3IO6A

Huntingtin amino-terminal region with 17 gln residues - crystal c92-a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
416
structure length
400
Chain Sequence
b'KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQPPPPPPPPPPQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein, HUNTINGTIN FUSION PROTE
publication title Secondary structure of Huntingtin amino-terminal region.
pubmed doi rcsb
source organism Escherichia coli k-12, homo sapiens
molecule tags Signaling protein
total genus 116
structure length 400
sequence length 416
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3io6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3io6A02
5DEXA 4P0IA 4PFYA 1EZPA 4RXLA 3R6UA 2CZLA 4XKPA 3C35A 3RTWB 2F34A 1TXFA 1YAEA 1SW2A 3T9XB 4LUBA 1USYH 1KWHA 1B4ZA 4PQJA 5EHMA 1UTHB 3BFTA 4Q8RA 1UQWA 4GXAA 2UXAA 3H03A 4UACA 5FHOA 2RCBA 2VGQA 5AA2A 3U93A 4ZEDA 4YKKA 5FHNA 3PD8A 1P99A 2I3VA 3G3IA 4ONYA 4LZ5A 4F22A 1XVYA 1LAFE 3VFJA 3ILUB 1M5DA 4AQ4A 3T66A 4WKMA 4AB5A 4RYAA 3O9PA 1SW5A 2XXWA 2F5XA 1NL5A 5ICTA 1JVXA 1PBPA 1S9TA 2ZYOA 4BLAA 1FTOA 3FIRA 1SI1A 5CBRA 3TEPA 1LAGE 2X7QA 3PUVE 3FVOA 5KZTA 4R6YA 4RY1A 1IXGA 3OOAA 1B5IA 1L5TA 2DXYA 2Z22A 4RK9A 3CG3A 3DELB 2KLFA 1ZU0A 5JK4A 3V89B 3K1NA 2Q8JA 4X1DA 4NEDA 3PU5A 3A3UA 2DE2A 4XXUA 3SERA 4DDDA 5AE4A 2Z8EA 4I62A 1B32A 1NKXA 5I2KB 3UK4A 1B51A 2O51A 4YAHX 4FEDA 5A5XA 5JEIA 2ONKE 3PGFA 5CMBA 1PB8A 4FIMA 3TTKA 3UORA 4LP2B 2QSXA 2FNCA 2QRYA 3ZKLA 1HSEA 3O97A 1PB9A 2VOZA 3N5LA 4POXA 5L9SA 3FJGA 1ELJA 2I49A 2O7UA 1RYOA 3SKPA 3S9EA 1QVSA 3CRBA 3G3JA 3QSLA 4ECFA 5CI5A 2I4CA 4F2QA 3OD7A 1B05A 2UVHA 1FTKA 2ZYMA 4GL0A 4F3GA 5AA3A 1SYHA 5I59A 1MH4A 4NMYA 1WVJA 3IK6B 4IO5A 3VVFA 1MDQA 1B9JA 4F3PA 1YPNA 4IO2A 4Q5TA 4ZEFA 4YICA 2DWAA 1URDA 1FTLA 3VV5A 4EUOA 2M8CA 2I3WA 2IA4A 2YPNA 5ISUA 5CMCA 3SEUA 3IO6A 1MQIA 1B7HA 4F2OA 1SBPA 4KFQA 4IO7A 4IY5A 2HZKA 4AB6A 3N6TA 5DVFA 1I69A 4C0RA 3L6HA 3K1MA 3EF7A 3FXRA 2FYIA 3TFLA 4RPNA 3M3KA 1IIWA 3UGWA 3CFZA 3CSGA 1B7UA 2VHAA 2QS3A 3ZS6A 5L9OA 2XXVA 3HO7A 3C31A 4ZZEA 3MZBA 4HS7A 3IX1A 3SDFA 3SEYA 2BJJX 2PYYA 5H8FA 2G93A 1P1WA 3LUYA 5HBCA 5IAIA 4H8JA 3WAEA 2OCUA 2HXWA 3PPRA 5H8NB 4LZ8A 2IEEA 3GXAA 1O63A 5DEXB 3IR1A 4ZZAA 1D9YA 1GVCA 1BKAA 2VD2A 3TDJA 5CC2A 3H3GA 4LQ5A 2UYFA 1MQGA 4X48A 4IY6A 2R71A 2ZYNA 2NWJA 3A3CA 3RT6B 3VLWA 4H5FA 1Y1MA 3RGYA 1JEUA 3T93B 1JETA 1A40A 3TCGA 4ZS9A 2P1SA 4ZECA 4F1UA 1Y9UA 4IO4A 4E0XA 1PB7A 2DWJA 2XXRA 3RLFE 1EU8A 3MP8A 2I48A 4THIA 4WEPA 4ELQA 2D5WA 1B3FA 4GLIA 3QUJA 4ESWA 1XHYA 2H4IA 1SQYA 5I2NA 2V93A 3H6VA 2W7YA 3T9HB 2F6GA 3M3FA 4YZZA 2H5YA 3QIMA 4YB7A 1H44A 3VXCA 1OMPA 2PVUA 4F29A 3K6UA 3EQ1A 1H45A 5EYFA 4G77A 1IITA 1PDAA 3OSQA 3RPWA 2LAOA 4N6PA 3O29A 1CB6A 1D3KA 5KCJA 4KYDA 2A5TA 3HHFA 2RF1A 3SESA 5ICQA 4H8IA 4OVJA 2DS9A 1MS7A 1FW0A 2VP1A 3KSXA 3IAZA 3R26A 1MPBA 3FVNA 5H8SA 5JTYA 4R72A 3IOUA 1OQHA 4JWYA 3KOTA 1LAXA 1YTVA 4FECA 4XKNA 5A5XB 2DVCA 4RK2A 4F1YA 3VLUA 4KPTA 1LFIA 3G3KA 3IO4A 2E1SA 4I8CA 3RQTA 1QUJA 5FHMA 5TP9A 2AIXA 4GF8A 4I9DA 3TELA 1A7LA 2DSFA 2OZZA 2QMWA 3R7XA 3PPNA 4R73A 5CBSA 3O6IA 3KJTA 1AIVA 3LC8A 4EQBA 3ZSFA 2HCAA 2H98A 4G4PA 2F36A 3RY3A 3KZGA 3LSFB 4O3CA 1DTGA 3Q28A 1VFEA 1YCJA 2HQ0A 4OESA 4QFKA 5I59B 2HZLA 3MPLA 3PPPA 3VXBA 2XXIA 3MBPA 4ELOA 3IB2A 4GRKA 5DTBA 4ZDMA 2UVJA 1FQFA 4M4GA 5I56A 3MC2A 1B58A 1I6BA 4QFNA 5FTHA 2ZNTA 5LOMA 1VSOA 1MQJA 4PFWA 4HTGA 3G7WA 4U4XA 1XOCA 2O7IA 1R1NA 1MQDA 3U94A 2XD3A 3CR9A 1A99A 1LCTA 4OTEA 3TTLA 3HSTA 1Y20A 1T0KA 4GFRA 5DVJA 4EF1A 1N7WA 3W9WA 3MW0A 3D4GA 4F3BA 4DIGA 1NH7A 4G8NA 4FATA 1B3HA 4JWOA 3FVGA 1US5A 1URSA 4Q30B 5H8FB 5B70A 5H8QA 3FV1A 1QKBA 3H7MA 4XKQA 3T96B 1UTBA 3EHUA 1B3LA 5HPQA 3O6HA 2Q2CA 3OELA 3MZ1A 3I5OA 2V3TA 4EF2A 1MY1A 1JW1A 4KCCA 1P1UA 2YJPA 1B1HA 2OWTA 4ISUA 1NFTA 4LONB 3LSWA 1II5A 5DVIA 5DT6A 5AA1A 4ND9A 3TCHA 4O3AA 2Y7WA 3OO9A 2RCAA 3ILTB 1Z7NE 1MDP1 1O7TA 2O1LA 1B3EA 2XX7A 4PP0A 3IOWA 4MF3A 4BDMA 4P11A 5H8HA 3B6TA 5I84A 1IXHA 2QS4A 3PUWE 1P1OA 1B7ZA 4QSEA 2ESNA 4DCXA 1IXCA 5I2NB 2NUVA 2THIA 4OZ9A 1NNTA 2DE4A 3SEXA 2OK2A 3H4ZA 1NNFA 1QUIA 2UVIA 4IO3A 3DP4A 5ITPA 3B7DA 3CVGA 4IO6A 4HCWA 4YKIA 1WDNA 3E3KA 1NMUA 1IEJA 5CRYA 4F39A 5L9MA 4EQ7A 1SYIA 3H6UA 1FQAA 3GBBA 4H67A 2Y7IA 3HHGA 3OO6A 2B65A 4LVQA 3MPKA 1Y1ZA 3VDFA 3PUXE 5KCJB 2ZNUA 2A5TB 2P2AA 3T9VA 1A55A 3IJOB 4KHZE 4H65A 1M5EA 3IL1B 3BBRA 3I3VA 3GBAA 1R6ZA 3FATA 5JTYB 1I6AA 4EDPA 1MY2A 3T22A 3VLVA 4NF5A 3QAXA 2XD2A 4U2RA 3Q29A 2ZYKA 2ONSA 2Q89A 1MM7A 3PMVA 2HEUA 3N6UA 1MQHA 3HV1A 5TP9B 3K2DA 4K3FA 3TUSA 4IGRA 3CI8A 2Z8DA 1LB9A 4H6DA 1LBBA 1D9VA 4G68A 2I4BA 2I6EA 3MQ9A 3TPAA 1ZLQA 2F7BA 1Y3NA 1IXIA 1S50A 4RNSA 1JEVA 3CG1A 1VFDA 1QUKA 2DP8A 3N94A 2HAVA 2QL3A 1QKAA 3FZVA 3O2AA 5AA4B 4MBPA 3FJMA 4NE4A 2DE3A 1AH5A 4ELPA 4NTLA 2NVUB 2PT2A 1TT1A 1Z7ME 4YKJA 1N04A 4F18A 3FUZA 3UN6A 3TMGA 4OFJA 5I56B 3L6GA 5BWJA 3CIJA 4NF8A 4RA1A 3GZGA 3IB0A 5I57A 3MUQA 3E13X 3MP1A 4JDFA 5KDTB 3S2VA 1XC1A 1Y4CA 4NWDA 1BP5A 2QPQA 3CFXA 1B40A 2YLNA 3OSRA 2AYSA 3MVZA 1N3XA 1EZOA 1MPCA 3K0VA 3V8XB 3TTMA 1JNFA 4KYEA 5DYHA 2GRVA 3C34A 4P0GA 2PX1A 5I58B 3PUYE 4RJZA 5H8QB 2V3UA 3Q25A 4XIGQ 3KEIA 4UA8A 2D3IA 3S9NC 3C36A 1UTBB 3UIFA 3A09A 2DVZA 3TAJA 3TQWA 2Y84A 4BDLA 3QK6A 4JSOA 3S4UA 3FV2A 4QF9A 2AL5A 3VVDA 4ZEKA 1PBQA 5BUUA 1BIYA 1Y3PA 3M8UA 1SDXA 1R9QA 4OXVA 3KOSA 3MAMA 3H06B 3RT8A 2REJA 2A5SA 1TWYA 4PFUA 2CMOA 4OQOA 1MG1A 1GGGA 1IUDA 4NF4B 3HN0A 4FORA 4EXLA 2H9BA 1B5JA 3OO8A 4C1TA 4KR5A 3MJNA 1RKMA 2XXHA 4BDQA 4F3SA 3TQLA 1S7YA 5H8HB 3GLBA 2R6GE 5F1QA 1MRPA 4TLMB 4TOZA 1FQBA 1SI0A 2GHBA 2DXRA 2REGA 3PD9A 4TLLB 3KG2A 1H43A 5EHSA 2Z8FA 4MLVA 2Z23A 1F9BA 1HSLA 1FQCA 3DLNA 4Q0CA 4POWA 2P0SA 2F7CA 1NNKA 1SW4A 1VE4A 3LBSA 2XX9A 4Z7EA 1QULA 4L17A 4ZE8A 4BDRA 3AXFA 2VD3A 4OYVA 4U1OA 3DM0A 1H3DA 2XXTA 1SVXB 3N26A 3K6XA 2FA7A 5AA4A 4F1VA 3DP8A 1MXWA 4QFPA 5M2VA 3MP6A 2QMXA 1UIVA 3TODA 4H1XA 4N07A 5IKBA 4GD5A 4NF5B 4NWCA 4PE5B 3PUZE 2HFBA 2OBGA 5FTIA 3CFLA 2XXQA 5KDTA 4OFOA 4H5GA 1JVYA 3KN7A 1LB8A 1M5BA 1LFGA 5K2XA 2ONRA 4G68B 4XKRA 3KJ7A 2I0CA 1B52A 4G68C 2ZMBA 4GOTA 1A54A 1M5FA 4DCYA 1CE2A 1B2HA 4FAJA 2ABHA 4DE8A 5I58A 3FGSA 4WXJA 4KYSA 1OLAA 2X7PA 1MY0A 3TCFA 1QJMA 4FEBA 2GHAA 5ITOA 1AMFA 5B7DA 3RNNA 3IJXB 2OWSA 3JZJA 1R9LA 1BLFA 2OLBA 4F19A 1MH3A 4N13A 2V3QA 4FJPA 1JQFA 3U72A 4JXIA 4NF8B 3FXUA 3SETA 5AA2D 4OEVA 2Y7KA 3QUFA 5I57B 1N7XA 4R75A 3KFMA 1TFAA 2XXUA 3O6GA 2HAUA 2O1MA 1XS5A 2DYXA 3G3FA 1LBCA 4NF4A 4OERA 1B46A 4IB2A 4DXBA 4LATA 4LZ7A 5HM4B 4QHQA 3K00A 3FASA 2X26A 4Z0IA 3KGCA 2PMSA 4YMBA 1EZ9A 3OO7A 4QFLA 1FQEA 2E0SA 3EPEA 3PMWA 1DPEA 1GV8A 4GVOA 4HW8A 1P1QA 2Q88A 2I58A 1POY1 4KQPA 4X9TA 1Q1KA 2V25A 2Y7RA 2Q2AA 2RC8A 4GXSB 3WAFA 1SD3A 4O3BA 3ZKKA 1JW5A 1OIBA 3DP6A 3H6TA 1J1NA 1DMBA 4OMBA 1ZTYA 2H25A 3HPIA 1ATGA 1MXYA 1HSJA 1POTA 1AOVA 4JB7A 1USYE 1P1NA 1MXZA 1ZMGA 4R6KA 4R2BA 2WKYA 1O64A 1ZIUA 2F8DA 4U22A 5J1DA 5L8DA 4BDOA 3BKIB 3O28A 3KN8A 3FD3A 3C33A 2O84X 3MWBA 5F7VA 4I1DA 1NH8A 1XVXA 4ZEBA 2XHDA 1GTKA 3K01A 3C9HA 3ONMA 2GH9A 3K4UA 3ECRA 1B0HA 4F31B 5K2YA 1EH3A 2UYEA 1N76A 2RC7A 1OLCA 4G8HA 4WEDA 3ODBA 1DOTA 1MXUA 3K02A 3OXNA 1B1XA 5TPAA 3Q26A 3VE1B 4ZEIA 4PETA 1FQDA 4R9GA 3UA8A 3QYTA 3M3LA 4HCYA 3I6VA 1OQGA 2PBWA 2F7AA 4BDNA 3EHSA 1LSTA 4IGTA 4OENA 4YU0A 2DOJA 1AL3A 3EN3A 3LSXA 4XTCQ 1BTJA 3MVXA 1A8EA 2F35A 1B3GA 3P7IA 4R74A 4NF6B 3RUMA 1TFDA 2XX8A 1UTHA 1H76A 3SEWA 1LGBC 3KN3A 1WODA 3SEVA 3BFUA 4KD5A 4MH5A 3OEKA 2XXYA 3LR1A 2ALUA 1N3WA 3PPOA 4X1BA 4R2FA 4E0WA 3IORA 2RINA 4OHNA 2I0BA 1LFHA 3OEMA 1B6HA 3D4CA 1MY3A 3C4MA 2F6PA 3C32A 1UIUA 2OJTA 3K6WA 4GQOA 1VR5A 4ESXA 1XT8A 3H6WA 1B5HA 3FXQA 4DZ1A 3PPQA 1DSNA 1RYXA 4U21A 1URGA 2NOOA 1ZBMA 2DWHA 1MM6A 3G3HA 2B3BA 3TTNA 2O69A 4OFLA 4G8MA 2O6AA 2V84A 4U1ZA 1B4HA 2QS1A 3JV9A 3U1OA 4KI0E 3RTFB 1Y4TA 3UP9A 3FVKA 3RN8A 1N0TA 1MY4A 5ELVA 2F97A 2R9JA 2D21A 4JWXA 2DQVA 3VVEA 5AA2B 3B6WA 5I2KA 1FTJA 3F11A 4EXKA 4EQ9A 1ANFA 4C1UA 1D4NA 3W9VA 4PFTA 2UVGA 3OMBA 1OVTA 1GR2A 1OVBA 4M1VA 3TTRA 1B0LA 3K1PA 3KSJA 3USDA 3S9LC 3FJ7A 3MZ9A 1IQ7A 2XXXA 3CSBA 4G2ZA 1MXXA 3O66A 3QXMA 3TYHA 4OETA 2PT1A 3W15C 4JBZA 1I6QA 4ZE9A 2DWIA 4DLDA 2QS2A 2Q9TA 2RC9A 4RPOA 4U4SA 2XXPA 1DPPA 4JSDA 1QW0A 1LLSA 4KCDA 3MVWA 4FE8A 2H99A 3G3GA 3PV0E 4DXCA 4GIZA 3V5AA 4OWDA 1N84A 3B6QA 4YKPA 3U8QA 4R6HA 3V83A 3JYRA 1IZ1A 2RKMA 2QJEA 2B3FA 1NNPA 1ZJLA 2ZNSA 2ANJA 1SW1A 2AL4A 2GFEA 5CMKA 4DXUA 5TU0A 3IOTA 2O68A 1LAHE 3PMXA 3TZAA 1FCKA 3KBRA 1M5CA 5CM6A 3S9MC 1ZKBA 4GL8A 3LSLA 4H0WA 1PEBA 4QSCA 2G29A 1US4A 4MLQA 4R9FA 2NXOA 5CMMA 4LA9A 1MPDA 4YMAA 1DTZA 1MXVA 4YB5A 4LQ2A 3K6VA 4NF6A 1FTMA 2F78A 2Y7PA 4U23A 4OEUA 4MFIA 3THIA 4QRZA 3OENA 3EHTA 3IB1A 3TKDA 1A8FA 4QSDA 4QFOA 1JW4A 4ELRA 2ZXTA 3U92A 3Q27A 1LCFA 3E9XA 4YB6A 3T9UA 3E4RA 1Q35A 1PC3A 4GWOA 3IOVA 5TPAB 3MVYA 4TQUQ 5H8NA 3HCQA 1Y3QA
chains in the Genus database with same CATH superfamily
5DEXA 4P0IA 4PFYA 1EZPA 4RXLA 3R6UA 1FBHA 2CZLA 4XKPA 3C35A 3RTWB 4PFRA 2F34A 1FPEA 1TXFA 1YAEA 1SW2A 3T9XB 2QVUA 4LUBA 4O94A 1USYH 3A29A 1KWHA 1B4ZA 1NI9A 4PQJA 5EHMA 1UTHB 3BFTA 4Q8RA 1UQWA 4GXAA 2UXAA 3H03A 4UACA 5FHOA 2RCBA 2VGQA 5AA2A 3U93A 4ZEDA 4YKKA 5FHNA 3PD8A 1P99A 2I3VA 1FJ6A 3G3IA 1VDWA 4KXPA 4ONYA 4LZ5A 4F22A 1XVYA 1LAFE 3VFJA 3ILUB 1M5DA 4AQ4A 3T66A 4PGNA 4WKMA 4AB5A 4RYAA 4I40A 3O9PA 1SW5A 2XXWA 2XWKA 2OWZA 2F5XA 1NL5A 5ICTA 1JVXA 1PBPA 4PAFA 4PF8A 1S9TA 2ZYOA 4BLAA 1FTOA 3FIRA 1SI1A 5CBRA 3TEPA 1LEVA 1LAGE 1NUZA 2X7QA 3PUVE 2B4MA 5I7IA 3FVOA 5KZTA 4R6YA 4RY1A 1IXGA 3OOAA 1NUYA 2JJKA 4LN5A 1B5IA 1L5TA 2DXYA 2Z22A 4RK9A 3CG3A 3DELB 4HE0A 2KLFA 1ZU0A 5JK4A 3V89B 3K1NA 2Q8JA 4X1DA 4NEDA 3PU5A 3A3UA 2DE2A 4XXUA 3SERA 4DDDA 5AE4A 2Z8EA 1KA0A 1B32A 1NKXA 4I62A 5I2KB 5ET7A 4AS5A 3UK4A 1B51A 2O51A 4YAHX 4FEDA 5A5XA 5JEIA 2ONKE 3PGFA 5CMBA 1PB8A 4FIMA 3TTKA 3UORA 4LP2B 4P1EA 5ET5A 1YXIA 2ZZWA 2QSXA 2FNCA 2QRYA 4IR8A 4QBAA 4I3YA 1RDXA 3ZKLA 2CZHA 1HSEA 1XI6A 5J16A 4PAIA 3O97A 1PB9A 2VOZA 3N5LA 4POXA 5L9SA 3FJGA 1ELJA 1FPJA 2I49A 2O7UA 1RYOA 1IMDA 3SKPA 5IZ3B 3S9EA 1QVSA 3CRBA 3G3JA 3QSLA 4ECFA 5CI5A 2I4CA 4F2QA 3OD7A 3ROJA 1B05A 2UVHA 1FTKA 2ZYMA 4GL0A 4F3GA 5AA3A 1SYHA 5I59A 1MH4A 4NMYA 1WVJA 2V4CA 3IK6B 4IO5A 3VVFA 1MDQA 1B9JA 4F3PA 1YPNA 4IO2A 4Q5TA 4P1LA 4ZEFA 4YICA 2DWAA 1URDA 1FTLA 3VV5A 4EUOA 2M8CA 2I3WA 4GWXA 2IA4A 2YPNA 5ISUA 5CMCA 3SEUA 3IO6A 1MQIA 1B7HA 4F2OA 4MJOA 2WYPA 2CZKA 1SBPA 4KFQA 4IO7A 4N91A 4IY5A 2HZKA 4AB6A 3N6TA 5DVFA 1I69A 4MEVA 4C0RA 3L6HA 3K1MA 3EF7A 3FXRA 2FYIA 3TFLA 3KC1A 1FBGA 2MKZA 2HPGA 4RPNA 3M3KA 1IIWA 3UGWA 3CFZA 3CSGA 1B7UA 2VHAA 2QS3A 3ZS6A 5L9OA 2XXVA 3HO7A 3C31A 4ZZEA 3MZBA 4HS7A 3IX1A 3SDFA 2PYYA 2BJJX 4MIJA 3SEYA 5H8FA 2Q8MA 2G93A 2HHMA 1FSAA 1KZ8A 1P1WA 3LUYA 5HBCA 5IAIA 4H8JA 3WAEA 2OCUA 2HXWA 3PPRA 5H8NB 4LZ8A 2IEEA 3GXAA 2VPOA 1Q9DA 1O63A 5DEXB 3IR1A 4N6DA 4ZZAA 1D9YA 1GVCA 1BKAA 2VD2A 3TDJA 5CC2A 3H3GA 4LQ5A 2UYFA 1FPFA 1MQGA 4P47A 4X48A 4IY6A 2R71A 2ZYNA 4N6KA 2NWJA 3A3CA 1G0HA 3RT6B 3VLWA 4H5FA 1Y1MA 3RGYA 4H45A 1JEUA 3T93B 1JETA 1A40A 3TCGA 4DI4B 4ZS9A 2P1SA 4ZECA 4F1UA 4DI3D 1Y9UA 4P56A 4IO4A 4E0XA 1PB7A 2DWJA 2XXRA 3RLFE 1EU8A 3MP8A 2I48A 4THIA 4WEPA 4ELQA 2D5WA 1B3FA 4GLIA 3QUJA 4PF6A 1XHYA 2H4IA 4ESWA 1SQYA 5I2NA 2V93A 3H6VA 2W7YA 3T9HB 3FBPA 1LBVA 2F6GA 3M3FA 4YZZA 2H5YA 3QIMA 4YB7A 1NV7A 1H44A 5EYGA 3VXCA 4N8GA 1OMPA 4PBQA 2PVUA 1LBZA 4F29A 3K6UA 3EQ1A 1H45A 4XF5A 5EYFA 4PDHA 5F24A 5IGAA 4G77A 1IITA 1PDAA 3OSQA 3RPWA 2LAOA 4N6PA 3O29A 1CB6A 2QVVA 1D3KA 5KCJA 4KYDA 2A5TA 3HHFA 2RF1A 3SESA 3LV0A 5ICQA 4H8IA 4I3EA 2DS9A 4OVJA 1NV5A 1MS7A 1FW0A 2VP1A 4N8YA 3KSXA 3IAZA 1BK4A 3R26A 1MPBA 1DCUA 3FVNA 5H8SA 5JTYA 4R72A 3IOUA 2DDKA 1OQHA 4JWYA 3KOTA 1LAXA 1YTVA 4FECA 4XKNA 5A5XB 2DVCA 4RK2A 4F1YA 3VLUA 1FPDA 4KPTA 1LFIA 3G3KA 4HXVA 3IO4A 2E1SA 4I8CA 4X04A 5I3SA 5IM2A 3RQTA 1QUJA 5FHMA 5TP9A 1FPKA 2AIXA 4GF8A 4I9DA 3TELA 3T1BA 1A7LA 2DSFA 2OZZA 2FHYA 2QMWA 3R7XA 5EQ9A 3PPNA 4OANA 4R73A 2F3DA 5CBSA 3O6IA 3KJTA 1AIVA 3LC8A 4EQBA 3ZSFA 5ESYA 2HCAA 2H98A 4G4PA 2F36A 3RY3A 3KZGA 3LSFB 4O3CA 1FBFA 1DTGA 2BJIA 3Q28A 1VFEA 1YCJA 2HQ0A 4OESA 2Q74A 4QFKA 2HZLA 5I59B 3MPLA 3PPPA 3VXBA 2XXIA 3MBPA 4NN3A 4ELOA 3IB2A 4GRKA 5DTBA 4ZDMA 2UVJA 4XEQA 1FQFA 1YYZA 4M4GA 2B4LA 5I56A 3MC2A 3E78A 1B58A 1I6BA 4X8RA 4QFNA 5FTHA 2ZNTA 5LOMA 1MQJA 1VSOA 4PFWA 4HTGA 3G7WA 4U4XA 1XOCA 3GYYA 2O7IA 1R1NA 1MQDA 4JVDA 3U94A 2XD3A 1NV1A 3CR9A 4P9KA 1A99A 2Y5LA 1LCTA 4OTEA 3TTLA 3HSTA 1Y20A 1T0KA 4GFRA 4JVCA 5DVJA 4EF1A 1N7WA 3W9WA 3MW0A 3D4GA 4F3BA 4DIGA 1NH7A 4G8NA 4FATA 1B3HA 3RPLA 4JWOA 3FVGA 1US5A 5EQ8A 1URSA 4Q30B 5H8FB 5B70A 5H8QA 5T3JA 3FV1A 1QKBA 3H7MA 4XKQA 3T96B 1UTBA 3EHUA 1B3LA 5HPQA 3O6HA 2Q2CA 2KQZA 3OELA 3MZ1A 3I5OA 2V3TA 4EF2A 1MY1A 1JW1A 4KCCA 1P1UA 2YJPA 1B1HA 2OWTA 4ISUA 1NFTA 3B50A 4LONB 3SZPA 3LSWA 1II5A 5DVIA 5DT6A 5AA1A 4ND9A 1EYIA 3TCHA 4O3AA 2Y7WA 3OO9A 2RCAA 3ILTB 1Z7NE 1MDP1 1EYKA 1O7TA 3NOHA 2O1LA 1B3EA 2XX7A 4PP0A 3IOWA 4MF3A 4BDMA 4P11A 3RYDA 5H8HA 3B6TA 5I84A 1IXHA 2QS4A 3PUWE 1P1OA 1B7ZA 4QSEA 2ESNA 4PGPA 4DCXA 1IXCA 5I2NB 2NUVA 2XA5A 2THIA 4OZ9A 1NNTA 2DE4A 3SEXA 1LBWA 2OK2A 3H4ZA 1NNFA 1QUIA 2UVIA 4IO3A 3DP4A 5ITPA 3B7DA 1FJ9A 3CVGA 4IO6A 4HCWA 4YKIA 1WDNA 1KA1A 2CEYA 3E3KA 1NMUA 1IEJA 5CRYA 4JVIA 4NAPA 2WBBA 4F39A 5L9MA 4EQ7A 1SYIA 3H6UA 1FQAA 3GBBA 4H67A 2Y7IA 3HHGA 3OO6A 4PC9A 2B65A 4LVQA 3MPKA 1Y1ZA 2PFZA 3VDFA 3PUXE 5KCJB 5LDZA 2ZNUA 4MNPA 2A5TB 2P2AA 3T9VA 1A55A 3IJOB 4KHZE 1NV6A 4H65A 2WYKA 2ZZXA 1M5EA 3IL1B 3BBRA 3I3VA 3GBAA 4MNIA 1R6ZA 3FATA 5JTYB 1LBYA 1I6AA 4EDPA 1MY2A 3D1RA 3T22A 3VLVA 2WEFA 4NF0A 4NF5A 3QAXA 2XD2A 4O7MA 4U2RA 3Q29A 2ZYKA 2ONSA 2Q89A 1MM7A 3PMVA 2HEUA 3N6UA 1IMEA 4QXDA 1MQHA 2WBDA 2F3BA 3HV1A 5TP9B 3K2DA 4K3FA 3TUSA 4IGRA 3CI8A 4P8BA 2Z8DA 1FBCA 1LB9A 4H6DA 1LBBA 1D9VA 4G68A 2I4BA 2I6EA 3MQ9A 4OVPA 3E79A 3TPAA 1ZLQA 2F7BA 1Y3NA 1IXIA 1S50A 4RNSA 5EQ7A 1JEVA 3CG1A 1VFDA 1QUKA 4O8MA 2DP8A 3N94A 2HAVA 2QL3A 3KBZA 1QKAA 3FZVA 3O2AA 5AA4B 4MBPA 3FJMA 4NG7A 4NE4A 2DE3A 1AH5A 4ELPA 4NTLA 2P3NA 4P3LA 2NVUB 2PT2A 1DK4A 1TT1A 1Z7ME 2XXKA 4YKJA 1FTAA 1N04A 4F18A 3FUZA 3UN6A 3TMGA 4OFJA 5I56B 3L6GA 5BWJA 3CIJA 4NF8A 4RA1A 3GZGA 3IB0A 5I57A 3MSTA 3MUQA 3E13X 4MHFA 3MP1A 4JDFA 5KDTB 3S2VA 1XC1A 1Y4CA 4NWDA 1BP5A 2QPQA 3CFXA 1B40A 2YLNA 3IFAA 3OSRA 4PTKA 2AYSA 3MVZA 1N3XA 1EZOA 1MPCA 3K0VA 3V8XB 3TTMA 3RPLB 1JNFA 4KYEA 5DYHA 2GRVA 3C34A 1JP4A 4P0GA 2PX1A 5I58B 3PUYE 4RJZA 5H8QB 2V3UA 3Q25A 4XIGQ 3KEIA 4UA8A 2D3IA 3S9NC 3C36A 3HFUA 2FIEA 1UTBB 2VT5A 3UIFA 3A09A 2DVZA 3TAJA 3TQWA 2Y84A 4BDLA 3QK6A 4JSOA 4OA4A 3S4UA 3FV2A 4PFIA 4QF9A 2AL5A 3VVDA 4ZEKA 1PBQA 5BUUA 1BIYA 1Y3PA 3M8UA 3QMFA 1SDXA 1R9QA 4OXVA 1RDYA 3KOSA 4GWWA 3MAMA 3H06B 3RT8A 2REJA 2A5SA 1TWYA 4PFUA 2CMOA 4OQOA 4H46A 1MG1A 1GGGA 1IUDA 4NF4B 3HN0A 4FORA 4EXLA 2H9BA 1B5JA 3OO8A 4C1TA 4KR5A 1DBZA 3MJNA 1FPIA 1RKMA 4GBVA 2XXHA 4BDQA 4F3SA 3TQLA 1S7YA 4GWSA 2QFLA 5H8HB 3GLBA 2R6GE 5F1QA 1MRPA 1IMFA 1LBXA 4TLMB 4TOZA 4FBPA 1FQBA 1SI0A 2GHBA 2DXRA 2REGA 3PD9A 4TLLB 1IMBA 3ISPA 3KG2A 2XWOA 1H43A 5EHSA 2Z8FA 4MLVA 2Z23A 1F9BA 1HSLA 4HE2A 1FQCA 3DLNA 4Q0CA 2OX3A 4POWA 2P0SA 2F7CA 1NNKA 1SW4A 1VE4A 3LBSA 4MAGA 2XX9A 4Z7EA 1QULA 4L17A 4ZE8A 4BDRA 3AXFA 2VD3A 4OYVA 4U1OA 1D9QA 3DM0A 1H3DA 2XXTA 1SVXB 1FPLA 3N26A 3K6XA 2FA7A 5AA4A 4XFEA 4F1VA 3DP8A 5IZZA 1K9ZA 1MXWA 4QFPA 5M2VA 3MP6A 2QMXA 1UIVA 3TODA 4H1XA 4N07A 3FXBA 4GX4A 4GD5A 5IKBA 2CEXA 2XWVA 4NF5B 4NWCA 4PE5B 3PUZE 4GWUA 2HFBA 2OBGA 5FTIA 3CFLA 3EKIA 1RDZA 2XXQA 5KDTA 4OFOA 4H5GA 1JVYA 3KN7A 2PCRA 4GBWA 4N17A 1LB8A 1M5BA 1LFGA 3BIHA 5K2XA 2ONRA 4G68B 4XKRA 3KJ7A 2I0CA 1B52A 4G68C 2ZMBA 4GOTA 1A54A 2CZIA 1M5FA 4NGUA 4DCYA 1CE2A 1IMAA 1B2HA 2ABHA 4DE8A 4FAJA 5I58A 3FGSA 4WXJA 4KYSA 1OLAA 2X7PA 1MY0A 3TCFA 1QJMA 4FEBA 2GHAA 5ITOA 1AMFA 5B7DA 3RNNA 3IJXB 2OWSA 3JZJA 4GWZA 1R9LA 1BLFA 2OLBA 4F19A 1MH3A 4N13A 2V3QA 4FJPA 1JQFA 3U72A 4JXIA 4NF8B 3FXUA 3SETA 5AA2D 4PBHA 4OEVA 2Y7KA 3QUFA 4UABA 5I57B 1N7XA 4R75A 3KFMA 1TFAA 2XXUA 3O6GA 2HAUA 2O1MA 1XS5A 2DYXA 3G3FA 1LBCA 4PAKA 4MNCA 4NF4A 4OERA 1B46A 4IB2A 4DXBA 4LATA 4LZ7A 2VPNA 5HM4B 4QHQA 3K00A 3FASA 5EQAA 2X26A 4Z0IA 5A5LA 3KGCA 1NV0A 2PMSA 2R8TA 4YMBA 1EZ9A 3OO7A 4QFLA 1FQEA 2E0SA 3EPEA 3PMWA 1DPEA 1GV8A 1AWBA 4GVOA 4HW8A 1P1QA 2Q88A 2I58A 1POY1 4KQPA 4X9TA 5DW8A 1Q1KA 2V25A 2Y7RA 2Q2AA 2RC8A 4GXSB 3WAFA 1NUXA 1SD3A 4O3BA 3ZKKA 1JW5A 1OIBA 3DP6A 3CHGA 3H6TA 1J1NA 1DMBA 4OMBA 1SPIA 4PFBA 1ZTYA 2H25A 3HPIA 1QGXA 1ATGA 1MXYA 1HSJA 1POTA 2Y5KA 1AOVA 4JB7A 1USYE 2ZZVA 1P1NA 1MXZA 1ZMGA 4R6KA 4R2BA 5EYHA 2WKYA 1O64A 1ZIUA 2F8DA 4U22A 5J1DA 5L8DA 4BDOA 3BKIB 3O28A 1NUWA 3KN8A 4GWYA 3FD3A 3C33A 2O84X 3MWBA 5F7VA 4I1DA 1NH8A 1XVXA 5FBPA 4ZEBA 3MYUA 2XHDA 1GTKA 4GX6A 4N15A 3K01A 3C9HA 3ONMA 2GH9A 3K4UA 3ECRA 1B0HA 4F31B 5K2YA 1EH3A 2UYEA 1N76A 2RC7A 1FPBA 3KC0A 1OLCA 3LUZA 4G8HA 4WEDA 3ODBA 1DOTA 1MXUA 3K02A 1FBPA 3OXNA 1B1XA 5TPAA 3Q26A 3VE1B 4ZEIA 4PETA 1FQDA 4R9GA 3UA8A 3QYTA 3M3LA 4HCYA 3I6VA 1OQGA 5ET8A 2PBWA 2F7AA 4BDNA 3EHSA 1LSTA 4IGTA 4OENA 4YU0A 1EYJA 2DOJA 1AL3A 2L5VA 3EN3A 3LSXA 4XTCQ 1BTJA 1FPGA 3MVXA 2HXRA 1A8EA 2F35A 1B3GA 3P7IA 4R74A 4NF6B 3RUMA 1TFDA 2XX8A 1UTHA 1H76A 3SEWA 1LGBC 3KN3A 1WODA 3SEVA 3BFUA 2XWIA 4KD5A 4MH5A 4NHBA 1FBDA 4PE3A 3OEKA 2XXYA 3LR1A 2ALUA 1N3WA 3PPOA 4X1BA 5IZ1A 4R2FA 4E0WA 3IORA 2RINA 4OHNA 2I0BA 1LFHA 3OEMA 1B6HA 2GQ1A 3D4CA 1MY3A 3C4MA 2F6PA 3C32A 1UIUA 1CNQA 2OJTA 3K6WA 4GQOA 1VR5A 4ESXA 1XT8A 3H6WA 1B5HA 3FXQA 4DZ1A 3PPQA 1DSNA 1RYXA 2KR0A 4U21A 1URGA 2NOOA 1ZBMA 2DWHA 1MM6A 3G3HA 2B3BA 3TTNA 2O69A 3PTYA 4OFLA 4G8MA 2O6AA 4MCOA 2FBPA 4U1ZA 2V84A 1B4HA 2QS1A 3JV9A 3U1OA 4PDDA 1K9YA 4KI0E 3RTFB 1Y4TA 3UP9A 1INPA 2QVRA 3FVKA 3RN8A 1N0TA 4PCDA 1MY4A 1NV3A 5ELVA 2F97A 1IMCA 2R9JA 2D21A 4OVSA 4JWXA 2DQVA 3VVEA 5AA2B 3B6WA 5I2KA 1FTJA 3F11A 4EXKA 4EQ9A 1ANFA 1FBEA 4C1UA 1D4NA 4N81A 4AS4A 5LTCA 1YZ0A 3W9VA 4PFTA 2UVGA 3OMBA 1OVTA 1GR2A 1OVBA 4M1VA 3TTRA 1B0LA 3K1PA 3KSJA 3USDA 3S9LC 3FJ7A 3MZ9A 1IQ7A 2XXXA 3CSBA 4G2ZA 1MXXA 3O66A 3QXMA 3TYHA 4OETA 2PT1A 3W15C 4JBZA 1I6QA 4ZE9A 2DWIA 4DLDA 4G61A 2QS2A 2Q9TA 2RC9A 4RPOA 2WX9A 4U4SA 2XXPA 1DPPA 4JSDA 1QW0A 5IZ3A 3T0JA 1LLSA 4OVRA 1G0IA 4KCDA 3MVWA 4FE8A 2H99A 3G3GA 3PV0E 4DXCA 4GIZA 3V5AA 4OWDA 1N84A 3B6QA 4YKPA 3U8QA 4NQ8A 4R6HA 3V83A 2FVZA 4HE1A 3JYRA 1IZ1A 2RKMA 2PFYA 2QJEA 2B3FA 1NNPA 1ZJLA 2ZNSA 2ANJA 1SW1A 2AL4A 2GFEA 4NX1A 5CMKA 4DXUA 5TU0A 3IOTA 3B8BA 2O68A 1LAHE 1FRPA 3PMXA 4OVTA 3TZAA 1FCKA 3KBRA 1M5CA 5CM6A 3S9MC 1ZKBA 4GL8A 4OVQA 3LSLA 4H0WA 1PEBA 4QSCA 2G29A 1US4A 1NV4A 4MLQA 3IFCA 4O7IA 4R9FA 2NXOA 5CMMA 4LA9A 1MPDA 4YMAA 1DTZA 1MXVA 4YB5A 2FIXA 4LQ2A 3K6VA 4NF6A 1FTMA 3BIGA 2F78A 2Y7PA 4U23A 4OEUA 4MFIA 3THIA 4QRZA 3OENA 3EHTA 5I5PA 3IB1A 3TKDA 4GX3A 1A8FA 1NV2A 4QSDA 5ET6A 4QFOA 1JW4A 4ELRA 4MX6A 2ZXTA 3U92A 3Q27A 1LCFA 3E9XA 2P3VA 4YB6A 3T9UA 3E4RA 1Q35A 3U65A 1PC3A 4MMPA 4GWOA 3IOVA 5TPAB 3MVYA 4TQUQ 4N4UA 5H8NA 3HCQA 1Y3QA
chains in the Genus database with same CATH topology
5DEXA 4P0IA 4PFYA 1EZPA 4RXLA 3R6UA 2CZLA 4XKPA 3C35A 3RTWB 2F34A 1TXFA 1YAEA 1SW2A 3T9XB 4LUBA 1USYH 1KWHA 1B4ZA 4PQJA 5EHMA 1UTHB 3BFTA 4Q8RA 1UQWA 4GXAA 2UXAA 3H03A 4UACA 5FHOA 2RCBA 2VGQA 5AA2A 3U93A 4ZEDA 4YKKA 5FHNA 3PD8A 1P99A 2I3VA 3G3IA 4ONYA 4LZ5A 4F22A 1XVYA 1LAFE 3VFJA 3ILUB 1M5DA 4AQ4A 3T66A 4WKMA 4AB5A 4RYAA 3O9PA 1SW5A 2XXWA 2F5XA 1NL5A 5ICTA 1JVXA 1PBPA 1S9TA 2ZYOA 4BLAA 1FTOA 3FIRA 1SI1A 5CBRA 3TEPA 1LAGE 2X7QA 3PUVE 3FVOA 5KZTA 4R6YA 4RY1A 1IXGA 3OOAA 1B5IA 1L5TA 2DXYA 2Z22A 4RK9A 3CG3A 3DELB 2KLFA 1ZU0A 5JK4A 3V89B 3K1NA 2Q8JA 4X1DA 4NEDA 3PU5A 3A3UA 2DE2A 4XXUA 3SERA 4DDDA 5AE4A 2Z8EA 4I62A 1B32A 1NKXA 5I2KB 3UK4A 1B51A 2O51A 4YAHX 4FEDA 5A5XA 5JEIA 2ONKE 3PGFA 5CMBA 1PB8A 4FIMA 3TTKA 3UORA 4LP2B 2QSXA 2FNCA 2QRYA 3ZKLA 1HSEA 3O97A 1PB9A 2VOZA 3N5LA 4POXA 5L9SA 3FJGA 1ELJA 2I49A 2O7UA 1RYOA 3SKPA 3S9EA 1QVSA 3CRBA 3G3JA 3QSLA 4ECFA 5CI5A 2I4CA 4F2QA 3OD7A 1B05A 2UVHA 1FTKA 2ZYMA 4GL0A 4F3GA 5AA3A 1SYHA 5I59A 1MH4A 4NMYA 1WVJA 3IK6B 4IO5A 3VVFA 1MDQA 1B9JA 4F3PA 1YPNA 4IO2A 4Q5TA 4ZEFA 4YICA 2DWAA 1URDA 1FTLA 3VV5A 4EUOA 2M8CA 2I3WA 2IA4A 2YPNA 5ISUA 5CMCA 3SEUA 3IO6A 1MQIA 1B7HA 4F2OA 1SBPA 4KFQA 4IO7A 4IY5A 2HZKA 4AB6A 3N6TA 5DVFA 1I69A 4C0RA 3L6HA 3K1MA 3EF7A 3FXRA 2FYIA 3TFLA 4RPNA 3M3KA 1IIWA 3UGWA 3CFZA 3CSGA 1B7UA 2VHAA 2QS3A 3ZS6A 5L9OA 2XXVA 3HO7A 3C31A 4ZZEA 3MZBA 4HS7A 3IX1A 3SDFA 3SEYA 2BJJX 2PYYA 5H8FA 2G93A 1P1WA 3LUYA 5HBCA 5IAIA 4H8JA 3WAEA 2OCUA 2HXWA 3PPRA 5H8NB 4LZ8A 2IEEA 3GXAA 1O63A 5DEXB 3IR1A 4ZZAA 1D9YA 1GVCA 1BKAA 2VD2A 3TDJA 5CC2A 3H3GA 4LQ5A 2UYFA 1MQGA 4X48A 4IY6A 2R71A 2ZYNA 2NWJA 3A3CA 3RT6B 3VLWA 4H5FA 1Y1MA 3RGYA 1JEUA 3T93B 1JETA 1A40A 3TCGA 4ZS9A 2P1SA 4ZECA 4F1UA 1Y9UA 4IO4A 4E0XA 1PB7A 2DWJA 2XXRA 3RLFE 1EU8A 3MP8A 2I48A 4THIA 4WEPA 4ELQA 2D5WA 1B3FA 4GLIA 3QUJA 4ESWA 1XHYA 2H4IA 1SQYA 5I2NA 2V93A 3H6VA 2W7YA 3T9HB 2F6GA 3M3FA 4YZZA 2H5YA 3QIMA 4YB7A 1H44A 3VXCA 1OMPA 2PVUA 4F29A 3K6UA 3EQ1A 1H45A 5EYFA 4G77A 1IITA 1PDAA 3OSQA 3RPWA 2LAOA 4N6PA 3O29A 1CB6A 1D3KA 5KCJA 4KYDA 2A5TA 3HHFA 2RF1A 3SESA 5ICQA 4H8IA 4OVJA 2DS9A 1MS7A 1FW0A 2VP1A 3KSXA 3IAZA 3R26A 1MPBA 3FVNA 5H8SA 5JTYA 4R72A 3IOUA 1OQHA 4JWYA 3KOTA 1LAXA 1YTVA 4FECA 4XKNA 5A5XB 2DVCA 4RK2A 4F1YA 3VLUA 4KPTA 1LFIA 3G3KA 3IO4A 2E1SA 4I8CA 3RQTA 1QUJA 5FHMA 5TP9A 2AIXA 4GF8A 4I9DA 3TELA 1A7LA 2DSFA 2OZZA 2QMWA 3R7XA 3PPNA 4R73A 5CBSA 3O6IA 3KJTA 1AIVA 3LC8A 4EQBA 3ZSFA 2HCAA 2H98A 4G4PA 2F36A 3RY3A 3KZGA 3LSFB 4O3CA 1DTGA 3Q28A 1VFEA 1YCJA 2HQ0A 4OESA 4QFKA 5I59B 2HZLA 3MPLA 3PPPA 3VXBA 2XXIA 3MBPA 4ELOA 3IB2A 4GRKA 5DTBA 4ZDMA 2UVJA 1FQFA 4M4GA 5I56A 3MC2A 1B58A 1I6BA 4QFNA 5FTHA 2ZNTA 5LOMA 1VSOA 1MQJA 4PFWA 4HTGA 3G7WA 4U4XA 1XOCA 2O7IA 1R1NA 1MQDA 3U94A 2XD3A 3CR9A 1A99A 1LCTA 4OTEA 3TTLA 3HSTA 1Y20A 1T0KA 4GFRA 5DVJA 4EF1A 1N7WA 3W9WA 3MW0A 3D4GA 4F3BA 4DIGA 1NH7A 4G8NA 4FATA 1B3HA 4JWOA 3FVGA 1US5A 1URSA 4Q30B 5H8FB 5B70A 5H8QA 3FV1A 1QKBA 3H7MA 4XKQA 3T96B 1UTBA 3EHUA 1B3LA 5HPQA 3O6HA 2Q2CA 3OELA 3MZ1A 3I5OA 2V3TA 4EF2A 1MY1A 1JW1A 4KCCA 1P1UA 2YJPA 1B1HA 2OWTA 4ISUA 1NFTA 4LONB 3LSWA 1II5A 5DVIA 5DT6A 5AA1A 4ND9A 3TCHA 4O3AA 2Y7WA 3OO9A 2RCAA 3ILTB 1Z7NE 1MDP1 1O7TA 2O1LA 1B3EA 2XX7A 4PP0A 3IOWA 4MF3A 4BDMA 4P11A 5H8HA 3B6TA 5I84A 1IXHA 2QS4A 3PUWE 1P1OA 1B7ZA 4QSEA 2ESNA 4DCXA 1IXCA 5I2NB 2NUVA 2THIA 4OZ9A 1NNTA 2DE4A 3SEXA 2OK2A 3H4ZA 1NNFA 1QUIA 2UVIA 4IO3A 3DP4A 5ITPA 3B7DA 3CVGA 4IO6A 4HCWA 4YKIA 1WDNA 3E3KA 1NMUA 1IEJA 5CRYA 4F39A 5L9MA 4EQ7A 1SYIA 3H6UA 1FQAA 3GBBA 4H67A 2Y7IA 3HHGA 3OO6A 2B65A 4LVQA 3MPKA 1Y1ZA 3VDFA 3PUXE 5KCJB 2ZNUA 2A5TB 2P2AA 3T9VA 1A55A 3IJOB 4KHZE 4H65A 1M5EA 3IL1B 3BBRA 3I3VA 3GBAA 1R6ZA 3FATA 5JTYB 1I6AA 4EDPA 1MY2A 3T22A 3VLVA 4NF5A 3QAXA 2XD2A 4U2RA 3Q29A 2ZYKA 2ONSA 2Q89A 1MM7A 3PMVA 2HEUA 3N6UA 1MQHA 3HV1A 5TP9B 3K2DA 4K3FA 3TUSA 4IGRA 3CI8A 2Z8DA 1LB9A 4H6DA 1LBBA 1D9VA 4G68A 2I4BA 2I6EA 3MQ9A 3TPAA 1ZLQA 2F7BA 1Y3NA 1IXIA 1S50A 4RNSA 1JEVA 3CG1A 1VFDA 1QUKA 2DP8A 3N94A 2HAVA 2QL3A 1QKAA 3FZVA 3O2AA 5AA4B 4MBPA 3FJMA 4NE4A 2DE3A 1AH5A 4ELPA 4NTLA 2NVUB 2PT2A 1TT1A 1Z7ME 4YKJA 1N04A 4F18A 3FUZA 3UN6A 3TMGA 4OFJA 5I56B 3L6GA 5BWJA 3CIJA 4NF8A 4RA1A 3GZGA 3IB0A 5I57A 3MUQA 3E13X 3MP1A 4JDFA 5KDTB 3S2VA 1XC1A 1Y4CA 4NWDA 1BP5A 2QPQA 3CFXA 1B40A 2YLNA 3OSRA 2AYSA 3MVZA 1N3XA 1EZOA 1MPCA 3K0VA 3V8XB 3TTMA 1JNFA 4KYEA 5DYHA 2GRVA 3C34A 4P0GA 2PX1A 5I58B 3PUYE 4RJZA 5H8QB 2V3UA 3Q25A 4XIGQ 3KEIA 4UA8A 2D3IA 3S9NC 3C36A 1UTBB 3UIFA 3A09A 2DVZA 3TAJA 3TQWA 2Y84A 4BDLA 3QK6A 4JSOA 3S4UA 3FV2A 4QF9A 2AL5A 3VVDA 4ZEKA 1PBQA 5BUUA 1BIYA 1Y3PA 3M8UA 1SDXA 1R9QA 4OXVA 3KOSA 3MAMA 3H06B 3RT8A 2REJA 2A5SA 1TWYA 4PFUA 2CMOA 4OQOA 1MG1A 1GGGA 1IUDA 4NF4B 3HN0A 4FORA 4EXLA 2H9BA 1B5JA 3OO8A 4C1TA 4KR5A 3MJNA 1RKMA 2XXHA 4BDQA 4F3SA 3TQLA 1S7YA 5H8HB 3GLBA 2R6GE 5F1QA 1MRPA 4TLMB 4TOZA 1FQBA 1SI0A 2GHBA 2DXRA 2REGA 3PD9A 4TLLB 3KG2A 1H43A 5EHSA 2Z8FA 4MLVA 2Z23A 1F9BA 1HSLA 1FQCA 3DLNA 4Q0CA 4POWA 2P0SA 2F7CA 1NNKA 1SW4A 1VE4A 3LBSA 2XX9A 4Z7EA 1QULA 4L17A 4ZE8A 4BDRA 3AXFA 2VD3A 4OYVA 4U1OA 3DM0A 1H3DA 2XXTA 1SVXB 3N26A 3K6XA 2FA7A 5AA4A 4F1VA 3DP8A 1MXWA 4QFPA 5M2VA 3MP6A 2QMXA 1UIVA 3TODA 4H1XA 4N07A 5IKBA 4GD5A 4NF5B 4NWCA 4PE5B 3PUZE 2HFBA 2OBGA 5FTIA 3CFLA 2XXQA 5KDTA 4OFOA 4H5GA 1JVYA 3KN7A 1LB8A 1M5BA 1LFGA 5K2XA 2ONRA 4G68B 4XKRA 3KJ7A 2I0CA 1B52A 4G68C 2ZMBA 4GOTA 1A54A 1M5FA 4DCYA 1CE2A 1B2HA 4FAJA 2ABHA 4DE8A 5I58A 3FGSA 4WXJA 4KYSA 1OLAA 2X7PA 1MY0A 3TCFA 1QJMA 4FEBA 2GHAA 5ITOA 1AMFA 5B7DA 3RNNA 3IJXB 2OWSA 3JZJA 1R9LA 1BLFA 2OLBA 4F19A 1MH3A 4N13A 2V3QA 4FJPA 1JQFA 3U72A 4JXIA 4NF8B 3FXUA 3SETA 5AA2D 4OEVA 2Y7KA 3QUFA 5I57B 1N7XA 4R75A 3KFMA 1TFAA 2XXUA 3O6GA 2HAUA 2O1MA 1XS5A 2DYXA 3G3FA 1LBCA 4NF4A 4OERA 1B46A 4IB2A 4DXBA 4LATA 4LZ7A 5HM4B 4QHQA 3K00A 3FASA 2X26A 4Z0IA 3KGCA 2PMSA 4YMBA 1EZ9A 3OO7A 4QFLA 1FQEA 2E0SA 3EPEA 3PMWA 1DPEA 1GV8A 4GVOA 4HW8A 1P1QA 2Q88A 2I58A 1POY1 4KQPA 4X9TA 1Q1KA 2V25A 2Y7RA 2Q2AA 2RC8A 4GXSB 3WAFA 1SD3A 4O3BA 3ZKKA 1JW5A 1OIBA 3DP6A 3H6TA 1J1NA 1DMBA 4OMBA 1ZTYA 2H25A 3HPIA 1ATGA 1MXYA 1HSJA 1POTA 1AOVA 4JB7A 1USYE 1P1NA 1MXZA 1ZMGA 4R6KA 4R2BA 2WKYA 1O64A 1ZIUA 2F8DA 4U22A 5J1DA 5L8DA 4BDOA 3BKIB 3O28A 3KN8A 3FD3A 3C33A 2O84X 3MWBA 5F7VA 4I1DA 1NH8A 1XVXA 4ZEBA 2XHDA 1GTKA 3K01A 3C9HA 3ONMA 2GH9A 3K4UA 3ECRA 1B0HA 4F31B 5K2YA 1EH3A 2UYEA 1N76A 2RC7A 1OLCA 4G8HA 4WEDA 3ODBA 1DOTA 1MXUA 3K02A 3OXNA 1B1XA 5TPAA 3Q26A 3VE1B 4ZEIA 4PETA 1FQDA 4R9GA 3UA8A 3QYTA 3M3LA 4HCYA 3I6VA 1OQGA 2PBWA 2F7AA 4BDNA 3EHSA 1LSTA 4IGTA 4OENA 4YU0A 2DOJA 1AL3A 3EN3A 3LSXA 4XTCQ 1BTJA 3MVXA 1A8EA 2F35A 1B3GA 3P7IA 4R74A 4NF6B 3RUMA 1TFDA 2XX8A 1UTHA 1H76A 3SEWA 1LGBC 3KN3A 1WODA 3SEVA 3BFUA 4KD5A 4MH5A 3OEKA 2XXYA 3LR1A 2ALUA 1N3WA 3PPOA 4X1BA 4R2FA 4E0WA 3IORA 2RINA 4OHNA 2I0BA 1LFHA 3OEMA 1B6HA 3D4CA 1MY3A 3C4MA 2F6PA 3C32A 1UIUA 2OJTA 3K6WA 4GQOA 1VR5A 4ESXA 1XT8A 3H6WA 1B5HA 3FXQA 4DZ1A 3PPQA 1DSNA 1RYXA 4U21A 1URGA 2NOOA 1ZBMA 2DWHA 1MM6A 3G3HA 2B3BA 3TTNA 2O69A 4OFLA 4G8MA 2O6AA 2V84A 4U1ZA 1B4HA 2QS1A 3JV9A 3U1OA 4KI0E 3RTFB 1Y4TA 3UP9A 3FVKA 3RN8A 1N0TA 1MY4A 5ELVA 2F97A 2R9JA 2D21A 4JWXA 2DQVA 3VVEA 5AA2B 3B6WA 5I2KA 1FTJA 3F11A 4EXKA 4EQ9A 1ANFA 4C1UA 1D4NA 3W9VA 4PFTA 2UVGA 3OMBA 1OVTA 1GR2A 1OVBA 4M1VA 3TTRA 1B0LA 3K1PA 3KSJA 3USDA 3S9LC 3FJ7A 3MZ9A 1IQ7A 2XXXA 3CSBA 4G2ZA 1MXXA 3O66A 3QXMA 3TYHA 4OETA 2PT1A 3W15C 4JBZA 1I6QA 4ZE9A 2DWIA 4DLDA 2QS2A 2Q9TA 2RC9A 4RPOA 4U4SA 2XXPA 1DPPA 4JSDA 1QW0A 1LLSA 4KCDA 3MVWA 4FE8A 2H99A 3G3GA 3PV0E 4DXCA 4GIZA 3V5AA 4OWDA 1N84A 3B6QA 4YKPA 3U8QA 4R6HA 3V83A 3JYRA 1IZ1A 2RKMA 2QJEA 2B3FA 1NNPA 1ZJLA 2ZNSA 2ANJA 1SW1A 2AL4A 2GFEA 5CMKA 4DXUA 5TU0A 3IOTA 2O68A 1LAHE 3PMXA 3TZAA 1FCKA 3KBRA 1M5CA 5CM6A 3S9MC 1ZKBA 4GL8A 3LSLA 4H0WA 1PEBA 4QSCA 2G29A 1US4A 4MLQA 4R9FA 2NXOA 5CMMA 4LA9A 1MPDA 4YMAA 1DTZA 1MXVA 4YB5A 4LQ2A 3K6VA 4NF6A 1FTMA 2F78A 2Y7PA 4U23A 4OEUA 4MFIA 3THIA 4QRZA 3OENA 3EHTA 3IB1A 3TKDA 1A8FA 4QSDA 4QFOA 1JW4A 4ELRA 2ZXTA 3U92A 3Q27A 1LCFA 3E9XA 4YB6A 3T9UA 3E4RA 1Q35A 1PC3A 4GWOA 3IOVA 5TPAB 3MVYA 4TQUQ 5H8NA 3HCQA 1Y3QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DEX A;  4P0I A;  4PFY A;  1EZP A;  4RXL A;  3R6U A;  2CZL A;  4XKP A;  3C35 A;  3RTW B;  2F34 A;  1TXF A;  1YAE A;  1SW2 A;  3T9X B;  4LUB A;  1USY H;  1KWH A;  1B4Z A;  4PQJ A;  5EHM A;  1UTH B;  3BFT A;  4Q8R A;  1UQW A;  4GXA A;  2UXA A;  3H03 A;  4UAC A;  5FHO A;  2RCB A;  2VGQ A;  5AA2 A;  3U93 A;  4ZED A;  4YKK A;  5FHN A;  3PD8 A;  1P99 A;  2I3V A;  3G3I A;  4ONY A;  4LZ5 A;  4F22 A;  1XVY A;  1LAF E;  3VFJ A;  3ILU B;  1M5D A;  4AQ4 A;  3T66 A;  4WKM A;  4AB5 A;  4RYA A;  3O9P A;  1SW5 A;  2XXW A;  2F5X A;  1NL5 A;  5ICT A;  1JVX A;  1PBP A;  1S9T A;  2ZYO A;  4BLA A;  1FTO A;  3FIR A;  1SI1 A;  5CBR A;  3TEP A;  1LAG E;  2X7Q A;  3PUV E;  3FVO A;  5KZT A;  4R6Y A;  4RY1 A;  1IXG A;  3OOA A;  1B5I A;  1L5T A;  2DXY A;  2Z22 A;  4RK9 A;  3CG3 A;  3DEL B;  2KLF A;  1ZU0 A;  5JK4 A;  3V89 B;  3K1N A;  2Q8J A;  4X1D A;  4NED A;  3PU5 A;  3A3U A;  2DE2 A;  4XXU A;  3SER A;  4DDD A;  5AE4 A;  2Z8E A;  4I62 A;  1B32 A;  1NKX A;  5I2K B;  3UK4 A;  1B51 A;  2O51 A;  4YAH X;  4FED A;  5A5X A;  5JEI A;  2ONK E;  3PGF A;  5CMB A;  1PB8 A;  4FIM A;  3TTK A;  3UOR A;  4LP2 B;  2QSX A;  2FNC A;  2QRY A;  3ZKL A;  1HSE A;  3O97 A;  1PB9 A;  2VOZ A;  3N5L A;  4POX A;  5L9S A;  3FJG A;  1ELJ A;  2I49 A;  2O7U A;  1RYO A;  3SKP A;  3S9E A;  1QVS A;  3CRB A;  3G3J A;  3QSL A;  4ECF A;  5CI5 A;  2I4C A;  4F2Q A;  3OD7 A;  1B05 A;  2UVH A;  1FTK A;  2ZYM A;  4GL0 A;  4F3G A;  5AA3 A;  1SYH A;  5I59 A;  1MH4 A;  4NMY A;  1WVJ A;  3IK6 B;  4IO5 A;  3VVF A;  1MDQ A;  1B9J A;  4F3P A;  1YPN A;  4IO2 A;  4Q5T A;  4ZEF A;  4YIC A;  2DWA A;  1URD A;  1FTL A;  3VV5 A;  4EUO A;  2M8C A;  2I3W A;  2IA4 A;  2YPN A;  5ISU A;  5CMC A;  3SEU A;  3IO6 A;  1MQI A;  1B7H A;  4F2O A;  1SBP A;  4KFQ A;  4IO7 A;  4IY5 A;  2HZK A;  4AB6 A;  3N6T A;  5DVF A;  1I69 A;  4C0R A;  3L6H A;  3K1M A;  3EF7 A;  3FXR A;  2FYI A;  3TFL A;  4RPN A;  3M3K A;  1IIW A;  3UGW A;  3CFZ A;  3CSG A;  1B7U A;  2VHA A;  2QS3 A;  3ZS6 A;  5L9O A;  2XXV A;  3HO7 A;  3C31 A;  4ZZE A;  3MZB A;  4HS7 A;  3IX1 A;  3SDF A;  3SEY A;  2BJJ X;  2PYY A;  5H8F A;  2G93 A;  1P1W A;  3LUY A;  5HBC A;  5IAI A;  4H8J A;  3WAE A;  2OCU A;  2HXW A;  3PPR A;  5H8N B;  4LZ8 A;  2IEE A;  3GXA A;  1O63 A;  5DEX B;  3IR1 A;  4ZZA A;  1D9Y A;  1GVC A;  1BKA A;  2VD2 A;  3TDJ A;  5CC2 A;  3H3G A;  4LQ5 A;  2UYF A;  1MQG A;  4X48 A;  4IY6 A;  2R71 A;  2ZYN A;  2NWJ A;  3A3C A;  3RT6 B;  3VLW A;  4H5F A;  1Y1M A;  3RGY A;  1JEU A;  3T93 B;  1JET A;  1A40 A;  3TCG A;  4ZS9 A;  2P1S A;  4ZEC A;  4F1U A;  1Y9U A;  4IO4 A;  4E0X A;  1PB7 A;  2DWJ A;  2XXR A;  3RLF E;  1EU8 A;  3MP8 A;  2I48 A;  4THI A;  4WEP A;  4ELQ A;  2D5W A;  1B3F A;  4GLI A;  3QUJ A;  4ESW A;  1XHY A;  2H4I A;  1SQY A;  5I2N A;  2V93 A;  3H6V A;  2W7Y A;  3T9H B;  2F6G A;  3M3F A;  4YZZ A;  2H5Y A;  3QIM A;  4YB7 A;  1H44 A;  3VXC A;  1OMP A;  2PVU A;  4F29 A;  3K6U A;  3EQ1 A;  1H45 A;  5EYF A;  4G77 A;  1IIT A;  1PDA A;  3OSQ A;  3RPW A;  2LAO A;  4N6P A;  3O29 A;  1CB6 A;  1D3K A;  5KCJ A;  4KYD A;  2A5T A;  3HHF A;  2RF1 A;  3SES A;  5ICQ A;  4H8I A;  4OVJ A;  2DS9 A;  1MS7 A;  1FW0 A;  2VP1 A;  3KSX A;  3IAZ A;  3R26 A;  1MPB A;  3FVN A;  5H8S A;  5JTY A;  4R72 A;  3IOU A;  1OQH A;  4JWY A;  3KOT A;  1LAX A;  1YTV A;  4FEC A;  4XKN A;  5A5X B;  2DVC A;  4RK2 A;  4F1Y A;  3VLU A;  4KPT A;  1LFI A;  3G3K A;  3IO4 A;  2E1S A;  4I8C A;  3RQT A;  1QUJ A;  5FHM A;  5TP9 A;  2AIX A;  4GF8 A;  4I9D A;  3TEL A;  1A7L A;  2DSF A;  2OZZ A;  2QMW A;  3R7X A;  3PPN A;  4R73 A;  5CBS A;  3O6I A;  3KJT A;  1AIV A;  3LC8 A;  4EQB A;  3ZSF A;  2HCA A;  2H98 A;  4G4P A;  2F36 A;  3RY3 A;  3KZG A;  3LSF B;  4O3C A;  1DTG A;  3Q28 A;  1VFE A;  1YCJ A;  2HQ0 A;  4OES A;  4QFK A;  5I59 B;  2HZL A;  3MPL A;  3PPP A;  3VXB A;  2XXI A;  3MBP A;  4ELO A;  3IB2 A;  4GRK A;  5DTB A;  4ZDM A;  2UVJ A;  1FQF A;  4M4G A;  5I56 A;  3MC2 A;  1B58 A;  1I6B A;  4QFN A;  5FTH A;  2ZNT A;  5LOM A;  1VSO A;  1MQJ A;  4PFW A;  4HTG A;  3G7W A;  4U4X A;  1XOC A;  2O7I A;  1R1N A;  1MQD A;  3U94 A;  2XD3 A;  3CR9 A;  1A99 A;  1LCT A;  4OTE A;  3TTL A;  3HST A;  1Y20 A;  1T0K A;  4GFR A;  5DVJ A;  4EF1 A;  1N7W A;  3W9W A;  3MW0 A;  3D4G A;  4F3B A;  4DIG A;  1NH7 A;  4G8N A;  4FAT A;  1B3H A;  4JWO A;  3FVG A;  1US5 A;  1URS A;  4Q30 B;  5H8F B;  5B70 A;  5H8Q A;  3FV1 A;  1QKB A;  3H7M A;  4XKQ A;  3T96 B;  1UTB A;  3EHU A;  1B3L A;  5HPQ A;  3O6H A;  2Q2C A;  3OEL A;  3MZ1 A;  3I5O A;  2V3T A;  4EF2 A;  1MY1 A;  1JW1 A;  4KCC A;  1P1U A;  2YJP A;  1B1H A;  2OWT A;  4ISU A;  1NFT A;  4LON B;  3LSW A;  1II5 A;  5DVI A;  5DT6 A;  5AA1 A;  4ND9 A;  3TCH A;  4O3A A;  2Y7W A;  3OO9 A;  2RCA A;  3ILT B;  1Z7N E;  1MDP 1;  1O7T A;  2O1L A;  1B3E A;  2XX7 A;  4PP0 A;  3IOW A;  4MF3 A;  4BDM A;  4P11 A;  5H8H A;  3B6T A;  5I84 A;  1IXH A;  2QS4 A;  3PUW E;  1P1O A;  1B7Z A;  4QSE A;  2ESN A;  4DCX A;  1IXC A;  5I2N B;  2NUV A;  2THI A;  4OZ9 A;  1NNT A;  2DE4 A;  3SEX A;  2OK2 A;  3H4Z A;  1NNF A;  1QUI A;  2UVI A;  4IO3 A;  3DP4 A;  5ITP A;  3B7D A;  3CVG A;  4IO6 A;  4HCW A;  4YKI A;  1WDN A;  3E3K A;  1NMU A;  1IEJ A;  5CRY A;  4F39 A;  5L9M A;  4EQ7 A;  1SYI A;  3H6U A;  1FQA A;  3GBB A;  4H67 A;  2Y7I A;  3HHG A;  3OO6 A;  2B65 A;  4LVQ A;  3MPK A;  1Y1Z A;  3VDF A;  3PUX E;  5KCJ B;  2ZNU A;  2A5T B;  2P2A A;  3T9V A;  1A55 A;  3IJO B;  4KHZ E;  4H65 A;  1M5E A;  3IL1 B;  3BBR A;  3I3V A;  3GBA A;  1R6Z A;  3FAT A;  5JTY B;  1I6A A;  4EDP A;  1MY2 A;  3T22 A;  3VLV A;  4NF5 A;  3QAX A;  2XD2 A;  4U2R A;  3Q29 A;  2ZYK A;  2ONS A;  2Q89 A;  1MM7 A;  3PMV A;  2HEU A;  3N6U A;  1MQH A;  3HV1 A;  5TP9 B;  3K2D A;  4K3F A;  3TUS A;  4IGR A;  3CI8 A;  2Z8D A;  1LB9 A;  4H6D A;  1LBB A;  1D9V A;  4G68 A;  2I4B A;  2I6E A;  3MQ9 A;  3TPA A;  1ZLQ A;  2F7B A;  1Y3N A;  1IXI A;  1S50 A;  4RNS A;  1JEV A;  3CG1 A;  1VFD A;  1QUK A;  2DP8 A;  3N94 A;  2HAV A;  2QL3 A;  1QKA A;  3FZV A;  3O2A A;  5AA4 B;  4MBP A;  3FJM A;  4NE4 A;  2DE3 A;  1AH5 A;  4ELP A;  4NTL A;  2NVU B;  2PT2 A;  1TT1 A;  1Z7M E;  4YKJ A;  1N04 A;  4F18 A;  3FUZ A;  3UN6 A;  3TMG A;  4OFJ A;  5I56 B;  3L6G A;  5BWJ A;  3CIJ A;  4NF8 A;  4RA1 A;  3GZG A;  3IB0 A;  5I57 A;  3MUQ A;  3E13 X;  3MP1 A;  4JDF A;  5KDT B;  3S2V A;  1XC1 A;  1Y4C A;  4NWD A;  1BP5 A;  2QPQ A;  3CFX A;  1B40 A;  2YLN A;  3OSR A;  2AYS A;  3MVZ A;  1N3X A;  1EZO A;  1MPC A;  3K0V A;  3V8X B;  3TTM A;  1JNF A;  4KYE A;  5DYH A;  2GRV A;  3C34 A;  4P0G A;  2PX1 A;  5I58 B;  3PUY E;  4RJZ A;  5H8Q B;  2V3U A;  3Q25 A;  4XIG Q;  3KEI A;  4UA8 A;  2D3I A;  3S9N C;  3C36 A;  1UTB B;  3UIF A;  3A09 A;  2DVZ A;  3TAJ A;  3TQW A;  2Y84 A;  4BDL A;  3QK6 A;  4JSO A;  3S4U A;  3FV2 A;  4QF9 A;  2AL5 A;  3VVD A;  4ZEK A;  1PBQ A;  5BUU A;  1BIY A;  1Y3P A;  3M8U A;  1SDX A;  1R9Q A;  4OXV A;  3KOS A;  3MAM A;  3H06 B;  3RT8 A;  2REJ A;  2A5S A;  1TWY A;  4PFU A;  2CMO A;  4OQO A;  1MG1 A;  1GGG A;  1IUD A;  4NF4 B;  3HN0 A;  4FOR A;  4EXL A;  2H9B A;  1B5J A;  3OO8 A;  4C1T A;  4KR5 A;  3MJN A;  1RKM A;  2XXH A;  4BDQ A;  4F3S A;  3TQL A;  1S7Y A;  5H8H B;  3GLB A;  2R6G E;  5F1Q A;  1MRP A;  4TLM B;  4TOZ A;  1FQB A;  1SI0 A;  2GHB A;  2DXR A;  2REG A;  3PD9 A;  4TLL B;  3KG2 A;  1H43 A;  5EHS A;  2Z8F A;  4MLV A;  2Z23 A;  1F9B A;  1HSL A;  1FQC A;  3DLN A;  4Q0C A;  4POW A;  2P0S A;  2F7C A;  1NNK A;  1SW4 A;  1VE4 A;  3LBS A;  2XX9 A;  4Z7E A;  1QUL A;  4L17 A;  4ZE8 A;  4BDR A;  3AXF A;  2VD3 A;  4OYV A;  4U1O A;  3DM0 A;  1H3D A;  2XXT A;  1SVX B;  3N26 A;  3K6X A;  2FA7 A;  5AA4 A;  4F1V A;  3DP8 A;  1MXW A;  4QFP A;  5M2V A;  3MP6 A;  2QMX A;  1UIV A;  3TOD A;  4H1X A;  4N07 A;  5IKB A;  4GD5 A;  4NF5 B;  4NWC A;  4PE5 B;  3PUZ E;  2HFB A;  2OBG A;  5FTI A;  3CFL A;  2XXQ A;  5KDT A;  4OFO A;  4H5G A;  1JVY A;  3KN7 A;  1LB8 A;  1M5B A;  1LFG A;  5K2X A;  2ONR A;  4G68 B;  4XKR A;  3KJ7 A;  2I0C A;  1B52 A;  4G68 C;  2ZMB A;  4GOT A;  1A54 A;  1M5F A;  4DCY A;  1CE2 A;  1B2H A;  4FAJ A;  2ABH A;  4DE8 A;  5I58 A;  3FGS A;  4WXJ A;  4KYS A;  1OLA A;  2X7P A;  1MY0 A;  3TCF A;  1QJM A;  4FEB A;  2GHA A;  5ITO A;  1AMF A;  5B7D A;  3RNN A;  3IJX B;  2OWS A;  3JZJ A;  1R9L A;  1BLF A;  2OLB A;  4F19 A;  1MH3 A;  4N13 A;  2V3Q A;  4FJP A;  1JQF A;  3U72 A;  4JXI A;  4NF8 B;  3FXU A;  3SET A;  5AA2 D;  4OEV A;  2Y7K A;  3QUF A;  5I57 B;  1N7X A;  4R75 A;  3KFM A;  1TFA A;  2XXU A;  3O6G A;  2HAU A;  2O1M A;  1XS5 A;  2DYX A;  3G3F A;  1LBC A;  4NF4 A;  4OER A;  1B46 A;  4IB2 A;  4DXB A;  4LAT A;  4LZ7 A;  5HM4 B;  4QHQ A;  3K00 A;  3FAS A;  2X26 A;  4Z0I A;  3KGC A;  2PMS A;  4YMB A;  1EZ9 A;  3OO7 A;  4QFL A;  1FQE A;  2E0S A;  3EPE A;  3PMW A;  1DPE A;  1GV8 A;  4GVO A;  4HW8 A;  1P1Q A;  2Q88 A;  2I58 A;  1POY 1;  4KQP A;  4X9T A;  1Q1K A;  2V25 A;  2Y7R A;  2Q2A A;  2RC8 A;  4GXS B;  3WAF A;  1SD3 A;  4O3B A;  3ZKK A;  1JW5 A;  1OIB A;  3DP6 A;  3H6T A;  1J1N A;  1DMB A;  4OMB A;  1ZTY A;  2H25 A;  3HPI A;  1ATG A;  1MXY A;  1HSJ A;  1POT A;  1AOV A;  4JB7 A;  1USY E;  1P1N A;  1MXZ A;  1ZMG A;  4R6K A;  4R2B A;  2WKY A;  1O64 A;  1ZIU A;  2F8D A;  4U22 A;  5J1D A;  5L8D A;  4BDO A;  3BKI B;  3O28 A;  3KN8 A;  3FD3 A;  3C33 A;  2O84 X;  3MWB A;  5F7V A;  4I1D A;  1NH8 A;  1XVX A;  4ZEB A;  2XHD A;  1GTK A;  3K01 A;  3C9H A;  3ONM A;  2GH9 A;  3K4U A;  3ECR A;  1B0H A;  4F31 B;  5K2Y A;  1EH3 A;  2UYE A;  1N76 A;  2RC7 A;  1OLC A;  4G8H A;  4WED A;  3ODB A;  1DOT A;  1MXU A;  3K02 A;  3OXN A;  1B1X A;  5TPA A;  3Q26 A;  3VE1 B;  4ZEI A;  4PET A;  1FQD A;  4R9G A;  3UA8 A;  3QYT A;  3M3L A;  4HCY A;  3I6V A;  1OQG A;  2PBW A;  2F7A A;  4BDN A;  3EHS A;  1LST A;  4IGT A;  4OEN A;  4YU0 A;  2DOJ A;  1AL3 A;  3EN3 A;  3LSX A;  4XTC Q;  1BTJ A;  3MVX A;  1A8E A;  2F35 A;  1B3G A;  3P7I A;  4R74 A;  4NF6 B;  3RUM A;  1TFD A;  2XX8 A;  1UTH A;  1H76 A;  3SEW A;  1LGB C;  3KN3 A;  1WOD A;  3SEV A;  3BFU A;  4KD5 A;  4MH5 A;  3OEK A;  2XXY A;  3LR1 A;  2ALU A;  1N3W A;  3PPO A;  4X1B A;  4R2F A;  4E0W A;  3IOR A;  2RIN A;  4OHN A;  2I0B A;  1LFH A;  3OEM A;  1B6H A;  3D4C A;  1MY3 A;  3C4M A;  2F6P A;  3C32 A;  1UIU A;  2OJT A;  3K6W A;  4GQO A;  1VR5 A;  4ESX A;  1XT8 A;  3H6W A;  1B5H A;  3FXQ A;  4DZ1 A;  3PPQ A;  1DSN A;  1RYX A;  4U21 A;  1URG A;  2NOO A;  1ZBM A;  2DWH A;  1MM6 A;  3G3H A;  2B3B A;  3TTN A;  2O69 A;  4OFL A;  4G8M A;  2O6A A;  2V84 A;  4U1Z A;  1B4H A;  2QS1 A;  3JV9 A;  3U1O A;  4KI0 E;  3RTF B;  1Y4T A;  3UP9 A;  3FVK A;  3RN8 A;  1N0T A;  1MY4 A;  5ELV A;  2F97 A;  2R9J A;  2D21 A;  4JWX A;  2DQV A;  3VVE A;  5AA2 B;  3B6W A;  5I2K A;  1FTJ A;  3F11 A;  4EXK A;  4EQ9 A;  1ANF A;  4C1U A;  1D4N A;  3W9V A;  4PFT A;  2UVG A;  3OMB A;  1OVT A;  1GR2 A;  1OVB A;  4M1V A;  3TTR A;  1B0L A;  3K1P A;  3KSJ A;  3USD A;  3S9L C;  3FJ7 A;  3MZ9 A;  1IQ7 A;  2XXX A;  3CSB A;  4G2Z A;  1MXX A;  3O66 A;  3QXM A;  3TYH A;  4OET A;  2PT1 A;  3W15 C;  4JBZ A;  1I6Q A;  4ZE9 A;  2DWI A;  4DLD A;  2QS2 A;  2Q9T A;  2RC9 A;  4RPO A;  4U4S A;  2XXP A;  1DPP A;  4JSD A;  1QW0 A;  1LLS A;  4KCD A;  3MVW A;  4FE8 A;  2H99 A;  3G3G A;  3PV0 E;  4DXC A;  4GIZ A;  3V5A A;  4OWD A;  1N84 A;  3B6Q A;  4YKP A;  3U8Q A;  4R6H A;  3V83 A;  3JYR A;  1IZ1 A;  2RKM A;  2QJE A;  2B3F A;  1NNP A;  1ZJL A;  2ZNS A;  2ANJ A;  1SW1 A;  2AL4 A;  2GFE A;  5CMK A;  4DXU A;  5TU0 A;  3IOT A;  2O68 A;  1LAH E;  3PMX A;  3TZA A;  1FCK A;  3KBR A;  1M5C A;  5CM6 A;  3S9M C;  1ZKB A;  4GL8 A;  3LSL A;  4H0W A;  1PEB A;  4QSC A;  2G29 A;  1US4 A;  4MLQ A;  4R9F A;  2NXO A;  5CMM A;  4LA9 A;  1MPD A;  4YMA A;  1DTZ A;  1MXV A;  4YB5 A;  4LQ2 A;  3K6V A;  4NF6 A;  1FTM A;  2F78 A;  2Y7P A;  4U23 A;  4OEU A;  4MFI A;  3THI A;  4QRZ A;  3OEN A;  3EHT A;  3IB1 A;  3TKD A;  1A8F A;  4QSD A;  4QFO A;  1JW4 A;  4ELR A;  2ZXT A;  3U92 A;  3Q27 A;  1LCF A;  3E9X A;  4YB6 A;  3T9U A;  3E4R A;  1Q35 A;  1PC3 A;  4GWO A;  3IOV A;  5TPA B;  3MVY A;  4TQU Q;  5H8N A;  3HCQ A;  1Y3Q A; 
#chains in the Genus database with same CATH topology
 5DEX A;  4P0I A;  4PFY A;  1EZP A;  4RXL A;  3R6U A;  1FBH A;  2CZL A;  4XKP A;  3C35 A;  3RTW B;  4PFR A;  2F34 A;  1FPE A;  1TXF A;  1YAE A;  1SW2 A;  3T9X B;  2QVU A;  4LUB A;  4O94 A;  1USY H;  3A29 A;  1KWH A;  1B4Z A;  1NI9 A;  4PQJ A;  5EHM A;  1UTH B;  3BFT A;  4Q8R A;  1UQW A;  4GXA A;  2UXA A;  3H03 A;  4UAC A;  5FHO A;  2RCB A;  2VGQ A;  5AA2 A;  3U93 A;  4ZED A;  4YKK A;  5FHN A;  3PD8 A;  1P99 A;  2I3V A;  1FJ6 A;  3G3I A;  1VDW A;  4KXP A;  4ONY A;  4LZ5 A;  4F22 A;  1XVY A;  1LAF E;  3VFJ A;  3ILU B;  1M5D A;  4AQ4 A;  3T66 A;  4PGN A;  4WKM A;  4AB5 A;  4RYA A;  4I40 A;  3O9P A;  1SW5 A;  2XXW A;  2XWK A;  2OWZ A;  2F5X A;  1NL5 A;  5ICT A;  1JVX A;  1PBP A;  4PAF A;  4PF8 A;  1S9T A;  2ZYO A;  4BLA A;  1FTO A;  3FIR A;  1SI1 A;  5CBR A;  3TEP A;  1LEV A;  1LAG E;  1NUZ A;  2X7Q A;  3PUV E;  2B4M A;  5I7I A;  3FVO A;  5KZT A;  4R6Y A;  4RY1 A;  1IXG A;  3OOA A;  1NUY A;  2JJK A;  4LN5 A;  1B5I A;  1L5T A;  2DXY A;  2Z22 A;  4RK9 A;  3CG3 A;  3DEL B;  4HE0 A;  2KLF A;  1ZU0 A;  5JK4 A;  3V89 B;  3K1N A;  2Q8J A;  4X1D A;  4NED A;  3PU5 A;  3A3U A;  2DE2 A;  4XXU A;  3SER A;  4DDD A;  5AE4 A;  2Z8E A;  1KA0 A;  1B32 A;  1NKX A;  4I62 A;  5I2K B;  5ET7 A;  4AS5 A;  3UK4 A;  1B51 A;  2O51 A;  4YAH X;  4FED A;  5A5X A;  5JEI A;  2ONK E;  3PGF A;  5CMB A;  1PB8 A;  4FIM A;  3TTK A;  3UOR A;  4LP2 B;  4P1E A;  5ET5 A;  1YXI A;  2ZZW A;  2QSX A;  2FNC A;  2QRY A;  4IR8 A;  4QBA A;  4I3Y A;  1RDX A;  3ZKL A;  2CZH A;  1HSE A;  1XI6 A;  5J16 A;  4PAI A;  3O97 A;  1PB9 A;  2VOZ A;  3N5L A;  4POX A;  5L9S A;  3FJG A;  1ELJ A;  1FPJ A;  2I49 A;  2O7U A;  1RYO A;  1IMD A;  3SKP A;  5IZ3 B;  3S9E A;  1QVS A;  3CRB A;  3G3J A;  3QSL A;  4ECF A;  5CI5 A;  2I4C A;  4F2Q A;  3OD7 A;  3ROJ A;  1B05 A;  2UVH A;  1FTK A;  2ZYM A;  4GL0 A;  4F3G A;  5AA3 A;  1SYH A;  5I59 A;  1MH4 A;  4NMY A;  1WVJ A;  2V4C A;  3IK6 B;  4IO5 A;  3VVF A;  1MDQ A;  1B9J A;  4F3P A;  1YPN A;  4IO2 A;  4Q5T A;  4P1L A;  4ZEF A;  4YIC A;  2DWA A;  1URD A;  1FTL A;  3VV5 A;  4EUO A;  2M8C A;  2I3W A;  4GWX A;  2IA4 A;  2YPN A;  5ISU A;  5CMC A;  3SEU A;  3IO6 A;  1MQI A;  1B7H A;  4F2O A;  4MJO A;  2WYP A;  2CZK A;  1SBP A;  4KFQ A;  4IO7 A;  4N91 A;  4IY5 A;  2HZK A;  4AB6 A;  3N6T A;  5DVF A;  1I69 A;  4MEV A;  4C0R A;  3L6H A;  3K1M A;  3EF7 A;  3FXR A;  2FYI A;  3TFL A;  3KC1 A;  1FBG A;  2MKZ A;  2HPG A;  4RPN A;  3M3K A;  1IIW A;  3UGW A;  3CFZ A;  3CSG A;  1B7U A;  2VHA A;  2QS3 A;  3ZS6 A;  5L9O A;  2XXV A;  3HO7 A;  3C31 A;  4ZZE A;  3MZB A;  4HS7 A;  3IX1 A;  3SDF A;  2PYY A;  2BJJ X;  4MIJ A;  3SEY A;  5H8F A;  2Q8M A;  2G93 A;  2HHM A;  1FSA A;  1KZ8 A;  1P1W A;  3LUY A;  5HBC A;  5IAI A;  4H8J A;  3WAE A;  2OCU A;  2HXW A;  3PPR A;  5H8N B;  4LZ8 A;  2IEE A;  3GXA A;  2VPO A;  1Q9D A;  1O63 A;  5DEX B;  3IR1 A;  4N6D A;  4ZZA A;  1D9Y A;  1GVC A;  1BKA A;  2VD2 A;  3TDJ A;  5CC2 A;  3H3G A;  4LQ5 A;  2UYF A;  1FPF A;  1MQG A;  4P47 A;  4X48 A;  4IY6 A;  2R71 A;  2ZYN A;  4N6K A;  2NWJ A;  3A3C A;  1G0H A;  3RT6 B;  3VLW A;  4H5F A;  1Y1M A;  3RGY A;  4H45 A;  1JEU A;  3T93 B;  1JET A;  1A40 A;  3TCG A;  4DI4 B;  4ZS9 A;  2P1S A;  4ZEC A;  4F1U A;  4DI3 D;  1Y9U A;  4P56 A;  4IO4 A;  4E0X A;  1PB7 A;  2DWJ A;  2XXR A;  3RLF E;  1EU8 A;  3MP8 A;  2I48 A;  4THI A;  4WEP A;  4ELQ A;  2D5W A;  1B3F A;  4GLI A;  3QUJ A;  4PF6 A;  1XHY A;  2H4I A;  4ESW A;  1SQY A;  5I2N A;  2V93 A;  3H6V A;  2W7Y A;  3T9H B;  3FBP A;  1LBV A;  2F6G A;  3M3F A;  4YZZ A;  2H5Y A;  3QIM A;  4YB7 A;  1NV7 A;  1H44 A;  5EYG A;  3VXC A;  4N8G A;  1OMP A;  4PBQ A;  2PVU A;  1LBZ A;  4F29 A;  3K6U A;  3EQ1 A;  1H45 A;  4XF5 A;  5EYF A;  4PDH A;  5F24 A;  5IGA A;  4G77 A;  1IIT A;  1PDA A;  3OSQ A;  3RPW A;  2LAO A;  4N6P A;  3O29 A;  1CB6 A;  2QVV A;  1D3K A;  5KCJ A;  4KYD A;  2A5T A;  3HHF A;  2RF1 A;  3SES A;  3LV0 A;  5ICQ A;  4H8I A;  4I3E A;  2DS9 A;  4OVJ A;  1NV5 A;  1MS7 A;  1FW0 A;  2VP1 A;  4N8Y A;  3KSX A;  3IAZ A;  1BK4 A;  3R26 A;  1MPB A;  1DCU A;  3FVN A;  5H8S A;  5JTY A;  4R72 A;  3IOU A;  2DDK A;  1OQH A;  4JWY A;  3KOT A;  1LAX A;  1YTV A;  4FEC A;  4XKN A;  5A5X B;  2DVC A;  4RK2 A;  4F1Y A;  3VLU A;  1FPD A;  4KPT A;  1LFI A;  3G3K A;  4HXV A;  3IO4 A;  2E1S A;  4I8C A;  4X04 A;  5I3S A;  5IM2 A;  3RQT A;  1QUJ A;  5FHM A;  5TP9 A;  1FPK A;  2AIX A;  4GF8 A;  4I9D A;  3TEL A;  3T1B A;  1A7L A;  2DSF A;  2OZZ A;  2FHY A;  2QMW A;  3R7X A;  5EQ9 A;  3PPN A;  4OAN A;  4R73 A;  2F3D A;  5CBS A;  3O6I A;  3KJT A;  1AIV A;  3LC8 A;  4EQB A;  3ZSF A;  5ESY A;  2HCA A;  2H98 A;  4G4P A;  2F36 A;  3RY3 A;  3KZG A;  3LSF B;  4O3C A;  1FBF A;  1DTG A;  2BJI A;  3Q28 A;  1VFE A;  1YCJ A;  2HQ0 A;  4OES A;  2Q74 A;  4QFK A;  2HZL A;  5I59 B;  3MPL A;  3PPP A;  3VXB A;  2XXI A;  3MBP A;  4NN3 A;  4ELO A;  3IB2 A;  4GRK A;  5DTB A;  4ZDM A;  2UVJ A;  4XEQ A;  1FQF A;  1YYZ A;  4M4G A;  2B4L A;  5I56 A;  3MC2 A;  3E78 A;  1B58 A;  1I6B A;  4X8R A;  4QFN A;  5FTH A;  2ZNT A;  5LOM A;  1MQJ A;  1VSO A;  4PFW A;  4HTG A;  3G7W A;  4U4X A;  1XOC A;  3GYY A;  2O7I A;  1R1N A;  1MQD A;  4JVD A;  3U94 A;  2XD3 A;  1NV1 A;  3CR9 A;  4P9K A;  1A99 A;  2Y5L A;  1LCT A;  4OTE A;  3TTL A;  3HST A;  1Y20 A;  1T0K A;  4GFR A;  4JVC A;  5DVJ A;  4EF1 A;  1N7W A;  3W9W A;  3MW0 A;  3D4G A;  4F3B A;  4DIG A;  1NH7 A;  4G8N A;  4FAT A;  1B3H A;  3RPL A;  4JWO A;  3FVG A;  1US5 A;  5EQ8 A;  1URS A;  4Q30 B;  5H8F B;  5B70 A;  5H8Q A;  5T3J A;  3FV1 A;  1QKB A;  3H7M A;  4XKQ A;  3T96 B;  1UTB A;  3EHU A;  1B3L A;  5HPQ A;  3O6H A;  2Q2C A;  2KQZ A;  3OEL A;  3MZ1 A;  3I5O A;  2V3T A;  4EF2 A;  1MY1 A;  1JW1 A;  4KCC A;  1P1U A;  2YJP A;  1B1H A;  2OWT A;  4ISU A;  1NFT A;  3B50 A;  4LON B;  3SZP A;  3LSW A;  1II5 A;  5DVI A;  5DT6 A;  5AA1 A;  4ND9 A;  1EYI A;  3TCH A;  4O3A A;  2Y7W A;  3OO9 A;  2RCA A;  3ILT B;  1Z7N E;  1MDP 1;  1EYK A;  1O7T A;  3NOH A;  2O1L A;  1B3E A;  2XX7 A;  4PP0 A;  3IOW A;  4MF3 A;  4BDM A;  4P11 A;  3RYD A;  5H8H A;  3B6T A;  5I84 A;  1IXH A;  2QS4 A;  3PUW E;  1P1O A;  1B7Z A;  4QSE A;  2ESN A;  4PGP A;  4DCX A;  1IXC A;  5I2N B;  2NUV A;  2XA5 A;  2THI A;  4OZ9 A;  1NNT A;  2DE4 A;  3SEX A;  1LBW A;  2OK2 A;  3H4Z A;  1NNF A;  1QUI A;  2UVI A;  4IO3 A;  3DP4 A;  5ITP A;  3B7D A;  1FJ9 A;  3CVG A;  4IO6 A;  4HCW A;  4YKI A;  1WDN A;  1KA1 A;  2CEY A;  3E3K A;  1NMU A;  1IEJ A;  5CRY A;  4JVI A;  4NAP A;  2WBB A;  4F39 A;  5L9M A;  4EQ7 A;  1SYI A;  3H6U A;  1FQA A;  3GBB A;  4H67 A;  2Y7I A;  3HHG A;  3OO6 A;  4PC9 A;  2B65 A;  4LVQ A;  3MPK A;  1Y1Z A;  2PFZ A;  3VDF A;  3PUX E;  5KCJ B;  5LDZ A;  2ZNU A;  4MNP A;  2A5T B;  2P2A A;  3T9V A;  1A55 A;  3IJO B;  4KHZ E;  1NV6 A;  4H65 A;  2WYK A;  2ZZX A;  1M5E A;  3IL1 B;  3BBR A;  3I3V A;  3GBA A;  4MNI A;  1R6Z A;  3FAT A;  5JTY B;  1LBY A;  1I6A A;  4EDP A;  1MY2 A;  3D1R A;  3T22 A;  3VLV A;  2WEF A;  4NF0 A;  4NF5 A;  3QAX A;  2XD2 A;  4O7M A;  4U2R A;  3Q29 A;  2ZYK A;  2ONS A;  2Q89 A;  1MM7 A;  3PMV A;  2HEU A;  3N6U A;  1IME A;  4QXD A;  1MQH A;  2WBD A;  2F3B A;  3HV1 A;  5TP9 B;  3K2D A;  4K3F A;  3TUS A;  4IGR A;  3CI8 A;  4P8B A;  2Z8D A;  1FBC A;  1LB9 A;  4H6D A;  1LBB A;  1D9V A;  4G68 A;  2I4B A;  2I6E A;  3MQ9 A;  4OVP A;  3E79 A;  3TPA A;  1ZLQ A;  2F7B A;  1Y3N A;  1IXI A;  1S50 A;  4RNS A;  5EQ7 A;  1JEV A;  3CG1 A;  1VFD A;  1QUK A;  4O8M A;  2DP8 A;  3N94 A;  2HAV A;  2QL3 A;  3KBZ A;  1QKA A;  3FZV A;  3O2A A;  5AA4 B;  4MBP A;  3FJM A;  4NG7 A;  4NE4 A;  2DE3 A;  1AH5 A;  4ELP A;  4NTL A;  2P3N A;  4P3L A;  2NVU B;  2PT2 A;  1DK4 A;  1TT1 A;  1Z7M E;  2XXK A;  4YKJ A;  1FTA A;  1N04 A;  4F18 A;  3FUZ A;  3UN6 A;  3TMG A;  4OFJ A;  5I56 B;  3L6G A;  5BWJ A;  3CIJ A;  4NF8 A;  4RA1 A;  3GZG A;  3IB0 A;  5I57 A;  3MST A;  3MUQ A;  3E13 X;  4MHF A;  3MP1 A;  4JDF A;  5KDT B;  3S2V A;  1XC1 A;  1Y4C A;  4NWD A;  1BP5 A;  2QPQ A;  3CFX A;  1B40 A;  2YLN A;  3IFA A;  3OSR A;  4PTK A;  2AYS A;  3MVZ A;  1N3X A;  1EZO A;  1MPC A;  3K0V A;  3V8X B;  3TTM A;  3RPL B;  1JNF A;  4KYE A;  5DYH A;  2GRV A;  3C34 A;  1JP4 A;  4P0G A;  2PX1 A;  5I58 B;  3PUY E;  4RJZ A;  5H8Q B;  2V3U A;  3Q25 A;  4XIG Q;  3KEI A;  4UA8 A;  2D3I A;  3S9N C;  3C36 A;  3HFU A;  2FIE A;  1UTB B;  2VT5 A;  3UIF A;  3A09 A;  2DVZ A;  3TAJ A;  3TQW A;  2Y84 A;  4BDL A;  3QK6 A;  4JSO A;  4OA4 A;  3S4U A;  3FV2 A;  4PFI A;  4QF9 A;  2AL5 A;  3VVD A;  4ZEK A;  1PBQ A;  5BUU A;  1BIY A;  1Y3P A;  3M8U A;  3QMF A;  1SDX A;  1R9Q A;  4OXV A;  1RDY A;  3KOS A;  4GWW A;  3MAM A;  3H06 B;  3RT8 A;  2REJ A;  2A5S A;  1TWY A;  4PFU A;  2CMO A;  4OQO A;  4H46 A;  1MG1 A;  1GGG A;  1IUD A;  4NF4 B;  3HN0 A;  4FOR A;  4EXL A;  2H9B A;  1B5J A;  3OO8 A;  4C1T A;  4KR5 A;  1DBZ A;  3MJN A;  1FPI A;  1RKM A;  4GBV A;  2XXH A;  4BDQ A;  4F3S A;  3TQL A;  1S7Y A;  4GWS A;  2QFL A;  5H8H B;  3GLB A;  2R6G E;  5F1Q A;  1MRP A;  1IMF A;  1LBX A;  4TLM B;  4TOZ A;  4FBP A;  1FQB A;  1SI0 A;  2GHB A;  2DXR A;  2REG A;  3PD9 A;  4TLL B;  1IMB A;  3ISP A;  3KG2 A;  2XWO A;  1H43 A;  5EHS A;  2Z8F A;  4MLV A;  2Z23 A;  1F9B A;  1HSL A;  4HE2 A;  1FQC A;  3DLN A;  4Q0C A;  2OX3 A;  4POW A;  2P0S A;  2F7C A;  1NNK A;  1SW4 A;  1VE4 A;  3LBS A;  4MAG A;  2XX9 A;  4Z7E A;  1QUL A;  4L17 A;  4ZE8 A;  4BDR A;  3AXF A;  2VD3 A;  4OYV A;  4U1O A;  1D9Q A;  3DM0 A;  1H3D A;  2XXT A;  1SVX B;  1FPL A;  3N26 A;  3K6X A;  2FA7 A;  5AA4 A;  4XFE A;  4F1V A;  3DP8 A;  5IZZ A;  1K9Z A;  1MXW A;  4QFP A;  5M2V A;  3MP6 A;  2QMX A;  1UIV A;  3TOD A;  4H1X A;  4N07 A;  3FXB A;  4GX4 A;  4GD5 A;  5IKB A;  2CEX A;  2XWV A;  4NF5 B;  4NWC A;  4PE5 B;  3PUZ E;  4GWU A;  2HFB A;  2OBG A;  5FTI A;  3CFL A;  3EKI A;  1RDZ A;  2XXQ A;  5KDT A;  4OFO A;  4H5G A;  1JVY A;  3KN7 A;  2PCR A;  4GBW A;  4N17 A;  1LB8 A;  1M5B A;  1LFG A;  3BIH A;  5K2X A;  2ONR A;  4G68 B;  4XKR A;  3KJ7 A;  2I0C A;  1B52 A;  4G68 C;  2ZMB A;  4GOT A;  1A54 A;  2CZI A;  1M5F A;  4NGU A;  4DCY A;  1CE2 A;  1IMA A;  1B2H A;  2ABH A;  4DE8 A;  4FAJ A;  5I58 A;  3FGS A;  4WXJ A;  4KYS A;  1OLA A;  2X7P A;  1MY0 A;  3TCF A;  1QJM A;  4FEB A;  2GHA A;  5ITO A;  1AMF A;  5B7D A;  3RNN A;  3IJX B;  2OWS A;  3JZJ A;  4GWZ A;  1R9L A;  1BLF A;  2OLB A;  4F19 A;  1MH3 A;  4N13 A;  2V3Q A;  4FJP A;  1JQF A;  3U72 A;  4JXI A;  4NF8 B;  3FXU A;  3SET A;  5AA2 D;  4PBH A;  4OEV A;  2Y7K A;  3QUF A;  4UAB A;  5I57 B;  1N7X A;  4R75 A;  3KFM A;  1TFA A;  2XXU A;  3O6G A;  2HAU A;  2O1M A;  1XS5 A;  2DYX A;  3G3F A;  1LBC A;  4PAK A;  4MNC A;  4NF4 A;  4OER A;  1B46 A;  4IB2 A;  4DXB A;  4LAT A;  4LZ7 A;  2VPN A;  5HM4 B;  4QHQ A;  3K00 A;  3FAS A;  5EQA A;  2X26 A;  4Z0I A;  5A5L A;  3KGC A;  1NV0 A;  2PMS A;  2R8T A;  4YMB A;  1EZ9 A;  3OO7 A;  4QFL A;  1FQE A;  2E0S A;  3EPE A;  3PMW A;  1DPE A;  1GV8 A;  1AWB A;  4GVO A;  4HW8 A;  1P1Q A;  2Q88 A;  2I58 A;  1POY 1;  4KQP A;  4X9T A;  5DW8 A;  1Q1K A;  2V25 A;  2Y7R A;  2Q2A A;  2RC8 A;  4GXS B;  3WAF A;  1NUX A;  1SD3 A;  4O3B A;  3ZKK A;  1JW5 A;  1OIB A;  3DP6 A;  3CHG A;  3H6T A;  1J1N A;  1DMB A;  4OMB A;  1SPI A;  4PFB A;  1ZTY A;  2H25 A;  3HPI A;  1QGX A;  1ATG A;  1MXY A;  1HSJ A;  1POT A;  2Y5K A;  1AOV A;  4JB7 A;  1USY E;  2ZZV A;  1P1N A;  1MXZ A;  1ZMG A;  4R6K A;  4R2B A;  5EYH A;  2WKY A;  1O64 A;  1ZIU A;  2F8D A;  4U22 A;  5J1D A;  5L8D A;  4BDO A;  3BKI B;  3O28 A;  1NUW A;  3KN8 A;  4GWY A;  3FD3 A;  3C33 A;  2O84 X;  3MWB A;  5F7V A;  4I1D A;  1NH8 A;  1XVX A;  5FBP A;  4ZEB A;  3MYU A;  2XHD A;  1GTK A;  4GX6 A;  4N15 A;  3K01 A;  3C9H A;  3ONM A;  2GH9 A;  3K4U A;  3ECR A;  1B0H A;  4F31 B;  5K2Y A;  1EH3 A;  2UYE A;  1N76 A;  2RC7 A;  1FPB A;  3KC0 A;  1OLC A;  3LUZ A;  4G8H A;  4WED A;  3ODB A;  1DOT A;  1MXU A;  3K02 A;  1FBP A;  3OXN A;  1B1X A;  5TPA A;  3Q26 A;  3VE1 B;  4ZEI A;  4PET A;  1FQD A;  4R9G A;  3UA8 A;  3QYT A;  3M3L A;  4HCY A;  3I6V A;  1OQG A;  5ET8 A;  2PBW A;  2F7A A;  4BDN A;  3EHS A;  1LST A;  4IGT A;  4OEN A;  4YU0 A;  1EYJ A;  2DOJ A;  1AL3 A;  2L5V A;  3EN3 A;  3LSX A;  4XTC Q;  1BTJ A;  1FPG A;  3MVX A;  2HXR A;  1A8E A;  2F35 A;  1B3G A;  3P7I A;  4R74 A;  4NF6 B;  3RUM A;  1TFD A;  2XX8 A;  1UTH A;  1H76 A;  3SEW A;  1LGB C;  3KN3 A;  1WOD A;  3SEV A;  3BFU A;  2XWI A;  4KD5 A;  4MH5 A;  4NHB A;  1FBD A;  4PE3 A;  3OEK A;  2XXY A;  3LR1 A;  2ALU A;  1N3W A;  3PPO A;  4X1B A;  5IZ1 A;  4R2F A;  4E0W A;  3IOR A;  2RIN A;  4OHN A;  2I0B A;  1LFH A;  3OEM A;  1B6H A;  2GQ1 A;  3D4C A;  1MY3 A;  3C4M A;  2F6P A;  3C32 A;  1UIU A;  1CNQ A;  2OJT A;  3K6W A;  4GQO A;  1VR5 A;  4ESX A;  1XT8 A;  3H6W A;  1B5H A;  3FXQ A;  4DZ1 A;  3PPQ A;  1DSN A;  1RYX A;  2KR0 A;  4U21 A;  1URG A;  2NOO A;  1ZBM A;  2DWH A;  1MM6 A;  3G3H A;  2B3B A;  3TTN A;  2O69 A;  3PTY A;  4OFL A;  4G8M A;  2O6A A;  4MCO A;  2FBP A;  4U1Z A;  2V84 A;  1B4H A;  2QS1 A;  3JV9 A;  3U1O A;  4PDD A;  1K9Y A;  4KI0 E;  3RTF B;  1Y4T A;  3UP9 A;  1INP A;  2QVR A;  3FVK A;  3RN8 A;  1N0T A;  4PCD A;  1MY4 A;  1NV3 A;  5ELV A;  2F97 A;  1IMC A;  2R9J A;  2D21 A;  4OVS A;  4JWX A;  2DQV A;  3VVE A;  5AA2 B;  3B6W A;  5I2K A;  1FTJ A;  3F11 A;  4EXK A;  4EQ9 A;  1ANF A;  1FBE A;  4C1U A;  1D4N A;  4N81 A;  4AS4 A;  5LTC A;  1YZ0 A;  3W9V A;  4PFT A;  2UVG A;  3OMB A;  1OVT A;  1GR2 A;  1OVB A;  4M1V A;  3TTR A;  1B0L A;  3K1P A;  3KSJ A;  3USD A;  3S9L C;  3FJ7 A;  3MZ9 A;  1IQ7 A;  2XXX A;  3CSB A;  4G2Z A;  1MXX A;  3O66 A;  3QXM A;  3TYH A;  4OET A;  2PT1 A;  3W15 C;  4JBZ A;  1I6Q A;  4ZE9 A;  2DWI A;  4DLD A;  4G61 A;  2QS2 A;  2Q9T A;  2RC9 A;  4RPO A;  2WX9 A;  4U4S A;  2XXP A;  1DPP A;  4JSD A;  1QW0 A;  5IZ3 A;  3T0J A;  1LLS A;  4OVR A;  1G0I A;  4KCD A;  3MVW A;  4FE8 A;  2H99 A;  3G3G A;  3PV0 E;  4DXC A;  4GIZ A;  3V5A A;  4OWD A;  1N84 A;  3B6Q A;  4YKP A;  3U8Q A;  4NQ8 A;  4R6H A;  3V83 A;  2FVZ A;  4HE1 A;  3JYR A;  1IZ1 A;  2RKM A;  2PFY A;  2QJE A;  2B3F A;  1NNP A;  1ZJL A;  2ZNS A;  2ANJ A;  1SW1 A;  2AL4 A;  2GFE A;  4NX1 A;  5CMK A;  4DXU A;  5TU0 A;  3IOT A;  3B8B A;  2O68 A;  1LAH E;  1FRP A;  3PMX A;  4OVT A;  3TZA A;  1FCK A;  3KBR A;  1M5C A;  5CM6 A;  3S9M C;  1ZKB A;  4GL8 A;  4OVQ A;  3LSL A;  4H0W A;  1PEB A;  4QSC A;  2G29 A;  1US4 A;  1NV4 A;  4MLQ A;  3IFC A;  4O7I A;  4R9F A;  2NXO A;  5CMM A;  4LA9 A;  1MPD A;  4YMA A;  1DTZ A;  1MXV A;  4YB5 A;  2FIX A;  4LQ2 A;  3K6V A;  4NF6 A;  1FTM A;  3BIG A;  2F78 A;  2Y7P A;  4U23 A;  4OEU A;  4MFI A;  3THI A;  4QRZ A;  3OEN A;  3EHT A;  5I5P A;  3IB1 A;  3TKD A;  4GX3 A;  1A8F A;  1NV2 A;  4QSD A;  5ET6 A;  4QFO A;  1JW4 A;  4ELR A;  4MX6 A;  2ZXT A;  3U92 A;  3Q27 A;  1LCF A;  3E9X A;  2P3V A;  4YB6 A;  3T9U A;  3E4R A;  1Q35 A;  3U65 A;  1PC3 A;  4MMP A;  4GWO A;  3IOV A;  5TPA B;  3MVY A;  4TQU Q;  4N4U A;  5H8N A;  3HCQ A;  1Y3Q A; 
#chains in the Genus database with same CATH homology
 5DEX A;  4P0I A;  4PFY A;  1EZP A;  4RXL A;  3R6U A;  2CZL A;  4XKP A;  3C35 A;  3RTW B;  2F34 A;  1TXF A;  1YAE A;  1SW2 A;  3T9X B;  4LUB A;  1USY H;  1KWH A;  1B4Z A;  4PQJ A;  5EHM A;  1UTH B;  3BFT A;  4Q8R A;  1UQW A;  4GXA A;  2UXA A;  3H03 A;  4UAC A;  5FHO A;  2RCB A;  2VGQ A;  5AA2 A;  3U93 A;  4ZED A;  4YKK A;  5FHN A;  3PD8 A;  1P99 A;  2I3V A;  3G3I A;  4ONY A;  4LZ5 A;  4F22 A;  1XVY A;  1LAF E;  3VFJ A;  3ILU B;  1M5D A;  4AQ4 A;  3T66 A;  4WKM A;  4AB5 A;  4RYA A;  3O9P A;  1SW5 A;  2XXW A;  2F5X A;  1NL5 A;  5ICT A;  1JVX A;  1PBP A;  1S9T A;  2ZYO A;  4BLA A;  1FTO A;  3FIR A;  1SI1 A;  5CBR A;  3TEP A;  1LAG E;  2X7Q A;  3PUV E;  3FVO A;  5KZT A;  4R6Y A;  4RY1 A;  1IXG A;  3OOA A;  1B5I A;  1L5T A;  2DXY A;  2Z22 A;  4RK9 A;  3CG3 A;  3DEL B;  2KLF A;  1ZU0 A;  5JK4 A;  3V89 B;  3K1N A;  2Q8J A;  4X1D A;  4NED A;  3PU5 A;  3A3U A;  2DE2 A;  4XXU A;  3SER A;  4DDD A;  5AE4 A;  2Z8E A;  4I62 A;  1B32 A;  1NKX A;  5I2K B;  3UK4 A;  1B51 A;  2O51 A;  4YAH X;  4FED A;  5A5X A;  5JEI A;  2ONK E;  3PGF A;  5CMB A;  1PB8 A;  4FIM A;  3TTK A;  3UOR A;  4LP2 B;  2QSX A;  2FNC A;  2QRY A;  3ZKL A;  1HSE A;  3O97 A;  1PB9 A;  2VOZ A;  3N5L A;  4POX A;  5L9S A;  3FJG A;  1ELJ A;  2I49 A;  2O7U A;  1RYO A;  3SKP A;  3S9E A;  1QVS A;  3CRB A;  3G3J A;  3QSL A;  4ECF A;  5CI5 A;  2I4C A;  4F2Q A;  3OD7 A;  1B05 A;  2UVH A;  1FTK A;  2ZYM A;  4GL0 A;  4F3G A;  5AA3 A;  1SYH A;  5I59 A;  1MH4 A;  4NMY A;  1WVJ A;  3IK6 B;  4IO5 A;  3VVF A;  1MDQ A;  1B9J A;  4F3P A;  1YPN A;  4IO2 A;  4Q5T A;  4ZEF A;  4YIC A;  2DWA A;  1URD A;  1FTL A;  3VV5 A;  4EUO A;  2M8C A;  2I3W A;  2IA4 A;  2YPN A;  5ISU A;  5CMC A;  3SEU A;  3IO6 A;  1MQI A;  1B7H A;  4F2O A;  1SBP A;  4KFQ A;  4IO7 A;  4IY5 A;  2HZK A;  4AB6 A;  3N6T A;  5DVF A;  1I69 A;  4C0R A;  3L6H A;  3K1M A;  3EF7 A;  3FXR A;  2FYI A;  3TFL A;  4RPN A;  3M3K A;  1IIW A;  3UGW A;  3CFZ A;  3CSG A;  1B7U A;  2VHA A;  2QS3 A;  3ZS6 A;  5L9O A;  2XXV A;  3HO7 A;  3C31 A;  4ZZE A;  3MZB A;  4HS7 A;  3IX1 A;  3SDF A;  3SEY A;  2BJJ X;  2PYY A;  5H8F A;  2G93 A;  1P1W A;  3LUY A;  5HBC A;  5IAI A;  4H8J A;  3WAE A;  2OCU A;  2HXW A;  3PPR A;  5H8N B;  4LZ8 A;  2IEE A;  3GXA A;  1O63 A;  5DEX B;  3IR1 A;  4ZZA A;  1D9Y A;  1GVC A;  1BKA A;  2VD2 A;  3TDJ A;  5CC2 A;  3H3G A;  4LQ5 A;  2UYF A;  1MQG A;  4X48 A;  4IY6 A;  2R71 A;  2ZYN A;  2NWJ A;  3A3C A;  3RT6 B;  3VLW A;  4H5F A;  1Y1M A;  3RGY A;  1JEU A;  3T93 B;  1JET A;  1A40 A;  3TCG A;  4ZS9 A;  2P1S A;  4ZEC A;  4F1U A;  1Y9U A;  4IO4 A;  4E0X A;  1PB7 A;  2DWJ A;  2XXR A;  3RLF E;  1EU8 A;  3MP8 A;  2I48 A;  4THI A;  4WEP A;  4ELQ A;  2D5W A;  1B3F A;  4GLI A;  3QUJ A;  4ESW A;  1XHY A;  2H4I A;  1SQY A;  5I2N A;  2V93 A;  3H6V A;  2W7Y A;  3T9H B;  2F6G A;  3M3F A;  4YZZ A;  2H5Y A;  3QIM A;  4YB7 A;  1H44 A;  3VXC A;  1OMP A;  2PVU A;  4F29 A;  3K6U A;  3EQ1 A;  1H45 A;  5EYF A;  4G77 A;  1IIT A;  1PDA A;  3OSQ A;  3RPW A;  2LAO A;  4N6P A;  3O29 A;  1CB6 A;  1D3K A;  5KCJ A;  4KYD A;  2A5T A;  3HHF A;  2RF1 A;  3SES A;  5ICQ A;  4H8I A;  4OVJ A;  2DS9 A;  1MS7 A;  1FW0 A;  2VP1 A;  3KSX A;  3IAZ A;  3R26 A;  1MPB A;  3FVN A;  5H8S A;  5JTY A;  4R72 A;  3IOU A;  1OQH A;  4JWY A;  3KOT A;  1LAX A;  1YTV A;  4FEC A;  4XKN A;  5A5X B;  2DVC A;  4RK2 A;  4F1Y A;  3VLU A;  4KPT A;  1LFI A;  3G3K A;  3IO4 A;  2E1S A;  4I8C A;  3RQT A;  1QUJ A;  5FHM A;  5TP9 A;  2AIX A;  4GF8 A;  4I9D A;  3TEL A;  1A7L A;  2DSF A;  2OZZ A;  2QMW A;  3R7X A;  3PPN A;  4R73 A;  5CBS A;  3O6I A;  3KJT A;  1AIV A;  3LC8 A;  4EQB A;  3ZSF A;  2HCA A;  2H98 A;  4G4P A;  2F36 A;  3RY3 A;  3KZG A;  3LSF B;  4O3C A;  1DTG A;  3Q28 A;  1VFE A;  1YCJ A;  2HQ0 A;  4OES A;  4QFK A;  5I59 B;  2HZL A;  3MPL A;  3PPP A;  3VXB A;  2XXI A;  3MBP A;  4ELO A;  3IB2 A;  4GRK A;  5DTB A;  4ZDM A;  2UVJ A;  1FQF A;  4M4G A;  5I56 A;  3MC2 A;  1B58 A;  1I6B A;  4QFN A;  5FTH A;  2ZNT A;  5LOM A;  1VSO A;  1MQJ A;  4PFW A;  4HTG A;  3G7W A;  4U4X A;  1XOC A;  2O7I A;  1R1N A;  1MQD A;  3U94 A;  2XD3 A;  3CR9 A;  1A99 A;  1LCT A;  4OTE A;  3TTL A;  3HST A;  1Y20 A;  1T0K A;  4GFR A;  5DVJ A;  4EF1 A;  1N7W A;  3W9W A;  3MW0 A;  3D4G A;  4F3B A;  4DIG A;  1NH7 A;  4G8N A;  4FAT A;  1B3H A;  4JWO A;  3FVG A;  1US5 A;  1URS A;  4Q30 B;  5H8F B;  5B70 A;  5H8Q A;  3FV1 A;  1QKB A;  3H7M A;  4XKQ A;  3T96 B;  1UTB A;  3EHU A;  1B3L A;  5HPQ A;  3O6H A;  2Q2C A;  3OEL A;  3MZ1 A;  3I5O A;  2V3T A;  4EF2 A;  1MY1 A;  1JW1 A;  4KCC A;  1P1U A;  2YJP A;  1B1H A;  2OWT A;  4ISU A;  1NFT A;  4LON B;  3LSW A;  1II5 A;  5DVI A;  5DT6 A;  5AA1 A;  4ND9 A;  3TCH A;  4O3A A;  2Y7W A;  3OO9 A;  2RCA A;  3ILT B;  1Z7N E;  1MDP 1;  1O7T A;  2O1L A;  1B3E A;  2XX7 A;  4PP0 A;  3IOW A;  4MF3 A;  4BDM A;  4P11 A;  5H8H A;  3B6T A;  5I84 A;  1IXH A;  2QS4 A;  3PUW E;  1P1O A;  1B7Z A;  4QSE A;  2ESN A;  4DCX A;  1IXC A;  5I2N B;  2NUV A;  2THI A;  4OZ9 A;  1NNT A;  2DE4 A;  3SEX A;  2OK2 A;  3H4Z A;  1NNF A;  1QUI A;  2UVI A;  4IO3 A;  3DP4 A;  5ITP A;  3B7D A;  3CVG A;  4IO6 A;  4HCW A;  4YKI A;  1WDN A;  3E3K A;  1NMU A;  1IEJ A;  5CRY A;  4F39 A;  5L9M A;  4EQ7 A;  1SYI A;  3H6U A;  1FQA A;  3GBB A;  4H67 A;  2Y7I A;  3HHG A;  3OO6 A;  2B65 A;  4LVQ A;  3MPK A;  1Y1Z A;  3VDF A;  3PUX E;  5KCJ B;  2ZNU A;  2A5T B;  2P2A A;  3T9V A;  1A55 A;  3IJO B;  4KHZ E;  4H65 A;  1M5E A;  3IL1 B;  3BBR A;  3I3V A;  3GBA A;  1R6Z A;  3FAT A;  5JTY B;  1I6A A;  4EDP A;  1MY2 A;  3T22 A;  3VLV A;  4NF5 A;  3QAX A;  2XD2 A;  4U2R A;  3Q29 A;  2ZYK A;  2ONS A;  2Q89 A;  1MM7 A;  3PMV A;  2HEU A;  3N6U A;  1MQH A;  3HV1 A;  5TP9 B;  3K2D A;  4K3F A;  3TUS A;  4IGR A;  3CI8 A;  2Z8D A;  1LB9 A;  4H6D A;  1LBB A;  1D9V A;  4G68 A;  2I4B A;  2I6E A;  3MQ9 A;  3TPA A;  1ZLQ A;  2F7B A;  1Y3N A;  1IXI A;  1S50 A;  4RNS A;  1JEV A;  3CG1 A;  1VFD A;  1QUK A;  2DP8 A;  3N94 A;  2HAV A;  2QL3 A;  1QKA A;  3FZV A;  3O2A A;  5AA4 B;  4MBP A;  3FJM A;  4NE4 A;  2DE3 A;  1AH5 A;  4ELP A;  4NTL A;  2NVU B;  2PT2 A;  1TT1 A;  1Z7M E;  4YKJ A;  1N04 A;  4F18 A;  3FUZ A;  3UN6 A;  3TMG A;  4OFJ A;  5I56 B;  3L6G A;  5BWJ A;  3CIJ A;  4NF8 A;  4RA1 A;  3GZG A;  3IB0 A;  5I57 A;  3MUQ A;  3E13 X;  3MP1 A;  4JDF A;  5KDT B;  3S2V A;  1XC1 A;  1Y4C A;  4NWD A;  1BP5 A;  2QPQ A;  3CFX A;  1B40 A;  2YLN A;  3OSR A;  2AYS A;  3MVZ A;  1N3X A;  1EZO A;  1MPC A;  3K0V A;  3V8X B;  3TTM A;  1JNF A;  4KYE A;  5DYH A;  2GRV A;  3C34 A;  4P0G A;  2PX1 A;  5I58 B;  3PUY E;  4RJZ A;  5H8Q B;  2V3U A;  3Q25 A;  4XIG Q;  3KEI A;  4UA8 A;  2D3I A;  3S9N C;  3C36 A;  1UTB B;  3UIF A;  3A09 A;  2DVZ A;  3TAJ A;  3TQW A;  2Y84 A;  4BDL A;  3QK6 A;  4JSO A;  3S4U A;  3FV2 A;  4QF9 A;  2AL5 A;  3VVD A;  4ZEK A;  1PBQ A;  5BUU A;  1BIY A;  1Y3P A;  3M8U A;  1SDX A;  1R9Q A;  4OXV A;  3KOS A;  3MAM A;  3H06 B;  3RT8 A;  2REJ A;  2A5S A;  1TWY A;  4PFU A;  2CMO A;  4OQO A;  1MG1 A;  1GGG A;  1IUD A;  4NF4 B;  3HN0 A;  4FOR A;  4EXL A;  2H9B A;  1B5J A;  3OO8 A;  4C1T A;  4KR5 A;  3MJN A;  1RKM A;  2XXH A;  4BDQ A;  4F3S A;  3TQL A;  1S7Y A;  5H8H B;  3GLB A;  2R6G E;  5F1Q A;  1MRP A;  4TLM B;  4TOZ A;  1FQB A;  1SI0 A;  2GHB A;  2DXR A;  2REG A;  3PD9 A;  4TLL B;  3KG2 A;  1H43 A;  5EHS A;  2Z8F A;  4MLV A;  2Z23 A;  1F9B A;  1HSL A;  1FQC A;  3DLN A;  4Q0C A;  4POW A;  2P0S A;  2F7C A;  1NNK A;  1SW4 A;  1VE4 A;  3LBS A;  2XX9 A;  4Z7E A;  1QUL A;  4L17 A;  4ZE8 A;  4BDR A;  3AXF A;  2VD3 A;  4OYV A;  4U1O A;  3DM0 A;  1H3D A;  2XXT A;  1SVX B;  3N26 A;  3K6X A;  2FA7 A;  5AA4 A;  4F1V A;  3DP8 A;  1MXW A;  4QFP A;  5M2V A;  3MP6 A;  2QMX A;  1UIV A;  3TOD A;  4H1X A;  4N07 A;  5IKB A;  4GD5 A;  4NF5 B;  4NWC A;  4PE5 B;  3PUZ E;  2HFB A;  2OBG A;  5FTI A;  3CFL A;  2XXQ A;  5KDT A;  4OFO A;  4H5G A;  1JVY A;  3KN7 A;  1LB8 A;  1M5B A;  1LFG A;  5K2X A;  2ONR A;  4G68 B;  4XKR A;  3KJ7 A;  2I0C A;  1B52 A;  4G68 C;  2ZMB A;  4GOT A;  1A54 A;  1M5F A;  4DCY A;  1CE2 A;  1B2H A;  4FAJ A;  2ABH A;  4DE8 A;  5I58 A;  3FGS A;  4WXJ A;  4KYS A;  1OLA A;  2X7P A;  1MY0 A;  3TCF A;  1QJM A;  4FEB A;  2GHA A;  5ITO A;  1AMF A;  5B7D A;  3RNN A;  3IJX B;  2OWS A;  3JZJ A;  1R9L A;  1BLF A;  2OLB A;  4F19 A;  1MH3 A;  4N13 A;  2V3Q A;  4FJP A;  1JQF A;  3U72 A;  4JXI A;  4NF8 B;  3FXU A;  3SET A;  5AA2 D;  4OEV A;  2Y7K A;  3QUF A;  5I57 B;  1N7X A;  4R75 A;  3KFM A;  1TFA A;  2XXU A;  3O6G A;  2HAU A;  2O1M A;  1XS5 A;  2DYX A;  3G3F A;  1LBC A;  4NF4 A;  4OER A;  1B46 A;  4IB2 A;  4DXB A;  4LAT A;  4LZ7 A;  5HM4 B;  4QHQ A;  3K00 A;  3FAS A;  2X26 A;  4Z0I A;  3KGC A;  2PMS A;  4YMB A;  1EZ9 A;  3OO7 A;  4QFL A;  1FQE A;  2E0S A;  3EPE A;  3PMW A;  1DPE A;  1GV8 A;  4GVO A;  4HW8 A;  1P1Q A;  2Q88 A;  2I58 A;  1POY 1;  4KQP A;  4X9T A;  1Q1K A;  2V25 A;  2Y7R A;  2Q2A A;  2RC8 A;  4GXS B;  3WAF A;  1SD3 A;  4O3B A;  3ZKK A;  1JW5 A;  1OIB A;  3DP6 A;  3H6T A;  1J1N A;  1DMB A;  4OMB A;  1ZTY A;  2H25 A;  3HPI A;  1ATG A;  1MXY A;  1HSJ A;  1POT A;  1AOV A;  4JB7 A;  1USY E;  1P1N A;  1MXZ A;  1ZMG A;  4R6K A;  4R2B A;  2WKY A;  1O64 A;  1ZIU A;  2F8D A;  4U22 A;  5J1D A;  5L8D A;  4BDO A;  3BKI B;  3O28 A;  3KN8 A;  3FD3 A;  3C33 A;  2O84 X;  3MWB A;  5F7V A;  4I1D A;  1NH8 A;  1XVX A;  4ZEB A;  2XHD A;  1GTK A;  3K01 A;  3C9H A;  3ONM A;  2GH9 A;  3K4U A;  3ECR A;  1B0H A;  4F31 B;  5K2Y A;  1EH3 A;  2UYE A;  1N76 A;  2RC7 A;  1OLC A;  4G8H A;  4WED A;  3ODB A;  1DOT A;  1MXU A;  3K02 A;  3OXN A;  1B1X A;  5TPA A;  3Q26 A;  3VE1 B;  4ZEI A;  4PET A;  1FQD A;  4R9G A;  3UA8 A;  3QYT A;  3M3L A;  4HCY A;  3I6V A;  1OQG A;  2PBW A;  2F7A A;  4BDN A;  3EHS A;  1LST A;  4IGT A;  4OEN A;  4YU0 A;  2DOJ A;  1AL3 A;  3EN3 A;  3LSX A;  4XTC Q;  1BTJ A;  3MVX A;  1A8E A;  2F35 A;  1B3G A;  3P7I A;  4R74 A;  4NF6 B;  3RUM A;  1TFD A;  2XX8 A;  1UTH A;  1H76 A;  3SEW A;  1LGB C;  3KN3 A;  1WOD A;  3SEV A;  3BFU A;  4KD5 A;  4MH5 A;  3OEK A;  2XXY A;  3LR1 A;  2ALU A;  1N3W A;  3PPO A;  4X1B A;  4R2F A;  4E0W A;  3IOR A;  2RIN A;  4OHN A;  2I0B A;  1LFH A;  3OEM A;  1B6H A;  3D4C A;  1MY3 A;  3C4M A;  2F6P A;  3C32 A;  1UIU A;  2OJT A;  3K6W A;  4GQO A;  1VR5 A;  4ESX A;  1XT8 A;  3H6W A;  1B5H A;  3FXQ A;  4DZ1 A;  3PPQ A;  1DSN A;  1RYX A;  4U21 A;  1URG A;  2NOO A;  1ZBM A;  2DWH A;  1MM6 A;  3G3H A;  2B3B A;  3TTN A;  2O69 A;  4OFL A;  4G8M A;  2O6A A;  2V84 A;  4U1Z A;  1B4H A;  2QS1 A;  3JV9 A;  3U1O A;  4KI0 E;  3RTF B;  1Y4T A;  3UP9 A;  3FVK A;  3RN8 A;  1N0T A;  1MY4 A;  5ELV A;  2F97 A;  2R9J A;  2D21 A;  4JWX A;  2DQV A;  3VVE A;  5AA2 B;  3B6W A;  5I2K A;  1FTJ A;  3F11 A;  4EXK A;  4EQ9 A;  1ANF A;  4C1U A;  1D4N A;  3W9V A;  4PFT A;  2UVG A;  3OMB A;  1OVT A;  1GR2 A;  1OVB A;  4M1V A;  3TTR A;  1B0L A;  3K1P A;  3KSJ A;  3USD A;  3S9L C;  3FJ7 A;  3MZ9 A;  1IQ7 A;  2XXX A;  3CSB A;  4G2Z A;  1MXX A;  3O66 A;  3QXM A;  3TYH A;  4OET A;  2PT1 A;  3W15 C;  4JBZ A;  1I6Q A;  4ZE9 A;  2DWI A;  4DLD A;  2QS2 A;  2Q9T A;  2RC9 A;  4RPO A;  4U4S A;  2XXP A;  1DPP A;  4JSD A;  1QW0 A;  1LLS A;  4KCD A;  3MVW A;  4FE8 A;  2H99 A;  3G3G A;  3PV0 E;  4DXC A;  4GIZ A;  3V5A A;  4OWD A;  1N84 A;  3B6Q A;  4YKP A;  3U8Q A;  4R6H A;  3V83 A;  3JYR A;  1IZ1 A;  2RKM A;  2QJE A;  2B3F A;  1NNP A;  1ZJL A;  2ZNS A;  2ANJ A;  1SW1 A;  2AL4 A;  2GFE A;  5CMK A;  4DXU A;  5TU0 A;  3IOT A;  2O68 A;  1LAH E;  3PMX A;  3TZA A;  1FCK A;  3KBR A;  1M5C A;  5CM6 A;  3S9M C;  1ZKB A;  4GL8 A;  3LSL A;  4H0W A;  1PEB A;  4QSC A;  2G29 A;  1US4 A;  4MLQ A;  4R9F A;  2NXO A;  5CMM A;  4LA9 A;  1MPD A;  4YMA A;  1DTZ A;  1MXV A;  4YB5 A;  4LQ2 A;  3K6V A;  4NF6 A;  1FTM A;  2F78 A;  2Y7P A;  4U23 A;  4OEU A;  4MFI A;  3THI A;  4QRZ A;  3OEN A;  3EHT A;  3IB1 A;  3TKD A;  1A8F A;  4QSD A;  4QFO A;  1JW4 A;  4ELR A;  2ZXT A;  3U92 A;  3Q27 A;  1LCF A;  3E9X A;  4YB6 A;  3T9U A;  3E4R A;  1Q35 A;  1PC3 A;  4GWO A;  3IOV A;  5TPA B;  3MVY A;  4TQU Q;  5H8N A;  3HCQ A;  1Y3Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...