3SEXA

Ni-mediated dimer of maltose-binding protein a216h/k220h by synthetic symmetrization (form ii)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
total genus 124
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sexA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sexA01
4QSEA 1GTKA 4OTEA 1Q35A 4O3CA 3S9LC 4ELRA 5I59A 3RT8A 5AA1A 1F9BA 4G8MA 3O28A 5B70A 3T66A 1NH7A 4E0XA 1A8EA 4P11A 1B51A 4U2RA 1NNFA 2ABHA 3KG2A 3VDFA 2VP1A 1Y3QA 3BKIB 3RQTA 2H99A 2XXHA 3A3CA 1M5CA 5H8FA 1H45A 4M1VA 3M8UA 3FVNA 1UQWA 3MVWA 4LUBA 1HSEA 5CBSA 3G3JA 2PBWA 4KYSA 3VE1B 2YJPA 2XXXA 4DIGA 5AA4B 1DMBA 4XKRA 1BP5A 1N0TA 4LZ8A 2VGQA 3H6WA 2OJTA 1JVXA 5ICTA 3K6XA 4JWXA 4LQ5A 1T0KA 1ZTYA 2H5YA 1MQDA 1YCJA 3OD7A 1H44A 4C1UA 3EHSA 4U22A 1PC3A 3IORA 2XXYA 2ONKE 4XKPA 4QFPA 1SYIA 1A7LA 3DP6A 4DE8A 4LONB 3K6VA 4IO2A 1SW5A 1ZLQA 2XX8A 3TEPA 4R73A 4H6DA 2XD3A 3LSFB 1GR2A 3FJ7A 3MC2A 3QAXA 4WEDA 3H4ZA 1FQFA 4OXVA 5L9OA 4LQ2A 1MQGA 4BDNA 3PD8A 5TU0A 2A5TB 4E0WA 2XX9A 5HM4B 4OYVA 3CG3A 5K2XA 1XVYA 3BFTA 3T9VA 2HCAA 2P0SA 3MP1A 4X9TA 1B46A 4LP2B 4R6YA 5I2KA 3TFLA 1JW1A 3U8QA 4IO7A 4NF6A 3L6GA 4BDRA 2XX7A 3VLWA 3RNNA 3RY3A 4GD5A 4ZDMA 4L17A 3FATA 3EQ1A 1LFGA 3THIA 2V93A 1LLSA 1B4HA 1YPNA 3K6UA 2I3VA 1Y9UA 4GL0A 2NOOA 1MXUA 5TPAB 2HQ0A 1M5EA 1URDA 3IOUA 4OESA 1MXZA 1IXIA 2NXOA 4FEDA 4EXLA 5FTIA 4GVOA 2GH9A 2VD2A 1I69A 5FHMA 1MY0A 2XXQA 4KCCA 2B65A 3MVZA 1MY3A 4QHQA 4PQJA 1LAXA 3KFMA 1IITA 3E13X 3RPWA 2DWJA 1LBCA 4R6KA 1R1NA 1DTZA 1EH3A 1A55A 2Z23A 1GVCA 3PGFA 4OERA 5K2YA 4DLDA 3W9VA 1O63A 4PP0A 2Z8EA 3C9HA 3QSLA 1UTBB 2F78A 1SQYA 2RKMA 2ZYKA 3U72A 3Q29A 2V3UA 3VXBA 5ITOA 3QK6A 2ESNA 1VR5A 4KYDA 2Y7IA 1IXHA 1RYXA 4RY1A 2QS4A 2LAOA 2REGA 2Q89A 4GXSB 1PBQA 2DP8A 3S9MC 1ZU0A 4YICA 3FZVA 2F7BA 3C32A 4ELPA 3VXCA 1POY1 1II5A 5I56A 2R6GE 1DPEA 3P7IA 4YB5A 3HPIA 4EDPA 1XT8A 1MXYA 4F22A 1A99A 5BWJA 4H5GA 3TTKA 2O7UA 5IKBA 2F5XA 4F3PA 1EZOA 1DPPA 2UVHA 1OLAA 3LSXA 4NF8B 4QFNA 5KCJA 3I3VA 2XHDA 2OCUA 2OBGA 2OZZA 1QUJA 3GZGA 4Q5TA 3CR9A 3G3KA 3LR1A 3TCHA 2RC7A 2AIXA 4MLVA 1D9VA 3AXFA 3UK4A 5I57B 2P1SA 1MH3A 4KHZE 4EQBA 4Z7EA 4BDQA 5JTYA 1O7TA 1IIWA 1B3EA 2XXWA 3U92A 4NF4A 2R71A 2UXAA 2H25A 4KI0E 1B3FA 2DE4A 1LGBC 3IB2A 3OOAA 4ZEFA 4R74A 4POWA 1NH8A 2QMXA 3KJ7A 2QS3A 4YMBA 1PDAA 1XVXA 4U4XA 2REJA 4R6HA 3FUZA 5TP9A 3R6UA 3VLUA 1NNPA 3RTWB 1RYOA 1CE2A 4ZEKA 4HW8A 4I9DA 5I2NB 3IX1A 1IXGA 5L8DA 3FJGA 4F1VA 4XIGQ 5F1QA 4POXA 5L9SA 3MQ9A 4G8NA 4OENA 2AL5A 5H8QA 5M2VA 3LSLA 3LC8A 2CZLA 1XC1A 2I3WA 2B3BA 3TTLA 5KZTA 1JQFA 3IOVA 4HCYA 3CFZA 3TKDA 3K1NA 4F19A 4GWOA 4X1BA 3N6TA 5DEXB 3SEUA 5EHMA 2ZMBA 3S9EA 4TLMB 5DVJA 3D4GA 2I49A 3TTRA 4IY6A 2DS9A 1US5A 2Z22A 2DQVA 3DLNA 1PB8A 1WVJA 1XS5A 4ZEBA 4IO6A 3KN8A 1USYE 4UA8A 3MPLA 1JVYA 4YZZA 2XD2A 1P1UA 3V8XB 1QULA 3ECRA 1AMFA 4Q30B 4LATA 3O6IA 4H65A 2HAUA 2A5SA 3A3UA 1N04A 5FHNA 3M3FA 3T9UA 1O64A 3LSWA 4F1YA 2Q2CA 3G3IA 1FQCA 1SI0A 5AA2B 3O66A 1B32A 2GHBA 4RJZA 4K3FA 2VOZA 3LUYA 4PE5B 1I6QA 3JV9A 3SESA 1US4A 5CM6A 2QS1A 5HPQA 4LA9A 5LOMA 1N3WA 2Y7PA 4RA1A 2X7QA 1OLCA 3QIMA 1BIYA 4N07A 4MFIA 1IXCA 4ELQA 4QFLA 1QW0A 5CC2A 3IL1B 2UVJA 3KGCA 4R72A 2RF1A 5EYFA 3TMGA 4DXBA 2XXTA 3T22A 4F3SA 4JSDA 1Y1ZA 4JWYA 4U23A 1YTVA 1SW4A 1Y20A 2UYFA 4F2OA 2ALUA 1DOTA 1IQ7A 3U93A 2Y7KA 2I6EA 3K01A 4NF5A 4NMYA 3PU5A 5I59B 3U94A 3K1MA 1LAGE 3K1PA 4OQOA 1SVXB 2UVGA 3KEIA 3TQWA 4JSOA 4OHNA 3V5AA 4DCYA 4ZZAA 2Y84A 2VHAA 2G29A 1Y3NA 1SI1A 2V84A 2F6GA 3B6WA 5FHOA 5I58A 3E4RA 2ZYNA 1I6BA 1JEVA 3FXRA 1OVTA 3KOTA 4PFTA 2DWHA 2V25A 5H8FB 4ZEDA 3CSBA 4GIZA 1B2HA 3IJXB 1HSLA 4O3AA 2PX1A 2O84X 3ZKLA 3I6VA 3HN0A 1MS7A 2PT2A 3HSTA 4IB2A 3TTMA 4EF1A 4FECA 2D5WA 2H9BA 4FE8A 1MY2A 1B1XA 2Z8FA 4GOTA 1B4ZA 2QRYA 5CBRA 2RC8A 4GRKA 1D3KA 3FVGA 2GHAA 3CFXA 2AYSA 1EU8A 3HHFA 2B3FA 4OFLA 4YU0A 3H03A 4NE4A 1B58A 3LBSA 5ELVA 4QSDA 3PD9A 2O69A 1ZMGA 5JK4A 4AQ4A 3C34A 1LAFE 3IO4A 1D9YA 3TTNA 3G3HA 3B6QA 2G93A 4I1DA 3GXAA 1MXXA 4YKPA 3K2DA 1P99A 5L9MA 3L6HA 5KDTA 2Z8DA 3UGWA 3G3GA 3O9PA 3OELA 4IGRA 5I84A 5A5XA 3SEWA 2F7AA 1PBPA 3KSXA 3S2VA 2NVUB 2YLNA 4WKMA 1LCFA 3C4MA 4IGTA 1S50A 2F6PA 1P1NA 3UIFA 5I2KB 4ZZEA 3MP6A 2NWJA 3SEXA 4NF6B 3IOWA 2CMOA 2I58A 3TUSA 2X7PA 1EZPA 1DSNA 3F11A 4MLQA 1UTHA 1GGGA 3KZGA 3FVKA 2XXRA 4OEUA 4GF8A 2QS2A 3QUJA 1VSOA 4BLAA 4G8HA 2ZNUA 3T96B 3PPQA 3ILTB 4FIMA 4U1OA 1MRPA 2D21A 1FQEA 3I5OA 4G68A 3OEMA 3BFUA 5ISUA 1JNFA 1USYH 4F29A 3TELA 1PB9A 2HXWA 2E1SA 2HZKA 2FYIA 4YMAA 2DE3A 2DE2A 1RKMA 1SYHA 1NMUA 3CIJA 2Y7RA 3VVFA 5JEIA 1AOVA 4H1XA 5AA2D 3GBAA 3KN3A 1LAHE 2DVCA 4JB7A 4PFYA 3U1OA 1B05A 4ESWA 1P1QA 2VD3A 1NNKA 4KYEA 1QUKA 3JYRA 2BJJX 1R9LA 1XHYA 1YAEA 3O6HA 3KOSA 1B52A 4LZ7A 3CSGA 1OIBA 3FV2A 1J1NA 2QSXA 1LBBA 3JZJA 3TCFA 3H3GA 1MG1A 3HHGA 2F36A 3ILUB 3EPEA 4GQOA 1B5JA 2DXYA 1MDP1 4R2FA 1IEJA 4NWCA 1WDNA 1FTKA 3C36A 5ICQA 1TWYA 1VFDA 4R9GA 1Z7NE 3PUXE 1FQDA 1QVSA 1P1OA 1A54A 3M3KA 1PEBA 5I56B 1VE4A 3IK6B 4QFKA 4YB7A 2Q8JA 2IA4A 1GV8A 2ZNTA 3S9NC 3D4CA 2OLBA 2XXIA 4FEBA 2PYYA 4HCWA 3V83A 2DOJA 3FIRA 1AL3A 5H8SA 4F2QA 3SDFA 4RYAA 3SEVA 4F39A 1MY1A 4R75A 4H0WA 3OSQA 3PUVE 3PPNA 3E9XA 5J1DA 3PMXA 5KCJB 4G68C 3H6VA 1MM7A 1MQHA 2V3QA 4RK9A 5B7DA 4EQ7A 2RCAA 1I6AA 3RN8A 4YKJA 3RTFB 4I8CA 2AL4A 4KD5A 3PPRA 4DDDA 5DTBA 5CMBA 3EHUA 1TT1A 2DYXA 4TOZA 3RUMA 1B7ZA 2O7IA 5JTYB 1FQAA 4JWOA 5F7VA 3FXUA 1XOCA 4O3BA 4XTCQ 1M5DA 4NF4B 1B0HA 1TXFA 2ZXTA 3ODBA 4JDFA 3S4UA 3TZAA 4XXUA 4G2ZA 3FXQA 2DSFA 3PPOA 3DELB 5H8NA 3MP8A 3KBRA 1FTLA 4FATA 3CFLA 5TP9B 3DM0A 1N3XA 1R6ZA 2Q9TA 3Q28A 2F7CA 3CI8A 1OQGA 1NFTA 4OFOA 3VV5A 2F97A 3T9XB 2FNCA 3QXMA 2QL3A 2Q88A 5H8QB 3PV0E 1BTJA 1DTGA 1MY4A 1SDXA 3N94A 3SETA 4KPTA 3W9WA 2WKYA 3CG1A 2ZYMA 3R26A 4ISUA 1B7UA 5CMCA 5ITPA 2O1LA 4G4PA 1NKXA 1TFDA 3UP9A 3H7MA 3N26A 1B40A 3EF7A 3Q25A 3OEKA 1Y4TA 4LZ5A 1ZBMA 4BDMA 3H6TA 3SEYA 1LB9A 3MZ9A 3KJTA 4QFOA 4P0IA 2RINA 3KSJA 3MAMA 4ZE9A 4EUOA 1Y3PA 2ZYOA 3FVOA 3N5LA 2W7YA 4RXLA 5CRYA 3MWBA 4Q8RA 4QRZA 3EN3A 2HEUA 5HBCA 5AA4A 2E0SA 1AH5A 1ELJA 3C31A 3G7WA 1LCTA 1FW0A 1URSA 3O29A 4U1ZA 4ONYA 2UYEA 1A40A 2RCBA 4BDOA 4JBZA 4H8IA 4FORA 3MZ1A 1HSJA 1MXWA 3G3FA 3QYTA 3HV1A 4H5FA 3ZKKA 5AE4A 4MBPA 2IEEA 4IY5A 3BBRA 4ZS9A 1Y4CA 4KR5A 3ZS6A 4OWDA 2V3TA 2QJEA 5AA3A 4F3GA 4OZ9A 1PB7A 2FA7A 3TAJA 4YB6A 3B7DA 4KFQA 1N7XA 3OXNA 4EQ9A 3FJMA 2NUVA 5CI5A 4RPOA 2I0CA 3OO7A 3H6UA 3K6WA 1VFEA 5FTHA 4KQPA 2DWIA 1NL5A 1B5IA 3B6TA 2HAVA 2A5TA 3SERA 4DXUA 3O2AA 3FD3A 2F35A 4NWDA 1B1HA 5DT6A 2O68A 3O97A 3TCGA 1M5FA 2PT1A 4UACA 4DXCA 3UN6A 2O51A 1SW2A 1FQBA 4PETA 4NF5B 2ANJA 3VFJA 3GLBA 2F8DA 1TFAA 3CRBA 1IZ1A 2GRVA 5H8HA 2QMWA 3IJOB 4MF3A 5TPAA 1B3HA 2I4CA 4GL8A 4ND9A 5I58B 1IUDA 3VLVA 2I48A 4N13A 2RC9A 1H3DA 2DVZA 3C35A 1LFHA 4ZE8A 4P0GA 1OVBA 2XXUA 1FCKA 1N76A 3RT6B 1P1WA 1B9JA 3OO6A 3OO9A 1ATGA 1QJMA 2DXRA 4THIA 5DVFA 3Q27A 3DP8A 4ESXA 2R9JA 2THIA 2ONSA 4R2BA 1QKBA 2OWSA 1A8FA 3H06B 3MW0A 3QUFA 3ONMA 3TYHA 1SD3A 3TODA 4AB6A 3PMVA 3C33A 4IO5A 3UA8A 3OO8A 1H43A 1UIUA 1UTBA 4YAHX 3TDJA 3MUQA 4OFJA 5H8HB 4ELOA 3PUYE 3N6UA 1B6HA 2PVUA 2I0BA 4N6PA 2O1MA 1OQHA 2P2AA 2H98A 4F31B 4HS7A 4H8JA 3EHTA 4IO3A 1ZKBA 3CVGA 1MM6A 3FASA 2HZLA 1FTMA 4KCDA 4WEPA 3TQLA 3GBBA 1FTOA 2Q2AA 1N7WA 1BLFA 3MVYA 3WAFA 3PUWE 3IB1A 4FAJA 1B3LA 4ECFA 4M4GA 1Q1KA 4JXIA 2UVIA 5KDTB 3HCQA 5EHSA 1JETA 4U21A 5A5XB 3MJNA 3MVXA 1B3GA 4NF8A 3K02A 1M5BA 4F18A 3KN7A 1SBPA 4ZEIA 2YPNA 3IAZA 4NTLA 2ONRA 5CMMA 1R9QA 3M3LA 4OVJA 2XXPA 4LVQA 4FJPA 3W15C 3OSRA 1UTHB 5I57A 2H4IA 4X48A 4OETA 2X26A 3K00A 2ZNSA 4F1UA 5CMKA 4U4SA 4PFWA 1MXVA 3K4UA 4YKKA 2OK2A 4G68B 1MQIA 4QSCA 3TPAA 3MZBA 1MPCA 2OWTA 5DYHA 3OMBA 3RGYA 1OMPA 1QUIA 4RNSA 4GXAA 4HTGA 1Y1MA 1D4NA 4DCXA 2DWAA 4C0RA 4X1DA 1SW1A 4GLIA 1BKAA 4EF2A 5I2NA 1N84A 4G77A 4Z0IA 3VVEA 2Y7WA 3FV1A 2QPQA 3DP4A 1EZ9A 4TQUQ 3MBPA 3V89B 3IOTA 3O6GA 2D3IA 4I62A 3OENA 5DEXA 3A09A 4R9FA 5DVIA 4NEDA 1QKAA 1B7HA 3PMWA 4XKQA 1MPBA 3K0VA 3SKPA 2GFEA 3HO7A 1URGA 4H67A 5BUUA 4ZECA 1LSTA 3UORA 1UIVA 1WODA 4PFUA 1JW4A 2I4BA 4TLLB 3T93B 1Z7ME 1S7YA 4OEVA 1H76A 3PPPA 4GFRA 2F34A 4EXKA 1ANFA 1AIVA 3WAEA 1FTJA 1ZIUA 1NNTA 3USDA 4RK2A 4RPNA 4IO4A 4BDLA 4Q0CA 1KWHA 1MDQA 1B5HA 4XKNA 1MQJA 3E3KA 1MPDA 2M8CA 5AA2A 3RLFE 1B0LA 3VVDA 4F3BA 1JW5A 2O6AA 4YKIA 4WXJA 1L5TA 2HFBA 3IB0A 3PUZE 3MPKA 2PMSA 2KLFA 1S9TA 4MH5A 1CB6A 4C1TA 1ZJLA 1JEUA 4OMBA 4AB5A 3ZSFA 3FGSA 4QF9A 1POTA 3T9HB 3IO6A 3IR1A 1MH4A 1LFIA 5H8NB 4DZ1A 3Q26A 1LB8A 2XXVA 3R7XA 5IAIA
chains in the Genus database with same CATH superfamily
4QSEA 1GTKA 4OTEA 1Q35A 4PGPA 4O3CA 3S9LC 4ELRA 5I59A 3RT8A 5AA1A 1F9BA 4G8MA 3O28A 5B70A 3T66A 1NH7A 4G61A 4E0XA 1A8EA 4P11A 1B51A 4U2RA 1NV0A 1NNFA 2ABHA 5J16A 3KG2A 1FBEA 3VDFA 2VP1A 1Y3QA 4MHFA 4NG7A 3BKIB 3RQTA 2H99A 2XXHA 3A3CA 1M5CA 4GWYA 5H8FA 1H45A 4M1VA 3M8UA 3FVNA 1NV6A 1UQWA 3MVWA 4LUBA 1HSEA 5CBSA 2QVUA 3G3JA 2PBWA 3KBZA 4KYSA 3VE1B 2YJPA 2XXXA 2CZKA 4DIGA 5AA4B 1DMBA 4XKRA 1FPDA 1BP5A 1N0TA 2XWKA 4LZ8A 2VGQA 3H6WA 2OJTA 1JVXA 4AS5A 5ICTA 3E79A 3K6XA 4JWXA 4LQ5A 1T0KA 4I3YA 1ZTYA 2H5YA 1MQDA 1YCJA 3OD7A 1INPA 1H44A 4C1UA 3EHSA 4U22A 1PC3A 3IORA 2XXYA 2ONKE 4XKPA 4H46A 4QFPA 1SYIA 1A7LA 3DP6A 4DE8A 4LONB 3K6VA 4IO2A 1SW5A 1ZLQA 2XX8A 4MAGA 3TEPA 4R73A 4H6DA 2XD3A 3LSFB 1GR2A 3FJ7A 3MC2A 4NX1A 4P9KA 5DW8A 3QAXA 4N8YA 4WEDA 3H4ZA 1FQFA 4OXVA 5L9OA 4LQ2A 1MQGA 4BDNA 3PD8A 5TU0A 2A5TB 4E0WA 2XX9A 5HM4B 4OYVA 3CG3A 5K2XA 1XVYA 3BFTA 3RPLA 3T9VA 2XWIA 2HCAA 2FVZA 2P0SA 2XA5A 3MP1A 4X9TA 1B46A 4LP2B 4R6YA 5I2KA 3TFLA 4XEQA 1JW1A 3U8QA 5I5PA 4IO7A 4NF6A 3L6GA 4BDRA 2XX7A 3VLWA 2CZHA 4N81A 3RNNA 3RY3A 4GD5A 4ZDMA 4L17A 3FATA 3EQ1A 1LFGA 3THIA 2V93A 1LLSA 1B4HA 1YPNA 3K6UA 2I3VA 2WBBA 1Y9UA 4GBWA 4GL0A 2NOOA 1MXUA 5TPAB 2HQ0A 1M5EA 1URDA 3IOUA 4OESA 1MXZA 1IXIA 2NXOA 4FEDA 4EXLA 3PTYA 1KA0A 5FTIA 4GVOA 1FBHA 2GH9A 2VD2A 1I69A 5FHMA 1MY0A 2XXQA 4KCCA 2B65A 4MMPA 3MVZA 1MY3A 4GWXA 4QHQA 4PQJA 1LAXA 3KFMA 1IITA 3E13X 3RPWA 2DWJA 1LBCA 4R6KA 1R1NA 1DTZA 1EH3A 1A55A 2Z23A 1GVCA 3PGFA 4OERA 4LN5A 5K2YA 4DLDA 3W9VA 1O63A 4MNPA 4AS4A 4X04A 4PP0A 2Z8EA 4QXDA 3C9HA 3QSLA 1UTBB 2F78A 4PGNA 1SQYA 2RKMA 2ZYKA 2WYPA 3U72A 3Q29A 2V3UA 3VXBA 5ITOA 3QK6A 2ESNA 1VR5A 4IR8A 4KYDA 2Y7IA 4N6DA 1IXHA 1RYXA 4RY1A 2QS4A 2LAOA 2REGA 5T3JA 2Q89A 4GXSB 1PBQA 2DP8A 3S9MC 4GBVA 1ZU0A 4PE3A 4YICA 3FZVA 2F7BA 3C32A 4ELPA 3VXCA 1POY1 1II5A 5I56A 2R6GE 1DPEA 3P7IA 4YB5A 3HPIA 4EDPA 4NAPA 1XT8A 1MXYA 1JP4A 4F22A 1A99A 5BWJA 4H5GA 3TTKA 2O7UA 5IKBA 2F5XA 4F3PA 1EZOA 1DPPA 2UVHA 1OLAA 3LSXA 4NF8B 3IFCA 4QFNA 5KCJA 3I3VA 2XHDA 2OCUA 1AWBA 2OBGA 2OZZA 1QUJA 3GZGA 4Q5TA 3CR9A 3G3KA 3LR1A 3TCHA 2RC7A 2AIXA 4HE2A 4MLVA 3T0JA 1D9VA 3AXFA 3UK4A 5I57B 2P1SA 1MH3A 1FPKA 4KHZE 4EQBA 4Z7EA 4BDQA 5JTYA 1O7TA 1IIWA 1B3EA 2XXWA 3D1RA 3U92A 4NF4A 2R71A 2UXAA 2H25A 4KI0E 1B3FA 2DE4A 1LGBC 3IB2A 3OOAA 5EQ7A 4ZEFA 4R74A 4POWA 1NH8A 2QMXA 3KJ7A 2QS3A 4YMBA 1NUWA 1PDAA 1XVXA 4U4XA 2REJA 4R6HA 3FUZA 5TP9A 3R6UA 3VLUA 1NNPA 5ESYA 3RTWB 1RYOA 1CE2A 4ZEKA 4HW8A 4I9DA 5I2NB 3IX1A 1IXGA 5L8DA 1YZ0A 1NV1A 2Y5LA 4GWUA 3FJGA 4F1VA 4XIGQ 5F1QA 4POXA 5L9SA 3MQ9A 4G8NA 4OENA 2AL5A 5H8QA 5M2VA 1FBFA 3LSLA 3LC8A 2CZLA 1LBWA 1XC1A 2I3WA 2B3BA 3TTLA 5KZTA 5I3SA 1JQFA 3IOVA 4HCYA 3CFZA 3MSTA 3TKDA 3K1NA 4F19A 4GWOA 4X1BA 3N6TA 2F3BA 5DEXB 3SEUA 5EHMA 2ZMBA 3S9EA 4TLMB 5DVJA 3D4GA 2I49A 3TTRA 4IY6A 2DS9A 1US5A 5IZ3B 2Z22A 2DQVA 3DLNA 1PB8A 1WVJA 1XS5A 4ZEBA 4IO6A 2MKZA 3KN8A 1USYE 4UA8A 3MPLA 1JVYA 4YZZA 2XD2A 1P1UA 3V8XB 1QULA 3ECRA 1AMFA 4Q30B 4LATA 3O6IA 1IMFA 2B4LA 4H65A 2HAUA 2A5SA 3A3UA 3ISPA 1FSAA 1N04A 5FHNA 3M3FA 3T9UA 1O64A 3LSWA 4F1YA 4MNCA 2Q2CA 1LBYA 3G3IA 2DDKA 1FQCA 1SI0A 5AA2B 3O66A 1NV7A 1B32A 2GHBA 4RJZA 4K3FA 2VOZA 3LUYA 4PE5B 1I6QA 3JV9A 3SESA 1US4A 5CM6A 2QS1A 5HPQA 4LA9A 5LOMA 1N3WA 2Y7PA 4OVQA 4RA1A 2X7QA 1OLCA 3QIMA 1BIYA 4N07A 4MFIA 4P1EA 1LBZA 1IXCA 4ELQA 4QFLA 4MX6A 1IMCA 2PFZA 1QW0A 5CC2A 3IL1B 2UVJA 4UABA 3KGCA 4R72A 2RF1A 4PBQA 5EYFA 1EYIA 3TMGA 4DXBA 2XXTA 3T22A 4F3SA 4JSDA 1Y1ZA 4JWYA 4U23A 1YTVA 1SW4A 1Y20A 2UYFA 4F2OA 1G0HA 2ALUA 2ZZWA 4I40A 1DOTA 1IQ7A 3U93A 2Y7KA 2I6EA 3K01A 3B50A 2R8TA 3FXBA 4NF5A 4NMYA 3PU5A 5I59B 4PF6A 3K1MA 3U94A 1LAGE 4DI4B 3K1PA 4OQOA 1SVXB 2UVGA 3KEIA 3TQWA 4JSOA 4OHNA 3V5AA 4DCYA 4P3LA 2HHMA 4ZZAA 2Y84A 2VHAA 2G29A 1Y3NA 4JVIA 1SI1A 4QBAA 2V84A 5ET6A 2F6GA 3B6WA 5FHOA 5I58A 3E4RA 4N8GA 1YYZA 2ZYNA 1I6BA 1JEVA 3HFUA 1BK4A 3FXRA 1OVTA 3KOTA 4PFTA 2DWHA 2V25A 4NGUA 5H8FB 4ZEDA 3CSBA 3EKIA 4GIZA 1B2HA 3IJXB 1HSLA 4NQ8A 4O3AA 2PX1A 2WYKA 4KXPA 2O84X 3ZKLA 3I6VA 3HN0A 1MS7A 2PT2A 3HSTA 4IB2A 3TTMA 4EF1A 4FECA 2D5WA 2H9BA 4FE8A 1MY2A 1B1XA 2Z8FA 4GOTA 1B4ZA 3B8BA 2QRYA 5CBRA 2RC8A 4GRKA 1D3KA 4JVDA 3FVGA 4O8MA 2GHAA 3CFXA 2AYSA 1EU8A 3HHFA 2B3FA 4OFLA 4YU0A 3H03A 4NE4A 1B58A 3LBSA 5ELVA 4QSDA 4MCOA 2KQZA 3PD9A 2O69A 1ZMGA 5JK4A 4AQ4A 3C34A 1LAFE 3IO4A 1RDXA 1D9YA 4H45A 3TTNA 3G3HA 3KC0A 3B6QA 2G93A 4I1DA 1FRPA 4N6KA 3GXAA 1MXXA 4YKPA 3K2DA 1P99A 2ZZVA 5L9MA 3L6HA 5KDTA 2Z8DA 3UGWA 3G3GA 3O9PA 3OELA 4IGRA 4N15A 5I84A 5A5XA 3SEWA 2F7AA 1PBPA 3KSXA 3S2VA 2NVUB 2YLNA 4WKMA 1LCFA 3C4MA 4IGTA 3RPLB 1S50A 1LBVA 2F6PA 5EYHA 1P1NA 3UIFA 5I2KB 4MNIA 4ZZEA 3MP6A 2NWJA 3SEXA 4NF6B 3IOWA 2CMOA 2I58A 3TUSA 2X7PA 1DK4A 1EZPA 5LTCA 1DSNA 3F11A 4MLQA 1UTHA 1GGGA 3KZGA 3FVKA 2XXRA 4OEUA 4GF8A 2QS2A 3QUJA 1VSOA 4BLAA 4G8HA 2ZNUA 3T96B 3PPQA 3ILTB 4FIMA 4X8RA 4U1OA 1MRPA 5ET8A 2D21A 1FQEA 4I3EA 3I5OA 4G68A 3OEMA 3BFUA 5ISUA 1JNFA 1USYH 4F29A 3TELA 1PB9A 2HXWA 4OANA 2E1SA 2HZKA 2FYIA 1IMAA 4YMAA 2DE3A 2DE2A 1RKMA 1G0IA 1NMUA 1SYHA 3CIJA 2Y7RA 3VVFA 5JEIA 1AOVA 4GX3A 4H1XA 1FPEA 5AA2D 3GBAA 3KN3A 4HXVA 1LAHE 2DVCA 4JB7A 4PFYA 3U1OA 1B05A 4ESWA 1P1QA 3QMFA 2VD3A 1NNKA 1LEVA 4KYEA 1QUKA 3JYRA 2BJJX 1R9LA 1XHYA 1YAEA 3O6HA 3KOSA 5F24A 1B52A 4LZ7A 3CSGA 4NF0A 1OIBA 5ET7A 2VPOA 3FV2A 1J1NA 2QSXA 4O7IA 1LBBA 3JZJA 3TCFA 3H3GA 1MG1A 3HHGA 3SZPA 4PC9A 2F36A 3ILUB 3EPEA 4GQOA 1B5JA 2DXYA 1MDP1 4R2FA 1IEJA 4NWCA 1WDNA 1FTKA 3C36A 5ICQA 1TWYA 1VFDA 4R9GA 1Z7NE 3PUXE 1FQDA 1QVSA 1P1OA 1A54A 3M3KA 1PEBA 5I56B 1VE4A 1FBPA 3IK6B 4QFKA 3E78A 1FPBA 4YB7A 2Q8JA 2IA4A 4DI3D 1GV8A 2ZNTA 3S9NC 3D4CA 2OLBA 2XXIA 4FEBA 2PYYA 4HCWA 3V83A 2DOJA 3FIRA 1AL3A 5H8SA 2KR0A 4F2QA 3SDFA 4RYAA 3SEVA 3A29A 1FPLA 1MY1A 4R75A 4F39A 4H0WA 2FIEA 3OSQA 3PUVE 2PCRA 3PPNA 3E9XA 5J1DA 2FBPA 3PMXA 5KCJB 1NV2A 4G68C 3H6VA 1MM7A 1RDYA 1MQHA 2V3QA 4OVRA 4RK9A 5B7DA 4EQ7A 2RCAA 1I6AA 4PAIA 3RN8A 2QVRA 4YKJA 5ET5A 3RTFB 4I8CA 2AL4A 4KD5A 4N91A 3PPRA 4DDDA 5DTBA 5CMBA 4P47A 3BIGA 2P3NA 3EHUA 1TT1A 2DYXA 4TOZA 3RUMA 1B7ZA 2O7IA 4OVSA 5JTYB 1FQAA 4JWOA 2WEFA 5F7VA 3FXUA 1XOCA 4O3BA 1K9YA 4XTCQ 1M5DA 4NF4B 3IFAA 1B0HA 1TXFA 2ZXTA 3ODBA 4JDFA 3S4UA 3TZAA 4XXUA 4G2ZA 3FXQA 2DSFA 2CZIA 3PPOA 3DELB 5H8NA 3MP8A 3KBRA 1FTLA 4FATA 3CFLA 5TP9B 3DM0A 1N3XA 1R6ZA 2Q9TA 3Q28A 2F7CA 3CI8A 1OQGA 1FPFA 1NFTA 4OFOA 3VV5A 2F97A 3T9XB 2FNCA 3QXMA 2QL3A 2Q88A 5H8QB 3PV0E 1BTJA 1DTGA 1MY4A 1SDXA 3N94A 3SETA 1RDZA 3CHGA 4KPTA 3W9WA 2WKYA 3CG1A 2ZYMA 3R26A 4ISUA 1B7UA 5CMCA 5ITPA 2O1LA 4G4PA 1NKXA 1TFDA 3UP9A 3H7MA 2XWOA 3N26A 1B40A 3EF7A 3Q25A 3RYDA 2XWVA 3OEKA 1Y4TA 4LZ5A 1ZBMA 4GX4A 4BDMA 3H6TA 3SEYA 1LB9A 2HPGA 3MZ9A 3KJTA 4QFOA 4GWZA 4P0IA 2RINA 4JVCA 3KSJA 3MAMA 4ZE9A 4EUOA 1Y3PA 2ZYOA 1FPGA 3FVOA 3N5LA 2W7YA 4RXLA 5CRYA 3MWBA 4Q8RA 4QRZA 3EN3A 2HEUA 5HBCA 5AA4A 2E0SA 1AH5A 1FJ6A 1ELJA 3C31A 5EQAA 3T1BA 1YXIA 3G7WA 3ROJA 1LCTA 1FBDA 1FW0A 1URSA 3O29A 4U1ZA 4ONYA 2UYEA 1A40A 2RCBA 4BDOA 4JBZA 4H8IA 5A5LA 4FORA 3MZ1A 1HSJA 1MXWA 2FIXA 3G3FA 3QYTA 3HV1A 4H5FA 2ZZXA 3ZKKA 5AE4A 4OVTA 1KA1A 4PTKA 4MBPA 2IEEA 4IY5A 3BBRA 4ZS9A 1Y4CA 4KR5A 3ZS6A 4OWDA 2V3TA 2QJEA 5AA3A 3BIHA 4F3GA 4OZ9A 4PFRA 1PB7A 2FA7A 3TAJA 4YB6A 3B7DA 2JJKA 4KFQA 1N7XA 3OXNA 4EQ9A 3FJMA 1FBGA 1EYKA 2NUVA 5CI5A 5IZ1A 4RPOA 4PAKA 2I0CA 3OO7A 3H6UA 3K6WA 1VFEA 5FTHA 4KQPA 2DWIA 1NV4A 1NL5A 1B5IA 4PDHA 3B6TA 2HAVA 2A5TA 4P56A 3SERA 4DXUA 3O2AA 3FD3A 1Q9DA 2F35A 1KZ8A 4NWDA 1B1HA 5DT6A 2O68A 3O97A 3TCGA 1M5FA 2PT1A 4UACA 4DXCA 3UN6A 5EQ8A 2O51A 1SW2A 1FQBA 4PETA 4GWWA 4NF5B 4FBPA 2ANJA 3VFJA 3GLBA 3KC1A 2F8DA 1TFAA 1FPIA 3CRBA 1IZ1A 2GRVA 5H8HA 2QMWA 3IJOB 4MF3A 5TPAA 1B3HA 1FJ9A 2I4CA 2XXKA 4GL8A 4ND9A 5I58B 1IUDA 3VLVA 2I48A 4N13A 2RC9A 1H3DA 2DVZA 4O7MA 3C35A 1LFHA 4ZE8A 4P0GA 1OVBA 2XXUA 1FCKA 1N76A 4GWSA 3RT6B 4PCDA 2P3VA 4PFIA 1P1WA 2GQ1A 3FBPA 1B9JA 3OO6A 3OO9A 1ATGA 2HXRA 1QJMA 2DXRA 4THIA 4PBHA 5DVFA 3Q27A 3DP8A 4ESXA 2R9JA 2THIA 2ONSA 4R2BA 1QKBA 2OWSA 1A8FA 3H06B 3MW0A 3QUFA 3ONMA 3TYHA 1SD3A 3TODA 4AB6A 3PMVA 1SPIA 3C33A 4IO5A 3UA8A 3OO8A 1H43A 1UIUA 1UTBA 4YAHX 3TDJA 3MUQA 4OFJA 5H8HB 5FBPA 4ELOA 3PUYE 3N6UA 1B6HA 2PVUA 2I0BA 4N6PA 2O1MA 4PAFA 2WX9A 1OQHA 2P2AA 4OA4A 2H98A 4F31B 4HS7A 4H8JA 3EHTA 4IO3A 1ZKBA 3CVGA 1MM6A 3FASA 2HZLA 1FTMA 4KCDA 4WEPA 1FPJA 3TQLA 3GBBA 5LDZA 1XI6A 1FTOA 2Q2AA 1NI9A 2OX3A 1N7WA 1BLFA 3MVYA 3WAFA 1FBCA 3PUWE 3IB1A 1EYJA 4FAJA 1B3LA 4ECFA 4M4GA 1Q1KA 4JXIA 4P8BA 2UVIA 5KDTB 4XFEA 1IMDA 3HCQA 5EHSA 1JETA 2Y5KA 4U21A 5A5XB 3MJNA 3MVXA 2PFYA 1DCUA 1B3GA 4NF8A 3K02A 1LBXA 1M5BA 4F18A 3KN7A 1SBPA 4ZEIA 4HE1A 5IM2A 2YPNA 3IAZA 1IMEA 4MJOA 4NTLA 2ONRA 5CMMA 1R9QA 5EYGA 3M3LA 4OVJA 2XXPA 4MIJA 4LVQA 4FJPA 3W15C 3OSRA 1UTHB 4GX6A 5I57A 2H4IA 4X48A 1K9ZA 4OETA 2X26A 3K00A 2ZNSA 4F1UA 2BJIA 4OVPA 1IMBA 5CMKA 4U4SA 4PFWA 1D9QA 4N17A 1MXVA 3K4UA 4YKKA 2OK2A 4G68B 1MQIA 4QSCA 3TPAA 3MZBA 1MPCA 2OWTA 5DYHA 3OMBA 3RGYA 1OMPA 1QUIA 4RNSA 4GXAA 4HTGA 1Y1MA 4PFBA 1D4NA 4DCXA 2DWAA 4C0RA 4X1DA 1SW1A 4GLIA 3GYYA 1BKAA 1QGXA 4EF2A 5I2NA 1N84A 3NOHA 4G77A 4PF8A 4Z0IA 3VVEA 2Y7WA 3FV1A 2QFLA 2QPQA 3LUZA 3DP4A 1EZ9A 4TQUQ 2OWZA 3MBPA 5IGAA 2F3DA 3V89B 3IOTA 1NUYA 3O6GA 2D3IA 2B4MA 4I62A 1FTAA 3OENA 5DEXA 1NUXA 3A09A 4R9FA 1CNQA 5DVIA 4PDDA 4NEDA 1QKAA 1B7HA 3PMWA 4XKQA 1MPBA 3K0VA 3SKPA 2GFEA 3HO7A 1URGA 4H67A 5BUUA 4ZECA 4NN3A 5IZ3A 1LSTA 4NHBA 3MYUA 3UORA 2Q74A 1UIVA 1WODA 4PFUA 2V4CA 1JW4A 2I4BA 1DBZA 4TLLB 3T93B 1Z7ME 1S7YA 4P1LA 4OEVA 3LV0A 1H76A 3PPPA 4GFRA 2F34A 4EXKA 1ANFA 1AIVA 3WAEA 4MEVA 1FTJA 1ZIUA 5I7IA 1NNTA 2FHYA 3USDA 4RK2A 4RPNA 4IO4A 4BDLA 5EQ9A 2L5VA 4Q0CA 1KWHA 1MDQA 1B5HA 4XKNA 1MQJA 3E3KA 4HE0A 1MPDA 2M8CA 5AA2A 3RLFE 1B0LA 3VVDA 2WBDA 4F3BA 1JW5A 2O6AA 4YKIA 4N4UA 4WXJA 1L5TA 2VT5A 2CEYA 2HFBA 3IB0A 1NV5A 2QVVA 3MPKA 3PUZE 1VDWA 2PMSA 2KLFA 4XF5A 2CEXA 1S9TA 1NUZA 4MH5A 1CB6A 4C1TA 1NV3A 1ZJLA 1JEUA 4OMBA 4AB5A 3ZSFA 3FGSA 4QF9A 2Q8MA 1POTA 3T9HB 3IO6A 3IR1A 1MH4A 3U65A 1LFIA 5H8NB 5IZZA 2VPNA 4DZ1A 3Q26A 1LB8A 2XXVA 3R7XA 5IAIA 4O94A
chains in the Genus database with same CATH topology
4QSEA 1GTKA 4OTEA 1Q35A 4O3CA 3S9LC 4ELRA 5I59A 3RT8A 5AA1A 1F9BA 4G8MA 3O28A 5B70A 3T66A 1NH7A 4E0XA 1A8EA 4P11A 1B51A 4U2RA 1NNFA 2ABHA 3KG2A 3VDFA 2VP1A 1Y3QA 3BKIB 3RQTA 2H99A 2XXHA 3A3CA 1M5CA 5H8FA 1H45A 4M1VA 3M8UA 3FVNA 1UQWA 3MVWA 4LUBA 1HSEA 5CBSA 3G3JA 2PBWA 4KYSA 3VE1B 2YJPA 2XXXA 4DIGA 5AA4B 1DMBA 4XKRA 1BP5A 1N0TA 4LZ8A 2VGQA 3H6WA 2OJTA 1JVXA 5ICTA 3K6XA 4JWXA 4LQ5A 1T0KA 1ZTYA 2H5YA 1MQDA 1YCJA 3OD7A 1H44A 4C1UA 3EHSA 4U22A 1PC3A 3IORA 2XXYA 2ONKE 4XKPA 4QFPA 1SYIA 1A7LA 3DP6A 4DE8A 4LONB 3K6VA 4IO2A 1SW5A 1ZLQA 2XX8A 3TEPA 4R73A 4H6DA 2XD3A 3LSFB 1GR2A 3FJ7A 3MC2A 3QAXA 4WEDA 3H4ZA 1FQFA 4OXVA 5L9OA 4LQ2A 1MQGA 4BDNA 3PD8A 5TU0A 2A5TB 4E0WA 2XX9A 5HM4B 4OYVA 3CG3A 5K2XA 1XVYA 3BFTA 3T9VA 2HCAA 2P0SA 3MP1A 4X9TA 1B46A 4LP2B 4R6YA 5I2KA 3TFLA 1JW1A 3U8QA 4IO7A 4NF6A 3L6GA 4BDRA 2XX7A 3VLWA 3RNNA 3RY3A 4GD5A 4ZDMA 4L17A 3FATA 3EQ1A 1LFGA 3THIA 2V93A 1LLSA 1B4HA 1YPNA 3K6UA 2I3VA 1Y9UA 4GL0A 2NOOA 1MXUA 5TPAB 2HQ0A 1M5EA 1URDA 3IOUA 4OESA 1MXZA 1IXIA 2NXOA 4FEDA 4EXLA 5FTIA 4GVOA 2GH9A 2VD2A 1I69A 5FHMA 1MY0A 2XXQA 4KCCA 2B65A 3MVZA 1MY3A 4QHQA 4PQJA 1LAXA 3KFMA 1IITA 3E13X 3RPWA 2DWJA 1LBCA 4R6KA 1R1NA 1DTZA 1EH3A 1A55A 2Z23A 1GVCA 3PGFA 4OERA 5K2YA 4DLDA 3W9VA 1O63A 4PP0A 2Z8EA 3C9HA 3QSLA 1UTBB 2F78A 1SQYA 2RKMA 2ZYKA 3U72A 3Q29A 2V3UA 3VXBA 5ITOA 3QK6A 2ESNA 1VR5A 4KYDA 2Y7IA 1IXHA 1RYXA 4RY1A 2QS4A 2LAOA 2REGA 2Q89A 4GXSB 1PBQA 2DP8A 3S9MC 1ZU0A 4YICA 3FZVA 2F7BA 3C32A 4ELPA 3VXCA 1POY1 1II5A 5I56A 2R6GE 1DPEA 3P7IA 4YB5A 3HPIA 4EDPA 1XT8A 1MXYA 4F22A 1A99A 5BWJA 4H5GA 3TTKA 2O7UA 5IKBA 2F5XA 4F3PA 1EZOA 1DPPA 2UVHA 1OLAA 3LSXA 4NF8B 4QFNA 5KCJA 3I3VA 2XHDA 2OCUA 2OBGA 2OZZA 1QUJA 3GZGA 4Q5TA 3CR9A 3G3KA 3LR1A 3TCHA 2RC7A 2AIXA 4MLVA 1D9VA 3AXFA 3UK4A 5I57B 2P1SA 1MH3A 4KHZE 4EQBA 4Z7EA 4BDQA 5JTYA 1O7TA 1IIWA 1B3EA 2XXWA 3U92A 4NF4A 2R71A 2UXAA 2H25A 4KI0E 1B3FA 2DE4A 1LGBC 3IB2A 3OOAA 4ZEFA 4R74A 4POWA 1NH8A 2QMXA 3KJ7A 2QS3A 4YMBA 1PDAA 1XVXA 4U4XA 2REJA 4R6HA 3FUZA 5TP9A 3R6UA 3VLUA 1NNPA 3RTWB 1RYOA 1CE2A 4ZEKA 4HW8A 4I9DA 5I2NB 3IX1A 1IXGA 5L8DA 3FJGA 4F1VA 4XIGQ 5F1QA 4POXA 5L9SA 3MQ9A 4G8NA 4OENA 2AL5A 5H8QA 5M2VA 3LSLA 3LC8A 2CZLA 1XC1A 2I3WA 2B3BA 3TTLA 5KZTA 1JQFA 3IOVA 4HCYA 3CFZA 3TKDA 3K1NA 4F19A 4GWOA 4X1BA 3N6TA 5DEXB 3SEUA 5EHMA 2ZMBA 3S9EA 4TLMB 5DVJA 3D4GA 2I49A 3TTRA 4IY6A 2DS9A 1US5A 2Z22A 2DQVA 3DLNA 1PB8A 1WVJA 1XS5A 4ZEBA 4IO6A 3KN8A 1USYE 4UA8A 3MPLA 1JVYA 4YZZA 2XD2A 1P1UA 3V8XB 1QULA 3ECRA 1AMFA 4Q30B 4LATA 3O6IA 4H65A 2HAUA 2A5SA 3A3UA 1N04A 5FHNA 3M3FA 3T9UA 1O64A 3LSWA 4F1YA 2Q2CA 3G3IA 1FQCA 1SI0A 5AA2B 3O66A 1B32A 2GHBA 4RJZA 4K3FA 2VOZA 3LUYA 4PE5B 1I6QA 3JV9A 3SESA 1US4A 5CM6A 2QS1A 5HPQA 4LA9A 5LOMA 1N3WA 2Y7PA 4RA1A 2X7QA 1OLCA 3QIMA 1BIYA 4N07A 4MFIA 1IXCA 4ELQA 4QFLA 1QW0A 5CC2A 3IL1B 2UVJA 3KGCA 4R72A 2RF1A 5EYFA 3TMGA 4DXBA 2XXTA 3T22A 4F3SA 4JSDA 1Y1ZA 4JWYA 4U23A 1YTVA 1SW4A 1Y20A 2UYFA 4F2OA 2ALUA 1DOTA 1IQ7A 3U93A 2Y7KA 2I6EA 3K01A 4NF5A 4NMYA 3PU5A 5I59B 3U94A 3K1MA 1LAGE 3K1PA 4OQOA 1SVXB 2UVGA 3KEIA 3TQWA 4JSOA 4OHNA 3V5AA 4DCYA 4ZZAA 2Y84A 2VHAA 2G29A 1Y3NA 1SI1A 2V84A 2F6GA 3B6WA 5FHOA 5I58A 3E4RA 2ZYNA 1I6BA 1JEVA 3FXRA 1OVTA 3KOTA 4PFTA 2DWHA 2V25A 5H8FB 4ZEDA 3CSBA 4GIZA 1B2HA 3IJXB 1HSLA 4O3AA 2PX1A 2O84X 3ZKLA 3I6VA 3HN0A 1MS7A 2PT2A 3HSTA 4IB2A 3TTMA 4EF1A 4FECA 2D5WA 2H9BA 4FE8A 1MY2A 1B1XA 2Z8FA 4GOTA 1B4ZA 2QRYA 5CBRA 2RC8A 4GRKA 1D3KA 3FVGA 2GHAA 3CFXA 2AYSA 1EU8A 3HHFA 2B3FA 4OFLA 4YU0A 3H03A 4NE4A 1B58A 3LBSA 5ELVA 4QSDA 3PD9A 2O69A 1ZMGA 5JK4A 4AQ4A 3C34A 1LAFE 3IO4A 1D9YA 3TTNA 3G3HA 3B6QA 2G93A 4I1DA 3GXAA 1MXXA 4YKPA 3K2DA 1P99A 5L9MA 3L6HA 5KDTA 2Z8DA 3UGWA 3G3GA 3O9PA 3OELA 4IGRA 5I84A 5A5XA 3SEWA 2F7AA 1PBPA 3KSXA 3S2VA 2NVUB 2YLNA 4WKMA 1LCFA 3C4MA 4IGTA 1S50A 2F6PA 1P1NA 3UIFA 5I2KB 4ZZEA 3MP6A 2NWJA 3SEXA 4NF6B 3IOWA 2CMOA 2I58A 3TUSA 2X7PA 1EZPA 1DSNA 3F11A 4MLQA 1UTHA 1GGGA 3KZGA 3FVKA 2XXRA 4OEUA 4GF8A 2QS2A 3QUJA 1VSOA 4BLAA 4G8HA 2ZNUA 3T96B 3PPQA 3ILTB 4FIMA 4U1OA 1MRPA 2D21A 1FQEA 3I5OA 4G68A 3OEMA 3BFUA 5ISUA 1JNFA 1USYH 4F29A 3TELA 1PB9A 2HXWA 2E1SA 2HZKA 2FYIA 4YMAA 2DE3A 2DE2A 1RKMA 1SYHA 1NMUA 3CIJA 2Y7RA 3VVFA 5JEIA 1AOVA 4H1XA 5AA2D 3GBAA 3KN3A 1LAHE 2DVCA 4JB7A 4PFYA 3U1OA 1B05A 4ESWA 1P1QA 2VD3A 1NNKA 4KYEA 1QUKA 3JYRA 2BJJX 1R9LA 1XHYA 1YAEA 3O6HA 3KOSA 1B52A 4LZ7A 3CSGA 1OIBA 3FV2A 1J1NA 2QSXA 1LBBA 3JZJA 3TCFA 3H3GA 1MG1A 3HHGA 2F36A 3ILUB 3EPEA 4GQOA 1B5JA 2DXYA 1MDP1 4R2FA 1IEJA 4NWCA 1WDNA 1FTKA 3C36A 5ICQA 1TWYA 1VFDA 4R9GA 1Z7NE 3PUXE 1FQDA 1QVSA 1P1OA 1A54A 3M3KA 1PEBA 5I56B 1VE4A 3IK6B 4QFKA 4YB7A 2Q8JA 2IA4A 1GV8A 2ZNTA 3S9NC 3D4CA 2OLBA 2XXIA 4FEBA 2PYYA 4HCWA 3V83A 2DOJA 3FIRA 1AL3A 5H8SA 4F2QA 3SDFA 4RYAA 3SEVA 4F39A 1MY1A 4R75A 4H0WA 3OSQA 3PUVE 3PPNA 3E9XA 5J1DA 3PMXA 5KCJB 4G68C 3H6VA 1MM7A 1MQHA 2V3QA 4RK9A 5B7DA 4EQ7A 2RCAA 1I6AA 3RN8A 4YKJA 3RTFB 4I8CA 2AL4A 4KD5A 3PPRA 4DDDA 5DTBA 5CMBA 3EHUA 1TT1A 2DYXA 4TOZA 3RUMA 1B7ZA 2O7IA 5JTYB 1FQAA 4JWOA 5F7VA 3FXUA 1XOCA 4O3BA 4XTCQ 1M5DA 4NF4B 1B0HA 1TXFA 2ZXTA 3ODBA 4JDFA 3S4UA 3TZAA 4XXUA 4G2ZA 3FXQA 2DSFA 3PPOA 3DELB 5H8NA 3MP8A 3KBRA 1FTLA 4FATA 3CFLA 5TP9B 3DM0A 1N3XA 1R6ZA 2Q9TA 3Q28A 2F7CA 3CI8A 1OQGA 1NFTA 4OFOA 3VV5A 2F97A 3T9XB 2FNCA 3QXMA 2QL3A 2Q88A 5H8QB 3PV0E 1BTJA 1DTGA 1MY4A 1SDXA 3N94A 3SETA 4KPTA 3W9WA 2WKYA 3CG1A 2ZYMA 3R26A 4ISUA 1B7UA 5CMCA 5ITPA 2O1LA 4G4PA 1NKXA 1TFDA 3UP9A 3H7MA 3N26A 1B40A 3EF7A 3Q25A 3OEKA 1Y4TA 4LZ5A 1ZBMA 4BDMA 3H6TA 3SEYA 1LB9A 3MZ9A 3KJTA 4QFOA 4P0IA 2RINA 3KSJA 3MAMA 4ZE9A 4EUOA 1Y3PA 2ZYOA 3FVOA 3N5LA 2W7YA 4RXLA 5CRYA 3MWBA 4Q8RA 4QRZA 3EN3A 2HEUA 5HBCA 5AA4A 2E0SA 1AH5A 1ELJA 3C31A 3G7WA 1LCTA 1FW0A 1URSA 3O29A 4U1ZA 4ONYA 2UYEA 1A40A 2RCBA 4BDOA 4JBZA 4H8IA 4FORA 3MZ1A 1HSJA 1MXWA 3G3FA 3QYTA 3HV1A 4H5FA 3ZKKA 5AE4A 4MBPA 2IEEA 4IY5A 3BBRA 4ZS9A 1Y4CA 4KR5A 3ZS6A 4OWDA 2V3TA 2QJEA 5AA3A 4F3GA 4OZ9A 1PB7A 2FA7A 3TAJA 4YB6A 3B7DA 4KFQA 1N7XA 3OXNA 4EQ9A 3FJMA 2NUVA 5CI5A 4RPOA 2I0CA 3OO7A 3H6UA 3K6WA 1VFEA 5FTHA 4KQPA 2DWIA 1NL5A 1B5IA 3B6TA 2HAVA 2A5TA 3SERA 4DXUA 3O2AA 3FD3A 2F35A 4NWDA 1B1HA 5DT6A 2O68A 3O97A 3TCGA 1M5FA 2PT1A 4UACA 4DXCA 3UN6A 2O51A 1SW2A 1FQBA 4PETA 4NF5B 2ANJA 3VFJA 3GLBA 2F8DA 1TFAA 3CRBA 1IZ1A 2GRVA 5H8HA 2QMWA 3IJOB 4MF3A 5TPAA 1B3HA 2I4CA 4GL8A 4ND9A 5I58B 1IUDA 3VLVA 2I48A 4N13A 2RC9A 1H3DA 2DVZA 3C35A 1LFHA 4ZE8A 4P0GA 1OVBA 2XXUA 1FCKA 1N76A 3RT6B 1P1WA 1B9JA 3OO6A 3OO9A 1ATGA 1QJMA 2DXRA 4THIA 5DVFA 3Q27A 3DP8A 4ESXA 2R9JA 2THIA 2ONSA 4R2BA 1QKBA 2OWSA 1A8FA 3H06B 3MW0A 3QUFA 3ONMA 3TYHA 1SD3A 3TODA 4AB6A 3PMVA 3C33A 4IO5A 3UA8A 3OO8A 1H43A 1UIUA 1UTBA 4YAHX 3TDJA 3MUQA 4OFJA 5H8HB 4ELOA 3PUYE 3N6UA 1B6HA 2PVUA 2I0BA 4N6PA 2O1MA 1OQHA 2P2AA 2H98A 4F31B 4HS7A 4H8JA 3EHTA 4IO3A 1ZKBA 3CVGA 1MM6A 3FASA 2HZLA 1FTMA 4KCDA 4WEPA 3TQLA 3GBBA 1FTOA 2Q2AA 1N7WA 1BLFA 3MVYA 3WAFA 3PUWE 3IB1A 4FAJA 1B3LA 4ECFA 4M4GA 1Q1KA 4JXIA 2UVIA 5KDTB 3HCQA 5EHSA 1JETA 4U21A 5A5XB 3MJNA 3MVXA 1B3GA 4NF8A 3K02A 1M5BA 4F18A 3KN7A 1SBPA 4ZEIA 2YPNA 3IAZA 4NTLA 2ONRA 5CMMA 1R9QA 3M3LA 4OVJA 2XXPA 4LVQA 4FJPA 3W15C 3OSRA 1UTHB 5I57A 2H4IA 4X48A 4OETA 2X26A 3K00A 2ZNSA 4F1UA 5CMKA 4U4SA 4PFWA 1MXVA 3K4UA 4YKKA 2OK2A 4G68B 1MQIA 4QSCA 3TPAA 3MZBA 1MPCA 2OWTA 5DYHA 3OMBA 3RGYA 1OMPA 1QUIA 4RNSA 4GXAA 4HTGA 1Y1MA 1D4NA 4DCXA 2DWAA 4C0RA 4X1DA 1SW1A 4GLIA 1BKAA 4EF2A 5I2NA 1N84A 4G77A 4Z0IA 3VVEA 2Y7WA 3FV1A 2QPQA 3DP4A 1EZ9A 4TQUQ 3MBPA 3V89B 3IOTA 3O6GA 2D3IA 4I62A 3OENA 5DEXA 3A09A 4R9FA 5DVIA 4NEDA 1QKAA 1B7HA 3PMWA 4XKQA 1MPBA 3K0VA 3SKPA 2GFEA 3HO7A 1URGA 4H67A 5BUUA 4ZECA 1LSTA 3UORA 1UIVA 1WODA 4PFUA 1JW4A 2I4BA 4TLLB 3T93B 1Z7ME 1S7YA 4OEVA 1H76A 3PPPA 4GFRA 2F34A 4EXKA 1ANFA 1AIVA 3WAEA 1FTJA 1ZIUA 1NNTA 3USDA 4RK2A 4RPNA 4IO4A 4BDLA 4Q0CA 1KWHA 1MDQA 1B5HA 4XKNA 1MQJA 3E3KA 1MPDA 2M8CA 5AA2A 3RLFE 1B0LA 3VVDA 4F3BA 1JW5A 2O6AA 4YKIA 4WXJA 1L5TA 2HFBA 3IB0A 3PUZE 3MPKA 2PMSA 2KLFA 1S9TA 4MH5A 1CB6A 4C1TA 1ZJLA 1JEUA 4OMBA 4AB5A 3ZSFA 3FGSA 4QF9A 1POTA 3T9HB 3IO6A 3IR1A 1MH4A 1LFIA 5H8NB 4DZ1A 3Q26A 1LB8A 2XXVA 3R7XA 5IAIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4QSE A;  1GTK A;  4OTE A;  1Q35 A;  4O3C A;  3S9L C;  4ELR A;  5I59 A;  3RT8 A;  5AA1 A;  1F9B A;  4G8M A;  3O28 A;  5B70 A;  3T66 A;  1NH7 A;  4E0X A;  1A8E A;  4P11 A;  1B51 A;  4U2R A;  1NNF A;  2ABH A;  3KG2 A;  3VDF A;  2VP1 A;  1Y3Q A;  3BKI B;  3RQT A;  2H99 A;  2XXH A;  3A3C A;  1M5C A;  5H8F A;  1H45 A;  4M1V A;  3M8U A;  3FVN A;  1UQW A;  3MVW A;  4LUB A;  1HSE A;  5CBS A;  3G3J A;  2PBW A;  4KYS A;  3VE1 B;  2YJP A;  2XXX A;  4DIG A;  5AA4 B;  1DMB A;  4XKR A;  1BP5 A;  1N0T A;  4LZ8 A;  2VGQ A;  3H6W A;  2OJT A;  1JVX A;  5ICT A;  3K6X A;  4JWX A;  4LQ5 A;  1T0K A;  1ZTY A;  2H5Y A;  1MQD A;  1YCJ A;  3OD7 A;  1H44 A;  4C1U A;  3EHS A;  4U22 A;  1PC3 A;  3IOR A;  2XXY A;  2ONK E;  4XKP A;  4QFP A;  1SYI A;  1A7L A;  3DP6 A;  4DE8 A;  4LON B;  3K6V A;  4IO2 A;  1SW5 A;  1ZLQ A;  2XX8 A;  3TEP A;  4R73 A;  4H6D A;  2XD3 A;  3LSF B;  1GR2 A;  3FJ7 A;  3MC2 A;  3QAX A;  4WED A;  3H4Z A;  1FQF A;  4OXV A;  5L9O A;  4LQ2 A;  1MQG A;  4BDN A;  3PD8 A;  5TU0 A;  2A5T B;  4E0W A;  2XX9 A;  5HM4 B;  4OYV A;  3CG3 A;  5K2X A;  1XVY A;  3BFT A;  3T9V A;  2HCA A;  2P0S A;  3MP1 A;  4X9T A;  1B46 A;  4LP2 B;  4R6Y A;  5I2K A;  3TFL A;  1JW1 A;  3U8Q A;  4IO7 A;  4NF6 A;  3L6G A;  4BDR A;  2XX7 A;  3VLW A;  3RNN A;  3RY3 A;  4GD5 A;  4ZDM A;  4L17 A;  3FAT A;  3EQ1 A;  1LFG A;  3THI A;  2V93 A;  1LLS A;  1B4H A;  1YPN A;  3K6U A;  2I3V A;  1Y9U A;  4GL0 A;  2NOO A;  1MXU A;  5TPA B;  2HQ0 A;  1M5E A;  1URD A;  3IOU A;  4OES A;  1MXZ A;  1IXI A;  2NXO A;  4FED A;  4EXL A;  5FTI A;  4GVO A;  2GH9 A;  2VD2 A;  1I69 A;  5FHM A;  1MY0 A;  2XXQ A;  4KCC A;  2B65 A;  3MVZ A;  1MY3 A;  4QHQ A;  4PQJ A;  1LAX A;  3KFM A;  1IIT A;  3E13 X;  3RPW A;  2DWJ A;  1LBC A;  4R6K A;  1R1N A;  1DTZ A;  1EH3 A;  1A55 A;  2Z23 A;  1GVC A;  3PGF A;  4OER A;  5K2Y A;  4DLD A;  3W9V A;  1O63 A;  4PP0 A;  2Z8E A;  3C9H A;  3QSL A;  1UTB B;  2F78 A;  1SQY A;  2RKM A;  2ZYK A;  3U72 A;  3Q29 A;  2V3U A;  3VXB A;  5ITO A;  3QK6 A;  2ESN A;  1VR5 A;  4KYD A;  2Y7I A;  1IXH A;  1RYX A;  4RY1 A;  2QS4 A;  2LAO A;  2REG A;  2Q89 A;  4GXS B;  1PBQ A;  2DP8 A;  3S9M C;  1ZU0 A;  4YIC A;  3FZV A;  2F7B A;  3C32 A;  4ELP A;  3VXC A;  1POY 1;  1II5 A;  5I56 A;  2R6G E;  1DPE A;  3P7I A;  4YB5 A;  3HPI A;  4EDP A;  1XT8 A;  1MXY A;  4F22 A;  1A99 A;  5BWJ A;  4H5G A;  3TTK A;  2O7U A;  5IKB A;  2F5X A;  4F3P A;  1EZO A;  1DPP A;  2UVH A;  1OLA A;  3LSX A;  4NF8 B;  4QFN A;  5KCJ A;  3I3V A;  2XHD A;  2OCU A;  2OBG A;  2OZZ A;  1QUJ A;  3GZG A;  4Q5T A;  3CR9 A;  3G3K A;  3LR1 A;  3TCH A;  2RC7 A;  2AIX A;  4MLV A;  1D9V A;  3AXF A;  3UK4 A;  5I57 B;  2P1S A;  1MH3 A;  4KHZ E;  4EQB A;  4Z7E A;  4BDQ A;  5JTY A;  1O7T A;  1IIW A;  1B3E A;  2XXW A;  3U92 A;  4NF4 A;  2R71 A;  2UXA A;  2H25 A;  4KI0 E;  1B3F A;  2DE4 A;  1LGB C;  3IB2 A;  3OOA A;  4ZEF A;  4R74 A;  4POW A;  1NH8 A;  2QMX A;  3KJ7 A;  2QS3 A;  4YMB A;  1PDA A;  1XVX A;  4U4X A;  2REJ A;  4R6H A;  3FUZ A;  5TP9 A;  3R6U A;  3VLU A;  1NNP A;  3RTW B;  1RYO A;  1CE2 A;  4ZEK A;  4HW8 A;  4I9D A;  5I2N B;  3IX1 A;  1IXG A;  5L8D A;  3FJG A;  4F1V A;  4XIG Q;  5F1Q A;  4POX A;  5L9S A;  3MQ9 A;  4G8N A;  4OEN A;  2AL5 A;  5H8Q A;  5M2V A;  3LSL A;  3LC8 A;  2CZL A;  1XC1 A;  2I3W A;  2B3B A;  3TTL A;  5KZT A;  1JQF A;  3IOV A;  4HCY A;  3CFZ A;  3TKD A;  3K1N A;  4F19 A;  4GWO A;  4X1B A;  3N6T A;  5DEX B;  3SEU A;  5EHM A;  2ZMB A;  3S9E A;  4TLM B;  5DVJ A;  3D4G A;  2I49 A;  3TTR A;  4IY6 A;  2DS9 A;  1US5 A;  2Z22 A;  2DQV A;  3DLN A;  1PB8 A;  1WVJ A;  1XS5 A;  4ZEB A;  4IO6 A;  3KN8 A;  1USY E;  4UA8 A;  3MPL A;  1JVY A;  4YZZ A;  2XD2 A;  1P1U A;  3V8X B;  1QUL A;  3ECR A;  1AMF A;  4Q30 B;  4LAT A;  3O6I A;  4H65 A;  2HAU A;  2A5S A;  3A3U A;  1N04 A;  5FHN A;  3M3F A;  3T9U A;  1O64 A;  3LSW A;  4F1Y A;  2Q2C A;  3G3I A;  1FQC A;  1SI0 A;  5AA2 B;  3O66 A;  1B32 A;  2GHB A;  4RJZ A;  4K3F A;  2VOZ A;  3LUY A;  4PE5 B;  1I6Q A;  3JV9 A;  3SES A;  1US4 A;  5CM6 A;  2QS1 A;  5HPQ A;  4LA9 A;  5LOM A;  1N3W A;  2Y7P A;  4RA1 A;  2X7Q A;  1OLC A;  3QIM A;  1BIY A;  4N07 A;  4MFI A;  1IXC A;  4ELQ A;  4QFL A;  1QW0 A;  5CC2 A;  3IL1 B;  2UVJ A;  3KGC A;  4R72 A;  2RF1 A;  5EYF A;  3TMG A;  4DXB A;  2XXT A;  3T22 A;  4F3S A;  4JSD A;  1Y1Z A;  4JWY A;  4U23 A;  1YTV A;  1SW4 A;  1Y20 A;  2UYF A;  4F2O A;  2ALU A;  1DOT A;  1IQ7 A;  3U93 A;  2Y7K A;  2I6E A;  3K01 A;  4NF5 A;  4NMY A;  3PU5 A;  5I59 B;  3U94 A;  3K1M A;  1LAG E;  3K1P A;  4OQO A;  1SVX B;  2UVG A;  3KEI A;  3TQW A;  4JSO A;  4OHN A;  3V5A A;  4DCY A;  4ZZA A;  2Y84 A;  2VHA A;  2G29 A;  1Y3N A;  1SI1 A;  2V84 A;  2F6G A;  3B6W A;  5FHO A;  5I58 A;  3E4R A;  2ZYN A;  1I6B A;  1JEV A;  3FXR A;  1OVT A;  3KOT A;  4PFT A;  2DWH A;  2V25 A;  5H8F B;  4ZED A;  3CSB A;  4GIZ A;  1B2H A;  3IJX B;  1HSL A;  4O3A A;  2PX1 A;  2O84 X;  3ZKL A;  3I6V A;  3HN0 A;  1MS7 A;  2PT2 A;  3HST A;  4IB2 A;  3TTM A;  4EF1 A;  4FEC A;  2D5W A;  2H9B A;  4FE8 A;  1MY2 A;  1B1X A;  2Z8F A;  4GOT A;  1B4Z A;  2QRY A;  5CBR A;  2RC8 A;  4GRK A;  1D3K A;  3FVG A;  2GHA A;  3CFX A;  2AYS A;  1EU8 A;  3HHF A;  2B3F A;  4OFL A;  4YU0 A;  3H03 A;  4NE4 A;  1B58 A;  3LBS A;  5ELV A;  4QSD A;  3PD9 A;  2O69 A;  1ZMG A;  5JK4 A;  4AQ4 A;  3C34 A;  1LAF E;  3IO4 A;  1D9Y A;  3TTN A;  3G3H A;  3B6Q A;  2G93 A;  4I1D A;  3GXA A;  1MXX A;  4YKP A;  3K2D A;  1P99 A;  5L9M A;  3L6H A;  5KDT A;  2Z8D A;  3UGW A;  3G3G A;  3O9P A;  3OEL A;  4IGR A;  5I84 A;  5A5X A;  3SEW A;  2F7A A;  1PBP A;  3KSX A;  3S2V A;  2NVU B;  2YLN A;  4WKM A;  1LCF A;  3C4M A;  4IGT A;  1S50 A;  2F6P A;  1P1N A;  3UIF A;  5I2K B;  4ZZE A;  3MP6 A;  2NWJ A;  3SEX A;  4NF6 B;  3IOW A;  2CMO A;  2I58 A;  3TUS A;  2X7P A;  1EZP A;  1DSN A;  3F11 A;  4MLQ A;  1UTH A;  1GGG A;  3KZG A;  3FVK A;  2XXR A;  4OEU A;  4GF8 A;  2QS2 A;  3QUJ A;  1VSO A;  4BLA A;  4G8H A;  2ZNU A;  3T96 B;  3PPQ A;  3ILT B;  4FIM A;  4U1O A;  1MRP A;  2D21 A;  1FQE A;  3I5O A;  4G68 A;  3OEM A;  3BFU A;  5ISU A;  1JNF A;  1USY H;  4F29 A;  3TEL A;  1PB9 A;  2HXW A;  2E1S A;  2HZK A;  2FYI A;  4YMA A;  2DE3 A;  2DE2 A;  1RKM A;  1SYH A;  1NMU A;  3CIJ A;  2Y7R A;  3VVF A;  5JEI A;  1AOV A;  4H1X A;  5AA2 D;  3GBA A;  3KN3 A;  1LAH E;  2DVC A;  4JB7 A;  4PFY A;  3U1O A;  1B05 A;  4ESW A;  1P1Q A;  2VD3 A;  1NNK A;  4KYE A;  1QUK A;  3JYR A;  2BJJ X;  1R9L A;  1XHY A;  1YAE A;  3O6H A;  3KOS A;  1B52 A;  4LZ7 A;  3CSG A;  1OIB A;  3FV2 A;  1J1N A;  2QSX A;  1LBB A;  3JZJ A;  3TCF A;  3H3G A;  1MG1 A;  3HHG A;  2F36 A;  3ILU B;  3EPE A;  4GQO A;  1B5J A;  2DXY A;  1MDP 1;  4R2F A;  1IEJ A;  4NWC A;  1WDN A;  1FTK A;  3C36 A;  5ICQ A;  1TWY A;  1VFD A;  4R9G A;  1Z7N E;  3PUX E;  1FQD A;  1QVS A;  1P1O A;  1A54 A;  3M3K A;  1PEB A;  5I56 B;  1VE4 A;  3IK6 B;  4QFK A;  4YB7 A;  2Q8J A;  2IA4 A;  1GV8 A;  2ZNT A;  3S9N C;  3D4C A;  2OLB A;  2XXI A;  4FEB A;  2PYY A;  4HCW A;  3V83 A;  2DOJ A;  3FIR A;  1AL3 A;  5H8S A;  4F2Q A;  3SDF A;  4RYA A;  3SEV A;  4F39 A;  1MY1 A;  4R75 A;  4H0W A;  3OSQ A;  3PUV E;  3PPN A;  3E9X A;  5J1D A;  3PMX A;  5KCJ B;  4G68 C;  3H6V A;  1MM7 A;  1MQH A;  2V3Q A;  4RK9 A;  5B7D A;  4EQ7 A;  2RCA A;  1I6A A;  3RN8 A;  4YKJ A;  3RTF B;  4I8C A;  2AL4 A;  4KD5 A;  3PPR A;  4DDD A;  5DTB A;  5CMB A;  3EHU A;  1TT1 A;  2DYX A;  4TOZ A;  3RUM A;  1B7Z A;  2O7I A;  5JTY B;  1FQA A;  4JWO A;  5F7V A;  3FXU A;  1XOC A;  4O3B A;  4XTC Q;  1M5D A;  4NF4 B;  1B0H A;  1TXF A;  2ZXT A;  3ODB A;  4JDF A;  3S4U A;  3TZA A;  4XXU A;  4G2Z A;  3FXQ A;  2DSF A;  3PPO A;  3DEL B;  5H8N A;  3MP8 A;  3KBR A;  1FTL A;  4FAT A;  3CFL A;  5TP9 B;  3DM0 A;  1N3X A;  1R6Z A;  2Q9T A;  3Q28 A;  2F7C A;  3CI8 A;  1OQG A;  1NFT A;  4OFO A;  3VV5 A;  2F97 A;  3T9X B;  2FNC A;  3QXM A;  2QL3 A;  2Q88 A;  5H8Q B;  3PV0 E;  1BTJ A;  1DTG A;  1MY4 A;  1SDX A;  3N94 A;  3SET A;  4KPT A;  3W9W A;  2WKY A;  3CG1 A;  2ZYM A;  3R26 A;  4ISU A;  1B7U A;  5CMC A;  5ITP A;  2O1L A;  4G4P A;  1NKX A;  1TFD A;  3UP9 A;  3H7M A;  3N26 A;  1B40 A;  3EF7 A;  3Q25 A;  3OEK A;  1Y4T A;  4LZ5 A;  1ZBM A;  4BDM A;  3H6T A;  3SEY A;  1LB9 A;  3MZ9 A;  3KJT A;  4QFO A;  4P0I A;  2RIN A;  3KSJ A;  3MAM A;  4ZE9 A;  4EUO A;  1Y3P A;  2ZYO A;  3FVO A;  3N5L A;  2W7Y A;  4RXL A;  5CRY A;  3MWB A;  4Q8R A;  4QRZ A;  3EN3 A;  2HEU A;  5HBC A;  5AA4 A;  2E0S A;  1AH5 A;  1ELJ A;  3C31 A;  3G7W A;  1LCT A;  1FW0 A;  1URS A;  3O29 A;  4U1Z A;  4ONY A;  2UYE A;  1A40 A;  2RCB A;  4BDO A;  4JBZ A;  4H8I A;  4FOR A;  3MZ1 A;  1HSJ A;  1MXW A;  3G3F A;  3QYT A;  3HV1 A;  4H5F A;  3ZKK A;  5AE4 A;  4MBP A;  2IEE A;  4IY5 A;  3BBR A;  4ZS9 A;  1Y4C A;  4KR5 A;  3ZS6 A;  4OWD A;  2V3T A;  2QJE A;  5AA3 A;  4F3G A;  4OZ9 A;  1PB7 A;  2FA7 A;  3TAJ A;  4YB6 A;  3B7D A;  4KFQ A;  1N7X A;  3OXN A;  4EQ9 A;  3FJM A;  2NUV A;  5CI5 A;  4RPO A;  2I0C A;  3OO7 A;  3H6U A;  3K6W A;  1VFE A;  5FTH A;  4KQP A;  2DWI A;  1NL5 A;  1B5I A;  3B6T A;  2HAV A;  2A5T A;  3SER A;  4DXU A;  3O2A A;  3FD3 A;  2F35 A;  4NWD A;  1B1H A;  5DT6 A;  2O68 A;  3O97 A;  3TCG A;  1M5F A;  2PT1 A;  4UAC A;  4DXC A;  3UN6 A;  2O51 A;  1SW2 A;  1FQB A;  4PET A;  4NF5 B;  2ANJ A;  3VFJ A;  3GLB A;  2F8D A;  1TFA A;  3CRB A;  1IZ1 A;  2GRV A;  5H8H A;  2QMW A;  3IJO B;  4MF3 A;  5TPA A;  1B3H A;  2I4C A;  4GL8 A;  4ND9 A;  5I58 B;  1IUD A;  3VLV A;  2I48 A;  4N13 A;  2RC9 A;  1H3D A;  2DVZ A;  3C35 A;  1LFH A;  4ZE8 A;  4P0G A;  1OVB A;  2XXU A;  1FCK A;  1N76 A;  3RT6 B;  1P1W A;  1B9J A;  3OO6 A;  3OO9 A;  1ATG A;  1QJM A;  2DXR A;  4THI A;  5DVF A;  3Q27 A;  3DP8 A;  4ESX A;  2R9J A;  2THI A;  2ONS A;  4R2B A;  1QKB A;  2OWS A;  1A8F A;  3H06 B;  3MW0 A;  3QUF A;  3ONM A;  3TYH A;  1SD3 A;  3TOD A;  4AB6 A;  3PMV A;  3C33 A;  4IO5 A;  3UA8 A;  3OO8 A;  1H43 A;  1UIU A;  1UTB A;  4YAH X;  3TDJ A;  3MUQ A;  4OFJ A;  5H8H B;  4ELO A;  3PUY E;  3N6U A;  1B6H A;  2PVU A;  2I0B A;  4N6P A;  2O1M A;  1OQH A;  2P2A A;  2H98 A;  4F31 B;  4HS7 A;  4H8J A;  3EHT A;  4IO3 A;  1ZKB A;  3CVG A;  1MM6 A;  3FAS A;  2HZL A;  1FTM A;  4KCD A;  4WEP A;  3TQL A;  3GBB A;  1FTO A;  2Q2A A;  1N7W A;  1BLF A;  3MVY A;  3WAF A;  3PUW E;  3IB1 A;  4FAJ A;  1B3L A;  4ECF A;  4M4G A;  1Q1K A;  4JXI A;  2UVI A;  5KDT B;  3HCQ A;  5EHS A;  1JET A;  4U21 A;  5A5X B;  3MJN A;  3MVX A;  1B3G A;  4NF8 A;  3K02 A;  1M5B A;  4F18 A;  3KN7 A;  1SBP A;  4ZEI A;  2YPN A;  3IAZ A;  4NTL A;  2ONR A;  5CMM A;  1R9Q A;  3M3L A;  4OVJ A;  2XXP A;  4LVQ A;  4FJP A;  3W15 C;  3OSR A;  1UTH B;  5I57 A;  2H4I A;  4X48 A;  4OET A;  2X26 A;  3K00 A;  2ZNS A;  4F1U A;  5CMK A;  4U4S A;  4PFW A;  1MXV A;  3K4U A;  4YKK A;  2OK2 A;  4G68 B;  1MQI A;  4QSC A;  3TPA A;  3MZB A;  1MPC A;  2OWT A;  5DYH A;  3OMB A;  3RGY A;  1OMP A;  1QUI A;  4RNS A;  4GXA A;  4HTG A;  1Y1M A;  1D4N A;  4DCX A;  2DWA A;  4C0R A;  4X1D A;  1SW1 A;  4GLI A;  1BKA A;  4EF2 A;  5I2N A;  1N84 A;  4G77 A;  4Z0I A;  3VVE A;  2Y7W A;  3FV1 A;  2QPQ A;  3DP4 A;  1EZ9 A;  4TQU Q;  3MBP A;  3V89 B;  3IOT A;  3O6G A;  2D3I A;  4I62 A;  3OEN A;  5DEX A;  3A09 A;  4R9F A;  5DVI A;  4NED A;  1QKA A;  1B7H A;  3PMW A;  4XKQ A;  1MPB A;  3K0V A;  3SKP A;  2GFE A;  3HO7 A;  1URG A;  4H67 A;  5BUU A;  4ZEC A;  1LST A;  3UOR A;  1UIV A;  1WOD A;  4PFU A;  1JW4 A;  2I4B A;  4TLL B;  3T93 B;  1Z7M E;  1S7Y A;  4OEV A;  1H76 A;  3PPP A;  4GFR A;  2F34 A;  4EXK A;  1ANF A;  1AIV A;  3WAE A;  1FTJ A;  1ZIU A;  1NNT A;  3USD A;  4RK2 A;  4RPN A;  4IO4 A;  4BDL A;  4Q0C A;  1KWH A;  1MDQ A;  1B5H A;  4XKN A;  1MQJ A;  3E3K A;  1MPD A;  2M8C A;  5AA2 A;  3RLF E;  1B0L A;  3VVD A;  4F3B A;  1JW5 A;  2O6A A;  4YKI A;  4WXJ A;  1L5T A;  2HFB A;  3IB0 A;  3PUZ E;  3MPK A;  2PMS A;  2KLF A;  1S9T A;  4MH5 A;  1CB6 A;  4C1T A;  1ZJL A;  1JEU A;  4OMB A;  4AB5 A;  3ZSF A;  3FGS A;  4QF9 A;  1POT A;  3T9H B;  3IO6 A;  3IR1 A;  1MH4 A;  1LFI A;  5H8N B;  4DZ1 A;  3Q26 A;  1LB8 A;  2XXV A;  3R7X A;  5IAI A; 
#chains in the Genus database with same CATH topology
 4QSE A;  1GTK A;  4OTE A;  1Q35 A;  4PGP A;  4O3C A;  3S9L C;  4ELR A;  5I59 A;  3RT8 A;  5AA1 A;  1F9B A;  4G8M A;  3O28 A;  5B70 A;  3T66 A;  1NH7 A;  4G61 A;  4E0X A;  1A8E A;  4P11 A;  1B51 A;  4U2R A;  1NV0 A;  1NNF A;  2ABH A;  5J16 A;  3KG2 A;  1FBE A;  3VDF A;  2VP1 A;  1Y3Q A;  4MHF A;  4NG7 A;  3BKI B;  3RQT A;  2H99 A;  2XXH A;  3A3C A;  1M5C A;  4GWY A;  5H8F A;  1H45 A;  4M1V A;  3M8U A;  3FVN A;  1NV6 A;  1UQW A;  3MVW A;  4LUB A;  1HSE A;  5CBS A;  2QVU A;  3G3J A;  2PBW A;  3KBZ A;  4KYS A;  3VE1 B;  2YJP A;  2XXX A;  2CZK A;  4DIG A;  5AA4 B;  1DMB A;  4XKR A;  1FPD A;  1BP5 A;  1N0T A;  2XWK A;  4LZ8 A;  2VGQ A;  3H6W A;  2OJT A;  1JVX A;  4AS5 A;  5ICT A;  3E79 A;  3K6X A;  4JWX A;  4LQ5 A;  1T0K A;  4I3Y A;  1ZTY A;  2H5Y A;  1MQD A;  1YCJ A;  3OD7 A;  1INP A;  1H44 A;  4C1U A;  3EHS A;  4U22 A;  1PC3 A;  3IOR A;  2XXY A;  2ONK E;  4XKP A;  4H46 A;  4QFP A;  1SYI A;  1A7L A;  3DP6 A;  4DE8 A;  4LON B;  3K6V A;  4IO2 A;  1SW5 A;  1ZLQ A;  2XX8 A;  4MAG A;  3TEP A;  4R73 A;  4H6D A;  2XD3 A;  3LSF B;  1GR2 A;  3FJ7 A;  3MC2 A;  4NX1 A;  4P9K A;  5DW8 A;  3QAX A;  4N8Y A;  4WED A;  3H4Z A;  1FQF A;  4OXV A;  5L9O A;  4LQ2 A;  1MQG A;  4BDN A;  3PD8 A;  5TU0 A;  2A5T B;  4E0W A;  2XX9 A;  5HM4 B;  4OYV A;  3CG3 A;  5K2X A;  1XVY A;  3BFT A;  3RPL A;  3T9V A;  2XWI A;  2HCA A;  2FVZ A;  2P0S A;  2XA5 A;  3MP1 A;  4X9T A;  1B46 A;  4LP2 B;  4R6Y A;  5I2K A;  3TFL A;  4XEQ A;  1JW1 A;  3U8Q A;  5I5P A;  4IO7 A;  4NF6 A;  3L6G A;  4BDR A;  2XX7 A;  3VLW A;  2CZH A;  4N81 A;  3RNN A;  3RY3 A;  4GD5 A;  4ZDM A;  4L17 A;  3FAT A;  3EQ1 A;  1LFG A;  3THI A;  2V93 A;  1LLS A;  1B4H A;  1YPN A;  3K6U A;  2I3V A;  2WBB A;  1Y9U A;  4GBW A;  4GL0 A;  2NOO A;  1MXU A;  5TPA B;  2HQ0 A;  1M5E A;  1URD A;  3IOU A;  4OES A;  1MXZ A;  1IXI A;  2NXO A;  4FED A;  4EXL A;  3PTY A;  1KA0 A;  5FTI A;  4GVO A;  1FBH A;  2GH9 A;  2VD2 A;  1I69 A;  5FHM A;  1MY0 A;  2XXQ A;  4KCC A;  2B65 A;  4MMP A;  3MVZ A;  1MY3 A;  4GWX A;  4QHQ A;  4PQJ A;  1LAX A;  3KFM A;  1IIT A;  3E13 X;  3RPW A;  2DWJ A;  1LBC A;  4R6K A;  1R1N A;  1DTZ A;  1EH3 A;  1A55 A;  2Z23 A;  1GVC A;  3PGF A;  4OER A;  4LN5 A;  5K2Y A;  4DLD A;  3W9V A;  1O63 A;  4MNP A;  4AS4 A;  4X04 A;  4PP0 A;  2Z8E A;  4QXD A;  3C9H A;  3QSL A;  1UTB B;  2F78 A;  4PGN A;  1SQY A;  2RKM A;  2ZYK A;  2WYP A;  3U72 A;  3Q29 A;  2V3U A;  3VXB A;  5ITO A;  3QK6 A;  2ESN A;  1VR5 A;  4IR8 A;  4KYD A;  2Y7I A;  4N6D A;  1IXH A;  1RYX A;  4RY1 A;  2QS4 A;  2LAO A;  2REG A;  5T3J A;  2Q89 A;  4GXS B;  1PBQ A;  2DP8 A;  3S9M C;  4GBV A;  1ZU0 A;  4PE3 A;  4YIC A;  3FZV A;  2F7B A;  3C32 A;  4ELP A;  3VXC A;  1POY 1;  1II5 A;  5I56 A;  2R6G E;  1DPE A;  3P7I A;  4YB5 A;  3HPI A;  4EDP A;  4NAP A;  1XT8 A;  1MXY A;  1JP4 A;  4F22 A;  1A99 A;  5BWJ A;  4H5G A;  3TTK A;  2O7U A;  5IKB A;  2F5X A;  4F3P A;  1EZO A;  1DPP A;  2UVH A;  1OLA A;  3LSX A;  4NF8 B;  3IFC A;  4QFN A;  5KCJ A;  3I3V A;  2XHD A;  2OCU A;  1AWB A;  2OBG A;  2OZZ A;  1QUJ A;  3GZG A;  4Q5T A;  3CR9 A;  3G3K A;  3LR1 A;  3TCH A;  2RC7 A;  2AIX A;  4HE2 A;  4MLV A;  3T0J A;  1D9V A;  3AXF A;  3UK4 A;  5I57 B;  2P1S A;  1MH3 A;  1FPK A;  4KHZ E;  4EQB A;  4Z7E A;  4BDQ A;  5JTY A;  1O7T A;  1IIW A;  1B3E A;  2XXW A;  3D1R A;  3U92 A;  4NF4 A;  2R71 A;  2UXA A;  2H25 A;  4KI0 E;  1B3F A;  2DE4 A;  1LGB C;  3IB2 A;  3OOA A;  5EQ7 A;  4ZEF A;  4R74 A;  4POW A;  1NH8 A;  2QMX A;  3KJ7 A;  2QS3 A;  4YMB A;  1NUW A;  1PDA A;  1XVX A;  4U4X A;  2REJ A;  4R6H A;  3FUZ A;  5TP9 A;  3R6U A;  3VLU A;  1NNP A;  5ESY A;  3RTW B;  1RYO A;  1CE2 A;  4ZEK A;  4HW8 A;  4I9D A;  5I2N B;  3IX1 A;  1IXG A;  5L8D A;  1YZ0 A;  1NV1 A;  2Y5L A;  4GWU A;  3FJG A;  4F1V A;  4XIG Q;  5F1Q A;  4POX A;  5L9S A;  3MQ9 A;  4G8N A;  4OEN A;  2AL5 A;  5H8Q A;  5M2V A;  1FBF A;  3LSL A;  3LC8 A;  2CZL A;  1LBW A;  1XC1 A;  2I3W A;  2B3B A;  3TTL A;  5KZT A;  5I3S A;  1JQF A;  3IOV A;  4HCY A;  3CFZ A;  3MST A;  3TKD A;  3K1N A;  4F19 A;  4GWO A;  4X1B A;  3N6T A;  2F3B A;  5DEX B;  3SEU A;  5EHM A;  2ZMB A;  3S9E A;  4TLM B;  5DVJ A;  3D4G A;  2I49 A;  3TTR A;  4IY6 A;  2DS9 A;  1US5 A;  5IZ3 B;  2Z22 A;  2DQV A;  3DLN A;  1PB8 A;  1WVJ A;  1XS5 A;  4ZEB A;  4IO6 A;  2MKZ A;  3KN8 A;  1USY E;  4UA8 A;  3MPL A;  1JVY A;  4YZZ A;  2XD2 A;  1P1U A;  3V8X B;  1QUL A;  3ECR A;  1AMF A;  4Q30 B;  4LAT A;  3O6I A;  1IMF A;  2B4L A;  4H65 A;  2HAU A;  2A5S A;  3A3U A;  3ISP A;  1FSA A;  1N04 A;  5FHN A;  3M3F A;  3T9U A;  1O64 A;  3LSW A;  4F1Y A;  4MNC A;  2Q2C A;  1LBY A;  3G3I A;  2DDK A;  1FQC A;  1SI0 A;  5AA2 B;  3O66 A;  1NV7 A;  1B32 A;  2GHB A;  4RJZ A;  4K3F A;  2VOZ A;  3LUY A;  4PE5 B;  1I6Q A;  3JV9 A;  3SES A;  1US4 A;  5CM6 A;  2QS1 A;  5HPQ A;  4LA9 A;  5LOM A;  1N3W A;  2Y7P A;  4OVQ A;  4RA1 A;  2X7Q A;  1OLC A;  3QIM A;  1BIY A;  4N07 A;  4MFI A;  4P1E A;  1LBZ A;  1IXC A;  4ELQ A;  4QFL A;  4MX6 A;  1IMC A;  2PFZ A;  1QW0 A;  5CC2 A;  3IL1 B;  2UVJ A;  4UAB A;  3KGC A;  4R72 A;  2RF1 A;  4PBQ A;  5EYF A;  1EYI A;  3TMG A;  4DXB A;  2XXT A;  3T22 A;  4F3S A;  4JSD A;  1Y1Z A;  4JWY A;  4U23 A;  1YTV A;  1SW4 A;  1Y20 A;  2UYF A;  4F2O A;  1G0H A;  2ALU A;  2ZZW A;  4I40 A;  1DOT A;  1IQ7 A;  3U93 A;  2Y7K A;  2I6E A;  3K01 A;  3B50 A;  2R8T A;  3FXB A;  4NF5 A;  4NMY A;  3PU5 A;  5I59 B;  4PF6 A;  3K1M A;  3U94 A;  1LAG E;  4DI4 B;  3K1P A;  4OQO A;  1SVX B;  2UVG A;  3KEI A;  3TQW A;  4JSO A;  4OHN A;  3V5A A;  4DCY A;  4P3L A;  2HHM A;  4ZZA A;  2Y84 A;  2VHA A;  2G29 A;  1Y3N A;  4JVI A;  1SI1 A;  4QBA A;  2V84 A;  5ET6 A;  2F6G A;  3B6W A;  5FHO A;  5I58 A;  3E4R A;  4N8G A;  1YYZ A;  2ZYN A;  1I6B A;  1JEV A;  3HFU A;  1BK4 A;  3FXR A;  1OVT A;  3KOT A;  4PFT A;  2DWH A;  2V25 A;  4NGU A;  5H8F B;  4ZED A;  3CSB A;  3EKI A;  4GIZ A;  1B2H A;  3IJX B;  1HSL A;  4NQ8 A;  4O3A A;  2PX1 A;  2WYK A;  4KXP A;  2O84 X;  3ZKL A;  3I6V A;  3HN0 A;  1MS7 A;  2PT2 A;  3HST A;  4IB2 A;  3TTM A;  4EF1 A;  4FEC A;  2D5W A;  2H9B A;  4FE8 A;  1MY2 A;  1B1X A;  2Z8F A;  4GOT A;  1B4Z A;  3B8B A;  2QRY A;  5CBR A;  2RC8 A;  4GRK A;  1D3K A;  4JVD A;  3FVG A;  4O8M A;  2GHA A;  3CFX A;  2AYS A;  1EU8 A;  3HHF A;  2B3F A;  4OFL A;  4YU0 A;  3H03 A;  4NE4 A;  1B58 A;  3LBS A;  5ELV A;  4QSD A;  4MCO A;  2KQZ A;  3PD9 A;  2O69 A;  1ZMG A;  5JK4 A;  4AQ4 A;  3C34 A;  1LAF E;  3IO4 A;  1RDX A;  1D9Y A;  4H45 A;  3TTN A;  3G3H A;  3KC0 A;  3B6Q A;  2G93 A;  4I1D A;  1FRP A;  4N6K A;  3GXA A;  1MXX A;  4YKP A;  3K2D A;  1P99 A;  2ZZV A;  5L9M A;  3L6H A;  5KDT A;  2Z8D A;  3UGW A;  3G3G A;  3O9P A;  3OEL A;  4IGR A;  4N15 A;  5I84 A;  5A5X A;  3SEW A;  2F7A A;  1PBP A;  3KSX A;  3S2V A;  2NVU B;  2YLN A;  4WKM A;  1LCF A;  3C4M A;  4IGT A;  3RPL B;  1S50 A;  1LBV A;  2F6P A;  5EYH A;  1P1N A;  3UIF A;  5I2K B;  4MNI A;  4ZZE A;  3MP6 A;  2NWJ A;  3SEX A;  4NF6 B;  3IOW A;  2CMO A;  2I58 A;  3TUS A;  2X7P A;  1DK4 A;  1EZP A;  5LTC A;  1DSN A;  3F11 A;  4MLQ A;  1UTH A;  1GGG A;  3KZG A;  3FVK A;  2XXR A;  4OEU A;  4GF8 A;  2QS2 A;  3QUJ A;  1VSO A;  4BLA A;  4G8H A;  2ZNU A;  3T96 B;  3PPQ A;  3ILT B;  4FIM A;  4X8R A;  4U1O A;  1MRP A;  5ET8 A;  2D21 A;  1FQE A;  4I3E A;  3I5O A;  4G68 A;  3OEM A;  3BFU A;  5ISU A;  1JNF A;  1USY H;  4F29 A;  3TEL A;  1PB9 A;  2HXW A;  4OAN A;  2E1S A;  2HZK A;  2FYI A;  1IMA A;  4YMA A;  2DE3 A;  2DE2 A;  1RKM A;  1G0I A;  1NMU A;  1SYH A;  3CIJ A;  2Y7R A;  3VVF A;  5JEI A;  1AOV A;  4GX3 A;  4H1X A;  1FPE A;  5AA2 D;  3GBA A;  3KN3 A;  4HXV A;  1LAH E;  2DVC A;  4JB7 A;  4PFY A;  3U1O A;  1B05 A;  4ESW A;  1P1Q A;  3QMF A;  2VD3 A;  1NNK A;  1LEV A;  4KYE A;  1QUK A;  3JYR A;  2BJJ X;  1R9L A;  1XHY A;  1YAE A;  3O6H A;  3KOS A;  5F24 A;  1B52 A;  4LZ7 A;  3CSG A;  4NF0 A;  1OIB A;  5ET7 A;  2VPO A;  3FV2 A;  1J1N A;  2QSX A;  4O7I A;  1LBB A;  3JZJ A;  3TCF A;  3H3G A;  1MG1 A;  3HHG A;  3SZP A;  4PC9 A;  2F36 A;  3ILU B;  3EPE A;  4GQO A;  1B5J A;  2DXY A;  1MDP 1;  4R2F A;  1IEJ A;  4NWC A;  1WDN A;  1FTK A;  3C36 A;  5ICQ A;  1TWY A;  1VFD A;  4R9G A;  1Z7N E;  3PUX E;  1FQD A;  1QVS A;  1P1O A;  1A54 A;  3M3K A;  1PEB A;  5I56 B;  1VE4 A;  1FBP A;  3IK6 B;  4QFK A;  3E78 A;  1FPB A;  4YB7 A;  2Q8J A;  2IA4 A;  4DI3 D;  1GV8 A;  2ZNT A;  3S9N C;  3D4C A;  2OLB A;  2XXI A;  4FEB A;  2PYY A;  4HCW A;  3V83 A;  2DOJ A;  3FIR A;  1AL3 A;  5H8S A;  2KR0 A;  4F2Q A;  3SDF A;  4RYA A;  3SEV A;  3A29 A;  1FPL A;  1MY1 A;  4R75 A;  4F39 A;  4H0W A;  2FIE A;  3OSQ A;  3PUV E;  2PCR A;  3PPN A;  3E9X A;  5J1D A;  2FBP A;  3PMX A;  5KCJ B;  1NV2 A;  4G68 C;  3H6V A;  1MM7 A;  1RDY A;  1MQH A;  2V3Q A;  4OVR A;  4RK9 A;  5B7D A;  4EQ7 A;  2RCA A;  1I6A A;  4PAI A;  3RN8 A;  2QVR A;  4YKJ A;  5ET5 A;  3RTF B;  4I8C A;  2AL4 A;  4KD5 A;  4N91 A;  3PPR A;  4DDD A;  5DTB A;  5CMB A;  4P47 A;  3BIG A;  2P3N A;  3EHU A;  1TT1 A;  2DYX A;  4TOZ A;  3RUM A;  1B7Z A;  2O7I A;  4OVS A;  5JTY B;  1FQA A;  4JWO A;  2WEF A;  5F7V A;  3FXU A;  1XOC A;  4O3B A;  1K9Y A;  4XTC Q;  1M5D A;  4NF4 B;  3IFA A;  1B0H A;  1TXF A;  2ZXT A;  3ODB A;  4JDF A;  3S4U A;  3TZA A;  4XXU A;  4G2Z A;  3FXQ A;  2DSF A;  2CZI A;  3PPO A;  3DEL B;  5H8N A;  3MP8 A;  3KBR A;  1FTL A;  4FAT A;  3CFL A;  5TP9 B;  3DM0 A;  1N3X A;  1R6Z A;  2Q9T A;  3Q28 A;  2F7C A;  3CI8 A;  1OQG A;  1FPF A;  1NFT A;  4OFO A;  3VV5 A;  2F97 A;  3T9X B;  2FNC A;  3QXM A;  2QL3 A;  2Q88 A;  5H8Q B;  3PV0 E;  1BTJ A;  1DTG A;  1MY4 A;  1SDX A;  3N94 A;  3SET A;  1RDZ A;  3CHG A;  4KPT A;  3W9W A;  2WKY A;  3CG1 A;  2ZYM A;  3R26 A;  4ISU A;  1B7U A;  5CMC A;  5ITP A;  2O1L A;  4G4P A;  1NKX A;  1TFD A;  3UP9 A;  3H7M A;  2XWO A;  3N26 A;  1B40 A;  3EF7 A;  3Q25 A;  3RYD A;  2XWV A;  3OEK A;  1Y4T A;  4LZ5 A;  1ZBM A;  4GX4 A;  4BDM A;  3H6T A;  3SEY A;  1LB9 A;  2HPG A;  3MZ9 A;  3KJT A;  4QFO A;  4GWZ A;  4P0I A;  2RIN A;  4JVC A;  3KSJ A;  3MAM A;  4ZE9 A;  4EUO A;  1Y3P A;  2ZYO A;  1FPG A;  3FVO A;  3N5L A;  2W7Y A;  4RXL A;  5CRY A;  3MWB A;  4Q8R A;  4QRZ A;  3EN3 A;  2HEU A;  5HBC A;  5AA4 A;  2E0S A;  1AH5 A;  1FJ6 A;  1ELJ A;  3C31 A;  5EQA A;  3T1B A;  1YXI A;  3G7W A;  3ROJ A;  1LCT A;  1FBD A;  1FW0 A;  1URS A;  3O29 A;  4U1Z A;  4ONY A;  2UYE A;  1A40 A;  2RCB A;  4BDO A;  4JBZ A;  4H8I A;  5A5L A;  4FOR A;  3MZ1 A;  1HSJ A;  1MXW A;  2FIX A;  3G3F A;  3QYT A;  3HV1 A;  4H5F A;  2ZZX A;  3ZKK A;  5AE4 A;  4OVT A;  1KA1 A;  4PTK A;  4MBP A;  2IEE A;  4IY5 A;  3BBR A;  4ZS9 A;  1Y4C A;  4KR5 A;  3ZS6 A;  4OWD A;  2V3T A;  2QJE A;  5AA3 A;  3BIH A;  4F3G A;  4OZ9 A;  4PFR A;  1PB7 A;  2FA7 A;  3TAJ A;  4YB6 A;  3B7D A;  2JJK A;  4KFQ A;  1N7X A;  3OXN A;  4EQ9 A;  3FJM A;  1FBG A;  1EYK A;  2NUV A;  5CI5 A;  5IZ1 A;  4RPO A;  4PAK A;  2I0C A;  3OO7 A;  3H6U A;  3K6W A;  1VFE A;  5FTH A;  4KQP A;  2DWI A;  1NV4 A;  1NL5 A;  1B5I A;  4PDH A;  3B6T A;  2HAV A;  2A5T A;  4P56 A;  3SER A;  4DXU A;  3O2A A;  3FD3 A;  1Q9D A;  2F35 A;  1KZ8 A;  4NWD A;  1B1H A;  5DT6 A;  2O68 A;  3O97 A;  3TCG A;  1M5F A;  2PT1 A;  4UAC A;  4DXC A;  3UN6 A;  5EQ8 A;  2O51 A;  1SW2 A;  1FQB A;  4PET A;  4GWW A;  4NF5 B;  4FBP A;  2ANJ A;  3VFJ A;  3GLB A;  3KC1 A;  2F8D A;  1TFA A;  1FPI A;  3CRB A;  1IZ1 A;  2GRV A;  5H8H A;  2QMW A;  3IJO B;  4MF3 A;  5TPA A;  1B3H A;  1FJ9 A;  2I4C A;  2XXK A;  4GL8 A;  4ND9 A;  5I58 B;  1IUD A;  3VLV A;  2I48 A;  4N13 A;  2RC9 A;  1H3D A;  2DVZ A;  4O7M A;  3C35 A;  1LFH A;  4ZE8 A;  4P0G A;  1OVB A;  2XXU A;  1FCK A;  1N76 A;  4GWS A;  3RT6 B;  4PCD A;  2P3V A;  4PFI A;  1P1W A;  2GQ1 A;  3FBP A;  1B9J A;  3OO6 A;  3OO9 A;  1ATG A;  2HXR A;  1QJM A;  2DXR A;  4THI A;  4PBH A;  5DVF A;  3Q27 A;  3DP8 A;  4ESX A;  2R9J A;  2THI A;  2ONS A;  4R2B A;  1QKB A;  2OWS A;  1A8F A;  3H06 B;  3MW0 A;  3QUF A;  3ONM A;  3TYH A;  1SD3 A;  3TOD A;  4AB6 A;  3PMV A;  1SPI A;  3C33 A;  4IO5 A;  3UA8 A;  3OO8 A;  1H43 A;  1UIU A;  1UTB A;  4YAH X;  3TDJ A;  3MUQ A;  4OFJ A;  5H8H B;  5FBP A;  4ELO A;  3PUY E;  3N6U A;  1B6H A;  2PVU A;  2I0B A;  4N6P A;  2O1M A;  4PAF A;  2WX9 A;  1OQH A;  2P2A A;  4OA4 A;  2H98 A;  4F31 B;  4HS7 A;  4H8J A;  3EHT A;  4IO3 A;  1ZKB A;  3CVG A;  1MM6 A;  3FAS A;  2HZL A;  1FTM A;  4KCD A;  4WEP A;  1FPJ A;  3TQL A;  3GBB A;  5LDZ A;  1XI6 A;  1FTO A;  2Q2A A;  1NI9 A;  2OX3 A;  1N7W A;  1BLF A;  3MVY A;  3WAF A;  1FBC A;  3PUW E;  3IB1 A;  1EYJ A;  4FAJ A;  1B3L A;  4ECF A;  4M4G A;  1Q1K A;  4JXI A;  4P8B A;  2UVI A;  5KDT B;  4XFE A;  1IMD A;  3HCQ A;  5EHS A;  1JET A;  2Y5K A;  4U21 A;  5A5X B;  3MJN A;  3MVX A;  2PFY A;  1DCU A;  1B3G A;  4NF8 A;  3K02 A;  1LBX A;  1M5B A;  4F18 A;  3KN7 A;  1SBP A;  4ZEI A;  4HE1 A;  5IM2 A;  2YPN A;  3IAZ A;  1IME A;  4MJO A;  4NTL A;  2ONR A;  5CMM A;  1R9Q A;  5EYG A;  3M3L A;  4OVJ A;  2XXP A;  4MIJ A;  4LVQ A;  4FJP A;  3W15 C;  3OSR A;  1UTH B;  4GX6 A;  5I57 A;  2H4I A;  4X48 A;  1K9Z A;  4OET A;  2X26 A;  3K00 A;  2ZNS A;  4F1U A;  2BJI A;  4OVP A;  1IMB A;  5CMK A;  4U4S A;  4PFW A;  1D9Q A;  4N17 A;  1MXV A;  3K4U A;  4YKK A;  2OK2 A;  4G68 B;  1MQI A;  4QSC A;  3TPA A;  3MZB A;  1MPC A;  2OWT A;  5DYH A;  3OMB A;  3RGY A;  1OMP A;  1QUI A;  4RNS A;  4GXA A;  4HTG A;  1Y1M A;  4PFB A;  1D4N A;  4DCX A;  2DWA A;  4C0R A;  4X1D A;  1SW1 A;  4GLI A;  3GYY A;  1BKA A;  1QGX A;  4EF2 A;  5I2N A;  1N84 A;  3NOH A;  4G77 A;  4PF8 A;  4Z0I A;  3VVE A;  2Y7W A;  3FV1 A;  2QFL A;  2QPQ A;  3LUZ A;  3DP4 A;  1EZ9 A;  4TQU Q;  2OWZ A;  3MBP A;  5IGA A;  2F3D A;  3V89 B;  3IOT A;  1NUY A;  3O6G A;  2D3I A;  2B4M A;  4I62 A;  1FTA A;  3OEN A;  5DEX A;  1NUX A;  3A09 A;  4R9F A;  1CNQ A;  5DVI A;  4PDD A;  4NED A;  1QKA A;  1B7H A;  3PMW A;  4XKQ A;  1MPB A;  3K0V A;  3SKP A;  2GFE A;  3HO7 A;  1URG A;  4H67 A;  5BUU A;  4ZEC A;  4NN3 A;  5IZ3 A;  1LST A;  4NHB A;  3MYU A;  3UOR A;  2Q74 A;  1UIV A;  1WOD A;  4PFU A;  2V4C A;  1JW4 A;  2I4B A;  1DBZ A;  4TLL B;  3T93 B;  1Z7M E;  1S7Y A;  4P1L A;  4OEV A;  3LV0 A;  1H76 A;  3PPP A;  4GFR A;  2F34 A;  4EXK A;  1ANF A;  1AIV A;  3WAE A;  4MEV A;  1FTJ A;  1ZIU A;  5I7I A;  1NNT A;  2FHY A;  3USD A;  4RK2 A;  4RPN A;  4IO4 A;  4BDL A;  5EQ9 A;  2L5V A;  4Q0C A;  1KWH A;  1MDQ A;  1B5H A;  4XKN A;  1MQJ A;  3E3K A;  4HE0 A;  1MPD A;  2M8C A;  5AA2 A;  3RLF E;  1B0L A;  3VVD A;  2WBD A;  4F3B A;  1JW5 A;  2O6A A;  4YKI A;  4N4U A;  4WXJ A;  1L5T A;  2VT5 A;  2CEY A;  2HFB A;  3IB0 A;  1NV5 A;  2QVV A;  3MPK A;  3PUZ E;  1VDW A;  2PMS A;  2KLF A;  4XF5 A;  2CEX A;  1S9T A;  1NUZ A;  4MH5 A;  1CB6 A;  4C1T A;  1NV3 A;  1ZJL A;  1JEU A;  4OMB A;  4AB5 A;  3ZSF A;  3FGS A;  4QF9 A;  2Q8M A;  1POT A;  3T9H B;  3IO6 A;  3IR1 A;  1MH4 A;  3U65 A;  1LFI A;  5H8N B;  5IZZ A;  2VPN A;  4DZ1 A;  3Q26 A;  1LB8 A;  2XXV A;  3R7X A;  5IAI A;  4O94 A; 
#chains in the Genus database with same CATH homology
 4QSE A;  1GTK A;  4OTE A;  1Q35 A;  4O3C A;  3S9L C;  4ELR A;  5I59 A;  3RT8 A;  5AA1 A;  1F9B A;  4G8M A;  3O28 A;  5B70 A;  3T66 A;  1NH7 A;  4E0X A;  1A8E A;  4P11 A;  1B51 A;  4U2R A;  1NNF A;  2ABH A;  3KG2 A;  3VDF A;  2VP1 A;  1Y3Q A;  3BKI B;  3RQT A;  2H99 A;  2XXH A;  3A3C A;  1M5C A;  5H8F A;  1H45 A;  4M1V A;  3M8U A;  3FVN A;  1UQW A;  3MVW A;  4LUB A;  1HSE A;  5CBS A;  3G3J A;  2PBW A;  4KYS A;  3VE1 B;  2YJP A;  2XXX A;  4DIG A;  5AA4 B;  1DMB A;  4XKR A;  1BP5 A;  1N0T A;  4LZ8 A;  2VGQ A;  3H6W A;  2OJT A;  1JVX A;  5ICT A;  3K6X A;  4JWX A;  4LQ5 A;  1T0K A;  1ZTY A;  2H5Y A;  1MQD A;  1YCJ A;  3OD7 A;  1H44 A;  4C1U A;  3EHS A;  4U22 A;  1PC3 A;  3IOR A;  2XXY A;  2ONK E;  4XKP A;  4QFP A;  1SYI A;  1A7L A;  3DP6 A;  4DE8 A;  4LON B;  3K6V A;  4IO2 A;  1SW5 A;  1ZLQ A;  2XX8 A;  3TEP A;  4R73 A;  4H6D A;  2XD3 A;  3LSF B;  1GR2 A;  3FJ7 A;  3MC2 A;  3QAX A;  4WED A;  3H4Z A;  1FQF A;  4OXV A;  5L9O A;  4LQ2 A;  1MQG A;  4BDN A;  3PD8 A;  5TU0 A;  2A5T B;  4E0W A;  2XX9 A;  5HM4 B;  4OYV A;  3CG3 A;  5K2X A;  1XVY A;  3BFT A;  3T9V A;  2HCA A;  2P0S A;  3MP1 A;  4X9T A;  1B46 A;  4LP2 B;  4R6Y A;  5I2K A;  3TFL A;  1JW1 A;  3U8Q A;  4IO7 A;  4NF6 A;  3L6G A;  4BDR A;  2XX7 A;  3VLW A;  3RNN A;  3RY3 A;  4GD5 A;  4ZDM A;  4L17 A;  3FAT A;  3EQ1 A;  1LFG A;  3THI A;  2V93 A;  1LLS A;  1B4H A;  1YPN A;  3K6U A;  2I3V A;  1Y9U A;  4GL0 A;  2NOO A;  1MXU A;  5TPA B;  2HQ0 A;  1M5E A;  1URD A;  3IOU A;  4OES A;  1MXZ A;  1IXI A;  2NXO A;  4FED A;  4EXL A;  5FTI A;  4GVO A;  2GH9 A;  2VD2 A;  1I69 A;  5FHM A;  1MY0 A;  2XXQ A;  4KCC A;  2B65 A;  3MVZ A;  1MY3 A;  4QHQ A;  4PQJ A;  1LAX A;  3KFM A;  1IIT A;  3E13 X;  3RPW A;  2DWJ A;  1LBC A;  4R6K A;  1R1N A;  1DTZ A;  1EH3 A;  1A55 A;  2Z23 A;  1GVC A;  3PGF A;  4OER A;  5K2Y A;  4DLD A;  3W9V A;  1O63 A;  4PP0 A;  2Z8E A;  3C9H A;  3QSL A;  1UTB B;  2F78 A;  1SQY A;  2RKM A;  2ZYK A;  3U72 A;  3Q29 A;  2V3U A;  3VXB A;  5ITO A;  3QK6 A;  2ESN A;  1VR5 A;  4KYD A;  2Y7I A;  1IXH A;  1RYX A;  4RY1 A;  2QS4 A;  2LAO A;  2REG A;  2Q89 A;  4GXS B;  1PBQ A;  2DP8 A;  3S9M C;  1ZU0 A;  4YIC A;  3FZV A;  2F7B A;  3C32 A;  4ELP A;  3VXC A;  1POY 1;  1II5 A;  5I56 A;  2R6G E;  1DPE A;  3P7I A;  4YB5 A;  3HPI A;  4EDP A;  1XT8 A;  1MXY A;  4F22 A;  1A99 A;  5BWJ A;  4H5G A;  3TTK A;  2O7U A;  5IKB A;  2F5X A;  4F3P A;  1EZO A;  1DPP A;  2UVH A;  1OLA A;  3LSX A;  4NF8 B;  4QFN A;  5KCJ A;  3I3V A;  2XHD A;  2OCU A;  2OBG A;  2OZZ A;  1QUJ A;  3GZG A;  4Q5T A;  3CR9 A;  3G3K A;  3LR1 A;  3TCH A;  2RC7 A;  2AIX A;  4MLV A;  1D9V A;  3AXF A;  3UK4 A;  5I57 B;  2P1S A;  1MH3 A;  4KHZ E;  4EQB A;  4Z7E A;  4BDQ A;  5JTY A;  1O7T A;  1IIW A;  1B3E A;  2XXW A;  3U92 A;  4NF4 A;  2R71 A;  2UXA A;  2H25 A;  4KI0 E;  1B3F A;  2DE4 A;  1LGB C;  3IB2 A;  3OOA A;  4ZEF A;  4R74 A;  4POW A;  1NH8 A;  2QMX A;  3KJ7 A;  2QS3 A;  4YMB A;  1PDA A;  1XVX A;  4U4X A;  2REJ A;  4R6H A;  3FUZ A;  5TP9 A;  3R6U A;  3VLU A;  1NNP A;  3RTW B;  1RYO A;  1CE2 A;  4ZEK A;  4HW8 A;  4I9D A;  5I2N B;  3IX1 A;  1IXG A;  5L8D A;  3FJG A;  4F1V A;  4XIG Q;  5F1Q A;  4POX A;  5L9S A;  3MQ9 A;  4G8N A;  4OEN A;  2AL5 A;  5H8Q A;  5M2V A;  3LSL A;  3LC8 A;  2CZL A;  1XC1 A;  2I3W A;  2B3B A;  3TTL A;  5KZT A;  1JQF A;  3IOV A;  4HCY A;  3CFZ A;  3TKD A;  3K1N A;  4F19 A;  4GWO A;  4X1B A;  3N6T A;  5DEX B;  3SEU A;  5EHM A;  2ZMB A;  3S9E A;  4TLM B;  5DVJ A;  3D4G A;  2I49 A;  3TTR A;  4IY6 A;  2DS9 A;  1US5 A;  2Z22 A;  2DQV A;  3DLN A;  1PB8 A;  1WVJ A;  1XS5 A;  4ZEB A;  4IO6 A;  3KN8 A;  1USY E;  4UA8 A;  3MPL A;  1JVY A;  4YZZ A;  2XD2 A;  1P1U A;  3V8X B;  1QUL A;  3ECR A;  1AMF A;  4Q30 B;  4LAT A;  3O6I A;  4H65 A;  2HAU A;  2A5S A;  3A3U A;  1N04 A;  5FHN A;  3M3F A;  3T9U A;  1O64 A;  3LSW A;  4F1Y A;  2Q2C A;  3G3I A;  1FQC A;  1SI0 A;  5AA2 B;  3O66 A;  1B32 A;  2GHB A;  4RJZ A;  4K3F A;  2VOZ A;  3LUY A;  4PE5 B;  1I6Q A;  3JV9 A;  3SES A;  1US4 A;  5CM6 A;  2QS1 A;  5HPQ A;  4LA9 A;  5LOM A;  1N3W A;  2Y7P A;  4RA1 A;  2X7Q A;  1OLC A;  3QIM A;  1BIY A;  4N07 A;  4MFI A;  1IXC A;  4ELQ A;  4QFL A;  1QW0 A;  5CC2 A;  3IL1 B;  2UVJ A;  3KGC A;  4R72 A;  2RF1 A;  5EYF A;  3TMG A;  4DXB A;  2XXT A;  3T22 A;  4F3S A;  4JSD A;  1Y1Z A;  4JWY A;  4U23 A;  1YTV A;  1SW4 A;  1Y20 A;  2UYF A;  4F2O A;  2ALU A;  1DOT A;  1IQ7 A;  3U93 A;  2Y7K A;  2I6E A;  3K01 A;  4NF5 A;  4NMY A;  3PU5 A;  5I59 B;  3U94 A;  3K1M A;  1LAG E;  3K1P A;  4OQO A;  1SVX B;  2UVG A;  3KEI A;  3TQW A;  4JSO A;  4OHN A;  3V5A A;  4DCY A;  4ZZA A;  2Y84 A;  2VHA A;  2G29 A;  1Y3N A;  1SI1 A;  2V84 A;  2F6G A;  3B6W A;  5FHO A;  5I58 A;  3E4R A;  2ZYN A;  1I6B A;  1JEV A;  3FXR A;  1OVT A;  3KOT A;  4PFT A;  2DWH A;  2V25 A;  5H8F B;  4ZED A;  3CSB A;  4GIZ A;  1B2H A;  3IJX B;  1HSL A;  4O3A A;  2PX1 A;  2O84 X;  3ZKL A;  3I6V A;  3HN0 A;  1MS7 A;  2PT2 A;  3HST A;  4IB2 A;  3TTM A;  4EF1 A;  4FEC A;  2D5W A;  2H9B A;  4FE8 A;  1MY2 A;  1B1X A;  2Z8F A;  4GOT A;  1B4Z A;  2QRY A;  5CBR A;  2RC8 A;  4GRK A;  1D3K A;  3FVG A;  2GHA A;  3CFX A;  2AYS A;  1EU8 A;  3HHF A;  2B3F A;  4OFL A;  4YU0 A;  3H03 A;  4NE4 A;  1B58 A;  3LBS A;  5ELV A;  4QSD A;  3PD9 A;  2O69 A;  1ZMG A;  5JK4 A;  4AQ4 A;  3C34 A;  1LAF E;  3IO4 A;  1D9Y A;  3TTN A;  3G3H A;  3B6Q A;  2G93 A;  4I1D A;  3GXA A;  1MXX A;  4YKP A;  3K2D A;  1P99 A;  5L9M A;  3L6H A;  5KDT A;  2Z8D A;  3UGW A;  3G3G A;  3O9P A;  3OEL A;  4IGR A;  5I84 A;  5A5X A;  3SEW A;  2F7A A;  1PBP A;  3KSX A;  3S2V A;  2NVU B;  2YLN A;  4WKM A;  1LCF A;  3C4M A;  4IGT A;  1S50 A;  2F6P A;  1P1N A;  3UIF A;  5I2K B;  4ZZE A;  3MP6 A;  2NWJ A;  3SEX A;  4NF6 B;  3IOW A;  2CMO A;  2I58 A;  3TUS A;  2X7P A;  1EZP A;  1DSN A;  3F11 A;  4MLQ A;  1UTH A;  1GGG A;  3KZG A;  3FVK A;  2XXR A;  4OEU A;  4GF8 A;  2QS2 A;  3QUJ A;  1VSO A;  4BLA A;  4G8H A;  2ZNU A;  3T96 B;  3PPQ A;  3ILT B;  4FIM A;  4U1O A;  1MRP A;  2D21 A;  1FQE A;  3I5O A;  4G68 A;  3OEM A;  3BFU A;  5ISU A;  1JNF A;  1USY H;  4F29 A;  3TEL A;  1PB9 A;  2HXW A;  2E1S A;  2HZK A;  2FYI A;  4YMA A;  2DE3 A;  2DE2 A;  1RKM A;  1SYH A;  1NMU A;  3CIJ A;  2Y7R A;  3VVF A;  5JEI A;  1AOV A;  4H1X A;  5AA2 D;  3GBA A;  3KN3 A;  1LAH E;  2DVC A;  4JB7 A;  4PFY A;  3U1O A;  1B05 A;  4ESW A;  1P1Q A;  2VD3 A;  1NNK A;  4KYE A;  1QUK A;  3JYR A;  2BJJ X;  1R9L A;  1XHY A;  1YAE A;  3O6H A;  3KOS A;  1B52 A;  4LZ7 A;  3CSG A;  1OIB A;  3FV2 A;  1J1N A;  2QSX A;  1LBB A;  3JZJ A;  3TCF A;  3H3G A;  1MG1 A;  3HHG A;  2F36 A;  3ILU B;  3EPE A;  4GQO A;  1B5J A;  2DXY A;  1MDP 1;  4R2F A;  1IEJ A;  4NWC A;  1WDN A;  1FTK A;  3C36 A;  5ICQ A;  1TWY A;  1VFD A;  4R9G A;  1Z7N E;  3PUX E;  1FQD A;  1QVS A;  1P1O A;  1A54 A;  3M3K A;  1PEB A;  5I56 B;  1VE4 A;  3IK6 B;  4QFK A;  4YB7 A;  2Q8J A;  2IA4 A;  1GV8 A;  2ZNT A;  3S9N C;  3D4C A;  2OLB A;  2XXI A;  4FEB A;  2PYY A;  4HCW A;  3V83 A;  2DOJ A;  3FIR A;  1AL3 A;  5H8S A;  4F2Q A;  3SDF A;  4RYA A;  3SEV A;  4F39 A;  1MY1 A;  4R75 A;  4H0W A;  3OSQ A;  3PUV E;  3PPN A;  3E9X A;  5J1D A;  3PMX A;  5KCJ B;  4G68 C;  3H6V A;  1MM7 A;  1MQH A;  2V3Q A;  4RK9 A;  5B7D A;  4EQ7 A;  2RCA A;  1I6A A;  3RN8 A;  4YKJ A;  3RTF B;  4I8C A;  2AL4 A;  4KD5 A;  3PPR A;  4DDD A;  5DTB A;  5CMB A;  3EHU A;  1TT1 A;  2DYX A;  4TOZ A;  3RUM A;  1B7Z A;  2O7I A;  5JTY B;  1FQA A;  4JWO A;  5F7V A;  3FXU A;  1XOC A;  4O3B A;  4XTC Q;  1M5D A;  4NF4 B;  1B0H A;  1TXF A;  2ZXT A;  3ODB A;  4JDF A;  3S4U A;  3TZA A;  4XXU A;  4G2Z A;  3FXQ A;  2DSF A;  3PPO A;  3DEL B;  5H8N A;  3MP8 A;  3KBR A;  1FTL A;  4FAT A;  3CFL A;  5TP9 B;  3DM0 A;  1N3X A;  1R6Z A;  2Q9T A;  3Q28 A;  2F7C A;  3CI8 A;  1OQG A;  1NFT A;  4OFO A;  3VV5 A;  2F97 A;  3T9X B;  2FNC A;  3QXM A;  2QL3 A;  2Q88 A;  5H8Q B;  3PV0 E;  1BTJ A;  1DTG A;  1MY4 A;  1SDX A;  3N94 A;  3SET A;  4KPT A;  3W9W A;  2WKY A;  3CG1 A;  2ZYM A;  3R26 A;  4ISU A;  1B7U A;  5CMC A;  5ITP A;  2O1L A;  4G4P A;  1NKX A;  1TFD A;  3UP9 A;  3H7M A;  3N26 A;  1B40 A;  3EF7 A;  3Q25 A;  3OEK A;  1Y4T A;  4LZ5 A;  1ZBM A;  4BDM A;  3H6T A;  3SEY A;  1LB9 A;  3MZ9 A;  3KJT A;  4QFO A;  4P0I A;  2RIN A;  3KSJ A;  3MAM A;  4ZE9 A;  4EUO A;  1Y3P A;  2ZYO A;  3FVO A;  3N5L A;  2W7Y A;  4RXL A;  5CRY A;  3MWB A;  4Q8R A;  4QRZ A;  3EN3 A;  2HEU A;  5HBC A;  5AA4 A;  2E0S A;  1AH5 A;  1ELJ A;  3C31 A;  3G7W A;  1LCT A;  1FW0 A;  1URS A;  3O29 A;  4U1Z A;  4ONY A;  2UYE A;  1A40 A;  2RCB A;  4BDO A;  4JBZ A;  4H8I A;  4FOR A;  3MZ1 A;  1HSJ A;  1MXW A;  3G3F A;  3QYT A;  3HV1 A;  4H5F A;  3ZKK A;  5AE4 A;  4MBP A;  2IEE A;  4IY5 A;  3BBR A;  4ZS9 A;  1Y4C A;  4KR5 A;  3ZS6 A;  4OWD A;  2V3T A;  2QJE A;  5AA3 A;  4F3G A;  4OZ9 A;  1PB7 A;  2FA7 A;  3TAJ A;  4YB6 A;  3B7D A;  4KFQ A;  1N7X A;  3OXN A;  4EQ9 A;  3FJM A;  2NUV A;  5CI5 A;  4RPO A;  2I0C A;  3OO7 A;  3H6U A;  3K6W A;  1VFE A;  5FTH A;  4KQP A;  2DWI A;  1NL5 A;  1B5I A;  3B6T A;  2HAV A;  2A5T A;  3SER A;  4DXU A;  3O2A A;  3FD3 A;  2F35 A;  4NWD A;  1B1H A;  5DT6 A;  2O68 A;  3O97 A;  3TCG A;  1M5F A;  2PT1 A;  4UAC A;  4DXC A;  3UN6 A;  2O51 A;  1SW2 A;  1FQB A;  4PET A;  4NF5 B;  2ANJ A;  3VFJ A;  3GLB A;  2F8D A;  1TFA A;  3CRB A;  1IZ1 A;  2GRV A;  5H8H A;  2QMW A;  3IJO B;  4MF3 A;  5TPA A;  1B3H A;  2I4C A;  4GL8 A;  4ND9 A;  5I58 B;  1IUD A;  3VLV A;  2I48 A;  4N13 A;  2RC9 A;  1H3D A;  2DVZ A;  3C35 A;  1LFH A;  4ZE8 A;  4P0G A;  1OVB A;  2XXU A;  1FCK A;  1N76 A;  3RT6 B;  1P1W A;  1B9J A;  3OO6 A;  3OO9 A;  1ATG A;  1QJM A;  2DXR A;  4THI A;  5DVF A;  3Q27 A;  3DP8 A;  4ESX A;  2R9J A;  2THI A;  2ONS A;  4R2B A;  1QKB A;  2OWS A;  1A8F A;  3H06 B;  3MW0 A;  3QUF A;  3ONM A;  3TYH A;  1SD3 A;  3TOD A;  4AB6 A;  3PMV A;  3C33 A;  4IO5 A;  3UA8 A;  3OO8 A;  1H43 A;  1UIU A;  1UTB A;  4YAH X;  3TDJ A;  3MUQ A;  4OFJ A;  5H8H B;  4ELO A;  3PUY E;  3N6U A;  1B6H A;  2PVU A;  2I0B A;  4N6P A;  2O1M A;  1OQH A;  2P2A A;  2H98 A;  4F31 B;  4HS7 A;  4H8J A;  3EHT A;  4IO3 A;  1ZKB A;  3CVG A;  1MM6 A;  3FAS A;  2HZL A;  1FTM A;  4KCD A;  4WEP A;  3TQL A;  3GBB A;  1FTO A;  2Q2A A;  1N7W A;  1BLF A;  3MVY A;  3WAF A;  3PUW E;  3IB1 A;  4FAJ A;  1B3L A;  4ECF A;  4M4G A;  1Q1K A;  4JXI A;  2UVI A;  5KDT B;  3HCQ A;  5EHS A;  1JET A;  4U21 A;  5A5X B;  3MJN A;  3MVX A;  1B3G A;  4NF8 A;  3K02 A;  1M5B A;  4F18 A;  3KN7 A;  1SBP A;  4ZEI A;  2YPN A;  3IAZ A;  4NTL A;  2ONR A;  5CMM A;  1R9Q A;  3M3L A;  4OVJ A;  2XXP A;  4LVQ A;  4FJP A;  3W15 C;  3OSR A;  1UTH B;  5I57 A;  2H4I A;  4X48 A;  4OET A;  2X26 A;  3K00 A;  2ZNS A;  4F1U A;  5CMK A;  4U4S A;  4PFW A;  1MXV A;  3K4U A;  4YKK A;  2OK2 A;  4G68 B;  1MQI A;  4QSC A;  3TPA A;  3MZB A;  1MPC A;  2OWT A;  5DYH A;  3OMB A;  3RGY A;  1OMP A;  1QUI A;  4RNS A;  4GXA A;  4HTG A;  1Y1M A;  1D4N A;  4DCX A;  2DWA A;  4C0R A;  4X1D A;  1SW1 A;  4GLI A;  1BKA A;  4EF2 A;  5I2N A;  1N84 A;  4G77 A;  4Z0I A;  3VVE A;  2Y7W A;  3FV1 A;  2QPQ A;  3DP4 A;  1EZ9 A;  4TQU Q;  3MBP A;  3V89 B;  3IOT A;  3O6G A;  2D3I A;  4I62 A;  3OEN A;  5DEX A;  3A09 A;  4R9F A;  5DVI A;  4NED A;  1QKA A;  1B7H A;  3PMW A;  4XKQ A;  1MPB A;  3K0V A;  3SKP A;  2GFE A;  3HO7 A;  1URG A;  4H67 A;  5BUU A;  4ZEC A;  1LST A;  3UOR A;  1UIV A;  1WOD A;  4PFU A;  1JW4 A;  2I4B A;  4TLL B;  3T93 B;  1Z7M E;  1S7Y A;  4OEV A;  1H76 A;  3PPP A;  4GFR A;  2F34 A;  4EXK A;  1ANF A;  1AIV A;  3WAE A;  1FTJ A;  1ZIU A;  1NNT A;  3USD A;  4RK2 A;  4RPN A;  4IO4 A;  4BDL A;  4Q0C A;  1KWH A;  1MDQ A;  1B5H A;  4XKN A;  1MQJ A;  3E3K A;  1MPD A;  2M8C A;  5AA2 A;  3RLF E;  1B0L A;  3VVD A;  4F3B A;  1JW5 A;  2O6A A;  4YKI A;  4WXJ A;  1L5T A;  2HFB A;  3IB0 A;  3PUZ E;  3MPK A;  2PMS A;  2KLF A;  1S9T A;  4MH5 A;  1CB6 A;  4C1T A;  1ZJL A;  1JEU A;  4OMB A;  4AB5 A;  3ZSF A;  3FGS A;  4QF9 A;  1POT A;  3T9H B;  3IO6 A;  3IR1 A;  1MH4 A;  1LFI A;  5H8N B;  4DZ1 A;  3Q26 A;  1LB8 A;  2XXV A;  3R7X A;  5IAI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...