3SEXA

Ni-mediated dimer of maltose-binding protein a216h/k220h by synthetic symmetrization (form ii)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
molecule keywords Maltose-binding periplasmic protein
total genus 124
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sexA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sexA01
2F5XA 4H8JA 5H8SA 3FATA 4ESWA 1IZ1A 3KEIA 1PBPA 3M3KA 4YKIA 5ELVA 1FQFA 2O51A 3PV0E 4KD5A 3RGYA 2QMXA 1FW0A 2I48A 3G3FA 3O6IA 4LQ2A 3MP8A 5H8QB 1M5EA 1B51A 4OHNA 2DWJA 1M5CA 4OFOA 5FHOA 1LSTA 5I84A 4OQOA 1DTGA 1NH8A 1ANFA 2LAOA 2QS2A 1O7TA 2UXAA 4GXAA 4H6DA 4F19A 1YCJA 1Y4CA 2I58A 3BBRA 1P1NA 1RYXA 3C34A 3IJOB 4NMYA 3T22A 4U21A 3SEUA 4DZ1A 1USYH 2ZYKA 5JEIA 4BDMA 2REGA 3K6UA 2VP1A 3GZGA 3O97A 4NF6A 3HV1A 3TPAA 3TEPA 1FQDA 4XIGQ 1IXHA 3OD7A 2NWJA 1IXCA 1MDQA 1QUJA 1MXVA 2F36A 2XXWA 2QS4A 2YPNA 2DSFA 1IXIA 3H06B 3O6GA 3OSQA 3TCHA 4RPNA 3IR1A 4OXVA 3PU5A 1P1OA 2HAVA 4F1YA 1WVJA 3M3LA 4U23A 3H6TA 4IY5A 1Y4TA 5DEXA 3W9WA 2B3BA 1NH7A 1PC3A 3MVYA 1B5JA 1ATGA 4LATA 4EXKA 5L9OA 1NNKA 3FJMA 5H8FA 1TXFA 3HO7A 4G68C 3HPIA 3K1PA 1TT1A 1Y1MA 1JW1A 4JSOA 1B52A 5JK4A 1SVXB 4OTEA 3K6VA 4C1TA 3H6VA 4NE4A 1MG1A 4FJPA 4NF5B 2XXQA 3A3UA 4FATA 5ITPA 5K2YA 2ZYNA 1R9LA 2Z8EA 3FVKA 3TUSA 2I6EA 4YB7A 5KDTA 1B3GA 2G93A 2UVJA 4YICA 2E0SA 4N07A 2XXYA 1EH3A 3LUYA 3RNNA 1EZPA 1QJMA 4JDFA 1JVYA 4JBZA 4H5GA 2WKYA 1DOTA 4PFWA 4QHQA 3SERA 4EF1A 1QUIA 3B6TA 2Q88A 1ZBMA 1FTKA 2VD2A 4U22A 4U4SA 5CMBA 5AA1A 4GVOA 3UA8A 4X1DA 3BKIB 3FVOA 3UORA 1N3XA 3K1MA 4E0WA 4ZS9A 1LFIA 1UQWA 2HZKA 3Q27A 1MPDA 2Y7KA 2ZXTA 2RC7A 3IOUA 3R6UA 4UACA 4BDQA 3CSBA 3T9VA 3USDA 1NNFA 3TYHA 3AXFA 1N84A 1ELJA 3CFLA 1LCTA 3HCQA 4H1XA 4YKPA 1HSLA 4QFLA 4PFYA 1UTHA 4NF8A 4EQ9A 5AE4A 4F18A 2H4IA 2ABHA 1POTA 3IO6A 3PPNA 3Q28A 5CI5A 5M2VA 3S9EA 4R75A 1GTKA 1JETA 4I8CA 4G2ZA 2VGQA 3TODA 3B6WA 3UN6A 3HN0A 3ILUB 3TMGA 2H99A 2PMSA 3HSTA 4DXBA 2D5WA 5DEXB 2V3TA 4F39A 1BIYA 1SW5A 3TQLA 5BWJA 5IKBA 2NUVA 1MH3A 5A5XB 4YU0A 1M5DA 1MXWA 3ONMA 1ZLQA 4R9FA 1A8EA 2F35A 1YPNA 3FJ7A 3BFUA 2OBGA 4XXUA 2ONRA 3C33A 4EF2A 2Y7IA 5CM6A 4MFIA 3IORA 5TP9B 4LONB 3UIFA 5AA3A 3O66A 5BUUA 4XKQA 2F7AA 2DWHA 2UVGA 3CG3A 4DCXA 5KZTA 3T9XB 1MPBA 3VVFA 5I59B 1AL3A 4G77A 4QF9A 3TTMA 1NL5A 3PGFA 2I4BA 3RTWB 2R71A 4LVQA 1ZTYA 1MS7A 4IO6A 1D3KA 3U1OA 4QSEA 4R6KA 3IX1A 3E9XA 1M5BA 2ZYMA 3RN8A 1MPCA 2DE2A 2HQ0A 2HXWA 4JWYA 3SDFA 1S50A 2Z8FA 2AYSA 1VSOA 2HEUA 1D9VA 1PBQA 2QL3A 3FGSA 4RXLA 2ZNUA 1UTHB 2P2AA 4NF8B 1SDXA 1P1UA 3S9MC 5DTBA 1PEBA 4HCYA 2Z8DA 4EQ7A 1FQEA 1NMUA 2I49A 1CE2A 3DP8A 2AL4A 4Z7EA 4R2FA 3V89B 3L6HA 3TFLA 1VFDA 2RKMA 4DXUA 1DSNA 2Q2AA 2QS3A 2XX9A 3OO6A 3UGWA 4ZEFA 2B65A 2I0CA 5HPQA 1LGBC 1US4A 2ONKE 3KFMA 3H3GA 3IOWA 1POY1 1QUKA 3C9HA 1RKMA 3FV2A 3FASA 4IO5A 3JZJA 3U8QA 2BJJX 1B1XA 1B9JA 3PPOA 4KCDA 3H6WA 3MBPA 3SEVA 3LR1A 2VHAA 3TZAA 4GF8A 5TP9A 1Y20A 4R73A 3VVEA 4I62A 3HHFA 2A5TA 3OOAA 4KI0E 1L5TA 4TOZA 2DE3A 1QW0A 3E3KA 1MQGA 2XX7A 3KJ7A 4RY1A 3N5LA 1D4NA 3QYTA 1FTJA 1Y9UA 2O6AA 3VLWA 2UVIA 3LSLA 2G29A 4R6YA 2ESNA 4FE8A 3TCFA 1JW5A 3KBRA 4HW8A 5CC2A 1DTZA 2F97A 3CFZA 3OO7A 4AB5A 1XVXA 1XVYA 2CZLA 2IA4A 2PX1A 2RCBA 1ZMGA 2ZNTA 3PUWE 4TQUQ 5AA4A 3SEXA 3KJTA 2RINA 4F2QA 1B3HA 1B7UA 4H8IA 1SW1A 1UIUA 2PT1A 3H03A 4G8MA 3IAZA 3BFTA 2F6PA 3C4MA 1OVTA 4U2RA 3QAXA 3RPWA 1T0KA 2OWTA 5F7VA 4WKMA 2W7YA 1PB7A 5TPAB 1I69A 1F9BA 1I6AA 3B7DA 5DVJA 4F2OA 5AA2D 2V3UA 1SI1A 1H43A 5A5XA 1B58A 3MC2A 3PPQA 2XXXA 3DM0A 1SQYA 4GWOA 3IK6B 4FORA 3V5AA 2I4CA 4THIA 5DVIA 4MLVA 4GFRA 3EHTA 1A99A 2XXRA 4XTCQ 3Q26A 2DS9A 5FTHA 4AB6A 3K02A 3ECRA 3H6UA 3QUJA 4KR5A 3RUMA 2OJTA 5H8HA 1EU8A 2R6GE 4XKNA 1OLAA 2DWAA 1NFTA 1R6ZA 1A8FA 2OZZA 2A5TB 4HS7A 2DWIA 3K6XA 4GL0A 3VVDA 3IOVA 2CMOA 4F3PA 3KOTA 1B5HA 4IO3A 4OWDA 5B7DA 3TQWA 2OK2A 2DQVA 3IB2A 5HBCA 3T9HB 1MXXA 5K2XA 3TELA 1FQCA 4H5FA 4YAHX 1R1NA 1P1WA 2Z22A 3OMBA 3T93B 1LLSA 4QRZA 1O64A 2OWSA 3E13X 3EPEA 1Y3PA 1MRPA 2GRVA 4GOTA 3M8UA 4R2BA 1N7XA 2PYYA 5CRYA 3U92A 1BP5A 2M8CA 3N26A 2NVUB 3U72A 2F7BA 3D4CA 3PUZE 1B2HA 1SYIA 4PETA 2Q2CA 4H65A 4NWDA 1JW4A 1LB9A 3H4ZA 4R72A 4ND9A 1LAHE 5EHMA 4TLMB 1PB8A 3CR9A 4GIZA 4QFPA 2ZYOA 4GRKA 3WAFA 4KYSA 1AMFA 4YB6A 3CIJA 3MUQA 3MW0A 2NXOA 2HFBA 3P7IA 4OEUA 2DYXA 3RT6B 5FTIA 1H3DA 5TPAA 3I3VA 5I56B 1US5A 1I6QA 3MP6A 4QFKA 4N6PA 3A09A 4EQBA 5HM4B 2DVZA 1B3LA 3MP1A 3CI8A 3EQ1A 1N3WA 2Y7RA 4LZ7A 2PBWA 1B3FA 3I6VA 4PE5B 4QSDA 1OVBA 4KYEA 3Q29A 4X1BA 4OERA 3DELB 3SKPA 3ZKLA 4YB5A 2I3VA 3O28A 4IGRA 2XXHA 2F8DA 4E0XA 4PQJA 1B40A 4IGTA 3OEKA 3RT8A 4YMAA 2HAUA 2AL5A 2QRYA 3DP6A 3FJGA 3IL1B 3LSWA 1B7ZA 4M1VA 1VFEA 4EXLA 4EDPA 1UIVA 2O68A 2XXIA 3TTRA 4YMBA 3KN3A 1A7LA 2O69A 1H44A 2Q9TA 1HSEA 4RK2A 1IUDA 1Q1KA 1UTBB 1XHYA 3LSXA 1B5IA 2DXRA 3T66A 3HHGA 3S9NC 2X7QA 3N94A 2ONSA 3F11A 3VLUA 2DVCA 1SBPA 4M4GA 4MBPA 5AA4B 1XT8A 1B0LA 3FVGA 3PMVA 4PP0A 3EHUA 2OLBA 4TLLB 2IEEA 3TKDA 4NTLA 3TCGA 3OO9A 3DLNA 1MY2A 4JB7A 3A3CA 1ZKBA 4RK9A 4K3FA 1N0TA 3G3KA 3B6QA 5CMKA 3MVZA 2FNCA 2FYIA 1B4HA 4ZDMA 3WAEA 1N7WA 2AIXA 5AA2A 1DMBA 1TFAA 2D21A 4KHZE 2O1LA 3CSGA 4ELQA 2RCAA 1AIVA 3RTFB 3GLBA 4Q8RA 2V25A 4ISUA 3IOTA 4QFOA 2B3FA 3H7MA 3KN7A 2H9BA 3PUXE 4GQOA 1D9YA 2X26A 4FEDA 2I3WA 1LFGA 2UYFA 2H25A 2THIA 4L17A 1JEVA 4GL8A 4XKPA 4YKKA 1B6HA 3N6TA 3O6HA 5H8NB 4Z0IA 3THIA 3ZSFA 1LBCA 1MM7A 3T9UA 4DIGA 4GD5A 1GVCA 3VE1B 3C32A 2O7IA 3CG1A 4G8NA 4BDRA 4LUBA 4H67A 2XXPA 3GBBA 1EZOA 5H8HB 1GGGA 1MY3A 2ANJA 3K2DA 3VLVA 4NEDA 1AH5A 2XXUA 3DP4A 1A40A 3E4RA 3OSRA 4G68B 4GXSB 4KPTA 1WDNA 5CBRA 2XXTA 5DYHA 3VFJA 3IJXB 2PT2A 1NNPA 3VV5A 3FVNA 3MVWA 3O29A 4BLAA 1SYHA 4DLDA 3C31A 4F22A 5CBSA 3OELA 5L8DA 1MDP1 2H5YA 3PUYE 1Y3QA 4LQ5A 1Y3NA 1I6BA 3KN8A 4RJZA 4FIMA 3KOSA 3CVGA 5CMCA 3JV9A 3LBSA 3ODBA 4N13A 4P0GA 5TU0A 4AQ4A 1MXZA 4F3BA 3IB1A 3O2AA 4OETA 3S4UA 2Y7PA 4BDLA 4F31B 1FTOA 4NWCA 4FECA 3T96B 1LAXA 3LSFB 3SEWA 1CB6A 1SW4A 2V93A 4O3CA 3PD9A 4F1VA 5AA2B 1MXUA 2GHBA 3MVXA 2NOOA 5JTYA 4LZ5A 3MJNA 4IO4A 4C0RA 3D4GA 1A54A 3GXAA 2GH9A 1OQHA 2ALUA 2Y84A 3MZBA 4ELOA 5I56A 2Q89A 2XX8A 2YLNA 3Q25A 4OENA 4OFLA 1LAFE 2RC9A 2O84X 3R26A 1LAGE 4OYVA 1Y1ZA 5H8NA 4Q5TA 2Q8JA 3UK4A 2VOZA 4PFTA 1YAEA 4IO2A 3MAMA 1JQFA 1GV8A 2PVUA 5I2NB 3MWBA 3TAJA 1B32A 5IAIA 1FQBA 1QKAA 2UVHA 1LB8A 4G68A 1H76A 1NNTA 3OENA 3CFXA 3PMWA 2XHDA 5L9SA 3IB0A 2GHAA 3FXRA 5I58B 1UTBA 4ECFA 5LOMA 2H98A 3TTKA 1IQ7A 2E1SA 2QS1A 4ZZAA 5ITOA 4DE8A 4ELPA 3K6WA 1OIBA 3C35A 1QVSA 2V3QA 3SEYA 2HCAA 3O9PA 3W9VA 1KWHA 3ZS6A 5I57B 3I5OA 2Z23A 3SETA 5KCJA 1USYE 1B0HA 4HCWA 3G7WA 3G3IA 3K1NA 1NKXA 2GFEA 4Q30B 2HZLA 2O1MA 1SI0A 3G3HA 4ONYA 5DVFA 4H0WA 4UA8A 4ZEBA 3S2VA 4HTGA 1QULA 4F3GA 2FA7A 4ESXA 4KQPA 3FXQA 1LBBA 2R9JA 4OFJA 3R7XA 5ISUA 3FV1A 4WXJA 4U1ZA 3IO4A 3C36A 2X7PA 2F34A 5JTYB 3W15C 1O63A 4JWXA 1TFDA 2XD2A 4YZZA 2P1SA 3TDJA 2XXVA 1A55A 4DCYA 5I2KA 1R9QA 2QMWA 1WODA 4Q0CA 3JYRA 2RF1A 4BDNA 2OCUA 4NF4B 4XKRA 3K4UA 4JSDA 1MM6A 3VXCA 1URSA 4X48A 3QK6A 1MY1A 1ZIUA 5I2KB 2F7CA 1DPPA 3KGCA 3KSXA 1JEUA 3K00A 1AOVA 5H8QA 3RQTA 5I2NA 2F78A 3EF7A 3QUFA 4KFQA 3PPRA 3PPPA 3U93A 1IXGA 4OESA 4ZECA 1B3EA 4JXIA 3S9LC 1B7HA 1B46A 1BLFA 4IO7A 1N04A 4POWA 1FTMA 1H45A 3GBAA 2RC8A 3MZ9A 2QSXA 5EYFA 2QPQA 4KYDA 3KZGA 2I0BA 3PD8A 1PDAA 4RA1A 1GR2A 1MXYA 4OMBA 3ZKKA 1PB9A 4DDDA 4WEDA 4DXCA 3MPLA 1VE4A 1M5FA 4U1OA 1DPEA 4KCCA 1IIWA 5DT6A 1XOCA 4O3AA 1RYOA 4WEPA 1XS5A 3VDFA 4QFNA 2QJEA 5I57A 1J1NA 1URDA 1XC1A 3FUZA 4EUOA 1P1QA 4IY6A 4YKJA 2ZNSA 1OQGA 4ZEIA 4R74A 5FHMA 4ZEDA 5KCJB 5B70A 1S7YA 3EHSA 1IITA 3QXMA 3EN3A 4G8HA 4LZ8A 4I1DA 5FHNA 1TWYA 3QSLA 4RNSA 2O7UA 1MQDA 3KSJA 3VXBA 3MPKA 4ELRA 1BKAA 1MY0A 4R9GA 5H8FB 1ZU0A 3UP9A 5F1QA 4F29A 1VR5A 1QKBA 2V84A 3CRBA 1Z7ME 4RYAA 4LA9A 5I59A 1S9TA 1B1HA 1LFHA 4P11A 4PFUA 3OXNA 5KDTB 3G3GA 1MY4A 2KLFA 5L9MA 4RPOA 3M3FA 4F1UA 3PUVE 4QSCA 3TTLA 4NF4A 1JNFA 3FD3A 3MQ9A 2P0SA 4JWOA 4FAJA 2REJA 2DE4A 3OO8A 1MH4A 2A5SA 3G3JA 1LCFA 2ZMBA 1FTLA 3K0VA 2F6GA 1ZJLA 5EHSA 3N6UA 1EZ9A 1N76A 4P0IA 2D3IA 4O3BA 5I58A 4ZEKA 4ZZEA 4R6HA 4NF6B 1B4ZA 1FQAA 1OMPA 4C1UA 1SD3A 3FZVA 2DOJA 4LP2B 2XD3A 4OVJA 3FXUA 3U94A 1OLCA 3QIMA 4MH5A 2DXYA 1II5A 4GLIA 4POXA 4U4XA 1JVXA 4MLQA 3PMXA 4OEVA 1Z7NE 2DP8A 2Y7WA 2YJPA 3KG2A 3SESA 4FEBA 5ICQA 2UYEA 1B05A 1SW2A 3ILTB 4I9DA 2VD3A 1BTJA 3FIRA 3LC8A 3RY3A 4G4PA 3TTNA 3V83A 5ICTA 4IB2A 3L6GA 3MZ1A 4BDOA 1MQJA 1IEJA 4OZ9A 4ZE9A 1Q35A 1HSJA 1MQIA 1MQHA 4MF3A 4NF5A 1YTVA 5CMMA 3RLFE 4ZE8A 4F3SA 3V8XB 3K01A 4X9TA 1FCKA 3OEMA 5J1DA 1P99A 1URGA
chains in the Genus database with same CATH superfamily
4H8JA 3FATA 3M3KA 1FQFA 2O51A 5H8QB 1B51A 4OFOA 4OQOA 4GXAA 3BBRA 4QXDA 1P1NA 3C34A 4OVQA 5JEIA 3HV1A 3TPAA 3OD7A 1QUJA 3O6GA 1IXIA 3IR1A 3QMFA 5DEXA 1ATGA 5L9OA 1NNKA 5H8FA 4G61A 1TXFA 3K1PA 5I59B 4C1TA 4NF5B 2XXQA 4MNPA 5K2YA 2I6EA 2UVJA 4YICA 2E0SA 4N07A 2XXYA 4JDFA 4H5GA 3E78A 5AA1A 4GVOA 4E0WA 3BKIB 2ZXTA 3R6UA 4UACA 3USDA 3HFUA 3CFLA 3HCQA 4H1XA 2Q74A 1IMCA 1UTHA 4NF8A 3PPNA 5CI5A 5M2VA 2VGQA 3UN6A 2D5WA 2V3TA 1SW5A 3TQLA 2NUVA 4YU0A 1M5DA 1ZLQA 2OBGA 2ZZWA 3IORA 3UIFA 5KZTA 1AL3A 3RTWB 4MX6A 2FIXA 1MPCA 2HQ0A 3T1BA 1VSOA 1VDWA 4OVSA 1SDXA 4N15A 1PEBA 1FQEA 4Z7EA 3SZPA 3DP8A 3L6HA 3UGWA 2QS3A 2XX9A 3OO6A 4ZEFA 2B65A 3KFMA 4I3EA 1EYKA 3C9HA 3FASA 1B1XA 2PFZA 4KCDA 3H6WA 3MBPA 1FBHA 5ET7A 4P1LA 5TP9A 2F3DA 4KI0E 1MQGA 2XX7A 3QYTA 2QVVA 4R6YA 4FE8A 4HW8A 5EQAA 1XVYA 2PX1A 3SEXA 1BK4A 1SW1A 1UIUA 4G8MA 3IAZA 2VPOA 4GWUA 1OVTA 1T0KA 5F7VA 1I69A 1F9BA 4F2OA 2V3UA 5A5XA 1B58A 3MC2A 4GWOA 2I4CA 4THIA 5I3SA 1SPIA 5DVIA 1IMEA 4GFRA 3EHTA 2DS9A 3K02A 3H6UA 5H8HA 4XKNA 1OLAA 2OZZA 4GL0A 2CMOA 4F3PA 1B5HA 3TQWA 5HBCA 3TELA 1MXXA 4YAHX 3T93B 1RDZA 2OWSA 1BP5A 2NVUB 1SYIA 4PETA 2CZIA 4NWDA 3H4ZA 2P3NA 3WAFA 2NXOA 2HFBA 2DYXA 5FTIA 1US5A 4MAGA 4N6PA 5HM4B 2DVZA 4H46A 3MP1A 3EQ1A 2QFLA 1OVBA 4KYEA 3SKPA 4GX6A 1B40A 4IGTA 3OEKA 3RT8A 2AL5A 4M1VA 2O68A 4NX1A 2Q9TA 1HSEA 3T66A 1B5IA 4NQ8A 4MBPA 4TLLB 3TKDA 3EHUA 1MY2A 3A3CA 4RK9A 5I7IA 2FNCA 4ZDMA 4P8BA 2AIXA 2D21A 3D1RA 2V4CA 1AIVA 2V25A 4GQOA 1D9YA 4FEDA 2I3WA 2THIA 4YKKA 3N6TA 5H8NB 3ZSFA 4DIGA 1GVCA 4BDRA 4G8NA 2XXPA 3GBBA 3K2DA 2ANJA 4QBAA 4GXSB 4GX3A 4KPTA 4X8RA 4PE3A 4N8GA 2WX9A 4DLDA 4F22A 3C31A 3OELA 5EQ9A 3KN8A 3KOSA 5CMCA 4P0GA 4F31B 2Y7PA 4I3YA 1LAXA 3MJNA 1NV6A 5I56A 2ALUA 1CNQA 2Q89A 2RC9A 2O84X 4Q5TA 3UK4A 4PCDA 3MAMA 1GV8A 3TAJA 4G68A 1H76A 3OENA 4DI3D 3FXRA 1UTBA 4ECFA 3TTKA 1G0IA 1OIBA 2GQ1A 4P9KA 3SEYA 2HCAA 1USYE 2FHYA 4Q30B 2HZLA 2O1MA 1SI0A 4ONYA 4HTGA 1JP4A 2R9JA 4PFIA 4JWXA 1TFDA 1R9QA 4XF5A 5EYGA 4BDNA 4JSDA 3K00A 1FPJA 3RQTA 3EF7A 4NN3A 1B7HA 1BLFA 2WBDA 2QPQA 1FTAA 1GR2A 1MXYA 4OMBA 4WEDA 1M5FA 1IIWA 1INPA 1XOCA 4WEPA 1XC1A 3FUZA 4IY6A 4ZEIA 5B70A 1IITA 4G8HA 5FHNA 3S9NC 3QSLA 1ZU0A 1VR5A 2HPGA 1Z7ME 4RYAA 4LA9A 1IMBA 1LFHA 5KDTB 4F1UA 4QSCA 4NF4A 3MQ9A 2P0SA 4JWOA 1MH4A 1LCFA 2F6GA 1ZJLA 5I58A 4LP2B 2XD3A 4OVJA 2DXYA 4MLQA 4OEVA 1Z7NE 2YJPA 2Y7WA 4UABA 3LC8A 5ICTA 2B4MA 3L6GA 3MZ1A 1IEJA 4ZE9A 5ET8A 3RLFE 3V8XB 1FCKA 3OEMA 3KEIA 5ELVA 4KD5A 1FW0A 3G3FA 3O6IA 3MP8A 2B4LA 4OHNA 1LSTA 2UXAA 1ANFA 4H6DA 2QS2A 2I58A 1RYXA 4NMYA 3T22A 4U21A 1USYH 4BDMA 3O97A 4NF6A 3TEPA 1IXHA 1MXVA 2YPNA 3H06B 4RPNA 3PU5A 4IY5A 1PC3A 4MCOA 2WBBA 2Q8MA 3HPIA 1Y1MA 3H6VA 1MG1A 5ITPA 3FVKA 4YB7A 2VT5A 1B3GA 2G93A 1EH3A 2WKYA 1DOTA 3B6TA 1LBXA 1N3XA 1UQWA 2HZKA 4BDQA 2WEFA 3Q27A 3CSBA 3T9VA 3AXFA 4QFLA 4PFYA 4EQ9A 4F18A 2ABHA 3Q28A 4G2ZA 3TODA 3HN0A 3ILUB 3TMGA 3EKIA 2XWOA 5LTCA 3ONMA 4R9FA 2F35A 1YPNA 3FJ7A 2ONRA 4MFIA 5TP9B 4LONB 5AA3A 3O66A 2DWHA 1MPBA 1ZTYA 1D3KA 3U1OA 1M5BA 3RN8A 2AYSA 1D9VA 2OX3A 1PBQA 2QL3A 3FGSA 4GWXA 3KC1A 4NHBA 4OA4A 2Z8DA 4EQ7A 2I49A 1CE2A 2AL4A 4R2FA 4DXUA 5HPQA 1US4A 2ONKE 3H3GA 4PGPA 3U8QA 1B9JA 2VHAA 1Y20A 3VVEA 2DE3A 4RY1A 5F24A 2L5VA 3VLWA 3LSLA 2G29A 3KBRA 1DTZA 2F97A 3OO7A 1XVXA 2CZLA 2RCBA 3PUWE 2ZNTA 4TQUQ 1B3HA 4H8IA 2PT1A 3H03A 2F6PA 2OWTA 2W7YA 1H43A 1NI9A 3PPQA 1SQYA 3IK6B 4FORA 2P3VA 4AB6A 3RUMA 1EU8A 3MYUA 1NFTA 1R6ZA 4HS7A 2DWIA 4O7IA 3IOVA 3KOTA 2OK2A 2DQVA 4F2QA 5K2XA 1FQCA 1FPFA 1P1WA 2Z22A 4QRZA 1O64A 2GRVA 1N7XA 2PYYA 3U72A 3D4CA 1LB9A 4ND9A 1PB8A 3CR9A 2Y5KA 4I40A 4GRKA 4KYSA 3MUQA 5I56B 3MP6A 4EQBA 3PTYA 1B3LA 4QSDA 1B3FA 3I6VA 4X1BA 4PQJA 2HAUA 3IL1B 2XXKA 4EDPA 3TTRA 1FPEA 3KN3A 1A7LA 1Q1KA 1UTBB 1XHYA 3VLUA 1XT8A 3PMVA 3TCGA 3OO9A 5CMKA 1N0TA 4PDHA 3MVZA 1IMFA 1DMBA 4PDDA 4ELQA 3RTFB 4Q8RA 4QFOA 3H7MA 3PUXE 4MJOA 1LFGA 1JEVA 4XKPA 1B6HA 3O6HA 3THIA 4GD5A 4GX4A 4N17A 1AH5A 2XXUA 3DP4A 3RPLA 3VFJA 3O29A 5CBSA 1I6BA 4RJZA 4FIMA 3JV9A 3LBSA 4N13A 3KC0A 1MXZA 1FPIA 4F3BA 4NWCA 2V93A 3MVXA 4XFEA 2NOOA 4IR8A 5JTYA 2FIEA 1A54A 2YLNA 1LAFE 3R26A 1LAGE 1Y1ZA 4HXVA 4PC9A 3GYYA 4PFTA 1YAEA 4IO2A 2CEXA 5I2NB 2UVHA 3CFXA 2OWZA 3PMWA 1IQ7A 2QS1A 4DE8A 3C35A 2V3QA 1KWHA 2Z23A 4HCWA 4RXLA 3K1NA 1NKXA 2GFEA 4H0WA 4ZEBA 4F3GA 1QULA 4ESXA 4KQPA 1LBBA 5ISUA 3FV1A 5JTYB 2F34A 5A5LA 4YZZA 2P1SA 3TDJA 1A55A 4Q0CA 2OCUA 4XKRA 3K4UA 1MM6A 3QK6A 1ZIUA 3KGCA 5H8QA 4KFQA 1IXGA 4OESA 1B3EA 4POWA 1H45A 4MNIA 2CEYA 3E79A 3PD8A 1PDAA 4N4UA 3ZKKA 1PB9A 4DDDA 2FVZA 3MPLA 1VE4A 5DT6A 4HE0A 1RYOA 1K9ZA 1D9QA 4QFNA 1URDA 1FSAA 5KCJB 4R74A 1S7YA 3EN3A 4LZ8A 4PTKA 4I1DA 2CZKA 3MPKA 1MY0A 3CRBA 1S9TA 5T3JA 4P11A 5EQ7A 3G3GA 1MY4A 1JNFA 2REJA 2A5SA 2ZMBA 3K0VA 1NUYA 4MNCA 1EZ9A 2ZZXA 2D3IA 4ZEKA 4ZZEA 4R6HA 3FXUA 3U94A 3QIMA 1II5A 3KG2A 2UYEA 4I9DA 2VPNA 1BTJA 1FBEA 4GWSA 4BDOA 1MQJA 1HSJA 5CMMA 1YTVA 3K01A 4X9TA 2F5XA 5H8SA 2QMXA 4PBQA 5FHOA 1NH8A 2LAOA 1Y4CA 3IJOB 3SEUA 2ZYKA 3K6UA 2VP1A 2NWJA 1IXCA 2QS4A 3TCHA 2DSFA 4F1YA 1WVJA 3M3LA 1Y4TA 4LATA 1B5JA 3FJMA 1TT1A 1JW1A 1NV3A 1FRPA 4JSOA 1SVXB 4OTEA 3K6VA 5JK4A 4NE4A 4FJPA 3A3UA 1R9LA 2BJIA 3FBPA 3RNNA 3LUYA 4O7MA 1DK4A 1QJMA 1JVYA 1EYIA 4JBZA 4PFWA 4QHQA 4EF1A 4U22A 2VD2A 4U4SA 4X1DA 3K1MA 1MPDA 2RC7A 4XEQA 4GWWA 1HSLA 5AE4A 2H4IA 3IO6A 3S9EA 4R75A 1GTKA 2QVRA 1JETA 4I8CA 3B6WA 2H99A 2PMSA 5DEXB 4F39A 1BIYA 5A5XB 5EYHA 1A8EA 3BFUA 1FPKA 2Y7IA 5CM6A 4XKQA 2F7AA 2UVGA 3CG3A 4DCXA 3T9XB 3TTMA 1NL5A 4QSEA 4R6KA 3SDFA 2DE2A 2HXWA 4JWYA 1S50A 1UTHB 4NF8B 1P1UA 3S9MC 1NMUA 1VFDA 1DSNA 2I0CA 3IOWA 1POY1 1RKMA 3MSTA 4NG7A 3FV2A 4IO5A 2BJJX 3TZAA 4GF8A 5IM2A 1L5TA 2A5TA 3OOAA 2XWKA 4TOZA 1QW0A 1YYZA 1D4NA 3N5LA 3LUZA 2O6AA 4GWZA 3TCFA 5CC2A 3CFZA 3TFLA 5IZZA 4N91A 2RINA 2HXRA 3BFTA 3C4MA 4OVRA 4U2RA 1G0HA 1NUZA 4WKMA 1PB7A 1I6AA 3B7DA 5DVJA 5AA2D 1SI1A 3DM0A 4XTCQ 1A99A 2XXRA 3Q26A 3ECRA 4KR5A 2R6GE 3RPLB 2R8TA 2A5TB 3VVDA 4IO3A 4OWDA 5B7DA 3IB2A 5I5PA 4H5FA 1LLSA 3E13X 3EPEA 4R2BA 1NUWA 4GOTA 3M8UA 4PF6A 5CRYA 3N26A 2F7BA 3BIGA 3PUZE 1B2HA 2KR0A 4H65A 2JJKA 5EHMA 4P3LA 4GIZA 4QFPA 2ZYOA 4YB6A 1AMFA 5TPAA 2ZZVA 1I6QA 4QFKA 3NOHA 3CI8A 1N3WA 2Y7RA 4LZ7A 2PBWA 4PE5B 4YB5A 3O28A 4IGRA 2XXHA 2F8DA 1YZ0A 3ROJA 4YMAA 1RDYA 3FJGA 3DP6A 3LSWA 1UIVA 2XXIA 4YMBA 2O69A 1H44A 3LSXA 1NV4A 2X7QA 3N94A 5LDZA 2Y5LA 5AA4B 1B0LA 3FVGA 1NV5A 2OLBA 4NTLA 3DLNA 4PAIA 4K3FA 3WAEA 4NAPA 4KHZE 2O1LA 3CSGA 4HE2A 3GLBA 4ISUA 1KA1A 2H9BA 4N6DA 3KN7A 4DI4B 4Z0IA 3T9UA 3VE1B 3C32A 2O7IA 4LUBA 1EZOA 5H8HB 1GGGA 1MY3A 3VLVA 4PF8A 1A40A 3OSRA 4FBPA 1WDNA 2XXTA 5DYHA 5L8DA 1MDP1 2H5YA 3PUYE 1FPBA 2MKZA 3IB1A 3O2AA 4OETA 3S4UA 4BDLA 3KBZA 3T96B 4AS5A 3SEWA 1CB6A 1SW4A 4O3CA 3PD9A 5AA2B 1MXUA 4MMPA 4IO4A 3D4GA 3GXAA 1OQHA 2Y84A 3MZBA 4OFLA 4GBVA 2Q8JA 2VOZA 2PVUA 3MWBA 5IAIA 1FBCA 1NNTA 2XHDA 5L9SA 3IB0A 2H98A 2E1SA 4O94A 1QVSA 5I57B 4NF0A 1B0HA 1LBYA 4PAFA 4OFJA 4U1ZA 3IO4A 3C36A 3W15C 1O63A 4DCYA 5DW8A 3JYRA 2XWVA 1URSA 4X48A 1DPPA 1AOVA 1JEUA 4LN5A 5I2NA 2F78A 3QUFA 4ZECA 3S9LC 3PPPA 1DCUA 1B46A 1N04A 1FTMA 3GBAA 2QSXA 5EYFA 4KYDA 3KZGA 4RA1A 4OVPA 2XWIA 2QJEA 1P1QA 3U65A 2ZNSA 4ZEDA 5FHMA 3VXBA 1TWYA 4RNSA 2O7UA 1MQDA 3KSJA 4PFBA 1BKAA 4R9GA 5H8FB 4F29A 5F1QA 5I59A 3PUVE 5IZ3A 4N6KA 1NV7A 3N6UA 1N76A 4P0IA 1FJ6A 4NF6B 1KZ8A 1FQAA 1OMPA 4C1UA 1SD3A 3FZVA 2DOJA 4GLIA 4POXA 1LEVA 4FEBA 5ICQA 1SW2A 3ILTB 3FIRA 1FJ9A 3RY3A 3V83A 1DBZA 4NGUA 4IB2A 1YXIA 1FBGA 4OZ9A 1Q35A 4F3SA 1MQHA 4ZE8A 5J1DA 1P99A 4OANA 4ESWA 1IZ1A 3RGYA 1PBPA 3UA8A 4YKIA 3PV0E 2I48A 4DZ1A 5IZ3B 4LQ2A 1M5EA 5I84A 2DWJA 1M5CA 1DTGA 4F19A 2CZHA 1O7TA 1YCJA 2REGA 3GZGA 2PCRA 1FQDA 4XIGQ 1MDQA 2F36A 3OSQA 2XXWA 4OXVA 1P1OA 2HAVA 4U23A 3H6TA 3W9WA 2B3BA 1NH7A 3MVYA 4GBWA 4EXKA 2XA5A 3HO7A 4G68C 1B52A 5IKBA 4FATA 3TUSA 2ZYNA 2Z8EA 4OVTA 1EZPA 3SERA 1QUIA 2Q88A 1ZBMA 1FTKA 5CMBA 3UORA 3RYDA 3FVOA 4ZS9A 1LFIA 2Y7KA 3IOUA 3BIHA 1NNFA 3TYHA 1N84A 1ELJA 5ET5A 1LCTA 4YKPA 1POTA 3HSTA 4DXBA 5BWJA 1MH3A 1MXWA 3A29A 4XXUA 4EF2A 3C33A 5BUUA 3VVFA 2QVUA 4QF9A 4G77A 3PGFA 2I4BA 2R71A 4LVQA 1MS7A 1XI6A 4IO6A 3IX1A 3E9XA 2ZYMA 2Z8FA 2HEUA 3B8BA 2ZNUA 4HE1A 2P2AA 1QGXA 5DTBA 4HCYA 2FBPA 1FBFA 3V89B 2RKMA 5ET6A 2Q2AA 1FBDA 4MEVA 1LGBC 1QUKA 4MHFA 3JZJA 3PPOA 1EYJA 3SEVA 3LR1A 3T0JA 5ESYA 1K9YA 4R73A 4I62A 3HHFA 3E3KA 3IFCA 3KJ7A 1FBPA 1FTJA 1Y9UA 2UVIA 2ESNA 1JW5A 4AB5A 2IA4A 1ZMGA 5AA4A 3KJTA 1B7UA 3QAXA 3RPWA 2F3BA 5IGAA 5TPAB 3V5AA 2XXXA 1LBVA 4AS4A 4MLVA 5FTHA 3QUJA 2OJTA 5FBPA 3B50A 2DWAA 1A8FA 3K6XA 1FPDA 3IFAA 3T9HB 1R1NA 3OMBA 1Y3PA 1LBZA 1MRPA 1NUXA 3U92A 2M8CA 2Q2CA 1JW4A 4R72A 1LAHE 2WYPA 4TLMB 3CIJA 3MW0A 3P7IA 4OEUA 3RT6B 1H3DA 3I3VA 3A09A 1RDXA 3ZKLA 3FXBA 3Q29A 4OERA 3DELB 2I3VA 4E0XA 4MIJA 2QRYA 5EQ8A 1B7ZA 1VFEA 4EXLA 4H45A 4RK2A 1IUDA 2DXRA 2KQZA 3HHGA 2ONSA 3F11A 2DVCA 1SBPA 4M4GA 3ISPA 4PP0A 1FPGA 2IEEA 4P1EA 4JB7A 1ZKBA 3G3KA 3B6QA 2FYIA 1B4HA 1N7WA 5AA2A 1TFAA 2RCAA 3IOTA 2B3FA 2X26A 2UYFA 2H25A 4L17A 4GL8A 1LBCA 1MM7A 3CG1A 4H67A 4PBHA 1NV2A 5I2KA 4NEDA 3E4RA 4G68B 5CBRA 2WYKA 1NV1A 3IJXB 2PT2A 1NNPA 3VV5A 3FVNA 3MVWA 4BLAA 1SYHA 4KXPA 1Y3QA 4LQ5A 1Y3NA 3CVGA 5TU0A 3ODBA 4PAKA 4AQ4A 1NV0A 1FTOA 4FECA 3LSFB 4P47A 3CHGA 4F1VA 2GHBA 4X04A 4LZ5A 4C0RA 2GH9A 4ELOA 2XX8A 4OENA 3Q25A 5KDTA 4OYVA 5H8NA 4GWYA 4JVCA 1JQFA 2DDKA 1B32A 1FQBA 1FPLA 1AWBA 1QKAA 1LB8A 2GHAA 5I58B 5LOMA 1LBWA 1Q9DA 5ITOA 4ZZAA 4ELPA 3K6WA 4N81A 3O9PA 3W9VA 3ZS6A 3I5OA 4N8YA 3SETA 5KCJA 3G7WA 3G3IA 5DVFA 3G3HA 4UA8A 3S2VA 5J16A 2FA7A 3FXQA 3R7XA 4WXJA 2X7PA 2XD2A 2XXVA 5IZ1A 2QMWA 1WODA 2RF1A 4O8MA 3VXCA 4NF4B 1MY1A 5I2KB 2F7CA 3KSXA 3PPRA 3U93A 4JXIA 4IO7A 2RC8A 3MZ9A 2I0BA 4DXCA 4U1OA 1DPEA 4KCCA 4O3AA 1XS5A 3VDFA 5I57A 1J1NA 4EUOA 4YKJA 1KA0A 1OQGA 3EHSA 3QXMA 4ELRA 2PFYA 3UP9A 2HHMA 1QKBA 2V84A 1B1HA 4JVDA 4PFUA 3OXNA 2KLFA 5L9MA 4RPOA 3M3FA 1IMDA 3TTLA 3FD3A 4FAJA 2DE4A 3OO8A 3G3JA 1FTLA 4P56A 5EHSA 4O3BA 1B4ZA 4PFRA 1OLCA 4MH5A 4U4XA 1JVXA 3PMXA 2DP8A 3LV0A 3SESA 1IMAA 1B05A 2VD3A 4G4PA 3TTNA 4JVIA 4NF5A 1MQIA 4MF3A 4PGNA 1URGA
chains in the Genus database with same CATH topology
2F5XA 4H8JA 5H8SA 3FATA 4ESWA 1IZ1A 3KEIA 1PBPA 3M3KA 4YKIA 5ELVA 1FQFA 2O51A 3PV0E 4KD5A 3RGYA 2QMXA 1FW0A 2I48A 3G3FA 3O6IA 4LQ2A 3MP8A 5H8QB 1M5EA 1B51A 4OHNA 2DWJA 1M5CA 4OFOA 5FHOA 1LSTA 5I84A 4OQOA 1DTGA 1NH8A 1ANFA 2LAOA 2QS2A 1O7TA 2UXAA 4GXAA 4H6DA 4F19A 1YCJA 1Y4CA 2I58A 3BBRA 1P1NA 1RYXA 3C34A 3IJOB 4NMYA 3T22A 4U21A 3SEUA 4DZ1A 1USYH 2ZYKA 5JEIA 4BDMA 2REGA 3K6UA 2VP1A 3GZGA 3O97A 4NF6A 3HV1A 3TPAA 3TEPA 1FQDA 4XIGQ 1IXHA 3OD7A 2NWJA 1IXCA 1MDQA 1QUJA 1MXVA 2F36A 2XXWA 2QS4A 2YPNA 2DSFA 1IXIA 3H06B 3O6GA 3OSQA 3TCHA 4RPNA 3IR1A 4OXVA 3PU5A 1P1OA 2HAVA 4F1YA 1WVJA 3M3LA 4U23A 3H6TA 4IY5A 1Y4TA 5DEXA 3W9WA 2B3BA 1NH7A 1PC3A 3MVYA 1B5JA 1ATGA 4LATA 4EXKA 5L9OA 1NNKA 3FJMA 5H8FA 1TXFA 3HO7A 4G68C 3HPIA 3K1PA 1TT1A 1Y1MA 1JW1A 4JSOA 1B52A 5JK4A 1SVXB 4OTEA 3K6VA 4C1TA 3H6VA 4NE4A 1MG1A 4FJPA 4NF5B 2XXQA 3A3UA 4FATA 5ITPA 5K2YA 2ZYNA 1R9LA 2Z8EA 3FVKA 3TUSA 2I6EA 4YB7A 5KDTA 1B3GA 2G93A 2UVJA 4YICA 2E0SA 4N07A 2XXYA 1EH3A 3LUYA 3RNNA 1EZPA 1QJMA 4JDFA 1JVYA 4JBZA 4H5GA 2WKYA 1DOTA 4PFWA 4QHQA 3SERA 4EF1A 1QUIA 3B6TA 2Q88A 1ZBMA 1FTKA 2VD2A 4U22A 4U4SA 5CMBA 5AA1A 4GVOA 3UA8A 4X1DA 3BKIB 3FVOA 3UORA 1N3XA 3K1MA 4E0WA 4ZS9A 1LFIA 1UQWA 2HZKA 3Q27A 1MPDA 2Y7KA 2ZXTA 2RC7A 3IOUA 3R6UA 4UACA 4BDQA 3CSBA 3T9VA 3USDA 1NNFA 3TYHA 3AXFA 1N84A 1ELJA 3CFLA 1LCTA 3HCQA 4H1XA 4YKPA 1HSLA 4QFLA 4PFYA 1UTHA 4NF8A 4EQ9A 5AE4A 4F18A 2H4IA 2ABHA 1POTA 3IO6A 3PPNA 3Q28A 5CI5A 5M2VA 3S9EA 4R75A 1GTKA 1JETA 4I8CA 4G2ZA 2VGQA 3TODA 3B6WA 3UN6A 3HN0A 3ILUB 3TMGA 2H99A 2PMSA 3HSTA 4DXBA 2D5WA 5DEXB 2V3TA 4F39A 1BIYA 1SW5A 3TQLA 5BWJA 5IKBA 2NUVA 1MH3A 5A5XB 4YU0A 1M5DA 1MXWA 3ONMA 1ZLQA 4R9FA 1A8EA 2F35A 1YPNA 3FJ7A 3BFUA 2OBGA 4XXUA 2ONRA 3C33A 4EF2A 2Y7IA 5CM6A 4MFIA 3IORA 5TP9B 4LONB 3UIFA 5AA3A 3O66A 5BUUA 4XKQA 2F7AA 2DWHA 2UVGA 3CG3A 4DCXA 5KZTA 3T9XB 1MPBA 3VVFA 5I59B 1AL3A 4G77A 4QF9A 3TTMA 1NL5A 3PGFA 2I4BA 3RTWB 2R71A 4LVQA 1ZTYA 1MS7A 4IO6A 1D3KA 3U1OA 4QSEA 4R6KA 3IX1A 3E9XA 1M5BA 2ZYMA 3RN8A 1MPCA 2DE2A 2HQ0A 2HXWA 4JWYA 3SDFA 1S50A 2Z8FA 2AYSA 1VSOA 2HEUA 1D9VA 1PBQA 2QL3A 3FGSA 4RXLA 2ZNUA 1UTHB 2P2AA 4NF8B 1SDXA 1P1UA 3S9MC 5DTBA 1PEBA 4HCYA 2Z8DA 4EQ7A 1FQEA 1NMUA 2I49A 1CE2A 3DP8A 2AL4A 4Z7EA 4R2FA 3V89B 3L6HA 3TFLA 1VFDA 2RKMA 4DXUA 1DSNA 2Q2AA 2QS3A 2XX9A 3OO6A 3UGWA 4ZEFA 2B65A 2I0CA 5HPQA 1LGBC 1US4A 2ONKE 3KFMA 3H3GA 3IOWA 1POY1 1QUKA 3C9HA 1RKMA 3FV2A 3FASA 4IO5A 3JZJA 3U8QA 2BJJX 1B1XA 1B9JA 3PPOA 4KCDA 3H6WA 3MBPA 3SEVA 3LR1A 2VHAA 3TZAA 4GF8A 5TP9A 1Y20A 4R73A 3VVEA 4I62A 3HHFA 2A5TA 3OOAA 4KI0E 1L5TA 4TOZA 2DE3A 1QW0A 3E3KA 1MQGA 2XX7A 3KJ7A 4RY1A 3N5LA 1D4NA 3QYTA 1FTJA 1Y9UA 2O6AA 3VLWA 2UVIA 3LSLA 2G29A 4R6YA 2ESNA 4FE8A 3TCFA 1JW5A 3KBRA 4HW8A 5CC2A 1DTZA 2F97A 3CFZA 3OO7A 4AB5A 1XVXA 1XVYA 2CZLA 2IA4A 2PX1A 2RCBA 1ZMGA 2ZNTA 3PUWE 4TQUQ 5AA4A 3SEXA 3KJTA 2RINA 4F2QA 1B3HA 1B7UA 4H8IA 1SW1A 1UIUA 2PT1A 3H03A 4G8MA 3IAZA 3BFTA 2F6PA 3C4MA 1OVTA 4U2RA 3QAXA 3RPWA 1T0KA 2OWTA 5F7VA 4WKMA 2W7YA 1PB7A 5TPAB 1I69A 1F9BA 1I6AA 3B7DA 5DVJA 4F2OA 5AA2D 2V3UA 1SI1A 1H43A 5A5XA 1B58A 3MC2A 3PPQA 2XXXA 3DM0A 1SQYA 4GWOA 3IK6B 4FORA 3V5AA 2I4CA 4THIA 5DVIA 4MLVA 4GFRA 3EHTA 1A99A 2XXRA 4XTCQ 3Q26A 2DS9A 5FTHA 4AB6A 3K02A 3ECRA 3H6UA 3QUJA 4KR5A 3RUMA 2OJTA 5H8HA 1EU8A 2R6GE 4XKNA 1OLAA 2DWAA 1NFTA 1R6ZA 1A8FA 2OZZA 2A5TB 4HS7A 2DWIA 3K6XA 4GL0A 3VVDA 3IOVA 2CMOA 4F3PA 3KOTA 1B5HA 4IO3A 4OWDA 5B7DA 3TQWA 2OK2A 2DQVA 3IB2A 5HBCA 3T9HB 1MXXA 5K2XA 3TELA 1FQCA 4H5FA 4YAHX 1R1NA 1P1WA 2Z22A 3OMBA 3T93B 1LLSA 4QRZA 1O64A 2OWSA 3E13X 3EPEA 1Y3PA 1MRPA 2GRVA 4GOTA 3M8UA 4R2BA 1N7XA 2PYYA 5CRYA 3U92A 1BP5A 2M8CA 3N26A 2NVUB 3U72A 2F7BA 3D4CA 3PUZE 1B2HA 1SYIA 4PETA 2Q2CA 4H65A 4NWDA 1JW4A 1LB9A 3H4ZA 4R72A 4ND9A 1LAHE 5EHMA 4TLMB 1PB8A 3CR9A 4GIZA 4QFPA 2ZYOA 4GRKA 3WAFA 4KYSA 1AMFA 4YB6A 3CIJA 3MUQA 3MW0A 2NXOA 2HFBA 3P7IA 4OEUA 2DYXA 3RT6B 5FTIA 1H3DA 5TPAA 3I3VA 5I56B 1US5A 1I6QA 3MP6A 4QFKA 4N6PA 3A09A 4EQBA 5HM4B 2DVZA 1B3LA 3MP1A 3CI8A 3EQ1A 1N3WA 2Y7RA 4LZ7A 2PBWA 1B3FA 3I6VA 4PE5B 4QSDA 1OVBA 4KYEA 3Q29A 4X1BA 4OERA 3DELB 3SKPA 3ZKLA 4YB5A 2I3VA 3O28A 4IGRA 2XXHA 2F8DA 4E0XA 4PQJA 1B40A 4IGTA 3OEKA 3RT8A 4YMAA 2HAUA 2AL5A 2QRYA 3DP6A 3FJGA 3IL1B 3LSWA 1B7ZA 4M1VA 1VFEA 4EXLA 4EDPA 1UIVA 2O68A 2XXIA 3TTRA 4YMBA 3KN3A 1A7LA 2O69A 1H44A 2Q9TA 1HSEA 4RK2A 1IUDA 1Q1KA 1UTBB 1XHYA 3LSXA 1B5IA 2DXRA 3T66A 3HHGA 3S9NC 2X7QA 3N94A 2ONSA 3F11A 3VLUA 2DVCA 1SBPA 4M4GA 4MBPA 5AA4B 1XT8A 1B0LA 3FVGA 3PMVA 4PP0A 3EHUA 2OLBA 4TLLB 2IEEA 3TKDA 4NTLA 3TCGA 3OO9A 3DLNA 1MY2A 4JB7A 3A3CA 1ZKBA 4RK9A 4K3FA 1N0TA 3G3KA 3B6QA 5CMKA 3MVZA 2FNCA 2FYIA 1B4HA 4ZDMA 3WAEA 1N7WA 2AIXA 5AA2A 1DMBA 1TFAA 2D21A 4KHZE 2O1LA 3CSGA 4ELQA 2RCAA 1AIVA 3RTFB 3GLBA 4Q8RA 2V25A 4ISUA 3IOTA 4QFOA 2B3FA 3H7MA 3KN7A 2H9BA 3PUXE 4GQOA 1D9YA 2X26A 4FEDA 2I3WA 1LFGA 2UYFA 2H25A 2THIA 4L17A 1JEVA 4GL8A 4XKPA 4YKKA 1B6HA 3N6TA 3O6HA 5H8NB 4Z0IA 3THIA 3ZSFA 1LBCA 1MM7A 3T9UA 4DIGA 4GD5A 1GVCA 3VE1B 3C32A 2O7IA 3CG1A 4G8NA 4BDRA 4LUBA 4H67A 2XXPA 3GBBA 1EZOA 5H8HB 1GGGA 1MY3A 2ANJA 3K2DA 3VLVA 4NEDA 1AH5A 2XXUA 3DP4A 1A40A 3E4RA 3OSRA 4G68B 4GXSB 4KPTA 1WDNA 5CBRA 2XXTA 5DYHA 3VFJA 3IJXB 2PT2A 1NNPA 3VV5A 3FVNA 3MVWA 3O29A 4BLAA 1SYHA 4DLDA 3C31A 4F22A 5CBSA 3OELA 5L8DA 1MDP1 2H5YA 3PUYE 1Y3QA 4LQ5A 1Y3NA 1I6BA 3KN8A 4RJZA 4FIMA 3KOSA 3CVGA 5CMCA 3JV9A 3LBSA 3ODBA 4N13A 4P0GA 5TU0A 4AQ4A 1MXZA 4F3BA 3IB1A 3O2AA 4OETA 3S4UA 2Y7PA 4BDLA 4F31B 1FTOA 4NWCA 4FECA 3T96B 1LAXA 3LSFB 3SEWA 1CB6A 1SW4A 2V93A 4O3CA 3PD9A 4F1VA 5AA2B 1MXUA 2GHBA 3MVXA 2NOOA 5JTYA 4LZ5A 3MJNA 4IO4A 4C0RA 3D4GA 1A54A 3GXAA 2GH9A 1OQHA 2ALUA 2Y84A 3MZBA 4ELOA 5I56A 2Q89A 2XX8A 2YLNA 3Q25A 4OENA 4OFLA 1LAFE 2RC9A 2O84X 3R26A 1LAGE 4OYVA 1Y1ZA 5H8NA 4Q5TA 2Q8JA 3UK4A 2VOZA 4PFTA 1YAEA 4IO2A 3MAMA 1JQFA 1GV8A 2PVUA 5I2NB 3MWBA 3TAJA 1B32A 5IAIA 1FQBA 1QKAA 2UVHA 1LB8A 4G68A 1H76A 1NNTA 3OENA 3CFXA 3PMWA 2XHDA 5L9SA 3IB0A 2GHAA 3FXRA 5I58B 1UTBA 4ECFA 5LOMA 2H98A 3TTKA 1IQ7A 2E1SA 2QS1A 4ZZAA 5ITOA 4DE8A 4ELPA 3K6WA 1OIBA 3C35A 1QVSA 2V3QA 3SEYA 2HCAA 3O9PA 3W9VA 1KWHA 3ZS6A 5I57B 3I5OA 2Z23A 3SETA 5KCJA 1USYE 1B0HA 4HCWA 3G7WA 3G3IA 3K1NA 1NKXA 2GFEA 4Q30B 2HZLA 2O1MA 1SI0A 3G3HA 4ONYA 5DVFA 4H0WA 4UA8A 4ZEBA 3S2VA 4HTGA 1QULA 4F3GA 2FA7A 4ESXA 4KQPA 3FXQA 1LBBA 2R9JA 4OFJA 3R7XA 5ISUA 3FV1A 4WXJA 4U1ZA 3IO4A 3C36A 2X7PA 2F34A 5JTYB 3W15C 1O63A 4JWXA 1TFDA 2XD2A 4YZZA 2P1SA 3TDJA 2XXVA 1A55A 4DCYA 5I2KA 1R9QA 2QMWA 1WODA 4Q0CA 3JYRA 2RF1A 4BDNA 2OCUA 4NF4B 4XKRA 3K4UA 4JSDA 1MM6A 3VXCA 1URSA 4X48A 3QK6A 1MY1A 1ZIUA 5I2KB 2F7CA 1DPPA 3KGCA 3KSXA 1JEUA 3K00A 1AOVA 5H8QA 3RQTA 5I2NA 2F78A 3EF7A 3QUFA 4KFQA 3PPRA 3PPPA 3U93A 1IXGA 4OESA 4ZECA 1B3EA 4JXIA 3S9LC 1B7HA 1B46A 1BLFA 4IO7A 1N04A 4POWA 1FTMA 1H45A 3GBAA 2RC8A 3MZ9A 2QSXA 5EYFA 2QPQA 4KYDA 3KZGA 2I0BA 3PD8A 1PDAA 4RA1A 1GR2A 1MXYA 4OMBA 3ZKKA 1PB9A 4DDDA 4WEDA 4DXCA 3MPLA 1VE4A 1M5FA 4U1OA 1DPEA 4KCCA 1IIWA 5DT6A 1XOCA 4O3AA 1RYOA 4WEPA 1XS5A 3VDFA 4QFNA 2QJEA 5I57A 1J1NA 1URDA 1XC1A 3FUZA 4EUOA 1P1QA 4IY6A 4YKJA 2ZNSA 1OQGA 4ZEIA 4R74A 5FHMA 4ZEDA 5KCJB 5B70A 1S7YA 3EHSA 1IITA 3QXMA 3EN3A 4G8HA 4LZ8A 4I1DA 5FHNA 1TWYA 3QSLA 4RNSA 2O7UA 1MQDA 3KSJA 3VXBA 3MPKA 4ELRA 1BKAA 1MY0A 4R9GA 5H8FB 1ZU0A 3UP9A 5F1QA 4F29A 1VR5A 1QKBA 2V84A 3CRBA 1Z7ME 4RYAA 4LA9A 5I59A 1S9TA 1B1HA 1LFHA 4P11A 4PFUA 3OXNA 5KDTB 3G3GA 1MY4A 2KLFA 5L9MA 4RPOA 3M3FA 4F1UA 3PUVE 4QSCA 3TTLA 4NF4A 1JNFA 3FD3A 3MQ9A 2P0SA 4JWOA 4FAJA 2REJA 2DE4A 3OO8A 1MH4A 2A5SA 3G3JA 1LCFA 2ZMBA 1FTLA 3K0VA 2F6GA 1ZJLA 5EHSA 3N6UA 1EZ9A 1N76A 4P0IA 2D3IA 4O3BA 5I58A 4ZEKA 4ZZEA 4R6HA 4NF6B 1B4ZA 1FQAA 1OMPA 4C1UA 1SD3A 3FZVA 2DOJA 4LP2B 2XD3A 4OVJA 3FXUA 3U94A 1OLCA 3QIMA 4MH5A 2DXYA 1II5A 4GLIA 4POXA 4U4XA 1JVXA 4MLQA 3PMXA 4OEVA 1Z7NE 2DP8A 2Y7WA 2YJPA 3KG2A 3SESA 4FEBA 5ICQA 2UYEA 1B05A 1SW2A 3ILTB 4I9DA 2VD3A 1BTJA 3FIRA 3LC8A 3RY3A 4G4PA 3TTNA 3V83A 5ICTA 4IB2A 3L6GA 3MZ1A 4BDOA 1MQJA 1IEJA 4OZ9A 4ZE9A 1Q35A 1HSJA 1MQIA 1MQHA 4MF3A 4NF5A 1YTVA 5CMMA 3RLFE 4ZE8A 4F3SA 3V8XB 3K01A 4X9TA 1FCKA 3OEMA 5J1DA 1P99A 1URGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F5X A;  4H8J A;  5H8S A;  3FAT A;  4ESW A;  1IZ1 A;  3KEI A;  1PBP A;  3M3K A;  4YKI A;  5ELV A;  1FQF A;  2O51 A;  3PV0 E;  4KD5 A;  3RGY A;  2QMX A;  1FW0 A;  2I48 A;  3G3F A;  3O6I A;  4LQ2 A;  3MP8 A;  5H8Q B;  1M5E A;  1B51 A;  4OHN A;  2DWJ A;  1M5C A;  4OFO A;  5FHO A;  1LST A;  5I84 A;  4OQO A;  1DTG A;  1NH8 A;  1ANF A;  2LAO A;  2QS2 A;  1O7T A;  2UXA A;  4GXA A;  4H6D A;  4F19 A;  1YCJ A;  1Y4C A;  2I58 A;  3BBR A;  1P1N A;  1RYX A;  3C34 A;  3IJO B;  4NMY A;  3T22 A;  4U21 A;  3SEU A;  4DZ1 A;  1USY H;  2ZYK A;  5JEI A;  4BDM A;  2REG A;  3K6U A;  2VP1 A;  3GZG A;  3O97 A;  4NF6 A;  3HV1 A;  3TPA A;  3TEP A;  1FQD A;  4XIG Q;  1IXH A;  3OD7 A;  2NWJ A;  1IXC A;  1MDQ A;  1QUJ A;  1MXV A;  2F36 A;  2XXW A;  2QS4 A;  2YPN A;  2DSF A;  1IXI A;  3H06 B;  3O6G A;  3OSQ A;  3TCH A;  4RPN A;  3IR1 A;  4OXV A;  3PU5 A;  1P1O A;  2HAV A;  4F1Y A;  1WVJ A;  3M3L A;  4U23 A;  3H6T A;  4IY5 A;  1Y4T A;  5DEX A;  3W9W A;  2B3B A;  1NH7 A;  1PC3 A;  3MVY A;  1B5J A;  1ATG A;  4LAT A;  4EXK A;  5L9O A;  1NNK A;  3FJM A;  5H8F A;  1TXF A;  3HO7 A;  4G68 C;  3HPI A;  3K1P A;  1TT1 A;  1Y1M A;  1JW1 A;  4JSO A;  1B52 A;  5JK4 A;  1SVX B;  4OTE A;  3K6V A;  4C1T A;  3H6V A;  4NE4 A;  1MG1 A;  4FJP A;  4NF5 B;  2XXQ A;  3A3U A;  4FAT A;  5ITP A;  5K2Y A;  2ZYN A;  1R9L A;  2Z8E A;  3FVK A;  3TUS A;  2I6E A;  4YB7 A;  5KDT A;  1B3G A;  2G93 A;  2UVJ A;  4YIC A;  2E0S A;  4N07 A;  2XXY A;  1EH3 A;  3LUY A;  3RNN A;  1EZP A;  1QJM A;  4JDF A;  1JVY A;  4JBZ A;  4H5G A;  2WKY A;  1DOT A;  4PFW A;  4QHQ A;  3SER A;  4EF1 A;  1QUI A;  3B6T A;  2Q88 A;  1ZBM A;  1FTK A;  2VD2 A;  4U22 A;  4U4S A;  5CMB A;  5AA1 A;  4GVO A;  3UA8 A;  4X1D A;  3BKI B;  3FVO A;  3UOR A;  1N3X A;  3K1M A;  4E0W A;  4ZS9 A;  1LFI A;  1UQW A;  2HZK A;  3Q27 A;  1MPD A;  2Y7K A;  2ZXT A;  2RC7 A;  3IOU A;  3R6U A;  4UAC A;  4BDQ A;  3CSB A;  3T9V A;  3USD A;  1NNF A;  3TYH A;  3AXF A;  1N84 A;  1ELJ A;  3CFL A;  1LCT A;  3HCQ A;  4H1X A;  4YKP A;  1HSL A;  4QFL A;  4PFY A;  1UTH A;  4NF8 A;  4EQ9 A;  5AE4 A;  4F18 A;  2H4I A;  2ABH A;  1POT A;  3IO6 A;  3PPN A;  3Q28 A;  5CI5 A;  5M2V A;  3S9E A;  4R75 A;  1GTK A;  1JET A;  4I8C A;  4G2Z A;  2VGQ A;  3TOD A;  3B6W A;  3UN6 A;  3HN0 A;  3ILU B;  3TMG A;  2H99 A;  2PMS A;  3HST A;  4DXB A;  2D5W A;  5DEX B;  2V3T A;  4F39 A;  1BIY A;  1SW5 A;  3TQL A;  5BWJ A;  5IKB A;  2NUV A;  1MH3 A;  5A5X B;  4YU0 A;  1M5D A;  1MXW A;  3ONM A;  1ZLQ A;  4R9F A;  1A8E A;  2F35 A;  1YPN A;  3FJ7 A;  3BFU A;  2OBG A;  4XXU A;  2ONR A;  3C33 A;  4EF2 A;  2Y7I A;  5CM6 A;  4MFI A;  3IOR A;  5TP9 B;  4LON B;  3UIF A;  5AA3 A;  3O66 A;  5BUU A;  4XKQ A;  2F7A A;  2DWH A;  2UVG A;  3CG3 A;  4DCX A;  5KZT A;  3T9X B;  1MPB A;  3VVF A;  5I59 B;  1AL3 A;  4G77 A;  4QF9 A;  3TTM A;  1NL5 A;  3PGF A;  2I4B A;  3RTW B;  2R71 A;  4LVQ A;  1ZTY A;  1MS7 A;  4IO6 A;  1D3K A;  3U1O A;  4QSE A;  4R6K A;  3IX1 A;  3E9X A;  1M5B A;  2ZYM A;  3RN8 A;  1MPC A;  2DE2 A;  2HQ0 A;  2HXW A;  4JWY A;  3SDF A;  1S50 A;  2Z8F A;  2AYS A;  1VSO A;  2HEU A;  1D9V A;  1PBQ A;  2QL3 A;  3FGS A;  4RXL A;  2ZNU A;  1UTH B;  2P2A A;  4NF8 B;  1SDX A;  1P1U A;  3S9M C;  5DTB A;  1PEB A;  4HCY A;  2Z8D A;  4EQ7 A;  1FQE A;  1NMU A;  2I49 A;  1CE2 A;  3DP8 A;  2AL4 A;  4Z7E A;  4R2F A;  3V89 B;  3L6H A;  3TFL A;  1VFD A;  2RKM A;  4DXU A;  1DSN A;  2Q2A A;  2QS3 A;  2XX9 A;  3OO6 A;  3UGW A;  4ZEF A;  2B65 A;  2I0C A;  5HPQ A;  1LGB C;  1US4 A;  2ONK E;  3KFM A;  3H3G A;  3IOW A;  1POY 1;  1QUK A;  3C9H A;  1RKM A;  3FV2 A;  3FAS A;  4IO5 A;  3JZJ A;  3U8Q A;  2BJJ X;  1B1X A;  1B9J A;  3PPO A;  4KCD A;  3H6W A;  3MBP A;  3SEV A;  3LR1 A;  2VHA A;  3TZA A;  4GF8 A;  5TP9 A;  1Y20 A;  4R73 A;  3VVE A;  4I62 A;  3HHF A;  2A5T A;  3OOA A;  4KI0 E;  1L5T A;  4TOZ A;  2DE3 A;  1QW0 A;  3E3K A;  1MQG A;  2XX7 A;  3KJ7 A;  4RY1 A;  3N5L A;  1D4N A;  3QYT A;  1FTJ A;  1Y9U A;  2O6A A;  3VLW A;  2UVI A;  3LSL A;  2G29 A;  4R6Y A;  2ESN A;  4FE8 A;  3TCF A;  1JW5 A;  3KBR A;  4HW8 A;  5CC2 A;  1DTZ A;  2F97 A;  3CFZ A;  3OO7 A;  4AB5 A;  1XVX A;  1XVY A;  2CZL A;  2IA4 A;  2PX1 A;  2RCB A;  1ZMG A;  2ZNT A;  3PUW E;  4TQU Q;  5AA4 A;  3SEX A;  3KJT A;  2RIN A;  4F2Q A;  1B3H A;  1B7U A;  4H8I A;  1SW1 A;  1UIU A;  2PT1 A;  3H03 A;  4G8M A;  3IAZ A;  3BFT A;  2F6P A;  3C4M A;  1OVT A;  4U2R A;  3QAX A;  3RPW A;  1T0K A;  2OWT A;  5F7V A;  4WKM A;  2W7Y A;  1PB7 A;  5TPA B;  1I69 A;  1F9B A;  1I6A A;  3B7D A;  5DVJ A;  4F2O A;  5AA2 D;  2V3U A;  1SI1 A;  1H43 A;  5A5X A;  1B58 A;  3MC2 A;  3PPQ A;  2XXX A;  3DM0 A;  1SQY A;  4GWO A;  3IK6 B;  4FOR A;  3V5A A;  2I4C A;  4THI A;  5DVI A;  4MLV A;  4GFR A;  3EHT A;  1A99 A;  2XXR A;  4XTC Q;  3Q26 A;  2DS9 A;  5FTH A;  4AB6 A;  3K02 A;  3ECR A;  3H6U A;  3QUJ A;  4KR5 A;  3RUM A;  2OJT A;  5H8H A;  1EU8 A;  2R6G E;  4XKN A;  1OLA A;  2DWA A;  1NFT A;  1R6Z A;  1A8F A;  2OZZ A;  2A5T B;  4HS7 A;  2DWI A;  3K6X A;  4GL0 A;  3VVD A;  3IOV A;  2CMO A;  4F3P A;  3KOT A;  1B5H A;  4IO3 A;  4OWD A;  5B7D A;  3TQW A;  2OK2 A;  2DQV A;  3IB2 A;  5HBC A;  3T9H B;  1MXX A;  5K2X A;  3TEL A;  1FQC A;  4H5F A;  4YAH X;  1R1N A;  1P1W A;  2Z22 A;  3OMB A;  3T93 B;  1LLS A;  4QRZ A;  1O64 A;  2OWS A;  3E13 X;  3EPE A;  1Y3P A;  1MRP A;  2GRV A;  4GOT A;  3M8U A;  4R2B A;  1N7X A;  2PYY A;  5CRY A;  3U92 A;  1BP5 A;  2M8C A;  3N26 A;  2NVU B;  3U72 A;  2F7B A;  3D4C A;  3PUZ E;  1B2H A;  1SYI A;  4PET A;  2Q2C A;  4H65 A;  4NWD A;  1JW4 A;  1LB9 A;  3H4Z A;  4R72 A;  4ND9 A;  1LAH E;  5EHM A;  4TLM B;  1PB8 A;  3CR9 A;  4GIZ A;  4QFP A;  2ZYO A;  4GRK A;  3WAF A;  4KYS A;  1AMF A;  4YB6 A;  3CIJ A;  3MUQ A;  3MW0 A;  2NXO A;  2HFB A;  3P7I A;  4OEU A;  2DYX A;  3RT6 B;  5FTI A;  1H3D A;  5TPA A;  3I3V A;  5I56 B;  1US5 A;  1I6Q A;  3MP6 A;  4QFK A;  4N6P A;  3A09 A;  4EQB A;  5HM4 B;  2DVZ A;  1B3L A;  3MP1 A;  3CI8 A;  3EQ1 A;  1N3W A;  2Y7R A;  4LZ7 A;  2PBW A;  1B3F A;  3I6V A;  4PE5 B;  4QSD A;  1OVB A;  4KYE A;  3Q29 A;  4X1B A;  4OER A;  3DEL B;  3SKP A;  3ZKL A;  4YB5 A;  2I3V A;  3O28 A;  4IGR A;  2XXH A;  2F8D A;  4E0X A;  4PQJ A;  1B40 A;  4IGT A;  3OEK A;  3RT8 A;  4YMA A;  2HAU A;  2AL5 A;  2QRY A;  3DP6 A;  3FJG A;  3IL1 B;  3LSW A;  1B7Z A;  4M1V A;  1VFE A;  4EXL A;  4EDP A;  1UIV A;  2O68 A;  2XXI A;  3TTR A;  4YMB A;  3KN3 A;  1A7L A;  2O69 A;  1H44 A;  2Q9T A;  1HSE A;  4RK2 A;  1IUD A;  1Q1K A;  1UTB B;  1XHY A;  3LSX A;  1B5I A;  2DXR A;  3T66 A;  3HHG A;  3S9N C;  2X7Q A;  3N94 A;  2ONS A;  3F11 A;  3VLU A;  2DVC A;  1SBP A;  4M4G A;  4MBP A;  5AA4 B;  1XT8 A;  1B0L A;  3FVG A;  3PMV A;  4PP0 A;  3EHU A;  2OLB A;  4TLL B;  2IEE A;  3TKD A;  4NTL A;  3TCG A;  3OO9 A;  3DLN A;  1MY2 A;  4JB7 A;  3A3C A;  1ZKB A;  4RK9 A;  4K3F A;  1N0T A;  3G3K A;  3B6Q A;  5CMK A;  3MVZ A;  2FNC A;  2FYI A;  1B4H A;  4ZDM A;  3WAE A;  1N7W A;  2AIX A;  5AA2 A;  1DMB A;  1TFA A;  2D21 A;  4KHZ E;  2O1L A;  3CSG A;  4ELQ A;  2RCA A;  1AIV A;  3RTF B;  3GLB A;  4Q8R A;  2V25 A;  4ISU A;  3IOT A;  4QFO A;  2B3F A;  3H7M A;  3KN7 A;  2H9B A;  3PUX E;  4GQO A;  1D9Y A;  2X26 A;  4FED A;  2I3W A;  1LFG A;  2UYF A;  2H25 A;  2THI A;  4L17 A;  1JEV A;  4GL8 A;  4XKP A;  4YKK A;  1B6H A;  3N6T A;  3O6H A;  5H8N B;  4Z0I A;  3THI A;  3ZSF A;  1LBC A;  1MM7 A;  3T9U A;  4DIG A;  4GD5 A;  1GVC A;  3VE1 B;  3C32 A;  2O7I A;  3CG1 A;  4G8N A;  4BDR A;  4LUB A;  4H67 A;  2XXP A;  3GBB A;  1EZO A;  5H8H B;  1GGG A;  1MY3 A;  2ANJ A;  3K2D A;  3VLV A;  4NED A;  1AH5 A;  2XXU A;  3DP4 A;  1A40 A;  3E4R A;  3OSR A;  4G68 B;  4GXS B;  4KPT A;  1WDN A;  5CBR A;  2XXT A;  5DYH A;  3VFJ A;  3IJX B;  2PT2 A;  1NNP A;  3VV5 A;  3FVN A;  3MVW A;  3O29 A;  4BLA A;  1SYH A;  4DLD A;  3C31 A;  4F22 A;  5CBS A;  3OEL A;  5L8D A;  1MDP 1;  2H5Y A;  3PUY E;  1Y3Q A;  4LQ5 A;  1Y3N A;  1I6B A;  3KN8 A;  4RJZ A;  4FIM A;  3KOS A;  3CVG A;  5CMC A;  3JV9 A;  3LBS A;  3ODB A;  4N13 A;  4P0G A;  5TU0 A;  4AQ4 A;  1MXZ A;  4F3B A;  3IB1 A;  3O2A A;  4OET A;  3S4U A;  2Y7P A;  4BDL A;  4F31 B;  1FTO A;  4NWC A;  4FEC A;  3T96 B;  1LAX A;  3LSF B;  3SEW A;  1CB6 A;  1SW4 A;  2V93 A;  4O3C A;  3PD9 A;  4F1V A;  5AA2 B;  1MXU A;  2GHB A;  3MVX A;  2NOO A;  5JTY A;  4LZ5 A;  3MJN A;  4IO4 A;  4C0R A;  3D4G A;  1A54 A;  3GXA A;  2GH9 A;  1OQH A;  2ALU A;  2Y84 A;  3MZB A;  4ELO A;  5I56 A;  2Q89 A;  2XX8 A;  2YLN A;  3Q25 A;  4OEN A;  4OFL A;  1LAF E;  2RC9 A;  2O84 X;  3R26 A;  1LAG E;  4OYV A;  1Y1Z A;  5H8N A;  4Q5T A;  2Q8J A;  3UK4 A;  2VOZ A;  4PFT A;  1YAE A;  4IO2 A;  3MAM A;  1JQF A;  1GV8 A;  2PVU A;  5I2N B;  3MWB A;  3TAJ A;  1B32 A;  5IAI A;  1FQB A;  1QKA A;  2UVH A;  1LB8 A;  4G68 A;  1H76 A;  1NNT A;  3OEN A;  3CFX A;  3PMW A;  2XHD A;  5L9S A;  3IB0 A;  2GHA A;  3FXR A;  5I58 B;  1UTB A;  4ECF A;  5LOM A;  2H98 A;  3TTK A;  1IQ7 A;  2E1S A;  2QS1 A;  4ZZA A;  5ITO A;  4DE8 A;  4ELP A;  3K6W A;  1OIB A;  3C35 A;  1QVS A;  2V3Q A;  3SEY A;  2HCA A;  3O9P A;  3W9V A;  1KWH A;  3ZS6 A;  5I57 B;  3I5O A;  2Z23 A;  3SET A;  5KCJ A;  1USY E;  1B0H A;  4HCW A;  3G7W A;  3G3I A;  3K1N A;  1NKX A;  2GFE A;  4Q30 B;  2HZL A;  2O1M A;  1SI0 A;  3G3H A;  4ONY A;  5DVF A;  4H0W A;  4UA8 A;  4ZEB A;  3S2V A;  4HTG A;  1QUL A;  4F3G A;  2FA7 A;  4ESX A;  4KQP A;  3FXQ A;  1LBB A;  2R9J A;  4OFJ A;  3R7X A;  5ISU A;  3FV1 A;  4WXJ A;  4U1Z A;  3IO4 A;  3C36 A;  2X7P A;  2F34 A;  5JTY B;  3W15 C;  1O63 A;  4JWX A;  1TFD A;  2XD2 A;  4YZZ A;  2P1S A;  3TDJ A;  2XXV A;  1A55 A;  4DCY A;  5I2K A;  1R9Q A;  2QMW A;  1WOD A;  4Q0C A;  3JYR A;  2RF1 A;  4BDN A;  2OCU A;  4NF4 B;  4XKR A;  3K4U A;  4JSD A;  1MM6 A;  3VXC A;  1URS A;  4X48 A;  3QK6 A;  1MY1 A;  1ZIU A;  5I2K B;  2F7C A;  1DPP A;  3KGC A;  3KSX A;  1JEU A;  3K00 A;  1AOV A;  5H8Q A;  3RQT A;  5I2N A;  2F78 A;  3EF7 A;  3QUF A;  4KFQ A;  3PPR A;  3PPP A;  3U93 A;  1IXG A;  4OES A;  4ZEC A;  1B3E A;  4JXI A;  3S9L C;  1B7H A;  1B46 A;  1BLF A;  4IO7 A;  1N04 A;  4POW A;  1FTM A;  1H45 A;  3GBA A;  2RC8 A;  3MZ9 A;  2QSX A;  5EYF A;  2QPQ A;  4KYD A;  3KZG A;  2I0B A;  3PD8 A;  1PDA A;  4RA1 A;  1GR2 A;  1MXY A;  4OMB A;  3ZKK A;  1PB9 A;  4DDD A;  4WED A;  4DXC A;  3MPL A;  1VE4 A;  1M5F A;  4U1O A;  1DPE A;  4KCC A;  1IIW A;  5DT6 A;  1XOC A;  4O3A A;  1RYO A;  4WEP A;  1XS5 A;  3VDF A;  4QFN A;  2QJE A;  5I57 A;  1J1N A;  1URD A;  1XC1 A;  3FUZ A;  4EUO A;  1P1Q A;  4IY6 A;  4YKJ A;  2ZNS A;  1OQG A;  4ZEI A;  4R74 A;  5FHM A;  4ZED A;  5KCJ B;  5B70 A;  1S7Y A;  3EHS A;  1IIT A;  3QXM A;  3EN3 A;  4G8H A;  4LZ8 A;  4I1D A;  5FHN A;  1TWY A;  3QSL A;  4RNS A;  2O7U A;  1MQD A;  3KSJ A;  3VXB A;  3MPK A;  4ELR A;  1BKA A;  1MY0 A;  4R9G A;  5H8F B;  1ZU0 A;  3UP9 A;  5F1Q A;  4F29 A;  1VR5 A;  1QKB A;  2V84 A;  3CRB A;  1Z7M E;  4RYA A;  4LA9 A;  5I59 A;  1S9T A;  1B1H A;  1LFH A;  4P11 A;  4PFU A;  3OXN A;  5KDT B;  3G3G A;  1MY4 A;  2KLF A;  5L9M A;  4RPO A;  3M3F A;  4F1U A;  3PUV E;  4QSC A;  3TTL A;  4NF4 A;  1JNF A;  3FD3 A;  3MQ9 A;  2P0S A;  4JWO A;  4FAJ A;  2REJ A;  2DE4 A;  3OO8 A;  1MH4 A;  2A5S A;  3G3J A;  1LCF A;  2ZMB A;  1FTL A;  3K0V A;  2F6G A;  1ZJL A;  5EHS A;  3N6U A;  1EZ9 A;  1N76 A;  4P0I A;  2D3I A;  4O3B A;  5I58 A;  4ZEK A;  4ZZE A;  4R6H A;  4NF6 B;  1B4Z A;  1FQA A;  1OMP A;  4C1U A;  1SD3 A;  3FZV A;  2DOJ A;  4LP2 B;  2XD3 A;  4OVJ A;  3FXU A;  3U94 A;  1OLC A;  3QIM A;  4MH5 A;  2DXY A;  1II5 A;  4GLI A;  4POX A;  4U4X A;  1JVX A;  4MLQ A;  3PMX A;  4OEV A;  1Z7N E;  2DP8 A;  2Y7W A;  2YJP A;  3KG2 A;  3SES A;  4FEB A;  5ICQ A;  2UYE A;  1B05 A;  1SW2 A;  3ILT B;  4I9D A;  2VD3 A;  1BTJ A;  3FIR A;  3LC8 A;  3RY3 A;  4G4P A;  3TTN A;  3V83 A;  5ICT A;  4IB2 A;  3L6G A;  3MZ1 A;  4BDO A;  1MQJ A;  1IEJ A;  4OZ9 A;  4ZE9 A;  1Q35 A;  1HSJ A;  1MQI A;  1MQH A;  4MF3 A;  4NF5 A;  1YTV A;  5CMM A;  3RLF E;  4ZE8 A;  4F3S A;  3V8X B;  3K01 A;  4X9T A;  1FCK A;  3OEM A;  5J1D A;  1P99 A;  1URG A; 
#chains in the Genus database with same CATH topology
 4H8J A;  3FAT A;  3M3K A;  1FQF A;  2O51 A;  5H8Q B;  1B51 A;  4OFO A;  4OQO A;  4GXA A;  3BBR A;  4QXD A;  1P1N A;  3C34 A;  4OVQ A;  5JEI A;  3HV1 A;  3TPA A;  3OD7 A;  1QUJ A;  3O6G A;  1IXI A;  3IR1 A;  3QMF A;  5DEX A;  1ATG A;  5L9O A;  1NNK A;  5H8F A;  4G61 A;  1TXF A;  3K1P A;  5I59 B;  4C1T A;  4NF5 B;  2XXQ A;  4MNP A;  5K2Y A;  2I6E A;  2UVJ A;  4YIC A;  2E0S A;  4N07 A;  2XXY A;  4JDF A;  4H5G A;  3E78 A;  5AA1 A;  4GVO A;  4E0W A;  3BKI B;  2ZXT A;  3R6U A;  4UAC A;  3USD A;  3HFU A;  3CFL A;  3HCQ A;  4H1X A;  2Q74 A;  1IMC A;  1UTH A;  4NF8 A;  3PPN A;  5CI5 A;  5M2V A;  2VGQ A;  3UN6 A;  2D5W A;  2V3T A;  1SW5 A;  3TQL A;  2NUV A;  4YU0 A;  1M5D A;  1ZLQ A;  2OBG A;  2ZZW A;  3IOR A;  3UIF A;  5KZT A;  1AL3 A;  3RTW B;  4MX6 A;  2FIX A;  1MPC A;  2HQ0 A;  3T1B A;  1VSO A;  1VDW A;  4OVS A;  1SDX A;  4N15 A;  1PEB A;  1FQE A;  4Z7E A;  3SZP A;  3DP8 A;  3L6H A;  3UGW A;  2QS3 A;  2XX9 A;  3OO6 A;  4ZEF A;  2B65 A;  3KFM A;  4I3E A;  1EYK A;  3C9H A;  3FAS A;  1B1X A;  2PFZ A;  4KCD A;  3H6W A;  3MBP A;  1FBH A;  5ET7 A;  4P1L A;  5TP9 A;  2F3D A;  4KI0 E;  1MQG A;  2XX7 A;  3QYT A;  2QVV A;  4R6Y A;  4FE8 A;  4HW8 A;  5EQA A;  1XVY A;  2PX1 A;  3SEX A;  1BK4 A;  1SW1 A;  1UIU A;  4G8M A;  3IAZ A;  2VPO A;  4GWU A;  1OVT A;  1T0K A;  5F7V A;  1I69 A;  1F9B A;  4F2O A;  2V3U A;  5A5X A;  1B58 A;  3MC2 A;  4GWO A;  2I4C A;  4THI A;  5I3S A;  1SPI A;  5DVI A;  1IME A;  4GFR A;  3EHT A;  2DS9 A;  3K02 A;  3H6U A;  5H8H A;  4XKN A;  1OLA A;  2OZZ A;  4GL0 A;  2CMO A;  4F3P A;  1B5H A;  3TQW A;  5HBC A;  3TEL A;  1MXX A;  4YAH X;  3T93 B;  1RDZ A;  2OWS A;  1BP5 A;  2NVU B;  1SYI A;  4PET A;  2CZI A;  4NWD A;  3H4Z A;  2P3N A;  3WAF A;  2NXO A;  2HFB A;  2DYX A;  5FTI A;  1US5 A;  4MAG A;  4N6P A;  5HM4 B;  2DVZ A;  4H46 A;  3MP1 A;  3EQ1 A;  2QFL A;  1OVB A;  4KYE A;  3SKP A;  4GX6 A;  1B40 A;  4IGT A;  3OEK A;  3RT8 A;  2AL5 A;  4M1V A;  2O68 A;  4NX1 A;  2Q9T A;  1HSE A;  3T66 A;  1B5I A;  4NQ8 A;  4MBP A;  4TLL B;  3TKD A;  3EHU A;  1MY2 A;  3A3C A;  4RK9 A;  5I7I A;  2FNC A;  4ZDM A;  4P8B A;  2AIX A;  2D21 A;  3D1R A;  2V4C A;  1AIV A;  2V25 A;  4GQO A;  1D9Y A;  4FED A;  2I3W A;  2THI A;  4YKK A;  3N6T A;  5H8N B;  3ZSF A;  4DIG A;  1GVC A;  4BDR A;  4G8N A;  2XXP A;  3GBB A;  3K2D A;  2ANJ A;  4QBA A;  4GXS B;  4GX3 A;  4KPT A;  4X8R A;  4PE3 A;  4N8G A;  2WX9 A;  4DLD A;  4F22 A;  3C31 A;  3OEL A;  5EQ9 A;  3KN8 A;  3KOS A;  5CMC A;  4P0G A;  4F31 B;  2Y7P A;  4I3Y A;  1LAX A;  3MJN A;  1NV6 A;  5I56 A;  2ALU A;  1CNQ A;  2Q89 A;  2RC9 A;  2O84 X;  4Q5T A;  3UK4 A;  4PCD A;  3MAM A;  1GV8 A;  3TAJ A;  4G68 A;  1H76 A;  3OEN A;  4DI3 D;  3FXR A;  1UTB A;  4ECF A;  3TTK A;  1G0I A;  1OIB A;  2GQ1 A;  4P9K A;  3SEY A;  2HCA A;  1USY E;  2FHY A;  4Q30 B;  2HZL A;  2O1M A;  1SI0 A;  4ONY A;  4HTG A;  1JP4 A;  2R9J A;  4PFI A;  4JWX A;  1TFD A;  1R9Q A;  4XF5 A;  5EYG A;  4BDN A;  4JSD A;  3K00 A;  1FPJ A;  3RQT A;  3EF7 A;  4NN3 A;  1B7H A;  1BLF A;  2WBD A;  2QPQ A;  1FTA A;  1GR2 A;  1MXY A;  4OMB A;  4WED A;  1M5F A;  1IIW A;  1INP A;  1XOC A;  4WEP A;  1XC1 A;  3FUZ A;  4IY6 A;  4ZEI A;  5B70 A;  1IIT A;  4G8H A;  5FHN A;  3S9N C;  3QSL A;  1ZU0 A;  1VR5 A;  2HPG A;  1Z7M E;  4RYA A;  4LA9 A;  1IMB A;  1LFH A;  5KDT B;  4F1U A;  4QSC A;  4NF4 A;  3MQ9 A;  2P0S A;  4JWO A;  1MH4 A;  1LCF A;  2F6G A;  1ZJL A;  5I58 A;  4LP2 B;  2XD3 A;  4OVJ A;  2DXY A;  4MLQ A;  4OEV A;  1Z7N E;  2YJP A;  2Y7W A;  4UAB A;  3LC8 A;  5ICT A;  2B4M A;  3L6G A;  3MZ1 A;  1IEJ A;  4ZE9 A;  5ET8 A;  3RLF E;  3V8X B;  1FCK A;  3OEM A;  3KEI A;  5ELV A;  4KD5 A;  1FW0 A;  3G3F A;  3O6I A;  3MP8 A;  2B4L A;  4OHN A;  1LST A;  2UXA A;  1ANF A;  4H6D A;  2QS2 A;  2I58 A;  1RYX A;  4NMY A;  3T22 A;  4U21 A;  1USY H;  4BDM A;  3O97 A;  4NF6 A;  3TEP A;  1IXH A;  1MXV A;  2YPN A;  3H06 B;  4RPN A;  3PU5 A;  4IY5 A;  1PC3 A;  4MCO A;  2WBB A;  2Q8M A;  3HPI A;  1Y1M A;  3H6V A;  1MG1 A;  5ITP A;  3FVK A;  4YB7 A;  2VT5 A;  1B3G A;  2G93 A;  1EH3 A;  2WKY A;  1DOT A;  3B6T A;  1LBX A;  1N3X A;  1UQW A;  2HZK A;  4BDQ A;  2WEF A;  3Q27 A;  3CSB A;  3T9V A;  3AXF A;  4QFL A;  4PFY A;  4EQ9 A;  4F18 A;  2ABH A;  3Q28 A;  4G2Z A;  3TOD A;  3HN0 A;  3ILU B;  3TMG A;  3EKI A;  2XWO A;  5LTC A;  3ONM A;  4R9F A;  2F35 A;  1YPN A;  3FJ7 A;  2ONR A;  4MFI A;  5TP9 B;  4LON B;  5AA3 A;  3O66 A;  2DWH A;  1MPB A;  1ZTY A;  1D3K A;  3U1O A;  1M5B A;  3RN8 A;  2AYS A;  1D9V A;  2OX3 A;  1PBQ A;  2QL3 A;  3FGS A;  4GWX A;  3KC1 A;  4NHB A;  4OA4 A;  2Z8D A;  4EQ7 A;  2I49 A;  1CE2 A;  2AL4 A;  4R2F A;  4DXU A;  5HPQ A;  1US4 A;  2ONK E;  3H3G A;  4PGP A;  3U8Q A;  1B9J A;  2VHA A;  1Y20 A;  3VVE A;  2DE3 A;  4RY1 A;  5F24 A;  2L5V A;  3VLW A;  3LSL A;  2G29 A;  3KBR A;  1DTZ A;  2F97 A;  3OO7 A;  1XVX A;  2CZL A;  2RCB A;  3PUW E;  2ZNT A;  4TQU Q;  1B3H A;  4H8I A;  2PT1 A;  3H03 A;  2F6P A;  2OWT A;  2W7Y A;  1H43 A;  1NI9 A;  3PPQ A;  1SQY A;  3IK6 B;  4FOR A;  2P3V A;  4AB6 A;  3RUM A;  1EU8 A;  3MYU A;  1NFT A;  1R6Z A;  4HS7 A;  2DWI A;  4O7I A;  3IOV A;  3KOT A;  2OK2 A;  2DQV A;  4F2Q A;  5K2X A;  1FQC A;  1FPF A;  1P1W A;  2Z22 A;  4QRZ A;  1O64 A;  2GRV A;  1N7X A;  2PYY A;  3U72 A;  3D4C A;  1LB9 A;  4ND9 A;  1PB8 A;  3CR9 A;  2Y5K A;  4I40 A;  4GRK A;  4KYS A;  3MUQ A;  5I56 B;  3MP6 A;  4EQB A;  3PTY A;  1B3L A;  4QSD A;  1B3F A;  3I6V A;  4X1B A;  4PQJ A;  2HAU A;  3IL1 B;  2XXK A;  4EDP A;  3TTR A;  1FPE A;  3KN3 A;  1A7L A;  1Q1K A;  1UTB B;  1XHY A;  3VLU A;  1XT8 A;  3PMV A;  3TCG A;  3OO9 A;  5CMK A;  1N0T A;  4PDH A;  3MVZ A;  1IMF A;  1DMB A;  4PDD A;  4ELQ A;  3RTF B;  4Q8R A;  4QFO A;  3H7M A;  3PUX E;  4MJO A;  1LFG A;  1JEV A;  4XKP A;  1B6H A;  3O6H A;  3THI A;  4GD5 A;  4GX4 A;  4N17 A;  1AH5 A;  2XXU A;  3DP4 A;  3RPL A;  3VFJ A;  3O29 A;  5CBS A;  1I6B A;  4RJZ A;  4FIM A;  3JV9 A;  3LBS A;  4N13 A;  3KC0 A;  1MXZ A;  1FPI A;  4F3B A;  4NWC A;  2V93 A;  3MVX A;  4XFE A;  2NOO A;  4IR8 A;  5JTY A;  2FIE A;  1A54 A;  2YLN A;  1LAF E;  3R26 A;  1LAG E;  1Y1Z A;  4HXV A;  4PC9 A;  3GYY A;  4PFT A;  1YAE A;  4IO2 A;  2CEX A;  5I2N B;  2UVH A;  3CFX A;  2OWZ A;  3PMW A;  1IQ7 A;  2QS1 A;  4DE8 A;  3C35 A;  2V3Q A;  1KWH A;  2Z23 A;  4HCW A;  4RXL A;  3K1N A;  1NKX A;  2GFE A;  4H0W A;  4ZEB A;  4F3G A;  1QUL A;  4ESX A;  4KQP A;  1LBB A;  5ISU A;  3FV1 A;  5JTY B;  2F34 A;  5A5L A;  4YZZ A;  2P1S A;  3TDJ A;  1A55 A;  4Q0C A;  2OCU A;  4XKR A;  3K4U A;  1MM6 A;  3QK6 A;  1ZIU A;  3KGC A;  5H8Q A;  4KFQ A;  1IXG A;  4OES A;  1B3E A;  4POW A;  1H45 A;  4MNI A;  2CEY A;  3E79 A;  3PD8 A;  1PDA A;  4N4U A;  3ZKK A;  1PB9 A;  4DDD A;  2FVZ A;  3MPL A;  1VE4 A;  5DT6 A;  4HE0 A;  1RYO A;  1K9Z A;  1D9Q A;  4QFN A;  1URD A;  1FSA A;  5KCJ B;  4R74 A;  1S7Y A;  3EN3 A;  4LZ8 A;  4PTK A;  4I1D A;  2CZK A;  3MPK A;  1MY0 A;  3CRB A;  1S9T A;  5T3J A;  4P11 A;  5EQ7 A;  3G3G A;  1MY4 A;  1JNF A;  2REJ A;  2A5S A;  2ZMB A;  3K0V A;  1NUY A;  4MNC A;  1EZ9 A;  2ZZX A;  2D3I A;  4ZEK A;  4ZZE A;  4R6H A;  3FXU A;  3U94 A;  3QIM A;  1II5 A;  3KG2 A;  2UYE A;  4I9D A;  2VPN A;  1BTJ A;  1FBE A;  4GWS A;  4BDO A;  1MQJ A;  1HSJ A;  5CMM A;  1YTV A;  3K01 A;  4X9T A;  2F5X A;  5H8S A;  2QMX A;  4PBQ A;  5FHO A;  1NH8 A;  2LAO A;  1Y4C A;  3IJO B;  3SEU A;  2ZYK A;  3K6U A;  2VP1 A;  2NWJ A;  1IXC A;  2QS4 A;  3TCH A;  2DSF A;  4F1Y A;  1WVJ A;  3M3L A;  1Y4T A;  4LAT A;  1B5J A;  3FJM A;  1TT1 A;  1JW1 A;  1NV3 A;  1FRP A;  4JSO A;  1SVX B;  4OTE A;  3K6V A;  5JK4 A;  4NE4 A;  4FJP A;  3A3U A;  1R9L A;  2BJI A;  3FBP A;  3RNN A;  3LUY A;  4O7M A;  1DK4 A;  1QJM A;  1JVY A;  1EYI A;  4JBZ A;  4PFW A;  4QHQ A;  4EF1 A;  4U22 A;  2VD2 A;  4U4S A;  4X1D A;  3K1M A;  1MPD A;  2RC7 A;  4XEQ A;  4GWW A;  1HSL A;  5AE4 A;  2H4I A;  3IO6 A;  3S9E A;  4R75 A;  1GTK A;  2QVR A;  1JET A;  4I8C A;  3B6W A;  2H99 A;  2PMS A;  5DEX B;  4F39 A;  1BIY A;  5A5X B;  5EYH A;  1A8E A;  3BFU A;  1FPK A;  2Y7I A;  5CM6 A;  4XKQ A;  2F7A A;  2UVG A;  3CG3 A;  4DCX A;  3T9X B;  3TTM A;  1NL5 A;  4QSE A;  4R6K A;  3SDF A;  2DE2 A;  2HXW A;  4JWY A;  1S50 A;  1UTH B;  4NF8 B;  1P1U A;  3S9M C;  1NMU A;  1VFD A;  1DSN A;  2I0C A;  3IOW A;  1POY 1;  1RKM A;  3MST A;  4NG7 A;  3FV2 A;  4IO5 A;  2BJJ X;  3TZA A;  4GF8 A;  5IM2 A;  1L5T A;  2A5T A;  3OOA A;  2XWK A;  4TOZ A;  1QW0 A;  1YYZ A;  1D4N A;  3N5L A;  3LUZ A;  2O6A A;  4GWZ A;  3TCF A;  5CC2 A;  3CFZ A;  3TFL A;  5IZZ A;  4N91 A;  2RIN A;  2HXR A;  3BFT A;  3C4M A;  4OVR A;  4U2R A;  1G0H A;  1NUZ A;  4WKM A;  1PB7 A;  1I6A A;  3B7D A;  5DVJ A;  5AA2 D;  1SI1 A;  3DM0 A;  4XTC Q;  1A99 A;  2XXR A;  3Q26 A;  3ECR A;  4KR5 A;  2R6G E;  3RPL B;  2R8T A;  2A5T B;  3VVD A;  4IO3 A;  4OWD A;  5B7D A;  3IB2 A;  5I5P A;  4H5F A;  1LLS A;  3E13 X;  3EPE A;  4R2B A;  1NUW A;  4GOT A;  3M8U A;  4PF6 A;  5CRY A;  3N26 A;  2F7B A;  3BIG A;  3PUZ E;  1B2H A;  2KR0 A;  4H65 A;  2JJK A;  5EHM A;  4P3L A;  4GIZ A;  4QFP A;  2ZYO A;  4YB6 A;  1AMF A;  5TPA A;  2ZZV A;  1I6Q A;  4QFK A;  3NOH A;  3CI8 A;  1N3W A;  2Y7R A;  4LZ7 A;  2PBW A;  4PE5 B;  4YB5 A;  3O28 A;  4IGR A;  2XXH A;  2F8D A;  1YZ0 A;  3ROJ A;  4YMA A;  1RDY A;  3FJG A;  3DP6 A;  3LSW A;  1UIV A;  2XXI A;  4YMB A;  2O69 A;  1H44 A;  3LSX A;  1NV4 A;  2X7Q A;  3N94 A;  5LDZ A;  2Y5L A;  5AA4 B;  1B0L A;  3FVG A;  1NV5 A;  2OLB A;  4NTL A;  3DLN A;  4PAI A;  4K3F A;  3WAE A;  4NAP A;  4KHZ E;  2O1L A;  3CSG A;  4HE2 A;  3GLB A;  4ISU A;  1KA1 A;  2H9B A;  4N6D A;  3KN7 A;  4DI4 B;  4Z0I A;  3T9U A;  3VE1 B;  3C32 A;  2O7I A;  4LUB A;  1EZO A;  5H8H B;  1GGG A;  1MY3 A;  3VLV A;  4PF8 A;  1A40 A;  3OSR A;  4FBP A;  1WDN A;  2XXT A;  5DYH A;  5L8D A;  1MDP 1;  2H5Y A;  3PUY E;  1FPB A;  2MKZ A;  3IB1 A;  3O2A A;  4OET A;  3S4U A;  4BDL A;  3KBZ A;  3T96 B;  4AS5 A;  3SEW A;  1CB6 A;  1SW4 A;  4O3C A;  3PD9 A;  5AA2 B;  1MXU A;  4MMP A;  4IO4 A;  3D4G A;  3GXA A;  1OQH A;  2Y84 A;  3MZB A;  4OFL A;  4GBV A;  2Q8J A;  2VOZ A;  2PVU A;  3MWB A;  5IAI A;  1FBC A;  1NNT A;  2XHD A;  5L9S A;  3IB0 A;  2H98 A;  2E1S A;  4O94 A;  1QVS A;  5I57 B;  4NF0 A;  1B0H A;  1LBY A;  4PAF A;  4OFJ A;  4U1Z A;  3IO4 A;  3C36 A;  3W15 C;  1O63 A;  4DCY A;  5DW8 A;  3JYR A;  2XWV A;  1URS A;  4X48 A;  1DPP A;  1AOV A;  1JEU A;  4LN5 A;  5I2N A;  2F78 A;  3QUF A;  4ZEC A;  3S9L C;  3PPP A;  1DCU A;  1B46 A;  1N04 A;  1FTM A;  3GBA A;  2QSX A;  5EYF A;  4KYD A;  3KZG A;  4RA1 A;  4OVP A;  2XWI A;  2QJE A;  1P1Q A;  3U65 A;  2ZNS A;  4ZED A;  5FHM A;  3VXB A;  1TWY A;  4RNS A;  2O7U A;  1MQD A;  3KSJ A;  4PFB A;  1BKA A;  4R9G A;  5H8F B;  4F29 A;  5F1Q A;  5I59 A;  3PUV E;  5IZ3 A;  4N6K A;  1NV7 A;  3N6U A;  1N76 A;  4P0I A;  1FJ6 A;  4NF6 B;  1KZ8 A;  1FQA A;  1OMP A;  4C1U A;  1SD3 A;  3FZV A;  2DOJ A;  4GLI A;  4POX A;  1LEV A;  4FEB A;  5ICQ A;  1SW2 A;  3ILT B;  3FIR A;  1FJ9 A;  3RY3 A;  3V83 A;  1DBZ A;  4NGU A;  4IB2 A;  1YXI A;  1FBG A;  4OZ9 A;  1Q35 A;  4F3S A;  1MQH A;  4ZE8 A;  5J1D A;  1P99 A;  4OAN A;  4ESW A;  1IZ1 A;  3RGY A;  1PBP A;  3UA8 A;  4YKI A;  3PV0 E;  2I48 A;  4DZ1 A;  5IZ3 B;  4LQ2 A;  1M5E A;  5I84 A;  2DWJ A;  1M5C A;  1DTG A;  4F19 A;  2CZH A;  1O7T A;  1YCJ A;  2REG A;  3GZG A;  2PCR A;  1FQD A;  4XIG Q;  1MDQ A;  2F36 A;  3OSQ A;  2XXW A;  4OXV A;  1P1O A;  2HAV A;  4U23 A;  3H6T A;  3W9W A;  2B3B A;  1NH7 A;  3MVY A;  4GBW A;  4EXK A;  2XA5 A;  3HO7 A;  4G68 C;  1B52 A;  5IKB A;  4FAT A;  3TUS A;  2ZYN A;  2Z8E A;  4OVT A;  1EZP A;  3SER A;  1QUI A;  2Q88 A;  1ZBM A;  1FTK A;  5CMB A;  3UOR A;  3RYD A;  3FVO A;  4ZS9 A;  1LFI A;  2Y7K A;  3IOU A;  3BIH A;  1NNF A;  3TYH A;  1N84 A;  1ELJ A;  5ET5 A;  1LCT A;  4YKP A;  1POT A;  3HST A;  4DXB A;  5BWJ A;  1MH3 A;  1MXW A;  3A29 A;  4XXU A;  4EF2 A;  3C33 A;  5BUU A;  3VVF A;  2QVU A;  4QF9 A;  4G77 A;  3PGF A;  2I4B A;  2R71 A;  4LVQ A;  1MS7 A;  1XI6 A;  4IO6 A;  3IX1 A;  3E9X A;  2ZYM A;  2Z8F A;  2HEU A;  3B8B A;  2ZNU A;  4HE1 A;  2P2A A;  1QGX A;  5DTB A;  4HCY A;  2FBP A;  1FBF A;  3V89 B;  2RKM A;  5ET6 A;  2Q2A A;  1FBD A;  4MEV A;  1LGB C;  1QUK A;  4MHF A;  3JZJ A;  3PPO A;  1EYJ A;  3SEV A;  3LR1 A;  3T0J A;  5ESY A;  1K9Y A;  4R73 A;  4I62 A;  3HHF A;  3E3K A;  3IFC A;  3KJ7 A;  1FBP A;  1FTJ A;  1Y9U A;  2UVI A;  2ESN A;  1JW5 A;  4AB5 A;  2IA4 A;  1ZMG A;  5AA4 A;  3KJT A;  1B7U A;  3QAX A;  3RPW A;  2F3B A;  5IGA A;  5TPA B;  3V5A A;  2XXX A;  1LBV A;  4AS4 A;  4MLV A;  5FTH A;  3QUJ A;  2OJT A;  5FBP A;  3B50 A;  2DWA A;  1A8F A;  3K6X A;  1FPD A;  3IFA A;  3T9H B;  1R1N A;  3OMB A;  1Y3P A;  1LBZ A;  1MRP A;  1NUX A;  3U92 A;  2M8C A;  2Q2C A;  1JW4 A;  4R72 A;  1LAH E;  2WYP A;  4TLM B;  3CIJ A;  3MW0 A;  3P7I A;  4OEU A;  3RT6 B;  1H3D A;  3I3V A;  3A09 A;  1RDX A;  3ZKL A;  3FXB A;  3Q29 A;  4OER A;  3DEL B;  2I3V A;  4E0X A;  4MIJ A;  2QRY A;  5EQ8 A;  1B7Z A;  1VFE A;  4EXL A;  4H45 A;  4RK2 A;  1IUD A;  2DXR A;  2KQZ A;  3HHG A;  2ONS A;  3F11 A;  2DVC A;  1SBP A;  4M4G A;  3ISP A;  4PP0 A;  1FPG A;  2IEE A;  4P1E A;  4JB7 A;  1ZKB A;  3G3K A;  3B6Q A;  2FYI A;  1B4H A;  1N7W A;  5AA2 A;  1TFA A;  2RCA A;  3IOT A;  2B3F A;  2X26 A;  2UYF A;  2H25 A;  4L17 A;  4GL8 A;  1LBC A;  1MM7 A;  3CG1 A;  4H67 A;  4PBH A;  1NV2 A;  5I2K A;  4NED A;  3E4R A;  4G68 B;  5CBR A;  2WYK A;  1NV1 A;  3IJX B;  2PT2 A;  1NNP A;  3VV5 A;  3FVN A;  3MVW A;  4BLA A;  1SYH A;  4KXP A;  1Y3Q A;  4LQ5 A;  1Y3N A;  3CVG A;  5TU0 A;  3ODB A;  4PAK A;  4AQ4 A;  1NV0 A;  1FTO A;  4FEC A;  3LSF B;  4P47 A;  3CHG A;  4F1V A;  2GHB A;  4X04 A;  4LZ5 A;  4C0R A;  2GH9 A;  4ELO A;  2XX8 A;  4OEN A;  3Q25 A;  5KDT A;  4OYV A;  5H8N A;  4GWY A;  4JVC A;  1JQF A;  2DDK A;  1B32 A;  1FQB A;  1FPL A;  1AWB A;  1QKA A;  1LB8 A;  2GHA A;  5I58 B;  5LOM A;  1LBW A;  1Q9D A;  5ITO A;  4ZZA A;  4ELP A;  3K6W A;  4N81 A;  3O9P A;  3W9V A;  3ZS6 A;  3I5O A;  4N8Y A;  3SET A;  5KCJ A;  3G7W A;  3G3I A;  5DVF A;  3G3H A;  4UA8 A;  3S2V A;  5J16 A;  2FA7 A;  3FXQ A;  3R7X A;  4WXJ A;  2X7P A;  2XD2 A;  2XXV A;  5IZ1 A;  2QMW A;  1WOD A;  2RF1 A;  4O8M A;  3VXC A;  4NF4 B;  1MY1 A;  5I2K B;  2F7C A;  3KSX A;  3PPR A;  3U93 A;  4JXI A;  4IO7 A;  2RC8 A;  3MZ9 A;  2I0B A;  4DXC A;  4U1O A;  1DPE A;  4KCC A;  4O3A A;  1XS5 A;  3VDF A;  5I57 A;  1J1N A;  4EUO A;  4YKJ A;  1KA0 A;  1OQG A;  3EHS A;  3QXM A;  4ELR A;  2PFY A;  3UP9 A;  2HHM A;  1QKB A;  2V84 A;  1B1H A;  4JVD A;  4PFU A;  3OXN A;  2KLF A;  5L9M A;  4RPO A;  3M3F A;  1IMD A;  3TTL A;  3FD3 A;  4FAJ A;  2DE4 A;  3OO8 A;  3G3J A;  1FTL A;  4P56 A;  5EHS A;  4O3B A;  1B4Z A;  4PFR A;  1OLC A;  4MH5 A;  4U4X A;  1JVX A;  3PMX A;  2DP8 A;  3LV0 A;  3SES A;  1IMA A;  1B05 A;  2VD3 A;  4G4P A;  3TTN A;  4JVI A;  4NF5 A;  1MQI A;  4MF3 A;  4PGN A;  1URG A; 
#chains in the Genus database with same CATH homology
 2F5X A;  4H8J A;  5H8S A;  3FAT A;  4ESW A;  1IZ1 A;  3KEI A;  1PBP A;  3M3K A;  4YKI A;  5ELV A;  1FQF A;  2O51 A;  3PV0 E;  4KD5 A;  3RGY A;  2QMX A;  1FW0 A;  2I48 A;  3G3F A;  3O6I A;  4LQ2 A;  3MP8 A;  5H8Q B;  1M5E A;  1B51 A;  4OHN A;  2DWJ A;  1M5C A;  4OFO A;  5FHO A;  1LST A;  5I84 A;  4OQO A;  1DTG A;  1NH8 A;  1ANF A;  2LAO A;  2QS2 A;  1O7T A;  2UXA A;  4GXA A;  4H6D A;  4F19 A;  1YCJ A;  1Y4C A;  2I58 A;  3BBR A;  1P1N A;  1RYX A;  3C34 A;  3IJO B;  4NMY A;  3T22 A;  4U21 A;  3SEU A;  4DZ1 A;  1USY H;  2ZYK A;  5JEI A;  4BDM A;  2REG A;  3K6U A;  2VP1 A;  3GZG A;  3O97 A;  4NF6 A;  3HV1 A;  3TPA A;  3TEP A;  1FQD A;  4XIG Q;  1IXH A;  3OD7 A;  2NWJ A;  1IXC A;  1MDQ A;  1QUJ A;  1MXV A;  2F36 A;  2XXW A;  2QS4 A;  2YPN A;  2DSF A;  1IXI A;  3H06 B;  3O6G A;  3OSQ A;  3TCH A;  4RPN A;  3IR1 A;  4OXV A;  3PU5 A;  1P1O A;  2HAV A;  4F1Y A;  1WVJ A;  3M3L A;  4U23 A;  3H6T A;  4IY5 A;  1Y4T A;  5DEX A;  3W9W A;  2B3B A;  1NH7 A;  1PC3 A;  3MVY A;  1B5J A;  1ATG A;  4LAT A;  4EXK A;  5L9O A;  1NNK A;  3FJM A;  5H8F A;  1TXF A;  3HO7 A;  4G68 C;  3HPI A;  3K1P A;  1TT1 A;  1Y1M A;  1JW1 A;  4JSO A;  1B52 A;  5JK4 A;  1SVX B;  4OTE A;  3K6V A;  4C1T A;  3H6V A;  4NE4 A;  1MG1 A;  4FJP A;  4NF5 B;  2XXQ A;  3A3U A;  4FAT A;  5ITP A;  5K2Y A;  2ZYN A;  1R9L A;  2Z8E A;  3FVK A;  3TUS A;  2I6E A;  4YB7 A;  5KDT A;  1B3G A;  2G93 A;  2UVJ A;  4YIC A;  2E0S A;  4N07 A;  2XXY A;  1EH3 A;  3LUY A;  3RNN A;  1EZP A;  1QJM A;  4JDF A;  1JVY A;  4JBZ A;  4H5G A;  2WKY A;  1DOT A;  4PFW A;  4QHQ A;  3SER A;  4EF1 A;  1QUI A;  3B6T A;  2Q88 A;  1ZBM A;  1FTK A;  2VD2 A;  4U22 A;  4U4S A;  5CMB A;  5AA1 A;  4GVO A;  3UA8 A;  4X1D A;  3BKI B;  3FVO A;  3UOR A;  1N3X A;  3K1M A;  4E0W A;  4ZS9 A;  1LFI A;  1UQW A;  2HZK A;  3Q27 A;  1MPD A;  2Y7K A;  2ZXT A;  2RC7 A;  3IOU A;  3R6U A;  4UAC A;  4BDQ A;  3CSB A;  3T9V A;  3USD A;  1NNF A;  3TYH A;  3AXF A;  1N84 A;  1ELJ A;  3CFL A;  1LCT A;  3HCQ A;  4H1X A;  4YKP A;  1HSL A;  4QFL A;  4PFY A;  1UTH A;  4NF8 A;  4EQ9 A;  5AE4 A;  4F18 A;  2H4I A;  2ABH A;  1POT A;  3IO6 A;  3PPN A;  3Q28 A;  5CI5 A;  5M2V A;  3S9E A;  4R75 A;  1GTK A;  1JET A;  4I8C A;  4G2Z A;  2VGQ A;  3TOD A;  3B6W A;  3UN6 A;  3HN0 A;  3ILU B;  3TMG A;  2H99 A;  2PMS A;  3HST A;  4DXB A;  2D5W A;  5DEX B;  2V3T A;  4F39 A;  1BIY A;  1SW5 A;  3TQL A;  5BWJ A;  5IKB A;  2NUV A;  1MH3 A;  5A5X B;  4YU0 A;  1M5D A;  1MXW A;  3ONM A;  1ZLQ A;  4R9F A;  1A8E A;  2F35 A;  1YPN A;  3FJ7 A;  3BFU A;  2OBG A;  4XXU A;  2ONR A;  3C33 A;  4EF2 A;  2Y7I A;  5CM6 A;  4MFI A;  3IOR A;  5TP9 B;  4LON B;  3UIF A;  5AA3 A;  3O66 A;  5BUU A;  4XKQ A;  2F7A A;  2DWH A;  2UVG A;  3CG3 A;  4DCX A;  5KZT A;  3T9X B;  1MPB A;  3VVF A;  5I59 B;  1AL3 A;  4G77 A;  4QF9 A;  3TTM A;  1NL5 A;  3PGF A;  2I4B A;  3RTW B;  2R71 A;  4LVQ A;  1ZTY A;  1MS7 A;  4IO6 A;  1D3K A;  3U1O A;  4QSE A;  4R6K A;  3IX1 A;  3E9X A;  1M5B A;  2ZYM A;  3RN8 A;  1MPC A;  2DE2 A;  2HQ0 A;  2HXW A;  4JWY A;  3SDF A;  1S50 A;  2Z8F A;  2AYS A;  1VSO A;  2HEU A;  1D9V A;  1PBQ A;  2QL3 A;  3FGS A;  4RXL A;  2ZNU A;  1UTH B;  2P2A A;  4NF8 B;  1SDX A;  1P1U A;  3S9M C;  5DTB A;  1PEB A;  4HCY A;  2Z8D A;  4EQ7 A;  1FQE A;  1NMU A;  2I49 A;  1CE2 A;  3DP8 A;  2AL4 A;  4Z7E A;  4R2F A;  3V89 B;  3L6H A;  3TFL A;  1VFD A;  2RKM A;  4DXU A;  1DSN A;  2Q2A A;  2QS3 A;  2XX9 A;  3OO6 A;  3UGW A;  4ZEF A;  2B65 A;  2I0C A;  5HPQ A;  1LGB C;  1US4 A;  2ONK E;  3KFM A;  3H3G A;  3IOW A;  1POY 1;  1QUK A;  3C9H A;  1RKM A;  3FV2 A;  3FAS A;  4IO5 A;  3JZJ A;  3U8Q A;  2BJJ X;  1B1X A;  1B9J A;  3PPO A;  4KCD A;  3H6W A;  3MBP A;  3SEV A;  3LR1 A;  2VHA A;  3TZA A;  4GF8 A;  5TP9 A;  1Y20 A;  4R73 A;  3VVE A;  4I62 A;  3HHF A;  2A5T A;  3OOA A;  4KI0 E;  1L5T A;  4TOZ A;  2DE3 A;  1QW0 A;  3E3K A;  1MQG A;  2XX7 A;  3KJ7 A;  4RY1 A;  3N5L A;  1D4N A;  3QYT A;  1FTJ A;  1Y9U A;  2O6A A;  3VLW A;  2UVI A;  3LSL A;  2G29 A;  4R6Y A;  2ESN A;  4FE8 A;  3TCF A;  1JW5 A;  3KBR A;  4HW8 A;  5CC2 A;  1DTZ A;  2F97 A;  3CFZ A;  3OO7 A;  4AB5 A;  1XVX A;  1XVY A;  2CZL A;  2IA4 A;  2PX1 A;  2RCB A;  1ZMG A;  2ZNT A;  3PUW E;  4TQU Q;  5AA4 A;  3SEX A;  3KJT A;  2RIN A;  4F2Q A;  1B3H A;  1B7U A;  4H8I A;  1SW1 A;  1UIU A;  2PT1 A;  3H03 A;  4G8M A;  3IAZ A;  3BFT A;  2F6P A;  3C4M A;  1OVT A;  4U2R A;  3QAX A;  3RPW A;  1T0K A;  2OWT A;  5F7V A;  4WKM A;  2W7Y A;  1PB7 A;  5TPA B;  1I69 A;  1F9B A;  1I6A A;  3B7D A;  5DVJ A;  4F2O A;  5AA2 D;  2V3U A;  1SI1 A;  1H43 A;  5A5X A;  1B58 A;  3MC2 A;  3PPQ A;  2XXX A;  3DM0 A;  1SQY A;  4GWO A;  3IK6 B;  4FOR A;  3V5A A;  2I4C A;  4THI A;  5DVI A;  4MLV A;  4GFR A;  3EHT A;  1A99 A;  2XXR A;  4XTC Q;  3Q26 A;  2DS9 A;  5FTH A;  4AB6 A;  3K02 A;  3ECR A;  3H6U A;  3QUJ A;  4KR5 A;  3RUM A;  2OJT A;  5H8H A;  1EU8 A;  2R6G E;  4XKN A;  1OLA A;  2DWA A;  1NFT A;  1R6Z A;  1A8F A;  2OZZ A;  2A5T B;  4HS7 A;  2DWI A;  3K6X A;  4GL0 A;  3VVD A;  3IOV A;  2CMO A;  4F3P A;  3KOT A;  1B5H A;  4IO3 A;  4OWD A;  5B7D A;  3TQW A;  2OK2 A;  2DQV A;  3IB2 A;  5HBC A;  3T9H B;  1MXX A;  5K2X A;  3TEL A;  1FQC A;  4H5F A;  4YAH X;  1R1N A;  1P1W A;  2Z22 A;  3OMB A;  3T93 B;  1LLS A;  4QRZ A;  1O64 A;  2OWS A;  3E13 X;  3EPE A;  1Y3P A;  1MRP A;  2GRV A;  4GOT A;  3M8U A;  4R2B A;  1N7X A;  2PYY A;  5CRY A;  3U92 A;  1BP5 A;  2M8C A;  3N26 A;  2NVU B;  3U72 A;  2F7B A;  3D4C A;  3PUZ E;  1B2H A;  1SYI A;  4PET A;  2Q2C A;  4H65 A;  4NWD A;  1JW4 A;  1LB9 A;  3H4Z A;  4R72 A;  4ND9 A;  1LAH E;  5EHM A;  4TLM B;  1PB8 A;  3CR9 A;  4GIZ A;  4QFP A;  2ZYO A;  4GRK A;  3WAF A;  4KYS A;  1AMF A;  4YB6 A;  3CIJ A;  3MUQ A;  3MW0 A;  2NXO A;  2HFB A;  3P7I A;  4OEU A;  2DYX A;  3RT6 B;  5FTI A;  1H3D A;  5TPA A;  3I3V A;  5I56 B;  1US5 A;  1I6Q A;  3MP6 A;  4QFK A;  4N6P A;  3A09 A;  4EQB A;  5HM4 B;  2DVZ A;  1B3L A;  3MP1 A;  3CI8 A;  3EQ1 A;  1N3W A;  2Y7R A;  4LZ7 A;  2PBW A;  1B3F A;  3I6V A;  4PE5 B;  4QSD A;  1OVB A;  4KYE A;  3Q29 A;  4X1B A;  4OER A;  3DEL B;  3SKP A;  3ZKL A;  4YB5 A;  2I3V A;  3O28 A;  4IGR A;  2XXH A;  2F8D A;  4E0X A;  4PQJ A;  1B40 A;  4IGT A;  3OEK A;  3RT8 A;  4YMA A;  2HAU A;  2AL5 A;  2QRY A;  3DP6 A;  3FJG A;  3IL1 B;  3LSW A;  1B7Z A;  4M1V A;  1VFE A;  4EXL A;  4EDP A;  1UIV A;  2O68 A;  2XXI A;  3TTR A;  4YMB A;  3KN3 A;  1A7L A;  2O69 A;  1H44 A;  2Q9T A;  1HSE A;  4RK2 A;  1IUD A;  1Q1K A;  1UTB B;  1XHY A;  3LSX A;  1B5I A;  2DXR A;  3T66 A;  3HHG A;  3S9N C;  2X7Q A;  3N94 A;  2ONS A;  3F11 A;  3VLU A;  2DVC A;  1SBP A;  4M4G A;  4MBP A;  5AA4 B;  1XT8 A;  1B0L A;  3FVG A;  3PMV A;  4PP0 A;  3EHU A;  2OLB A;  4TLL B;  2IEE A;  3TKD A;  4NTL A;  3TCG A;  3OO9 A;  3DLN A;  1MY2 A;  4JB7 A;  3A3C A;  1ZKB A;  4RK9 A;  4K3F A;  1N0T A;  3G3K A;  3B6Q A;  5CMK A;  3MVZ A;  2FNC A;  2FYI A;  1B4H A;  4ZDM A;  3WAE A;  1N7W A;  2AIX A;  5AA2 A;  1DMB A;  1TFA A;  2D21 A;  4KHZ E;  2O1L A;  3CSG A;  4ELQ A;  2RCA A;  1AIV A;  3RTF B;  3GLB A;  4Q8R A;  2V25 A;  4ISU A;  3IOT A;  4QFO A;  2B3F A;  3H7M A;  3KN7 A;  2H9B A;  3PUX E;  4GQO A;  1D9Y A;  2X26 A;  4FED A;  2I3W A;  1LFG A;  2UYF A;  2H25 A;  2THI A;  4L17 A;  1JEV A;  4GL8 A;  4XKP A;  4YKK A;  1B6H A;  3N6T A;  3O6H A;  5H8N B;  4Z0I A;  3THI A;  3ZSF A;  1LBC A;  1MM7 A;  3T9U A;  4DIG A;  4GD5 A;  1GVC A;  3VE1 B;  3C32 A;  2O7I A;  3CG1 A;  4G8N A;  4BDR A;  4LUB A;  4H67 A;  2XXP A;  3GBB A;  1EZO A;  5H8H B;  1GGG A;  1MY3 A;  2ANJ A;  3K2D A;  3VLV A;  4NED A;  1AH5 A;  2XXU A;  3DP4 A;  1A40 A;  3E4R A;  3OSR A;  4G68 B;  4GXS B;  4KPT A;  1WDN A;  5CBR A;  2XXT A;  5DYH A;  3VFJ A;  3IJX B;  2PT2 A;  1NNP A;  3VV5 A;  3FVN A;  3MVW A;  3O29 A;  4BLA A;  1SYH A;  4DLD A;  3C31 A;  4F22 A;  5CBS A;  3OEL A;  5L8D A;  1MDP 1;  2H5Y A;  3PUY E;  1Y3Q A;  4LQ5 A;  1Y3N A;  1I6B A;  3KN8 A;  4RJZ A;  4FIM A;  3KOS A;  3CVG A;  5CMC A;  3JV9 A;  3LBS A;  3ODB A;  4N13 A;  4P0G A;  5TU0 A;  4AQ4 A;  1MXZ A;  4F3B A;  3IB1 A;  3O2A A;  4OET A;  3S4U A;  2Y7P A;  4BDL A;  4F31 B;  1FTO A;  4NWC A;  4FEC A;  3T96 B;  1LAX A;  3LSF B;  3SEW A;  1CB6 A;  1SW4 A;  2V93 A;  4O3C A;  3PD9 A;  4F1V A;  5AA2 B;  1MXU A;  2GHB A;  3MVX A;  2NOO A;  5JTY A;  4LZ5 A;  3MJN A;  4IO4 A;  4C0R A;  3D4G A;  1A54 A;  3GXA A;  2GH9 A;  1OQH A;  2ALU A;  2Y84 A;  3MZB A;  4ELO A;  5I56 A;  2Q89 A;  2XX8 A;  2YLN A;  3Q25 A;  4OEN A;  4OFL A;  1LAF E;  2RC9 A;  2O84 X;  3R26 A;  1LAG E;  4OYV A;  1Y1Z A;  5H8N A;  4Q5T A;  2Q8J A;  3UK4 A;  2VOZ A;  4PFT A;  1YAE A;  4IO2 A;  3MAM A;  1JQF A;  1GV8 A;  2PVU A;  5I2N B;  3MWB A;  3TAJ A;  1B32 A;  5IAI A;  1FQB A;  1QKA A;  2UVH A;  1LB8 A;  4G68 A;  1H76 A;  1NNT A;  3OEN A;  3CFX A;  3PMW A;  2XHD A;  5L9S A;  3IB0 A;  2GHA A;  3FXR A;  5I58 B;  1UTB A;  4ECF A;  5LOM A;  2H98 A;  3TTK A;  1IQ7 A;  2E1S A;  2QS1 A;  4ZZA A;  5ITO A;  4DE8 A;  4ELP A;  3K6W A;  1OIB A;  3C35 A;  1QVS A;  2V3Q A;  3SEY A;  2HCA A;  3O9P A;  3W9V A;  1KWH A;  3ZS6 A;  5I57 B;  3I5O A;  2Z23 A;  3SET A;  5KCJ A;  1USY E;  1B0H A;  4HCW A;  3G7W A;  3G3I A;  3K1N A;  1NKX A;  2GFE A;  4Q30 B;  2HZL A;  2O1M A;  1SI0 A;  3G3H A;  4ONY A;  5DVF A;  4H0W A;  4UA8 A;  4ZEB A;  3S2V A;  4HTG A;  1QUL A;  4F3G A;  2FA7 A;  4ESX A;  4KQP A;  3FXQ A;  1LBB A;  2R9J A;  4OFJ A;  3R7X A;  5ISU A;  3FV1 A;  4WXJ A;  4U1Z A;  3IO4 A;  3C36 A;  2X7P A;  2F34 A;  5JTY B;  3W15 C;  1O63 A;  4JWX A;  1TFD A;  2XD2 A;  4YZZ A;  2P1S A;  3TDJ A;  2XXV A;  1A55 A;  4DCY A;  5I2K A;  1R9Q A;  2QMW A;  1WOD A;  4Q0C A;  3JYR A;  2RF1 A;  4BDN A;  2OCU A;  4NF4 B;  4XKR A;  3K4U A;  4JSD A;  1MM6 A;  3VXC A;  1URS A;  4X48 A;  3QK6 A;  1MY1 A;  1ZIU A;  5I2K B;  2F7C A;  1DPP A;  3KGC A;  3KSX A;  1JEU A;  3K00 A;  1AOV A;  5H8Q A;  3RQT A;  5I2N A;  2F78 A;  3EF7 A;  3QUF A;  4KFQ A;  3PPR A;  3PPP A;  3U93 A;  1IXG A;  4OES A;  4ZEC A;  1B3E A;  4JXI A;  3S9L C;  1B7H A;  1B46 A;  1BLF A;  4IO7 A;  1N04 A;  4POW A;  1FTM A;  1H45 A;  3GBA A;  2RC8 A;  3MZ9 A;  2QSX A;  5EYF A;  2QPQ A;  4KYD A;  3KZG A;  2I0B A;  3PD8 A;  1PDA A;  4RA1 A;  1GR2 A;  1MXY A;  4OMB A;  3ZKK A;  1PB9 A;  4DDD A;  4WED A;  4DXC A;  3MPL A;  1VE4 A;  1M5F A;  4U1O A;  1DPE A;  4KCC A;  1IIW A;  5DT6 A;  1XOC A;  4O3A A;  1RYO A;  4WEP A;  1XS5 A;  3VDF A;  4QFN A;  2QJE A;  5I57 A;  1J1N A;  1URD A;  1XC1 A;  3FUZ A;  4EUO A;  1P1Q A;  4IY6 A;  4YKJ A;  2ZNS A;  1OQG A;  4ZEI A;  4R74 A;  5FHM A;  4ZED A;  5KCJ B;  5B70 A;  1S7Y A;  3EHS A;  1IIT A;  3QXM A;  3EN3 A;  4G8H A;  4LZ8 A;  4I1D A;  5FHN A;  1TWY A;  3QSL A;  4RNS A;  2O7U A;  1MQD A;  3KSJ A;  3VXB A;  3MPK A;  4ELR A;  1BKA A;  1MY0 A;  4R9G A;  5H8F B;  1ZU0 A;  3UP9 A;  5F1Q A;  4F29 A;  1VR5 A;  1QKB A;  2V84 A;  3CRB A;  1Z7M E;  4RYA A;  4LA9 A;  5I59 A;  1S9T A;  1B1H A;  1LFH A;  4P11 A;  4PFU A;  3OXN A;  5KDT B;  3G3G A;  1MY4 A;  2KLF A;  5L9M A;  4RPO A;  3M3F A;  4F1U A;  3PUV E;  4QSC A;  3TTL A;  4NF4 A;  1JNF A;  3FD3 A;  3MQ9 A;  2P0S A;  4JWO A;  4FAJ A;  2REJ A;  2DE4 A;  3OO8 A;  1MH4 A;  2A5S A;  3G3J A;  1LCF A;  2ZMB A;  1FTL A;  3K0V A;  2F6G A;  1ZJL A;  5EHS A;  3N6U A;  1EZ9 A;  1N76 A;  4P0I A;  2D3I A;  4O3B A;  5I58 A;  4ZEK A;  4ZZE A;  4R6H A;  4NF6 B;  1B4Z A;  1FQA A;  1OMP A;  4C1U A;  1SD3 A;  3FZV A;  2DOJ A;  4LP2 B;  2XD3 A;  4OVJ A;  3FXU A;  3U94 A;  1OLC A;  3QIM A;  4MH5 A;  2DXY A;  1II5 A;  4GLI A;  4POX A;  4U4X A;  1JVX A;  4MLQ A;  3PMX A;  4OEV A;  1Z7N E;  2DP8 A;  2Y7W A;  2YJP A;  3KG2 A;  3SES A;  4FEB A;  5ICQ A;  2UYE A;  1B05 A;  1SW2 A;  3ILT B;  4I9D A;  2VD3 A;  1BTJ A;  3FIR A;  3LC8 A;  3RY3 A;  4G4P A;  3TTN A;  3V83 A;  5ICT A;  4IB2 A;  3L6G A;  3MZ1 A;  4BDO A;  1MQJ A;  1IEJ A;  4OZ9 A;  4ZE9 A;  1Q35 A;  1HSJ A;  1MQI A;  1MQH A;  4MF3 A;  4NF5 A;  1YTV A;  5CMM A;  3RLF E;  4ZE8 A;  4F3S A;  3V8X B;  3K01 A;  4X9T A;  1FCK A;  3OEM A;  5J1D A;  1P99 A;  1URG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...