Q88 A;  2I3V A;  2HZK A;  2HAU A;  2A5T A;  3DP4 A;  3JYR A;  1ZLQ A;  1Y3N A;  3DEL B;  1ZIU A;  5JK4 A;  4GVO A;  5I59 B;  2CEX A;  3MJN A;  3OEN A;  1D9V A;  3MP6 A;  5I2K A;  4ELQ A;  4RYA A;  2UVH A;  1JNF A;  1URS A;  5JTY B;  4OVJ A;  1B3F A;  2I4C A;  4N13 A;  2A5T B;  4KCD A;  4GBW A;  1G0I A;  1PBQ A;  3P7I A;  4HE0 A;  1NV5 A;  1A99 A;  1ZMG A;  4P56 A;  1MXU A;  4EXK A;  1QUL A;  4ZED A;  3I5O A;  4OEN A;  5F1Q A;  4NWD A;  3T1B A;  4EQB A;  5I2K B;  3THI A;  2XXX A;  3RTW B;  3TTK A;  4KCC A;  4KYS A;  3VE1 B;  4KYD A;  4HXV A;  2F3D A;  5DVI A;  3C36 A;  3W9W A;  2E1S A;  3RTF B;  1A8F A;  1KA0 A;  4OWD A;  1B58 A;  1FQE A;  2XXT A;  3FV2 A;  4P1L A;  5IGA A;  5JEI A;  1DPE A;  3LR1 A;  4YIC A;  4IO7 A;  2O84 X;  3ILT B;  4F19 A;  2QS4 A;  3SET A;  5EQ9 A;  3B6Q A;  4RY1 A;  2O51 A;  1MPB A;  2B3B A;  4LZ8 A;  1B7H A;  4XKR A;  5ELV A;  4QF9 A;  1CE2 A;  3VLU A;  1Y4C A;  4XF5 A;  3VV5 A;  4QFP A;  2I49 A;  3LC8 A;  1XHY A;  1H3D A;  3BKI B;  5CM6 A;  4ISU A;  1T0K A;  1DSN A;  2P1S A;  2OBG A;  4KXP A;  3MZ9 A;  4H8I A;  4PFB A;  1SI0 A;  1MQJ A;  3F11 A;  5CRY A;  1A54 A;  3M3F A;  1MM6 A;  1B1H A;  4KQP A;  2Q9T A;  2D5W A;  3S4U A;  5AA2 D;  2Q8M A;  4N91 A;  4HE2 A;  1ELJ A;  4L17 A;  3K6V A;  4XKN A;  3SKP A;  2ZYM A;  1B7U A;  4POW A;  3B7D A;  4R74 A;  3IJO B;  4BDQ A;  3IL1 B;  3V8X B;  5DVJ A;  1LBB A;  4OFL A;  3EPE A;  2OWS A;  5KCJ A;  4C0R A;  2YLN A;  1PEB A;  3QAX A;  4QFN A;  4FAJ A;  4N6P A;  4XKQ A;  4MHF A;  1OMP A;  3UIF A;  4EF2 A;  1N3W A;  3H7M A;  3E78 A;  1URG A;  3QXM A;  1FQF A;  5I5P A;  1VFE A;  1QVS A;  2V25 A;  4NF6 A;  4X1B A;  2V3U A;  5KCJ B;  2NXO A;  4R6Y A;  1BIY A;  4G8H A;  4NTL A;  3TTM A;  5T3J A;  1NV3 A;  2AIX A;  4P8B A;  4GWO A;  2ZZX A;  4OAN A;  2FNC A;  1IZ1 A;  1MDP 1;  2F7B A;  1USY E;  3MUQ A;  3KBR A;  3VLV A;  3BBR A;  4X04 A;  2HAV A;  5B7D A;  2D3I A;  1XI6 A;  2XWO A;  1BTJ A;  2Z22 A;  3FXQ A;  2IA4 A;  2HCA A;  2PFY A;  3BIG A;  4N4U A;  4EQ7 A;  2UYE A;  1LBY A;  3PD9 A;  1NMU A;  1OLC A;  1FTM A;  4ESX A;  1FBD A;  4H6D A;  3L6G A;  3DM0 A;  3V5A A;  2PVU A;  4H1X A;  4H65 A;  1RKM A;  4U4S A;  4QBA A;  2ZZW A;  3L6H A;  2HXW A;  1GR2 A;  3TQW A;  1IXH A;  4KPT A;  3HST A;  2VGQ A;  1GGG A;  2XXQ A;  2Q2A A;  4KR5 A;  1ANF A;  3PPQ A;  4RXL A;  3R7X A;  1Q1K A;  1LEV A;  1S7Y A;  1FTO A;  3KG2 A;  4U23 A;  2PFZ A;  3GBB A;  3RUM A;  2Y7I A;  2OK2 A;  3IJX B;  4H45 A;  1B1X A;  2ZNT A;  2I4B A;  1VSO A;  4GWX A;  1B0L A;  3PPN A;  3T9H B;  4P47 A;  3N6U A;  5M2V A;  2IEE A;  5CMK A;  4R9F A;  1FJ6 A;  1FJ9 A;  3O29 A;  4O3C A;  2M8C A;  1RYX A;  2DVZ A;  3IX1 A;  1NKX A;  3IO6 A;  4F1V A;  3K2D A;  2Q2C A;  3FXB A;  2RIN A;  1B9J A;  2V84 A;  3NOH A;  1TXF A;  4NF8 A;  3RN8 A;  1B3L A;  4GQO A;  1MY3 A;  3CSG A;  3EQ1 A;  3LBS A;  3VVE A;  1A8E A;  4QFL A;  1MY4 A;  1YPN A;  4PQJ A;  1B0H A;  2D21 A;  2LAO A;  4MFI A;  1LCT A;  5IAI A;  1L5T A;  5H8N A;  5CMM A;  3OO7 A;  3CFX A;  2B65 A;  4JVI A;  2B4L A;  1P1O A;  3O66 A;  1QJM A;  3Q29 A;  3SEW A;  3HN0 A;  2XXK A;  4NF8 B;  3KJ7 A;  1IXG A;  2X7P A;  3GYY A;  4OXV A;  3TYH A;  1M5C A;  2DQV A;  3BIH A;  2VPO A;  3ZKK A;  1SW1 A;  3G7W A;  3PUZ E;  2F7C A;  1R9L A;  3N5L A;  5H8N B;  4OEV A;  4AB5 A;  3BFT A;  4NWC A;  2QPQ A;  4LZ5 A;  1NV7 A;  1I6A A;  2XXR A;  1RDZ A;  1NUW A;  3MVZ A;  1AIV A;  2RC7 A;  3LUY A;  3VVF A;  3ODB A;  5I58 A;  1H45 A;  1WVJ A;  2H25 A;  4IB2 A;  3LSF B;  1MH4 A;  2UVJ A;  3R6U A;  1MXX A;  1UTH A;  4OQO A;  2HHM A;  1LB9 A;  3E9X A;  3TEL A;  1IME A;  4PF8 A;  4NF4 A;  4JB7 A;  2F5X A;  1NUY A;  1SW4 A;  4NAP A;  4OVT A;  2DDK A;  2XXI A;  1B4H A;  3MP8 A;  5F7V A;  2VP1 A;  5H8H A;  3RY3 A;  4P11 A;  2UYF A;  5ISU A;  5I58 B;  2R8T A;  2DWJ A;  1D3K A;  2NVU B;  2WBD A;  4NF5 A;  1IIT A;  4LUB A;  1IEJ A;  5CBR A;  1UTH B;  5LTC A;  4PDH A;  4EF1 A;  3IB2 A;  1Y20 A;  3E13 X;  4NF4 B;  3KN3 A;  2I58 A;  5TU0 A;  2REJ A;  2ZNU A;  3IR1 A;  1FPK A;  3PD8 A;  5H8H B;  4XKP A;  3TKD A;  1NV2 A;  5LDZ A;  1J1N A;  4JVC A;  1NNP A;  3CG1 A;  1IUD A;  1B5J A;  4NF5 B;  1B3E A;  3O97 A;  1MXW A;  2ONK E;  1SW5 A;  2WYP A;  1FQB A;  2QRY A;  4GFR A;  1HSE A;  3CG3 A;  3QYT A;  5AA3 A;  2WBB A;  3CVG A;  1EYI A;  1MPC A;  2FBP A;  1LFI A;  3G3J A;  2WKY A;  1EZ9 A;  2H9B A;  1IQ7 A;  3T9U A;  1NL5 A;  4P3L A;  1B3H A;  4GX3 A;  1MS7 A;  2DWH A;  4U2R A;  4I40 A;  1URD A;  1O63 A;  1VR5 A;  2QS2 A;  2PCR A;  1D4N A;  2R71 A;  2Z8D A;  4ZE9 A;  1OVB A;  3ZKL A;  2FVZ A;  4QFK A;  3M8U A;  3ROJ A;  3SDF A;  4U1Z A;  1PB7 A;  5DTB A;  4X48 A;  1FBG A;  1JEU A;  1M5E A;  2YPN A;  3IOR A;  3TAJ A;  2H99 A;  3IOV A;  1H44 A;  4X1D A;  3ZS6 A;  4HS7 A;  1DK4 A;  4MF3 A;  1A7L A;  4G2Z A;  3UOR A;  3OXN A;  4FAT A;  3S9E A;  4TLM B;  5DVF A;  3N26 A;  4HW8 A;  3H4Z A;  1KWH A;  2Y7P A;  1LAH E;  4BDM A;  1NNK A;  3H6W A;  2HQ0 A;  1DOT A;  1JW1 A;  2QMW A;  2XXW A;  4N8G A;  4G77 A;  1MY2 A;  4TQU Q;  3B6T A;  4ESW A;  1EU8 A;  4H67 A;  4OYV A;  1N84 A;  2P0S A;  1BP5 A;  1JET A;  4F2Q A;  5I57 A;  3QUF A;  5EYG A;  1PB9 A;  1SW2 A;  1II5 A;  1SYH A;  4GWU A;  5I2N A;  4QFO A;  4IY6 A;  3LSW A;  3RT8 A;  1MPD A;  3GZG A;  4JVD A;  4ZEB A;  4MLV A;  3RLF E;  3CRB A;  3IB0 A;  3IB1 A;  1N76 A;  4I9D A;  4PGP A;  1K9Z A;  1GV8 A;  5I57 B;  3CR9 A;  1Q35 A;  1S9T A;  4LQ5 A;  1MXV A;  2F78 A;  2RCB A;  2F36 A;  2QJE A;  5I84 A;  5IKB A;  2KQZ A;  4KFQ A;  1XT8 A;  1LCF A;  3G3G A;  4LVQ A;  1TWY A;  1S50 A;  2XWK A;  4MX6 A;  1JEV A;  1OIB A;  3T96 B;  4NMY A;  3H6U A;  2THI A;  5KDT A;  1I69 A;  1FCK A;  3DP8 A;  2XHD A;  4FIM A;  3OEL A;  4AB6 A;  3O2A A;  4O7M A;  4UA8 A;  4F22 A;  2R9J A;  2VD2 A;  3T0J A;  4OET A;  1QUK A;  4WED A;  2PBW A;  4HE1 A;  4F1Y A;  1IMC A;  4DI3 D;  3EHS A;  4Z7E A;  1B32 A;  4PFI A;  5KDT B;  3GXA A;  4M4G A;  4MMP A;  2A5S A;  1DPP A;  1FPF A;  4PFU A;  2CZH A;  5BUU A;  3IO4 A;  1FBH A;  3HCQ A;  3MBP A;  4O3B A;  4RK9 A;  1JP4 A;  3IFC A;  3T9V A;  4MBP A;  1NI9 A;  4KYE A;  2B3F A;  4IO2 A;  4MCO A;  3PUX E;  1M5B A;  1LGB C;  3C34 A;  5FTH A;  1FSA A;  1UIV A;  3OOA A;  4GL8 A;  1RDX A;  1FPL A;  4KI0 E;  3M3K A;  4R9G A;  4LN5 A;  1LLS A;  3H06 B;  2F35 A;  4NE4 A;  2FIX A;  4R73 A;  3USD A;  1P99 A;  3FJM A;  4X8R A;  3WAF A;  1JQF A;  1NFT A;  1NV4 A;  1EZO A;  5L9M A;  1ZTY A;  2CEY A;  5J16 A;  3QMF A;  2Z8F A;  4GWY A;  5FHO A;  4Q0C A;  2Q89 A;  5HM4 B;  4GXA A;  3O6G A;  3FAT A;  4I3Y A;  4PAF A;  3IOT A;  3PMW A;  4E0X A;  2F8D A;  4FJP A;  5L9S A;  5EYF A;  2UXA A;  2OZZ A;  3TCH A;  4XFE A;  3A29 A;  3FVO A;  5DYH A;  5H8Q A;  1YTV A;  1Y9U A;  4G68 C;  1N04 A;  2VOZ A;  4MAG A;  4M1V A;  1LB8 A;  4FBP A;  4LA9 A;  4F31 B;  4KHZ E;  5HPQ A;  2QVU A;  4NN3 A;  2P3N A;  3GLB A;  3JV9 A;  2O1L A;  4MIJ A;  1FPI A;  1B3G A;  4THI A;  4ZZE A;  3MVX A;  3EHT A;  1NV1 A;  1UTB A;  4JXI A;  4NF6 B;  1IIW A;  3ONM A;  4FEC A;  4DDD A;  2R6G E;  1EYK A;  2V3Q A;  3MYU A;  4RNS A;  3M3L A;  2ONR A;  3CFZ A;  5H8Q B;  3KOT A;  3LV0 A;  4ZEI A;  4JSD A;  1YCJ A;  1TFD A;  4DCY A;  1ZKB A;  3SER A;  3ZSF A;  4OFJ A;  4FED A;  3RQT A;  3PPR A;  5CMC A;  2XD2 A;  2V4C A;  5HBC A;  4PF6 A;  1I6Q A;  1UTB B;  2CZL A;  4TLL B;  1B5H A;  4H5F A;  2F6G A;  3K0V A;  4PBH A;  4EDP A;  4MLQ A;  3W15 C;  2XD3 A;  3OO9 A;  5LOM A;  4GF8 A;  3K6X A;  1LST A;  3TCF A;  2OWT A;  4GX6 A;  2OX3 A;  4I1D A;  3CSB A;  4O3A A;  3MPL A;  4OFO A;  1ATG A;  3B50 A;  4PAI A;  1GTK A;  3TTN A;  4PP0 A;  4OA4 A;  5EQA A;  3FAS A;  3HV1 A;  5DEX A;  5ET5 A;  1N7W A;  2UVG A;  1PDA A;  1IXI A;  4GWZ A;  3SEU A;  3H6T A;  1FPG A;  1Z7M E;  2ANJ A;  1KA1 A;  1FBE A;  4N17 A;  3FJ7 A;  3I6V A;  3PUV E;  3TFL A;  1FBP A;  4E0W A;  5AE4 A;  5ITO A;  2DS9 A;  5DW8 A;  3OEK A;  1MXY A;  3UK4 A;  2AYS A;  3H6V A;  1DTG A;  4IO3 A;  1UQW A;  5A5X A;  2G29 A;  3FJG A;  5DEX B;  4OVS A;  5F24 A;  1D9Q A;  3MW0 A;  1SVX B;  4ZZA A;  3QSL A;  2QMX A;  4K3F A;  3MWB A;  4QSD A;  1P1N A;  4AQ4 A;  4YAH X;  1LBZ A;  2RF1 A;  5FHN A;  3C32 A;  1CNQ A;  4PDD A;  4YB7 A;  2RC9 A;  2QL3 A;  4PGN A;  1YXI A;  5A5X B;  3RGY A;  2Z23 A;  1DCU A;  3PU5 A;  1YYZ A;  4GIZ A;  2F3B A;  1AWB A;  3S9N C;  5EQ8 A;  1B05 A;  4NX1 A;  4PFY A;  3JZJ A;  3ILU B;  4NGU A;  1IMB A;  4YKJ A;  4JBZ A;  4ZEF A;  5ET7 A;  2QS1 A;  3FZV A;  3PUW E;  5ESY A;  3FXR A;  1Y3Q A;  3D4C A;  3U92 A;  2XX7 A;  4QXD A;  1XOC A;  2GHB A;  4R75 A;  3CHG A;  3FBP A;  4IR8 A;  4HCY A;  2NWJ A;  4GL0 A;  3V83 A;  2PX1 A;  2RC8 A;  3PMX A;  2XXP A;  1QUI A;  3VFJ A;  1MM7 A;  5ICQ A;  4OVR A;  5AA4 A;  4ECF A;  2Y5L A;  4HCW A;  3QUJ A;  4DLD A;  1QGX A;  3UA8 A;  2XX9 A;  2GRV A;  3LSX A;  3S9L C;  3KC0 A;  4DXC A;  4O8M A;  3W9V A;  5ITP A;  4BLA A;  5I56 A;  3DLN A;  1NUX A;  1ZJL A;  3CIJ A;  2KLF A;  3TTR A;  3IFA A;  4PET A;  3RT6 B;  1PB8 A;  3KSX A;  3C33 A;  1MH3 A;  1ZBM A;  4RK2 A;  4OES A;  1UIU A;  3FGS A;  3K6W A;  2DE2 A;  1KZ8 A;  1LBC A;  1MQD A;  4X9T A;  4PCD A;  1YAE A;  3OSQ A;  4H46 A;  4YKP A;  3E4R A;  5L9O A;  1IXC A;  4GD5 A;  5I56 B;  3CFL A;  4YZZ A;  4LAT A;  3K4U A;  5EQ7 A;  3C9H A;  5FHM A;  3C35 A;  5J1D A;  4P9K A;  2G93 A;  3U93 A;  3RYD A;  5ET8 A;  3MVY A;  4TOZ A;  3LSL A;  2F7A A;  1B51 A;  1JW4 A;  3N94 A;  4C1U A;  4N07 A;  4DZ1 A;  4Q30 B;  2Y7W A;  3D4G A;  2O7I A;  3PPO A;  1NV0 A;  1SBP A;  4WKM A;  3T66 A;  2NUV A;  2Y7K A;  2DYX A;  2QSX A;  4N6D A;  1FPD A;  2VT5 A;  3A09 A;  2DWI A;  2PYY A;  5CMB A;  3A3C A;  2DP8 A;  3Q26 A;  3HO7 A;  1A55 A;  4F3P A;  2I6E A;  4PAK A;  3H03 A;  2I0B A;  2AL4 A;  1B5I A;  4PFR A;  3WAE A;  4UAC A;  1M5F A;  2ZMB A;  1WDN A;  3K00 A;  4AS5 A;  3O9P A;  3C31 A;  5A5L A;  3CI8 A;  1HSJ A;  2BJJ X;  2PMS A;  2HPG A;  1G0H A;  2CZI A;  5CBS A;  1MQH A;  1I6B A;  5FBP A;  3MQ9 A;  2WEF A;  3TZA A;  3T9X B;  4U21 A;  1FTJ A;  5AA2 A;  1FRP A;  3D1R A;  1MQI A;  3EKI A;  5L8D A;  4HTG A;  4N8Y A;  5AA1 A;  5I7I A;  2Y5K A;  2ZZV A;  4XEQ A;  1MQG A;  1TT1 A;  4YKK A;  4G68 A;  3T93 B;  4LP2 B;  4U22 A;  1Q9D A;  3K01 A;  4OTE A;  3SES A;  1YZ0 A;  1RDY A;  4QSC A;  3E3K A;  2ESN A;  4F2O A;  3MZB A;  1AH5 A;  4OVP A;  4BDL A;  3KBZ A;  3N6T A;  3FIR A;  2DVC A;  4IO6 A;  2YJP A;  2ONS A;  3KFM A;  4MH5 A;  3O6I A;  2F97 A;  4G8M A;  3G3H A;  4POX A;  2P2A A;  1OQH A;  4RJZ A;  1LFH A;  1BLF A;  5AA2 B;  2OCU A;  3TQL A;  4I8C A;  1MY0 A;  1USY H;  3MST A;  3MP1 A;  4XTC Q;  5I2N B;  3FVK A;  4YMA A;  1BK4 A;  1SDX A;  1EH3 A;  2H4I A;  4YB6 A;  4F3B A;  2ALU A;  4G68 B;  4DI4 B;  4P1E A;  4R2F A;  2PT2 A;  1H43 A;  4ZDM A;  3HHG A;  1SPI A;  1XC1 A;  1US4 A;  1IMF A;  2E0S A;  3TUS A;  4FOR A;  3VLW A;  4YB5 A;  4RPO A;  5I3S A;  4ZE8 A;  1HSL A;  3G3F A;  4R6H A;  2VHA A;  1Y3P A;  3K02 A;  4PFW A;  4GX4 A;  2CZK A;  3E79 A;  2XXV A;  1FBF A;  2DXY A;  4NED A;  1K9Y A;  3KEI A;  3VDF A;  3KN8 A;  2Y84 A;  2REG A;  2ZYN A;  3B8B A;  4WXJ A;  4JWX A;  4QHQ A;  3K1M A;  2GHA A;  5IZ1 A;  1B46 A;  4RPN A;  5IZZ A;  2JJK A;  1OVT A;  1Y1Z A;  1ZU0 A;  4LON B;  2Y7R A;  1MXZ A;  3GBA A;  4Q8R A;  4OZ9 A;  4G61 A;  5KZT A;  1OLA A;  4YMB A;  1N7X A;  1RYO A;  5H8F A;  5EYH A;  3U65 A;  2UVI A;  4IGT A;  2QS3 A;  2OJT A;  1LBX A;  1FW0 A;  3TTL A;  4N6K A;  2XXY A;  4PTK A;  2MKZ A;  2XWV A;  1Z7N E;  2XX8 A;  2I48 A;  5H8F B;  4JSO A;  2O68 A;  3PPP A;  4H0W A;  1CB6 A;  2H98 A;  1AMF A;  3G3I A;  3HPI A;  2XWI A;  3EHU A;  3K1N A;  4QSE A;  3ECR A;  3SEV A;  4PE3 A;  1FBC A;  4AS4 A;  3OO6 A;  3K6U A;  4WEP A;  1B4Z A;  1DMB A;  3O28 A;  1OQG A;  4MNC A;  4XIG Q;  1SI1 A;  3VXC A;  1FPJ A;  1B40 A;  2AL5 A;  4ZEK A;  3U1O A;  1VFD A;  3Q28 A;  2QVR A;  3KOS A;  3MZ1 A;  2O69 A;  3OEM A;  1XS5 A;  1FQA A;  1MY1 A;  1DTZ A;  2O6A A;  5CI5 A;  2HEU A;  2HZL A;  3VXB A;  3S2V A;  1P1Q A;  3TCG A;  2OWZ A;  4GOT A;  2WYK A;  4BDN A;  4NQ8 A;  3FD3 A;  4PFT A;  2XXU A;  1POY 1;  3HFU A;  3SEX A;  5K2X A;  1NNT A;  1LAG E;  1VDW A;  1SQY A;  2I0C A;  2QFL A;  3G3K A;  4N15 A;  2HFB A;  4DIG A;  2FHY A;  4QRZ A;  4P0I A;  4JDF A;  1SD3 A;  4OER A;  2P3V A; 
#chains in the Genus database with same CATH homology
 1DK4 A;  4KXP A;  4QXD A;  3CHG A;  4PFB A;  3FBP A;  4IR8 A;  4HCY A;  2XA5 A;  4NHB A;  2FIE A;  4N81 A;  2Q9T A;  2DE3 A;  2Q8M A;  4N91 A;  4OVR A;  4HE2 A;  2Y5L A;  4HCW A;  4N8G A;  1QGX A;  2VPN A;  1FPE A;  3KC0 A;  4O8M A;  3W9V A;  1NUX A;  2HXR A;  5EYG A;  3IFA A;  4PET A;  4GWU A;  2DE2 A;  1KZ8 A;  4JVD A;  4MHF A;  4X9T A;  4PCD A;  4H46 A;  1FPB A;  3E78 A;  4NG7 A;  4PGP A;  1K9Z A;  4YZZ A;  5I5P A;  5EQ7 A;  5J1D A;  2BJI A;  4P9K A;  3RYD A;  5ET8 A;  1DBZ A;  2KQZ A;  5T3J A;  1NV3 A;  4P8B A;  2GQ1 A;  2XWK A;  4MX6 A;  4MJO A;  2ZZX A;  4OVQ A;  4OAN A;  1NV0 A;  4X04 A;  1XI6 A;  2XWO A;  4N6D A;  1FPD A;  2VT5 A;  4O7M A;  2PFY A;  3BIG A;  4N4U A;  1LBY A;  4O7I A;  4UAB A;  1FBD A;  3T0J A;  4PBQ A;  1IMD A;  2QVV A;  4HE1 A;  1IMC A;  4PAK A;  4QBA A;  2ZZW A;  4DI3 D;  4PFR A;  1INP A;  4PC9 A;  4PFI A;  5IM2 A;  3KC1 A;  4MMP A;  4AS5 A;  5A5L A;  1FPF A;  2CZH A;  2Q74 A;  2HPG A;  2WX9 A;  1G0H A;  2CZI A;  4GWW A;  1LEV A;  1FBH A;  5FBP A;  1JP4 A;  3IFC A;  2PFZ A;  2WEF A;  1NI9 A;  2B4M A;  4H45 A;  4MCO A;  2DE4 A;  1FSA A;  1FRP A;  3D1R A;  4GWX A;  3EKI A;  1RDX A;  1FPL A;  4LN5 A;  4N8Y A;  1LBV A;  2KR0 A;  4P47 A;  2FIX A;  5I7I A;  2Y5K A;  2ZZV A;  4XEQ A;  4X8R A;  1FJ6 A;  1FJ9 A;  2DVZ A;  1NV4 A;  1Q9D A;  2CEY A;  4F1V A;  5J16 A;  3QMF A;  1YZ0 A;  1RDY A;  3FXB A;  4GWY A;  3NOH A;  4OVP A;  3KBZ A;  3LUZ A;  4I3Y A;  4PAF A;  4O94 A;  3MST A;  4XFE A;  3A29 A;  1BK4 A;  4MAG A;  4DI4 B;  2L5V A;  4M1V A;  4P1E A;  4FBP A;  5IZ3 A;  3PTY A;  4F1U A;  3SZP A;  4JVI A;  2B4L A;  3ISP A;  2QVU A;  4NN3 A;  2P3N A;  2XXK A;  4MIJ A;  1FPI A;  1SPI A;  3GYY A;  1IMF A;  1NV1 A;  1NUZ A;  3BIH A;  4I3E A;  5I3S A;  2VPO A;  1FTA A;  1EYK A;  2V3Q A;  3MYU A;  3RPL A;  4F18 A;  4GX4 A;  3LV0 A;  2QPQ A;  2CZK A;  3E79 A;  4MNI A;  5IZ3 B;  1NV7 A;  1FBF A;  5ET6 A;  1RDZ A;  4GBV A;  1NV6 A;  1NUW A;  4GWS A;  1K9Y A;  3B8B A;  1LBW A;  2V4C A;  4NF0 A;  5IZ1 A;  4PF6 A;  4MNP A;  5IZZ A;  2JJK A;  1EYJ A;  4MEV A;  4PBH A;  3RPL B;  4G61 A;  1IMA A;  2HHM A;  1IME A;  4PF8 A;  5EYH A;  4GX6 A;  2OX3 A;  3U65 A;  2HZK A;  2F5X A;  1NUY A;  3B50 A;  4NAP A;  4OVT A;  4PAI A;  2DDK A;  1LBX A;  4OA4 A;  5JK4 A;  5EQA A;  2CEX A;  4N6K A;  5ET5 A;  2R8T A;  4GWZ A;  4PTK A;  2WBD A;  2MKZ A;  1FPG A;  5LTC A;  2XWV A;  4PDH A;  1KA1 A;  1FBE A;  4N17 A;  1FBP A;  4GBW A;  2XWI A;  1G0I A;  4HE0 A;  1FPK A;  5DW8 A;  4PE3 A;  1FBC A;  1NV5 A;  4AS4 A;  1NV2 A;  5LDZ A;  4P56 A;  4JVC A;  4OVS A;  5F24 A;  4MNC A;  3T1B A;  1D9Q A;  1FPJ A;  2WYP A;  4HXV A;  2WBB A;  1EYI A;  2F3D A;  1LBZ A;  2QVR A;  2FBP A;  3W9W A;  1CNQ A;  4P3L A;  4GX3 A;  1KA0 A;  4PDD A;  2HZL A;  4P1L A;  5IGA A;  4PGN A;  4I40 A;  1YXI A;  4YIC A;  2OWZ A;  1DCU A;  4F19 A;  2WYK A;  5EQ9 A;  1YYZ A;  2PCR A;  4NQ8 A;  2F3B A;  2FVZ A;  1AWB A;  5EQ8 A;  3ROJ A;  3HFU A;  4NX1 A;  4XF5 A;  1FBG A;  4NGU A;  1IMB A;  1VDW A;  2QFL A;  4N15 A;  5ET7 A;  5CM6 A;  2FHY A;  5ESY A;  2P3V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...