3IO6A

Huntingtin amino-terminal region with 17 gln residues - crystal c92-a
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
416
structure length
400
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMATLEKLMKAFESLKSFQQPPPPPPPPPPQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Maltose-binding periplasmic protein, HUNTINGTIN FUSION PROTE
publication title Secondary structure of Huntingtin amino-terminal region.
pubmed doi rcsb
source organism Escherichia coli k-12, homo sapiens
total genus 116
structure length 400
sequence length 416
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3io6A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3io6A02
2HEUA 4RY1A 5A5XA 4IO6A 4P0GA 3OO9A 1QW0A 1US5A 3MBPA 5EYFA 1M5EA 3D4GA 4QFPA 3K6UA 3GLBA 2H9BA 5CI5A 3RLFE 3FXUA 3V5AA 2Q2CA 2ZYKA 1ZKBA 1IUDA 2UVGA 5I57A 2F6PA 3O6IA 3SESA 3TYHA 2HXWA 1JW1A 4TQUQ 5H8QA 3C35A 2O69A 1XOCA 2HAUA 3M8UA 1ZJLA 4G8HA 4YMBA 3T9HB 1B3LA 4YU0A 4Q5TA 2PBWA 1MXZA 1Y20A 2F78A 5HM4B 1S50A 1MY2A 1UTBB 1BIYA 3CRBA 1IXIA 4GXSB 2GHAA 2DP8A 4YB5A 2H25A 4BDOA 4H6DA 5I84A 2Y7PA 1N76A 3OD7A 1ZLQA 2F5XA 1FW0A 4GFRA 4H67A 1UTBA 4OVJA 3USDA 4WXJA 5M2VA 1LFIA 4ZECA 1EZ9A 4OEUA 1YAEA 4QFLA 3IB2A 4U22A 1JVXA 4NF4B 1MY1A 4KYSA 3EHSA 3C31A 1M5BA 1WODA 2ZYNA 5KCJB 3G3JA 2H4IA 5ITOA 1MDQA 3H7MA 4H5GA 4M1VA 3MVXA 4YKKA 3VLWA 2GFEA 3ILTB 1T0KA 3IAZA 4FEBA 2XXVA 4E0XA 4G4PA 4YB7A 3TTMA 4O3CA 3M3LA 3IOTA 2O51A 4LUBA 4TLMB 3MJNA 1Y3QA 3MVZA 3KOTA 3IOVA 5L9OA 1NH7A 3PUYE 1J1NA 4DXUA 1TWYA 1MXWA 4JDFA 3G3FA 3W9WA 3VV5A 3DELB 2RINA 1SBPA 5FHMA 4LA9A 1B7UA 3H06B 4F22A 1H44A 4IY6A 4U1ZA 3K6WA 3PMVA 2QMXA 3MZ1A 4RPOA 1YCJA 1JVYA 3MP6A 1XC1A 1MRPA 2Y7KA 3CG1A 4C1UA 4G2ZA 4JSDA 4KFQA 1FQDA 2A5TA 1IITA 1O63A 3QUJA 3VXBA 4ZE8A 4NE4A 1PC3A 4OETA 1B5IA 1L5TA 3K00A 3G7WA 2RC8A 4EQ9A 2DWAA 1YTVA 1VFDA 4IO7A 1MXUA 1B4HA 2Y7IA 1A54A 3HHGA 3OENA 5TP9A 1QKAA 3IJXB 4EXLA 3R6UA 4FE8A 3S9EA 1IEJA 2OK2A 3LSXA 4R6HA 1MY0A 3OO6A 4G77A 2AL5A 2RC9A 2QSXA 3TAJA 3RPWA 1OIBA 1JEUA 4DCXA 4LQ2A 5CMCA 3EF7A 1MQHA 2NXOA 2ZYMA 1VSOA 2I4CA 3O28A 1DOTA 2DE3A 2QS1A 3OELA 3JZJA 1N0TA 3E3KA 3IL1B 3PUVE 1ZU0A 2VD2A 3H6WA 2X7QA 5DEXB 5BUUA 1IXHA 2XD3A 3E4RA 4TLLB 3C34A 1I6AA 1XVXA 4YKPA 2NWJA 4ZZEA 3ZS6A 1D4NA 4X9TA 3VVDA 1MQIA 1VR5A 1WVJA 4DIGA 2F6GA 4FECA 1LAXA 4X1DA 5HBCA 4XKRA 1I6QA 1A99A 4ELPA 1RYXA 2I3WA 3W15C 2Z22A 3K2DA 1WDNA 3GXAA 1M5CA 2OWTA 4PP0A 1PB7A 2XXWA 5CRYA 3FIRA 4N13A 1DTGA 1B1XA 1N7WA 1P1WA 3RNNA 3T9XB 3ZSFA 3KN8A 2XXXA 3MZBA 1B40A 3H4ZA 3CI8A 3OXNA 2ABHA 2HZLA 2FNCA 3PPQA 5DTBA 4C0RA 5I2KA 1RKMA 4UA8A 3UP9A 4I1DA 4GL0A 3QSLA 4R9FA 3JYRA 2V84A 4OFJA 1B51A 2BJJX 2Q88A 3FJ7A 2ZNTA 1P1QA 3E13X 3K6VA 3KOSA 1MPDA 4QSDA 5H8HA 3UN6A 1QUJA 5FHNA 4UACA 3CSBA 3G3HA 2E0SA 3UA8A 2QMWA 1Z7NE 1FQBA 4KCDA 3TPAA 5H8SA 3P7IA 4OXVA 3C9HA 2YLNA 4PFTA 3ODBA 4FJPA 1MG1A 3SEUA 2OWSA 5FTHA 4JBZA 4F3PA 4OHNA 3MQ9A 4BLAA 1A40A 1P99A 2F8DA 2XXHA 3TTNA 5AA2A 2DXRA 4YZZA 1D9VA 3KEIA 2B3BA 4JSOA 4G8MA 1H76A 2Z8FA 2XXQA 4XIGQ 3CR9A 2G93A 4F2QA 2ANJA 3SKPA 4OTEA 4RK9A 2P0SA 3OEKA 2NOOA 4MBPA 1ANFA 4M4GA 1ZTYA 3PPPA 5B7DA 5CM6A 3VE1B 3S9MC 1MS7A 4H0WA 3MVWA 2XX9A 2UYEA 3PV0E 2FA7A 3FJMA 5I2NA 2I6EA 1KWHA 2KLFA 2V3UA 4ONYA 5TPAA 1URGA 3TUSA 5DYHA 4XKNA 1B7ZA 4KD5A 1NNKA 5A5XB 1JW4A 4OFLA 2Y7WA 4PFWA 2O84X 1LAFE 1I6BA 4P0IA 1IXGA 4YB6A 3OSRA 1B1HA 2RCAA 2AL4A 2I3VA 4U2RA 2I49A 4OERA 2VGQA 5I57B 2ZXTA 2O7UA 1M5FA 1O7TA 4KYEA 4AQ4A 5H8QB 3VVFA 3LSLA 2V93A 3IJOB 2HCAA 4PE5B 2X26A 3PMXA 1NKXA 4GLIA 4DDDA 3TQWA 2PX1A 2YJPA 5CMMA 1NNTA 1NMUA 2ZNSA 5H8FB 3B7DA 3A09A 2DWIA 2DVZA 4QSCA 1MQDA 2PMSA 1EZOA 4ZEBA 3FV1A 3UORA 1ELJA 4NF5A 5KDTA 5H8FA 3S2VA 5AA3A 3GBBA 4RPNA 4QSEA 1POY1 2OCUA 2H98A 1H3DA 2H5YA 4GRKA 3CFLA 1GTKA 2DE4A 4QHQA 4POXA 3A3UA 3Q29A 3A3CA 4NF6A 4IO2A 1PB8A 4F18A 1CE2A 3QYTA 4H5FA 5KZTA 1DSNA 4F29A 3PGFA 4F1UA 1JW5A 1LFHA 3C36A 3PUWE 3LC8A 3O66A 2WKYA 3LBSA 2D3IA 3O2AA 4WKMA 3RN8A 1IZ1A 4HS7A 3U94A 3DLNA 2UVJA 4ZS9A 4IGTA 2F7AA 5AA4A 3SERA 2I58A 5CMKA 2PT1A 1GR2A 1S7YA 2Q2AA 2H99A 2GHBA 2RCBA 4OWDA 2F7CA 3CVGA 2V3TA 4JWXA 2HFBA 1H45A 4KR5A 3U92A 3TCHA 4POWA 4R73A 1LAGE 3Q27A 3SEVA 3JV9A 1HSEA 4R75A 1GGGA 3VVEA 2M8CA 1Y4CA 3PUXE 4ZDMA 4NTLA 3H03A 1DPEA 1N3WA 4EDPA 5DT6A 2E1SA 4EUOA 1FTJA 3SEYA 4JB7A 2O1MA 1XHYA 4G8NA 4LONB 2XHDA 3IK6B 4OEVA 2DQVA 2RF1A 4K3FA 2A5TB 4ZEIA 2OZZA 4OFOA 4XKQA 5F1QA 4IY5A 1NH8A 1Q1KA 5EHMA 4RNSA 1R6ZA 3MC2A 3FXQA 1SI1A 4ZE9A 3TTRA 1R9LA 1B4ZA 3CSGA 3U72A 1A8FA 1QUKA 4WEDA 1B5JA 2RKMA 1URDA 2O1LA 4WEPA 3S9LC 1R9QA 4ESWA 1Y3PA 5TP9B 4E0WA 4ND9A 5ITPA 2F36A 4LQ5A 3FXRA 4ISUA 3TTLA 3KJ7A 1B52A 1ZMGA 1MM7A 3M3KA 4ZEKA 3KSXA 1EU8A 4P11A 3T66A 3TEPA 2QPQA 3O97A 5BWJA 1MY3A 2VOZA 3DP8A 5AE4A 1MQGA 4YKIA 2XD2A 3PMWA 3TFLA 3FVGA 3CFXA 1N04A 3HHFA 1TFAA 2QL3A 4AB6A 4NMYA 1MH3A 3T93B 1TXFA 1MXVA 2OLBA 4KPTA 5JTYB 5TU0A 3FVKA 3TODA 3DP6A 4F1VA 4DE8A 5K2XA 4I62A 3OEMA 4BDNA 3U8QA 4OESA 5JTYA 2R9JA 2ONRA 1AL3A 2Y7RA 2B65A 1TT1A 2W7YA 5HPQA 2REJA 1SQYA 4Q30B 2Q9TA 3C4MA 4ECFA 4G68C 1MY4A 4DLDA 5CMBA 4TOZA 2OBGA 3TCGA 4ZZAA 3R7XA 1B7HA 3DP4A 3IB1A 3W9VA 3PD8A 1NL5A 2ZNUA 4MH5A 3FJGA 5I2KB 1FQFA 4IO5A 1OLCA 4G68A 1SW1A 1B0HA 4OZ9A 1JEVA 3Q28A 2F34A 4AB5A 1OLAA 1Y1MA 3LUYA 4ELOA 1FTMA 2Y84A 2VP1A 4Q0CA 1OQGA 1BKAA 1JQFA 1MPBA 3V8XB 4GQOA 3VLVA 4DCYA 4F31B 2CMOA 4F1YA 3IB0A 5L9MA 4I9DA 4U1OA 2V3QA 1LB9A 5H8HB 3QK6A 3K0VA 1B58A 1SD3A 5IAIA 3B6QA 2ESNA 4YKJA 4R74A 1QVSA 4L17A 4F2OA 3IOUA 1OVTA 2VD3A 4NWCA 3EPEA 3SEXA 1M5DA 1PBPA 5CBRA 5DVIA 4QFOA 4GIZA 3O6HA 4H1XA 3M3FA 3KN7A 4QRZA 4PETA 3KGCA 1FTKA 5I59A 2O68A 4H8IA 1Y9UA 3TCFA 2Z23A 4QF9A 3H6UA 2Q89A 4LATA 2QS3A 3TELA 5AA2B 3MW0A 1B6HA 2B3FA 3PUZE 3Q26A 3G3KA 3U93A 3K1PA 1MQJA 4Z0IA 3HN0A 1FQCA 4KYDA 3KG2A 4ZEDA 4H65A 1Z7ME 3LSFB 1B32A 4GF8A 5EHSA 2UXAA 4X48A 4MF3A 1MXYA 3F11A 3MP8A 5AA1A 4RA1A 4LZ8A 3B6TA 4FIMA 1SI0A 5DVFA 5I2NB 4NEDA 2UVIA 2P1SA 1VE4A 3AXFA 5TPAB 2XX7A 3EN3A 1H43A 1US4A 3OSQA 2QS4A 1SW4A 5I56B 1LGBC 1Y3NA 1FCKA 2Z8DA 1FQAA 1TFDA 2XXTA 1QULA 3SDFA 2P2AA 4IO4A 4BDMA 3H6VA 3RTFB 5I56A 3DM0A 5FTIA 2XXIA 2A5SA 3RUMA 5H8NA 2F35A 1UQWA 1F9BA 2ONSA 2F7BA 2UYFA 1DPPA 2DS9A 1AMFA 1IXCA 3O29A 3WAEA 2NVUB 1RYOA 4YAHX 4YMAA 4KQPA 4OMBA 3HSTA 4U21A 3CIJA 4NF5B 5KDTB 2F97A 1OQHA 4GXAA 4XKPA 4THIA 1NNPA 3IORA 3LSWA 1QJMA 5I58B 3HV1A 3ONMA 1B2HA 3GZGA 3PPRA 1B3GA 4HTGA 4JWYA 1LSTA 4F3GA 4YICA 3H6TA 4F3BA 2DE2A 5I58A 3MUQA 4NF6B 3E9XA 2I0BA 5K2YA 4IGRA 4HW8A 3SETA 2AYSA 3N5LA 4NWDA 4O3BA 1GV8A 1P1NA 3K6XA 2IEEA 2QRYA 3TTKA 1SW5A 3CFZA 3RGYA 1BTJA 3FVOA 4EQ7A 2GRVA 3EQ1A 2G29A 3FATA 3TQLA 1UTHB 2XXUA 4DXCA 1D3KA 3RT6B 3T9VA 5L9SA 3FD3A 4KCCA 4LP2B 1O64A 5AA4B 1LBCA 2Z8EA 4U4XA 1EH3A 1AIVA 3CG3A 5JK4A 1UTHA 3UIFA 2VHAA 1PDAA 3KN3A 4FATA 2V25A 3HPIA 4PFYA 2PVUA 3O6GA 2XX8A 1HSJA 3OO8A 4Q8RA 1NFTA 4RYAA 3VXCA 3MVYA 4R2BA 5ICTA 4NF4A 4JWOA 1USYE 1PB9A 3THIA 1B0LA 5J1DA 4IO3A 3ECRA 1JNFA 2THIA 4KI0E 3RQTA 1LCTA 4RXLA 3BFTA 5KCJA 3SEWA 1Y4TA 3IX1A 3FV2A 2RC7A 1B46A 2QJEA 3IR1A 1II5A 4PQJA 2UVHA 1LB8A 4JXIA 1OVBA 4GWOA 3BKIB 3N6TA 3PD9A 3HCQA 2ALUA 1ATGA 3EHUA 3D4CA 4DZ1A 4R6YA 2IA4A 3Q25A 1B3FA 5DVJA 3PPOA 3R26A 4R2FA 4ELQA 3ZKKA 1B3HA 4R9GA 3KZGA 3T22A 1OMPA 3N6UA 1QKBA 1SYHA 2I0CA 2ZYOA 3IO4A 1MPCA 2NUVA 4HCYA 4GL8A 3TKDA 3ZKLA 4Z7EA 1SDXA 1MDP1 4KHZE 1A7LA 1SVXB 4ZEFA 3MP1A 4EQBA 2DOJA 1GVCA 2XXYA 2GH9A 3KJTA 3K1MA 2DVCA 4EF2A 3MZ9A 3UGWA 3V83A 4XXUA 3KFMA 3FZVA 4BDLA 1R1NA 4QFKA 3B6WA 1MH4A 2ZMBA 1HSLA 1S9TA 4DXBA 3G3IA 1NNFA 1PEBA 1A55A 1SW2A 4ESXA 4LZ7A 1AOVA 2R71A 2AIXA 5L8DA 5FHOA 1QUIA 4OYVA 3GBAA 1JETA 1FQEA 3QUFA 1DTZA 3VLUA 1N84A 1B05A 4RK2A 2X7PA 2YPNA 3TDJA 3C33A 5ISUA 1LLSA 2DWHA 2DYXA 3OO7A 3QIMA 1XT8A 3RY3A 1XS5A 4C1TA 1Y1ZA 1PBQA 1FTLA 1LFGA 4R72A 3QXMA 3K1NA 4BDQA 3KSJA 4IB2A 3MAMA 4EF1A 4OQOA 3BFUA 4H8JA 4G68B 5DEXA 1ZIUA 3FUZA 3RTWB 4ELRA 1Q35A 5F7VA 1CB6A 4F19A 1B9JA 3QAXA 2OJTA 5IKBA 1MM6A 2PT2A 1BP5A 2Q8JA 3S9NC 1LAHE 3IO6A 3C32A 4RJZA 1IIWA 2DXYA 3EHTA 3G3GA 4HCWA 2DWJA 3V89B 4GVOA 1AH5A 1UIUA 3IOWA 3WAFA 4XTCQ 4R6KA 2HZKA 1N3XA 3K02A 4OENA 4PFUA 1LBBA 3H3GA 3U1OA 4MLQA 1FTOA 3FVNA 2HAVA 1LCFA 4I8CA 3VFJA 4F3SA 5I59B 3N94A 1ZBMA 5AA2D 1P1UA 5ELVA 2HQ0A 3I6VA 1B5HA 4LVQA 3HO7A 1A8EA 2CZLA 1USYH 1YPNA 5CBSA 3MPLA 4QFNA 4X1BA 3T9UA 2ONKE 3KBRA 3L6HA 5CC2A 2I48A 4GOTA 4U4SA 4U23A 1EZPA 4FORA 2REGA 4FAJA 3N26A 2O6AA 2D5WA 1N7XA 3L6GA 1BLFA 3S4UA 3VDFA 4BDRA 4FEDA 4GD5A 2XXPA 3MPKA 4F39A 2FYIA 1P1OA 4NF8B 3I5OA 2XXRA 3TZAA 1POTA 3K01A 5JEIA 3RT8A 1IQ7A 2PYYA 4NF8A 3FGSA 1UIVA 1XVYA 3MWBA 4N07A 5B70A 3K4UA 5LOMA 2O7IA 2R6GE 3BBRA 4N6PA 1VFEA 1D9YA 3UK4A 3OMBA 4MFIA 1URSA 3FASA 5H8NB 3TMGA 3PPNA 4MLVA 3LR1A 3ILUB 2QS2A 1MXXA 2D21A 4O3AA 3T96B 3I3VA 4EXKA 3OOAA 5ICQA 2LAOA 1B3EA 2I4BA 3PU5A 1I69A 1DMBA 4LZ5A 2DSFA 1SYIA 3O9PA
chains in the Genus database with same CATH superfamily
2HEUA 4RY1A 5A5XA 4IO6A 4P0GA 3OO9A 5IM2A 1QW0A 1US5A 3MBPA 5EYFA 1M5EA 2PFZA 3D4GA 4QFPA 3K6UA 4XEQA 2JJKA 2H9BA 3GLBA 5CI5A 3RLFE 3FXUA 2B4LA 3V5AA 2Q2CA 2ZYKA 1ZKBA 1IUDA 2UVGA 4QBAA 5I57A 2F6PA 1IMAA 3O6IA 3SESA 3TYHA 5EYHA 2HXWA 1FBFA 1DCUA 1JW1A 4TQUQ 5H8QA 3C35A 2O69A 1XOCA 2HAUA 3M8UA 1ZJLA 4G8HA 4YMBA 2FHYA 3T9HB 1B3LA 4YU0A 4Q5TA 2PBWA 1MXZA 1Y20A 2F78A 5HM4B 1S50A 1MY2A 1UTBB 1BIYA 3CRBA 1IXIA 4GXSB 2GHAA 2DP8A 1INPA 4YB5A 2H25A 4BDOA 4H6DA 5I84A 2Y7PA 1N76A 3OD7A 1ZLQA 2F5XA 1FW0A 4GFRA 4H67A 1UTBA 4OVJA 3LUZA 3USDA 2V4CA 4OVSA 4WXJA 5M2VA 1LFIA 5IZ1A 4ZECA 1EZ9A 1NV7A 4OEUA 1YAEA 4QFLA 3IB2A 4U22A 1JVXA 4PCDA 1NV1A 4NF4B 4PGPA 1MY1A 4KYSA 3EHSA 3C31A 3EKIA 1M5BA 4MNPA 4PF6A 1WODA 5ET6A 5J16A 2ZYNA 5KCJB 3G3JA 2H4IA 5ITOA 1MDQA 3H7MA 4H5GA 4M1VA 3MVXA 4YKKA 3VLWA 3FBPA 2GFEA 3ILTB 1T0KA 2XWVA 3IAZA 4FEBA 2XXVA 4E0XA 1LBXA 4NGUA 4G4PA 3BIHA 4YB7A 3TTMA 4O3CA 3M3LA 2FIXA 3IOTA 2O51A 4LUBA 4TLMB 3MJNA 1Y3QA 3MVZA 3KOTA 3IOVA 3GYYA 5L9OA 1NH7A 3PUYE 1J1NA 4DXUA 1TWYA 5LDZA 4I3YA 1MXWA 4JDFA 3G3FA 3W9WA 3VV5A 2XWOA 3DELB 2RINA 1SBPA 5FHMA 1LBWA 4LA9A 4PGNA 2KQZA 1B7UA 3H06B 4F22A 1H44A 4IY6A 4U1ZA 3K6WA 3PMVA 2QMXA 3MZ1A 4RPOA 1YCJA 1JVYA 3BIGA 3MP6A 1XC1A 1FBGA 1MRPA 2Y7KA 3CG1A 4C1UA 4G2ZA 4JSDA 4KFQA 1FQDA 2A5TA 1IITA 1O63A 3QUJA 3VXBA 4ZE8A 2QVVA 4NE4A 1PC3A 2FIEA 4OETA 2QVUA 1B5IA 1L5TA 2PCRA 4P47A 3K00A 3G7WA 2RC8A 4EQ9A 2DWAA 1YTVA 1VFDA 4IO7A 4PFBA 1MXUA 1B4HA 2Y7IA 1A54A 3HHGA 3OENA 5TP9A 1QKAA 3IJXB 4EXLA 3R6UA 4O7MA 4FE8A 3S9EA 1IEJA 2OK2A 3LSXA 4DI4B 4R6HA 1MY0A 3OO6A 1XI6A 4G77A 2WBDA 2AL5A 2RC9A 2QSXA 4NQ8A 3TAJA 3RPWA 1OIBA 4HE2A 1JEUA 4DCXA 2Y5LA 4LQ2A 5CMCA 3EF7A 1MQHA 2NXOA 4PBHA 2ZYMA 1VSOA 2I4CA 3O28A 1DOTA 1KA0A 2DE3A 2QS1A 2P3NA 3MYUA 1Q9DA 3OELA 3JZJA 1N0TA 3E3KA 3IL1B 3PUVE 1ZU0A 2VD2A 3H6WA 2X7QA 5DEXB 5BUUA 1IXHA 2XD3A 3KC1A 3E4RA 4TLLB 1KZ8A 3C34A 1I6AA 1XVXA 4OVQA 4YKPA 2NWJA 4ZZEA 3ZS6A 1D4NA 4X9TA 3VVDA 1NV4A 4PAFA 1MQIA 1VR5A 1WVJA 4DIGA 2F6GA 4FECA 1LAXA 1VDWA 4X1DA 5HBCA 4GX3A 4GBVA 1I6QA 1A99A 4XKRA 4ELPA 1RYXA 2I3WA 3NOHA 3W15C 2Z22A 3K2DA 5LTCA 2XWKA 1WDNA 3GXAA 1M5CA 2OWTA 4PP0A 1PB7A 2XXWA 5CRYA 1G0HA 3FIRA 4N13A 1DTGA 1B1XA 1N7WA 1P1WA 3RNNA 3T9XB 3ZSFA 5DW8A 3KN8A 2XXXA 4P1LA 3MZBA 1B40A 3H4ZA 3CI8A 3OXNA 2ABHA 2HZLA 3IFAA 2F3BA 2FNCA 1FPBA 4NHBA 3PPQA 5DTBA 4C0RA 5I2KA 1RKMA 4X8RA 2F3DA 4UA8A 3UP9A 4I1DA 4GL0A 3QSLA 4R9FA 3JYRA 4MNIA 2V84A 4OFJA 1B51A 4O8MA 2BJJX 1YZ0A 2Q88A 3FJ7A 2WX9A 2ZNTA 1P1QA 3E13X 3K6VA 3KOSA 1MPDA 2GQ1A 4QSDA 5H8HA 3UN6A 1QUJA 5FHNA 4UACA 3CSBA 3G3HA 2E0SA 3UA8A 2QMWA 1Z7NE 1FQBA 4KCDA 3TPAA 5H8SA 3P7IA 4OXVA 3C9HA 2YLNA 4PFTA 3ODBA 3E79A 2ZZXA 4FJPA 1MG1A 3SEUA 2OWSA 5FTHA 4JBZA 4MHFA 4F3PA 4OHNA 3MQ9A 1NV3A 4BLAA 1A40A 1P99A 2F8DA 2XXHA 3TTNA 4G61A 5AA2A 2DXRA 4YZZA 1D9VA 3KEIA 2B3BA 4JSOA 5IZZA 4G8MA 1H76A 4I3EA 2Z8FA 2XXQA 4XIGQ 3CR9A 2Q8MA 1BK4A 2G93A 4F2QA 2ANJA 3SKPA 4OTEA 4RK9A 2P0SA 3OEKA 2NOOA 4MBPA 1ANFA 4M4GA 1ZTYA 3PPPA 5B7DA 4FBPA 2FBPA 5CM6A 3VE1B 4N17A 3S9MC 1MS7A 4H0WA 3MVWA 2XX9A 2UYEA 3PV0E 2FA7A 3FJMA 5I2NA 1KA1A 2I6EA 1KWHA 2KLFA 2V3UA 4ONYA 2HHMA 5TPAA 4MJOA 1URGA 3TUSA 5DYHA 4XKNA 1B7ZA 4KD5A 4PTKA 1NNKA 5A5XB 1JW4A 3B8BA 2CEXA 4OFLA 2Y7WA 4PFWA 4GWSA 2O84X 2WYKA 1LAFE 1I6BA 4P0IA 4PFIA 1IXGA 4YB6A 3OSRA 1B1HA 2RCAA 2AL4A 2I3VA 4U2RA 2I49A 4OERA 2P3VA 2VGQA 5I57B 2ZXTA 2O7UA 4GX4A 1M5FA 1O7TA 4JVIA 4KYEA 4AQ4A 3B50A 5H8QB 3VVFA 3LSLA 2V93A 3IJOB 2HCAA 4PE5B 2X26A 3PMXA 1NKXA 4GLIA 4AS4A 4DDDA 3TQWA 2PX1A 4N4UA 3MSTA 2YJPA 5CMMA 1NNTA 1NMUA 2ZNSA 5H8FB 3B7DA 3A09A 2DWIA 2DVZA 4QSCA 1MQDA 2PMSA 1EZOA 4ZEBA 3FV1A 3UORA 1ELJA 1NUWA 4NF5A 5KDTA 5A5LA 2XA5A 5H8FA 3S2VA 5AA3A 3GBBA 4RPNA 4QSEA 4GWZA 1POY1 2OCUA 2H98A 1H3DA 2H5YA 4GRKA 3CFLA 1NUYA 1GTKA 1FPJA 2DE4A 4QHQA 4POXA 3A3UA 4I40A 3Q29A 3A3CA 4NF6A 4IO2A 1IMEA 1PB8A 4F18A 1CE2A 1IMFA 1FJ6A 3QYTA 2XWIA 4H5FA 5KZTA 1DSNA 4F29A 3PGFA 4F1UA 1JW5A 1LFHA 3C36A 3PUWE 4OVPA 3LC8A 3O66A 2WKYA 2QVRA 3LBSA 2D3IA 3O2AA 4WKMA 3RN8A 4HE1A 1IZ1A 4HS7A 1G0IA 3U94A 3DLNA 2UVJA 4ZS9A 2WEFA 4IGTA 2F7AA 4NX1A 5AA4A 3SERA 2I58A 5CMKA 2PT1A 4N91A 1GR2A 1S7YA 2Q2AA 2H99A 2GHBA 2RCBA 4OWDA 2F7CA 4PC9A 3CVGA 2V3TA 4JWXA 2HFBA 1H45A 4KR5A 3U92A 3TCHA 3T1BA 4POWA 4R73A 1LAGE 3Q27A 3SEVA 2MKZA 3JV9A 1HSEA 4R75A 1GGGA 3VVEA 2M8CA 1Y4CA 3PUXE 4ZDMA 4NTLA 3H03A 1DPEA 1N3WA 4EDPA 5DT6A 2E1SA 4EUOA 1FTJA 3SEYA 4JB7A 2O1MA 1XHYA 4G8NA 4HE0A 4LONB 2XHDA 3IK6B 4OEVA 2XXKA 2DQVA 2RF1A 4K3FA 2A5TB 3E78A 2OZZA 4ZEIA 4OFOA 4XKQA 5T3JA 5F1QA 3SZPA 4IY5A 1LBZA 1NH8A 1RDYA 1Q1KA 5EHMA 1CNQA 4RNSA 5I5PA 1D9QA 1R6ZA 3MC2A 3FXQA 4P56A 1SI1A 4ZE9A 3TTRA 1R9LA 1B4ZA 3CSGA 3U72A 1A8FA 1QUKA 4WEDA 1B5JA 2RKMA 4WEPA 1URDA 2O1LA 3S9LC 1LBVA 1R9QA 4ESWA 1Y3PA 5TP9B 4E0WA 4ND9A 5ITPA 2F36A 4LQ5A 3FXRA 4ISUA 3TTLA 3KJ7A 1B52A 1ZMGA 2Y5KA 1MM7A 3M3KA 4ZEKA 3KSXA 1EU8A 4QXDA 4P11A 3T66A 4N15A 3TEPA 2QPQA 4DI3D 3O97A 5BWJA 1MY3A 1RDZA 4PAKA 2VOZA 5I7IA 3DP8A 5AE4A 1MQGA 4YKIA 2XD2A 3PMWA 3TFLA 3FVGA 3CFXA 1N04A 3HHFA 1TFAA 2QL3A 4AB6A 4NMYA 1MH3A 3T93B 1TXFA 1MXVA 2OLBA 4KPTA 5JTYB 3U65A 5TU0A 3FVKA 3TODA 4PDDA 3DP6A 4F1VA 3KC0A 5K2XA 4I62A 4DE8A 3OEMA 4BDNA 4O94A 3U8QA 4OESA 5JTYA 2R9JA 2ONRA 2ZZVA 4XF5A 1AL3A 2Y7RA 1K9YA 2B65A 1TT1A 2W7YA 5HPQA 1QGXA 2REJA 1SQYA 4Q30B 2Q9TA 3C4MA 4ECFA 4G68C 1FBPA 1MY4A 4DLDA 5CMBA 4TOZA 4PFRA 2OBGA 3TCGA 4ZZAA 3R7XA 1B7HA 3DP4A 4MCOA 3IB1A 3W9VA 3PD8A 1NL5A 2ZNUA 5ET5A 4MH5A 3FJGA 5I2KB 1FQFA 4IO5A 1OLCA 4G68A 1SW1A 1B0HA 4OZ9A 1JEVA 4GWWA 3Q28A 2F34A 4AB5A 1NUZA 1OLAA 1Y1MA 3LUYA 4ELOA 1FTMA 2Y84A 2VP1A 4Q0CA 1OQGA 1BKAA 2L5VA 1JQFA 1MPBA 3V8XB 4GQOA 3VLVA 1FRPA 4DCYA 4F31B 2CMOA 4F1YA 3IB0A 5L9MA 4I9DA 4U1OA 2V3QA 1LB9A 5H8HB 3QK6A 3K0VA 1B58A 1SD3A 5IAIA 3B6QA 2ESNA 4YKJA 1NV2A 4R74A 1QVSA 4GX6A 4L17A 4F2OA 3IOUA 1OVTA 2VD3A 4NWCA 3EPEA 3SEXA 1M5DA 1PBPA 5CBRA 5DVIA 4QFOA 4GIZA 4MEVA 3O6HA 4H1XA 1FPFA 3M3FA 3KN7A 4QRZA 1NV6A 4PETA 3KGCA 1FTKA 5I59A 2O68A 4MAGA 4H8IA 4JVCA 1Y9UA 3TCFA 2Z23A 4QF9A 3H6UA 1EYJA 2Q89A 4LATA 2QS3A 3TELA 5AA2B 3MW0A 1B6HA 4OVTA 2B3FA 3PUZE 3Q26A 3G3KA 3U93A 3K1PA 1MQJA 4Z0IA 3HN0A 3RPLA 4X04A 2WYPA 1FQCA 4KYDA 3KG2A 4ZEDA 4H65A 1Z7ME 3LSFB 4NG7A 1B32A 4GF8A 5EHSA 2UXAA 4X48A 4MF3A 1MXYA 3F11A 3MP8A 5AA1A 4RA1A 2CEYA 4LZ8A 3KBZA 3B6TA 4FIMA 1SI0A 5DVFA 5I2NB 4NEDA 2UVIA 4GWUA 2P1SA 1VE4A 3AXFA 5TPAB 2XX7A 3RYDA 4HXVA 3EN3A 3ISPA 1H43A 1US4A 3OSQA 2PFYA 2QS4A 2OWZA 1DBZA 1SW4A 5I56B 1LGBC 1Y3NA 1FCKA 2Z8DA 1FQAA 1TFDA 2XXTA 1QULA 3SDFA 2P2AA 4IO4A 4BDMA 3H6VA 3RTFB 5I56A 5I3SA 3DM0A 5FTIA 1JP4A 2XXIA 2A5SA 3RUMA 5H8NA 1FPKA 2F35A 1UQWA 1F9BA 2ONSA 1NI9A 2F7BA 2UYFA 1LEVA 1DPPA 2DS9A 1AMFA 1IXCA 3O29A 3WAEA 4PDHA 3FXBA 2NVUB 1RYOA 4YAHX 4YMAA 4KQPA 4OMBA 5IZ3B 3HSTA 4U21A 4GBWA 3CIJA 4NF5B 5KDTB 2F97A 1OQHA 4GXAA 4XKPA 1FBCA 4N6DA 2Q74A 4THIA 1NNPA 1NUXA 2OX3A 3IORA 3LSWA 1QJMA 3LV0A 5I58B 3HV1A 3T0JA 3A29A 3ONMA 1YYZA 1B2HA 5IZ3A 3GZGA 3PPRA 4OA4A 3D1RA 1B3GA 4HTGA 4PF8A 4JWYA 1LSTA 4F3GA 4N8GA 4YICA 3H6TA 1FTAA 4F3BA 5ET8A 2DE2A 5I58A 3MUQA 4NF6B 3E9XA 2I0BA 4MNCA 5K2YA 4IGRA 4HW8A 3SETA 2AYSA 3N5LA 4NWDA 4O3BA 1GV8A 1P1NA 3K6XA 2IEEA 2QRYA 3TTKA 2HXRA 1SW5A 2DDKA 3CFZA 3RGYA 1AWBA 1BTJA 3FVOA 2FVZA 4EQ7A 2GRVA 3EQ1A 2G29A 3FATA 3TQLA 1UTHB 2XXUA 4DXCA 4P8BA 1D3KA 3RT6B 3T9VA 4MX6A 3FD3A 5L9SA 4KCCA 5EQ7A 4LP2B 1O64A 5AA4B 3PTYA 5F24A 1LBCA 2Z8EA 4U4XA 1EH3A 1AIVA 3CG3A 5JK4A 1UTHA 3UIFA 2VHAA 2VPOA 1PDAA 3KN3A 4FATA 1FPGA 2V25A 3HPIA 4PFYA 2PVUA 3O6GA 2XX8A 1HSJA 3OO8A 4Q8RA 4NAPA 1NFTA 4RYAA 1FBEA 3VXCA 3MVYA 4R2BA 3IFCA 5ICTA 4NF4A 4JWOA 1USYE 1PB9A 3THIA 1B0LA 5J1DA 4IO3A 3ECRA 1JNFA 2THIA 4H45A 4KI0E 3RQTA 1LCTA 4RXLA 3BFTA 5KCJA 3SEWA 1Y4TA 3IX1A 3HFUA 3FV2A 2RC7A 1B46A 2QJEA 4IR8A 3IR1A 1II5A 1FPDA 4PQJA 2UVHA 1LB8A 4JXIA 1OVBA 4GWOA 3BKIB 3N6TA 3PD9A 3HCQA 2ALUA 1ATGA 3EHUA 3D4CA 5EQAA 4DZ1A 4R6YA 2IA4A 3Q25A 1B3FA 4N81A 5DVJA 3PPOA 3R26A 4N6KA 4R2FA 1NV5A 5EQ9A 1K9ZA 4ELQA 3ZKKA 1B3HA 4R9GA 4MIJA 3KZGA 3T22A 2WBBA 1OMPA 3N6UA 1QKBA 4NN3A 1FPIA 1SYHA 2I0CA 2ZYOA 3IO4A 1MPCA 2NUVA 4HCYA 4GL8A 3TKDA 4P9KA 3ZKLA 4Z7EA 1SDXA 4AS5A 1MDP1 4KHZE 1A7LA 1SVXB 4ZEFA 3MP1A 4EQBA 2HPGA 2DOJA 1GVCA 2XXYA 2GH9A 3KJTA 3K1MA 4OANA 2DVCA 4EF2A 3MZ9A 3UGWA 3V83A 4XXUA 2QFLA 3KFMA 3FZVA 4BDLA 1R1NA 4QFKA 3B6WA 1MH4A 2ZMBA 1HSLA 1S9TA 4DXBA 1FPEA 3G3IA 1NNFA 1PEBA 1A55A 1SW2A 4ESXA 4LZ7A 1AOVA 2R71A 2AIXA 5L8DA 5FHOA 1QUIA 4OYVA 3GBAA 1JETA 1FQEA 4O7IA 3QUFA 1DK4A 4GWYA 4JVDA 1SPIA 1DTZA 3VLUA 1N84A 1B05A 4RK2A 1FPLA 1FBHA 2X7PA 2YPNA 3TDJA 3C33A 5ISUA 1LLSA 2DWHA 2DYXA 3OO7A 3QIMA 1RDXA 1XT8A 3RY3A 1XS5A 4C1TA 1IMCA 1Y1ZA 1YXIA 1PBQA 1FTLA 1LFGA 4R72A 3QXMA 3K1NA 4BDQA 3KSJA 4IB2A 3MAMA 4EF1A 4OQOA 1IMDA 3BFUA 5FBPA 4H8JA 5IGAA 4G68B 5DEXA 1ZIUA 3FUZA 3RTWB 2VT5A 5ESYA 4ELRA 1Q35A 5EYGA 5F7VA 1CB6A 4F19A 1B9JA 3QAXA 2OJTA 5IKBA 1MM6A 3QMFA 2PT2A 1BP5A 2Q8JA 3S9NC 1LAHE 3IO6A 3C32A 4RJZA 1IIWA 2DXYA 4LN5A 3EHTA 3G3GA 4HCWA 2DWJA 3V89B 4GVOA 1AH5A 1UIUA 3IOWA 3WAFA 4XTCQ 1LBYA 4R6KA 2HZKA 1N3XA 3K02A 4OENA 4PFUA 1LBBA 3H3GA 3U1OA 4MLQA 4KXPA 1FTOA 3FVNA 2HAVA 1LCFA 4I8CA 3VFJA 4F3SA 5I59B 3N94A 1FSAA 1ZBMA 5AA2D 1P1UA 5EQ8A 5ELVA 2HQ0A 3I6VA 5ET7A 3ROJA 1B5HA 4LVQA 2ZZWA 3HO7A 1A8EA 2CZLA 1USYH 1YPNA 5CBSA 3MPLA 4QFNA 1FBDA 4X1BA 3T9UA 2ONKE 2B4MA 3KBRA 3L6HA 5CC2A 2I48A 3RPLB 4NF0A 4GOTA 2VPNA 4U4SA 4U23A 1EYKA 1EZPA 4FORA 2REGA 4FAJA 1NV0A 2O6AA 3N26A 2D5WA 2CZKA 1N7XA 3L6GA 1BLFA 3S4UA 3VDFA 4BDRA 4FEDA 4GD5A 2XXPA 3MPKA 4F39A 2FYIA 1P1OA 4NF8B 3I5OA 2XXRA 3TZAA 4N8YA 1POTA 3K01A 5JEIA 3RT8A 1IQ7A 4PAIA 4H46A 2PYYA 4NF8A 4OVRA 4PE3A 4PBQA 3FGSA 1UIVA 1XVYA 2KR0A 3MWBA 4N07A 5B70A 3K4UA 5LOMA 2O7IA 2R6GE 2CZHA 2R8TA 3BBRA 4N6PA 1VFEA 1D9YA 1EYIA 3UK4A 4GWXA 2BJIA 3OMBA 4MFIA 1URSA 3FASA 4UABA 4XFEA 5H8NB 4MMPA 3TMGA 3PPNA 4MLVA 3LR1A 3ILUB 2QS2A 1MXXA 2D21A 4O3AA 3T96B 3I3VA 1IMBA 4EXKA 1FJ9A 3CHGA 3OOAA 5ICQA 2LAOA 1B3EA 2I4BA 3PU5A 1I69A 1DMBA 4LZ5A 4P3LA 2DSFA 1SYIA 3O9PA 4P1EA 2CZIA
chains in the Genus database with same CATH topology
2HEUA 4RY1A 5A5XA 4IO6A 4P0GA 3OO9A 1QW0A 1US5A 3MBPA 5EYFA 1M5EA 3D4GA 4QFPA 3K6UA 3GLBA 2H9BA 5CI5A 3RLFE 3FXUA 3V5AA 2Q2CA 2ZYKA 1ZKBA 1IUDA 2UVGA 5I57A 2F6PA 3O6IA 3SESA 3TYHA 2HXWA 1JW1A 4TQUQ 5H8QA 3C35A 2O69A 1XOCA 2HAUA 3M8UA 1ZJLA 4G8HA 4YMBA 3T9HB 1B3LA 4YU0A 4Q5TA 2PBWA 1MXZA 1Y20A 2F78A 5HM4B 1S50A 1MY2A 1UTBB 1BIYA 3CRBA 1IXIA 4GXSB 2GHAA 2DP8A 4YB5A 2H25A 4BDOA 4H6DA 5I84A 2Y7PA 1N76A 3OD7A 1ZLQA 2F5XA 1FW0A 4GFRA 4H67A 1UTBA 4OVJA 3USDA 4WXJA 5M2VA 1LFIA 4ZECA 1EZ9A 4OEUA 1YAEA 4QFLA 3IB2A 4U22A 1JVXA 4NF4B 1MY1A 4KYSA 3EHSA 3C31A 1M5BA 1WODA 2ZYNA 5KCJB 3G3JA 2H4IA 5ITOA 1MDQA 3H7MA 4H5GA 4M1VA 3MVXA 4YKKA 3VLWA 2GFEA 3ILTB 1T0KA 3IAZA 4FEBA 2XXVA 4E0XA 4G4PA 4YB7A 3TTMA 4O3CA 3M3LA 3IOTA 2O51A 4LUBA 4TLMB 3MJNA 1Y3QA 3MVZA 3KOTA 3IOVA 5L9OA 1NH7A 3PUYE 1J1NA 4DXUA 1TWYA 1MXWA 4JDFA 3G3FA 3W9WA 3VV5A 3DELB 2RINA 1SBPA 5FHMA 4LA9A 1B7UA 3H06B 4F22A 1H44A 4IY6A 4U1ZA 3K6WA 3PMVA 2QMXA 3MZ1A 4RPOA 1YCJA 1JVYA 3MP6A 1XC1A 1MRPA 2Y7KA 3CG1A 4C1UA 4G2ZA 4JSDA 4KFQA 1FQDA 2A5TA 1IITA 1O63A 3QUJA 3VXBA 4ZE8A 4NE4A 1PC3A 4OETA 1B5IA 1L5TA 3K00A 3G7WA 2RC8A 4EQ9A 2DWAA 1YTVA 1VFDA 4IO7A 1MXUA 1B4HA 2Y7IA 1A54A 3HHGA 3OENA 5TP9A 1QKAA 3IJXB 4EXLA 3R6UA 4FE8A 3S9EA 1IEJA 2OK2A 3LSXA 4R6HA 1MY0A 3OO6A 4G77A 2AL5A 2RC9A 2QSXA 3TAJA 3RPWA 1OIBA 1JEUA 4DCXA 4LQ2A 5CMCA 3EF7A 1MQHA 2NXOA 2ZYMA 1VSOA 2I4CA 3O28A 1DOTA 2DE3A 2QS1A 3OELA 3JZJA 1N0TA 3E3KA 3IL1B 3PUVE 1ZU0A 2VD2A 3H6WA 2X7QA 5DEXB 5BUUA 1IXHA 2XD3A 3E4RA 4TLLB 3C34A 1I6AA 1XVXA 4YKPA 2NWJA 4ZZEA 3ZS6A 1D4NA 4X9TA 3VVDA 1MQIA 1VR5A 1WVJA 4DIGA 2F6GA 4FECA 1LAXA 4X1DA 5HBCA 4XKRA 1I6QA 1A99A 4ELPA 1RYXA 2I3WA 3W15C 2Z22A 3K2DA 1WDNA 3GXAA 1M5CA 2OWTA 4PP0A 1PB7A 2XXWA 5CRYA 3FIRA 4N13A 1DTGA 1B1XA 1N7WA 1P1WA 3RNNA 3T9XB 3ZSFA 3KN8A 2XXXA 3MZBA 1B40A 3H4ZA 3CI8A 3OXNA 2ABHA 2HZLA 2FNCA 3PPQA 5DTBA 4C0RA 5I2KA 1RKMA 4UA8A 3UP9A 4I1DA 4GL0A 3QSLA 4R9FA 3JYRA 2V84A 4OFJA 1B51A 2BJJX 2Q88A 3FJ7A 2ZNTA 1P1QA 3E13X 3K6VA 3KOSA 1MPDA 4QSDA 5H8HA 3UN6A 1QUJA 5FHNA 4UACA 3CSBA 3G3HA 2E0SA 3UA8A 2QMWA 1Z7NE 1FQBA 4KCDA 3TPAA 5H8SA 3P7IA 4OXVA 3C9HA 2YLNA 4PFTA 3ODBA 4FJPA 1MG1A 3SEUA 2OWSA 5FTHA 4JBZA 4F3PA 4OHNA 3MQ9A 4BLAA 1A40A 1P99A 2F8DA 2XXHA 3TTNA 5AA2A 2DXRA 4YZZA 1D9VA 3KEIA 2B3BA 4JSOA 4G8MA 1H76A 2Z8FA 2XXQA 4XIGQ 3CR9A 2G93A 4F2QA 2ANJA 3SKPA 4OTEA 4RK9A 2P0SA 3OEKA 2NOOA 4MBPA 1ANFA 4M4GA 1ZTYA 3PPPA 5B7DA 5CM6A 3VE1B 3S9MC 1MS7A 4H0WA 3MVWA 2XX9A 2UYEA 3PV0E 2FA7A 3FJMA 5I2NA 2I6EA 1KWHA 2KLFA 2V3UA 4ONYA 5TPAA 1URGA 3TUSA 5DYHA 4XKNA 1B7ZA 4KD5A 1NNKA 5A5XB 1JW4A 4OFLA 2Y7WA 4PFWA 2O84X 1LAFE 1I6BA 4P0IA 1IXGA 4YB6A 3OSRA 1B1HA 2RCAA 2AL4A 2I3VA 4U2RA 2I49A 4OERA 2VGQA 5I57B 2ZXTA 2O7UA 1M5FA 1O7TA 4KYEA 4AQ4A 5H8QB 3VVFA 3LSLA 2V93A 3IJOB 2HCAA 4PE5B 2X26A 3PMXA 1NKXA 4GLIA 4DDDA 3TQWA 2PX1A 2YJPA 5CMMA 1NNTA 1NMUA 2ZNSA 5H8FB 3B7DA 3A09A 2DWIA 2DVZA 4QSCA 1MQDA 2PMSA 1EZOA 4ZEBA 3FV1A 3UORA 1ELJA 4NF5A 5KDTA 5H8FA 3S2VA 5AA3A 3GBBA 4RPNA 4QSEA 1POY1 2OCUA 2H98A 1H3DA 2H5YA 4GRKA 3CFLA 1GTKA 2DE4A 4QHQA 4POXA 3A3UA 3Q29A 3A3CA 4NF6A 4IO2A 1PB8A 4F18A 1CE2A 3QYTA 4H5FA 5KZTA 1DSNA 4F29A 3PGFA 4F1UA 1JW5A 1LFHA 3C36A 3PUWE 3LC8A 3O66A 2WKYA 3LBSA 2D3IA 3O2AA 4WKMA 3RN8A 1IZ1A 4HS7A 3U94A 3DLNA 2UVJA 4ZS9A 4IGTA 2F7AA 5AA4A 3SERA 2I58A 5CMKA 2PT1A 1GR2A 1S7YA 2Q2AA 2H99A 2GHBA 2RCBA 4OWDA 2F7CA 3CVGA 2V3TA 4JWXA 2HFBA 1H45A 4KR5A 3U92A 3TCHA 4POWA 4R73A 1LAGE 3Q27A 3SEVA 3JV9A 1HSEA 4R75A 1GGGA 3VVEA 2M8CA 1Y4CA 3PUXE 4ZDMA 4NTLA 3H03A 1DPEA 1N3WA 4EDPA 5DT6A 2E1SA 4EUOA 1FTJA 3SEYA 4JB7A 2O1MA 1XHYA 4G8NA 4LONB 2XHDA 3IK6B 4OEVA 2DQVA 2RF1A 4K3FA 2A5TB 4ZEIA 2OZZA 4OFOA 4XKQA 5F1QA 4IY5A 1NH8A 1Q1KA 5EHMA 4RNSA 1R6ZA 3MC2A 3FXQA 1SI1A 4ZE9A 3TTRA 1R9LA 1B4ZA 3CSGA 3U72A 1A8FA 1QUKA 4WEDA 1B5JA 2RKMA 1URDA 2O1LA 4WEPA 3S9LC 1R9QA 4ESWA 1Y3PA 5TP9B 4E0WA 4ND9A 5ITPA 2F36A 4LQ5A 3FXRA 4ISUA 3TTLA 3KJ7A 1B52A 1ZMGA 1MM7A 3M3KA 4ZEKA 3KSXA 1EU8A 4P11A 3T66A 3TEPA 2QPQA 3O97A 5BWJA 1MY3A 2VOZA 3DP8A 5AE4A 1MQGA 4YKIA 2XD2A 3PMWA 3TFLA 3FVGA 3CFXA 1N04A 3HHFA 1TFAA 2QL3A 4AB6A 4NMYA 1MH3A 3T93B 1TXFA 1MXVA 2OLBA 4KPTA 5JTYB 5TU0A 3FVKA 3TODA 3DP6A 4F1VA 4DE8A 5K2XA 4I62A 3OEMA 4BDNA 3U8QA 4OESA 5JTYA 2R9JA 2ONRA 1AL3A 2Y7RA 2B65A 1TT1A 2W7YA 5HPQA 2REJA 1SQYA 4Q30B 2Q9TA 3C4MA 4ECFA 4G68C 1MY4A 4DLDA 5CMBA 4TOZA 2OBGA 3TCGA 4ZZAA 3R7XA 1B7HA 3DP4A 3IB1A 3W9VA 3PD8A 1NL5A 2ZNUA 4MH5A 3FJGA 5I2KB 1FQFA 4IO5A 1OLCA 4G68A 1SW1A 1B0HA 4OZ9A 1JEVA 3Q28A 2F34A 4AB5A 1OLAA 1Y1MA 3LUYA 4ELOA 1FTMA 2Y84A 2VP1A 4Q0CA 1OQGA 1BKAA 1JQFA 1MPBA 3V8XB 4GQOA 3VLVA 4DCYA 4F31B 2CMOA 4F1YA 3IB0A 5L9MA 4I9DA 4U1OA 2V3QA 1LB9A 5H8HB 3QK6A 3K0VA 1B58A 1SD3A 5IAIA 3B6QA 2ESNA 4YKJA 4R74A 1QVSA 4L17A 4F2OA 3IOUA 1OVTA 2VD3A 4NWCA 3EPEA 3SEXA 1M5DA 1PBPA 5CBRA 5DVIA 4QFOA 4GIZA 3O6HA 4H1XA 3M3FA 3KN7A 4QRZA 4PETA 3KGCA 1FTKA 5I59A 2O68A 4H8IA 1Y9UA 3TCFA 2Z23A 4QF9A 3H6UA 2Q89A 4LATA 2QS3A 3TELA 5AA2B 3MW0A 1B6HA 2B3FA 3PUZE 3Q26A 3G3KA 3U93A 3K1PA 1MQJA 4Z0IA 3HN0A 1FQCA 4KYDA 3KG2A 4ZEDA 4H65A 1Z7ME 3LSFB 1B32A 4GF8A 5EHSA 2UXAA 4X48A 4MF3A 1MXYA 3F11A 3MP8A 5AA1A 4RA1A 4LZ8A 3B6TA 4FIMA 1SI0A 5DVFA 5I2NB 4NEDA 2UVIA 2P1SA 1VE4A 3AXFA 5TPAB 2XX7A 3EN3A 1H43A 1US4A 3OSQA 2QS4A 1SW4A 5I56B 1LGBC 1Y3NA 1FCKA 2Z8DA 1FQAA 1TFDA 2XXTA 1QULA 3SDFA 2P2AA 4IO4A 4BDMA 3H6VA 3RTFB 5I56A 3DM0A 5FTIA 2XXIA 2A5SA 3RUMA 5H8NA 2F35A 1UQWA 1F9BA 2ONSA 2F7BA 2UYFA 1DPPA 2DS9A 1AMFA 1IXCA 3O29A 3WAEA 2NVUB 1RYOA 4YAHX 4YMAA 4KQPA 4OMBA 3HSTA 4U21A 3CIJA 4NF5B 5KDTB 2F97A 1OQHA 4GXAA 4XKPA 4THIA 1NNPA 3IORA 3LSWA 1QJMA 5I58B 3HV1A 3ONMA 1B2HA 3GZGA 3PPRA 1B3GA 4HTGA 4JWYA 1LSTA 4F3GA 4YICA 3H6TA 4F3BA 2DE2A 5I58A 3MUQA 4NF6B 3E9XA 2I0BA 5K2YA 4IGRA 4HW8A 3SETA 2AYSA 3N5LA 4NWDA 4O3BA 1GV8A 1P1NA 3K6XA 2IEEA 2QRYA 3TTKA 1SW5A 3CFZA 3RGYA 1BTJA 3FVOA 4EQ7A 2GRVA 3EQ1A 2G29A 3FATA 3TQLA 1UTHB 2XXUA 4DXCA 1D3KA 3RT6B 3T9VA 5L9SA 3FD3A 4KCCA 4LP2B 1O64A 5AA4B 1LBCA 2Z8EA 4U4XA 1EH3A 1AIVA 3CG3A 5JK4A 1UTHA 3UIFA 2VHAA 1PDAA 3KN3A 4FATA 2V25A 3HPIA 4PFYA 2PVUA 3O6GA 2XX8A 1HSJA 3OO8A 4Q8RA 1NFTA 4RYAA 3VXCA 3MVYA 4R2BA 5ICTA 4NF4A 4JWOA 1USYE 1PB9A 3THIA 1B0LA 5J1DA 4IO3A 3ECRA 1JNFA 2THIA 4KI0E 3RQTA 1LCTA 4RXLA 3BFTA 5KCJA 3SEWA 1Y4TA 3IX1A 3FV2A 2RC7A 1B46A 2QJEA 3IR1A 1II5A 4PQJA 2UVHA 1LB8A 4JXIA 1OVBA 4GWOA 3BKIB 3N6TA 3PD9A 3HCQA 2ALUA 1ATGA 3EHUA 3D4CA 4DZ1A 4R6YA 2IA4A 3Q25A 1B3FA 5DVJA 3PPOA 3R26A 4R2FA 4ELQA 3ZKKA 1B3HA 4R9GA 3KZGA 3T22A 1OMPA 3N6UA 1QKBA 1SYHA 2I0CA 2ZYOA 3IO4A 1MPCA 2NUVA 4HCYA 4GL8A 3TKDA 3ZKLA 4Z7EA 1SDXA 1MDP1 4KHZE 1A7LA 1SVXB 4ZEFA 3MP1A 4EQBA 2DOJA 1GVCA 2XXYA 2GH9A 3KJTA 3K1MA 2DVCA 4EF2A 3MZ9A 3UGWA 3V83A 4XXUA 3KFMA 3FZVA 4BDLA 1R1NA 4QFKA 3B6WA 1MH4A 2ZMBA 1HSLA 1S9TA 4DXBA 3G3IA 1NNFA 1PEBA 1A55A 1SW2A 4ESXA 4LZ7A 1AOVA 2R71A 2AIXA 5L8DA 5FHOA 1QUIA 4OYVA 3GBAA 1JETA 1FQEA 3QUFA 1DTZA 3VLUA 1N84A 1B05A 4RK2A 2X7PA 2YPNA 3TDJA 3C33A 5ISUA 1LLSA 2DWHA 2DYXA 3OO7A 3QIMA 1XT8A 3RY3A 1XS5A 4C1TA 1Y1ZA 1PBQA 1FTLA 1LFGA 4R72A 3QXMA 3K1NA 4BDQA 3KSJA 4IB2A 3MAMA 4EF1A 4OQOA 3BFUA 4H8JA 4G68B 5DEXA 1ZIUA 3FUZA 3RTWB 4ELRA 1Q35A 5F7VA 1CB6A 4F19A 1B9JA 3QAXA 2OJTA 5IKBA 1MM6A 2PT2A 1BP5A 2Q8JA 3S9NC 1LAHE 3IO6A 3C32A 4RJZA 1IIWA 2DXYA 3EHTA 3G3GA 4HCWA 2DWJA 3V89B 4GVOA 1AH5A 1UIUA 3IOWA 3WAFA 4XTCQ 4R6KA 2HZKA 1N3XA 3K02A 4OENA 4PFUA 1LBBA 3H3GA 3U1OA 4MLQA 1FTOA 3FVNA 2HAVA 1LCFA 4I8CA 3VFJA 4F3SA 5I59B 3N94A 1ZBMA 5AA2D 1P1UA 5ELVA 2HQ0A 3I6VA 1B5HA 4LVQA 3HO7A 1A8EA 2CZLA 1USYH 1YPNA 5CBSA 3MPLA 4QFNA 4X1BA 3T9UA 2ONKE 3KBRA 3L6HA 5CC2A 2I48A 4GOTA 4U4SA 4U23A 1EZPA 4FORA 2REGA 4FAJA 3N26A 2O6AA 2D5WA 1N7XA 3L6GA 1BLFA 3S4UA 3VDFA 4BDRA 4FEDA 4GD5A 2XXPA 3MPKA 4F39A 2FYIA 1P1OA 4NF8B 3I5OA 2XXRA 3TZAA 1POTA 3K01A 5JEIA 3RT8A 1IQ7A 2PYYA 4NF8A 3FGSA 1UIVA 1XVYA 3MWBA 4N07A 5B70A 3K4UA 5LOMA 2O7IA 2R6GE 3BBRA 4N6PA 1VFEA 1D9YA 3UK4A 3OMBA 4MFIA 1URSA 3FASA 5H8NB 3TMGA 3PPNA 4MLVA 3LR1A 3ILUB 2QS2A 1MXXA 2D21A 4O3AA 3T96B 3I3VA 4EXKA 3OOAA 5ICQA 2LAOA 1B3EA 2I4BA 3PU5A 1I69A 1DMBA 4LZ5A 2DSFA 1SYIA 3O9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEU A;  4RY1 A;  5A5X A;  4IO6 A;  4P0G A;  3OO9 A;  1QW0 A;  1US5 A;  3MBP A;  5EYF A;  1M5E A;  3D4G A;  4QFP A;  3K6U A;  3GLB A;  2H9B A;  5CI5 A;  3RLF E;  3FXU A;  3V5A A;  2Q2C A;  2ZYK A;  1ZKB A;  1IUD A;  2UVG A;  5I57 A;  2F6P A;  3O6I A;  3SES A;  3TYH A;  2HXW A;  1JW1 A;  4TQU Q;  5H8Q A;  3C35 A;  2O69 A;  1XOC A;  2HAU A;  3M8U A;  1ZJL A;  4G8H A;  4YMB A;  3T9H B;  1B3L A;  4YU0 A;  4Q5T A;  2PBW A;  1MXZ A;  1Y20 A;  2F78 A;  5HM4 B;  1S50 A;  1MY2 A;  1UTB B;  1BIY A;  3CRB A;  1IXI A;  4GXS B;  2GHA A;  2DP8 A;  4YB5 A;  2H25 A;  4BDO A;  4H6D A;  5I84 A;  2Y7P A;  1N76 A;  3OD7 A;  1ZLQ A;  2F5X A;  1FW0 A;  4GFR A;  4H67 A;  1UTB A;  4OVJ A;  3USD A;  4WXJ A;  5M2V A;  1LFI A;  4ZEC A;  1EZ9 A;  4OEU A;  1YAE A;  4QFL A;  3IB2 A;  4U22 A;  1JVX A;  4NF4 B;  1MY1 A;  4KYS A;  3EHS A;  3C31 A;  1M5B A;  1WOD A;  2ZYN A;  5KCJ B;  3G3J A;  2H4I A;  5ITO A;  1MDQ A;  3H7M A;  4H5G A;  4M1V A;  3MVX A;  4YKK A;  3VLW A;  2GFE A;  3ILT B;  1T0K A;  3IAZ A;  4FEB A;  2XXV A;  4E0X A;  4G4P A;  4YB7 A;  3TTM A;  4O3C A;  3M3L A;  3IOT A;  2O51 A;  4LUB A;  4TLM B;  3MJN A;  1Y3Q A;  3MVZ A;  3KOT A;  3IOV A;  5L9O A;  1NH7 A;  3PUY E;  1J1N A;  4DXU A;  1TWY A;  1MXW A;  4JDF A;  3G3F A;  3W9W A;  3VV5 A;  3DEL B;  2RIN A;  1SBP A;  5FHM A;  4LA9 A;  1B7U A;  3H06 B;  4F22 A;  1H44 A;  4IY6 A;  4U1Z A;  3K6W A;  3PMV A;  2QMX A;  3MZ1 A;  4RPO A;  1YCJ A;  1JVY A;  3MP6 A;  1XC1 A;  1MRP A;  2Y7K A;  3CG1 A;  4C1U A;  4G2Z A;  4JSD A;  4KFQ A;  1FQD A;  2A5T A;  1IIT A;  1O63 A;  3QUJ A;  3VXB A;  4ZE8 A;  4NE4 A;  1PC3 A;  4OET A;  1B5I A;  1L5T A;  3K00 A;  3G7W A;  2RC8 A;  4EQ9 A;  2DWA A;  1YTV A;  1VFD A;  4IO7 A;  1MXU A;  1B4H A;  2Y7I A;  1A54 A;  3HHG A;  3OEN A;  5TP9 A;  1QKA A;  3IJX B;  4EXL A;  3R6U A;  4FE8 A;  3S9E A;  1IEJ A;  2OK2 A;  3LSX A;  4R6H A;  1MY0 A;  3OO6 A;  4G77 A;  2AL5 A;  2RC9 A;  2QSX A;  3TAJ A;  3RPW A;  1OIB A;  1JEU A;  4DCX A;  4LQ2 A;  5CMC A;  3EF7 A;  1MQH A;  2NXO A;  2ZYM A;  1VSO A;  2I4C A;  3O28 A;  1DOT A;  2DE3 A;  2QS1 A;  3OEL A;  3JZJ A;  1N0T A;  3E3K A;  3IL1 B;  3PUV E;  1ZU0 A;  2VD2 A;  3H6W A;  2X7Q A;  5DEX B;  5BUU A;  1IXH A;  2XD3 A;  3E4R A;  4TLL B;  3C34 A;  1I6A A;  1XVX A;  4YKP A;  2NWJ A;  4ZZE A;  3ZS6 A;  1D4N A;  4X9T A;  3VVD A;  1MQI A;  1VR5 A;  1WVJ A;  4DIG A;  2F6G A;  4FEC A;  1LAX A;  4X1D A;  5HBC A;  4XKR A;  1I6Q A;  1A99 A;  4ELP A;  1RYX A;  2I3W A;  3W15 C;  2Z22 A;  3K2D A;  1WDN A;  3GXA A;  1M5C A;  2OWT A;  4PP0 A;  1PB7 A;  2XXW A;  5CRY A;  3FIR A;  4N13 A;  1DTG A;  1B1X A;  1N7W A;  1P1W A;  3RNN A;  3T9X B;  3ZSF A;  3KN8 A;  2XXX A;  3MZB A;  1B40 A;  3H4Z A;  3CI8 A;  3OXN A;  2ABH A;  2HZL A;  2FNC A;  3PPQ A;  5DTB A;  4C0R A;  5I2K A;  1RKM A;  4UA8 A;  3UP9 A;  4I1D A;  4GL0 A;  3QSL A;  4R9F A;  3JYR A;  2V84 A;  4OFJ A;  1B51 A;  2BJJ X;  2Q88 A;  3FJ7 A;  2ZNT A;  1P1Q A;  3E13 X;  3K6V A;  3KOS A;  1MPD A;  4QSD A;  5H8H A;  3UN6 A;  1QUJ A;  5FHN A;  4UAC A;  3CSB A;  3G3H A;  2E0S A;  3UA8 A;  2QMW A;  1Z7N E;  1FQB A;  4KCD A;  3TPA A;  5H8S A;  3P7I A;  4OXV A;  3C9H A;  2YLN A;  4PFT A;  3ODB A;  4FJP A;  1MG1 A;  3SEU A;  2OWS A;  5FTH A;  4JBZ A;  4F3P A;  4OHN A;  3MQ9 A;  4BLA A;  1A40 A;  1P99 A;  2F8D A;  2XXH A;  3TTN A;  5AA2 A;  2DXR A;  4YZZ A;  1D9V A;  3KEI A;  2B3B A;  4JSO A;  4G8M A;  1H76 A;  2Z8F A;  2XXQ A;  4XIG Q;  3CR9 A;  2G93 A;  4F2Q A;  2ANJ A;  3SKP A;  4OTE A;  4RK9 A;  2P0S A;  3OEK A;  2NOO A;  4MBP A;  1ANF A;  4M4G A;  1ZTY A;  3PPP A;  5B7D A;  5CM6 A;  3VE1 B;  3S9M C;  1MS7 A;  4H0W A;  3MVW A;  2XX9 A;  2UYE A;  3PV0 E;  2FA7 A;  3FJM A;  5I2N A;  2I6E A;  1KWH A;  2KLF A;  2V3U A;  4ONY A;  5TPA A;  1URG A;  3TUS A;  5DYH A;  4XKN A;  1B7Z A;  4KD5 A;  1NNK A;  5A5X B;  1JW4 A;  4OFL A;  2Y7W A;  4PFW A;  2O84 X;  1LAF E;  1I6B A;  4P0I A;  1IXG A;  4YB6 A;  3OSR A;  1B1H A;  2RCA A;  2AL4 A;  2I3V A;  4U2R A;  2I49 A;  4OER A;  2VGQ A;  5I57 B;  2ZXT A;  2O7U A;  1M5F A;  1O7T A;  4KYE A;  4AQ4 A;  5H8Q B;  3VVF A;  3LSL A;  2V93 A;  3IJO B;  2HCA A;  4PE5 B;  2X26 A;  3PMX A;  1NKX A;  4GLI A;  4DDD A;  3TQW A;  2PX1 A;  2YJP A;  5CMM A;  1NNT A;  1NMU A;  2ZNS A;  5H8F B;  3B7D A;  3A09 A;  2DWI A;  2DVZ A;  4QSC A;  1MQD A;  2PMS A;  1EZO A;  4ZEB A;  3FV1 A;  3UOR A;  1ELJ A;  4NF5 A;  5KDT A;  5H8F A;  3S2V A;  5AA3 A;  3GBB A;  4RPN A;  4QSE A;  1POY 1;  2OCU A;  2H98 A;  1H3D A;  2H5Y A;  4GRK A;  3CFL A;  1GTK A;  2DE4 A;  4QHQ A;  4POX A;  3A3U A;  3Q29 A;  3A3C A;  4NF6 A;  4IO2 A;  1PB8 A;  4F18 A;  1CE2 A;  3QYT A;  4H5F A;  5KZT A;  1DSN A;  4F29 A;  3PGF A;  4F1U A;  1JW5 A;  1LFH A;  3C36 A;  3PUW E;  3LC8 A;  3O66 A;  2WKY A;  3LBS A;  2D3I A;  3O2A A;  4WKM A;  3RN8 A;  1IZ1 A;  4HS7 A;  3U94 A;  3DLN A;  2UVJ A;  4ZS9 A;  4IGT A;  2F7A A;  5AA4 A;  3SER A;  2I58 A;  5CMK A;  2PT1 A;  1GR2 A;  1S7Y A;  2Q2A A;  2H99 A;  2GHB A;  2RCB A;  4OWD A;  2F7C A;  3CVG A;  2V3T A;  4JWX A;  2HFB A;  1H45 A;  4KR5 A;  3U92 A;  3TCH A;  4POW A;  4R73 A;  1LAG E;  3Q27 A;  3SEV A;  3JV9 A;  1HSE A;  4R75 A;  1GGG A;  3VVE A;  2M8C A;  1Y4C A;  3PUX E;  4ZDM A;  4NTL A;  3H03 A;  1DPE A;  1N3W A;  4EDP A;  5DT6 A;  2E1S A;  4EUO A;  1FTJ A;  3SEY A;  4JB7 A;  2O1M A;  1XHY A;  4G8N A;  4LON B;  2XHD A;  3IK6 B;  4OEV A;  2DQV A;  2RF1 A;  4K3F A;  2A5T B;  4ZEI A;  2OZZ A;  4OFO A;  4XKQ A;  5F1Q A;  4IY5 A;  1NH8 A;  1Q1K A;  5EHM A;  4RNS A;  1R6Z A;  3MC2 A;  3FXQ A;  1SI1 A;  4ZE9 A;  3TTR A;  1R9L A;  1B4Z A;  3CSG A;  3U72 A;  1A8F A;  1QUK A;  4WED A;  1B5J A;  2RKM A;  1URD A;  2O1L A;  4WEP A;  3S9L C;  1R9Q A;  4ESW A;  1Y3P A;  5TP9 B;  4E0W A;  4ND9 A;  5ITP A;  2F36 A;  4LQ5 A;  3FXR A;  4ISU A;  3TTL A;  3KJ7 A;  1B52 A;  1ZMG A;  1MM7 A;  3M3K A;  4ZEK A;  3KSX A;  1EU8 A;  4P11 A;  3T66 A;  3TEP A;  2QPQ A;  3O97 A;  5BWJ A;  1MY3 A;  2VOZ A;  3DP8 A;  5AE4 A;  1MQG A;  4YKI A;  2XD2 A;  3PMW A;  3TFL A;  3FVG A;  3CFX A;  1N04 A;  3HHF A;  1TFA A;  2QL3 A;  4AB6 A;  4NMY A;  1MH3 A;  3T93 B;  1TXF A;  1MXV A;  2OLB A;  4KPT A;  5JTY B;  5TU0 A;  3FVK A;  3TOD A;  3DP6 A;  4F1V A;  4DE8 A;  5K2X A;  4I62 A;  3OEM A;  4BDN A;  3U8Q A;  4OES A;  5JTY A;  2R9J A;  2ONR A;  1AL3 A;  2Y7R A;  2B65 A;  1TT1 A;  2W7Y A;  5HPQ A;  2REJ A;  1SQY A;  4Q30 B;  2Q9T A;  3C4M A;  4ECF A;  4G68 C;  1MY4 A;  4DLD A;  5CMB A;  4TOZ A;  2OBG A;  3TCG A;  4ZZA A;  3R7X A;  1B7H A;  3DP4 A;  3IB1 A;  3W9V A;  3PD8 A;  1NL5 A;  2ZNU A;  4MH5 A;  3FJG A;  5I2K B;  1FQF A;  4IO5 A;  1OLC A;  4G68 A;  1SW1 A;  1B0H A;  4OZ9 A;  1JEV A;  3Q28 A;  2F34 A;  4AB5 A;  1OLA A;  1Y1M A;  3LUY A;  4ELO A;  1FTM A;  2Y84 A;  2VP1 A;  4Q0C A;  1OQG A;  1BKA A;  1JQF A;  1MPB A;  3V8X B;  4GQO A;  3VLV A;  4DCY A;  4F31 B;  2CMO A;  4F1Y A;  3IB0 A;  5L9M A;  4I9D A;  4U1O A;  2V3Q A;  1LB9 A;  5H8H B;  3QK6 A;  3K0V A;  1B58 A;  1SD3 A;  5IAI A;  3B6Q A;  2ESN A;  4YKJ A;  4R74 A;  1QVS A;  4L17 A;  4F2O A;  3IOU A;  1OVT A;  2VD3 A;  4NWC A;  3EPE A;  3SEX A;  1M5D A;  1PBP A;  5CBR A;  5DVI A;  4QFO A;  4GIZ A;  3O6H A;  4H1X A;  3M3F A;  3KN7 A;  4QRZ A;  4PET A;  3KGC A;  1FTK A;  5I59 A;  2O68 A;  4H8I A;  1Y9U A;  3TCF A;  2Z23 A;  4QF9 A;  3H6U A;  2Q89 A;  4LAT A;  2QS3 A;  3TEL A;  5AA2 B;  3MW0 A;  1B6H A;  2B3F A;  3PUZ E;  3Q26 A;  3G3K A;  3U93 A;  3K1P A;  1MQJ A;  4Z0I A;  3HN0 A;  1FQC A;  4KYD A;  3KG2 A;  4ZED A;  4H65 A;  1Z7M E;  3LSF B;  1B32 A;  4GF8 A;  5EHS A;  2UXA A;  4X48 A;  4MF3 A;  1MXY A;  3F11 A;  3MP8 A;  5AA1 A;  4RA1 A;  4LZ8 A;  3B6T A;  4FIM A;  1SI0 A;  5DVF A;  5I2N B;  4NED A;  2UVI A;  2P1S A;  1VE4 A;  3AXF A;  5TPA B;  2XX7 A;  3EN3 A;  1H43 A;  1US4 A;  3OSQ A;  2QS4 A;  1SW4 A;  5I56 B;  1LGB C;  1Y3N A;  1FCK A;  2Z8D A;  1FQA A;  1TFD A;  2XXT A;  1QUL A;  3SDF A;  2P2A A;  4IO4 A;  4BDM A;  3H6V A;  3RTF B;  5I56 A;  3DM0 A;  5FTI A;  2XXI A;  2A5S A;  3RUM A;  5H8N A;  2F35 A;  1UQW A;  1F9B A;  2ONS A;  2F7B A;  2UYF A;  1DPP A;  2DS9 A;  1AMF A;  1IXC A;  3O29 A;  3WAE A;  2NVU B;  1RYO A;  4YAH X;  4YMA A;  4KQP A;  4OMB A;  3HST A;  4U21 A;  3CIJ A;  4NF5 B;  5KDT B;  2F97 A;  1OQH A;  4GXA A;  4XKP A;  4THI A;  1NNP A;  3IOR A;  3LSW A;  1QJM A;  5I58 B;  3HV1 A;  3ONM A;  1B2H A;  3GZG A;  3PPR A;  1B3G A;  4HTG A;  4JWY A;  1LST A;  4F3G A;  4YIC A;  3H6T A;  4F3B A;  2DE2 A;  5I58 A;  3MUQ A;  4NF6 B;  3E9X A;  2I0B A;  5K2Y A;  4IGR A;  4HW8 A;  3SET A;  2AYS A;  3N5L A;  4NWD A;  4O3B A;  1GV8 A;  1P1N A;  3K6X A;  2IEE A;  2QRY A;  3TTK A;  1SW5 A;  3CFZ A;  3RGY A;  1BTJ A;  3FVO A;  4EQ7 A;  2GRV A;  3EQ1 A;  2G29 A;  3FAT A;  3TQL A;  1UTH B;  2XXU A;  4DXC A;  1D3K A;  3RT6 B;  3T9V A;  5L9S A;  3FD3 A;  4KCC A;  4LP2 B;  1O64 A;  5AA4 B;  1LBC A;  2Z8E A;  4U4X A;  1EH3 A;  1AIV A;  3CG3 A;  5JK4 A;  1UTH A;  3UIF A;  2VHA A;  1PDA A;  3KN3 A;  4FAT A;  2V25 A;  3HPI A;  4PFY A;  2PVU A;  3O6G A;  2XX8 A;  1HSJ A;  3OO8 A;  4Q8R A;  1NFT A;  4RYA A;  3VXC A;  3MVY A;  4R2B A;  5ICT A;  4NF4 A;  4JWO A;  1USY E;  1PB9 A;  3THI A;  1B0L A;  5J1D A;  4IO3 A;  3ECR A;  1JNF A;  2THI A;  4KI0 E;  3RQT A;  1LCT A;  4RXL A;  3BFT A;  5KCJ A;  3SEW A;  1Y4T A;  3IX1 A;  3FV2 A;  2RC7 A;  1B46 A;  2QJE A;  3IR1 A;  1II5 A;  4PQJ A;  2UVH A;  1LB8 A;  4JXI A;  1OVB A;  4GWO A;  3BKI B;  3N6T A;  3PD9 A;  3HCQ A;  2ALU A;  1ATG A;  3EHU A;  3D4C A;  4DZ1 A;  4R6Y A;  2IA4 A;  3Q25 A;  1B3F A;  5DVJ A;  3PPO A;  3R26 A;  4R2F A;  4ELQ A;  3ZKK A;  1B3H A;  4R9G A;  3KZG A;  3T22 A;  1OMP A;  3N6U A;  1QKB A;  1SYH A;  2I0C A;  2ZYO A;  3IO4 A;  1MPC A;  2NUV A;  4HCY A;  4GL8 A;  3TKD A;  3ZKL A;  4Z7E A;  1SDX A;  1MDP 1;  4KHZ E;  1A7L A;  1SVX B;  4ZEF A;  3MP1 A;  4EQB A;  2DOJ A;  1GVC A;  2XXY A;  2GH9 A;  3KJT A;  3K1M A;  2DVC A;  4EF2 A;  3MZ9 A;  3UGW A;  3V83 A;  4XXU A;  3KFM A;  3FZV A;  4BDL A;  1R1N A;  4QFK A;  3B6W A;  1MH4 A;  2ZMB A;  1HSL A;  1S9T A;  4DXB A;  3G3I A;  1NNF A;  1PEB A;  1A55 A;  1SW2 A;  4ESX A;  4LZ7 A;  1AOV A;  2R71 A;  2AIX A;  5L8D A;  5FHO A;  1QUI A;  4OYV A;  3GBA A;  1JET A;  1FQE A;  3QUF A;  1DTZ A;  3VLU A;  1N84 A;  1B05 A;  4RK2 A;  2X7P A;  2YPN A;  3TDJ A;  3C33 A;  5ISU A;  1LLS A;  2DWH A;  2DYX A;  3OO7 A;  3QIM A;  1XT8 A;  3RY3 A;  1XS5 A;  4C1T A;  1Y1Z A;  1PBQ A;  1FTL A;  1LFG A;  4R72 A;  3QXM A;  3K1N A;  4BDQ A;  3KSJ A;  4IB2 A;  3MAM A;  4EF1 A;  4OQO A;  3BFU A;  4H8J A;  4G68 B;  5DEX A;  1ZIU A;  3FUZ A;  3RTW B;  4ELR A;  1Q35 A;  5F7V A;  1CB6 A;  4F19 A;  1B9J A;  3QAX A;  2OJT A;  5IKB A;  1MM6 A;  2PT2 A;  1BP5 A;  2Q8J A;  3S9N C;  1LAH E;  3IO6 A;  3C32 A;  4RJZ A;  1IIW A;  2DXY A;  3EHT A;  3G3G A;  4HCW A;  2DWJ A;  3V89 B;  4GVO A;  1AH5 A;  1UIU A;  3IOW A;  3WAF A;  4XTC Q;  4R6K A;  2HZK A;  1N3X A;  3K02 A;  4OEN A;  4PFU A;  1LBB A;  3H3G A;  3U1O A;  4MLQ A;  1FTO A;  3FVN A;  2HAV A;  1LCF A;  4I8C A;  3VFJ A;  4F3S A;  5I59 B;  3N94 A;  1ZBM A;  5AA2 D;  1P1U A;  5ELV A;  2HQ0 A;  3I6V A;  1B5H A;  4LVQ A;  3HO7 A;  1A8E A;  2CZL A;  1USY H;  1YPN A;  5CBS A;  3MPL A;  4QFN A;  4X1B A;  3T9U A;  2ONK E;  3KBR A;  3L6H A;  5CC2 A;  2I48 A;  4GOT A;  4U4S A;  4U23 A;  1EZP A;  4FOR A;  2REG A;  4FAJ A;  3N26 A;  2O6A A;  2D5W A;  1N7X A;  3L6G A;  1BLF A;  3S4U A;  3VDF A;  4BDR A;  4FED A;  4GD5 A;  2XXP A;  3MPK A;  4F39 A;  2FYI A;  1P1O A;  4NF8 B;  3I5O A;  2XXR A;  3TZA A;  1POT A;  3K01 A;  5JEI A;  3RT8 A;  1IQ7 A;  2PYY A;  4NF8 A;  3FGS A;  1UIV A;  1XVY A;  3MWB A;  4N07 A;  5B70 A;  3K4U A;  5LOM A;  2O7I A;  2R6G E;  3BBR A;  4N6P A;  1VFE A;  1D9Y A;  3UK4 A;  3OMB A;  4MFI A;  1URS A;  3FAS A;  5H8N B;  3TMG A;  3PPN A;  4MLV A;  3LR1 A;  3ILU B;  2QS2 A;  1MXX A;  2D21 A;  4O3A A;  3T96 B;  3I3V A;  4EXK A;  3OOA A;  5ICQ A;  2LAO A;  1B3E A;  2I4B A;  3PU5 A;  1I69 A;  1DMB A;  4LZ5 A;  2DSF A;  1SYI A;  3O9P A; 
#chains in the Genus database with same CATH topology
 2HEU A;  4RY1 A;  5A5X A;  4IO6 A;  4P0G A;  3OO9 A;  5IM2 A;  1QW0 A;  1US5 A;  3MBP A;  5EYF A;  1M5E A;  2PFZ A;  3D4G A;  4QFP A;  3K6U A;  4XEQ A;  2JJK A;  2H9B A;  3GLB A;  5CI5 A;  3RLF E;  3FXU A;  2B4L A;  3V5A A;  2Q2C A;  2ZYK A;  1ZKB A;  1IUD A;  2UVG A;  4QBA A;  5I57 A;  2F6P A;  1IMA A;  3O6I A;  3SES A;  3TYH A;  5EYH A;  2HXW A;  1FBF A;  1DCU A;  1JW1 A;  4TQU Q;  5H8Q A;  3C35 A;  2O69 A;  1XOC A;  2HAU A;  3M8U A;  1ZJL A;  4G8H A;  4YMB A;  2FHY A;  3T9H B;  1B3L A;  4YU0 A;  4Q5T A;  2PBW A;  1MXZ A;  1Y20 A;  2F78 A;  5HM4 B;  1S50 A;  1MY2 A;  1UTB B;  1BIY A;  3CRB A;  1IXI A;  4GXS B;  2GHA A;  2DP8 A;  1INP A;  4YB5 A;  2H25 A;  4BDO A;  4H6D A;  5I84 A;  2Y7P A;  1N76 A;  3OD7 A;  1ZLQ A;  2F5X A;  1FW0 A;  4GFR A;  4H67 A;  1UTB A;  4OVJ A;  3LUZ A;  3USD A;  2V4C A;  4OVS A;  4WXJ A;  5M2V A;  1LFI A;  5IZ1 A;  4ZEC A;  1EZ9 A;  1NV7 A;  4OEU A;  1YAE A;  4QFL A;  3IB2 A;  4U22 A;  1JVX A;  4PCD A;  1NV1 A;  4NF4 B;  4PGP A;  1MY1 A;  4KYS A;  3EHS A;  3C31 A;  3EKI A;  1M5B A;  4MNP A;  4PF6 A;  1WOD A;  5ET6 A;  5J16 A;  2ZYN A;  5KCJ B;  3G3J A;  2H4I A;  5ITO A;  1MDQ A;  3H7M A;  4H5G A;  4M1V A;  3MVX A;  4YKK A;  3VLW A;  3FBP A;  2GFE A;  3ILT B;  1T0K A;  2XWV A;  3IAZ A;  4FEB A;  2XXV A;  4E0X A;  1LBX A;  4NGU A;  4G4P A;  3BIH A;  4YB7 A;  3TTM A;  4O3C A;  3M3L A;  2FIX A;  3IOT A;  2O51 A;  4LUB A;  4TLM B;  3MJN A;  1Y3Q A;  3MVZ A;  3KOT A;  3IOV A;  3GYY A;  5L9O A;  1NH7 A;  3PUY E;  1J1N A;  4DXU A;  1TWY A;  5LDZ A;  4I3Y A;  1MXW A;  4JDF A;  3G3F A;  3W9W A;  3VV5 A;  2XWO A;  3DEL B;  2RIN A;  1SBP A;  5FHM A;  1LBW A;  4LA9 A;  4PGN A;  2KQZ A;  1B7U A;  3H06 B;  4F22 A;  1H44 A;  4IY6 A;  4U1Z A;  3K6W A;  3PMV A;  2QMX A;  3MZ1 A;  4RPO A;  1YCJ A;  1JVY A;  3BIG A;  3MP6 A;  1XC1 A;  1FBG A;  1MRP A;  2Y7K A;  3CG1 A;  4C1U A;  4G2Z A;  4JSD A;  4KFQ A;  1FQD A;  2A5T A;  1IIT A;  1O63 A;  3QUJ A;  3VXB A;  4ZE8 A;  2QVV A;  4NE4 A;  1PC3 A;  2FIE A;  4OET A;  2QVU A;  1B5I A;  1L5T A;  2PCR A;  4P47 A;  3K00 A;  3G7W A;  2RC8 A;  4EQ9 A;  2DWA A;  1YTV A;  1VFD A;  4IO7 A;  4PFB A;  1MXU A;  1B4H A;  2Y7I A;  1A54 A;  3HHG A;  3OEN A;  5TP9 A;  1QKA A;  3IJX B;  4EXL A;  3R6U A;  4O7M A;  4FE8 A;  3S9E A;  1IEJ A;  2OK2 A;  3LSX A;  4DI4 B;  4R6H A;  1MY0 A;  3OO6 A;  1XI6 A;  4G77 A;  2WBD A;  2AL5 A;  2RC9 A;  2QSX A;  4NQ8 A;  3TAJ A;  3RPW A;  1OIB A;  4HE2 A;  1JEU A;  4DCX A;  2Y5L A;  4LQ2 A;  5CMC A;  3EF7 A;  1MQH A;  2NXO A;  4PBH A;  2ZYM A;  1VSO A;  2I4C A;  3O28 A;  1DOT A;  1KA0 A;  2DE3 A;  2QS1 A;  2P3N A;  3MYU A;  1Q9D A;  3OEL A;  3JZJ A;  1N0T A;  3E3K A;  3IL1 B;  3PUV E;  1ZU0 A;  2VD2 A;  3H6W A;  2X7Q A;  5DEX B;  5BUU A;  1IXH A;  2XD3 A;  3KC1 A;  3E4R A;  4TLL B;  1KZ8 A;  3C34 A;  1I6A A;  1XVX A;  4OVQ A;  4YKP A;  2NWJ A;  4ZZE A;  3ZS6 A;  1D4N A;  4X9T A;  3VVD A;  1NV4 A;  4PAF A;  1MQI A;  1VR5 A;  1WVJ A;  4DIG A;  2F6G A;  4FEC A;  1LAX A;  1VDW A;  4X1D A;  5HBC A;  4GX3 A;  4GBV A;  1I6Q A;  1A99 A;  4XKR A;  4ELP A;  1RYX A;  2I3W A;  3NOH A;  3W15 C;  2Z22 A;  3K2D A;  5LTC A;  2XWK A;  1WDN A;  3GXA A;  1M5C A;  2OWT A;  4PP0 A;  1PB7 A;  2XXW A;  5CRY A;  1G0H A;  3FIR A;  4N13 A;  1DTG A;  1B1X A;  1N7W A;  1P1W A;  3RNN A;  3T9X B;  3ZSF A;  5DW8 A;  3KN8 A;  2XXX A;  4P1L A;  3MZB A;  1B40 A;  3H4Z A;  3CI8 A;  3OXN A;  2ABH A;  2HZL A;  3IFA A;  2F3B A;  2FNC A;  1FPB A;  4NHB A;  3PPQ A;  5DTB A;  4C0R A;  5I2K A;  1RKM A;  4X8R A;  2F3D A;  4UA8 A;  3UP9 A;  4I1D A;  4GL0 A;  3QSL A;  4R9F A;  3JYR A;  4MNI A;  2V84 A;  4OFJ A;  1B51 A;  4O8M A;  2BJJ X;  1YZ0 A;  2Q88 A;  3FJ7 A;  2WX9 A;  2ZNT A;  1P1Q A;  3E13 X;  3K6V A;  3KOS A;  1MPD A;  2GQ1 A;  4QSD A;  5H8H A;  3UN6 A;  1QUJ A;  5FHN A;  4UAC A;  3CSB A;  3G3H A;  2E0S A;  3UA8 A;  2QMW A;  1Z7N E;  1FQB A;  4KCD A;  3TPA A;  5H8S A;  3P7I A;  4OXV A;  3C9H A;  2YLN A;  4PFT A;  3ODB A;  3E79 A;  2ZZX A;  4FJP A;  1MG1 A;  3SEU A;  2OWS A;  5FTH A;  4JBZ A;  4MHF A;  4F3P A;  4OHN A;  3MQ9 A;  1NV3 A;  4BLA A;  1A40 A;  1P99 A;  2F8D A;  2XXH A;  3TTN A;  4G61 A;  5AA2 A;  2DXR A;  4YZZ A;  1D9V A;  3KEI A;  2B3B A;  4JSO A;  5IZZ A;  4G8M A;  1H76 A;  4I3E A;  2Z8F A;  2XXQ A;  4XIG Q;  3CR9 A;  2Q8M A;  1BK4 A;  2G93 A;  4F2Q A;  2ANJ A;  3SKP A;  4OTE A;  4RK9 A;  2P0S A;  3OEK A;  2NOO A;  4MBP A;  1ANF A;  4M4G A;  1ZTY A;  3PPP A;  5B7D A;  4FBP A;  2FBP A;  5CM6 A;  3VE1 B;  4N17 A;  3S9M C;  1MS7 A;  4H0W A;  3MVW A;  2XX9 A;  2UYE A;  3PV0 E;  2FA7 A;  3FJM A;  5I2N A;  1KA1 A;  2I6E A;  1KWH A;  2KLF A;  2V3U A;  4ONY A;  2HHM A;  5TPA A;  4MJO A;  1URG A;  3TUS A;  5DYH A;  4XKN A;  1B7Z A;  4KD5 A;  4PTK A;  1NNK A;  5A5X B;  1JW4 A;  3B8B A;  2CEX A;  4OFL A;  2Y7W A;  4PFW A;  4GWS A;  2O84 X;  2WYK A;  1LAF E;  1I6B A;  4P0I A;  4PFI A;  1IXG A;  4YB6 A;  3OSR A;  1B1H A;  2RCA A;  2AL4 A;  2I3V A;  4U2R A;  2I49 A;  4OER A;  2P3V A;  2VGQ A;  5I57 B;  2ZXT A;  2O7U A;  4GX4 A;  1M5F A;  1O7T A;  4JVI A;  4KYE A;  4AQ4 A;  3B50 A;  5H8Q B;  3VVF A;  3LSL A;  2V93 A;  3IJO B;  2HCA A;  4PE5 B;  2X26 A;  3PMX A;  1NKX A;  4GLI A;  4AS4 A;  4DDD A;  3TQW A;  2PX1 A;  4N4U A;  3MST A;  2YJP A;  5CMM A;  1NNT A;  1NMU A;  2ZNS A;  5H8F B;  3B7D A;  3A09 A;  2DWI A;  2DVZ A;  4QSC A;  1MQD A;  2PMS A;  1EZO A;  4ZEB A;  3FV1 A;  3UOR A;  1ELJ A;  1NUW A;  4NF5 A;  5KDT A;  5A5L A;  2XA5 A;  5H8F A;  3S2V A;  5AA3 A;  3GBB A;  4RPN A;  4QSE A;  4GWZ A;  1POY 1;  2OCU A;  2H98 A;  1H3D A;  2H5Y A;  4GRK A;  3CFL A;  1NUY A;  1GTK A;  1FPJ A;  2DE4 A;  4QHQ A;  4POX A;  3A3U A;  4I40 A;  3Q29 A;  3A3C A;  4NF6 A;  4IO2 A;  1IME A;  1PB8 A;  4F18 A;  1CE2 A;  1IMF A;  1FJ6 A;  3QYT A;  2XWI A;  4H5F A;  5KZT A;  1DSN A;  4F29 A;  3PGF A;  4F1U A;  1JW5 A;  1LFH A;  3C36 A;  3PUW E;  4OVP A;  3LC8 A;  3O66 A;  2WKY A;  2QVR A;  3LBS A;  2D3I A;  3O2A A;  4WKM A;  3RN8 A;  4HE1 A;  1IZ1 A;  4HS7 A;  1G0I A;  3U94 A;  3DLN A;  2UVJ A;  4ZS9 A;  2WEF A;  4IGT A;  2F7A A;  4NX1 A;  5AA4 A;  3SER A;  2I58 A;  5CMK A;  2PT1 A;  4N91 A;  1GR2 A;  1S7Y A;  2Q2A A;  2H99 A;  2GHB A;  2RCB A;  4OWD A;  2F7C A;  4PC9 A;  3CVG A;  2V3T A;  4JWX A;  2HFB A;  1H45 A;  4KR5 A;  3U92 A;  3TCH A;  3T1B A;  4POW A;  4R73 A;  1LAG E;  3Q27 A;  3SEV A;  2MKZ A;  3JV9 A;  1HSE A;  4R75 A;  1GGG A;  3VVE A;  2M8C A;  1Y4C A;  3PUX E;  4ZDM A;  4NTL A;  3H03 A;  1DPE A;  1N3W A;  4EDP A;  5DT6 A;  2E1S A;  4EUO A;  1FTJ A;  3SEY A;  4JB7 A;  2O1M A;  1XHY A;  4G8N A;  4HE0 A;  4LON B;  2XHD A;  3IK6 B;  4OEV A;  2XXK A;  2DQV A;  2RF1 A;  4K3F A;  2A5T B;  3E78 A;  2OZZ A;  4ZEI A;  4OFO A;  4XKQ A;  5T3J A;  5F1Q A;  3SZP A;  4IY5 A;  1LBZ A;  1NH8 A;  1RDY A;  1Q1K A;  5EHM A;  1CNQ A;  4RNS A;  5I5P A;  1D9Q A;  1R6Z A;  3MC2 A;  3FXQ A;  4P56 A;  1SI1 A;  4ZE9 A;  3TTR A;  1R9L A;  1B4Z A;  3CSG A;  3U72 A;  1A8F A;  1QUK A;  4WED A;  1B5J A;  2RKM A;  4WEP A;  1URD A;  2O1L A;  3S9L C;  1LBV A;  1R9Q A;  4ESW A;  1Y3P A;  5TP9 B;  4E0W A;  4ND9 A;  5ITP A;  2F36 A;  4LQ5 A;  3FXR A;  4ISU A;  3TTL A;  3KJ7 A;  1B52 A;  1ZMG A;  2Y5K A;  1MM7 A;  3M3K A;  4ZEK A;  3KSX A;  1EU8 A;  4QXD A;  4P11 A;  3T66 A;  4N15 A;  3TEP A;  2QPQ A;  4DI3 D;  3O97 A;  5BWJ A;  1MY3 A;  1RDZ A;  4PAK A;  2VOZ A;  5I7I A;  3DP8 A;  5AE4 A;  1MQG A;  4YKI A;  2XD2 A;  3PMW A;  3TFL A;  3FVG A;  3CFX A;  1N04 A;  3HHF A;  1TFA A;  2QL3 A;  4AB6 A;  4NMY A;  1MH3 A;  3T93 B;  1TXF A;  1MXV A;  2OLB A;  4KPT A;  5JTY B;  3U65 A;  5TU0 A;  3FVK A;  3TOD A;  4PDD A;  3DP6 A;  4F1V A;  3KC0 A;  5K2X A;  4I62 A;  4DE8 A;  3OEM A;  4BDN A;  4O94 A;  3U8Q A;  4OES A;  5JTY A;  2R9J A;  2ONR A;  2ZZV A;  4XF5 A;  1AL3 A;  2Y7R A;  1K9Y A;  2B65 A;  1TT1 A;  2W7Y A;  5HPQ A;  1QGX A;  2REJ A;  1SQY A;  4Q30 B;  2Q9T A;  3C4M A;  4ECF A;  4G68 C;  1FBP A;  1MY4 A;  4DLD A;  5CMB A;  4TOZ A;  4PFR A;  2OBG A;  3TCG A;  4ZZA A;  3R7X A;  1B7H A;  3DP4 A;  4MCO A;  3IB1 A;  3W9V A;  3PD8 A;  1NL5 A;  2ZNU A;  5ET5 A;  4MH5 A;  3FJG A;  5I2K B;  1FQF A;  4IO5 A;  1OLC A;  4G68 A;  1SW1 A;  1B0H A;  4OZ9 A;  1JEV A;  4GWW A;  3Q28 A;  2F34 A;  4AB5 A;  1NUZ A;  1OLA A;  1Y1M A;  3LUY A;  4ELO A;  1FTM A;  2Y84 A;  2VP1 A;  4Q0C A;  1OQG A;  1BKA A;  2L5V A;  1JQF A;  1MPB A;  3V8X B;  4GQO A;  3VLV A;  1FRP A;  4DCY A;  4F31 B;  2CMO A;  4F1Y A;  3IB0 A;  5L9M A;  4I9D A;  4U1O A;  2V3Q A;  1LB9 A;  5H8H B;  3QK6 A;  3K0V A;  1B58 A;  1SD3 A;  5IAI A;  3B6Q A;  2ESN A;  4YKJ A;  1NV2 A;  4R74 A;  1QVS A;  4GX6 A;  4L17 A;  4F2O A;  3IOU A;  1OVT A;  2VD3 A;  4NWC A;  3EPE A;  3SEX A;  1M5D A;  1PBP A;  5CBR A;  5DVI A;  4QFO A;  4GIZ A;  4MEV A;  3O6H A;  4H1X A;  1FPF A;  3M3F A;  3KN7 A;  4QRZ A;  1NV6 A;  4PET A;  3KGC A;  1FTK A;  5I59 A;  2O68 A;  4MAG A;  4H8I A;  4JVC A;  1Y9U A;  3TCF A;  2Z23 A;  4QF9 A;  3H6U A;  1EYJ A;  2Q89 A;  4LAT A;  2QS3 A;  3TEL A;  5AA2 B;  3MW0 A;  1B6H A;  4OVT A;  2B3F A;  3PUZ E;  3Q26 A;  3G3K A;  3U93 A;  3K1P A;  1MQJ A;  4Z0I A;  3HN0 A;  3RPL A;  4X04 A;  2WYP A;  1FQC A;  4KYD A;  3KG2 A;  4ZED A;  4H65 A;  1Z7M E;  3LSF B;  4NG7 A;  1B32 A;  4GF8 A;  5EHS A;  2UXA A;  4X48 A;  4MF3 A;  1MXY A;  3F11 A;  3MP8 A;  5AA1 A;  4RA1 A;  2CEY A;  4LZ8 A;  3KBZ A;  3B6T A;  4FIM A;  1SI0 A;  5DVF A;  5I2N B;  4NED A;  2UVI A;  4GWU A;  2P1S A;  1VE4 A;  3AXF A;  5TPA B;  2XX7 A;  3RYD A;  4HXV A;  3EN3 A;  3ISP A;  1H43 A;  1US4 A;  3OSQ A;  2PFY A;  2QS4 A;  2OWZ A;  1DBZ A;  1SW4 A;  5I56 B;  1LGB C;  1Y3N A;  1FCK A;  2Z8D A;  1FQA A;  1TFD A;  2XXT A;  1QUL A;  3SDF A;  2P2A A;  4IO4 A;  4BDM A;  3H6V A;  3RTF B;  5I56 A;  5I3S A;  3DM0 A;  5FTI A;  1JP4 A;  2XXI A;  2A5S A;  3RUM A;  5H8N A;  1FPK A;  2F35 A;  1UQW A;  1F9B A;  2ONS A;  1NI9 A;  2F7B A;  2UYF A;  1LEV A;  1DPP A;  2DS9 A;  1AMF A;  1IXC A;  3O29 A;  3WAE A;  4PDH A;  3FXB A;  2NVU B;  1RYO A;  4YAH X;  4YMA A;  4KQP A;  4OMB A;  5IZ3 B;  3HST A;  4U21 A;  4GBW A;  3CIJ A;  4NF5 B;  5KDT B;  2F97 A;  1OQH A;  4GXA A;  4XKP A;  1FBC A;  4N6D A;  2Q74 A;  4THI A;  1NNP A;  1NUX A;  2OX3 A;  3IOR A;  3LSW A;  1QJM A;  3LV0 A;  5I58 B;  3HV1 A;  3T0J A;  3A29 A;  3ONM A;  1YYZ A;  1B2H A;  5IZ3 A;  3GZG A;  3PPR A;  4OA4 A;  3D1R A;  1B3G A;  4HTG A;  4PF8 A;  4JWY A;  1LST A;  4F3G A;  4N8G A;  4YIC A;  3H6T A;  1FTA A;  4F3B A;  5ET8 A;  2DE2 A;  5I58 A;  3MUQ A;  4NF6 B;  3E9X A;  2I0B A;  4MNC A;  5K2Y A;  4IGR A;  4HW8 A;  3SET A;  2AYS A;  3N5L A;  4NWD A;  4O3B A;  1GV8 A;  1P1N A;  3K6X A;  2IEE A;  2QRY A;  3TTK A;  2HXR A;  1SW5 A;  2DDK A;  3CFZ A;  3RGY A;  1AWB A;  1BTJ A;  3FVO A;  2FVZ A;  4EQ7 A;  2GRV A;  3EQ1 A;  2G29 A;  3FAT A;  3TQL A;  1UTH B;  2XXU A;  4DXC A;  4P8B A;  1D3K A;  3RT6 B;  3T9V A;  4MX6 A;  3FD3 A;  5L9S A;  4KCC A;  5EQ7 A;  4LP2 B;  1O64 A;  5AA4 B;  3PTY A;  5F24 A;  1LBC A;  2Z8E A;  4U4X A;  1EH3 A;  1AIV A;  3CG3 A;  5JK4 A;  1UTH A;  3UIF A;  2VHA A;  2VPO A;  1PDA A;  3KN3 A;  4FAT A;  1FPG A;  2V25 A;  3HPI A;  4PFY A;  2PVU A;  3O6G A;  2XX8 A;  1HSJ A;  3OO8 A;  4Q8R A;  4NAP A;  1NFT A;  4RYA A;  1FBE A;  3VXC A;  3MVY A;  4R2B A;  3IFC A;  5ICT A;  4NF4 A;  4JWO A;  1USY E;  1PB9 A;  3THI A;  1B0L A;  5J1D A;  4IO3 A;  3ECR A;  1JNF A;  2THI A;  4H45 A;  4KI0 E;  3RQT A;  1LCT A;  4RXL A;  3BFT A;  5KCJ A;  3SEW A;  1Y4T A;  3IX1 A;  3HFU A;  3FV2 A;  2RC7 A;  1B46 A;  2QJE A;  4IR8 A;  3IR1 A;  1II5 A;  1FPD A;  4PQJ A;  2UVH A;  1LB8 A;  4JXI A;  1OVB A;  4GWO A;  3BKI B;  3N6T A;  3PD9 A;  3HCQ A;  2ALU A;  1ATG A;  3EHU A;  3D4C A;  5EQA A;  4DZ1 A;  4R6Y A;  2IA4 A;  3Q25 A;  1B3F A;  4N81 A;  5DVJ A;  3PPO A;  3R26 A;  4N6K A;  4R2F A;  1NV5 A;  5EQ9 A;  1K9Z A;  4ELQ A;  3ZKK A;  1B3H A;  4R9G A;  4MIJ A;  3KZG A;  3T22 A;  2WBB A;  1OMP A;  3N6U A;  1QKB A;  4NN3 A;  1FPI A;  1SYH A;  2I0C A;  2ZYO A;  3IO4 A;  1MPC A;  2NUV A;  4HCY A;  4GL8 A;  3TKD A;  4P9K A;  3ZKL A;  4Z7E A;  1SDX A;  4AS5 A;  1MDP 1;  4KHZ E;  1A7L A;  1SVX B;  4ZEF A;  3MP1 A;  4EQB A;  2HPG A;  2DOJ A;  1GVC A;  2XXY A;  2GH9 A;  3KJT A;  3K1M A;  4OAN A;  2DVC A;  4EF2 A;  3MZ9 A;  3UGW A;  3V83 A;  4XXU A;  2QFL A;  3KFM A;  3FZV A;  4BDL A;  1R1N A;  4QFK A;  3B6W A;  1MH4 A;  2ZMB A;  1HSL A;  1S9T A;  4DXB A;  1FPE A;  3G3I A;  1NNF A;  1PEB A;  1A55 A;  1SW2 A;  4ESX A;  4LZ7 A;  1AOV A;  2R71 A;  2AIX A;  5L8D A;  5FHO A;  1QUI A;  4OYV A;  3GBA A;  1JET A;  1FQE A;  4O7I A;  3QUF A;  1DK4 A;  4GWY A;  4JVD A;  1SPI A;  1DTZ A;  3VLU A;  1N84 A;  1B05 A;  4RK2 A;  1FPL A;  1FBH A;  2X7P A;  2YPN A;  3TDJ A;  3C33 A;  5ISU A;  1LLS A;  2DWH A;  2DYX A;  3OO7 A;  3QIM A;  1RDX A;  1XT8 A;  3RY3 A;  1XS5 A;  4C1T A;  1IMC A;  1Y1Z A;  1YXI A;  1PBQ A;  1FTL A;  1LFG A;  4R72 A;  3QXM A;  3K1N A;  4BDQ A;  3KSJ A;  4IB2 A;  3MAM A;  4EF1 A;  4OQO A;  1IMD A;  3BFU A;  5FBP A;  4H8J A;  5IGA A;  4G68 B;  5DEX A;  1ZIU A;  3FUZ A;  3RTW B;  2VT5 A;  5ESY A;  4ELR A;  1Q35 A;  5EYG A;  5F7V A;  1CB6 A;  4F19 A;  1B9J A;  3QAX A;  2OJT A;  5IKB A;  1MM6 A;  3QMF A;  2PT2 A;  1BP5 A;  2Q8J A;  3S9N C;  1LAH E;  3IO6 A;  3C32 A;  4RJZ A;  1IIW A;  2DXY A;  4LN5 A;  3EHT A;  3G3G A;  4HCW A;  2DWJ A;  3V89 B;  4GVO A;  1AH5 A;  1UIU A;  3IOW A;  3WAF A;  4XTC Q;  1LBY A;  4R6K A;  2HZK A;  1N3X A;  3K02 A;  4OEN A;  4PFU A;  1LBB A;  3H3G A;  3U1O A;  4MLQ A;  4KXP A;  1FTO A;  3FVN A;  2HAV A;  1LCF A;  4I8C A;  3VFJ A;  4F3S A;  5I59 B;  3N94 A;  1FSA A;  1ZBM A;  5AA2 D;  1P1U A;  5EQ8 A;  5ELV A;  2HQ0 A;  3I6V A;  5ET7 A;  3ROJ A;  1B5H A;  4LVQ A;  2ZZW A;  3HO7 A;  1A8E A;  2CZL A;  1USY H;  1YPN A;  5CBS A;  3MPL A;  4QFN A;  1FBD A;  4X1B A;  3T9U A;  2ONK E;  2B4M A;  3KBR A;  3L6H A;  5CC2 A;  2I48 A;  3RPL B;  4NF0 A;  4GOT A;  2VPN A;  4U4S A;  4U23 A;  1EYK A;  1EZP A;  4FOR A;  2REG A;  4FAJ A;  1NV0 A;  2O6A A;  3N26 A;  2D5W A;  2CZK A;  1N7X A;  3L6G A;  1BLF A;  3S4U A;  3VDF A;  4BDR A;  4FED A;  4GD5 A;  2XXP A;  3MPK A;  4F39 A;  2FYI A;  1P1O A;  4NF8 B;  3I5O A;  2XXR A;  3TZA A;  4N8Y A;  1POT A;  3K01 A;  5JEI A;  3RT8 A;  1IQ7 A;  4PAI A;  4H46 A;  2PYY A;  4NF8 A;  4OVR A;  4PE3 A;  4PBQ A;  3FGS A;  1UIV A;  1XVY A;  2KR0 A;  3MWB A;  4N07 A;  5B70 A;  3K4U A;  5LOM A;  2O7I A;  2R6G E;  2CZH A;  2R8T A;  3BBR A;  4N6P A;  1VFE A;  1D9Y A;  1EYI A;  3UK4 A;  4GWX A;  2BJI A;  3OMB A;  4MFI A;  1URS A;  3FAS A;  4UAB A;  4XFE A;  5H8N B;  4MMP A;  3TMG A;  3PPN A;  4MLV A;  3LR1 A;  3ILU B;  2QS2 A;  1MXX A;  2D21 A;  4O3A A;  3T96 B;  3I3V A;  1IMB A;  4EXK A;  1FJ9 A;  3CHG A;  3OOA A;  5ICQ A;  2LAO A;  1B3E A;  2I4B A;  3PU5 A;  1I69 A;  1DMB A;  4LZ5 A;  4P3L A;  2DSF A;  1SYI A;  3O9P A;  4P1E A;  2CZI A; 
#chains in the Genus database with same CATH homology
 2HEU A;  4RY1 A;  5A5X A;  4IO6 A;  4P0G A;  3OO9 A;  1QW0 A;  1US5 A;  3MBP A;  5EYF A;  1M5E A;  3D4G A;  4QFP A;  3K6U A;  3GLB A;  2H9B A;  5CI5 A;  3RLF E;  3FXU A;  3V5A A;  2Q2C A;  2ZYK A;  1ZKB A;  1IUD A;  2UVG A;  5I57 A;  2F6P A;  3O6I A;  3SES A;  3TYH A;  2HXW A;  1JW1 A;  4TQU Q;  5H8Q A;  3C35 A;  2O69 A;  1XOC A;  2HAU A;  3M8U A;  1ZJL A;  4G8H A;  4YMB A;  3T9H B;  1B3L A;  4YU0 A;  4Q5T A;  2PBW A;  1MXZ A;  1Y20 A;  2F78 A;  5HM4 B;  1S50 A;  1MY2 A;  1UTB B;  1BIY A;  3CRB A;  1IXI A;  4GXS B;  2GHA A;  2DP8 A;  4YB5 A;  2H25 A;  4BDO A;  4H6D A;  5I84 A;  2Y7P A;  1N76 A;  3OD7 A;  1ZLQ A;  2F5X A;  1FW0 A;  4GFR A;  4H67 A;  1UTB A;  4OVJ A;  3USD A;  4WXJ A;  5M2V A;  1LFI A;  4ZEC A;  1EZ9 A;  4OEU A;  1YAE A;  4QFL A;  3IB2 A;  4U22 A;  1JVX A;  4NF4 B;  1MY1 A;  4KYS A;  3EHS A;  3C31 A;  1M5B A;  1WOD A;  2ZYN A;  5KCJ B;  3G3J A;  2H4I A;  5ITO A;  1MDQ A;  3H7M A;  4H5G A;  4M1V A;  3MVX A;  4YKK A;  3VLW A;  2GFE A;  3ILT B;  1T0K A;  3IAZ A;  4FEB A;  2XXV A;  4E0X A;  4G4P A;  4YB7 A;  3TTM A;  4O3C A;  3M3L A;  3IOT A;  2O51 A;  4LUB A;  4TLM B;  3MJN A;  1Y3Q A;  3MVZ A;  3KOT A;  3IOV A;  5L9O A;  1NH7 A;  3PUY E;  1J1N A;  4DXU A;  1TWY A;  1MXW A;  4JDF A;  3G3F A;  3W9W A;  3VV5 A;  3DEL B;  2RIN A;  1SBP A;  5FHM A;  4LA9 A;  1B7U A;  3H06 B;  4F22 A;  1H44 A;  4IY6 A;  4U1Z A;  3K6W A;  3PMV A;  2QMX A;  3MZ1 A;  4RPO A;  1YCJ A;  1JVY A;  3MP6 A;  1XC1 A;  1MRP A;  2Y7K A;  3CG1 A;  4C1U A;  4G2Z A;  4JSD A;  4KFQ A;  1FQD A;  2A5T A;  1IIT A;  1O63 A;  3QUJ A;  3VXB A;  4ZE8 A;  4NE4 A;  1PC3 A;  4OET A;  1B5I A;  1L5T A;  3K00 A;  3G7W A;  2RC8 A;  4EQ9 A;  2DWA A;  1YTV A;  1VFD A;  4IO7 A;  1MXU A;  1B4H A;  2Y7I A;  1A54 A;  3HHG A;  3OEN A;  5TP9 A;  1QKA A;  3IJX B;  4EXL A;  3R6U A;  4FE8 A;  3S9E A;  1IEJ A;  2OK2 A;  3LSX A;  4R6H A;  1MY0 A;  3OO6 A;  4G77 A;  2AL5 A;  2RC9 A;  2QSX A;  3TAJ A;  3RPW A;  1OIB A;  1JEU A;  4DCX A;  4LQ2 A;  5CMC A;  3EF7 A;  1MQH A;  2NXO A;  2ZYM A;  1VSO A;  2I4C A;  3O28 A;  1DOT A;  2DE3 A;  2QS1 A;  3OEL A;  3JZJ A;  1N0T A;  3E3K A;  3IL1 B;  3PUV E;  1ZU0 A;  2VD2 A;  3H6W A;  2X7Q A;  5DEX B;  5BUU A;  1IXH A;  2XD3 A;  3E4R A;  4TLL B;  3C34 A;  1I6A A;  1XVX A;  4YKP A;  2NWJ A;  4ZZE A;  3ZS6 A;  1D4N A;  4X9T A;  3VVD A;  1MQI A;  1VR5 A;  1WVJ A;  4DIG A;  2F6G A;  4FEC A;  1LAX A;  4X1D A;  5HBC A;  4XKR A;  1I6Q A;  1A99 A;  4ELP A;  1RYX A;  2I3W A;  3W15 C;  2Z22 A;  3K2D A;  1WDN A;  3GXA A;  1M5C A;  2OWT A;  4PP0 A;  1PB7 A;  2XXW A;  5CRY A;  3FIR A;  4N13 A;  1DTG A;  1B1X A;  1N7W A;  1P1W A;  3RNN A;  3T9X B;  3ZSF A;  3KN8 A;  2XXX A;  3MZB A;  1B40 A;  3H4Z A;  3CI8 A;  3OXN A;  2ABH A;  2HZL A;  2FNC A;  3PPQ A;  5DTB A;  4C0R A;  5I2K A;  1RKM A;  4UA8 A;  3UP9 A;  4I1D A;  4GL0 A;  3QSL A;  4R9F A;  3JYR A;  2V84 A;  4OFJ A;  1B51 A;  2BJJ X;  2Q88 A;  3FJ7 A;  2ZNT A;  1P1Q A;  3E13 X;  3K6V A;  3KOS A;  1MPD A;  4QSD A;  5H8H A;  3UN6 A;  1QUJ A;  5FHN A;  4UAC A;  3CSB A;  3G3H A;  2E0S A;  3UA8 A;  2QMW A;  1Z7N E;  1FQB A;  4KCD A;  3TPA A;  5H8S A;  3P7I A;  4OXV A;  3C9H A;  2YLN A;  4PFT A;  3ODB A;  4FJP A;  1MG1 A;  3SEU A;  2OWS A;  5FTH A;  4JBZ A;  4F3P A;  4OHN A;  3MQ9 A;  4BLA A;  1A40 A;  1P99 A;  2F8D A;  2XXH A;  3TTN A;  5AA2 A;  2DXR A;  4YZZ A;  1D9V A;  3KEI A;  2B3B A;  4JSO A;  4G8M A;  1H76 A;  2Z8F A;  2XXQ A;  4XIG Q;  3CR9 A;  2G93 A;  4F2Q A;  2ANJ A;  3SKP A;  4OTE A;  4RK9 A;  2P0S A;  3OEK A;  2NOO A;  4MBP A;  1ANF A;  4M4G A;  1ZTY A;  3PPP A;  5B7D A;  5CM6 A;  3VE1 B;  3S9M C;  1MS7 A;  4H0W A;  3MVW A;  2XX9 A;  2UYE A;  3PV0 E;  2FA7 A;  3FJM A;  5I2N A;  2I6E A;  1KWH A;  2KLF A;  2V3U A;  4ONY A;  5TPA A;  1URG A;  3TUS A;  5DYH A;  4XKN A;  1B7Z A;  4KD5 A;  1NNK A;  5A5X B;  1JW4 A;  4OFL A;  2Y7W A;  4PFW A;  2O84 X;  1LAF E;  1I6B A;  4P0I A;  1IXG A;  4YB6 A;  3OSR A;  1B1H A;  2RCA A;  2AL4 A;  2I3V A;  4U2R A;  2I49 A;  4OER A;  2VGQ A;  5I57 B;  2ZXT A;  2O7U A;  1M5F A;  1O7T A;  4KYE A;  4AQ4 A;  5H8Q B;  3VVF A;  3LSL A;  2V93 A;  3IJO B;  2HCA A;  4PE5 B;  2X26 A;  3PMX A;  1NKX A;  4GLI A;  4DDD A;  3TQW A;  2PX1 A;  2YJP A;  5CMM A;  1NNT A;  1NMU A;  2ZNS A;  5H8F B;  3B7D A;  3A09 A;  2DWI A;  2DVZ A;  4QSC A;  1MQD A;  2PMS A;  1EZO A;  4ZEB A;  3FV1 A;  3UOR A;  1ELJ A;  4NF5 A;  5KDT A;  5H8F A;  3S2V A;  5AA3 A;  3GBB A;  4RPN A;  4QSE A;  1POY 1;  2OCU A;  2H98 A;  1H3D A;  2H5Y A;  4GRK A;  3CFL A;  1GTK A;  2DE4 A;  4QHQ A;  4POX A;  3A3U A;  3Q29 A;  3A3C A;  4NF6 A;  4IO2 A;  1PB8 A;  4F18 A;  1CE2 A;  3QYT A;  4H5F A;  5KZT A;  1DSN A;  4F29 A;  3PGF A;  4F1U A;  1JW5 A;  1LFH A;  3C36 A;  3PUW E;  3LC8 A;  3O66 A;  2WKY A;  3LBS A;  2D3I A;  3O2A A;  4WKM A;  3RN8 A;  1IZ1 A;  4HS7 A;  3U94 A;  3DLN A;  2UVJ A;  4ZS9 A;  4IGT A;  2F7A A;  5AA4 A;  3SER A;  2I58 A;  5CMK A;  2PT1 A;  1GR2 A;  1S7Y A;  2Q2A A;  2H99 A;  2GHB A;  2RCB A;  4OWD A;  2F7C A;  3CVG A;  2V3T A;  4JWX A;  2HFB A;  1H45 A;  4KR5 A;  3U92 A;  3TCH A;  4POW A;  4R73 A;  1LAG E;  3Q27 A;  3SEV A;  3JV9 A;  1HSE A;  4R75 A;  1GGG A;  3VVE A;  2M8C A;  1Y4C A;  3PUX E;  4ZDM A;  4NTL A;  3H03 A;  1DPE A;  1N3W A;  4EDP A;  5DT6 A;  2E1S A;  4EUO A;  1FTJ A;  3SEY A;  4JB7 A;  2O1M A;  1XHY A;  4G8N A;  4LON B;  2XHD A;  3IK6 B;  4OEV A;  2DQV A;  2RF1 A;  4K3F A;  2A5T B;  4ZEI A;  2OZZ A;  4OFO A;  4XKQ A;  5F1Q A;  4IY5 A;  1NH8 A;  1Q1K A;  5EHM A;  4RNS A;  1R6Z A;  3MC2 A;  3FXQ A;  1SI1 A;  4ZE9 A;  3TTR A;  1R9L A;  1B4Z A;  3CSG A;  3U72 A;  1A8F A;  1QUK A;  4WED A;  1B5J A;  2RKM A;  1URD A;  2O1L A;  4WEP A;  3S9L C;  1R9Q A;  4ESW A;  1Y3P A;  5TP9 B;  4E0W A;  4ND9 A;  5ITP A;  2F36 A;  4LQ5 A;  3FXR A;  4ISU A;  3TTL A;  3KJ7 A;  1B52 A;  1ZMG A;  1MM7 A;  3M3K A;  4ZEK A;  3KSX A;  1EU8 A;  4P11 A;  3T66 A;  3TEP A;  2QPQ A;  3O97 A;  5BWJ A;  1MY3 A;  2VOZ A;  3DP8 A;  5AE4 A;  1MQG A;  4YKI A;  2XD2 A;  3PMW A;  3TFL A;  3FVG A;  3CFX A;  1N04 A;  3HHF A;  1TFA A;  2QL3 A;  4AB6 A;  4NMY A;  1MH3 A;  3T93 B;  1TXF A;  1MXV A;  2OLB A;  4KPT A;  5JTY B;  5TU0 A;  3FVK A;  3TOD A;  3DP6 A;  4F1V A;  4DE8 A;  5K2X A;  4I62 A;  3OEM A;  4BDN A;  3U8Q A;  4OES A;  5JTY A;  2R9J A;  2ONR A;  1AL3 A;  2Y7R A;  2B65 A;  1TT1 A;  2W7Y A;  5HPQ A;  2REJ A;  1SQY A;  4Q30 B;  2Q9T A;  3C4M A;  4ECF A;  4G68 C;  1MY4 A;  4DLD A;  5CMB A;  4TOZ A;  2OBG A;  3TCG A;  4ZZA A;  3R7X A;  1B7H A;  3DP4 A;  3IB1 A;  3W9V A;  3PD8 A;  1NL5 A;  2ZNU A;  4MH5 A;  3FJG A;  5I2K B;  1FQF A;  4IO5 A;  1OLC A;  4G68 A;  1SW1 A;  1B0H A;  4OZ9 A;  1JEV A;  3Q28 A;  2F34 A;  4AB5 A;  1OLA A;  1Y1M A;  3LUY A;  4ELO A;  1FTM A;  2Y84 A;  2VP1 A;  4Q0C A;  1OQG A;  1BKA A;  1JQF A;  1MPB A;  3V8X B;  4GQO A;  3VLV A;  4DCY A;  4F31 B;  2CMO A;  4F1Y A;  3IB0 A;  5L9M A;  4I9D A;  4U1O A;  2V3Q A;  1LB9 A;  5H8H B;  3QK6 A;  3K0V A;  1B58 A;  1SD3 A;  5IAI A;  3B6Q A;  2ESN A;  4YKJ A;  4R74 A;  1QVS A;  4L17 A;  4F2O A;  3IOU A;  1OVT A;  2VD3 A;  4NWC A;  3EPE A;  3SEX A;  1M5D A;  1PBP A;  5CBR A;  5DVI A;  4QFO A;  4GIZ A;  3O6H A;  4H1X A;  3M3F A;  3KN7 A;  4QRZ A;  4PET A;  3KGC A;  1FTK A;  5I59 A;  2O68 A;  4H8I A;  1Y9U A;  3TCF A;  2Z23 A;  4QF9 A;  3H6U A;  2Q89 A;  4LAT A;  2QS3 A;  3TEL A;  5AA2 B;  3MW0 A;  1B6H A;  2B3F A;  3PUZ E;  3Q26 A;  3G3K A;  3U93 A;  3K1P A;  1MQJ A;  4Z0I A;  3HN0 A;  1FQC A;  4KYD A;  3KG2 A;  4ZED A;  4H65 A;  1Z7M E;  3LSF B;  1B32 A;  4GF8 A;  5EHS A;  2UXA A;  4X48 A;  4MF3 A;  1MXY A;  3F11 A;  3MP8 A;  5AA1 A;  4RA1 A;  4LZ8 A;  3B6T A;  4FIM A;  1SI0 A;  5DVF A;  5I2N B;  4NED A;  2UVI A;  2P1S A;  1VE4 A;  3AXF A;  5TPA B;  2XX7 A;  3EN3 A;  1H43 A;  1US4 A;  3OSQ A;  2QS4 A;  1SW4 A;  5I56 B;  1LGB C;  1Y3N A;  1FCK A;  2Z8D A;  1FQA A;  1TFD A;  2XXT A;  1QUL A;  3SDF A;  2P2A A;  4IO4 A;  4BDM A;  3H6V A;  3RTF B;  5I56 A;  3DM0 A;  5FTI A;  2XXI A;  2A5S A;  3RUM A;  5H8N A;  2F35 A;  1UQW A;  1F9B A;  2ONS A;  2F7B A;  2UYF A;  1DPP A;  2DS9 A;  1AMF A;  1IXC A;  3O29 A;  3WAE A;  2NVU B;  1RYO A;  4YAH X;  4YMA A;  4KQP A;  4OMB A;  3HST A;  4U21 A;  3CIJ A;  4NF5 B;  5KDT B;  2F97 A;  1OQH A;  4GXA A;  4XKP A;  4THI A;  1NNP A;  3IOR A;  3LSW A;  1QJM A;  5I58 B;  3HV1 A;  3ONM A;  1B2H A;  3GZG A;  3PPR A;  1B3G A;  4HTG A;  4JWY A;  1LST A;  4F3G A;  4YIC A;  3H6T A;  4F3B A;  2DE2 A;  5I58 A;  3MUQ A;  4NF6 B;  3E9X A;  2I0B A;  5K2Y A;  4IGR A;  4HW8 A;  3SET A;  2AYS A;  3N5L A;  4NWD A;  4O3B A;  1GV8 A;  1P1N A;  3K6X A;  2IEE A;  2QRY A;  3TTK A;  1SW5 A;  3CFZ A;  3RGY A;  1BTJ A;  3FVO A;  4EQ7 A;  2GRV A;  3EQ1 A;  2G29 A;  3FAT A;  3TQL A;  1UTH B;  2XXU A;  4DXC A;  1D3K A;  3RT6 B;  3T9V A;  5L9S A;  3FD3 A;  4KCC A;  4LP2 B;  1O64 A;  5AA4 B;  1LBC A;  2Z8E A;  4U4X A;  1EH3 A;  1AIV A;  3CG3 A;  5JK4 A;  1UTH A;  3UIF A;  2VHA A;  1PDA A;  3KN3 A;  4FAT A;  2V25 A;  3HPI A;  4PFY A;  2PVU A;  3O6G A;  2XX8 A;  1HSJ A;  3OO8 A;  4Q8R A;  1NFT A;  4RYA A;  3VXC A;  3MVY A;  4R2B A;  5ICT A;  4NF4 A;  4JWO A;  1USY E;  1PB9 A;  3THI A;  1B0L A;  5J1D A;  4IO3 A;  3ECR A;  1JNF A;  2THI A;  4KI0 E;  3RQT A;  1LCT A;  4RXL A;  3BFT A;  5KCJ A;  3SEW A;  1Y4T A;  3IX1 A;  3FV2 A;  2RC7 A;  1B46 A;  2QJE A;  3IR1 A;  1II5 A;  4PQJ A;  2UVH A;  1LB8 A;  4JXI A;  1OVB A;  4GWO A;  3BKI B;  3N6T A;  3PD9 A;  3HCQ A;  2ALU A;  1ATG A;  3EHU A;  3D4C A;  4DZ1 A;  4R6Y A;  2IA4 A;  3Q25 A;  1B3F A;  5DVJ A;  3PPO A;  3R26 A;  4R2F A;  4ELQ A;  3ZKK A;  1B3H A;  4R9G A;  3KZG A;  3T22 A;  1OMP A;  3N6U A;  1QKB A;  1SYH A;  2I0C A;  2ZYO A;  3IO4 A;  1MPC A;  2NUV A;  4HCY A;  4GL8 A;  3TKD A;  3ZKL A;  4Z7E A;  1SDX A;  1MDP 1;  4KHZ E;  1A7L A;  1SVX B;  4ZEF A;  3MP1 A;  4EQB A;  2DOJ A;  1GVC A;  2XXY A;  2GH9 A;  3KJT A;  3K1M A;  2DVC A;  4EF2 A;  3MZ9 A;  3UGW A;  3V83 A;  4XXU A;  3KFM A;  3FZV A;  4BDL A;  1R1N A;  4QFK A;  3B6W A;  1MH4 A;  2ZMB A;  1HSL A;  1S9T A;  4DXB A;  3G3I A;  1NNF A;  1PEB A;  1A55 A;  1SW2 A;  4ESX A;  4LZ7 A;  1AOV A;  2R71 A;  2AIX A;  5L8D A;  5FHO A;  1QUI A;  4OYV A;  3GBA A;  1JET A;  1FQE A;  3QUF A;  1DTZ A;  3VLU A;  1N84 A;  1B05 A;  4RK2 A;  2X7P A;  2YPN A;  3TDJ A;  3C33 A;  5ISU A;  1LLS A;  2DWH A;  2DYX A;  3OO7 A;  3QIM A;  1XT8 A;  3RY3 A;  1XS5 A;  4C1T A;  1Y1Z A;  1PBQ A;  1FTL A;  1LFG A;  4R72 A;  3QXM A;  3K1N A;  4BDQ A;  3KSJ A;  4IB2 A;  3MAM A;  4EF1 A;  4OQO A;  3BFU A;  4H8J A;  4G68 B;  5DEX A;  1ZIU A;  3FUZ A;  3RTW B;  4ELR A;  1Q35 A;  5F7V A;  1CB6 A;  4F19 A;  1B9J A;  3QAX A;  2OJT A;  5IKB A;  1MM6 A;  2PT2 A;  1BP5 A;  2Q8J A;  3S9N C;  1LAH E;  3IO6 A;  3C32 A;  4RJZ A;  1IIW A;  2DXY A;  3EHT A;  3G3G A;  4HCW A;  2DWJ A;  3V89 B;  4GVO A;  1AH5 A;  1UIU A;  3IOW A;  3WAF A;  4XTC Q;  4R6K A;  2HZK A;  1N3X A;  3K02 A;  4OEN A;  4PFU A;  1LBB A;  3H3G A;  3U1O A;  4MLQ A;  1FTO A;  3FVN A;  2HAV A;  1LCF A;  4I8C A;  3VFJ A;  4F3S A;  5I59 B;  3N94 A;  1ZBM A;  5AA2 D;  1P1U A;  5ELV A;  2HQ0 A;  3I6V A;  1B5H A;  4LVQ A;  3HO7 A;  1A8E A;  2CZL A;  1USY H;  1YPN A;  5CBS A;  3MPL A;  4QFN A;  4X1B A;  3T9U A;  2ONK E;  3KBR A;  3L6H A;  5CC2 A;  2I48 A;  4GOT A;  4U4S A;  4U23 A;  1EZP A;  4FOR A;  2REG A;  4FAJ A;  3N26 A;  2O6A A;  2D5W A;  1N7X A;  3L6G A;  1BLF A;  3S4U A;  3VDF A;  4BDR A;  4FED A;  4GD5 A;  2XXP A;  3MPK A;  4F39 A;  2FYI A;  1P1O A;  4NF8 B;  3I5O A;  2XXR A;  3TZA A;  1POT A;  3K01 A;  5JEI A;  3RT8 A;  1IQ7 A;  2PYY A;  4NF8 A;  3FGS A;  1UIV A;  1XVY A;  3MWB A;  4N07 A;  5B70 A;  3K4U A;  5LOM A;  2O7I A;  2R6G E;  3BBR A;  4N6P A;  1VFE A;  1D9Y A;  3UK4 A;  3OMB A;  4MFI A;  1URS A;  3FAS A;  5H8N B;  3TMG A;  3PPN A;  4MLV A;  3LR1 A;  3ILU B;  2QS2 A;  1MXX A;  2D21 A;  4O3A A;  3T96 B;  3I3V A;  4EXK A;  3OOA A;  5ICQ A;  2LAO A;  1B3E A;  2I4B A;  3PU5 A;  1I69 A;  1DMB A;  4LZ5 A;  2DSF A;  1SYI A;  3O9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...