3IO6A

Huntingtin amino-terminal region with 17 gln residues - crystal c92-a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
416
structure length
400
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQPPPPPPPPPPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein, HUNTINGTIN FUSION PROTE
publication title Secondary structure of Huntingtin amino-terminal region.
pubmed doi rcsb
source organism Escherichia coli k-12, homo sapiens
molecule tags Signaling protein
total genus 116
structure length 400
sequence length 416
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3io6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3io6A02
1LAGE 3TTKA 1ZU0A 1UQWA 4R75A 2DVZA 2Z8DA 4XIGQ 4BDQA 3OSRA 1QULA 3LR1A 4DCXA 1FTLA 3KJ7A 3B6QA 5I2NB 1H3DA 4OHNA 4Z0IA 3RY3A 4G4PA 1GV8A 5H8QB 3V89B 2HEUA 2H98A 4FE8A 1DSNA 3CI8A 1T0KA 4K3FA 4ELQA 1B5IA 4ZS9A 3I5OA 1Z7ME 4FORA 4RJZA 1MY1A 3H6WA 2VHAA 2I0BA 3DELB 3PGFA 3Q29A 4DXBA 1OVBA 4F19A 2BJJX 4ESXA 1B51A 1NKXA 4FIMA 2FNCA 4DIGA 2ONRA 4AB6A 4LQ5A 4H65A 5I2NA 5CRYA 1B6HA 4KQPA 4KHZE 2DE3A 1WVJA 1DPEA 2DXYA 2XXUA 1I6QA 4P0GA 4H8JA 1AIVA 4GLIA 5H8QA 4O3CA 4ESWA 3IX1A 3VXCA 3WAEA 1B3HA 3VFJA 4OWDA 3FJ7A 2B3BA 1LFIA 4N07A 3H6VA 2RINA 4NMYA 1SQYA 1FQAA 1OLCA 2QS3A 3TPAA 4DLDA 2XXXA 4LONB 2UVGA 4R9GA 4MBPA 4OXVA 1B7ZA 1TWYA 3OEMA 3VLWA 3M3FA 3TTRA 3IB1A 2F7BA 1P1OA 2Q2CA 1MPBA 2LAOA 3KBRA 2HAVA 3N5LA 4IO7A 1TT1A 4YZZA 3S9MC 3MVWA 3H06B 5H8FB 4FEBA 1O64A 3HO7A 1JVXA 3BFTA 3SEUA 1N7XA 2IEEA 1EZPA 4RPNA 4GOTA 1FCKA 3VVEA 3MPKA 1PBPA 4OESA 1B4HA 5FTIA 3G3HA 4F2QA 3A09A 3FV2A 1H43A 3JV9A 3U72A 4U1ZA 1MH4A 4X1BA 3MVXA 4FJPA 1PEBA 2THIA 5JK4A 1B0HA 3H7MA 1CE2A 4ZZAA 2F6GA 5I84A 1MY3A 1JW4A 2F35A 3RT8A 1B5JA 1FW0A 4EF1A 4RK9A 5H8FA 3VVDA 2R71A 3K02A 1PB9A 4DDDA 2HQ0A 1S50A 2DSFA 1ZTYA 1B52A 4EXKA 4R6YA 3KOSA 4N6PA 4IO4A 1XVXA 2OBGA 4ZZEA 2KLFA 3QUJA 1Y4TA 4H5GA 5H8NB 2RC8A 4QSEA 3CRBA 4HCWA 2Z8FA 5IAIA 5TP9B 3Q27A 1KWHA 4X48A 3EPEA 5K2YA 3EF7A 3C36A 2OCUA 1MM7A 5ITOA 4WKMA 1A99A 3F11A 1IIWA 3B7DA 3T9VA 3VLVA 1QKBA 3CG3A 4M4GA 2ANJA 1MPCA 5H8HB 5CBSA 3T66A 4F3PA 5ELVA 1M5DA 2O6AA 2V3UA 5L9MA 2UYEA 4G2ZA 3HPIA 1SBPA 3B6WA 2XX7A 3CG1A 1S9TA 2B65A 2QS2A 2DS9A 5H8NA 1NH7A 5HM4B 1H44A 1VR5A 5TP9A 5DT6A 1B3FA 4KFQA 1IUDA 3N26A 3TCHA 2OZZA 3R6UA 3FVNA 4UACA 3MP6A 3FXRA 3TYHA 3FJGA 2DWAA 4TQUQ 1BP5A 1LAXA 1NNPA 3PPPA 5AA4B 3TODA 3PPNA 2RF1A 3T93B 3OO8A 1L5TA 2Q88A 5H8HA 5JTYB 2ZNSA 4ZE9A 2NVUB 4EUOA 1POY1 1A8EA 2PT1A 3IB0A 3UGWA 1URSA 4RA1A 4OERA 1QUIA 3FXQA 2P1SA 2DE2A 3PU5A 4HTGA 3IAZA 4YAHX 4ND9A 3MVZA 1D9VA 4R73A 5ISUA 2Z22A 3KGCA 4F22A 4BDLA 5DYHA 2ZXTA 4H0WA 2UVJA 3T22A 4POWA 5AA4A 3KFMA 1A40A 1ZKBA 2XXPA 4P0IA 3PPQA 2ZYKA 1PBQA 4EQ9A 3DP4A 4DXUA 2F7CA 2GFEA 4MLVA 1DTZA 3GXAA 3WAFA 5JTYA 3OD7A 3I6VA 1OIBA 2I4BA 4GL8A 3UA8A 3KJTA 2ZNUA 2WKYA 5K2XA 1A8FA 5TPAB 2QMXA 3MP8A 2QSXA 5EYFA 2X7PA 2Y7IA 2Y7KA 1POTA 4LQ2A 4XKRA 4IGTA 2I48A 3U94A 3PUYE 3HV1A 4QSCA 3IOTA 2CMOA 3TELA 4IO5A 1QJMA 2QRYA 4HS7A 4PETA 5J1DA 3MPLA 1JNFA 1US5A 3ZSFA 4LZ5A 1ANFA 4OFOA 1VSOA 1SDXA 4OEUA 1URDA 4GXAA 4Q30B 1LGBC 3TAJA 1YCJA 4TOZA 1QKAA 1MS7A 3MBPA 1NFTA 5TPAA 1TFDA 2A5TB 3TEPA 4EQBA 3FJMA 3K0VA 4HCYA 1Y20A 5FHMA 1IEJA 4F31B 1M5BA 4F3BA 3O6HA 1HSLA 4F1YA 1MQDA 4ISUA 3U92A 2ONKE 5AA2B 1EZ9A 3EHSA 3S4UA 3V5AA 4H5FA 3TTLA 4IO6A 1N3WA 1A55A 4E0XA 3MC2A 1N76A 1ZMGA 4HW8A 3CVGA 3VE1B 1AMFA 4GXSB 1YAEA 3DP8A 3IORA 2NOOA 1SVXB 3O6GA 5I58B 2R6GE 4ZEFA 2A5TA 3PUWE 5KZTA 3TTNA 3LBSA 3PUZE 3FUZA 3OO7A 4Z7EA 3R26A 4I9DA 3PPOA 3CSBA 1MQIA 2H99A 1NH8A 2VP1A 2UXAA 1TXFA 2HZKA 2YPNA 1LB8A 3IL1B 1SD3A 1SI0A 5AA2A 4R9FA 2F5XA 2AL5A 4QFNA 1B3GA 2ONSA 2AIXA 4MLQA 2QPQA 3QAXA 1LFGA 1US4A 1GVCA 1ZIUA 4O3BA 3UP9A 2D5WA 4O3AA 5I58A 3KN8A 3L6HA 4G68B 5CMBA 1NNKA 4RNSA 3S9EA 3M3KA 2ZYOA 2Y84A 3QXMA 3BKIB 1MY0A 1DOTA 4MFIA 3DP6A 2H5YA 4F3GA 3THIA 1P99A 4QF9A 1SW5A 2O51A 3MVYA 2PVUA 2NWJA 2HFBA 4LP2B 1PC3A 4GVOA 1VFDA 4U21A 3RTFB 2GRVA 4IO2A 4YB5A 4GL0A 4OTEA 2UYFA 4UA8A 3DLNA 1OQHA 3M8UA 1Z7NE 3PD8A 1QUKA 4I1DA 3BFUA 2DWIA 1B3EA 4G68A 3MP1A 4OVJA 3TCGA 4BDMA 3OO6A 1XHYA 3MJNA 2Q89A 3QK6A 1SW4A 1JW1A 1NMUA 2DWJA 3U8QA 1MQHA 4GWOA 1MXWA 3OSQA 3K6XA 1LAFE 1TFAA 3T9XB 1N0TA 1ZLQA 2PMSA 3O29A 3K2DA 4M1VA 3G7WA 3RTWB 1BTJA 3IO6A 2E1SA 3KSJA 4BDNA 2O69A 2E0SA 5TU0A 4JWOA 5B7DA 1I6AA 4QFKA 3O97A 3PV0E 1OVTA 2AYSA 4F2OA 3B6TA 2IA4A 1FQDA 1MXVA 3RLFE 3O6IA 4Q5TA 2YJPA 4KCDA 4R2FA 3LSXA 4E0WA 2XHDA 1OQGA 1Y1MA 4H6DA 3RUMA 4KCCA 3TQLA 1XT8A 2V84A 3IO4A 3TDJA 3K6UA 2M8CA 3OENA 4I8CA 3KN3A 1IXGA 1FQCA 1B7HA 1N84A 4NWDA 5A5XB 3TZAA 4NF8B 3C4MA 1LCTA 3QYTA 1FTJA 4GD5A 4YB7A 5ICQA 4C1TA 1JQFA 4GFRA 3DM0A 3S9NC 1N04A 3KOTA 5L8DA 2F36A 3ZKLA 1XVYA 3K6VA 2VGQA 3FZVA 2Q9TA 3IOVA 3TFLA 4BLAA 4F18A 1MQJA 3CSGA 4LATA 4LA9A 2PX1A 3E9XA 4N13A 1URGA 5HPQA 3V8XB 2XXIA 4ZDMA 4MH5A 2HZLA 1VE4A 4FATA 2I49A 2DVCA 3FATA 1B3LA 5A5XA 2XD2A 3IJOB 2UVHA 4PFWA 1D9YA 4NF8A 4YKKA 2D21A 3ONMA 5L9OA 3K01A 4YICA 1JEUA 2X7QA 4WXJA 4ZECA 4U22A 1ELJA 5FHNA 1QW0A 2RCBA 2QS1A 1Y9UA 2F7AA 3C9HA 2G29A 4QFPA 2O84X 3Q26A 1SYIA 4TLLB 3IJXB 3M3LA 4L17A 3SKPA 1RKMA 5IKBA 5DEXB 5AE4A 3AXFA 1SW1A 3U93A 4R72A 3EQ1A 4JDFA 5I57B 3E4RA 5ITPA 2OLBA 5M2VA 1MXUA 3OMBA 4H67A 3KG2A 1M5FA 4GF8A 3TTMA 3LSFB 2XXVA 2F34A 1MDQA 2QMWA 4QHQA 1B0LA 2XXYA 3KN7A 1UTBB 4QRZA 2QS4A 1SW2A 2I58A 4ONYA 2O7UA 2HAUA 3IOUA 4JWXA 2PYYA 3UK4A 2O1MA 4IY5A 3MAMA 2ZMBA 1P1NA 3K1PA 2DOJA 3FVKA 4ELRA 2NXOA 4H8IA 3RPWA 2PT2A 3T96B 1BIYA 5DEXA 1LSTA 1DPPA 1B5HA 3OXNA 2I3VA 1OMPA 5CMKA 1A54A 3ECRA 5I57A 4Q0CA 2GHAA 3OEKA 4NWCA 2XX9A 3FVOA 3P7IA 3PUXE 3RT6B 1QVSA 3S9LC 5DVFA 1JEVA 2P2AA 1N3XA 2OWTA 1WDNA 2QL3A 3TMGA 1UTBA 4PFYA 3HCQA 1I6BA 3C34A 1RYOA 3PMWA 4FECA 4KR5A 1EU8A 3HHFA 1MM6A 2O7IA 2Z23A 2DE4A 3K6WA 3W9VA 3FGSA 4JSOA 2ALUA 4GIZA 4XXUA 3O9PA 1NNFA 4GRKA 2R9JA 1JETA 1P1WA 1YTVA 3G3GA 3SERA 3PMXA 3G3JA 3D4CA 4GQOA 1MXXA 1ZJLA 4JXIA 1LAHE 2W7YA 4THIA 5AA3A 4QFLA 2ZYMA 1B7UA 5KDTB 4H1XA 3PD9A 1B1XA 1GR2A 1P1QA 4G8NA 3MWBA 3TUSA 4F1UA 3VVFA 4OEVA 3HHGA 3VV5A 4G8HA 1JW5A 1R1NA 3IB2A 4OYVA 3G3IA 2DQVA 3ILUB 3N94A 4U4XA 1FTOA 4OETA 4YKIA 5BUUA 1O7TA 1JVYA 4C1UA 2XXTA 3SEVA 1M5CA 5CMCA 5CC2A 1M5EA 1GTKA 3LSWA 4F1VA 1GGGA 2YLNA 1SI1A 4PFUA 3FV1A 3GBAA 1OLAA 1NL5A 4G77A 3MZBA 2CZLA 2Y7PA 5KDTA 3T9UA 3W9WA 4P11A 4RYAA 3U1OA 2XD3A 5AA2D 3EHUA 3MZ9A 1D3KA 5BWJA 2GH9A 1EZOA 4ZEIA 3QSLA 4DZ1A 2Q2AA 2OJTA 2FYIA 4WEPA 1XOCA 3GLBA 5I59B 1EH3A 1USYE 1B46A 4G68C 3IOWA 1IZ1A 3N6UA 4KPTA 3G3KA 2P0SA 3W15C 1FQBA 4NEDA 2AL4A 3HN0A 1XS5A 4LZ7A 1Y3QA 1B9JA 1VFEA 1H76A 1UIUA 4QFOA 2I6EA 1XC1A 2UVIA 2DXRA 1DTGA 2ABHA 3CFXA 5AA1A 2GHBA 4U23A 1B32A 1LB9A 2H25A 3K1MA 4POXA 1PB7A 3H4ZA 2V93A 3PUVE 1HSJA 5ICTA 1CB6A 3KZGA 5F1QA 4F29A 3JZJA 1O63A 3FVGA 2REGA 1LLSA 5I59A 4F39A 4FAJA 2I3WA 3TKDA 2VD2A 3K4UA 2V3TA 4KI0E 3S2VA 2F8DA 3ZKKA 3KSXA 4YKJA 2HXWA 1MXYA 1IXHA 4OQOA 3E13X 1UIVA 3MQ9A 5I2KB 1I69A 3OOAA 4PQJA 2DYXA 3R7XA 3O66A 4LVQA 3SEWA 4BDRA 2OK2A 1MRPA 4FEDA 3HSTA 4TLMB 5EHSA 3CIJA 4U4SA 3VDFA 2RCAA 3K1NA 3C33A 2ESNA 3OELA 4PE5B 4QSDA 3I3VA 4YMBA 3USDA 4ZE8A 3GZGA 1B4ZA 2H9BA 3TQWA 2Q8JA 1PDAA 1A7LA 5KCJB 1MQGA 4X1DA 2PBWA 5DVJA 3Q25A 1Y4CA 4BDOA 4OZ9A 1FQEA 5I2KA 3BBRA 3RN8A 5DVIA 3CFZA 4EDPA 3KEIA 4U2RA 3PMVA 4WEDA 5H8SA 3ZS6A 1DMBA 2H4IA 1Q35A 4XKPA 1AL3A 3A3UA 3FIRA 4IGRA 4OFLA 2O1LA 3FASA 5CI5A 1ATGA 1Y3PA 2OWSA 4X9TA 3C32A 5FTHA 1MY2A 4LUBA 3OO9A 4G8MA 1MG1A 2XXHA 1AH5A 5KCJA 3MW0A 1MH3A 1R9QA 4RY1A 1IXCA 1II5A 3H03A 2DP8A 2O68A 3SESA 1AOVA 4LZ8A 3UORA 1BKAA 5CMMA 4JSDA 4OFJA 2F78A 4C0RA 2Y7WA 3EHTA 3SEYA 1PB8A 4XKQA 1IITA 4PFTA 3FD3A 3QIMA 4XTCQ 3RQTA 3RNNA 1QUJA 4YMAA 1UTHB 3LUYA 3K00A 1RYXA 2XXWA 3EN3A 1IQ7A 4U1OA 1FTKA 1USYH 2G93A 3H6TA 2DWHA 4NF6B 5JEIA 3SETA 3SEXA 2Z8EA 4ZEDA 4ZEBA 4JB7A 2HCAA 3RGYA 5B70A 2ZYNA 1FTMA 4NF4B 3MUQA 5LOMA 3CFLA 3GBBA 4IY6A 4ELOA 3C35A 1LBBA 1YPNA 3O2AA 4DE8A 1Q1KA 5L9SA 4ZEKA 4KYEA 2XXQA 1LCFA 3MZ1A 4NTLA 1Y1ZA 2F6PA 4I62A 4F3SA 4AQ4A 1WODA 2I0CA 1UTHA 1B05A 2XX8A 1NNTA 1P1UA 1F9BA 4YU0A 1FQFA 2I4CA 3H3GA 2V25A 4RXLA 4YB6A 3CR9A 4NF6A 3L6GA 5CM6A 4DXCA 4NF5B 3H6UA 5F7VA 2VD3A 2RC9A 4NF4A 1MPDA 4YKPA 3C31A 3VLUA 1MDP1 2XXRA 1LFHA 1R6ZA 2RC7A 1MXZA 4PP0A 2A5SA 1B1HA 2FA7A 4ECFA 3IR1A 3E3KA 3UN6A 1Y3NA 5I56B 4EXLA 4NE4A 3FXUA 3A3CA 3N6TA 2B3FA 4EF2A 4EQ7A 1S7YA 3IK6B 3ODBA 4KYSA 3T9HB 4IB2A 1J1NA 4RPOA 4KD5A 3PPRA 5HBCA 1ZBMA 3O28A 4Q8RA 4KYDA 1B58A 5EHMA 3Q28A 3D4GA 4NF5A 5DTBA 4ELPA 2D3IA 1LBCA 3LSLA 3QUFA 4DCYA 4R74A 4OENA 3SDFA 2X26A 1D4NA 3UIFA 1SYHA 2QJEA 4RK2A 4JBZA 1B40A 1MY4A 4R6HA 1IXIA 5FHOA 1HSEA 4R6KA 2Y7RA 2RKMA 4R2BA 2ZNTA 4IO3A 3JYRA 5I56A 4XKNA 3V83A 3G3FA 2NUVA 3VXBA 4MF3A 1R9LA 1N7WA 1H45A 2V3QA 3LC8A 4JWYA 2REJA 4AB5A 3ILTB 3TCFA 2VOZA 2F97A 1B2HA 4OMBA 1BLFA 5CBRA
chains in the Genus database with same CATH superfamily
1LBZA 1LAGE 4PDDA 3TTKA 1ZU0A 1UQWA 4R75A 2DVZA 2Z8DA 4XIGQ 4BDQA 3OSRA 3KBZA 1QULA 3LR1A 3KC1A 4DCXA 1FTLA 3KJ7A 3B6QA 5I2NB 1H3DA 4N81A 4O7MA 4OHNA 4Z0IA 1VDWA 3RY3A 4G4PA 1GV8A 3FXBA 5H8QB 3V89B 2HEUA 1FPGA 2H98A 4FE8A 1DSNA 1FTAA 3CI8A 1T0KA 4K3FA 4ELQA 5DW8A 1B5IA 4ZS9A 3I5OA 1Z7ME 4FORA 4RJZA 1MY1A 3H6WA 2VHAA 2I0BA 2PCRA 3DELB 3PGFA 3Q29A 4DXBA 4OVSA 1OVBA 4PCDA 4F19A 2BJJX 4ESXA 1B51A 1NKXA 4FIMA 2FNCA 4DIGA 2ONRA 4AB6A 4LQ5A 4H65A 5I2NA 5CRYA 1B6HA 4KQPA 4KHZE 2DE3A 1DPEA 1WVJA 2DXYA 2XXUA 1G0IA 1I6QA 2CZIA 4P0GA 4H8JA 1AIVA 4GLIA 5H8QA 2ZZWA 4O3CA 2HXRA 4ESWA 3IX1A 3VXCA 3WAEA 1B3HA 3VFJA 4OWDA 3FJ7A 2B3BA 1LFIA 4HE0A 4N07A 3H6VA 2RINA 4NMYA 1SQYA 4N6KA 1G0HA 1FQAA 1OLCA 2QS3A 4P1EA 3TPAA 4DLDA 4PFBA 2XXXA 4LONB 2UVGA 4R9GA 2R8TA 4MBPA 4OXVA 1B7ZA 1TWYA 4NN3A 1FPBA 4MHFA 2XA5A 3OEMA 3VLWA 3M3FA 4H46A 3TTRA 3IB1A 2F7BA 1P1OA 2Q2CA 2QVVA 1MPBA 3B50A 1RDXA 2LAOA 3KBRA 2HAVA 3N5LA 4PBHA 4IO7A 1TT1A 4YZZA 3S9MC 3MVWA 3H06B 5H8FB 4FEBA 1O64A 3HO7A 1JVXA 1EYKA 1CNQA 3BFTA 3SEUA 1N7XA 5ET7A 2IEEA 1EZPA 4RPNA 4GOTA 2WEFA 1FCKA 3VVEA 3MPKA 2Q8MA 5F24A 4P8BA 1PBPA 4OESA 1B4HA 1FPDA 5FTIA 3G3HA 4F2QA 3A09A 3FV2A 1H43A 3JV9A 3U72A 4IR8A 4U1ZA 1INPA 1MH4A 4X1BA 3MVXA 4FJPA 1PEBA 2THIA 5JK4A 1B0HA 2XWKA 4OVTA 3H7MA 1CE2A 4AS5A 4ZZAA 2F6GA 5I84A 1MY3A 1JW4A 2F35A 3RT8A 1B5JA 1FW0A 1NI9A 4EF1A 4RK9A 5H8FA 3VVDA 2R71A 3K02A 1PB9A 4DDDA 2HQ0A 1S50A 5I5PA 2DSFA 1ZTYA 1B52A 4EXKA 4R6YA 1K9YA 3KOSA 4N6PA 4IO4A 4OANA 1XVXA 2OBGA 1FPKA 3IFAA 4P1LA 2V4CA 4ZZEA 2KLFA 3QUJA 1Y4TA 4H5GA 4MMPA 5H8NB 2RC8A 4QSEA 3CRBA 4HCWA 2Z8FA 5IAIA 1YXIA 5TP9B 1FBHA 1FBPA 2KQZA 3Q27A 1KWHA 4PBQA 4X48A 3EPEA 5K2YA 3EF7A 3C36A 2OCUA 1FSAA 1FPIA 1MM7A 5ITOA 4WKMA 1A99A 3F11A 1IIWA 3B7DA 3T9VA 3VLVA 1QKBA 3CG3A 4M4GA 2ANJA 1MPCA 5H8HB 5CBSA 3T66A 4F3PA 5ELVA 1M5DA 2O6AA 1IMBA 2V3UA 5L9MA 2UYEA 4G2ZA 3HPIA 1SBPA 3B6WA 3D1RA 2XX7A 3CG1A 4LN5A 1S9TA 2B65A 2QS2A 2DS9A 5H8NA 1NH7A 5HM4B 1H44A 1KA1A 1VR5A 5TP9A 4N15A 5DT6A 1B3FA 4KFQA 1IUDA 3N26A 3QMFA 4PF6A 3TCHA 2OZZA 3R6UA 3FVNA 4UACA 3MP6A 3FXRA 3TYHA 3FJGA 2DWAA 4TQUQ 1BP5A 1LAXA 4MEVA 1NNPA 4PGNA 3PPPA 5AA4B 3TODA 3PPNA 2RF1A 2FIXA 2CZHA 3T93B 3OO8A 4GWXA 1L5TA 2Q88A 5H8HA 5JTYB 2ZNSA 4ZE9A 1NV4A 3ISPA 2NVUB 4EUOA 1POY1 1A8EA 2PT1A 5FBPA 2VT5A 3IB0A 3UGWA 1URSA 4RA1A 4OERA 1QUIA 2L5VA 3FXQA 2P1SA 2DE2A 3PU5A 4HTGA 4MJOA 5IZZA 3IAZA 4YAHX 4ND9A 3MVZA 1D9VA 4NHBA 3KC0A 4R73A 5ISUA 2Z22A 3KGCA 4F22A 2OX3A 5T3JA 4BDLA 5DYHA 2ZXTA 3BIHA 2UVJA 4H0WA 4POWA 3T22A 5AA4A 3KFMA 1A40A 1ZKBA 2XXPA 4P0IA 3PPQA 2ZYKA 4OVQA 1PBQA 4EQ9A 3DP4A 4DXUA 2F7CA 2GFEA 4MLVA 1NV3A 1DTZA 3GXAA 3WAFA 2WBBA 5JTYA 3OD7A 3I6VA 1OIBA 2I4BA 4GL8A 3UA8A 3KJTA 2ZNUA 2WKYA 5K2XA 1AWBA 2FHYA 1A8FA 5TPAB 2QMXA 3MP8A 3EKIA 4MNPA 4OVRA 2QSXA 5EYFA 1LBYA 2X7PA 2Y7IA 4P47A 2Y7KA 1POTA 2Y5LA 4LQ2A 4XKRA 5J16A 1IMDA 4IGTA 2I48A 3U94A 3PUYE 3HV1A 4QSCA 3IOTA 2CMOA 3TELA 4IO5A 1QJMA 2QRYA 4HS7A 4PETA 5J1DA 3MPLA 1JNFA 3IFCA 1US5A 3ZSFA 4LZ5A 1ANFA 4OFOA 1VSOA 1SDXA 4OEUA 1URDA 4GXAA 4Q30B 4QBAA 1LGBC 1D9QA 3TAJA 1YCJA 4TOZA 1QKAA 1MS7A 3MBPA 1NFTA 4GWUA 5TPAA 1TFDA 2A5TB 3TEPA 4EQBA 3FJMA 3K0VA 4HCYA 1Y20A 5EQ8A 5FHMA 1IEJA 4MNIA 4F31B 1M5BA 4F3BA 3O6HA 1HSLA 4F1YA 1MQDA 1FJ6A 2FIEA 4ISUA 3U92A 2HPGA 2ONKE 5AA2B 2Y5KA 1EZ9A 3EHSA 3S4UA 3V5AA 4H5FA 3TTLA 4H45A 4IO6A 1N3WA 1A55A 4E0XA 3MC2A 1N76A 1ZMGA 5ESYA 2XXKA 4HW8A 3CVGA 3VE1B 1AMFA 4GXSB 2QVRA 1YAEA 3DP8A 3IORA 2NOOA 1SVXB 3O6GA 5I58B 2R6GE 4ZEFA 2A5TA 3PUWE 5KZTA 3TTNA 3LBSA 3PUZE 3FUZA 3OO7A 4Z7EA 3R26A 4I9DA 3PPOA 3CSBA 1MQIA 4O8MA 2H99A 2WYPA 1NH8A 2VP1A 1DK4A 2UXAA 1TXFA 2HZKA 1NUWA 2YPNA 1LB8A 1FPJA 3IL1B 4FBPA 1SD3A 1SI0A 5AA2A 5IM2A 4R9FA 2F5XA 2AL5A 4QFNA 1B3GA 2WX9A 2ONSA 2AIXA 4XFEA 4MLQA 1KZ8A 2QPQA 3QAXA 1LFGA 1US4A 1GVCA 1ZIUA 5ET8A 4O3BA 3UP9A 2D5WA 4O3AA 5I58A 3KN8A 2QVUA 3L6HA 4G68B 3RYDA 5CMBA 1NNKA 4RNSA 3S9EA 3M3KA 2ZYOA 2Y84A 3QXMA 3BKIB 1MY0A 4NGUA 1DOTA 1FRPA 1IMCA 5EYHA 1IMAA 4MFIA 3DP6A 2H5YA 4F3GA 3THIA 1P99A 4QF9A 1SW5A 2O51A 3MVYA 2PVUA 2NWJA 5IZ3B 2HFBA 4LP2B 1PC3A 4GVOA 1VFDA 4U21A 3RTFB 2GRVA 4IO2A 4YB5A 4GL0A 4OTEA 2UYFA 4UA8A 2QFLA 3DLNA 1OQHA 3M8UA 1Z7NE 4PF8A 3PD8A 4O94A 1QUKA 4I1DA 4GBWA 3BFUA 2DWIA 1B3EA 4G68A 1SPIA 3MP1A 1FPFA 4OVJA 3TCGA 4BDMA 3OO6A 5LTCA 1XHYA 3MJNA 2Q89A 3QK6A 1SW4A 1JW1A 1NMUA 1FBFA 2DWJA 3U8QA 1MQHA 4GWOA 1MXWA 3OSQA 3K6XA 1LAFE 1TFAA 3T9XB 1N0TA 1ZLQA 2PMSA 3O29A 3T0JA 3K2DA 4M1VA 3G7WA 3RTWB 1BTJA 3IO6A 2E1SA 5IZ3A 3KSJA 4BDNA 1YYZA 2O69A 2E0SA 5TU0A 4JWOA 5B7DA 1I6AA 1NV0A 4QFKA 3O97A 3PV0E 1OVTA 2AYSA 4F2OA 3B6TA 2IA4A 4MX6A 1FQDA 1MXVA 3RLFE 3O6IA 4Q5TA 2VPOA 2YJPA 4KCDA 4R2FA 3B8BA 3LSXA 4E0WA 2XHDA 2CEXA 1OQGA 1Y1MA 2XWVA 4H6DA 3RUMA 4KCCA 3TQLA 1XT8A 2V84A 1FPEA 3IO4A 3TDJA 3K6UA 2M8CA 2BJIA 3OENA 4I8CA 3KN3A 3E79A 1IXGA 4N8YA 1FQCA 1B7HA 1N84A 4NWDA 5A5XB 3TZAA 4NF8B 3C4MA 1LCTA 3QYTA 1FTJA 4GD5A 4YB7A 5ICQA 4C1TA 1JQFA 4GFRA 3DM0A 3S9NC 1N04A 3KOTA 5L8DA 2F36A 3ZKLA 1XVYA 3K6VA 2VGQA 3FZVA 2Q9TA 3IOVA 3TFLA 4BLAA 4F18A 1MQJA 3CSGA 4LATA 4LA9A 2PX1A 3E9XA 4N13A 1URGA 4OVPA 3V8XB 5HPQA 2XXIA 4ZDMA 4MH5A 1FBEA 2HZLA 1VE4A 4FATA 2I49A 2DVCA 3FATA 1B3LA 4GBVA 2B4MA 5A5XA 1BK4A 2XD2A 3IJOB 2UVHA 4PFWA 1D9YA 4DI3D 4NF8A 1FJ9A 4YKKA 2D21A 1NV1A 1FBDA 1NV7A 3ONMA 4PGPA 5L9OA 3K01A 4NAPA 4YICA 1JEUA 2X7QA 4PAFA 4WXJA 4ZECA 4U22A 1ELJA 5FHNA 1QW0A 2RCBA 2QS1A 1EYIA 1Y9UA 2F7AA 3C9HA 2G29A 4P9KA 4QFPA 2O84X 3Q26A 4XEQA 1SYIA 4TLLB 4JVDA 3IJXB 3M3LA 4L17A 3SKPA 1RKMA 5IKBA 5DEXB 5AE4A 3AXFA 1SW1A 3U93A 4R72A 4GWWA 1LBWA 3EQ1A 4JDFA 2PFZA 5I57B 3E4RA 5ITPA 2OLBA 5M2VA 1MXUA 3OMBA 4H67A 3KG2A 1M5FA 4GF8A 3TTMA 3LSFB 2XXVA 4NF0A 2F34A 1MDQA 2QMWA 4QHQA 4KXPA 1B0LA 2XXYA 3KN7A 1UTBB 4QRZA 2QS4A 1SW2A 2I58A 4ONYA 2O7UA 2HAUA 3IOUA 4JWXA 2PYYA 3UK4A 4MIJA 2O1MA 4IY5A 3MAMA 2ZMBA 1P1NA 3K1PA 2DOJA 3FVKA 4ELRA 4GWYA 2NXOA 4H8IA 3RPWA 2PT2A 3T96B 1BIYA 3RPLB 3E78A 5DEXA 1LSTA 1DPPA 4MAGA 1B5HA 3OXNA 2I3VA 1OMPA 5CMKA 1A54A 5IGAA 3ECRA 5I57A 4Q0CA 2GHAA 2B4LA 3OEKA 4I3YA 4UABA 4NWCA 2XX9A 3FVOA 3P7IA 3PUXE 1XI6A 3RT6B 1JP4A 1QVSA 3S9LC 5DVFA 1JEVA 2P2AA 1N3XA 2OWTA 1WDNA 2QL3A 1K9ZA 4PTKA 3TMGA 1UTBA 4GX4A 4PFYA 3FBPA 3HCQA 1I6BA 3C34A 1RYOA 2OWZA 3PMWA 4FECA 4KR5A 1EU8A 3HHFA 1RDZA 5LDZA 1MM6A 2O7IA 2Z23A 2DE4A 3K6WA 3W9VA 1YZ0A 3FGSA 4JSOA 1NUXA 2ALUA 4GIZA 4XXUA 3O9PA 1NNFA 4GRKA 2R9JA 3RPLA 1JETA 1P1WA 1YTVA 3G3GA 3SERA 3PMXA 3G3JA 3D4CA 4GQOA 1MXXA 1ZJLA 4JXIA 1LAHE 2W7YA 4THIA 5AA3A 4QFLA 2ZYMA 1B7UA 5I7IA 5KDTB 4H1XA 3PD9A 2Q74A 1B1XA 1GR2A 1P1QA 4G8NA 3MWBA 3TUSA 4F1UA 3VVFA 1KA0A 4OEVA 3HHGA 2KR0A 3VV5A 4G8HA 1R1NA 1JW5A 3IB2A 4OYVA 4PFRA 3G3IA 4HXVA 2DQVA 3ILUB 3N94A 3MYUA 3PTYA 4U4XA 1FTOA 4OETA 4YKIA 1DBZA 5BUUA 1O7TA 2FVZA 1JVYA 4C1UA 2XXTA 3ROJA 3SEVA 1M5CA 5CMCA 5CC2A 1M5EA 4XF5A 4PAIA 1GTKA 3LSWA 4F1VA 1GGGA 2YLNA 1SI1A 4PFUA 3FV1A 3GBAA 1OLAA 1NL5A 4G77A 3MZBA 2CZLA 2Y7PA 5KDTA 2MKZA 3T9UA 3W9WA 4P11A 4RYAA 3U1OA 2XD3A 1IMEA 3EHUA 3MZ9A 5AA2D 1D3KA 4P56A 5BWJA 2GH9A 1EZOA 4ZEIA 3QSLA 4DZ1A 2Q2AA 4I3EA 4JVIA 5ET5A 2OJTA 2FYIA 1EYJA 4WEPA 1XOCA 5A5LA 3GLBA 5I59B 1EH3A 1USYE 1B46A 4G68C 3IOWA 1IZ1A 3N6UA 4KPTA 3G3KA 2P0SA 3W15C 1FQBA 1DCUA 4NEDA 2AL4A 3HN0A 1XS5A 4LZ7A 1Y3QA 1B9JA 1VFEA 1H76A 1UIUA 4QFOA 2I6EA 1XC1A 2UVIA 2DXRA 1DTGA 2ABHA 3CFXA 5EQAA 5AA1A 2GHBA 4U23A 1B32A 1LB9A 2H25A 3K1MA 4POXA 1PB7A 3H4ZA 2V93A 3PUVE 1HSJA 4AS4A 5ICTA 1CB6A 3KZGA 5F1QA 4F29A 1NV6A 3JZJA 4G61A 1O63A 4PC9A 3FVGA 4P3LA 2REGA 1LLSA 4N4UA 5I59A 4F39A 4FAJA 2I3WA 1FBGA 3TKDA 2VD2A 3K4UA 2V3TA 4KI0E 3S2VA 2F8DA 3ZKKA 3KSXA 4N6DA 4YKJA 2HXWA 1MXYA 1IXHA 4OQOA 3E13X 1UIVA 3MQ9A 5I2KB 1I69A 3OOAA 4PQJA 2DYXA 3R7XA 3O66A 4LVQA 4MCOA 4GX3A 4I40A 3SEWA 4BDRA 2OK2A 1MRPA 2F3BA 4FEDA 3HSTA 2FBPA 4TLMB 5EHSA 1QGXA 4JVCA 3CIJA 4U4SA 3VDFA 5EQ7A 2RCAA 3K1NA 3C33A 2ESNA 3OELA 4PE5B 4QSDA 1IMFA 3I3VA 4YMBA 3USDA 4ZE8A 3GZGA 1B4ZA 2H9BA 3TQWA 2Q8JA 1PDAA 4NG7A 1Q9DA 1A7LA 5KCJB 1MQGA 4X1DA 2PBWA 5DVJA 3HFUA 3Q25A 1Y4CA 4BDOA 4OZ9A 1FQEA 5I2KA 3BBRA 3RN8A 5DVIA 3CFZA 4EDPA 3KEIA 4U2RA 3PMVA 4WEDA 3BIGA 4N91A 5H8SA 2VPNA 1NUYA 3ZS6A 1DMBA 2H4IA 1Q35A 4XKPA 1AL3A 3A3UA 3FIRA 4IGRA 1FBCA 4OFLA 2O1LA 3FASA 2CEYA 5CI5A 1ATGA 2HHMA 1Y3PA 2OWSA 4X9TA 1RDYA 4OA4A 3C32A 5FTHA 1MY2A 4X04A 4LUBA 4O7IA 2GQ1A 3OO9A 4G8MA 1MG1A 2XXHA 1AH5A 5KCJA 3MW0A 1MH3A 1R9QA 4RY1A 4MNCA 1IXCA 2JJKA 1II5A 3H03A 2DP8A 2O68A 4DI4B 3SESA 1AOVA 4LZ8A 3UORA 1BKAA 3U65A 5CMMA 4JSDA 2ZZVA 4OFJA 2F78A 4C0RA 2Y7WA 3EHTA 3SEYA 1PB8A 4XKQA 1IITA 4PFTA 3FD3A 3QIMA 4XTCQ 3RQTA 3RNNA 1QUJA 4YMAA 1UTHB 3LUYA 3K00A 1RYXA 2XXWA 4QXDA 3EN3A 1IQ7A 2XWOA 4U1OA 1FTKA 1USYH 2G93A 5I3SA 3H6TA 2ZZXA 2DWHA 4NF6B 5JEIA 1LBVA 3SETA 3SEXA 2Z8EA 4ZEDA 4ZEBA 4JB7A 2HCAA 4PFIA 3RGYA 5B70A 2ZYNA 1FTMA 4NF4B 3MUQA 5LOMA 5EYGA 3CFLA 3GBBA 4IY6A 4ELOA 3C35A 4PDHA 2WYKA 1LBBA 1YPNA 3O2AA 4DE8A 1Q1KA 5L9SA 4ZEKA 4KYEA 2P3VA 4N8GA 1NV5A 2XXQA 3SZPA 1LCFA 3MZ1A 2F3DA 4NTLA 1Y1ZA 2F6PA 4HE1A 4I62A 4F3SA 4AQ4A 1WODA 3NOHA 2I0CA 1UTHA 1B05A 4HE2A 2XX8A 1NNTA 1P1UA 2WBDA 1F9BA 4YU0A 1LEVA 3CHGA 3LUZA 1FQFA 2I4CA 3H3GA 2V25A 4NX1A 4PAKA 4RXLA 4YB6A 3CR9A 4NF6A 3L6GA 5CM6A 4DXCA 4NF5B 3H6UA 5F7VA 3T1BA 2VD3A 2RC9A 4NF4A 1MPDA 4YKPA 3C31A 3VLUA 1FPLA 1MDP1 2XXRA 1LFHA 1R6ZA 2RC7A 1MXZA 4PP0A 2A5SA 1B1HA 2FA7A 4ECFA 3IR1A 3E3KA 3UN6A 1Y3NA 5I56B 4EXLA 4NE4A 3FXUA 3A3CA 3N6TA 3GYYA 2B3FA 4EF2A 4EQ7A 5EQ9A 2PFYA 1S7YA 3IK6B 1NUZA 3ODBA 4NQ8A 4PE3A 4KYSA 3T9HB 3A29A 4IB2A 1J1NA 4RPOA 1LBXA 4KD5A 3PPRA 5HBCA 1ZBMA 3O28A 4Q8RA 4KYDA 1B58A 3LV0A 5EHMA 3Q28A 3D4GA 4NF5A 5DTBA 4X8RA 4ELPA 2D3IA 1LBCA 3LSLA 3QUFA 4DCYA 4R74A 4OENA 3SDFA 1NV2A 2X26A 1D4NA 3UIFA 1SYHA 2QJEA 4RK2A 2CZKA 4JBZA 1B40A 1MY4A 4R6HA 4GWZA 1IXIA 5FHOA 1HSEA 4R6KA 2Y7RA 2XWIA 2RKMA 4R2BA 2ZNTA 4IO3A 3JYRA 5I56A 4XKNA 3V83A 3G3FA 2NUVA 3VXBA 4MF3A 1R9LA 1N7WA 1H45A 5IZ1A 4N17A 2V3QA 3LC8A 4JWYA 2REJA 4GWSA 4AB5A 3ILTB 3TCFA 3MSTA 2VOZA 2F97A 5ET6A 1B2HA 4OMBA 1BLFA 2P3NA 4GX6A 2DDKA 5CBRA
chains in the Genus database with same CATH topology
1LAGE 3TTKA 1ZU0A 1UQWA 4R75A 2DVZA 2Z8DA 4XIGQ 4BDQA 3OSRA 1QULA 3LR1A 4DCXA 1FTLA 3KJ7A 3B6QA 5I2NB 1H3DA 4OHNA 4Z0IA 3RY3A 4G4PA 1GV8A 5H8QB 3V89B 2HEUA 2H98A 4FE8A 1DSNA 3CI8A 1T0KA 4K3FA 4ELQA 1B5IA 4ZS9A 3I5OA 1Z7ME 4FORA 4RJZA 1MY1A 3H6WA 2VHAA 2I0BA 3DELB 3PGFA 3Q29A 4DXBA 1OVBA 4F19A 2BJJX 4ESXA 1B51A 1NKXA 4FIMA 2FNCA 4DIGA 2ONRA 4AB6A 4LQ5A 4H65A 5I2NA 5CRYA 1B6HA 4KQPA 4KHZE 2DE3A 1WVJA 1DPEA 2DXYA 2XXUA 1I6QA 4P0GA 4H8JA 1AIVA 4GLIA 5H8QA 4O3CA 4ESWA 3IX1A 3VXCA 3WAEA 1B3HA 3VFJA 4OWDA 3FJ7A 2B3BA 1LFIA 4N07A 3H6VA 2RINA 4NMYA 1SQYA 1FQAA 1OLCA 2QS3A 3TPAA 4DLDA 2XXXA 4LONB 2UVGA 4R9GA 4MBPA 4OXVA 1B7ZA 1TWYA 3OEMA 3VLWA 3M3FA 3TTRA 3IB1A 2F7BA 1P1OA 2Q2CA 1MPBA 2LAOA 3KBRA 2HAVA 3N5LA 4IO7A 1TT1A 4YZZA 3S9MC 3MVWA 3H06B 5H8FB 4FEBA 1O64A 3HO7A 1JVXA 3BFTA 3SEUA 1N7XA 2IEEA 1EZPA 4RPNA 4GOTA 1FCKA 3VVEA 3MPKA 1PBPA 4OESA 1B4HA 5FTIA 3G3HA 4F2QA 3A09A 3FV2A 1H43A 3JV9A 3U72A 4U1ZA 1MH4A 4X1BA 3MVXA 4FJPA 1PEBA 2THIA 5JK4A 1B0HA 3H7MA 1CE2A 4ZZAA 2F6GA 5I84A 1MY3A 1JW4A 2F35A 3RT8A 1B5JA 1FW0A 4EF1A 4RK9A 5H8FA 3VVDA 2R71A 3K02A 1PB9A 4DDDA 2HQ0A 1S50A 2DSFA 1ZTYA 1B52A 4EXKA 4R6YA 3KOSA 4N6PA 4IO4A 1XVXA 2OBGA 4ZZEA 2KLFA 3QUJA 1Y4TA 4H5GA 5H8NB 2RC8A 4QSEA 3CRBA 4HCWA 2Z8FA 5IAIA 5TP9B 3Q27A 1KWHA 4X48A 3EPEA 5K2YA 3EF7A 3C36A 2OCUA 1MM7A 5ITOA 4WKMA 1A99A 3F11A 1IIWA 3B7DA 3T9VA 3VLVA 1QKBA 3CG3A 4M4GA 2ANJA 1MPCA 5H8HB 5CBSA 3T66A 4F3PA 5ELVA 1M5DA 2O6AA 2V3UA 5L9MA 2UYEA 4G2ZA 3HPIA 1SBPA 3B6WA 2XX7A 3CG1A 1S9TA 2B65A 2QS2A 2DS9A 5H8NA 1NH7A 5HM4B 1H44A 1VR5A 5TP9A 5DT6A 1B3FA 4KFQA 1IUDA 3N26A 3TCHA 2OZZA 3R6UA 3FVNA 4UACA 3MP6A 3FXRA 3TYHA 3FJGA 2DWAA 4TQUQ 1BP5A 1LAXA 1NNPA 3PPPA 5AA4B 3TODA 3PPNA 2RF1A 3T93B 3OO8A 1L5TA 2Q88A 5H8HA 5JTYB 2ZNSA 4ZE9A 2NVUB 4EUOA 1POY1 1A8EA 2PT1A 3IB0A 3UGWA 1URSA 4RA1A 4OERA 1QUIA 3FXQA 2P1SA 2DE2A 3PU5A 4HTGA 3IAZA 4YAHX 4ND9A 3MVZA 1D9VA 4R73A 5ISUA 2Z22A 3KGCA 4F22A 4BDLA 5DYHA 2ZXTA 4H0WA 2UVJA 3T22A 4POWA 5AA4A 3KFMA 1A40A 1ZKBA 2XXPA 4P0IA 3PPQA 2ZYKA 1PBQA 4EQ9A 3DP4A 4DXUA 2F7CA 2GFEA 4MLVA 1DTZA 3GXAA 3WAFA 5JTYA 3OD7A 3I6VA 1OIBA 2I4BA 4GL8A 3UA8A 3KJTA 2ZNUA 2WKYA 5K2XA 1A8FA 5TPAB 2QMXA 3MP8A 2QSXA 5EYFA 2X7PA 2Y7IA 2Y7KA 1POTA 4LQ2A 4XKRA 4IGTA 2I48A 3U94A 3PUYE 3HV1A 4QSCA 3IOTA 2CMOA 3TELA 4IO5A 1QJMA 2QRYA 4HS7A 4PETA 5J1DA 3MPLA 1JNFA 1US5A 3ZSFA 4LZ5A 1ANFA 4OFOA 1VSOA 1SDXA 4OEUA 1URDA 4GXAA 4Q30B 1LGBC 3TAJA 1YCJA 4TOZA 1QKAA 1MS7A 3MBPA 1NFTA 5TPAA 1TFDA 2A5TB 3TEPA 4EQBA 3FJMA 3K0VA 4HCYA 1Y20A 5FHMA 1IEJA 4F31B 1M5BA 4F3BA 3O6HA 1HSLA 4F1YA 1MQDA 4ISUA 3U92A 2ONKE 5AA2B 1EZ9A 3EHSA 3S4UA 3V5AA 4H5FA 3TTLA 4IO6A 1N3WA 1A55A 4E0XA 3MC2A 1N76A 1ZMGA 4HW8A 3CVGA 3VE1B 1AMFA 4GXSB 1YAEA 3DP8A 3IORA 2NOOA 1SVXB 3O6GA 5I58B 2R6GE 4ZEFA 2A5TA 3PUWE 5KZTA 3TTNA 3LBSA 3PUZE 3FUZA 3OO7A 4Z7EA 3R26A 4I9DA 3PPOA 3CSBA 1MQIA 2H99A 1NH8A 2VP1A 2UXAA 1TXFA 2HZKA 2YPNA 1LB8A 3IL1B 1SD3A 1SI0A 5AA2A 4R9FA 2F5XA 2AL5A 4QFNA 1B3GA 2ONSA 2AIXA 4MLQA 2QPQA 3QAXA 1LFGA 1US4A 1GVCA 1ZIUA 4O3BA 3UP9A 2D5WA 4O3AA 5I58A 3KN8A 3L6HA 4G68B 5CMBA 1NNKA 4RNSA 3S9EA 3M3KA 2ZYOA 2Y84A 3QXMA 3BKIB 1MY0A 1DOTA 4MFIA 3DP6A 2H5YA 4F3GA 3THIA 1P99A 4QF9A 1SW5A 2O51A 3MVYA 2PVUA 2NWJA 2HFBA 4LP2B 1PC3A 4GVOA 1VFDA 4U21A 3RTFB 2GRVA 4IO2A 4YB5A 4GL0A 4OTEA 2UYFA 4UA8A 3DLNA 1OQHA 3M8UA 1Z7NE 3PD8A 1QUKA 4I1DA 3BFUA 2DWIA 1B3EA 4G68A 3MP1A 4OVJA 3TCGA 4BDMA 3OO6A 1XHYA 3MJNA 2Q89A 3QK6A 1SW4A 1JW1A 1NMUA 2DWJA 3U8QA 1MQHA 4GWOA 1MXWA 3OSQA 3K6XA 1LAFE 1TFAA 3T9XB 1N0TA 1ZLQA 2PMSA 3O29A 3K2DA 4M1VA 3G7WA 3RTWB 1BTJA 3IO6A 2E1SA 3KSJA 4BDNA 2O69A 2E0SA 5TU0A 4JWOA 5B7DA 1I6AA 4QFKA 3O97A 3PV0E 1OVTA 2AYSA 4F2OA 3B6TA 2IA4A 1FQDA 1MXVA 3RLFE 3O6IA 4Q5TA 2YJPA 4KCDA 4R2FA 3LSXA 4E0WA 2XHDA 1OQGA 1Y1MA 4H6DA 3RUMA 4KCCA 3TQLA 1XT8A 2V84A 3IO4A 3TDJA 3K6UA 2M8CA 3OENA 4I8CA 3KN3A 1IXGA 1FQCA 1B7HA 1N84A 4NWDA 5A5XB 3TZAA 4NF8B 3C4MA 1LCTA 3QYTA 1FTJA 4GD5A 4YB7A 5ICQA 4C1TA 1JQFA 4GFRA 3DM0A 3S9NC 1N04A 3KOTA 5L8DA 2F36A 3ZKLA 1XVYA 3K6VA 2VGQA 3FZVA 2Q9TA 3IOVA 3TFLA 4BLAA 4F18A 1MQJA 3CSGA 4LATA 4LA9A 2PX1A 3E9XA 4N13A 1URGA 5HPQA 3V8XB 2XXIA 4ZDMA 4MH5A 2HZLA 1VE4A 4FATA 2I49A 2DVCA 3FATA 1B3LA 5A5XA 2XD2A 3IJOB 2UVHA 4PFWA 1D9YA 4NF8A 4YKKA 2D21A 3ONMA 5L9OA 3K01A 4YICA 1JEUA 2X7QA 4WXJA 4ZECA 4U22A 1ELJA 5FHNA 1QW0A 2RCBA 2QS1A 1Y9UA 2F7AA 3C9HA 2G29A 4QFPA 2O84X 3Q26A 1SYIA 4TLLB 3IJXB 3M3LA 4L17A 3SKPA 1RKMA 5IKBA 5DEXB 5AE4A 3AXFA 1SW1A 3U93A 4R72A 3EQ1A 4JDFA 5I57B 3E4RA 5ITPA 2OLBA 5M2VA 1MXUA 3OMBA 4H67A 3KG2A 1M5FA 4GF8A 3TTMA 3LSFB 2XXVA 2F34A 1MDQA 2QMWA 4QHQA 1B0LA 2XXYA 3KN7A 1UTBB 4QRZA 2QS4A 1SW2A 2I58A 4ONYA 2O7UA 2HAUA 3IOUA 4JWXA 2PYYA 3UK4A 2O1MA 4IY5A 3MAMA 2ZMBA 1P1NA 3K1PA 2DOJA 3FVKA 4ELRA 2NXOA 4H8IA 3RPWA 2PT2A 3T96B 1BIYA 5DEXA 1LSTA 1DPPA 1B5HA 3OXNA 2I3VA 1OMPA 5CMKA 1A54A 3ECRA 5I57A 4Q0CA 2GHAA 3OEKA 4NWCA 2XX9A 3FVOA 3P7IA 3PUXE 3RT6B 1QVSA 3S9LC 5DVFA 1JEVA 2P2AA 1N3XA 2OWTA 1WDNA 2QL3A 3TMGA 1UTBA 4PFYA 3HCQA 1I6BA 3C34A 1RYOA 3PMWA 4FECA 4KR5A 1EU8A 3HHFA 1MM6A 2O7IA 2Z23A 2DE4A 3K6WA 3W9VA 3FGSA 4JSOA 2ALUA 4GIZA 4XXUA 3O9PA 1NNFA 4GRKA 2R9JA 1JETA 1P1WA 1YTVA 3G3GA 3SERA 3PMXA 3G3JA 3D4CA 4GQOA 1MXXA 1ZJLA 4JXIA 1LAHE 2W7YA 4THIA 5AA3A 4QFLA 2ZYMA 1B7UA 5KDTB 4H1XA 3PD9A 1B1XA 1GR2A 1P1QA 4G8NA 3MWBA 3TUSA 4F1UA 3VVFA 4OEVA 3HHGA 3VV5A 4G8HA 1JW5A 1R1NA 3IB2A 4OYVA 3G3IA 2DQVA 3ILUB 3N94A 4U4XA 1FTOA 4OETA 4YKIA 5BUUA 1O7TA 1JVYA 4C1UA 2XXTA 3SEVA 1M5CA 5CMCA 5CC2A 1M5EA 1GTKA 3LSWA 4F1VA 1GGGA 2YLNA 1SI1A 4PFUA 3FV1A 3GBAA 1OLAA 1NL5A 4G77A 3MZBA 2CZLA 2Y7PA 5KDTA 3T9UA 3W9WA 4P11A 4RYAA 3U1OA 2XD3A 5AA2D 3EHUA 3MZ9A 1D3KA 5BWJA 2GH9A 1EZOA 4ZEIA 3QSLA 4DZ1A 2Q2AA 2OJTA 2FYIA 4WEPA 1XOCA 3GLBA 5I59B 1EH3A 1USYE 1B46A 4G68C 3IOWA 1IZ1A 3N6UA 4KPTA 3G3KA 2P0SA 3W15C 1FQBA 4NEDA 2AL4A 3HN0A 1XS5A 4LZ7A 1Y3QA 1B9JA 1VFEA 1H76A 1UIUA 4QFOA 2I6EA 1XC1A 2UVIA 2DXRA 1DTGA 2ABHA 3CFXA 5AA1A 2GHBA 4U23A 1B32A 1LB9A 2H25A 3K1MA 4POXA 1PB7A 3H4ZA 2V93A 3PUVE 1HSJA 5ICTA 1CB6A 3KZGA 5F1QA 4F29A 3JZJA 1O63A 3FVGA 2REGA 1LLSA 5I59A 4F39A 4FAJA 2I3WA 3TKDA 2VD2A 3K4UA 2V3TA 4KI0E 3S2VA 2F8DA 3ZKKA 3KSXA 4YKJA 2HXWA 1MXYA 1IXHA 4OQOA 3E13X 1UIVA 3MQ9A 5I2KB 1I69A 3OOAA 4PQJA 2DYXA 3R7XA 3O66A 4LVQA 3SEWA 4BDRA 2OK2A 1MRPA 4FEDA 3HSTA 4TLMB 5EHSA 3CIJA 4U4SA 3VDFA 2RCAA 3K1NA 3C33A 2ESNA 3OELA 4PE5B 4QSDA 3I3VA 4YMBA 3USDA 4ZE8A 3GZGA 1B4ZA 2H9BA 3TQWA 2Q8JA 1PDAA 1A7LA 5KCJB 1MQGA 4X1DA 2PBWA 5DVJA 3Q25A 1Y4CA 4BDOA 4OZ9A 1FQEA 5I2KA 3BBRA 3RN8A 5DVIA 3CFZA 4EDPA 3KEIA 4U2RA 3PMVA 4WEDA 5H8SA 3ZS6A 1DMBA 2H4IA 1Q35A 4XKPA 1AL3A 3A3UA 3FIRA 4IGRA 4OFLA 2O1LA 3FASA 5CI5A 1ATGA 1Y3PA 2OWSA 4X9TA 3C32A 5FTHA 1MY2A 4LUBA 3OO9A 4G8MA 1MG1A 2XXHA 1AH5A 5KCJA 3MW0A 1MH3A 1R9QA 4RY1A 1IXCA 1II5A 3H03A 2DP8A 2O68A 3SESA 1AOVA 4LZ8A 3UORA 1BKAA 5CMMA 4JSDA 4OFJA 2F78A 4C0RA 2Y7WA 3EHTA 3SEYA 1PB8A 4XKQA 1IITA 4PFTA 3FD3A 3QIMA 4XTCQ 3RQTA 3RNNA 1QUJA 4YMAA 1UTHB 3LUYA 3K00A 1RYXA 2XXWA 3EN3A 1IQ7A 4U1OA 1FTKA 1USYH 2G93A 3H6TA 2DWHA 4NF6B 5JEIA 3SETA 3SEXA 2Z8EA 4ZEDA 4ZEBA 4JB7A 2HCAA 3RGYA 5B70A 2ZYNA 1FTMA 4NF4B 3MUQA 5LOMA 3CFLA 3GBBA 4IY6A 4ELOA 3C35A 1LBBA 1YPNA 3O2AA 4DE8A 1Q1KA 5L9SA 4ZEKA 4KYEA 2XXQA 1LCFA 3MZ1A 4NTLA 1Y1ZA 2F6PA 4I62A 4F3SA 4AQ4A 1WODA 2I0CA 1UTHA 1B05A 2XX8A 1NNTA 1P1UA 1F9BA 4YU0A 1FQFA 2I4CA 3H3GA 2V25A 4RXLA 4YB6A 3CR9A 4NF6A 3L6GA 5CM6A 4DXCA 4NF5B 3H6UA 5F7VA 2VD3A 2RC9A 4NF4A 1MPDA 4YKPA 3C31A 3VLUA 1MDP1 2XXRA 1LFHA 1R6ZA 2RC7A 1MXZA 4PP0A 2A5SA 1B1HA 2FA7A 4ECFA 3IR1A 3E3KA 3UN6A 1Y3NA 5I56B 4EXLA 4NE4A 3FXUA 3A3CA 3N6TA 2B3FA 4EF2A 4EQ7A 1S7YA 3IK6B 3ODBA 4KYSA 3T9HB 4IB2A 1J1NA 4RPOA 4KD5A 3PPRA 5HBCA 1ZBMA 3O28A 4Q8RA 4KYDA 1B58A 5EHMA 3Q28A 3D4GA 4NF5A 5DTBA 4ELPA 2D3IA 1LBCA 3LSLA 3QUFA 4DCYA 4R74A 4OENA 3SDFA 2X26A 1D4NA 3UIFA 1SYHA 2QJEA 4RK2A 4JBZA 1B40A 1MY4A 4R6HA 1IXIA 5FHOA 1HSEA 4R6KA 2Y7RA 2RKMA 4R2BA 2ZNTA 4IO3A 3JYRA 5I56A 4XKNA 3V83A 3G3FA 2NUVA 3VXBA 4MF3A 1R9LA 1N7WA 1H45A 2V3QA 3LC8A 4JWYA 2REJA 4AB5A 3ILTB 3TCFA 2VOZA 2F97A 1B2HA 4OMBA 1BLFA 5CBRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LAG E;  3TTK A;  1ZU0 A;  1UQW A;  4R75 A;  2DVZ A;  2Z8D A;  4XIG Q;  4BDQ A;  3OSR A;  1QUL A;  3LR1 A;  4DCX A;  1FTL A;  3KJ7 A;  3B6Q A;  5I2N B;  1H3D A;  4OHN A;  4Z0I A;  3RY3 A;  4G4P A;  1GV8 A;  5H8Q B;  3V89 B;  2HEU A;  2H98 A;  4FE8 A;  1DSN A;  3CI8 A;  1T0K A;  4K3F A;  4ELQ A;  1B5I A;  4ZS9 A;  3I5O A;  1Z7M E;  4FOR A;  4RJZ A;  1MY1 A;  3H6W A;  2VHA A;  2I0B A;  3DEL B;  3PGF A;  3Q29 A;  4DXB A;  1OVB A;  4F19 A;  2BJJ X;  4ESX A;  1B51 A;  1NKX A;  4FIM A;  2FNC A;  4DIG A;  2ONR A;  4AB6 A;  4LQ5 A;  4H65 A;  5I2N A;  5CRY A;  1B6H A;  4KQP A;  4KHZ E;  2DE3 A;  1WVJ A;  1DPE A;  2DXY A;  2XXU A;  1I6Q A;  4P0G A;  4H8J A;  1AIV A;  4GLI A;  5H8Q A;  4O3C A;  4ESW A;  3IX1 A;  3VXC A;  3WAE A;  1B3H A;  3VFJ A;  4OWD A;  3FJ7 A;  2B3B A;  1LFI A;  4N07 A;  3H6V A;  2RIN A;  4NMY A;  1SQY A;  1FQA A;  1OLC A;  2QS3 A;  3TPA A;  4DLD A;  2XXX A;  4LON B;  2UVG A;  4R9G A;  4MBP A;  4OXV A;  1B7Z A;  1TWY A;  3OEM A;  3VLW A;  3M3F A;  3TTR A;  3IB1 A;  2F7B A;  1P1O A;  2Q2C A;  1MPB A;  2LAO A;  3KBR A;  2HAV A;  3N5L A;  4IO7 A;  1TT1 A;  4YZZ A;  3S9M C;  3MVW A;  3H06 B;  5H8F B;  4FEB A;  1O64 A;  3HO7 A;  1JVX A;  3BFT A;  3SEU A;  1N7X A;  2IEE A;  1EZP A;  4RPN A;  4GOT A;  1FCK A;  3VVE A;  3MPK A;  1PBP A;  4OES A;  1B4H A;  5FTI A;  3G3H A;  4F2Q A;  3A09 A;  3FV2 A;  1H43 A;  3JV9 A;  3U72 A;  4U1Z A;  1MH4 A;  4X1B A;  3MVX A;  4FJP A;  1PEB A;  2THI A;  5JK4 A;  1B0H A;  3H7M A;  1CE2 A;  4ZZA A;  2F6G A;  5I84 A;  1MY3 A;  1JW4 A;  2F35 A;  3RT8 A;  1B5J A;  1FW0 A;  4EF1 A;  4RK9 A;  5H8F A;  3VVD A;  2R71 A;  3K02 A;  1PB9 A;  4DDD A;  2HQ0 A;  1S50 A;  2DSF A;  1ZTY A;  1B52 A;  4EXK A;  4R6Y A;  3KOS A;  4N6P A;  4IO4 A;  1XVX A;  2OBG A;  4ZZE A;  2KLF A;  3QUJ A;  1Y4T A;  4H5G A;  5H8N B;  2RC8 A;  4QSE A;  3CRB A;  4HCW A;  2Z8F A;  5IAI A;  5TP9 B;  3Q27 A;  1KWH A;  4X48 A;  3EPE A;  5K2Y A;  3EF7 A;  3C36 A;  2OCU A;  1MM7 A;  5ITO A;  4WKM A;  1A99 A;  3F11 A;  1IIW A;  3B7D A;  3T9V A;  3VLV A;  1QKB A;  3CG3 A;  4M4G A;  2ANJ A;  1MPC A;  5H8H B;  5CBS A;  3T66 A;  4F3P A;  5ELV A;  1M5D A;  2O6A A;  2V3U A;  5L9M A;  2UYE A;  4G2Z A;  3HPI A;  1SBP A;  3B6W A;  2XX7 A;  3CG1 A;  1S9T A;  2B65 A;  2QS2 A;  2DS9 A;  5H8N A;  1NH7 A;  5HM4 B;  1H44 A;  1VR5 A;  5TP9 A;  5DT6 A;  1B3F A;  4KFQ A;  1IUD A;  3N26 A;  3TCH A;  2OZZ A;  3R6U A;  3FVN A;  4UAC A;  3MP6 A;  3FXR A;  3TYH A;  3FJG A;  2DWA A;  4TQU Q;  1BP5 A;  1LAX A;  1NNP A;  3PPP A;  5AA4 B;  3TOD A;  3PPN A;  2RF1 A;  3T93 B;  3OO8 A;  1L5T A;  2Q88 A;  5H8H A;  5JTY B;  2ZNS A;  4ZE9 A;  2NVU B;  4EUO A;  1POY 1;  1A8E A;  2PT1 A;  3IB0 A;  3UGW A;  1URS A;  4RA1 A;  4OER A;  1QUI A;  3FXQ A;  2P1S A;  2DE2 A;  3PU5 A;  4HTG A;  3IAZ A;  4YAH X;  4ND9 A;  3MVZ A;  1D9V A;  4R73 A;  5ISU A;  2Z22 A;  3KGC A;  4F22 A;  4BDL A;  5DYH A;  2ZXT A;  4H0W A;  2UVJ A;  3T22 A;  4POW A;  5AA4 A;  3KFM A;  1A40 A;  1ZKB A;  2XXP A;  4P0I A;  3PPQ A;  2ZYK A;  1PBQ A;  4EQ9 A;  3DP4 A;  4DXU A;  2F7C A;  2GFE A;  4MLV A;  1DTZ A;  3GXA A;  3WAF A;  5JTY A;  3OD7 A;  3I6V A;  1OIB A;  2I4B A;  4GL8 A;  3UA8 A;  3KJT A;  2ZNU A;  2WKY A;  5K2X A;  1A8F A;  5TPA B;  2QMX A;  3MP8 A;  2QSX A;  5EYF A;  2X7P A;  2Y7I A;  2Y7K A;  1POT A;  4LQ2 A;  4XKR A;  4IGT A;  2I48 A;  3U94 A;  3PUY E;  3HV1 A;  4QSC A;  3IOT A;  2CMO A;  3TEL A;  4IO5 A;  1QJM A;  2QRY A;  4HS7 A;  4PET A;  5J1D A;  3MPL A;  1JNF A;  1US5 A;  3ZSF A;  4LZ5 A;  1ANF A;  4OFO A;  1VSO A;  1SDX A;  4OEU A;  1URD A;  4GXA A;  4Q30 B;  1LGB C;  3TAJ A;  1YCJ A;  4TOZ A;  1QKA A;  1MS7 A;  3MBP A;  1NFT A;  5TPA A;  1TFD A;  2A5T B;  3TEP A;  4EQB A;  3FJM A;  3K0V A;  4HCY A;  1Y20 A;  5FHM A;  1IEJ A;  4F31 B;  1M5B A;  4F3B A;  3O6H A;  1HSL A;  4F1Y A;  1MQD A;  4ISU A;  3U92 A;  2ONK E;  5AA2 B;  1EZ9 A;  3EHS A;  3S4U A;  3V5A A;  4H5F A;  3TTL A;  4IO6 A;  1N3W A;  1A55 A;  4E0X A;  3MC2 A;  1N76 A;  1ZMG A;  4HW8 A;  3CVG A;  3VE1 B;  1AMF A;  4GXS B;  1YAE A;  3DP8 A;  3IOR A;  2NOO A;  1SVX B;  3O6G A;  5I58 B;  2R6G E;  4ZEF A;  2A5T A;  3PUW E;  5KZT A;  3TTN A;  3LBS A;  3PUZ E;  3FUZ A;  3OO7 A;  4Z7E A;  3R26 A;  4I9D A;  3PPO A;  3CSB A;  1MQI A;  2H99 A;  1NH8 A;  2VP1 A;  2UXA A;  1TXF A;  2HZK A;  2YPN A;  1LB8 A;  3IL1 B;  1SD3 A;  1SI0 A;  5AA2 A;  4R9F A;  2F5X A;  2AL5 A;  4QFN A;  1B3G A;  2ONS A;  2AIX A;  4MLQ A;  2QPQ A;  3QAX A;  1LFG A;  1US4 A;  1GVC A;  1ZIU A;  4O3B A;  3UP9 A;  2D5W A;  4O3A A;  5I58 A;  3KN8 A;  3L6H A;  4G68 B;  5CMB A;  1NNK A;  4RNS A;  3S9E A;  3M3K A;  2ZYO A;  2Y84 A;  3QXM A;  3BKI B;  1MY0 A;  1DOT A;  4MFI A;  3DP6 A;  2H5Y A;  4F3G A;  3THI A;  1P99 A;  4QF9 A;  1SW5 A;  2O51 A;  3MVY A;  2PVU A;  2NWJ A;  2HFB A;  4LP2 B;  1PC3 A;  4GVO A;  1VFD A;  4U21 A;  3RTF B;  2GRV A;  4IO2 A;  4YB5 A;  4GL0 A;  4OTE A;  2UYF A;  4UA8 A;  3DLN A;  1OQH A;  3M8U A;  1Z7N E;  3PD8 A;  1QUK A;  4I1D A;  3BFU A;  2DWI A;  1B3E A;  4G68 A;  3MP1 A;  4OVJ A;  3TCG A;  4BDM A;  3OO6 A;  1XHY A;  3MJN A;  2Q89 A;  3QK6 A;  1SW4 A;  1JW1 A;  1NMU A;  2DWJ A;  3U8Q A;  1MQH A;  4GWO A;  1MXW A;  3OSQ A;  3K6X A;  1LAF E;  1TFA A;  3T9X B;  1N0T A;  1ZLQ A;  2PMS A;  3O29 A;  3K2D A;  4M1V A;  3G7W A;  3RTW B;  1BTJ A;  3IO6 A;  2E1S A;  3KSJ A;  4BDN A;  2O69 A;  2E0S A;  5TU0 A;  4JWO A;  5B7D A;  1I6A A;  4QFK A;  3O97 A;  3PV0 E;  1OVT A;  2AYS A;  4F2O A;  3B6T A;  2IA4 A;  1FQD A;  1MXV A;  3RLF E;  3O6I A;  4Q5T A;  2YJP A;  4KCD A;  4R2F A;  3LSX A;  4E0W A;  2XHD A;  1OQG A;  1Y1M A;  4H6D A;  3RUM A;  4KCC A;  3TQL A;  1XT8 A;  2V84 A;  3IO4 A;  3TDJ A;  3K6U A;  2M8C A;  3OEN A;  4I8C A;  3KN3 A;  1IXG A;  1FQC A;  1B7H A;  1N84 A;  4NWD A;  5A5X B;  3TZA A;  4NF8 B;  3C4M A;  1LCT A;  3QYT A;  1FTJ A;  4GD5 A;  4YB7 A;  5ICQ A;  4C1T A;  1JQF A;  4GFR A;  3DM0 A;  3S9N C;  1N04 A;  3KOT A;  5L8D A;  2F36 A;  3ZKL A;  1XVY A;  3K6V A;  2VGQ A;  3FZV A;  2Q9T A;  3IOV A;  3TFL A;  4BLA A;  4F18 A;  1MQJ A;  3CSG A;  4LAT A;  4LA9 A;  2PX1 A;  3E9X A;  4N13 A;  1URG A;  5HPQ A;  3V8X B;  2XXI A;  4ZDM A;  4MH5 A;  2HZL A;  1VE4 A;  4FAT A;  2I49 A;  2DVC A;  3FAT A;  1B3L A;  5A5X A;  2XD2 A;  3IJO B;  2UVH A;  4PFW A;  1D9Y A;  4NF8 A;  4YKK A;  2D21 A;  3ONM A;  5L9O A;  3K01 A;  4YIC A;  1JEU A;  2X7Q A;  4WXJ A;  4ZEC A;  4U22 A;  1ELJ A;  5FHN A;  1QW0 A;  2RCB A;  2QS1 A;  1Y9U A;  2F7A A;  3C9H A;  2G29 A;  4QFP A;  2O84 X;  3Q26 A;  1SYI A;  4TLL B;  3IJX B;  3M3L A;  4L17 A;  3SKP A;  1RKM A;  5IKB A;  5DEX B;  5AE4 A;  3AXF A;  1SW1 A;  3U93 A;  4R72 A;  3EQ1 A;  4JDF A;  5I57 B;  3E4R A;  5ITP A;  2OLB A;  5M2V A;  1MXU A;  3OMB A;  4H67 A;  3KG2 A;  1M5F A;  4GF8 A;  3TTM A;  3LSF B;  2XXV A;  2F34 A;  1MDQ A;  2QMW A;  4QHQ A;  1B0L A;  2XXY A;  3KN7 A;  1UTB B;  4QRZ A;  2QS4 A;  1SW2 A;  2I58 A;  4ONY A;  2O7U A;  2HAU A;  3IOU A;  4JWX A;  2PYY A;  3UK4 A;  2O1M A;  4IY5 A;  3MAM A;  2ZMB A;  1P1N A;  3K1P A;  2DOJ A;  3FVK A;  4ELR A;  2NXO A;  4H8I A;  3RPW A;  2PT2 A;  3T96 B;  1BIY A;  5DEX A;  1LST A;  1DPP A;  1B5H A;  3OXN A;  2I3V A;  1OMP A;  5CMK A;  1A54 A;  3ECR A;  5I57 A;  4Q0C A;  2GHA A;  3OEK A;  4NWC A;  2XX9 A;  3FVO A;  3P7I A;  3PUX E;  3RT6 B;  1QVS A;  3S9L C;  5DVF A;  1JEV A;  2P2A A;  1N3X A;  2OWT A;  1WDN A;  2QL3 A;  3TMG A;  1UTB A;  4PFY A;  3HCQ A;  1I6B A;  3C34 A;  1RYO A;  3PMW A;  4FEC A;  4KR5 A;  1EU8 A;  3HHF A;  1MM6 A;  2O7I A;  2Z23 A;  2DE4 A;  3K6W A;  3W9V A;  3FGS A;  4JSO A;  2ALU A;  4GIZ A;  4XXU A;  3O9P A;  1NNF A;  4GRK A;  2R9J A;  1JET A;  1P1W A;  1YTV A;  3G3G A;  3SER A;  3PMX A;  3G3J A;  3D4C A;  4GQO A;  1MXX A;  1ZJL A;  4JXI A;  1LAH E;  2W7Y A;  4THI A;  5AA3 A;  4QFL A;  2ZYM A;  1B7U A;  5KDT B;  4H1X A;  3PD9 A;  1B1X A;  1GR2 A;  1P1Q A;  4G8N A;  3MWB A;  3TUS A;  4F1U A;  3VVF A;  4OEV A;  3HHG A;  3VV5 A;  4G8H A;  1JW5 A;  1R1N A;  3IB2 A;  4OYV A;  3G3I A;  2DQV A;  3ILU B;  3N94 A;  4U4X A;  1FTO A;  4OET A;  4YKI A;  5BUU A;  1O7T A;  1JVY A;  4C1U A;  2XXT A;  3SEV A;  1M5C A;  5CMC A;  5CC2 A;  1M5E A;  1GTK A;  3LSW A;  4F1V A;  1GGG A;  2YLN A;  1SI1 A;  4PFU A;  3FV1 A;  3GBA A;  1OLA A;  1NL5 A;  4G77 A;  3MZB A;  2CZL A;  2Y7P A;  5KDT A;  3T9U A;  3W9W A;  4P11 A;  4RYA A;  3U1O A;  2XD3 A;  5AA2 D;  3EHU A;  3MZ9 A;  1D3K A;  5BWJ A;  2GH9 A;  1EZO A;  4ZEI A;  3QSL A;  4DZ1 A;  2Q2A A;  2OJT A;  2FYI A;  4WEP A;  1XOC A;  3GLB A;  5I59 B;  1EH3 A;  1USY E;  1B46 A;  4G68 C;  3IOW A;  1IZ1 A;  3N6U A;  4KPT A;  3G3K A;  2P0S A;  3W15 C;  1FQB A;  4NED A;  2AL4 A;  3HN0 A;  1XS5 A;  4LZ7 A;  1Y3Q A;  1B9J A;  1VFE A;  1H76 A;  1UIU A;  4QFO A;  2I6E A;  1XC1 A;  2UVI A;  2DXR A;  1DTG A;  2ABH A;  3CFX A;  5AA1 A;  2GHB A;  4U23 A;  1B32 A;  1LB9 A;  2H25 A;  3K1M A;  4POX A;  1PB7 A;  3H4Z A;  2V93 A;  3PUV E;  1HSJ A;  5ICT A;  1CB6 A;  3KZG A;  5F1Q A;  4F29 A;  3JZJ A;  1O63 A;  3FVG A;  2REG A;  1LLS A;  5I59 A;  4F39 A;  4FAJ A;  2I3W A;  3TKD A;  2VD2 A;  3K4U A;  2V3T A;  4KI0 E;  3S2V A;  2F8D A;  3ZKK A;  3KSX A;  4YKJ A;  2HXW A;  1MXY A;  1IXH A;  4OQO A;  3E13 X;  1UIV A;  3MQ9 A;  5I2K B;  1I69 A;  3OOA A;  4PQJ A;  2DYX A;  3R7X A;  3O66 A;  4LVQ A;  3SEW A;  4BDR A;  2OK2 A;  1MRP A;  4FED A;  3HST A;  4TLM B;  5EHS A;  3CIJ A;  4U4S A;  3VDF A;  2RCA A;  3K1N A;  3C33 A;  2ESN A;  3OEL A;  4PE5 B;  4QSD A;  3I3V A;  4YMB A;  3USD A;  4ZE8 A;  3GZG A;  1B4Z A;  2H9B A;  3TQW A;  2Q8J A;  1PDA A;  1A7L A;  5KCJ B;  1MQG A;  4X1D A;  2PBW A;  5DVJ A;  3Q25 A;  1Y4C A;  4BDO A;  4OZ9 A;  1FQE A;  5I2K A;  3BBR A;  3RN8 A;  5DVI A;  3CFZ A;  4EDP A;  3KEI A;  4U2R A;  3PMV A;  4WED A;  5H8S A;  3ZS6 A;  1DMB A;  2H4I A;  1Q35 A;  4XKP A;  1AL3 A;  3A3U A;  3FIR A;  4IGR A;  4OFL A;  2O1L A;  3FAS A;  5CI5 A;  1ATG A;  1Y3P A;  2OWS A;  4X9T A;  3C32 A;  5FTH A;  1MY2 A;  4LUB A;  3OO9 A;  4G8M A;  1MG1 A;  2XXH A;  1AH5 A;  5KCJ A;  3MW0 A;  1MH3 A;  1R9Q A;  4RY1 A;  1IXC A;  1II5 A;  3H03 A;  2DP8 A;  2O68 A;  3SES A;  1AOV A;  4LZ8 A;  3UOR A;  1BKA A;  5CMM A;  4JSD A;  4OFJ A;  2F78 A;  4C0R A;  2Y7W A;  3EHT A;  3SEY A;  1PB8 A;  4XKQ A;  1IIT A;  4PFT A;  3FD3 A;  3QIM A;  4XTC Q;  3RQT A;  3RNN A;  1QUJ A;  4YMA A;  1UTH B;  3LUY A;  3K00 A;  1RYX A;  2XXW A;  3EN3 A;  1IQ7 A;  4U1O A;  1FTK A;  1USY H;  2G93 A;  3H6T A;  2DWH A;  4NF6 B;  5JEI A;  3SET A;  3SEX A;  2Z8E A;  4ZED A;  4ZEB A;  4JB7 A;  2HCA A;  3RGY A;  5B70 A;  2ZYN A;  1FTM A;  4NF4 B;  3MUQ A;  5LOM A;  3CFL A;  3GBB A;  4IY6 A;  4ELO A;  3C35 A;  1LBB A;  1YPN A;  3O2A A;  4DE8 A;  1Q1K A;  5L9S A;  4ZEK A;  4KYE A;  2XXQ A;  1LCF A;  3MZ1 A;  4NTL A;  1Y1Z A;  2F6P A;  4I62 A;  4F3S A;  4AQ4 A;  1WOD A;  2I0C A;  1UTH A;  1B05 A;  2XX8 A;  1NNT A;  1P1U A;  1F9B A;  4YU0 A;  1FQF A;  2I4C A;  3H3G A;  2V25 A;  4RXL A;  4YB6 A;  3CR9 A;  4NF6 A;  3L6G A;  5CM6 A;  4DXC A;  4NF5 B;  3H6U A;  5F7V A;  2VD3 A;  2RC9 A;  4NF4 A;  1MPD A;  4YKP A;  3C31 A;  3VLU A;  1MDP 1;  2XXR A;  1LFH A;  1R6Z A;  2RC7 A;  1MXZ A;  4PP0 A;  2A5S A;  1B1H A;  2FA7 A;  4ECF A;  3IR1 A;  3E3K A;  3UN6 A;  1Y3N A;  5I56 B;  4EXL A;  4NE4 A;  3FXU A;  3A3C A;  3N6T A;  2B3F A;  4EF2 A;  4EQ7 A;  1S7Y A;  3IK6 B;  3ODB A;  4KYS A;  3T9H B;  4IB2 A;  1J1N A;  4RPO A;  4KD5 A;  3PPR A;  5HBC A;  1ZBM A;  3O28 A;  4Q8R A;  4KYD A;  1B58 A;  5EHM A;  3Q28 A;  3D4G A;  4NF5 A;  5DTB A;  4ELP A;  2D3I A;  1LBC A;  3LSL A;  3QUF A;  4DCY A;  4R74 A;  4OEN A;  3SDF A;  2X26 A;  1D4N A;  3UIF A;  1SYH A;  2QJE A;  4RK2 A;  4JBZ A;  1B40 A;  1MY4 A;  4R6H A;  1IXI A;  5FHO A;  1HSE A;  4R6K A;  2Y7R A;  2RKM A;  4R2B A;  2ZNT A;  4IO3 A;  3JYR A;  5I56 A;  4XKN A;  3V83 A;  3G3F A;  2NUV A;  3VXB A;  4MF3 A;  1R9L A;  1N7W A;  1H45 A;  2V3Q A;  3LC8 A;  4JWY A;  2REJ A;  4AB5 A;  3ILT B;  3TCF A;  2VOZ A;  2F97 A;  1B2H A;  4OMB A;  1BLF A;  5CBR A; 
#chains in the Genus database with same CATH topology
 1LBZ A;  1LAG E;  4PDD A;  3TTK A;  1ZU0 A;  1UQW A;  4R75 A;  2DVZ A;  2Z8D A;  4XIG Q;  4BDQ A;  3OSR A;  3KBZ A;  1QUL A;  3LR1 A;  3KC1 A;  4DCX A;  1FTL A;  3KJ7 A;  3B6Q A;  5I2N B;  1H3D A;  4N81 A;  4O7M A;  4OHN A;  4Z0I A;  1VDW A;  3RY3 A;  4G4P A;  1GV8 A;  3FXB A;  5H8Q B;  3V89 B;  2HEU A;  1FPG A;  2H98 A;  4FE8 A;  1DSN A;  1FTA A;  3CI8 A;  1T0K A;  4K3F A;  4ELQ A;  5DW8 A;  1B5I A;  4ZS9 A;  3I5O A;  1Z7M E;  4FOR A;  4RJZ A;  1MY1 A;  3H6W A;  2VHA A;  2I0B A;  2PCR A;  3DEL B;  3PGF A;  3Q29 A;  4DXB A;  4OVS A;  1OVB A;  4PCD A;  4F19 A;  2BJJ X;  4ESX A;  1B51 A;  1NKX A;  4FIM A;  2FNC A;  4DIG A;  2ONR A;  4AB6 A;  4LQ5 A;  4H65 A;  5I2N A;  5CRY A;  1B6H A;  4KQP A;  4KHZ E;  2DE3 A;  1DPE A;  1WVJ A;  2DXY A;  2XXU A;  1G0I A;  1I6Q A;  2CZI A;  4P0G A;  4H8J A;  1AIV A;  4GLI A;  5H8Q A;  2ZZW A;  4O3C A;  2HXR A;  4ESW A;  3IX1 A;  3VXC A;  3WAE A;  1B3H A;  3VFJ A;  4OWD A;  3FJ7 A;  2B3B A;  1LFI A;  4HE0 A;  4N07 A;  3H6V A;  2RIN A;  4NMY A;  1SQY A;  4N6K A;  1G0H A;  1FQA A;  1OLC A;  2QS3 A;  4P1E A;  3TPA A;  4DLD A;  4PFB A;  2XXX A;  4LON B;  2UVG A;  4R9G A;  2R8T A;  4MBP A;  4OXV A;  1B7Z A;  1TWY A;  4NN3 A;  1FPB A;  4MHF A;  2XA5 A;  3OEM A;  3VLW A;  3M3F A;  4H46 A;  3TTR A;  3IB1 A;  2F7B A;  1P1O A;  2Q2C A;  2QVV A;  1MPB A;  3B50 A;  1RDX A;  2LAO A;  3KBR A;  2HAV A;  3N5L A;  4PBH A;  4IO7 A;  1TT1 A;  4YZZ A;  3S9M C;  3MVW A;  3H06 B;  5H8F B;  4FEB A;  1O64 A;  3HO7 A;  1JVX A;  1EYK A;  1CNQ A;  3BFT A;  3SEU A;  1N7X A;  5ET7 A;  2IEE A;  1EZP A;  4RPN A;  4GOT A;  2WEF A;  1FCK A;  3VVE A;  3MPK A;  2Q8M A;  5F24 A;  4P8B A;  1PBP A;  4OES A;  1B4H A;  1FPD A;  5FTI A;  3G3H A;  4F2Q A;  3A09 A;  3FV2 A;  1H43 A;  3JV9 A;  3U72 A;  4IR8 A;  4U1Z A;  1INP A;  1MH4 A;  4X1B A;  3MVX A;  4FJP A;  1PEB A;  2THI A;  5JK4 A;  1B0H A;  2XWK A;  4OVT A;  3H7M A;  1CE2 A;  4AS5 A;  4ZZA A;  2F6G A;  5I84 A;  1MY3 A;  1JW4 A;  2F35 A;  3RT8 A;  1B5J A;  1FW0 A;  1NI9 A;  4EF1 A;  4RK9 A;  5H8F A;  3VVD A;  2R71 A;  3K02 A;  1PB9 A;  4DDD A;  2HQ0 A;  1S50 A;  5I5P A;  2DSF A;  1ZTY A;  1B52 A;  4EXK A;  4R6Y A;  1K9Y A;  3KOS A;  4N6P A;  4IO4 A;  4OAN A;  1XVX A;  2OBG A;  1FPK A;  3IFA A;  4P1L A;  2V4C A;  4ZZE A;  2KLF A;  3QUJ A;  1Y4T A;  4H5G A;  4MMP A;  5H8N B;  2RC8 A;  4QSE A;  3CRB A;  4HCW A;  2Z8F A;  5IAI A;  1YXI A;  5TP9 B;  1FBH A;  1FBP A;  2KQZ A;  3Q27 A;  1KWH A;  4PBQ A;  4X48 A;  3EPE A;  5K2Y A;  3EF7 A;  3C36 A;  2OCU A;  1FSA A;  1FPI A;  1MM7 A;  5ITO A;  4WKM A;  1A99 A;  3F11 A;  1IIW A;  3B7D A;  3T9V A;  3VLV A;  1QKB A;  3CG3 A;  4M4G A;  2ANJ A;  1MPC A;  5H8H B;  5CBS A;  3T66 A;  4F3P A;  5ELV A;  1M5D A;  2O6A A;  1IMB A;  2V3U A;  5L9M A;  2UYE A;  4G2Z A;  3HPI A;  1SBP A;  3B6W A;  3D1R A;  2XX7 A;  3CG1 A;  4LN5 A;  1S9T A;  2B65 A;  2QS2 A;  2DS9 A;  5H8N A;  1NH7 A;  5HM4 B;  1H44 A;  1KA1 A;  1VR5 A;  5TP9 A;  4N15 A;  5DT6 A;  1B3F A;  4KFQ A;  1IUD A;  3N26 A;  3QMF A;  4PF6 A;  3TCH A;  2OZZ A;  3R6U A;  3FVN A;  4UAC A;  3MP6 A;  3FXR A;  3TYH A;  3FJG A;  2DWA A;  4TQU Q;  1BP5 A;  1LAX A;  4MEV A;  1NNP A;  4PGN A;  3PPP A;  5AA4 B;  3TOD A;  3PPN A;  2RF1 A;  2FIX A;  2CZH A;  3T93 B;  3OO8 A;  4GWX A;  1L5T A;  2Q88 A;  5H8H A;  5JTY B;  2ZNS A;  4ZE9 A;  1NV4 A;  3ISP A;  2NVU B;  4EUO A;  1POY 1;  1A8E A;  2PT1 A;  5FBP A;  2VT5 A;  3IB0 A;  3UGW A;  1URS A;  4RA1 A;  4OER A;  1QUI A;  2L5V A;  3FXQ A;  2P1S A;  2DE2 A;  3PU5 A;  4HTG A;  4MJO A;  5IZZ A;  3IAZ A;  4YAH X;  4ND9 A;  3MVZ A;  1D9V A;  4NHB A;  3KC0 A;  4R73 A;  5ISU A;  2Z22 A;  3KGC A;  4F22 A;  2OX3 A;  5T3J A;  4BDL A;  5DYH A;  2ZXT A;  3BIH A;  2UVJ A;  4H0W A;  4POW A;  3T22 A;  5AA4 A;  3KFM A;  1A40 A;  1ZKB A;  2XXP A;  4P0I A;  3PPQ A;  2ZYK A;  4OVQ A;  1PBQ A;  4EQ9 A;  3DP4 A;  4DXU A;  2F7C A;  2GFE A;  4MLV A;  1NV3 A;  1DTZ A;  3GXA A;  3WAF A;  2WBB A;  5JTY A;  3OD7 A;  3I6V A;  1OIB A;  2I4B A;  4GL8 A;  3UA8 A;  3KJT A;  2ZNU A;  2WKY A;  5K2X A;  1AWB A;  2FHY A;  1A8F A;  5TPA B;  2QMX A;  3MP8 A;  3EKI A;  4MNP A;  4OVR A;  2QSX A;  5EYF A;  1LBY A;  2X7P A;  2Y7I A;  4P47 A;  2Y7K A;  1POT A;  2Y5L A;  4LQ2 A;  4XKR A;  5J16 A;  1IMD A;  4IGT A;  2I48 A;  3U94 A;  3PUY E;  3HV1 A;  4QSC A;  3IOT A;  2CMO A;  3TEL A;  4IO5 A;  1QJM A;  2QRY A;  4HS7 A;  4PET A;  5J1D A;  3MPL A;  1JNF A;  3IFC A;  1US5 A;  3ZSF A;  4LZ5 A;  1ANF A;  4OFO A;  1VSO A;  1SDX A;  4OEU A;  1URD A;  4GXA A;  4Q30 B;  4QBA A;  1LGB C;  1D9Q A;  3TAJ A;  1YCJ A;  4TOZ A;  1QKA A;  1MS7 A;  3MBP A;  1NFT A;  4GWU A;  5TPA A;  1TFD A;  2A5T B;  3TEP A;  4EQB A;  3FJM A;  3K0V A;  4HCY A;  1Y20 A;  5EQ8 A;  5FHM A;  1IEJ A;  4MNI A;  4F31 B;  1M5B A;  4F3B A;  3O6H A;  1HSL A;  4F1Y A;  1MQD A;  1FJ6 A;  2FIE A;  4ISU A;  3U92 A;  2HPG A;  2ONK E;  5AA2 B;  2Y5K A;  1EZ9 A;  3EHS A;  3S4U A;  3V5A A;  4H5F A;  3TTL A;  4H45 A;  4IO6 A;  1N3W A;  1A55 A;  4E0X A;  3MC2 A;  1N76 A;  1ZMG A;  5ESY A;  2XXK A;  4HW8 A;  3CVG A;  3VE1 B;  1AMF A;  4GXS B;  2QVR A;  1YAE A;  3DP8 A;  3IOR A;  2NOO A;  1SVX B;  3O6G A;  5I58 B;  2R6G E;  4ZEF A;  2A5T A;  3PUW E;  5KZT A;  3TTN A;  3LBS A;  3PUZ E;  3FUZ A;  3OO7 A;  4Z7E A;  3R26 A;  4I9D A;  3PPO A;  3CSB A;  1MQI A;  4O8M A;  2H99 A;  2WYP A;  1NH8 A;  2VP1 A;  1DK4 A;  2UXA A;  1TXF A;  2HZK A;  1NUW A;  2YPN A;  1LB8 A;  1FPJ A;  3IL1 B;  4FBP A;  1SD3 A;  1SI0 A;  5AA2 A;  5IM2 A;  4R9F A;  2F5X A;  2AL5 A;  4QFN A;  1B3G A;  2WX9 A;  2ONS A;  2AIX A;  4XFE A;  4MLQ A;  1KZ8 A;  2QPQ A;  3QAX A;  1LFG A;  1US4 A;  1GVC A;  1ZIU A;  5ET8 A;  4O3B A;  3UP9 A;  2D5W A;  4O3A A;  5I58 A;  3KN8 A;  2QVU A;  3L6H A;  4G68 B;  3RYD A;  5CMB A;  1NNK A;  4RNS A;  3S9E A;  3M3K A;  2ZYO A;  2Y84 A;  3QXM A;  3BKI B;  1MY0 A;  4NGU A;  1DOT A;  1FRP A;  1IMC A;  5EYH A;  1IMA A;  4MFI A;  3DP6 A;  2H5Y A;  4F3G A;  3THI A;  1P99 A;  4QF9 A;  1SW5 A;  2O51 A;  3MVY A;  2PVU A;  2NWJ A;  5IZ3 B;  2HFB A;  4LP2 B;  1PC3 A;  4GVO A;  1VFD A;  4U21 A;  3RTF B;  2GRV A;  4IO2 A;  4YB5 A;  4GL0 A;  4OTE A;  2UYF A;  4UA8 A;  2QFL A;  3DLN A;  1OQH A;  3M8U A;  1Z7N E;  4PF8 A;  3PD8 A;  4O94 A;  1QUK A;  4I1D A;  4GBW A;  3BFU A;  2DWI A;  1B3E A;  4G68 A;  1SPI A;  3MP1 A;  1FPF A;  4OVJ A;  3TCG A;  4BDM A;  3OO6 A;  5LTC A;  1XHY A;  3MJN A;  2Q89 A;  3QK6 A;  1SW4 A;  1JW1 A;  1NMU A;  1FBF A;  2DWJ A;  3U8Q A;  1MQH A;  4GWO A;  1MXW A;  3OSQ A;  3K6X A;  1LAF E;  1TFA A;  3T9X B;  1N0T A;  1ZLQ A;  2PMS A;  3O29 A;  3T0J A;  3K2D A;  4M1V A;  3G7W A;  3RTW B;  1BTJ A;  3IO6 A;  2E1S A;  5IZ3 A;  3KSJ A;  4BDN A;  1YYZ A;  2O69 A;  2E0S A;  5TU0 A;  4JWO A;  5B7D A;  1I6A A;  1NV0 A;  4QFK A;  3O97 A;  3PV0 E;  1OVT A;  2AYS A;  4F2O A;  3B6T A;  2IA4 A;  4MX6 A;  1FQD A;  1MXV A;  3RLF E;  3O6I A;  4Q5T A;  2VPO A;  2YJP A;  4KCD A;  4R2F A;  3B8B A;  3LSX A;  4E0W A;  2XHD A;  2CEX A;  1OQG A;  1Y1M A;  2XWV A;  4H6D A;  3RUM A;  4KCC A;  3TQL A;  1XT8 A;  2V84 A;  1FPE A;  3IO4 A;  3TDJ A;  3K6U A;  2M8C A;  2BJI A;  3OEN A;  4I8C A;  3KN3 A;  3E79 A;  1IXG A;  4N8Y A;  1FQC A;  1B7H A;  1N84 A;  4NWD A;  5A5X B;  3TZA A;  4NF8 B;  3C4M A;  1LCT A;  3QYT A;  1FTJ A;  4GD5 A;  4YB7 A;  5ICQ A;  4C1T A;  1JQF A;  4GFR A;  3DM0 A;  3S9N C;  1N04 A;  3KOT A;  5L8D A;  2F36 A;  3ZKL A;  1XVY A;  3K6V A;  2VGQ A;  3FZV A;  2Q9T A;  3IOV A;  3TFL A;  4BLA A;  4F18 A;  1MQJ A;  3CSG A;  4LAT A;  4LA9 A;  2PX1 A;  3E9X A;  4N13 A;  1URG A;  4OVP A;  3V8X B;  5HPQ A;  2XXI A;  4ZDM A;  4MH5 A;  1FBE A;  2HZL A;  1VE4 A;  4FAT A;  2I49 A;  2DVC A;  3FAT A;  1B3L A;  4GBV A;  2B4M A;  5A5X A;  1BK4 A;  2XD2 A;  3IJO B;  2UVH A;  4PFW A;  1D9Y A;  4DI3 D;  4NF8 A;  1FJ9 A;  4YKK A;  2D21 A;  1NV1 A;  1FBD A;  1NV7 A;  3ONM A;  4PGP A;  5L9O A;  3K01 A;  4NAP A;  4YIC A;  1JEU A;  2X7Q A;  4PAF A;  4WXJ A;  4ZEC A;  4U22 A;  1ELJ A;  5FHN A;  1QW0 A;  2RCB A;  2QS1 A;  1EYI A;  1Y9U A;  2F7A A;  3C9H A;  2G29 A;  4P9K A;  4QFP A;  2O84 X;  3Q26 A;  4XEQ A;  1SYI A;  4TLL B;  4JVD A;  3IJX B;  3M3L A;  4L17 A;  3SKP A;  1RKM A;  5IKB A;  5DEX B;  5AE4 A;  3AXF A;  1SW1 A;  3U93 A;  4R72 A;  4GWW A;  1LBW A;  3EQ1 A;  4JDF A;  2PFZ A;  5I57 B;  3E4R A;  5ITP A;  2OLB A;  5M2V A;  1MXU A;  3OMB A;  4H67 A;  3KG2 A;  1M5F A;  4GF8 A;  3TTM A;  3LSF B;  2XXV A;  4NF0 A;  2F34 A;  1MDQ A;  2QMW A;  4QHQ A;  4KXP A;  1B0L A;  2XXY A;  3KN7 A;  1UTB B;  4QRZ A;  2QS4 A;  1SW2 A;  2I58 A;  4ONY A;  2O7U A;  2HAU A;  3IOU A;  4JWX A;  2PYY A;  3UK4 A;  4MIJ A;  2O1M A;  4IY5 A;  3MAM A;  2ZMB A;  1P1N A;  3K1P A;  2DOJ A;  3FVK A;  4ELR A;  4GWY A;  2NXO A;  4H8I A;  3RPW A;  2PT2 A;  3T96 B;  1BIY A;  3RPL B;  3E78 A;  5DEX A;  1LST A;  1DPP A;  4MAG A;  1B5H A;  3OXN A;  2I3V A;  1OMP A;  5CMK A;  1A54 A;  5IGA A;  3ECR A;  5I57 A;  4Q0C A;  2GHA A;  2B4L A;  3OEK A;  4I3Y A;  4UAB A;  4NWC A;  2XX9 A;  3FVO A;  3P7I A;  3PUX E;  1XI6 A;  3RT6 B;  1JP4 A;  1QVS A;  3S9L C;  5DVF A;  1JEV A;  2P2A A;  1N3X A;  2OWT A;  1WDN A;  2QL3 A;  1K9Z A;  4PTK A;  3TMG A;  1UTB A;  4GX4 A;  4PFY A;  3FBP A;  3HCQ A;  1I6B A;  3C34 A;  1RYO A;  2OWZ A;  3PMW A;  4FEC A;  4KR5 A;  1EU8 A;  3HHF A;  1RDZ A;  5LDZ A;  1MM6 A;  2O7I A;  2Z23 A;  2DE4 A;  3K6W A;  3W9V A;  1YZ0 A;  3FGS A;  4JSO A;  1NUX A;  2ALU A;  4GIZ A;  4XXU A;  3O9P A;  1NNF A;  4GRK A;  2R9J A;  3RPL A;  1JET A;  1P1W A;  1YTV A;  3G3G A;  3SER A;  3PMX A;  3G3J A;  3D4C A;  4GQO A;  1MXX A;  1ZJL A;  4JXI A;  1LAH E;  2W7Y A;  4THI A;  5AA3 A;  4QFL A;  2ZYM A;  1B7U A;  5I7I A;  5KDT B;  4H1X A;  3PD9 A;  2Q74 A;  1B1X A;  1GR2 A;  1P1Q A;  4G8N A;  3MWB A;  3TUS A;  4F1U A;  3VVF A;  1KA0 A;  4OEV A;  3HHG A;  2KR0 A;  3VV5 A;  4G8H A;  1R1N A;  1JW5 A;  3IB2 A;  4OYV A;  4PFR A;  3G3I A;  4HXV A;  2DQV A;  3ILU B;  3N94 A;  3MYU A;  3PTY A;  4U4X A;  1FTO A;  4OET A;  4YKI A;  1DBZ A;  5BUU A;  1O7T A;  2FVZ A;  1JVY A;  4C1U A;  2XXT A;  3ROJ A;  3SEV A;  1M5C A;  5CMC A;  5CC2 A;  1M5E A;  4XF5 A;  4PAI A;  1GTK A;  3LSW A;  4F1V A;  1GGG A;  2YLN A;  1SI1 A;  4PFU A;  3FV1 A;  3GBA A;  1OLA A;  1NL5 A;  4G77 A;  3MZB A;  2CZL A;  2Y7P A;  5KDT A;  2MKZ A;  3T9U A;  3W9W A;  4P11 A;  4RYA A;  3U1O A;  2XD3 A;  1IME A;  3EHU A;  3MZ9 A;  5AA2 D;  1D3K A;  4P56 A;  5BWJ A;  2GH9 A;  1EZO A;  4ZEI A;  3QSL A;  4DZ1 A;  2Q2A A;  4I3E A;  4JVI A;  5ET5 A;  2OJT A;  2FYI A;  1EYJ A;  4WEP A;  1XOC A;  5A5L A;  3GLB A;  5I59 B;  1EH3 A;  1USY E;  1B46 A;  4G68 C;  3IOW A;  1IZ1 A;  3N6U A;  4KPT A;  3G3K A;  2P0S A;  3W15 C;  1FQB A;  1DCU A;  4NED A;  2AL4 A;  3HN0 A;  1XS5 A;  4LZ7 A;  1Y3Q A;  1B9J A;  1VFE A;  1H76 A;  1UIU A;  4QFO A;  2I6E A;  1XC1 A;  2UVI A;  2DXR A;  1DTG A;  2ABH A;  3CFX A;  5EQA A;  5AA1 A;  2GHB A;  4U23 A;  1B32 A;  1LB9 A;  2H25 A;  3K1M A;  4POX A;  1PB7 A;  3H4Z A;  2V93 A;  3PUV E;  1HSJ A;  4AS4 A;  5ICT A;  1CB6 A;  3KZG A;  5F1Q A;  4F29 A;  1NV6 A;  3JZJ A;  4G61 A;  1O63 A;  4PC9 A;  3FVG A;  4P3L A;  2REG A;  1LLS A;  4N4U A;  5I59 A;  4F39 A;  4FAJ A;  2I3W A;  1FBG A;  3TKD A;  2VD2 A;  3K4U A;  2V3T A;  4KI0 E;  3S2V A;  2F8D A;  3ZKK A;  3KSX A;  4N6D A;  4YKJ A;  2HXW A;  1MXY A;  1IXH A;  4OQO A;  3E13 X;  1UIV A;  3MQ9 A;  5I2K B;  1I69 A;  3OOA A;  4PQJ A;  2DYX A;  3R7X A;  3O66 A;  4LVQ A;  4MCO A;  4GX3 A;  4I40 A;  3SEW A;  4BDR A;  2OK2 A;  1MRP A;  2F3B A;  4FED A;  3HST A;  2FBP A;  4TLM B;  5EHS A;  1QGX A;  4JVC A;  3CIJ A;  4U4S A;  3VDF A;  5EQ7 A;  2RCA A;  3K1N A;  3C33 A;  2ESN A;  3OEL A;  4PE5 B;  4QSD A;  1IMF A;  3I3V A;  4YMB A;  3USD A;  4ZE8 A;  3GZG A;  1B4Z A;  2H9B A;  3TQW A;  2Q8J A;  1PDA A;  4NG7 A;  1Q9D A;  1A7L A;  5KCJ B;  1MQG A;  4X1D A;  2PBW A;  5DVJ A;  3HFU A;  3Q25 A;  1Y4C A;  4BDO A;  4OZ9 A;  1FQE A;  5I2K A;  3BBR A;  3RN8 A;  5DVI A;  3CFZ A;  4EDP A;  3KEI A;  4U2R A;  3PMV A;  4WED A;  3BIG A;  4N91 A;  5H8S A;  2VPN A;  1NUY A;  3ZS6 A;  1DMB A;  2H4I A;  1Q35 A;  4XKP A;  1AL3 A;  3A3U A;  3FIR A;  4IGR A;  1FBC A;  4OFL A;  2O1L A;  3FAS A;  2CEY A;  5CI5 A;  1ATG A;  2HHM A;  1Y3P A;  2OWS A;  4X9T A;  1RDY A;  4OA4 A;  3C32 A;  5FTH A;  1MY2 A;  4X04 A;  4LUB A;  4O7I A;  2GQ1 A;  3OO9 A;  4G8M A;  1MG1 A;  2XXH A;  1AH5 A;  5KCJ A;  3MW0 A;  1MH3 A;  1R9Q A;  4RY1 A;  4MNC A;  1IXC A;  2JJK A;  1II5 A;  3H03 A;  2DP8 A;  2O68 A;  4DI4 B;  3SES A;  1AOV A;  4LZ8 A;  3UOR A;  1BKA A;  3U65 A;  5CMM A;  4JSD A;  2ZZV A;  4OFJ A;  2F78 A;  4C0R A;  2Y7W A;  3EHT A;  3SEY A;  1PB8 A;  4XKQ A;  1IIT A;  4PFT A;  3FD3 A;  3QIM A;  4XTC Q;  3RQT A;  3RNN A;  1QUJ A;  4YMA A;  1UTH B;  3LUY A;  3K00 A;  1RYX A;  2XXW A;  4QXD A;  3EN3 A;  1IQ7 A;  2XWO A;  4U1O A;  1FTK A;  1USY H;  2G93 A;  5I3S A;  3H6T A;  2ZZX A;  2DWH A;  4NF6 B;  5JEI A;  1LBV A;  3SET A;  3SEX A;  2Z8E A;  4ZED A;  4ZEB A;  4JB7 A;  2HCA A;  4PFI A;  3RGY A;  5B70 A;  2ZYN A;  1FTM A;  4NF4 B;  3MUQ A;  5LOM A;  5EYG A;  3CFL A;  3GBB A;  4IY6 A;  4ELO A;  3C35 A;  4PDH A;  2WYK A;  1LBB A;  1YPN A;  3O2A A;  4DE8 A;  1Q1K A;  5L9S A;  4ZEK A;  4KYE A;  2P3V A;  4N8G A;  1NV5 A;  2XXQ A;  3SZP A;  1LCF A;  3MZ1 A;  2F3D A;  4NTL A;  1Y1Z A;  2F6P A;  4HE1 A;  4I62 A;  4F3S A;  4AQ4 A;  1WOD A;  3NOH A;  2I0C A;  1UTH A;  1B05 A;  4HE2 A;  2XX8 A;  1NNT A;  1P1U A;  2WBD A;  1F9B A;  4YU0 A;  1LEV A;  3CHG A;  3LUZ A;  1FQF A;  2I4C A;  3H3G A;  2V25 A;  4NX1 A;  4PAK A;  4RXL A;  4YB6 A;  3CR9 A;  4NF6 A;  3L6G A;  5CM6 A;  4DXC A;  4NF5 B;  3H6U A;  5F7V A;  3T1B A;  2VD3 A;  2RC9 A;  4NF4 A;  1MPD A;  4YKP A;  3C31 A;  3VLU A;  1FPL A;  1MDP 1;  2XXR A;  1LFH A;  1R6Z A;  2RC7 A;  1MXZ A;  4PP0 A;  2A5S A;  1B1H A;  2FA7 A;  4ECF A;  3IR1 A;  3E3K A;  3UN6 A;  1Y3N A;  5I56 B;  4EXL A;  4NE4 A;  3FXU A;  3A3C A;  3N6T A;  3GYY A;  2B3F A;  4EF2 A;  4EQ7 A;  5EQ9 A;  2PFY A;  1S7Y A;  3IK6 B;  1NUZ A;  3ODB A;  4NQ8 A;  4PE3 A;  4KYS A;  3T9H B;  3A29 A;  4IB2 A;  1J1N A;  4RPO A;  1LBX A;  4KD5 A;  3PPR A;  5HBC A;  1ZBM A;  3O28 A;  4Q8R A;  4KYD A;  1B58 A;  3LV0 A;  5EHM A;  3Q28 A;  3D4G A;  4NF5 A;  5DTB A;  4X8R A;  4ELP A;  2D3I A;  1LBC A;  3LSL A;  3QUF A;  4DCY A;  4R74 A;  4OEN A;  3SDF A;  1NV2 A;  2X26 A;  1D4N A;  3UIF A;  1SYH A;  2QJE A;  4RK2 A;  2CZK A;  4JBZ A;  1B40 A;  1MY4 A;  4R6H A;  4GWZ A;  1IXI A;  5FHO A;  1HSE A;  4R6K A;  2Y7R A;  2XWI A;  2RKM A;  4R2B A;  2ZNT A;  4IO3 A;  3JYR A;  5I56 A;  4XKN A;  3V83 A;  3G3F A;  2NUV A;  3VXB A;  4MF3 A;  1R9L A;  1N7W A;  1H45 A;  5IZ1 A;  4N17 A;  2V3Q A;  3LC8 A;  4JWY A;  2REJ A;  4GWS A;  4AB5 A;  3ILT B;  3TCF A;  3MST A;  2VOZ A;  2F97 A;  5ET6 A;  1B2H A;  4OMB A;  1BLF A;  2P3N A;  4GX6 A;  2DDK A;  5CBR A; 
#chains in the Genus database with same CATH homology
 1LAG E;  3TTK A;  1ZU0 A;  1UQW A;  4R75 A;  2DVZ A;  2Z8D A;  4XIG Q;  4BDQ A;  3OSR A;  1QUL A;  3LR1 A;  4DCX A;  1FTL A;  3KJ7 A;  3B6Q A;  5I2N B;  1H3D A;  4OHN A;  4Z0I A;  3RY3 A;  4G4P A;  1GV8 A;  5H8Q B;  3V89 B;  2HEU A;  2H98 A;  4FE8 A;  1DSN A;  3CI8 A;  1T0K A;  4K3F A;  4ELQ A;  1B5I A;  4ZS9 A;  3I5O A;  1Z7M E;  4FOR A;  4RJZ A;  1MY1 A;  3H6W A;  2VHA A;  2I0B A;  3DEL B;  3PGF A;  3Q29 A;  4DXB A;  1OVB A;  4F19 A;  2BJJ X;  4ESX A;  1B51 A;  1NKX A;  4FIM A;  2FNC A;  4DIG A;  2ONR A;  4AB6 A;  4LQ5 A;  4H65 A;  5I2N A;  5CRY A;  1B6H A;  4KQP A;  4KHZ E;  2DE3 A;  1WVJ A;  1DPE A;  2DXY A;  2XXU A;  1I6Q A;  4P0G A;  4H8J A;  1AIV A;  4GLI A;  5H8Q A;  4O3C A;  4ESW A;  3IX1 A;  3VXC A;  3WAE A;  1B3H A;  3VFJ A;  4OWD A;  3FJ7 A;  2B3B A;  1LFI A;  4N07 A;  3H6V A;  2RIN A;  4NMY A;  1SQY A;  1FQA A;  1OLC A;  2QS3 A;  3TPA A;  4DLD A;  2XXX A;  4LON B;  2UVG A;  4R9G A;  4MBP A;  4OXV A;  1B7Z A;  1TWY A;  3OEM A;  3VLW A;  3M3F A;  3TTR A;  3IB1 A;  2F7B A;  1P1O A;  2Q2C A;  1MPB A;  2LAO A;  3KBR A;  2HAV A;  3N5L A;  4IO7 A;  1TT1 A;  4YZZ A;  3S9M C;  3MVW A;  3H06 B;  5H8F B;  4FEB A;  1O64 A;  3HO7 A;  1JVX A;  3BFT A;  3SEU A;  1N7X A;  2IEE A;  1EZP A;  4RPN A;  4GOT A;  1FCK A;  3VVE A;  3MPK A;  1PBP A;  4OES A;  1B4H A;  5FTI A;  3G3H A;  4F2Q A;  3A09 A;  3FV2 A;  1H43 A;  3JV9 A;  3U72 A;  4U1Z A;  1MH4 A;  4X1B A;  3MVX A;  4FJP A;  1PEB A;  2THI A;  5JK4 A;  1B0H A;  3H7M A;  1CE2 A;  4ZZA A;  2F6G A;  5I84 A;  1MY3 A;  1JW4 A;  2F35 A;  3RT8 A;  1B5J A;  1FW0 A;  4EF1 A;  4RK9 A;  5H8F A;  3VVD A;  2R71 A;  3K02 A;  1PB9 A;  4DDD A;  2HQ0 A;  1S50 A;  2DSF A;  1ZTY A;  1B52 A;  4EXK A;  4R6Y A;  3KOS A;  4N6P A;  4IO4 A;  1XVX A;  2OBG A;  4ZZE A;  2KLF A;  3QUJ A;  1Y4T A;  4H5G A;  5H8N B;  2RC8 A;  4QSE A;  3CRB A;  4HCW A;  2Z8F A;  5IAI A;  5TP9 B;  3Q27 A;  1KWH A;  4X48 A;  3EPE A;  5K2Y A;  3EF7 A;  3C36 A;  2OCU A;  1MM7 A;  5ITO A;  4WKM A;  1A99 A;  3F11 A;  1IIW A;  3B7D A;  3T9V A;  3VLV A;  1QKB A;  3CG3 A;  4M4G A;  2ANJ A;  1MPC A;  5H8H B;  5CBS A;  3T66 A;  4F3P A;  5ELV A;  1M5D A;  2O6A A;  2V3U A;  5L9M A;  2UYE A;  4G2Z A;  3HPI A;  1SBP A;  3B6W A;  2XX7 A;  3CG1 A;  1S9T A;  2B65 A;  2QS2 A;  2DS9 A;  5H8N A;  1NH7 A;  5HM4 B;  1H44 A;  1VR5 A;  5TP9 A;  5DT6 A;  1B3F A;  4KFQ A;  1IUD A;  3N26 A;  3TCH A;  2OZZ A;  3R6U A;  3FVN A;  4UAC A;  3MP6 A;  3FXR A;  3TYH A;  3FJG A;  2DWA A;  4TQU Q;  1BP5 A;  1LAX A;  1NNP A;  3PPP A;  5AA4 B;  3TOD A;  3PPN A;  2RF1 A;  3T93 B;  3OO8 A;  1L5T A;  2Q88 A;  5H8H A;  5JTY B;  2ZNS A;  4ZE9 A;  2NVU B;  4EUO A;  1POY 1;  1A8E A;  2PT1 A;  3IB0 A;  3UGW A;  1URS A;  4RA1 A;  4OER A;  1QUI A;  3FXQ A;  2P1S A;  2DE2 A;  3PU5 A;  4HTG A;  3IAZ A;  4YAH X;  4ND9 A;  3MVZ A;  1D9V A;  4R73 A;  5ISU A;  2Z22 A;  3KGC A;  4F22 A;  4BDL A;  5DYH A;  2ZXT A;  4H0W A;  2UVJ A;  3T22 A;  4POW A;  5AA4 A;  3KFM A;  1A40 A;  1ZKB A;  2XXP A;  4P0I A;  3PPQ A;  2ZYK A;  1PBQ A;  4EQ9 A;  3DP4 A;  4DXU A;  2F7C A;  2GFE A;  4MLV A;  1DTZ A;  3GXA A;  3WAF A;  5JTY A;  3OD7 A;  3I6V A;  1OIB A;  2I4B A;  4GL8 A;  3UA8 A;  3KJT A;  2ZNU A;  2WKY A;  5K2X A;  1A8F A;  5TPA B;  2QMX A;  3MP8 A;  2QSX A;  5EYF A;  2X7P A;  2Y7I A;  2Y7K A;  1POT A;  4LQ2 A;  4XKR A;  4IGT A;  2I48 A;  3U94 A;  3PUY E;  3HV1 A;  4QSC A;  3IOT A;  2CMO A;  3TEL A;  4IO5 A;  1QJM A;  2QRY A;  4HS7 A;  4PET A;  5J1D A;  3MPL A;  1JNF A;  1US5 A;  3ZSF A;  4LZ5 A;  1ANF A;  4OFO A;  1VSO A;  1SDX A;  4OEU A;  1URD A;  4GXA A;  4Q30 B;  1LGB C;  3TAJ A;  1YCJ A;  4TOZ A;  1QKA A;  1MS7 A;  3MBP A;  1NFT A;  5TPA A;  1TFD A;  2A5T B;  3TEP A;  4EQB A;  3FJM A;  3K0V A;  4HCY A;  1Y20 A;  5FHM A;  1IEJ A;  4F31 B;  1M5B A;  4F3B A;  3O6H A;  1HSL A;  4F1Y A;  1MQD A;  4ISU A;  3U92 A;  2ONK E;  5AA2 B;  1EZ9 A;  3EHS A;  3S4U A;  3V5A A;  4H5F A;  3TTL A;  4IO6 A;  1N3W A;  1A55 A;  4E0X A;  3MC2 A;  1N76 A;  1ZMG A;  4HW8 A;  3CVG A;  3VE1 B;  1AMF A;  4GXS B;  1YAE A;  3DP8 A;  3IOR A;  2NOO A;  1SVX B;  3O6G A;  5I58 B;  2R6G E;  4ZEF A;  2A5T A;  3PUW E;  5KZT A;  3TTN A;  3LBS A;  3PUZ E;  3FUZ A;  3OO7 A;  4Z7E A;  3R26 A;  4I9D A;  3PPO A;  3CSB A;  1MQI A;  2H99 A;  1NH8 A;  2VP1 A;  2UXA A;  1TXF A;  2HZK A;  2YPN A;  1LB8 A;  3IL1 B;  1SD3 A;  1SI0 A;  5AA2 A;  4R9F A;  2F5X A;  2AL5 A;  4QFN A;  1B3G A;  2ONS A;  2AIX A;  4MLQ A;  2QPQ A;  3QAX A;  1LFG A;  1US4 A;  1GVC A;  1ZIU A;  4O3B A;  3UP9 A;  2D5W A;  4O3A A;  5I58 A;  3KN8 A;  3L6H A;  4G68 B;  5CMB A;  1NNK A;  4RNS A;  3S9E A;  3M3K A;  2ZYO A;  2Y84 A;  3QXM A;  3BKI B;  1MY0 A;  1DOT A;  4MFI A;  3DP6 A;  2H5Y A;  4F3G A;  3THI A;  1P99 A;  4QF9 A;  1SW5 A;  2O51 A;  3MVY A;  2PVU A;  2NWJ A;  2HFB A;  4LP2 B;  1PC3 A;  4GVO A;  1VFD A;  4U21 A;  3RTF B;  2GRV A;  4IO2 A;  4YB5 A;  4GL0 A;  4OTE A;  2UYF A;  4UA8 A;  3DLN A;  1OQH A;  3M8U A;  1Z7N E;  3PD8 A;  1QUK A;  4I1D A;  3BFU A;  2DWI A;  1B3E A;  4G68 A;  3MP1 A;  4OVJ A;  3TCG A;  4BDM A;  3OO6 A;  1XHY A;  3MJN A;  2Q89 A;  3QK6 A;  1SW4 A;  1JW1 A;  1NMU A;  2DWJ A;  3U8Q A;  1MQH A;  4GWO A;  1MXW A;  3OSQ A;  3K6X A;  1LAF E;  1TFA A;  3T9X B;  1N0T A;  1ZLQ A;  2PMS A;  3O29 A;  3K2D A;  4M1V A;  3G7W A;  3RTW B;  1BTJ A;  3IO6 A;  2E1S A;  3KSJ A;  4BDN A;  2O69 A;  2E0S A;  5TU0 A;  4JWO A;  5B7D A;  1I6A A;  4QFK A;  3O97 A;  3PV0 E;  1OVT A;  2AYS A;  4F2O A;  3B6T A;  2IA4 A;  1FQD A;  1MXV A;  3RLF E;  3O6I A;  4Q5T A;  2YJP A;  4KCD A;  4R2F A;  3LSX A;  4E0W A;  2XHD A;  1OQG A;  1Y1M A;  4H6D A;  3RUM A;  4KCC A;  3TQL A;  1XT8 A;  2V84 A;  3IO4 A;  3TDJ A;  3K6U A;  2M8C A;  3OEN A;  4I8C A;  3KN3 A;  1IXG A;  1FQC A;  1B7H A;  1N84 A;  4NWD A;  5A5X B;  3TZA A;  4NF8 B;  3C4M A;  1LCT A;  3QYT A;  1FTJ A;  4GD5 A;  4YB7 A;  5ICQ A;  4C1T A;  1JQF A;  4GFR A;  3DM0 A;  3S9N C;  1N04 A;  3KOT A;  5L8D A;  2F36 A;  3ZKL A;  1XVY A;  3K6V A;  2VGQ A;  3FZV A;  2Q9T A;  3IOV A;  3TFL A;  4BLA A;  4F18 A;  1MQJ A;  3CSG A;  4LAT A;  4LA9 A;  2PX1 A;  3E9X A;  4N13 A;  1URG A;  5HPQ A;  3V8X B;  2XXI A;  4ZDM A;  4MH5 A;  2HZL A;  1VE4 A;  4FAT A;  2I49 A;  2DVC A;  3FAT A;  1B3L A;  5A5X A;  2XD2 A;  3IJO B;  2UVH A;  4PFW A;  1D9Y A;  4NF8 A;  4YKK A;  2D21 A;  3ONM A;  5L9O A;  3K01 A;  4YIC A;  1JEU A;  2X7Q A;  4WXJ A;  4ZEC A;  4U22 A;  1ELJ A;  5FHN A;  1QW0 A;  2RCB A;  2QS1 A;  1Y9U A;  2F7A A;  3C9H A;  2G29 A;  4QFP A;  2O84 X;  3Q26 A;  1SYI A;  4TLL B;  3IJX B;  3M3L A;  4L17 A;  3SKP A;  1RKM A;  5IKB A;  5DEX B;  5AE4 A;  3AXF A;  1SW1 A;  3U93 A;  4R72 A;  3EQ1 A;  4JDF A;  5I57 B;  3E4R A;  5ITP A;  2OLB A;  5M2V A;  1MXU A;  3OMB A;  4H67 A;  3KG2 A;  1M5F A;  4GF8 A;  3TTM A;  3LSF B;  2XXV A;  2F34 A;  1MDQ A;  2QMW A;  4QHQ A;  1B0L A;  2XXY A;  3KN7 A;  1UTB B;  4QRZ A;  2QS4 A;  1SW2 A;  2I58 A;  4ONY A;  2O7U A;  2HAU A;  3IOU A;  4JWX A;  2PYY A;  3UK4 A;  2O1M A;  4IY5 A;  3MAM A;  2ZMB A;  1P1N A;  3K1P A;  2DOJ A;  3FVK A;  4ELR A;  2NXO A;  4H8I A;  3RPW A;  2PT2 A;  3T96 B;  1BIY A;  5DEX A;  1LST A;  1DPP A;  1B5H A;  3OXN A;  2I3V A;  1OMP A;  5CMK A;  1A54 A;  3ECR A;  5I57 A;  4Q0C A;  2GHA A;  3OEK A;  4NWC A;  2XX9 A;  3FVO A;  3P7I A;  3PUX E;  3RT6 B;  1QVS A;  3S9L C;  5DVF A;  1JEV A;  2P2A A;  1N3X A;  2OWT A;  1WDN A;  2QL3 A;  3TMG A;  1UTB A;  4PFY A;  3HCQ A;  1I6B A;  3C34 A;  1RYO A;  3PMW A;  4FEC A;  4KR5 A;  1EU8 A;  3HHF A;  1MM6 A;  2O7I A;  2Z23 A;  2DE4 A;  3K6W A;  3W9V A;  3FGS A;  4JSO A;  2ALU A;  4GIZ A;  4XXU A;  3O9P A;  1NNF A;  4GRK A;  2R9J A;  1JET A;  1P1W A;  1YTV A;  3G3G A;  3SER A;  3PMX A;  3G3J A;  3D4C A;  4GQO A;  1MXX A;  1ZJL A;  4JXI A;  1LAH E;  2W7Y A;  4THI A;  5AA3 A;  4QFL A;  2ZYM A;  1B7U A;  5KDT B;  4H1X A;  3PD9 A;  1B1X A;  1GR2 A;  1P1Q A;  4G8N A;  3MWB A;  3TUS A;  4F1U A;  3VVF A;  4OEV A;  3HHG A;  3VV5 A;  4G8H A;  1JW5 A;  1R1N A;  3IB2 A;  4OYV A;  3G3I A;  2DQV A;  3ILU B;  3N94 A;  4U4X A;  1FTO A;  4OET A;  4YKI A;  5BUU A;  1O7T A;  1JVY A;  4C1U A;  2XXT A;  3SEV A;  1M5C A;  5CMC A;  5CC2 A;  1M5E A;  1GTK A;  3LSW A;  4F1V A;  1GGG A;  2YLN A;  1SI1 A;  4PFU A;  3FV1 A;  3GBA A;  1OLA A;  1NL5 A;  4G77 A;  3MZB A;  2CZL A;  2Y7P A;  5KDT A;  3T9U A;  3W9W A;  4P11 A;  4RYA A;  3U1O A;  2XD3 A;  5AA2 D;  3EHU A;  3MZ9 A;  1D3K A;  5BWJ A;  2GH9 A;  1EZO A;  4ZEI A;  3QSL A;  4DZ1 A;  2Q2A A;  2OJT A;  2FYI A;  4WEP A;  1XOC A;  3GLB A;  5I59 B;  1EH3 A;  1USY E;  1B46 A;  4G68 C;  3IOW A;  1IZ1 A;  3N6U A;  4KPT A;  3G3K A;  2P0S A;  3W15 C;  1FQB A;  4NED A;  2AL4 A;  3HN0 A;  1XS5 A;  4LZ7 A;  1Y3Q A;  1B9J A;  1VFE A;  1H76 A;  1UIU A;  4QFO A;  2I6E A;  1XC1 A;  2UVI A;  2DXR A;  1DTG A;  2ABH A;  3CFX A;  5AA1 A;  2GHB A;  4U23 A;  1B32 A;  1LB9 A;  2H25 A;  3K1M A;  4POX A;  1PB7 A;  3H4Z A;  2V93 A;  3PUV E;  1HSJ A;  5ICT A;  1CB6 A;  3KZG A;  5F1Q A;  4F29 A;  3JZJ A;  1O63 A;  3FVG A;  2REG A;  1LLS A;  5I59 A;  4F39 A;  4FAJ A;  2I3W A;  3TKD A;  2VD2 A;  3K4U A;  2V3T A;  4KI0 E;  3S2V A;  2F8D A;  3ZKK A;  3KSX A;  4YKJ A;  2HXW A;  1MXY A;  1IXH A;  4OQO A;  3E13 X;  1UIV A;  3MQ9 A;  5I2K B;  1I69 A;  3OOA A;  4PQJ A;  2DYX A;  3R7X A;  3O66 A;  4LVQ A;  3SEW A;  4BDR A;  2OK2 A;  1MRP A;  4FED A;  3HST A;  4TLM B;  5EHS A;  3CIJ A;  4U4S A;  3VDF A;  2RCA A;  3K1N A;  3C33 A;  2ESN A;  3OEL A;  4PE5 B;  4QSD A;  3I3V A;  4YMB A;  3USD A;  4ZE8 A;  3GZG A;  1B4Z A;  2H9B A;  3TQW A;  2Q8J A;  1PDA A;  1A7L A;  5KCJ B;  1MQG A;  4X1D A;  2PBW A;  5DVJ A;  3Q25 A;  1Y4C A;  4BDO A;  4OZ9 A;  1FQE A;  5I2K A;  3BBR A;  3RN8 A;  5DVI A;  3CFZ A;  4EDP A;  3KEI A;  4U2R A;  3PMV A;  4WED A;  5H8S A;  3ZS6 A;  1DMB A;  2H4I A;  1Q35 A;  4XKP A;  1AL3 A;  3A3U A;  3FIR A;  4IGR A;  4OFL A;  2O1L A;  3FAS A;  5CI5 A;  1ATG A;  1Y3P A;  2OWS A;  4X9T A;  3C32 A;  5FTH A;  1MY2 A;  4LUB A;  3OO9 A;  4G8M A;  1MG1 A;  2XXH A;  1AH5 A;  5KCJ A;  3MW0 A;  1MH3 A;  1R9Q A;  4RY1 A;  1IXC A;  1II5 A;  3H03 A;  2DP8 A;  2O68 A;  3SES A;  1AOV A;  4LZ8 A;  3UOR A;  1BKA A;  5CMM A;  4JSD A;  4OFJ A;  2F78 A;  4C0R A;  2Y7W A;  3EHT A;  3SEY A;  1PB8 A;  4XKQ A;  1IIT A;  4PFT A;  3FD3 A;  3QIM A;  4XTC Q;  3RQT A;  3RNN A;  1QUJ A;  4YMA A;  1UTH B;  3LUY A;  3K00 A;  1RYX A;  2XXW A;  3EN3 A;  1IQ7 A;  4U1O A;  1FTK A;  1USY H;  2G93 A;  3H6T A;  2DWH A;  4NF6 B;  5JEI A;  3SET A;  3SEX A;  2Z8E A;  4ZED A;  4ZEB A;  4JB7 A;  2HCA A;  3RGY A;  5B70 A;  2ZYN A;  1FTM A;  4NF4 B;  3MUQ A;  5LOM A;  3CFL A;  3GBB A;  4IY6 A;  4ELO A;  3C35 A;  1LBB A;  1YPN A;  3O2A A;  4DE8 A;  1Q1K A;  5L9S A;  4ZEK A;  4KYE A;  2XXQ A;  1LCF A;  3MZ1 A;  4NTL A;  1Y1Z A;  2F6P A;  4I62 A;  4F3S A;  4AQ4 A;  1WOD A;  2I0C A;  1UTH A;  1B05 A;  2XX8 A;  1NNT A;  1P1U A;  1F9B A;  4YU0 A;  1FQF A;  2I4C A;  3H3G A;  2V25 A;  4RXL A;  4YB6 A;  3CR9 A;  4NF6 A;  3L6G A;  5CM6 A;  4DXC A;  4NF5 B;  3H6U A;  5F7V A;  2VD3 A;  2RC9 A;  4NF4 A;  1MPD A;  4YKP A;  3C31 A;  3VLU A;  1MDP 1;  2XXR A;  1LFH A;  1R6Z A;  2RC7 A;  1MXZ A;  4PP0 A;  2A5S A;  1B1H A;  2FA7 A;  4ECF A;  3IR1 A;  3E3K A;  3UN6 A;  1Y3N A;  5I56 B;  4EXL A;  4NE4 A;  3FXU A;  3A3C A;  3N6T A;  2B3F A;  4EF2 A;  4EQ7 A;  1S7Y A;  3IK6 B;  3ODB A;  4KYS A;  3T9H B;  4IB2 A;  1J1N A;  4RPO A;  4KD5 A;  3PPR A;  5HBC A;  1ZBM A;  3O28 A;  4Q8R A;  4KYD A;  1B58 A;  5EHM A;  3Q28 A;  3D4G A;  4NF5 A;  5DTB A;  4ELP A;  2D3I A;  1LBC A;  3LSL A;  3QUF A;  4DCY A;  4R74 A;  4OEN A;  3SDF A;  2X26 A;  1D4N A;  3UIF A;  1SYH A;  2QJE A;  4RK2 A;  4JBZ A;  1B40 A;  1MY4 A;  4R6H A;  1IXI A;  5FHO A;  1HSE A;  4R6K A;  2Y7R A;  2RKM A;  4R2B A;  2ZNT A;  4IO3 A;  3JYR A;  5I56 A;  4XKN A;  3V83 A;  3G3F A;  2NUV A;  3VXB A;  4MF3 A;  1R9L A;  1N7W A;  1H45 A;  2V3Q A;  3LC8 A;  4JWY A;  2REJ A;  4AB5 A;  3ILT B;  3TCF A;  2VOZ A;  2F97 A;  1B2H A;  4OMB A;  1BLF A;  5CBR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...