3SEXA

Ni-mediated dimer of maltose-binding protein a216h/k220h by synthetic symmetrization (form ii)
Total Genus 124
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
124
sequence length
370
structure length
370
Chain Sequence
b'KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEHAFNHGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein
publication title An approach to crystallizing proteins by metal-mediated synthetic symmetrization.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein
total genus 124
structure length 370
sequence length 370
chains with identical sequence C
ec nomenclature
pdb deposition date 2011-06-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sexA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3sexA01
2XHDA 1WODA 1DMBA 3U8QA 4ESXA 1ATGA 2UYFA 1MQJA 4OHNA 4OEUA 1MRPA 2ZYMA 4L17A 4GWOA 3PMWA 2F36A 1XT8A 3UGWA 3FASA 5F7VA 4C1TA 2THIA 2DWIA 4R2FA 3RT8A 4ZEDA 1B4HA 4YKJA 4GQOA 1ZMGA 3SEVA 5JK4A 5L9MA 1FQBA 2OLBA 1FQCA 1MH4A 5I58A 2XXPA 4JWXA 1A8FA 1NNFA 2F35A 4LUBA 4X48A 5EHSA 5J1DA 1OLAA 3UIFA 1LFGA 4FAJA 4LP2B 1MXVA 1QUKA 4KR5A 2GFEA 2ZXTA 4N13A 1IEJA 1QKAA 2Z8DA 1MY1A 1N84A 2XXRA 1PBPA 3T9XB 3MVZA 3FZVA 5A5XB 4KCCA 4PQJA 3MQ9A 4G8MA 5IKBA 1BLFA 5TU0A 2F34A 1EU8A 3FXQA 5CRYA 4F3PA 1LAHE 2ZYOA 3N6TA 3QXMA 2ONRA 3ODBA 2O69A 1NH7A 1QUIA 2AYSA 1BIYA 2M8CA 4DXCA 4X9TA 3GBBA 1SD3A 2YLNA 2REJA 1LFHA 5M2VA 1SI0A 1RYXA 4I62A 3U93A 3HV1A 4C1UA 2DWAA 4DZ1A 2ESNA 3MP1A 4WEDA 3USDA 1SQYA 4AB5A 2XD3A 3CFXA 4R6HA 3K6UA 5K2XA 1OVTA 2OWTA 5DTBA 3FGSA 3H03A 3FJGA 1A99A 4JSOA 4GL8A 3RTFB 1ZBMA 1FTJA 1FCKA 4NWCA 1I6QA 2REGA 3EHSA 4XKRA 1EZOA 1MQIA 2VD2A 5TPAB 4Q30B 1UTBB 2V3TA 2IA4A 1M5FA 5I2NB 3VXBA 1JEVA 3JZJA 1TXFA 3SKPA 3M8UA 2FA7A 3R7XA 3VDFA 1FQDA 3L6GA 1VE4A 4IO4A 4OVJA 1MM6A 5KDTA 4KYSA 4F39A 3KN7A 2DOJA 3G3HA 3OMBA 1MY4A 2W7YA 3E13X 3MP8A 4QFPA 1IZ1A 4F1YA 3K01A 3K6WA 3RUMA 4RJZA 2G93A 2HEUA 3OD7A 4FEBA 2X7PA 3IR1A 3C34A 4ISUA 2QS4A 1B3EA 3K1PA 3IK6B 2AL5A 4U21A 1M5DA 3TEPA 3KSXA 1XHYA 1M5EA 4F3BA 4EQ9A 1OLCA 4R9FA 3QSLA 1O7TA 3ZKLA 4IO5A 4KQPA 1MG1A 3MZBA 4YZZA 4IY5A 4H8IA 2X7QA 3KN3A 3KJTA 1ZU0A 2Z22A 5H8NA 4WXJA 2QPQA 3TQWA 4GD5A 1MXXA 3LSWA 4RPNA 3MPLA 2DXRA 3P7IA 4YKKA 2H98A 4F2QA 4F3SA 4OERA 4DIGA 3DP4A 3EHTA 1XC1A 2O1LA 3W15C 1JW4A 4NMYA 1T0KA 1Y3QA 3LSFB 4EXKA 1PB8A 5CM6A 1PB9A 2Q2CA 4RK2A 1ELJA 2Y7KA 3H6UA 1EZ9A 3O97A 3AXFA 3DP6A 1QW0A 3PUXE 4P0GA 3U1OA 2XD2A 2HCAA 1MQGA 4OZ9A 3D4CA 1ZLQA 3TTLA 5HPQA 3I5OA 1RKMA 4QFLA 4WKMA 3B6TA 1NMUA 3I6VA 4DLDA 4ZECA 2V3UA 2NOOA 1UTHB 2ZYKA 4ZEBA 4FIMA 4YU0A 5K2YA 3G3IA 3PPOA 1IXGA 4R74A 1NH8A 3VXCA 4RA1A 1ZKBA 2F97A 3E4RA 3GZGA 4O3BA 3IB1A 1A7LA 1US4A 1J1NA 4M4GA 3HCQA 4X1BA 1MDQA 3FV2A 1M5CA 1YAEA 5ITOA 2Y7RA 4F18A 1B7HA 3MC2A 4G68C 1XVXA 3IAZA 2HXWA 4UACA 5KCJB 1LSTA 5TP9A 3T9UA 2XXVA 3KZGA 5CMKA 2UXAA 3W9WA 2PVUA 3RLFE 2E0SA 3QAXA 1XS5A 2RC9A 1YPNA 2V84A 3MZ1A 2B3BA 4E0WA 3RTWB 3O2AA 1P1QA 3CG3A 3G3JA 4OTEA 5JTYB 4TQUQ 2F78A 5I2KA 3OOAA 4H5GA 3LSXA 2PYYA 2YJPA 4PP0A 1SDXA 1Y20A 4QFKA 4ELRA 4R75A 1NL5A 2HZLA 4PFTA 4NF8A 4H0WA 3MAMA 4DXBA 3PMVA 4KPTA 2UVIA 3HSTA 3CSGA 4PFYA 2Z8FA 1JVYA 2ANJA 1QJMA 3SERA 2O68A 2H4IA 2AIXA 2DE2A 3PD9A 4XKNA 4BLAA 1P99A 2D5WA 5AE4A 4GLIA 4JDFA 1MY0A 3VVEA 1UTBA 4K3FA 1B58A 1N76A 4LQ5A 3JYRA 1MPCA 1TWYA 5FTIA 4G4PA 3CVGA 3FJ7A 3B7DA 3B6QA 4EUOA 1DPPA 2I3WA 3C35A 2ZYNA 4U2RA 4POXA 3DLNA 4F22A 1FTLA 2X26A 2ONKE 1O63A 4POWA 4ND9A 3HHGA 3IORA 3PPRA 3M3FA 5ICQA 3PPQA 3FV1A 1USYH 3OSQA 3VLUA 1B6HA 3WAEA 3UN6A 2DS9A 3S9EA 4R2BA 1MH3A 4OWDA 4JWYA 2DVZA 3V8XB 2A5TB 1B32A 3T9VA 3Q29A 5AA3A 4NF6B 5ELVA 1DSNA 3T96B 2I48A 4NWDA 1SVXB 3MVYA 1B3HA 3PU5A 1TFAA 1HSLA 1FTKA 3UORA 4EXLA 1IQ7A 2HFBA 3BFUA 5AA2A 2P0SA 3FD3A 2Y7IA 5B7DA 5H8FB 1R9LA 4MLVA 1Y4CA 2Q89A 2B65A 1RYOA 4LZ7A 3KJ7A 4NF4B 2HAVA 1B0LA 2P2AA 1TT1A 3GXAA 3K2DA 1IXHA 4NF5B 3FJMA 4PFUA 4GFRA 2V25A 4LQ2A 4R72A 1GTKA 4TOZA 2Z8EA 5H8QB 3G3KA 2HQ0A 3N94A 4ZZEA 3IOWA 2E1SA 3IX1A 2I0BA 4YKPA 4ELQA 1SW1A 4OYVA 4H8JA 3KFMA 2NVUB 3FXRA 3E9XA 1LB8A 3WAFA 1OQGA 1M5BA 2Q9TA 2R9JA 5CC2A 1ZTYA 4U1OA 4G8NA 2QRYA 3ONMA 4ESWA 4KYDA 3ZS6A 1B4ZA 3DELB 5I56A 1LBCA 3RGYA 1B7UA 3M3LA 1IIWA 4ZE8A 4THIA 5KCJA 1MQDA 2QMWA 5KZTA 2QS2A 1QVSA 3GLBA 1HSJA 2HAUA 1I6BA 4YB5A 3HHFA 2QL3A 5AA1A 1Y3NA 1MPBA 2QSXA 4MH5A 3KN8A 5CMCA 1SBPA 3IO6A 5AA4A 3N26A 5JTYA 5F1QA 4G68B 2I4BA 4FORA 2OK2A 4OFOA 4F3GA 3R6UA 3OXNA 1FQAA 1N3XA 1F9BA 1URSA 4FATA 1MS7A 4LZ8A 5CBRA 3T9HB 1MY3A 2O7UA 3TYHA 2PBWA 3SEUA 3MBPA 3IOUA 4HCWA 1UIVA 1DTZA 4FJPA 3MP6A 5IAIA 4QSCA 4DCXA 1SW4A 2NXOA 2XXYA 4PETA 2XX7A 1NNTA 2V93A 5I59A 1I6AA 3A3UA 2VHAA 1YTVA 2XXWA 2QMXA 2Q8JA 1DPEA 1UQWA 3Q27A 4OFLA 1URDA 1Y4TA 3DM0A 4Q0CA 2Y84A 1JEUA 3D4GA 1FW0A 3K6VA 3KGCA 1A40A 1ZIUA 4ZEFA 3EF7A 5L9SA 2F7AA 1H76A 1R1NA 4FECA 1FTMA 2NUVA 2CMOA 4BDMA 1FQFA 4EF2A 4ELPA 2GH9A 4RK9A 1IITA 3I3VA 4H5FA 5B70A 5CMBA 4YKIA 3S4UA 1IXCA 3M3KA 3THIA 4BDNA 1L5TA 3KSJA 2Q88A 1MXYA 1LLSA 1B0HA 4LONB 1Y9UA 3W9VA 5H8HB 1NKXA 3U94A 5DVIA 2O1MA 4I9DA 3TCFA 2NWJA 5DEXB 3TELA 1MXUA 3PUYE 1LAGE 4BDRA 4ZS9A 1B51A 2A5TA 2F5XA 1SYHA 4HS7A 4G8HA 4ZEKA 4NF6A 3T93B 5ISUA 5I84A 4F1VA 1LAXA 2RCAA 3FVKA 3QUFA 4GF8A 2P1SA 1SI1A 2A5SA 3B6WA 3R26A 4U1ZA 3UK4A 2DWHA 4U4SA 2GHAA 1B05A 3CI8A 5FHNA 2ZMBA 3FVOA 2RKMA 3ILTB 2UVJA 4I8CA 3O6HA 1P1WA 3Q26A 3RT6B 3K6XA 3FXUA 4KFQA 4MFIA 2I3VA 1JVXA 5H8SA 5A5XA 3S9LC 4EQBA 1P1NA 5H8FA 5EYFA 1S9TA 3PUZE 4NTLA 5DYHA 3E3KA 4O3AA 2FYIA 4NF4A 1AMFA 2ONSA 3IL1B 1VR5A 4NF5A 2F6GA 4F2OA 2O6AA 4F31B 1SW5A 4Z7EA 4ZE9A 4GOTA 4OENA 1B52A 4EQ7A 3RY3A 3EPEA 3H6TA 1JETA 4FEDA 1UIUA 3IOVA 5HBCA 1I69A 4QFNA 2O7IA 4OEVA 4MLQA 3C9HA 3IJOB 3V5AA 5HM4B 1POY1 3S9NC 4QSEA 1USYE 1N7WA 5H8NB 2I0CA 2BJJX 5CI5A 2Z23A 1IUDA 1D9VA 3A09A 5JEIA 4JXIA 2DP8A 3VVDA 1O64A 2LAOA 2WKYA 1II5A 4YB7A 5TPAA 5ITPA 3LBSA 1R6ZA 1XVYA 2QS3A 3TMGA 5I2NA 4GXSB 1B5JA 4YB6A 3PV0E 2XXUA 1HSEA 5FHOA 1GVCA 3H06B 3RN8A 2XX9A 3ILUB 3CSBA 4P11A 2H5YA 4ECFA 1SW2A 4RNSA 1H44A 1AOVA 4KI0E 2ABHA 2O84X 2KLFA 2I4CA 4Q5TA 1QULA 1D9YA 4LATA 3H7MA 4GIZA 3S2VA 1EH3A 5L8DA 3VVFA 4O3CA 4G68A 4KYEA 1B3LA 4JSDA 3ZKKA 1Y3PA 2VGQA 3DP8A 1CE2A 4JBZA 4FE8A 4LA9A 4X1DA 5CMMA 4R9GA 4KHZE 3ZSFA 2GHBA 4H65A 2VOZA 1PC3A 1FQEA 2DXYA 1JQFA 4XTCQ 2F7BA 4LVQA 1Q1KA 3KBRA 4IGTA 2CZLA 2XXHA 3MUQA 3KOSA 2DWJA 2RCBA 2F6PA 3CR9A 3H3GA 3T22A 2RC7A 3N5LA 3VLVA 4RXLA 4G77A 3GBAA 3CIJA 2ZNUA 3L6HA 2XXXA 4JWOA 1B5HA 1VSOA 4RY1A 3SETA 1Y1ZA 2UYEA 1LAFE 3TQLA 4XXUA 4F1UA 3K4UA 3VV5A 4XKQA 1Y1MA 4ELOA 3MZ9A 3V89B 1PDAA 5TP9B 1PB7A 5I57B 2H25A 1FTOA 4NEDA 3IOTA 3OSRA 4HCYA 2HZKA 5LOMA 1P1UA 3RPWA 2RINA 3G3FA 4PE5B 1D3KA 3IJXB 1MXZA 4QSDA 3OO6A 5FHMA 5I2KB 3OO8A 3BBRA 2XX8A 2V3QA 4U22A 1MM7A 4OMBA 1DOTA 2DE4A 4U4XA 2QJEA 3VLWA 4ONYA 4YMAA 4G2ZA 5AA2D 1UTHA 4KCDA 1B1XA 3TODA 3OENA 3LC8A 4NF8B 4IY6A 4ZEIA 4GXAA 1AH5A 3G3GA 2XXIA 3KEIA 5H8HA 2H99A 3K02A 4IGRA 1A55A 3K0VA 1URGA 2F7CA 5DEXA 3OO7A 3SESA 1D4NA 1VFEA 3Q25A 4XIGQ 4DE8A 3U92A 4JB7A 2RF1A 4OESA 4YMBA 3U72A 2PT1A 1JW5A 3K1NA 1A8EA 3G7WA 2DSFA 3TTMA 1NNKA 3PPPA 1POTA 2YPNA 1LFIA 5EHMA 3C31A 3KOTA 1Z7NE 1GR2A 1SYIA 3MVWA 3QYTA 3PMXA 2I49A 3HPIA 2ZNTA 3O6IA 3UP9A 4RPOA 3H4ZA 4OETA 2Y7PA 5DVFA 1B46A 4Z0IA 4M1VA 4KD5A 3EN3A 3PGFA 3PD8A 2IEEA 3Q28A 2OJTA 1GV8A 3MJNA 4ZZAA 1VFDA 3TTRA 4AB6A 3IB2A 1A54A 1B40A 2ZNSA 3LSLA 1MDP1 1LBBA 1NNPA 3FVGA 3TPAA 2R6GE 3TFLA 3FIRA 4IO7A 4BDOA 4MF3A 4IO2A 2AL4A 3JV9A 2UVGA 5BUUA 3FATA 3O28A 4GL0A 1PBQA 1EZPA 3SEWA 1ZJLA 4DDDA 2H9BA 3TCHA 2OWSA 1AL3A 4DCYA 1MY2A 3K00A 3K1MA 3RQTA 4R73A 4QFOA 1Q35A 1R9QA 1BP5A 3FUZA 3QK6A 1B9JA 2O51A 5I58B 4H1XA 5ICTA 1B1HA 3BKIB 4EF1A 1CB6A 3MVXA 4QRZA 4BDLA 1MPDA 2GRVA 3C4MA 3CG1A 3O66A 3PUVE 3MW0A 3CFLA 4IO3A 5AA2B 4R6KA 2VP1A 4F29A 1S7YA 4EDPA 4IB2A 4R6YA 3RNNA 4YAHX 1H45A 2G29A 4WEPA 3OELA 3OO9A 4I1DA 1B2HA 3F11A 4QHQA 4HW8A 4YICA 3LUYA 4BDQA 3O9PA 2DYXA 3TTKA 3CRBA 4HTGA 3V83A 2Q2AA 2OCUA 5FTHA 1H43A 1KWHA 3ECRA 4AQ4A 1LB9A 4PFWA 3HO7A 2OZZA 4OQOA 3QIMA 3C33A 4H6DA 1N3WA 4RYAA 1GGGA 3O6GA 3H6WA 3T66A 3PPNA 1QKBA 1XOCA 3KG2A 4OFJA 1Z7ME 3N6UA 1B3GA 2XXTA 5DT6A 3TTNA 2DE3A 1OIBA 4IO6A 2OBGA 4C0RA 3C36A 1OQHA 4F19A 5I56B 3TUSA 3H6VA 2I58A 3QUJA 3UA8A 3TKDA 1P1OA 1OVBA 5KDTB 5I57A 3SEXA 2F8DA 3FVNA 2QS1A 2PMSA 3IO4A 1YCJA 4Q8RA 1TFDA 2I6EA 1S50A 1PEBA 4XKPA 5AA4B 1MQHA 1N7XA 2VD3A 4QF9A 3TDJA 5H8QA 4MBPA 1LGBC 3TCGA 1QUJA 1BKAA 1OMPA 3MPKA 3LR1A 2Y7WA 5CBSA 1WDNA 2D3IA 3PUWE 3EHUA 2DQVA 4OXVA 2XXQA 3HN0A 4TLLB 5L9OA 3TZAA 5BWJA 1B3FA 2RC8A 1B7ZA 4H67A 3BFTA 2R71A 4LZ5A 4GRKA 1BTJA 3IB0A 3O29A 1N04A 1B5IA 4TLMB 4P0IA 1ANFA 4N07A 2UVHA 5I59B 4DXUA 3OEMA 4GVOA 1N0TA 4ZDMA 2FNCA 1JW1A 2DVCA 3S9MC 1MXWA 2D21A 1AIVA 3A3CA 1LCFA 2PX1A 2PT2A 4NE4A 4UA8A 3EQ1A 3C32A 1WVJA 1NFTA 1LCTA 1JNFA 1IXIA 4N6PA 3VFJA 3SEYA 3TAJA 2ALUA 2B3FA 4U23A 3SDFA 3MWBA 5DVJA 3VE1B 3OEKA 3CFZA 1H3DA 1US5A 4E0XA 1DTGA
chains in the Genus database with same CATH superfamily
2XHDA 1WODA 1DMBA 3U8QA 4ESXA 1ATGA 2UYFA 4OVSA 1MQJA 2QVVA 3T1BA 4OHNA 4OEUA 1MRPA 2ZYMA 4L17A 4GWOA 3PMWA 3RPLB 2F36A 1XT8A 3UGWA 3FASA 5F7VA 5ET7A 4C1TA 2THIA 1G0IA 4PFBA 2DWIA 4R2FA 3RT8A 4ZEDA 1B4HA 4YKJA 4GQOA 1ZMGA 1NUXA 3SEVA 5JK4A 5L9MA 1FQBA 2OLBA 1FQCA 1MH4A 5I58A 4N6KA 2XXPA 4JWXA 1A8FA 1NNFA 2F35A 4LUBA 4X48A 5EHSA 1FPDA 4OVQA 5J1DA 1OLAA 2Q74A 3UIFA 1LFGA 4FAJA 4LP2B 1MXVA 1QUKA 4KR5A 2GFEA 2ZXTA 4N13A 1IEJA 1QKAA 1FPLA 2Z8DA 1MY1A 1N84A 2XXRA 1PBPA 3T9XB 3MVZA 3FZVA 5A5XB 4KCCA 4PQJA 3MQ9A 4G8MA 5IKBA 4NAPA 1BLFA 5TU0A 1K9YA 3LV0A 2F34A 4H45A 1EU8A 3FXQA 4OVRA 5CRYA 4F3PA 1LAHE 2ZYOA 3N6TA 3QXMA 2ONRA 1SPIA 3ODBA 4QXDA 2O69A 1NH7A 2VPNA 1QUIA 2AYSA 1BIYA 2M8CA 4DXCA 4X9TA 3GBBA 1SD3A 2YLNA 2REJA 1LFHA 5M2VA 1SI0A 1RYXA 4I62A 3U93A 3HV1A 4C1UA 1IMAA 3FBPA 2DWAA 4DZ1A 2ESNA 3MP1A 4WEDA 3USDA 2CZKA 1SQYA 4P3LA 4AB5A 4O94A 2XD3A 1XI6A 3CFXA 4R6HA 3K6UA 5K2XA 1OVTA 2OWTA 3KC1A 4HXVA 3FGSA 3H03A 3FJGA 5DTBA 1A99A 4JSOA 4GL8A 3RTFB 1ZBMA 1FTJA 1FCKA 4NWCA 1I6QA 2REGA 3EHSA 4XKRA 4NF0A 1EZOA 1MQIA 2VD2A 4GWSA 5TPAB 4Q30B 1UTBB 2V3TA 2IA4A 1M5FA 5I2NB 4MNCA 2VPOA 3VXBA 1JEVA 1FPGA 3JZJA 1TXFA 3SKPA 3M8UA 2FA7A 4N81A 3R7XA 3VDFA 1FQDA 3L6GA 1VE4A 2XXKA 4IO4A 1FTAA 4OVJA 1MM6A 5KDTA 4KYSA 4F39A 3KN7A 2DOJA 3G3HA 3OMBA 1MY4A 2W7YA 3E13X 3MP8A 4QFPA 1IZ1A 4F1YA 3K01A 3K6WA 3RUMA 4RJZA 2G93A 2HEUA 3OD7A 4FEBA 2X7PA 3IR1A 3C34A 4ISUA 5IZ1A 2QS4A 1B3EA 1FJ6A 3K1PA 3IK6B 2AL5A 4U21A 1M5DA 3TEPA 1IMFA 3KSXA 2Q8MA 1XHYA 1M5EA 4F3BA 4EQ9A 1OLCA 4R9FA 3QSLA 1O7TA 3ZKLA 4IO5A 4MAGA 4KQPA 4MCOA 1MG1A 2FIEA 3MZBA 4YZZA 4IY5A 4H8IA 2X7QA 3KN3A 4PFRA 4DI3D 3KJTA 1ZU0A 2Z22A 5H8NA 4WXJA 2QPQA 3TQWA 4GD5A 1MXXA 3LSWA 4KXPA 4RPNA 3MPLA 2HPGA 2DXRA 3GYYA 3P7IA 4YKKA 2CEXA 2H98A 4F2QA 4F3SA 4OERA 4DIGA 4LN5A 3DP4A 3EHTA 1XC1A 2WBBA 2O1LA 3W15C 1JW4A 4NMYA 1T0KA 2WEFA 1Y3QA 3LSFB 4EXKA 1PB8A 5CM6A 1PB9A 4P9KA 2Q2CA 4RK2A 1ELJA 2Y7KA 3H6UA 1EZ9A 3O97A 3AXFA 4DI4B 3DP6A 1QW0A 3PUXE 3EKIA 4GWUA 4P0GA 3U1OA 2XD2A 2HCAA 1MQGA 4OZ9A 4N4UA 3D4CA 1ZLQA 1LBXA 3TTLA 5HPQA 3I5OA 1RKMA 4QFLA 4WKMA 3B6TA 1NMUA 3I6VA 1EYJA 4DLDA 1KA0A 2PCRA 4ZECA 2V3UA 2NOOA 1UTHB 2ZYKA 4ZEBA 5IM2A 4FIMA 4H46A 4YU0A 4GWWA 5K2YA 3G3IA 3PPOA 1IXGA 4R74A 1NH8A 3VXCA 3PTYA 4RA1A 1ZKBA 2F97A 3E4RA 3ISPA 1YYZA 3KBZA 4NX1A 1NV3A 3GZGA 4O3BA 4OANA 5A5LA 3IB1A 1A7LA 1US4A 1J1NA 4M4GA 1EYKA 3HCQA 4X1BA 1MDQA 3FV2A 1M5CA 1YAEA 5ITOA 4P8BA 2Y7RA 4F18A 1B7HA 3MC2A 4G68C 1XVXA 3IAZA 2HXWA 4UACA 5KCJB 1LSTA 5TP9A 3T9UA 2XXVA 3KZGA 5CMKA 2UXAA 3W9WA 2PVUA 4PAKA 3RLFE 2E0SA 3QAXA 1XS5A 1DK4A 2RC9A 1YPNA 2V84A 3MZ1A 2B3BA 3RTWB 4E0WA 3O2AA 3CHGA 1P1QA 3CG3A 4N91A 3G3JA 4OTEA 1FBCA 2QFLA 5JTYB 4TQUQ 2F78A 5I2KA 3OOAA 1FBFA 4H5GA 3LSXA 2PYYA 2YJPA 4PP0A 1SDXA 1Y20A 4QFKA 4ELRA 4R75A 1NL5A 2HZLA 4PFTA 4NF8A 1FBHA 4H0WA 1D9QA 3MAMA 4DXBA 4HE0A 1FBPA 3PMVA 4KPTA 2FBPA 2UVIA 3HSTA 3CSGA 4PFYA 3LUZA 2Z8FA 1JVYA 2ANJA 1QJMA 3SERA 2O68A 2H4IA 2AIXA 2DE2A 3PD9A 4XKNA 4BLAA 1P99A 2D5WA 5AE4A 4GLIA 4AS5A 4JDFA 1MY0A 3VVEA 1UTBA 4K3FA 1B58A 4PTKA 4AS4A 5I7IA 1N76A 4LQ5A 3JYRA 1MPCA 1TWYA 5FTIA 2F3BA 2CEYA 2XWVA 4G4PA 3CVGA 3FJ7A 3B7DA 3B6QA 4EUOA 1DPPA 2I3WA 3C35A 2ZYNA 4MHFA 4U2RA 4POXA 3DLNA 4F22A 1FTLA 2X26A 2ONKE 1RDYA 1O63A 4POWA 4ND9A 3HHGA 3IORA 3KC0A 3PPRA 3M3FA 5ICQA 1IMBA 3PPQA 3FV1A 1USYH 3BIGA 3OSQA 3VLUA 1B6HA 4JVIA 3WAEA 2P3VA 3UN6A 4PBQA 2DS9A 4I3EA 3S9EA 4R2BA 1MH3A 4OWDA 4JWYA 2DVZA 3V8XB 2A5TB 1B32A 3T9VA 3Q29A 5AA3A 4NF6B 5ELVA 1RDZA 2DDKA 1DSNA 3T96B 3RYDA 2I48A 4NWDA 1SVXB 3MVYA 1B3HA 3PU5A 1TFAA 1HSLA 1FTKA 3UORA 4MEVA 1NV4A 4EXLA 1IQ7A 2HFBA 3BFUA 5AA2A 4X04A 2P0SA 3FD3A 2Y7IA 2WYKA 5IZ3B 4PAIA 5B7DA 5H8FB 1NV7A 1R9LA 4MLVA 1Y4CA 2Q89A 2B65A 1RYOA 4LZ7A 1IMDA 3KJ7A 4NF4B 1RDXA 2HAVA 1B0LA 1NV0A 2P2AA 1TT1A 3GXAA 3K2DA 1IXHA 4NF5B 3FJMA 4PFUA 4GFRA 2V25A 4LQ2A 4R72A 1GTKA 4TOZA 2Z8EA 5H8QB 3G3KA 2HQ0A 3N94A 2VT5A 4ZZEA 3IOWA 2E1SA 4PCDA 3IX1A 2I0BA 4YKPA 4ELQA 4OVTA 1SW1A 4OYVA 4H8JA 3KFMA 2NVUB 2XA5A 3FXRA 4O7IA 2WBDA 3E9XA 1LB8A 3WAFA 1OQGA 1M5BA 2Q9TA 2R9JA 5CC2A 1ZTYA 4U1OA 4G8NA 1FPJA 2QRYA 3ONMA 4ESWA 4KYDA 3ZS6A 1B4ZA 2Y5KA 3DELB 5I56A 1LBCA 3RGYA 1B7UA 3M3LA 1IIWA 1NV5A 4ZE8A 4THIA 5KCJA 1FBDA 1MQDA 4UABA 2QMWA 5KZTA 2QS2A 1QVSA 3GLBA 1HSJA 2HAUA 2P3NA 2XWOA 1I6BA 1JP4A 4YB5A 3HHFA 2QL3A 5AA1A 1Y3NA 1MPBA 3B50A 2QSXA 4MH5A 3KN8A 5CMCA 1SBPA 3IO6A 4O8MA 5AA4A 3N26A 5JTYA 5F1QA 2WYPA 4G68B 2I4BA 4FORA 2OK2A 4OFOA 4F3GA 3SZPA 3R6UA 3OXNA 1FQAA 1N3XA 1F9BA 1URSA 4FATA 1NUZA 4QBAA 1MS7A 3MSTA 4LZ8A 1CNQA 5CBRA 3T9HB 1MY3A 1AWBA 2CZHA 2O7UA 3TYHA 2PBWA 3SEUA 3MBPA 3IOUA 4HCWA 5IZZA 4I40A 1UIVA 1DTZA 4FJPA 1VDWA 3MP6A 5IAIA 4QSCA 4DCXA 1SW4A 2NXOA 2XXYA 4PETA 2XX7A 1NNTA 2V93A 5I59A 1I6AA 1NUWA 2VHAA 1YTVA 3A3UA 2XXWA 2QMXA 2Q8JA 1DPEA 1UQWA 3Q27A 4OFLA 1URDA 1Y4TA 3DM0A 4Q0CA 2Y84A 1JEUA 3D4GA 1FW0A 3K6VA 3KGCA 1DBZA 2KQZA 1A40A 1ZIUA 1K9ZA 1NV6A 4ZEFA 3EF7A 1IMCA 2QVUA 5L9SA 2MKZA 2F7AA 1H76A 1R1NA 4FECA 2PFZA 1FTMA 2WX9A 2NUVA 4P1EA 2CMOA 4BDMA 1FQFA 4EF2A 4ELPA 2GH9A 4RK9A 1IITA 3I3VA 4H5FA 5B70A 5CMBA 4YKIA 3S4UA 1IXCA 1YZ0A 3M3KA 3THIA 4BDNA 4XEQA 3T0JA 1L5TA 3KSJA 3QMFA 2Q88A 1MXYA 1LLSA 1B0HA 4LONB 1Y9UA 3W9VA 1FBGA 5H8HB 1NKXA 3U94A 5DVIA 4N15A 2O1MA 4I9DA 3RPLA 3TCFA 4PC9A 2NWJA 5DEXB 3TELA 1MXUA 3PUYE 1LAGE 4BDRA 4ZS9A 1B51A 2A5TA 4OVPA 2F5XA 1SYHA 4HS7A 5DW8A 4G8HA 4ZEKA 4NF6A 3T93B 5ISUA 3B8BA 5I84A 2B4LA 4F1VA 1LAXA 2RCAA 1LBVA 3FVKA 3QUFA 4GF8A 2P1SA 1SI1A 4JVDA 4N8YA 2A5SA 3B6WA 3R26A 4U1ZA 3UK4A 4GX4A 4PBHA 2DWHA 2Y5LA 4U4SA 2GHAA 1B05A 3CI8A 5FHNA 2ZMBA 3FVOA 2RKMA 3ILTB 2UVJA 4I8CA 3O6HA 1P1WA 3Q26A 3RT6B 3K6XA 2KR0A 3FXUA 4KFQA 4MX6A 4MFIA 2I3VA 1JVXA 5H8SA 5A5XA 3S9LC 4EQBA 1P1NA 5H8FA 4GWZA 2GQ1A 5ET6A 5EYFA 1S9TA 3PUZE 4NTLA 5DYHA 3E3KA 4O3AA 2FYIA 4NF4A 1AMFA 2ONSA 3IL1B 5EQAA 1VR5A 2R8TA 4NF5A 2F6GA 4F2OA 2O6AA 4F31B 1SW5A 4Z7EA 2ZZVA 4ZE9A 4GOTA 4MJOA 4OENA 1B52A 4EQ7A 3RY3A 3EPEA 3H6TA 1JETA 4FEDA 4GX3A 1UIUA 3IOVA 5HBCA 1I69A 4QFNA 2O7IA 4OEVA 4MLQA 3C9HA 3IJOB 3V5AA 5HM4B 1POY1 4IR8A 4N8GA 1NUYA 3S9NC 4QSEA 1USYE 1N7WA 5H8NB 2I0CA 2BJJX 5CI5A 2Z23A 2FHYA 1IUDA 1D9VA 3A09A 5JEIA 4JXIA 2DP8A 3VVDA 1O64A 2LAOA 2WKYA 1II5A 4YB7A 5TPAA 5ITPA 2XWIA 3LBSA 1R6ZA 1XVYA 2QS3A 3TMGA 5I2NA 4GXSB 1B5JA 4YB6A 3PV0E 2XXUA 1HSEA 5FHOA 1GVCA 1FPIA 3H06B 3RN8A 2XX9A 3ILUB 4GBWA 2BJIA 3CSBA 4P11A 2H5YA 4ECFA 1SW2A 4RNSA 1H44A 1AOVA 4KI0E 2ABHA 2O84X 2KLFA 4GX6A 2QVRA 2I4CA 5LTCA 2PFYA 4Q5TA 3NOHA 1QULA 1D9YA 4LATA 3H7MA 5J16A 4PDDA 4GIZA 3S2VA 1EH3A 5L8DA 3VVFA 4O3CA 4G68A 3U65A 4KYEA 1B3LA 4JSDA 3ZKKA 1FJ9A 1Y3PA 2VGQA 4NG7A 3DP8A 1CE2A 4JBZA 4FE8A 5EQ7A 4LA9A 4X1DA 5CMMA 4R9GA 4KHZE 3ZSFA 2GHBA 4H65A 2VOZA 3IFCA 1PC3A 1FQEA 2DXYA 1JQFA 4XTCQ 2ZZWA 2F7BA 1G0HA 4LVQA 1Q1KA 2V4CA 3KBRA 4IGTA 2CZLA 2XXHA 3MUQA 3KOSA 2DWJA 2RCBA 2F6PA 3CR9A 3H3GA 3T22A 2RC7A 3N5LA 4X8RA 3VLVA 4RXLA 4G77A 3GBAA 3CIJA 2ZNUA 3L6HA 2XXXA 4JWOA 1B5HA 1VSOA 5ESYA 3ROJA 4RY1A 3SETA 1Y1ZA 2UYEA 1LAFE 3TQLA 4XXUA 4F1UA 3K4UA 3VV5A 4XKQA 1Y1MA 4ELOA 3MZ9A 3V89B 1PDAA 5TP9B 4NGUA 1PB7A 5I57B 2H25A 1FTOA 4NEDA 3IOTA 3OSRA 5LDZA 4HCYA 2HZKA 5LOMA 1P1UA 3RPWA 2RINA 3G3FA 4PE5B 1D3KA 3IJXB 1MXZA 4JVCA 4QSDA 1NV1A 3OO6A 5FHMA 5I2KB 3OO8A 1FPKA 4PDHA 3BBRA 2XX8A 4I3YA 5EQ8A 2V3QA 4U22A 1MM7A 4OMBA 1DOTA 2DE4A 2JJKA 4U4XA 2QJEA 3VLWA 4ONYA 4YMAA 4G2ZA 3MYUA 5AA2D 1UTHA 4KCDA 1B1XA 3D1RA 3TODA 3OENA 1LBYA 3LC8A 4IY6A 4NF8B 5EYGA 4ZEIA 4GXAA 1AH5A 4P1LA 3G3GA 2XXIA 3KEIA 5ET8A 5H8HA 2H99A 1LEVA 3K02A 4IGRA 1A55A 3K0VA 1URGA 2F7CA 5DEXA 3OO7A 3SESA 1D4NA 1VFEA 3Q25A 4XIGQ 4DE8A 1FPBA 3U92A 4JB7A 2RF1A 4OESA 4YMBA 3U72A 2PT1A 1JW5A 3K1NA 1A8EA 3G7WA 2DSFA 3TTMA 1NNKA 3PPPA 1POTA 1BK4A 1LFIA 2YPNA 5EHMA 3HFUA 3C31A 2HHMA 3KOTA 1Z7NE 1GR2A 1SYIA 3MVWA 3QYTA 3PMXA 2I49A 3HPIA 2ZNTA 3O6IA 3UP9A 3E79A 4RPOA 3H4ZA 4OETA 2Y7PA 4P47A 5DVFA 1FBEA 3E78A 1B46A 4Z0IA 4M1VA 4KD5A 3EN3A 3BIHA 3PGFA 3PD8A 2IEEA 3Q28A 2OJTA 1GV8A 3MJNA 4ZZAA 3IFAA 1VFDA 3TTRA 4AB6A 3IB2A 1A54A 1B40A 2ZNSA 2ZZXA 3LSLA 1MDP1 1LBBA 1NNPA 3FVGA 3TPAA 2R6GE 3TFLA 5IGAA 3FIRA 4IO7A 4N17A 4BDOA 4MF3A 4IO2A 2AL4A 3JV9A 2UVGA 5BUUA 1KA1A 4FBPA 3FATA 3O28A 4GL0A 1PBQA 1EZPA 3SEWA 1ZJLA 4DDDA 2H9BA 3TCHA 2OWSA 1AL3A 4DCYA 1MY2A 4MMPA 1IMEA 3K00A 1FPFA 5EQ9A 3K1MA 3RQTA 4R73A 4QFOA 1Q35A 5I3SA 1R9QA 3A29A 1BP5A 2OX3A 4PF6A 2CZIA 4HE2A 3FUZA 3QK6A 1B9JA 4O7MA 2O51A 4GWYA 5I58B 1NV2A 4PAFA 4NHBA 4H1XA 2FVZA 4NN3A 5ICTA 1B1HA 3BKIB 4EF1A 5T3JA 1CB6A 3MVXA 4QRZA 4BDLA 1MPDA 2GRVA 3C4MA 3CG1A 3O66A 3PUVE 3MW0A 4PGNA 3CFLA 4IO3A 5AA2B 4R6KA 2VP1A 4F29A 1S7YA 4EDPA 4IB2A 4R6YA 3RNNA 4YAHX 1H45A 2G29A 1INPA 4WEPA 3OELA 3OO9A 4I1DA 1B2HA 3F11A 4QHQA 4HW8A 4YICA 1FRPA 3LUYA 4BDQA 4PE3A 3O9PA 2DYXA 3TTKA 3CRBA 4HTGA 3V83A 1LBWA 2Q2AA 4P56A 2OCUA 5FTHA 4G61A 1H43A 1KWHA 3ECRA 4AQ4A 1LB9A 4PFWA 4N6DA 1LBZA 3HO7A 1Q9DA 2OZZA 4GWXA 4OQOA 5F24A 3QIMA 3C33A 4GBVA 1FSAA 4H6DA 1N3WA 4XFEA 2L5VA 4RYAA 1GGGA 3O6GA 3H6WA 3T66A 3PPNA 1QKBA 1XOCA 3KG2A 4OFJA 1Z7ME 3N6UA 1B3GA 2XXTA 5DT6A 3TTNA 2DE3A 4PF8A 1OIBA 4IO6A 4PGPA 2OBGA 4NQ8A 4C0RA 3C36A 1OQHA 4F19A 5I56B 3TUSA 5ET5A 3H6VA 2I58A 3QUJA 3UA8A 3TKDA 1NI9A 1P1OA 1OVBA 5KDTB 5I57A 5IZ3A 3SEXA 2F8DA 3FVNA 2QS1A 2PMSA 2OWZA 3IO4A 1YCJA 4Q8RA 1TFDA 1KZ8A 2I6EA 1S50A 1PEBA 4OA4A 4XKPA 5AA4B 1MQHA 1N7XA 2HXRA 2VD3A 4HE1A 4QF9A 2FIXA 3TDJA 5H8QA 4MBPA 4MIJA 1LGBC 5EYHA 3TCGA 1QUJA 1BKAA 1OMPA 3MPKA 3LR1A 1QGXA 2Y7WA 5CBSA 1YXIA 1WDNA 2D3IA 3PUWE 3EHUA 2DQVA 4OXVA 2XXQA 3HN0A 4TLLB 5L9OA 2F3DA 3TZAA 5BWJA 1B3FA 2RC8A 1B7ZA 4H67A 3BFTA 2R71A 4LZ5A 4GRKA 1BTJA 3IB0A 3O29A 1N04A 1B5IA 4TLMB 4P0IA 1ANFA 4N07A 2UVHA 5I59B 4MNPA 4DXUA 3OEMA 4GVOA 1N0TA 4ZDMA 2FNCA 1JW1A 3FXBA 2DVCA 4XF5A 3S9MC 4MNIA 2B4MA 1MXWA 2D21A 5FBPA 1DCUA 1AIVA 3A3CA 1LCFA 2PX1A 2PT2A 4NE4A 4UA8A 3EQ1A 3C32A 1WVJA 1NFTA 1LCTA 1FPEA 1JNFA 1IXIA 4N6PA 3VFJA 3SEYA 3TAJA 2ALUA 2B3FA 4U23A 5I5PA 4PFIA 3SDFA 3MWBA 5DVJA 2XWKA 3VE1B 1EYIA 3OEKA 3CFZA 1H3DA 1US5A 4E0XA 1DTGA
chains in the Genus database with same CATH topology
2XHDA 1WODA 1DMBA 3U8QA 4ESXA 1ATGA 2UYFA 1MQJA 4OHNA 4OEUA 1MRPA 2ZYMA 4L17A 4GWOA 3PMWA 2F36A 1XT8A 3UGWA 3FASA 5F7VA 4C1TA 2THIA 2DWIA 4R2FA 3RT8A 4ZEDA 1B4HA 4YKJA 4GQOA 1ZMGA 3SEVA 5JK4A 5L9MA 1FQBA 2OLBA 1FQCA 1MH4A 5I58A 2XXPA 4JWXA 1A8FA 1NNFA 2F35A 4LUBA 4X48A 5EHSA 5J1DA 1OLAA 3UIFA 1LFGA 4FAJA 4LP2B 1MXVA 1QUKA 4KR5A 2GFEA 2ZXTA 4N13A 1IEJA 1QKAA 2Z8DA 1MY1A 1N84A 2XXRA 1PBPA 3T9XB 3MVZA 3FZVA 5A5XB 4KCCA 4PQJA 3MQ9A 4G8MA 5IKBA 1BLFA 5TU0A 2F34A 1EU8A 3FXQA 5CRYA 4F3PA 1LAHE 2ZYOA 3N6TA 3QXMA 2ONRA 3ODBA 2O69A 1NH7A 1QUIA 2AYSA 1BIYA 2M8CA 4DXCA 4X9TA 3GBBA 1SD3A 2YLNA 2REJA 1LFHA 5M2VA 1SI0A 1RYXA 4I62A 3U93A 3HV1A 4C1UA 2DWAA 4DZ1A 2ESNA 3MP1A 4WEDA 3USDA 1SQYA 4AB5A 2XD3A 3CFXA 4R6HA 3K6UA 5K2XA 1OVTA 2OWTA 5DTBA 3FGSA 3H03A 3FJGA 1A99A 4JSOA 4GL8A 3RTFB 1ZBMA 1FTJA 1FCKA 4NWCA 1I6QA 2REGA 3EHSA 4XKRA 1EZOA 1MQIA 2VD2A 5TPAB 4Q30B 1UTBB 2V3TA 2IA4A 1M5FA 5I2NB 3VXBA 1JEVA 3JZJA 1TXFA 3SKPA 3M8UA 2FA7A 3R7XA 3VDFA 1FQDA 3L6GA 1VE4A 4IO4A 4OVJA 1MM6A 5KDTA 4KYSA 4F39A 3KN7A 2DOJA 3G3HA 3OMBA 1MY4A 2W7YA 3E13X 3MP8A 4QFPA 1IZ1A 4F1YA 3K01A 3K6WA 3RUMA 4RJZA 2G93A 2HEUA 3OD7A 4FEBA 2X7PA 3IR1A 3C34A 4ISUA 2QS4A 1B3EA 3K1PA 3IK6B 2AL5A 4U21A 1M5DA 3TEPA 3KSXA 1XHYA 1M5EA 4F3BA 4EQ9A 1OLCA 4R9FA 3QSLA 1O7TA 3ZKLA 4IO5A 4KQPA 1MG1A 3MZBA 4YZZA 4IY5A 4H8IA 2X7QA 3KN3A 3KJTA 1ZU0A 2Z22A 5H8NA 4WXJA 2QPQA 3TQWA 4GD5A 1MXXA 3LSWA 4RPNA 3MPLA 2DXRA 3P7IA 4YKKA 2H98A 4F2QA 4F3SA 4OERA 4DIGA 3DP4A 3EHTA 1XC1A 2O1LA 3W15C 1JW4A 4NMYA 1T0KA 1Y3QA 3LSFB 4EXKA 1PB8A 5CM6A 1PB9A 2Q2CA 4RK2A 1ELJA 2Y7KA 3H6UA 1EZ9A 3O97A 3AXFA 3DP6A 1QW0A 3PUXE 4P0GA 3U1OA 2XD2A 2HCAA 1MQGA 4OZ9A 3D4CA 1ZLQA 3TTLA 5HPQA 3I5OA 1RKMA 4QFLA 4WKMA 3B6TA 1NMUA 3I6VA 4DLDA 4ZECA 2V3UA 2NOOA 1UTHB 2ZYKA 4ZEBA 4FIMA 4YU0A 5K2YA 3G3IA 3PPOA 1IXGA 4R74A 1NH8A 3VXCA 4RA1A 1ZKBA 2F97A 3E4RA 3GZGA 4O3BA 3IB1A 1A7LA 1US4A 1J1NA 4M4GA 3HCQA 4X1BA 1MDQA 3FV2A 1M5CA 1YAEA 5ITOA 2Y7RA 4F18A 1B7HA 3MC2A 4G68C 1XVXA 3IAZA 2HXWA 4UACA 5KCJB 1LSTA 5TP9A 3T9UA 2XXVA 3KZGA 5CMKA 2UXAA 3W9WA 2PVUA 3RLFE 2E0SA 3QAXA 1XS5A 2RC9A 1YPNA 2V84A 3MZ1A 2B3BA 4E0WA 3RTWB 3O2AA 1P1QA 3CG3A 3G3JA 4OTEA 5JTYB 4TQUQ 2F78A 5I2KA 3OOAA 4H5GA 3LSXA 2PYYA 2YJPA 4PP0A 1SDXA 1Y20A 4QFKA 4ELRA 4R75A 1NL5A 2HZLA 4PFTA 4NF8A 4H0WA 3MAMA 4DXBA 3PMVA 4KPTA 2UVIA 3HSTA 3CSGA 4PFYA 2Z8FA 1JVYA 2ANJA 1QJMA 3SERA 2O68A 2H4IA 2AIXA 2DE2A 3PD9A 4XKNA 4BLAA 1P99A 2D5WA 5AE4A 4GLIA 4JDFA 1MY0A 3VVEA 1UTBA 4K3FA 1B58A 1N76A 4LQ5A 3JYRA 1MPCA 1TWYA 5FTIA 4G4PA 3CVGA 3FJ7A 3B7DA 3B6QA 4EUOA 1DPPA 2I3WA 3C35A 2ZYNA 4U2RA 4POXA 3DLNA 4F22A 1FTLA 2X26A 2ONKE 1O63A 4POWA 4ND9A 3HHGA 3IORA 3PPRA 3M3FA 5ICQA 3PPQA 3FV1A 1USYH 3OSQA 3VLUA 1B6HA 3WAEA 3UN6A 2DS9A 3S9EA 4R2BA 1MH3A 4OWDA 4JWYA 2DVZA 3V8XB 2A5TB 1B32A 3T9VA 3Q29A 5AA3A 4NF6B 5ELVA 1DSNA 3T96B 2I48A 4NWDA 1SVXB 3MVYA 1B3HA 3PU5A 1TFAA 1HSLA 1FTKA 3UORA 4EXLA 1IQ7A 2HFBA 3BFUA 5AA2A 2P0SA 3FD3A 2Y7IA 5B7DA 5H8FB 1R9LA 4MLVA 1Y4CA 2Q89A 2B65A 1RYOA 4LZ7A 3KJ7A 4NF4B 2HAVA 1B0LA 2P2AA 1TT1A 3GXAA 3K2DA 1IXHA 4NF5B 3FJMA 4PFUA 4GFRA 2V25A 4LQ2A 4R72A 1GTKA 4TOZA 2Z8EA 5H8QB 3G3KA 2HQ0A 3N94A 4ZZEA 3IOWA 2E1SA 3IX1A 2I0BA 4YKPA 4ELQA 1SW1A 4OYVA 4H8JA 3KFMA 2NVUB 3FXRA 3E9XA 1LB8A 3WAFA 1OQGA 1M5BA 2Q9TA 2R9JA 5CC2A 1ZTYA 4U1OA 4G8NA 2QRYA 3ONMA 4ESWA 4KYDA 3ZS6A 1B4ZA 3DELB 5I56A 1LBCA 3RGYA 1B7UA 3M3LA 1IIWA 4ZE8A 4THIA 5KCJA 1MQDA 2QMWA 5KZTA 2QS2A 1QVSA 3GLBA 1HSJA 2HAUA 1I6BA 4YB5A 3HHFA 2QL3A 5AA1A 1Y3NA 1MPBA 2QSXA 4MH5A 3KN8A 5CMCA 1SBPA 3IO6A 5AA4A 3N26A 5JTYA 5F1QA 4G68B 2I4BA 4FORA 2OK2A 4OFOA 4F3GA 3R6UA 3OXNA 1FQAA 1N3XA 1F9BA 1URSA 4FATA 1MS7A 4LZ8A 5CBRA 3T9HB 1MY3A 2O7UA 3TYHA 2PBWA 3SEUA 3MBPA 3IOUA 4HCWA 1UIVA 1DTZA 4FJPA 3MP6A 5IAIA 4QSCA 4DCXA 1SW4A 2NXOA 2XXYA 4PETA 2XX7A 1NNTA 2V93A 5I59A 1I6AA 3A3UA 2VHAA 1YTVA 2XXWA 2QMXA 2Q8JA 1DPEA 1UQWA 3Q27A 4OFLA 1URDA 1Y4TA 3DM0A 4Q0CA 2Y84A 1JEUA 3D4GA 1FW0A 3K6VA 3KGCA 1A40A 1ZIUA 4ZEFA 3EF7A 5L9SA 2F7AA 1H76A 1R1NA 4FECA 1FTMA 2NUVA 2CMOA 4BDMA 1FQFA 4EF2A 4ELPA 2GH9A 4RK9A 1IITA 3I3VA 4H5FA 5B70A 5CMBA 4YKIA 3S4UA 1IXCA 3M3KA 3THIA 4BDNA 1L5TA 3KSJA 2Q88A 1MXYA 1LLSA 1B0HA 4LONB 1Y9UA 3W9VA 5H8HB 1NKXA 3U94A 5DVIA 2O1MA 4I9DA 3TCFA 2NWJA 5DEXB 3TELA 1MXUA 3PUYE 1LAGE 4BDRA 4ZS9A 1B51A 2A5TA 2F5XA 1SYHA 4HS7A 4G8HA 4ZEKA 4NF6A 3T93B 5ISUA 5I84A 4F1VA 1LAXA 2RCAA 3FVKA 3QUFA 4GF8A 2P1SA 1SI1A 2A5SA 3B6WA 3R26A 4U1ZA 3UK4A 2DWHA 4U4SA 2GHAA 1B05A 3CI8A 5FHNA 2ZMBA 3FVOA 2RKMA 3ILTB 2UVJA 4I8CA 3O6HA 1P1WA 3Q26A 3RT6B 3K6XA 3FXUA 4KFQA 4MFIA 2I3VA 1JVXA 5H8SA 5A5XA 3S9LC 4EQBA 1P1NA 5H8FA 5EYFA 1S9TA 3PUZE 4NTLA 5DYHA 3E3KA 4O3AA 2FYIA 4NF4A 1AMFA 2ONSA 3IL1B 1VR5A 4NF5A 2F6GA 4F2OA 2O6AA 4F31B 1SW5A 4Z7EA 4ZE9A 4GOTA 4OENA 1B52A 4EQ7A 3RY3A 3EPEA 3H6TA 1JETA 4FEDA 1UIUA 3IOVA 5HBCA 1I69A 4QFNA 2O7IA 4OEVA 4MLQA 3C9HA 3IJOB 3V5AA 5HM4B 1POY1 3S9NC 4QSEA 1USYE 1N7WA 5H8NB 2I0CA 2BJJX 5CI5A 2Z23A 1IUDA 1D9VA 3A09A 5JEIA 4JXIA 2DP8A 3VVDA 1O64A 2LAOA 2WKYA 1II5A 4YB7A 5TPAA 5ITPA 3LBSA 1R6ZA 1XVYA 2QS3A 3TMGA 5I2NA 4GXSB 1B5JA 4YB6A 3PV0E 2XXUA 1HSEA 5FHOA 1GVCA 3H06B 3RN8A 2XX9A 3ILUB 3CSBA 4P11A 2H5YA 4ECFA 1SW2A 4RNSA 1H44A 1AOVA 4KI0E 2ABHA 2O84X 2KLFA 2I4CA 4Q5TA 1QULA 1D9YA 4LATA 3H7MA 4GIZA 3S2VA 1EH3A 5L8DA 3VVFA 4O3CA 4G68A 4KYEA 1B3LA 4JSDA 3ZKKA 1Y3PA 2VGQA 3DP8A 1CE2A 4JBZA 4FE8A 4LA9A 4X1DA 5CMMA 4R9GA 4KHZE 3ZSFA 2GHBA 4H65A 2VOZA 1PC3A 1FQEA 2DXYA 1JQFA 4XTCQ 2F7BA 4LVQA 1Q1KA 3KBRA 4IGTA 2CZLA 2XXHA 3MUQA 3KOSA 2DWJA 2RCBA 2F6PA 3CR9A 3H3GA 3T22A 2RC7A 3N5LA 3VLVA 4RXLA 4G77A 3GBAA 3CIJA 2ZNUA 3L6HA 2XXXA 4JWOA 1B5HA 1VSOA 4RY1A 3SETA 1Y1ZA 2UYEA 1LAFE 3TQLA 4XXUA 4F1UA 3K4UA 3VV5A 4XKQA 1Y1MA 4ELOA 3MZ9A 3V89B 1PDAA 5TP9B 1PB7A 5I57B 2H25A 1FTOA 4NEDA 3IOTA 3OSRA 4HCYA 2HZKA 5LOMA 1P1UA 3RPWA 2RINA 3G3FA 4PE5B 1D3KA 3IJXB 1MXZA 4QSDA 3OO6A 5FHMA 5I2KB 3OO8A 3BBRA 2XX8A 2V3QA 4U22A 1MM7A 4OMBA 1DOTA 2DE4A 4U4XA 2QJEA 3VLWA 4ONYA 4YMAA 4G2ZA 5AA2D 1UTHA 4KCDA 1B1XA 3TODA 3OENA 3LC8A 4NF8B 4IY6A 4ZEIA 4GXAA 1AH5A 3G3GA 2XXIA 3KEIA 5H8HA 2H99A 3K02A 4IGRA 1A55A 3K0VA 1URGA 2F7CA 5DEXA 3OO7A 3SESA 1D4NA 1VFEA 3Q25A 4XIGQ 4DE8A 3U92A 4JB7A 2RF1A 4OESA 4YMBA 3U72A 2PT1A 1JW5A 3K1NA 1A8EA 3G7WA 2DSFA 3TTMA 1NNKA 3PPPA 1POTA 2YPNA 1LFIA 5EHMA 3C31A 3KOTA 1Z7NE 1GR2A 1SYIA 3MVWA 3QYTA 3PMXA 2I49A 3HPIA 2ZNTA 3O6IA 3UP9A 4RPOA 3H4ZA 4OETA 2Y7PA 5DVFA 1B46A 4Z0IA 4M1VA 4KD5A 3EN3A 3PGFA 3PD8A 2IEEA 3Q28A 2OJTA 1GV8A 3MJNA 4ZZAA 1VFDA 3TTRA 4AB6A 3IB2A 1A54A 1B40A 2ZNSA 3LSLA 1MDP1 1LBBA 1NNPA 3FVGA 3TPAA 2R6GE 3TFLA 3FIRA 4IO7A 4BDOA 4MF3A 4IO2A 2AL4A 3JV9A 2UVGA 5BUUA 3FATA 3O28A 4GL0A 1PBQA 1EZPA 3SEWA 1ZJLA 4DDDA 2H9BA 3TCHA 2OWSA 1AL3A 4DCYA 1MY2A 3K00A 3K1MA 3RQTA 4R73A 4QFOA 1Q35A 1R9QA 1BP5A 3FUZA 3QK6A 1B9JA 2O51A 5I58B 4H1XA 5ICTA 1B1HA 3BKIB 4EF1A 1CB6A 3MVXA 4QRZA 4BDLA 1MPDA 2GRVA 3C4MA 3CG1A 3O66A 3PUVE 3MW0A 3CFLA 4IO3A 5AA2B 4R6KA 2VP1A 4F29A 1S7YA 4EDPA 4IB2A 4R6YA 3RNNA 4YAHX 1H45A 2G29A 4WEPA 3OELA 3OO9A 4I1DA 1B2HA 3F11A 4QHQA 4HW8A 4YICA 3LUYA 4BDQA 3O9PA 2DYXA 3TTKA 3CRBA 4HTGA 3V83A 2Q2AA 2OCUA 5FTHA 1H43A 1KWHA 3ECRA 4AQ4A 1LB9A 4PFWA 3HO7A 2OZZA 4OQOA 3QIMA 3C33A 4H6DA 1N3WA 4RYAA 1GGGA 3O6GA 3H6WA 3T66A 3PPNA 1QKBA 1XOCA 3KG2A 4OFJA 1Z7ME 3N6UA 1B3GA 2XXTA 5DT6A 3TTNA 2DE3A 1OIBA 4IO6A 2OBGA 4C0RA 3C36A 1OQHA 4F19A 5I56B 3TUSA 3H6VA 2I58A 3QUJA 3UA8A 3TKDA 1P1OA 1OVBA 5KDTB 5I57A 3SEXA 2F8DA 3FVNA 2QS1A 2PMSA 3IO4A 1YCJA 4Q8RA 1TFDA 2I6EA 1S50A 1PEBA 4XKPA 5AA4B 1MQHA 1N7XA 2VD3A 4QF9A 3TDJA 5H8QA 4MBPA 1LGBC 3TCGA 1QUJA 1BKAA 1OMPA 3MPKA 3LR1A 2Y7WA 5CBSA 1WDNA 2D3IA 3PUWE 3EHUA 2DQVA 4OXVA 2XXQA 3HN0A 4TLLB 5L9OA 3TZAA 5BWJA 1B3FA 2RC8A 1B7ZA 4H67A 3BFTA 2R71A 4LZ5A 4GRKA 1BTJA 3IB0A 3O29A 1N04A 1B5IA 4TLMB 4P0IA 1ANFA 4N07A 2UVHA 5I59B 4DXUA 3OEMA 4GVOA 1N0TA 4ZDMA 2FNCA 1JW1A 2DVCA 3S9MC 1MXWA 2D21A 1AIVA 3A3CA 1LCFA 2PX1A 2PT2A 4NE4A 4UA8A 3EQ1A 3C32A 1WVJA 1NFTA 1LCTA 1JNFA 1IXIA 4N6PA 3VFJA 3SEYA 3TAJA 2ALUA 2B3FA 4U23A 3SDFA 3MWBA 5DVJA 3VE1B 3OEKA 3CFZA 1H3DA 1US5A 4E0XA 1DTGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHD A;  1WOD A;  1DMB A;  3U8Q A;  4ESX A;  1ATG A;  2UYF A;  1MQJ A;  4OHN A;  4OEU A;  1MRP A;  2ZYM A;  4L17 A;  4GWO A;  3PMW A;  2F36 A;  1XT8 A;  3UGW A;  3FAS A;  5F7V A;  4C1T A;  2THI A;  2DWI A;  4R2F A;  3RT8 A;  4ZED A;  1B4H A;  4YKJ A;  4GQO A;  1ZMG A;  3SEV A;  5JK4 A;  5L9M A;  1FQB A;  2OLB A;  1FQC A;  1MH4 A;  5I58 A;  2XXP A;  4JWX A;  1A8F A;  1NNF A;  2F35 A;  4LUB A;  4X48 A;  5EHS A;  5J1D A;  1OLA A;  3UIF A;  1LFG A;  4FAJ A;  4LP2 B;  1MXV A;  1QUK A;  4KR5 A;  2GFE A;  2ZXT A;  4N13 A;  1IEJ A;  1QKA A;  2Z8D A;  1MY1 A;  1N84 A;  2XXR A;  1PBP A;  3T9X B;  3MVZ A;  3FZV A;  5A5X B;  4KCC A;  4PQJ A;  3MQ9 A;  4G8M A;  5IKB A;  1BLF A;  5TU0 A;  2F34 A;  1EU8 A;  3FXQ A;  5CRY A;  4F3P A;  1LAH E;  2ZYO A;  3N6T A;  3QXM A;  2ONR A;  3ODB A;  2O69 A;  1NH7 A;  1QUI A;  2AYS A;  1BIY A;  2M8C A;  4DXC A;  4X9T A;  3GBB A;  1SD3 A;  2YLN A;  2REJ A;  1LFH A;  5M2V A;  1SI0 A;  1RYX A;  4I62 A;  3U93 A;  3HV1 A;  4C1U A;  2DWA A;  4DZ1 A;  2ESN A;  3MP1 A;  4WED A;  3USD A;  1SQY A;  4AB5 A;  2XD3 A;  3CFX A;  4R6H A;  3K6U A;  5K2X A;  1OVT A;  2OWT A;  5DTB A;  3FGS A;  3H03 A;  3FJG A;  1A99 A;  4JSO A;  4GL8 A;  3RTF B;  1ZBM A;  1FTJ A;  1FCK A;  4NWC A;  1I6Q A;  2REG A;  3EHS A;  4XKR A;  1EZO A;  1MQI A;  2VD2 A;  5TPA B;  4Q30 B;  1UTB B;  2V3T A;  2IA4 A;  1M5F A;  5I2N B;  3VXB A;  1JEV A;  3JZJ A;  1TXF A;  3SKP A;  3M8U A;  2FA7 A;  3R7X A;  3VDF A;  1FQD A;  3L6G A;  1VE4 A;  4IO4 A;  4OVJ A;  1MM6 A;  5KDT A;  4KYS A;  4F39 A;  3KN7 A;  2DOJ A;  3G3H A;  3OMB A;  1MY4 A;  2W7Y A;  3E13 X;  3MP8 A;  4QFP A;  1IZ1 A;  4F1Y A;  3K01 A;  3K6W A;  3RUM A;  4RJZ A;  2G93 A;  2HEU A;  3OD7 A;  4FEB A;  2X7P A;  3IR1 A;  3C34 A;  4ISU A;  2QS4 A;  1B3E A;  3K1P A;  3IK6 B;  2AL5 A;  4U21 A;  1M5D A;  3TEP A;  3KSX A;  1XHY A;  1M5E A;  4F3B A;  4EQ9 A;  1OLC A;  4R9F A;  3QSL A;  1O7T A;  3ZKL A;  4IO5 A;  4KQP A;  1MG1 A;  3MZB A;  4YZZ A;  4IY5 A;  4H8I A;  2X7Q A;  3KN3 A;  3KJT A;  1ZU0 A;  2Z22 A;  5H8N A;  4WXJ A;  2QPQ A;  3TQW A;  4GD5 A;  1MXX A;  3LSW A;  4RPN A;  3MPL A;  2DXR A;  3P7I A;  4YKK A;  2H98 A;  4F2Q A;  4F3S A;  4OER A;  4DIG A;  3DP4 A;  3EHT A;  1XC1 A;  2O1L A;  3W15 C;  1JW4 A;  4NMY A;  1T0K A;  1Y3Q A;  3LSF B;  4EXK A;  1PB8 A;  5CM6 A;  1PB9 A;  2Q2C A;  4RK2 A;  1ELJ A;  2Y7K A;  3H6U A;  1EZ9 A;  3O97 A;  3AXF A;  3DP6 A;  1QW0 A;  3PUX E;  4P0G A;  3U1O A;  2XD2 A;  2HCA A;  1MQG A;  4OZ9 A;  3D4C A;  1ZLQ A;  3TTL A;  5HPQ A;  3I5O A;  1RKM A;  4QFL A;  4WKM A;  3B6T A;  1NMU A;  3I6V A;  4DLD A;  4ZEC A;  2V3U A;  2NOO A;  1UTH B;  2ZYK A;  4ZEB A;  4FIM A;  4YU0 A;  5K2Y A;  3G3I A;  3PPO A;  1IXG A;  4R74 A;  1NH8 A;  3VXC A;  4RA1 A;  1ZKB A;  2F97 A;  3E4R A;  3GZG A;  4O3B A;  3IB1 A;  1A7L A;  1US4 A;  1J1N A;  4M4G A;  3HCQ A;  4X1B A;  1MDQ A;  3FV2 A;  1M5C A;  1YAE A;  5ITO A;  2Y7R A;  4F18 A;  1B7H A;  3MC2 A;  4G68 C;  1XVX A;  3IAZ A;  2HXW A;  4UAC A;  5KCJ B;  1LST A;  5TP9 A;  3T9U A;  2XXV A;  3KZG A;  5CMK A;  2UXA A;  3W9W A;  2PVU A;  3RLF E;  2E0S A;  3QAX A;  1XS5 A;  2RC9 A;  1YPN A;  2V84 A;  3MZ1 A;  2B3B A;  4E0W A;  3RTW B;  3O2A A;  1P1Q A;  3CG3 A;  3G3J A;  4OTE A;  5JTY B;  4TQU Q;  2F78 A;  5I2K A;  3OOA A;  4H5G A;  3LSX A;  2PYY A;  2YJP A;  4PP0 A;  1SDX A;  1Y20 A;  4QFK A;  4ELR A;  4R75 A;  1NL5 A;  2HZL A;  4PFT A;  4NF8 A;  4H0W A;  3MAM A;  4DXB A;  3PMV A;  4KPT A;  2UVI A;  3HST A;  3CSG A;  4PFY A;  2Z8F A;  1JVY A;  2ANJ A;  1QJM A;  3SER A;  2O68 A;  2H4I A;  2AIX A;  2DE2 A;  3PD9 A;  4XKN A;  4BLA A;  1P99 A;  2D5W A;  5AE4 A;  4GLI A;  4JDF A;  1MY0 A;  3VVE A;  1UTB A;  4K3F A;  1B58 A;  1N76 A;  4LQ5 A;  3JYR A;  1MPC A;  1TWY A;  5FTI A;  4G4P A;  3CVG A;  3FJ7 A;  3B7D A;  3B6Q A;  4EUO A;  1DPP A;  2I3W A;  3C35 A;  2ZYN A;  4U2R A;  4POX A;  3DLN A;  4F22 A;  1FTL A;  2X26 A;  2ONK E;  1O63 A;  4POW A;  4ND9 A;  3HHG A;  3IOR A;  3PPR A;  3M3F A;  5ICQ A;  3PPQ A;  3FV1 A;  1USY H;  3OSQ A;  3VLU A;  1B6H A;  3WAE A;  3UN6 A;  2DS9 A;  3S9E A;  4R2B A;  1MH3 A;  4OWD A;  4JWY A;  2DVZ A;  3V8X B;  2A5T B;  1B32 A;  3T9V A;  3Q29 A;  5AA3 A;  4NF6 B;  5ELV A;  1DSN A;  3T96 B;  2I48 A;  4NWD A;  1SVX B;  3MVY A;  1B3H A;  3PU5 A;  1TFA A;  1HSL A;  1FTK A;  3UOR A;  4EXL A;  1IQ7 A;  2HFB A;  3BFU A;  5AA2 A;  2P0S A;  3FD3 A;  2Y7I A;  5B7D A;  5H8F B;  1R9L A;  4MLV A;  1Y4C A;  2Q89 A;  2B65 A;  1RYO A;  4LZ7 A;  3KJ7 A;  4NF4 B;  2HAV A;  1B0L A;  2P2A A;  1TT1 A;  3GXA A;  3K2D A;  1IXH A;  4NF5 B;  3FJM A;  4PFU A;  4GFR A;  2V25 A;  4LQ2 A;  4R72 A;  1GTK A;  4TOZ A;  2Z8E A;  5H8Q B;  3G3K A;  2HQ0 A;  3N94 A;  4ZZE A;  3IOW A;  2E1S A;  3IX1 A;  2I0B A;  4YKP A;  4ELQ A;  1SW1 A;  4OYV A;  4H8J A;  3KFM A;  2NVU B;  3FXR A;  3E9X A;  1LB8 A;  3WAF A;  1OQG A;  1M5B A;  2Q9T A;  2R9J A;  5CC2 A;  1ZTY A;  4U1O A;  4G8N A;  2QRY A;  3ONM A;  4ESW A;  4KYD A;  3ZS6 A;  1B4Z A;  3DEL B;  5I56 A;  1LBC A;  3RGY A;  1B7U A;  3M3L A;  1IIW A;  4ZE8 A;  4THI A;  5KCJ A;  1MQD A;  2QMW A;  5KZT A;  2QS2 A;  1QVS A;  3GLB A;  1HSJ A;  2HAU A;  1I6B A;  4YB5 A;  3HHF A;  2QL3 A;  5AA1 A;  1Y3N A;  1MPB A;  2QSX A;  4MH5 A;  3KN8 A;  5CMC A;  1SBP A;  3IO6 A;  5AA4 A;  3N26 A;  5JTY A;  5F1Q A;  4G68 B;  2I4B A;  4FOR A;  2OK2 A;  4OFO A;  4F3G A;  3R6U A;  3OXN A;  1FQA A;  1N3X A;  1F9B A;  1URS A;  4FAT A;  1MS7 A;  4LZ8 A;  5CBR A;  3T9H B;  1MY3 A;  2O7U A;  3TYH A;  2PBW A;  3SEU A;  3MBP A;  3IOU A;  4HCW A;  1UIV A;  1DTZ A;  4FJP A;  3MP6 A;  5IAI A;  4QSC A;  4DCX A;  1SW4 A;  2NXO A;  2XXY A;  4PET A;  2XX7 A;  1NNT A;  2V93 A;  5I59 A;  1I6A A;  3A3U A;  2VHA A;  1YTV A;  2XXW A;  2QMX A;  2Q8J A;  1DPE A;  1UQW A;  3Q27 A;  4OFL A;  1URD A;  1Y4T A;  3DM0 A;  4Q0C A;  2Y84 A;  1JEU A;  3D4G A;  1FW0 A;  3K6V A;  3KGC A;  1A40 A;  1ZIU A;  4ZEF A;  3EF7 A;  5L9S A;  2F7A A;  1H76 A;  1R1N A;  4FEC A;  1FTM A;  2NUV A;  2CMO A;  4BDM A;  1FQF A;  4EF2 A;  4ELP A;  2GH9 A;  4RK9 A;  1IIT A;  3I3V A;  4H5F A;  5B70 A;  5CMB A;  4YKI A;  3S4U A;  1IXC A;  3M3K A;  3THI A;  4BDN A;  1L5T A;  3KSJ A;  2Q88 A;  1MXY A;  1LLS A;  1B0H A;  4LON B;  1Y9U A;  3W9V A;  5H8H B;  1NKX A;  3U94 A;  5DVI A;  2O1M A;  4I9D A;  3TCF A;  2NWJ A;  5DEX B;  3TEL A;  1MXU A;  3PUY E;  1LAG E;  4BDR A;  4ZS9 A;  1B51 A;  2A5T A;  2F5X A;  1SYH A;  4HS7 A;  4G8H A;  4ZEK A;  4NF6 A;  3T93 B;  5ISU A;  5I84 A;  4F1V A;  1LAX A;  2RCA A;  3FVK A;  3QUF A;  4GF8 A;  2P1S A;  1SI1 A;  2A5S A;  3B6W A;  3R26 A;  4U1Z A;  3UK4 A;  2DWH A;  4U4S A;  2GHA A;  1B05 A;  3CI8 A;  5FHN A;  2ZMB A;  3FVO A;  2RKM A;  3ILT B;  2UVJ A;  4I8C A;  3O6H A;  1P1W A;  3Q26 A;  3RT6 B;  3K6X A;  3FXU A;  4KFQ A;  4MFI A;  2I3V A;  1JVX A;  5H8S A;  5A5X A;  3S9L C;  4EQB A;  1P1N A;  5H8F A;  5EYF A;  1S9T A;  3PUZ E;  4NTL A;  5DYH A;  3E3K A;  4O3A A;  2FYI A;  4NF4 A;  1AMF A;  2ONS A;  3IL1 B;  1VR5 A;  4NF5 A;  2F6G A;  4F2O A;  2O6A A;  4F31 B;  1SW5 A;  4Z7E A;  4ZE9 A;  4GOT A;  4OEN A;  1B52 A;  4EQ7 A;  3RY3 A;  3EPE A;  3H6T A;  1JET A;  4FED A;  1UIU A;  3IOV A;  5HBC A;  1I69 A;  4QFN A;  2O7I A;  4OEV A;  4MLQ A;  3C9H A;  3IJO B;  3V5A A;  5HM4 B;  1POY 1;  3S9N C;  4QSE A;  1USY E;  1N7W A;  5H8N B;  2I0C A;  2BJJ X;  5CI5 A;  2Z23 A;  1IUD A;  1D9V A;  3A09 A;  5JEI A;  4JXI A;  2DP8 A;  3VVD A;  1O64 A;  2LAO A;  2WKY A;  1II5 A;  4YB7 A;  5TPA A;  5ITP A;  3LBS A;  1R6Z A;  1XVY A;  2QS3 A;  3TMG A;  5I2N A;  4GXS B;  1B5J A;  4YB6 A;  3PV0 E;  2XXU A;  1HSE A;  5FHO A;  1GVC A;  3H06 B;  3RN8 A;  2XX9 A;  3ILU B;  3CSB A;  4P11 A;  2H5Y A;  4ECF A;  1SW2 A;  4RNS A;  1H44 A;  1AOV A;  4KI0 E;  2ABH A;  2O84 X;  2KLF A;  2I4C A;  4Q5T A;  1QUL A;  1D9Y A;  4LAT A;  3H7M A;  4GIZ A;  3S2V A;  1EH3 A;  5L8D A;  3VVF A;  4O3C A;  4G68 A;  4KYE A;  1B3L A;  4JSD A;  3ZKK A;  1Y3P A;  2VGQ A;  3DP8 A;  1CE2 A;  4JBZ A;  4FE8 A;  4LA9 A;  4X1D A;  5CMM A;  4R9G A;  4KHZ E;  3ZSF A;  2GHB A;  4H65 A;  2VOZ A;  1PC3 A;  1FQE A;  2DXY A;  1JQF A;  4XTC Q;  2F7B A;  4LVQ A;  1Q1K A;  3KBR A;  4IGT A;  2CZL A;  2XXH A;  3MUQ A;  3KOS A;  2DWJ A;  2RCB A;  2F6P A;  3CR9 A;  3H3G A;  3T22 A;  2RC7 A;  3N5L A;  3VLV A;  4RXL A;  4G77 A;  3GBA A;  3CIJ A;  2ZNU A;  3L6H A;  2XXX A;  4JWO A;  1B5H A;  1VSO A;  4RY1 A;  3SET A;  1Y1Z A;  2UYE A;  1LAF E;  3TQL A;  4XXU A;  4F1U A;  3K4U A;  3VV5 A;  4XKQ A;  1Y1M A;  4ELO A;  3MZ9 A;  3V89 B;  1PDA A;  5TP9 B;  1PB7 A;  5I57 B;  2H25 A;  1FTO A;  4NED A;  3IOT A;  3OSR A;  4HCY A;  2HZK A;  5LOM A;  1P1U A;  3RPW A;  2RIN A;  3G3F A;  4PE5 B;  1D3K A;  3IJX B;  1MXZ A;  4QSD A;  3OO6 A;  5FHM A;  5I2K B;  3OO8 A;  3BBR A;  2XX8 A;  2V3Q A;  4U22 A;  1MM7 A;  4OMB A;  1DOT A;  2DE4 A;  4U4X A;  2QJE A;  3VLW A;  4ONY A;  4YMA A;  4G2Z A;  5AA2 D;  1UTH A;  4KCD A;  1B1X A;  3TOD A;  3OEN A;  3LC8 A;  4NF8 B;  4IY6 A;  4ZEI A;  4GXA A;  1AH5 A;  3G3G A;  2XXI A;  3KEI A;  5H8H A;  2H99 A;  3K02 A;  4IGR A;  1A55 A;  3K0V A;  1URG A;  2F7C A;  5DEX A;  3OO7 A;  3SES A;  1D4N A;  1VFE A;  3Q25 A;  4XIG Q;  4DE8 A;  3U92 A;  4JB7 A;  2RF1 A;  4OES A;  4YMB A;  3U72 A;  2PT1 A;  1JW5 A;  3K1N A;  1A8E A;  3G7W A;  2DSF A;  3TTM A;  1NNK A;  3PPP A;  1POT A;  2YPN A;  1LFI A;  5EHM A;  3C31 A;  3KOT A;  1Z7N E;  1GR2 A;  1SYI A;  3MVW A;  3QYT A;  3PMX A;  2I49 A;  3HPI A;  2ZNT A;  3O6I A;  3UP9 A;  4RPO A;  3H4Z A;  4OET A;  2Y7P A;  5DVF A;  1B46 A;  4Z0I A;  4M1V A;  4KD5 A;  3EN3 A;  3PGF A;  3PD8 A;  2IEE A;  3Q28 A;  2OJT A;  1GV8 A;  3MJN A;  4ZZA A;  1VFD A;  3TTR A;  4AB6 A;  3IB2 A;  1A54 A;  1B40 A;  2ZNS A;  3LSL A;  1MDP 1;  1LBB A;  1NNP A;  3FVG A;  3TPA A;  2R6G E;  3TFL A;  3FIR A;  4IO7 A;  4BDO A;  4MF3 A;  4IO2 A;  2AL4 A;  3JV9 A;  2UVG A;  5BUU A;  3FAT A;  3O28 A;  4GL0 A;  1PBQ A;  1EZP A;  3SEW A;  1ZJL A;  4DDD A;  2H9B A;  3TCH A;  2OWS A;  1AL3 A;  4DCY A;  1MY2 A;  3K00 A;  3K1M A;  3RQT A;  4R73 A;  4QFO A;  1Q35 A;  1R9Q A;  1BP5 A;  3FUZ A;  3QK6 A;  1B9J A;  2O51 A;  5I58 B;  4H1X A;  5ICT A;  1B1H A;  3BKI B;  4EF1 A;  1CB6 A;  3MVX A;  4QRZ A;  4BDL A;  1MPD A;  2GRV A;  3C4M A;  3CG1 A;  3O66 A;  3PUV E;  3MW0 A;  3CFL A;  4IO3 A;  5AA2 B;  4R6K A;  2VP1 A;  4F29 A;  1S7Y A;  4EDP A;  4IB2 A;  4R6Y A;  3RNN A;  4YAH X;  1H45 A;  2G29 A;  4WEP A;  3OEL A;  3OO9 A;  4I1D A;  1B2H A;  3F11 A;  4QHQ A;  4HW8 A;  4YIC A;  3LUY A;  4BDQ A;  3O9P A;  2DYX A;  3TTK A;  3CRB A;  4HTG A;  3V83 A;  2Q2A A;  2OCU A;  5FTH A;  1H43 A;  1KWH A;  3ECR A;  4AQ4 A;  1LB9 A;  4PFW A;  3HO7 A;  2OZZ A;  4OQO A;  3QIM A;  3C33 A;  4H6D A;  1N3W A;  4RYA A;  1GGG A;  3O6G A;  3H6W A;  3T66 A;  3PPN A;  1QKB A;  1XOC A;  3KG2 A;  4OFJ A;  1Z7M E;  3N6U A;  1B3G A;  2XXT A;  5DT6 A;  3TTN A;  2DE3 A;  1OIB A;  4IO6 A;  2OBG A;  4C0R A;  3C36 A;  1OQH A;  4F19 A;  5I56 B;  3TUS A;  3H6V A;  2I58 A;  3QUJ A;  3UA8 A;  3TKD A;  1P1O A;  1OVB A;  5KDT B;  5I57 A;  3SEX A;  2F8D A;  3FVN A;  2QS1 A;  2PMS A;  3IO4 A;  1YCJ A;  4Q8R A;  1TFD A;  2I6E A;  1S50 A;  1PEB A;  4XKP A;  5AA4 B;  1MQH A;  1N7X A;  2VD3 A;  4QF9 A;  3TDJ A;  5H8Q A;  4MBP A;  1LGB C;  3TCG A;  1QUJ A;  1BKA A;  1OMP A;  3MPK A;  3LR1 A;  2Y7W A;  5CBS A;  1WDN A;  2D3I A;  3PUW E;  3EHU A;  2DQV A;  4OXV A;  2XXQ A;  3HN0 A;  4TLL B;  5L9O A;  3TZA A;  5BWJ A;  1B3F A;  2RC8 A;  1B7Z A;  4H67 A;  3BFT A;  2R71 A;  4LZ5 A;  4GRK A;  1BTJ A;  3IB0 A;  3O29 A;  1N04 A;  1B5I A;  4TLM B;  4P0I A;  1ANF A;  4N07 A;  2UVH A;  5I59 B;  4DXU A;  3OEM A;  4GVO A;  1N0T A;  4ZDM A;  2FNC A;  1JW1 A;  2DVC A;  3S9M C;  1MXW A;  2D21 A;  1AIV A;  3A3C A;  1LCF A;  2PX1 A;  2PT2 A;  4NE4 A;  4UA8 A;  3EQ1 A;  3C32 A;  1WVJ A;  1NFT A;  1LCT A;  1JNF A;  1IXI A;  4N6P A;  3VFJ A;  3SEY A;  3TAJ A;  2ALU A;  2B3F A;  4U23 A;  3SDF A;  3MWB A;  5DVJ A;  3VE1 B;  3OEK A;  3CFZ A;  1H3D A;  1US5 A;  4E0X A;  1DTG A; 
#chains in the Genus database with same CATH topology
 2XHD A;  1WOD A;  1DMB A;  3U8Q A;  4ESX A;  1ATG A;  2UYF A;  4OVS A;  1MQJ A;  2QVV A;  3T1B A;  4OHN A;  4OEU A;  1MRP A;  2ZYM A;  4L17 A;  4GWO A;  3PMW A;  3RPL B;  2F36 A;  1XT8 A;  3UGW A;  3FAS A;  5F7V A;  5ET7 A;  4C1T A;  2THI A;  1G0I A;  4PFB A;  2DWI A;  4R2F A;  3RT8 A;  4ZED A;  1B4H A;  4YKJ A;  4GQO A;  1ZMG A;  1NUX A;  3SEV A;  5JK4 A;  5L9M A;  1FQB A;  2OLB A;  1FQC A;  1MH4 A;  5I58 A;  4N6K A;  2XXP A;  4JWX A;  1A8F A;  1NNF A;  2F35 A;  4LUB A;  4X48 A;  5EHS A;  1FPD A;  4OVQ A;  5J1D A;  1OLA A;  2Q74 A;  3UIF A;  1LFG A;  4FAJ A;  4LP2 B;  1MXV A;  1QUK A;  4KR5 A;  2GFE A;  2ZXT A;  4N13 A;  1IEJ A;  1QKA A;  1FPL A;  2Z8D A;  1MY1 A;  1N84 A;  2XXR A;  1PBP A;  3T9X B;  3MVZ A;  3FZV A;  5A5X B;  4KCC A;  4PQJ A;  3MQ9 A;  4G8M A;  5IKB A;  4NAP A;  1BLF A;  5TU0 A;  1K9Y A;  3LV0 A;  2F34 A;  4H45 A;  1EU8 A;  3FXQ A;  4OVR A;  5CRY A;  4F3P A;  1LAH E;  2ZYO A;  3N6T A;  3QXM A;  2ONR A;  1SPI A;  3ODB A;  4QXD A;  2O69 A;  1NH7 A;  2VPN A;  1QUI A;  2AYS A;  1BIY A;  2M8C A;  4DXC A;  4X9T A;  3GBB A;  1SD3 A;  2YLN A;  2REJ A;  1LFH A;  5M2V A;  1SI0 A;  1RYX A;  4I62 A;  3U93 A;  3HV1 A;  4C1U A;  1IMA A;  3FBP A;  2DWA A;  4DZ1 A;  2ESN A;  3MP1 A;  4WED A;  3USD A;  2CZK A;  1SQY A;  4P3L A;  4AB5 A;  4O94 A;  2XD3 A;  1XI6 A;  3CFX A;  4R6H A;  3K6U A;  5K2X A;  1OVT A;  2OWT A;  3KC1 A;  4HXV A;  3FGS A;  3H03 A;  3FJG A;  5DTB A;  1A99 A;  4JSO A;  4GL8 A;  3RTF B;  1ZBM A;  1FTJ A;  1FCK A;  4NWC A;  1I6Q A;  2REG A;  3EHS A;  4XKR A;  4NF0 A;  1EZO A;  1MQI A;  2VD2 A;  4GWS A;  5TPA B;  4Q30 B;  1UTB B;  2V3T A;  2IA4 A;  1M5F A;  5I2N B;  4MNC A;  2VPO A;  3VXB A;  1JEV A;  1FPG A;  3JZJ A;  1TXF A;  3SKP A;  3M8U A;  2FA7 A;  4N81 A;  3R7X A;  3VDF A;  1FQD A;  3L6G A;  1VE4 A;  2XXK A;  4IO4 A;  1FTA A;  4OVJ A;  1MM6 A;  5KDT A;  4KYS A;  4F39 A;  3KN7 A;  2DOJ A;  3G3H A;  3OMB A;  1MY4 A;  2W7Y A;  3E13 X;  3MP8 A;  4QFP A;  1IZ1 A;  4F1Y A;  3K01 A;  3K6W A;  3RUM A;  4RJZ A;  2G93 A;  2HEU A;  3OD7 A;  4FEB A;  2X7P A;  3IR1 A;  3C34 A;  4ISU A;  5IZ1 A;  2QS4 A;  1B3E A;  1FJ6 A;  3K1P A;  3IK6 B;  2AL5 A;  4U21 A;  1M5D A;  3TEP A;  1IMF A;  3KSX A;  2Q8M A;  1XHY A;  1M5E A;  4F3B A;  4EQ9 A;  1OLC A;  4R9F A;  3QSL A;  1O7T A;  3ZKL A;  4IO5 A;  4MAG A;  4KQP A;  4MCO A;  1MG1 A;  2FIE A;  3MZB A;  4YZZ A;  4IY5 A;  4H8I A;  2X7Q A;  3KN3 A;  4PFR A;  4DI3 D;  3KJT A;  1ZU0 A;  2Z22 A;  5H8N A;  4WXJ A;  2QPQ A;  3TQW A;  4GD5 A;  1MXX A;  3LSW A;  4KXP A;  4RPN A;  3MPL A;  2HPG A;  2DXR A;  3GYY A;  3P7I A;  4YKK A;  2CEX A;  2H98 A;  4F2Q A;  4F3S A;  4OER A;  4DIG A;  4LN5 A;  3DP4 A;  3EHT A;  1XC1 A;  2WBB A;  2O1L A;  3W15 C;  1JW4 A;  4NMY A;  1T0K A;  2WEF A;  1Y3Q A;  3LSF B;  4EXK A;  1PB8 A;  5CM6 A;  1PB9 A;  4P9K A;  2Q2C A;  4RK2 A;  1ELJ A;  2Y7K A;  3H6U A;  1EZ9 A;  3O97 A;  3AXF A;  4DI4 B;  3DP6 A;  1QW0 A;  3PUX E;  3EKI A;  4GWU A;  4P0G A;  3U1O A;  2XD2 A;  2HCA A;  1MQG A;  4OZ9 A;  4N4U A;  3D4C A;  1ZLQ A;  1LBX A;  3TTL A;  5HPQ A;  3I5O A;  1RKM A;  4QFL A;  4WKM A;  3B6T A;  1NMU A;  3I6V A;  1EYJ A;  4DLD A;  1KA0 A;  2PCR A;  4ZEC A;  2V3U A;  2NOO A;  1UTH B;  2ZYK A;  4ZEB A;  5IM2 A;  4FIM A;  4H46 A;  4YU0 A;  4GWW A;  5K2Y A;  3G3I A;  3PPO A;  1IXG A;  4R74 A;  1NH8 A;  3VXC A;  3PTY A;  4RA1 A;  1ZKB A;  2F97 A;  3E4R A;  3ISP A;  1YYZ A;  3KBZ A;  4NX1 A;  1NV3 A;  3GZG A;  4O3B A;  4OAN A;  5A5L A;  3IB1 A;  1A7L A;  1US4 A;  1J1N A;  4M4G A;  1EYK A;  3HCQ A;  4X1B A;  1MDQ A;  3FV2 A;  1M5C A;  1YAE A;  5ITO A;  4P8B A;  2Y7R A;  4F18 A;  1B7H A;  3MC2 A;  4G68 C;  1XVX A;  3IAZ A;  2HXW A;  4UAC A;  5KCJ B;  1LST A;  5TP9 A;  3T9U A;  2XXV A;  3KZG A;  5CMK A;  2UXA A;  3W9W A;  2PVU A;  4PAK A;  3RLF E;  2E0S A;  3QAX A;  1XS5 A;  1DK4 A;  2RC9 A;  1YPN A;  2V84 A;  3MZ1 A;  2B3B A;  3RTW B;  4E0W A;  3O2A A;  3CHG A;  1P1Q A;  3CG3 A;  4N91 A;  3G3J A;  4OTE A;  1FBC A;  2QFL A;  5JTY B;  4TQU Q;  2F78 A;  5I2K A;  3OOA A;  1FBF A;  4H5G A;  3LSX A;  2PYY A;  2YJP A;  4PP0 A;  1SDX A;  1Y20 A;  4QFK A;  4ELR A;  4R75 A;  1NL5 A;  2HZL A;  4PFT A;  4NF8 A;  1FBH A;  4H0W A;  1D9Q A;  3MAM A;  4DXB A;  4HE0 A;  1FBP A;  3PMV A;  4KPT A;  2FBP A;  2UVI A;  3HST A;  3CSG A;  4PFY A;  3LUZ A;  2Z8F A;  1JVY A;  2ANJ A;  1QJM A;  3SER A;  2O68 A;  2H4I A;  2AIX A;  2DE2 A;  3PD9 A;  4XKN A;  4BLA A;  1P99 A;  2D5W A;  5AE4 A;  4GLI A;  4AS5 A;  4JDF A;  1MY0 A;  3VVE A;  1UTB A;  4K3F A;  1B58 A;  4PTK A;  4AS4 A;  5I7I A;  1N76 A;  4LQ5 A;  3JYR A;  1MPC A;  1TWY A;  5FTI A;  2F3B A;  2CEY A;  2XWV A;  4G4P A;  3CVG A;  3FJ7 A;  3B7D A;  3B6Q A;  4EUO A;  1DPP A;  2I3W A;  3C35 A;  2ZYN A;  4MHF A;  4U2R A;  4POX A;  3DLN A;  4F22 A;  1FTL A;  2X26 A;  2ONK E;  1RDY A;  1O63 A;  4POW A;  4ND9 A;  3HHG A;  3IOR A;  3KC0 A;  3PPR A;  3M3F A;  5ICQ A;  1IMB A;  3PPQ A;  3FV1 A;  1USY H;  3BIG A;  3OSQ A;  3VLU A;  1B6H A;  4JVI A;  3WAE A;  2P3V A;  3UN6 A;  4PBQ A;  2DS9 A;  4I3E A;  3S9E A;  4R2B A;  1MH3 A;  4OWD A;  4JWY A;  2DVZ A;  3V8X B;  2A5T B;  1B32 A;  3T9V A;  3Q29 A;  5AA3 A;  4NF6 B;  5ELV A;  1RDZ A;  2DDK A;  1DSN A;  3T96 B;  3RYD A;  2I48 A;  4NWD A;  1SVX B;  3MVY A;  1B3H A;  3PU5 A;  1TFA A;  1HSL A;  1FTK A;  3UOR A;  4MEV A;  1NV4 A;  4EXL A;  1IQ7 A;  2HFB A;  3BFU A;  5AA2 A;  4X04 A;  2P0S A;  3FD3 A;  2Y7I A;  2WYK A;  5IZ3 B;  4PAI A;  5B7D A;  5H8F B;  1NV7 A;  1R9L A;  4MLV A;  1Y4C A;  2Q89 A;  2B65 A;  1RYO A;  4LZ7 A;  1IMD A;  3KJ7 A;  4NF4 B;  1RDX A;  2HAV A;  1B0L A;  1NV0 A;  2P2A A;  1TT1 A;  3GXA A;  3K2D A;  1IXH A;  4NF5 B;  3FJM A;  4PFU A;  4GFR A;  2V25 A;  4LQ2 A;  4R72 A;  1GTK A;  4TOZ A;  2Z8E A;  5H8Q B;  3G3K A;  2HQ0 A;  3N94 A;  2VT5 A;  4ZZE A;  3IOW A;  2E1S A;  4PCD A;  3IX1 A;  2I0B A;  4YKP A;  4ELQ A;  4OVT A;  1SW1 A;  4OYV A;  4H8J A;  3KFM A;  2NVU B;  2XA5 A;  3FXR A;  4O7I A;  2WBD A;  3E9X A;  1LB8 A;  3WAF A;  1OQG A;  1M5B A;  2Q9T A;  2R9J A;  5CC2 A;  1ZTY A;  4U1O A;  4G8N A;  1FPJ A;  2QRY A;  3ONM A;  4ESW A;  4KYD A;  3ZS6 A;  1B4Z A;  2Y5K A;  3DEL B;  5I56 A;  1LBC A;  3RGY A;  1B7U A;  3M3L A;  1IIW A;  1NV5 A;  4ZE8 A;  4THI A;  5KCJ A;  1FBD A;  1MQD A;  4UAB A;  2QMW A;  5KZT A;  2QS2 A;  1QVS A;  3GLB A;  1HSJ A;  2HAU A;  2P3N A;  2XWO A;  1I6B A;  1JP4 A;  4YB5 A;  3HHF A;  2QL3 A;  5AA1 A;  1Y3N A;  1MPB A;  3B50 A;  2QSX A;  4MH5 A;  3KN8 A;  5CMC A;  1SBP A;  3IO6 A;  4O8M A;  5AA4 A;  3N26 A;  5JTY A;  5F1Q A;  2WYP A;  4G68 B;  2I4B A;  4FOR A;  2OK2 A;  4OFO A;  4F3G A;  3SZP A;  3R6U A;  3OXN A;  1FQA A;  1N3X A;  1F9B A;  1URS A;  4FAT A;  1NUZ A;  4QBA A;  1MS7 A;  3MST A;  4LZ8 A;  1CNQ A;  5CBR A;  3T9H B;  1MY3 A;  1AWB A;  2CZH A;  2O7U A;  3TYH A;  2PBW A;  3SEU A;  3MBP A;  3IOU A;  4HCW A;  5IZZ A;  4I40 A;  1UIV A;  1DTZ A;  4FJP A;  1VDW A;  3MP6 A;  5IAI A;  4QSC A;  4DCX A;  1SW4 A;  2NXO A;  2XXY A;  4PET A;  2XX7 A;  1NNT A;  2V93 A;  5I59 A;  1I6A A;  1NUW A;  2VHA A;  1YTV A;  3A3U A;  2XXW A;  2QMX A;  2Q8J A;  1DPE A;  1UQW A;  3Q27 A;  4OFL A;  1URD A;  1Y4T A;  3DM0 A;  4Q0C A;  2Y84 A;  1JEU A;  3D4G A;  1FW0 A;  3K6V A;  3KGC A;  1DBZ A;  2KQZ A;  1A40 A;  1ZIU A;  1K9Z A;  1NV6 A;  4ZEF A;  3EF7 A;  1IMC A;  2QVU A;  5L9S A;  2MKZ A;  2F7A A;  1H76 A;  1R1N A;  4FEC A;  2PFZ A;  1FTM A;  2WX9 A;  2NUV A;  4P1E A;  2CMO A;  4BDM A;  1FQF A;  4EF2 A;  4ELP A;  2GH9 A;  4RK9 A;  1IIT A;  3I3V A;  4H5F A;  5B70 A;  5CMB A;  4YKI A;  3S4U A;  1IXC A;  1YZ0 A;  3M3K A;  3THI A;  4BDN A;  4XEQ A;  3T0J A;  1L5T A;  3KSJ A;  3QMF A;  2Q88 A;  1MXY A;  1LLS A;  1B0H A;  4LON B;  1Y9U A;  3W9V A;  1FBG A;  5H8H B;  1NKX A;  3U94 A;  5DVI A;  4N15 A;  2O1M A;  4I9D A;  3RPL A;  3TCF A;  4PC9 A;  2NWJ A;  5DEX B;  3TEL A;  1MXU A;  3PUY E;  1LAG E;  4BDR A;  4ZS9 A;  1B51 A;  2A5T A;  4OVP A;  2F5X A;  1SYH A;  4HS7 A;  5DW8 A;  4G8H A;  4ZEK A;  4NF6 A;  3T93 B;  5ISU A;  3B8B A;  5I84 A;  2B4L A;  4F1V A;  1LAX A;  2RCA A;  1LBV A;  3FVK A;  3QUF A;  4GF8 A;  2P1S A;  1SI1 A;  4JVD A;  4N8Y A;  2A5S A;  3B6W A;  3R26 A;  4U1Z A;  3UK4 A;  4GX4 A;  4PBH A;  2DWH A;  2Y5L A;  4U4S A;  2GHA A;  1B05 A;  3CI8 A;  5FHN A;  2ZMB A;  3FVO A;  2RKM A;  3ILT B;  2UVJ A;  4I8C A;  3O6H A;  1P1W A;  3Q26 A;  3RT6 B;  3K6X A;  2KR0 A;  3FXU A;  4KFQ A;  4MX6 A;  4MFI A;  2I3V A;  1JVX A;  5H8S A;  5A5X A;  3S9L C;  4EQB A;  1P1N A;  5H8F A;  4GWZ A;  2GQ1 A;  5ET6 A;  5EYF A;  1S9T A;  3PUZ E;  4NTL A;  5DYH A;  3E3K A;  4O3A A;  2FYI A;  4NF4 A;  1AMF A;  2ONS A;  3IL1 B;  5EQA A;  1VR5 A;  2R8T A;  4NF5 A;  2F6G A;  4F2O A;  2O6A A;  4F31 B;  1SW5 A;  4Z7E A;  2ZZV A;  4ZE9 A;  4GOT A;  4MJO A;  4OEN A;  1B52 A;  4EQ7 A;  3RY3 A;  3EPE A;  3H6T A;  1JET A;  4FED A;  4GX3 A;  1UIU A;  3IOV A;  5HBC A;  1I69 A;  4QFN A;  2O7I A;  4OEV A;  4MLQ A;  3C9H A;  3IJO B;  3V5A A;  5HM4 B;  1POY 1;  4IR8 A;  4N8G A;  1NUY A;  3S9N C;  4QSE A;  1USY E;  1N7W A;  5H8N B;  2I0C A;  2BJJ X;  5CI5 A;  2Z23 A;  2FHY A;  1IUD A;  1D9V A;  3A09 A;  5JEI A;  4JXI A;  2DP8 A;  3VVD A;  1O64 A;  2LAO A;  2WKY A;  1II5 A;  4YB7 A;  5TPA A;  5ITP A;  2XWI A;  3LBS A;  1R6Z A;  1XVY A;  2QS3 A;  3TMG A;  5I2N A;  4GXS B;  1B5J A;  4YB6 A;  3PV0 E;  2XXU A;  1HSE A;  5FHO A;  1GVC A;  1FPI A;  3H06 B;  3RN8 A;  2XX9 A;  3ILU B;  4GBW A;  2BJI A;  3CSB A;  4P11 A;  2H5Y A;  4ECF A;  1SW2 A;  4RNS A;  1H44 A;  1AOV A;  4KI0 E;  2ABH A;  2O84 X;  2KLF A;  4GX6 A;  2QVR A;  2I4C A;  5LTC A;  2PFY A;  4Q5T A;  3NOH A;  1QUL A;  1D9Y A;  4LAT A;  3H7M A;  5J16 A;  4PDD A;  4GIZ A;  3S2V A;  1EH3 A;  5L8D A;  3VVF A;  4O3C A;  4G68 A;  3U65 A;  4KYE A;  1B3L A;  4JSD A;  3ZKK A;  1FJ9 A;  1Y3P A;  2VGQ A;  4NG7 A;  3DP8 A;  1CE2 A;  4JBZ A;  4FE8 A;  5EQ7 A;  4LA9 A;  4X1D A;  5CMM A;  4R9G A;  4KHZ E;  3ZSF A;  2GHB A;  4H65 A;  2VOZ A;  3IFC A;  1PC3 A;  1FQE A;  2DXY A;  1JQF A;  4XTC Q;  2ZZW A;  2F7B A;  1G0H A;  4LVQ A;  1Q1K A;  2V4C A;  3KBR A;  4IGT A;  2CZL A;  2XXH A;  3MUQ A;  3KOS A;  2DWJ A;  2RCB A;  2F6P A;  3CR9 A;  3H3G A;  3T22 A;  2RC7 A;  3N5L A;  4X8R A;  3VLV A;  4RXL A;  4G77 A;  3GBA A;  3CIJ A;  2ZNU A;  3L6H A;  2XXX A;  4JWO A;  1B5H A;  1VSO A;  5ESY A;  3ROJ A;  4RY1 A;  3SET A;  1Y1Z A;  2UYE A;  1LAF E;  3TQL A;  4XXU A;  4F1U A;  3K4U A;  3VV5 A;  4XKQ A;  1Y1M A;  4ELO A;  3MZ9 A;  3V89 B;  1PDA A;  5TP9 B;  4NGU A;  1PB7 A;  5I57 B;  2H25 A;  1FTO A;  4NED A;  3IOT A;  3OSR A;  5LDZ A;  4HCY A;  2HZK A;  5LOM A;  1P1U A;  3RPW A;  2RIN A;  3G3F A;  4PE5 B;  1D3K A;  3IJX B;  1MXZ A;  4JVC A;  4QSD A;  1NV1 A;  3OO6 A;  5FHM A;  5I2K B;  3OO8 A;  1FPK A;  4PDH A;  3BBR A;  2XX8 A;  4I3Y A;  5EQ8 A;  2V3Q A;  4U22 A;  1MM7 A;  4OMB A;  1DOT A;  2DE4 A;  2JJK A;  4U4X A;  2QJE A;  3VLW A;  4ONY A;  4YMA A;  4G2Z A;  3MYU A;  5AA2 D;  1UTH A;  4KCD A;  1B1X A;  3D1R A;  3TOD A;  3OEN A;  1LBY A;  3LC8 A;  4IY6 A;  4NF8 B;  5EYG A;  4ZEI A;  4GXA A;  1AH5 A;  4P1L A;  3G3G A;  2XXI A;  3KEI A;  5ET8 A;  5H8H A;  2H99 A;  1LEV A;  3K02 A;  4IGR A;  1A55 A;  3K0V A;  1URG A;  2F7C A;  5DEX A;  3OO7 A;  3SES A;  1D4N A;  1VFE A;  3Q25 A;  4XIG Q;  4DE8 A;  1FPB A;  3U92 A;  4JB7 A;  2RF1 A;  4OES A;  4YMB A;  3U72 A;  2PT1 A;  1JW5 A;  3K1N A;  1A8E A;  3G7W A;  2DSF A;  3TTM A;  1NNK A;  3PPP A;  1POT A;  1BK4 A;  1LFI A;  2YPN A;  5EHM A;  3HFU A;  3C31 A;  2HHM A;  3KOT A;  1Z7N E;  1GR2 A;  1SYI A;  3MVW A;  3QYT A;  3PMX A;  2I49 A;  3HPI A;  2ZNT A;  3O6I A;  3UP9 A;  3E79 A;  4RPO A;  3H4Z A;  4OET A;  2Y7P A;  4P47 A;  5DVF A;  1FBE A;  3E78 A;  1B46 A;  4Z0I A;  4M1V A;  4KD5 A;  3EN3 A;  3BIH A;  3PGF A;  3PD8 A;  2IEE A;  3Q28 A;  2OJT A;  1GV8 A;  3MJN A;  4ZZA A;  3IFA A;  1VFD A;  3TTR A;  4AB6 A;  3IB2 A;  1A54 A;  1B40 A;  2ZNS A;  2ZZX A;  3LSL A;  1MDP 1;  1LBB A;  1NNP A;  3FVG A;  3TPA A;  2R6G E;  3TFL A;  5IGA A;  3FIR A;  4IO7 A;  4N17 A;  4BDO A;  4MF3 A;  4IO2 A;  2AL4 A;  3JV9 A;  2UVG A;  5BUU A;  1KA1 A;  4FBP A;  3FAT A;  3O28 A;  4GL0 A;  1PBQ A;  1EZP A;  3SEW A;  1ZJL A;  4DDD A;  2H9B A;  3TCH A;  2OWS A;  1AL3 A;  4DCY A;  1MY2 A;  4MMP A;  1IME A;  3K00 A;  1FPF A;  5EQ9 A;  3K1M A;  3RQT A;  4R73 A;  4QFO A;  1Q35 A;  5I3S A;  1R9Q A;  3A29 A;  1BP5 A;  2OX3 A;  4PF6 A;  2CZI A;  4HE2 A;  3FUZ A;  3QK6 A;  1B9J A;  4O7M A;  2O51 A;  4GWY A;  5I58 B;  1NV2 A;  4PAF A;  4NHB A;  4H1X A;  2FVZ A;  4NN3 A;  5ICT A;  1B1H A;  3BKI B;  4EF1 A;  5T3J A;  1CB6 A;  3MVX A;  4QRZ A;  4BDL A;  1MPD A;  2GRV A;  3C4M A;  3CG1 A;  3O66 A;  3PUV E;  3MW0 A;  4PGN A;  3CFL A;  4IO3 A;  5AA2 B;  4R6K A;  2VP1 A;  4F29 A;  1S7Y A;  4EDP A;  4IB2 A;  4R6Y A;  3RNN A;  4YAH X;  1H45 A;  2G29 A;  1INP A;  4WEP A;  3OEL A;  3OO9 A;  4I1D A;  1B2H A;  3F11 A;  4QHQ A;  4HW8 A;  4YIC A;  1FRP A;  3LUY A;  4BDQ A;  4PE3 A;  3O9P A;  2DYX A;  3TTK A;  3CRB A;  4HTG A;  3V83 A;  1LBW A;  2Q2A A;  4P56 A;  2OCU A;  5FTH A;  4G61 A;  1H43 A;  1KWH A;  3ECR A;  4AQ4 A;  1LB9 A;  4PFW A;  4N6D A;  1LBZ A;  3HO7 A;  1Q9D A;  2OZZ A;  4GWX A;  4OQO A;  5F24 A;  3QIM A;  3C33 A;  4GBV A;  1FSA A;  4H6D A;  1N3W A;  4XFE A;  2L5V A;  4RYA A;  1GGG A;  3O6G A;  3H6W A;  3T66 A;  3PPN A;  1QKB A;  1XOC A;  3KG2 A;  4OFJ A;  1Z7M E;  3N6U A;  1B3G A;  2XXT A;  5DT6 A;  3TTN A;  2DE3 A;  4PF8 A;  1OIB A;  4IO6 A;  4PGP A;  2OBG A;  4NQ8 A;  4C0R A;  3C36 A;  1OQH A;  4F19 A;  5I56 B;  3TUS A;  5ET5 A;  3H6V A;  2I58 A;  3QUJ A;  3UA8 A;  3TKD A;  1NI9 A;  1P1O A;  1OVB A;  5KDT B;  5I57 A;  5IZ3 A;  3SEX A;  2F8D A;  3FVN A;  2QS1 A;  2PMS A;  2OWZ A;  3IO4 A;  1YCJ A;  4Q8R A;  1TFD A;  1KZ8 A;  2I6E A;  1S50 A;  1PEB A;  4OA4 A;  4XKP A;  5AA4 B;  1MQH A;  1N7X A;  2HXR A;  2VD3 A;  4HE1 A;  4QF9 A;  2FIX A;  3TDJ A;  5H8Q A;  4MBP A;  4MIJ A;  1LGB C;  5EYH A;  3TCG A;  1QUJ A;  1BKA A;  1OMP A;  3MPK A;  3LR1 A;  1QGX A;  2Y7W A;  5CBS A;  1YXI A;  1WDN A;  2D3I A;  3PUW E;  3EHU A;  2DQV A;  4OXV A;  2XXQ A;  3HN0 A;  4TLL B;  5L9O A;  2F3D A;  3TZA A;  5BWJ A;  1B3F A;  2RC8 A;  1B7Z A;  4H67 A;  3BFT A;  2R71 A;  4LZ5 A;  4GRK A;  1BTJ A;  3IB0 A;  3O29 A;  1N04 A;  1B5I A;  4TLM B;  4P0I A;  1ANF A;  4N07 A;  2UVH A;  5I59 B;  4MNP A;  4DXU A;  3OEM A;  4GVO A;  1N0T A;  4ZDM A;  2FNC A;  1JW1 A;  3FXB A;  2DVC A;  4XF5 A;  3S9M C;  4MNI A;  2B4M A;  1MXW A;  2D21 A;  5FBP A;  1DCU A;  1AIV A;  3A3C A;  1LCF A;  2PX1 A;  2PT2 A;  4NE4 A;  4UA8 A;  3EQ1 A;  3C32 A;  1WVJ A;  1NFT A;  1LCT A;  1FPE A;  1JNF A;  1IXI A;  4N6P A;  3VFJ A;  3SEY A;  3TAJ A;  2ALU A;  2B3F A;  4U23 A;  5I5P A;  4PFI A;  3SDF A;  3MWB A;  5DVJ A;  2XWK A;  3VE1 B;  1EYI A;  3OEK A;  3CFZ A;  1H3D A;  1US5 A;  4E0X A;  1DTG A; 
#chains in the Genus database with same CATH homology
 2XHD A;  1WOD A;  1DMB A;  3U8Q A;  4ESX A;  1ATG A;  2UYF A;  1MQJ A;  4OHN A;  4OEU A;  1MRP A;  2ZYM A;  4L17 A;  4GWO A;  3PMW A;  2F36 A;  1XT8 A;  3UGW A;  3FAS A;  5F7V A;  4C1T A;  2THI A;  2DWI A;  4R2F A;  3RT8 A;  4ZED A;  1B4H A;  4YKJ A;  4GQO A;  1ZMG A;  3SEV A;  5JK4 A;  5L9M A;  1FQB A;  2OLB A;  1FQC A;  1MH4 A;  5I58 A;  2XXP A;  4JWX A;  1A8F A;  1NNF A;  2F35 A;  4LUB A;  4X48 A;  5EHS A;  5J1D A;  1OLA A;  3UIF A;  1LFG A;  4FAJ A;  4LP2 B;  1MXV A;  1QUK A;  4KR5 A;  2GFE A;  2ZXT A;  4N13 A;  1IEJ A;  1QKA A;  2Z8D A;  1MY1 A;  1N84 A;  2XXR A;  1PBP A;  3T9X B;  3MVZ A;  3FZV A;  5A5X B;  4KCC A;  4PQJ A;  3MQ9 A;  4G8M A;  5IKB A;  1BLF A;  5TU0 A;  2F34 A;  1EU8 A;  3FXQ A;  5CRY A;  4F3P A;  1LAH E;  2ZYO A;  3N6T A;  3QXM A;  2ONR A;  3ODB A;  2O69 A;  1NH7 A;  1QUI A;  2AYS A;  1BIY A;  2M8C A;  4DXC A;  4X9T A;  3GBB A;  1SD3 A;  2YLN A;  2REJ A;  1LFH A;  5M2V A;  1SI0 A;  1RYX A;  4I62 A;  3U93 A;  3HV1 A;  4C1U A;  2DWA A;  4DZ1 A;  2ESN A;  3MP1 A;  4WED A;  3USD A;  1SQY A;  4AB5 A;  2XD3 A;  3CFX A;  4R6H A;  3K6U A;  5K2X A;  1OVT A;  2OWT A;  5DTB A;  3FGS A;  3H03 A;  3FJG A;  1A99 A;  4JSO A;  4GL8 A;  3RTF B;  1ZBM A;  1FTJ A;  1FCK A;  4NWC A;  1I6Q A;  2REG A;  3EHS A;  4XKR A;  1EZO A;  1MQI A;  2VD2 A;  5TPA B;  4Q30 B;  1UTB B;  2V3T A;  2IA4 A;  1M5F A;  5I2N B;  3VXB A;  1JEV A;  3JZJ A;  1TXF A;  3SKP A;  3M8U A;  2FA7 A;  3R7X A;  3VDF A;  1FQD A;  3L6G A;  1VE4 A;  4IO4 A;  4OVJ A;  1MM6 A;  5KDT A;  4KYS A;  4F39 A;  3KN7 A;  2DOJ A;  3G3H A;  3OMB A;  1MY4 A;  2W7Y A;  3E13 X;  3MP8 A;  4QFP A;  1IZ1 A;  4F1Y A;  3K01 A;  3K6W A;  3RUM A;  4RJZ A;  2G93 A;  2HEU A;  3OD7 A;  4FEB A;  2X7P A;  3IR1 A;  3C34 A;  4ISU A;  2QS4 A;  1B3E A;  3K1P A;  3IK6 B;  2AL5 A;  4U21 A;  1M5D A;  3TEP A;  3KSX A;  1XHY A;  1M5E A;  4F3B A;  4EQ9 A;  1OLC A;  4R9F A;  3QSL A;  1O7T A;  3ZKL A;  4IO5 A;  4KQP A;  1MG1 A;  3MZB A;  4YZZ A;  4IY5 A;  4H8I A;  2X7Q A;  3KN3 A;  3KJT A;  1ZU0 A;  2Z22 A;  5H8N A;  4WXJ A;  2QPQ A;  3TQW A;  4GD5 A;  1MXX A;  3LSW A;  4RPN A;  3MPL A;  2DXR A;  3P7I A;  4YKK A;  2H98 A;  4F2Q A;  4F3S A;  4OER A;  4DIG A;  3DP4 A;  3EHT A;  1XC1 A;  2O1L A;  3W15 C;  1JW4 A;  4NMY A;  1T0K A;  1Y3Q A;  3LSF B;  4EXK A;  1PB8 A;  5CM6 A;  1PB9 A;  2Q2C A;  4RK2 A;  1ELJ A;  2Y7K A;  3H6U A;  1EZ9 A;  3O97 A;  3AXF A;  3DP6 A;  1QW0 A;  3PUX E;  4P0G A;  3U1O A;  2XD2 A;  2HCA A;  1MQG A;  4OZ9 A;  3D4C A;  1ZLQ A;  3TTL A;  5HPQ A;  3I5O A;  1RKM A;  4QFL A;  4WKM A;  3B6T A;  1NMU A;  3I6V A;  4DLD A;  4ZEC A;  2V3U A;  2NOO A;  1UTH B;  2ZYK A;  4ZEB A;  4FIM A;  4YU0 A;  5K2Y A;  3G3I A;  3PPO A;  1IXG A;  4R74 A;  1NH8 A;  3VXC A;  4RA1 A;  1ZKB A;  2F97 A;  3E4R A;  3GZG A;  4O3B A;  3IB1 A;  1A7L A;  1US4 A;  1J1N A;  4M4G A;  3HCQ A;  4X1B A;  1MDQ A;  3FV2 A;  1M5C A;  1YAE A;  5ITO A;  2Y7R A;  4F18 A;  1B7H A;  3MC2 A;  4G68 C;  1XVX A;  3IAZ A;  2HXW A;  4UAC A;  5KCJ B;  1LST A;  5TP9 A;  3T9U A;  2XXV A;  3KZG A;  5CMK A;  2UXA A;  3W9W A;  2PVU A;  3RLF E;  2E0S A;  3QAX A;  1XS5 A;  2RC9 A;  1YPN A;  2V84 A;  3MZ1 A;  2B3B A;  4E0W A;  3RTW B;  3O2A A;  1P1Q A;  3CG3 A;  3G3J A;  4OTE A;  5JTY B;  4TQU Q;  2F78 A;  5I2K A;  3OOA A;  4H5G A;  3LSX A;  2PYY A;  2YJP A;  4PP0 A;  1SDX A;  1Y20 A;  4QFK A;  4ELR A;  4R75 A;  1NL5 A;  2HZL A;  4PFT A;  4NF8 A;  4H0W A;  3MAM A;  4DXB A;  3PMV A;  4KPT A;  2UVI A;  3HST A;  3CSG A;  4PFY A;  2Z8F A;  1JVY A;  2ANJ A;  1QJM A;  3SER A;  2O68 A;  2H4I A;  2AIX A;  2DE2 A;  3PD9 A;  4XKN A;  4BLA A;  1P99 A;  2D5W A;  5AE4 A;  4GLI A;  4JDF A;  1MY0 A;  3VVE A;  1UTB A;  4K3F A;  1B58 A;  1N76 A;  4LQ5 A;  3JYR A;  1MPC A;  1TWY A;  5FTI A;  4G4P A;  3CVG A;  3FJ7 A;  3B7D A;  3B6Q A;  4EUO A;  1DPP A;  2I3W A;  3C35 A;  2ZYN A;  4U2R A;  4POX A;  3DLN A;  4F22 A;  1FTL A;  2X26 A;  2ONK E;  1O63 A;  4POW A;  4ND9 A;  3HHG A;  3IOR A;  3PPR A;  3M3F A;  5ICQ A;  3PPQ A;  3FV1 A;  1USY H;  3OSQ A;  3VLU A;  1B6H A;  3WAE A;  3UN6 A;  2DS9 A;  3S9E A;  4R2B A;  1MH3 A;  4OWD A;  4JWY A;  2DVZ A;  3V8X B;  2A5T B;  1B32 A;  3T9V A;  3Q29 A;  5AA3 A;  4NF6 B;  5ELV A;  1DSN A;  3T96 B;  2I48 A;  4NWD A;  1SVX B;  3MVY A;  1B3H A;  3PU5 A;  1TFA A;  1HSL A;  1FTK A;  3UOR A;  4EXL A;  1IQ7 A;  2HFB A;  3BFU A;  5AA2 A;  2P0S A;  3FD3 A;  2Y7I A;  5B7D A;  5H8F B;  1R9L A;  4MLV A;  1Y4C A;  2Q89 A;  2B65 A;  1RYO A;  4LZ7 A;  3KJ7 A;  4NF4 B;  2HAV A;  1B0L A;  2P2A A;  1TT1 A;  3GXA A;  3K2D A;  1IXH A;  4NF5 B;  3FJM A;  4PFU A;  4GFR A;  2V25 A;  4LQ2 A;  4R72 A;  1GTK A;  4TOZ A;  2Z8E A;  5H8Q B;  3G3K A;  2HQ0 A;  3N94 A;  4ZZE A;  3IOW A;  2E1S A;  3IX1 A;  2I0B A;  4YKP A;  4ELQ A;  1SW1 A;  4OYV A;  4H8J A;  3KFM A;  2NVU B;  3FXR A;  3E9X A;  1LB8 A;  3WAF A;  1OQG A;  1M5B A;  2Q9T A;  2R9J A;  5CC2 A;  1ZTY A;  4U1O A;  4G8N A;  2QRY A;  3ONM A;  4ESW A;  4KYD A;  3ZS6 A;  1B4Z A;  3DEL B;  5I56 A;  1LBC A;  3RGY A;  1B7U A;  3M3L A;  1IIW A;  4ZE8 A;  4THI A;  5KCJ A;  1MQD A;  2QMW A;  5KZT A;  2QS2 A;  1QVS A;  3GLB A;  1HSJ A;  2HAU A;  1I6B A;  4YB5 A;  3HHF A;  2QL3 A;  5AA1 A;  1Y3N A;  1MPB A;  2QSX A;  4MH5 A;  3KN8 A;  5CMC A;  1SBP A;  3IO6 A;  5AA4 A;  3N26 A;  5JTY A;  5F1Q A;  4G68 B;  2I4B A;  4FOR A;  2OK2 A;  4OFO A;  4F3G A;  3R6U A;  3OXN A;  1FQA A;  1N3X A;  1F9B A;  1URS A;  4FAT A;  1MS7 A;  4LZ8 A;  5CBR A;  3T9H B;  1MY3 A;  2O7U A;  3TYH A;  2PBW A;  3SEU A;  3MBP A;  3IOU A;  4HCW A;  1UIV A;  1DTZ A;  4FJP A;  3MP6 A;  5IAI A;  4QSC A;  4DCX A;  1SW4 A;  2NXO A;  2XXY A;  4PET A;  2XX7 A;  1NNT A;  2V93 A;  5I59 A;  1I6A A;  3A3U A;  2VHA A;  1YTV A;  2XXW A;  2QMX A;  2Q8J A;  1DPE A;  1UQW A;  3Q27 A;  4OFL A;  1URD A;  1Y4T A;  3DM0 A;  4Q0C A;  2Y84 A;  1JEU A;  3D4G A;  1FW0 A;  3K6V A;  3KGC A;  1A40 A;  1ZIU A;  4ZEF A;  3EF7 A;  5L9S A;  2F7A A;  1H76 A;  1R1N A;  4FEC A;  1FTM A;  2NUV A;  2CMO A;  4BDM A;  1FQF A;  4EF2 A;  4ELP A;  2GH9 A;  4RK9 A;  1IIT A;  3I3V A;  4H5F A;  5B70 A;  5CMB A;  4YKI A;  3S4U A;  1IXC A;  3M3K A;  3THI A;  4BDN A;  1L5T A;  3KSJ A;  2Q88 A;  1MXY A;  1LLS A;  1B0H A;  4LON B;  1Y9U A;  3W9V A;  5H8H B;  1NKX A;  3U94 A;  5DVI A;  2O1M A;  4I9D A;  3TCF A;  2NWJ A;  5DEX B;  3TEL A;  1MXU A;  3PUY E;  1LAG E;  4BDR A;  4ZS9 A;  1B51 A;  2A5T A;  2F5X A;  1SYH A;  4HS7 A;  4G8H A;  4ZEK A;  4NF6 A;  3T93 B;  5ISU A;  5I84 A;  4F1V A;  1LAX A;  2RCA A;  3FVK A;  3QUF A;  4GF8 A;  2P1S A;  1SI1 A;  2A5S A;  3B6W A;  3R26 A;  4U1Z A;  3UK4 A;  2DWH A;  4U4S A;  2GHA A;  1B05 A;  3CI8 A;  5FHN A;  2ZMB A;  3FVO A;  2RKM A;  3ILT B;  2UVJ A;  4I8C A;  3O6H A;  1P1W A;  3Q26 A;  3RT6 B;  3K6X A;  3FXU A;  4KFQ A;  4MFI A;  2I3V A;  1JVX A;  5H8S A;  5A5X A;  3S9L C;  4EQB A;  1P1N A;  5H8F A;  5EYF A;  1S9T A;  3PUZ E;  4NTL A;  5DYH A;  3E3K A;  4O3A A;  2FYI A;  4NF4 A;  1AMF A;  2ONS A;  3IL1 B;  1VR5 A;  4NF5 A;  2F6G A;  4F2O A;  2O6A A;  4F31 B;  1SW5 A;  4Z7E A;  4ZE9 A;  4GOT A;  4OEN A;  1B52 A;  4EQ7 A;  3RY3 A;  3EPE A;  3H6T A;  1JET A;  4FED A;  1UIU A;  3IOV A;  5HBC A;  1I69 A;  4QFN A;  2O7I A;  4OEV A;  4MLQ A;  3C9H A;  3IJO B;  3V5A A;  5HM4 B;  1POY 1;  3S9N C;  4QSE A;  1USY E;  1N7W A;  5H8N B;  2I0C A;  2BJJ X;  5CI5 A;  2Z23 A;  1IUD A;  1D9V A;  3A09 A;  5JEI A;  4JXI A;  2DP8 A;  3VVD A;  1O64 A;  2LAO A;  2WKY A;  1II5 A;  4YB7 A;  5TPA A;  5ITP A;  3LBS A;  1R6Z A;  1XVY A;  2QS3 A;  3TMG A;  5I2N A;  4GXS B;  1B5J A;  4YB6 A;  3PV0 E;  2XXU A;  1HSE A;  5FHO A;  1GVC A;  3H06 B;  3RN8 A;  2XX9 A;  3ILU B;  3CSB A;  4P11 A;  2H5Y A;  4ECF A;  1SW2 A;  4RNS A;  1H44 A;  1AOV A;  4KI0 E;  2ABH A;  2O84 X;  2KLF A;  2I4C A;  4Q5T A;  1QUL A;  1D9Y A;  4LAT A;  3H7M A;  4GIZ A;  3S2V A;  1EH3 A;  5L8D A;  3VVF A;  4O3C A;  4G68 A;  4KYE A;  1B3L A;  4JSD A;  3ZKK A;  1Y3P A;  2VGQ A;  3DP8 A;  1CE2 A;  4JBZ A;  4FE8 A;  4LA9 A;  4X1D A;  5CMM A;  4R9G A;  4KHZ E;  3ZSF A;  2GHB A;  4H65 A;  2VOZ A;  1PC3 A;  1FQE A;  2DXY A;  1JQF A;  4XTC Q;  2F7B A;  4LVQ A;  1Q1K A;  3KBR A;  4IGT A;  2CZL A;  2XXH A;  3MUQ A;  3KOS A;  2DWJ A;  2RCB A;  2F6P A;  3CR9 A;  3H3G A;  3T22 A;  2RC7 A;  3N5L A;  3VLV A;  4RXL A;  4G77 A;  3GBA A;  3CIJ A;  2ZNU A;  3L6H A;  2XXX A;  4JWO A;  1B5H A;  1VSO A;  4RY1 A;  3SET A;  1Y1Z A;  2UYE A;  1LAF E;  3TQL A;  4XXU A;  4F1U A;  3K4U A;  3VV5 A;  4XKQ A;  1Y1M A;  4ELO A;  3MZ9 A;  3V89 B;  1PDA A;  5TP9 B;  1PB7 A;  5I57 B;  2H25 A;  1FTO A;  4NED A;  3IOT A;  3OSR A;  4HCY A;  2HZK A;  5LOM A;  1P1U A;  3RPW A;  2RIN A;  3G3F A;  4PE5 B;  1D3K A;  3IJX B;  1MXZ A;  4QSD A;  3OO6 A;  5FHM A;  5I2K B;  3OO8 A;  3BBR A;  2XX8 A;  2V3Q A;  4U22 A;  1MM7 A;  4OMB A;  1DOT A;  2DE4 A;  4U4X A;  2QJE A;  3VLW A;  4ONY A;  4YMA A;  4G2Z A;  5AA2 D;  1UTH A;  4KCD A;  1B1X A;  3TOD A;  3OEN A;  3LC8 A;  4NF8 B;  4IY6 A;  4ZEI A;  4GXA A;  1AH5 A;  3G3G A;  2XXI A;  3KEI A;  5H8H A;  2H99 A;  3K02 A;  4IGR A;  1A55 A;  3K0V A;  1URG A;  2F7C A;  5DEX A;  3OO7 A;  3SES A;  1D4N A;  1VFE A;  3Q25 A;  4XIG Q;  4DE8 A;  3U92 A;  4JB7 A;  2RF1 A;  4OES A;  4YMB A;  3U72 A;  2PT1 A;  1JW5 A;  3K1N A;  1A8E A;  3G7W A;  2DSF A;  3TTM A;  1NNK A;  3PPP A;  1POT A;  2YPN A;  1LFI A;  5EHM A;  3C31 A;  3KOT A;  1Z7N E;  1GR2 A;  1SYI A;  3MVW A;  3QYT A;  3PMX A;  2I49 A;  3HPI A;  2ZNT A;  3O6I A;  3UP9 A;  4RPO A;  3H4Z A;  4OET A;  2Y7P A;  5DVF A;  1B46 A;  4Z0I A;  4M1V A;  4KD5 A;  3EN3 A;  3PGF A;  3PD8 A;  2IEE A;  3Q28 A;  2OJT A;  1GV8 A;  3MJN A;  4ZZA A;  1VFD A;  3TTR A;  4AB6 A;  3IB2 A;  1A54 A;  1B40 A;  2ZNS A;  3LSL A;  1MDP 1;  1LBB A;  1NNP A;  3FVG A;  3TPA A;  2R6G E;  3TFL A;  3FIR A;  4IO7 A;  4BDO A;  4MF3 A;  4IO2 A;  2AL4 A;  3JV9 A;  2UVG A;  5BUU A;  3FAT A;  3O28 A;  4GL0 A;  1PBQ A;  1EZP A;  3SEW A;  1ZJL A;  4DDD A;  2H9B A;  3TCH A;  2OWS A;  1AL3 A;  4DCY A;  1MY2 A;  3K00 A;  3K1M A;  3RQT A;  4R73 A;  4QFO A;  1Q35 A;  1R9Q A;  1BP5 A;  3FUZ A;  3QK6 A;  1B9J A;  2O51 A;  5I58 B;  4H1X A;  5ICT A;  1B1H A;  3BKI B;  4EF1 A;  1CB6 A;  3MVX A;  4QRZ A;  4BDL A;  1MPD A;  2GRV A;  3C4M A;  3CG1 A;  3O66 A;  3PUV E;  3MW0 A;  3CFL A;  4IO3 A;  5AA2 B;  4R6K A;  2VP1 A;  4F29 A;  1S7Y A;  4EDP A;  4IB2 A;  4R6Y A;  3RNN A;  4YAH X;  1H45 A;  2G29 A;  4WEP A;  3OEL A;  3OO9 A;  4I1D A;  1B2H A;  3F11 A;  4QHQ A;  4HW8 A;  4YIC A;  3LUY A;  4BDQ A;  3O9P A;  2DYX A;  3TTK A;  3CRB A;  4HTG A;  3V83 A;  2Q2A A;  2OCU A;  5FTH A;  1H43 A;  1KWH A;  3ECR A;  4AQ4 A;  1LB9 A;  4PFW A;  3HO7 A;  2OZZ A;  4OQO A;  3QIM A;  3C33 A;  4H6D A;  1N3W A;  4RYA A;  1GGG A;  3O6G A;  3H6W A;  3T66 A;  3PPN A;  1QKB A;  1XOC A;  3KG2 A;  4OFJ A;  1Z7M E;  3N6U A;  1B3G A;  2XXT A;  5DT6 A;  3TTN A;  2DE3 A;  1OIB A;  4IO6 A;  2OBG A;  4C0R A;  3C36 A;  1OQH A;  4F19 A;  5I56 B;  3TUS A;  3H6V A;  2I58 A;  3QUJ A;  3UA8 A;  3TKD A;  1P1O A;  1OVB A;  5KDT B;  5I57 A;  3SEX A;  2F8D A;  3FVN A;  2QS1 A;  2PMS A;  3IO4 A;  1YCJ A;  4Q8R A;  1TFD A;  2I6E A;  1S50 A;  1PEB A;  4XKP A;  5AA4 B;  1MQH A;  1N7X A;  2VD3 A;  4QF9 A;  3TDJ A;  5H8Q A;  4MBP A;  1LGB C;  3TCG A;  1QUJ A;  1BKA A;  1OMP A;  3MPK A;  3LR1 A;  2Y7W A;  5CBS A;  1WDN A;  2D3I A;  3PUW E;  3EHU A;  2DQV A;  4OXV A;  2XXQ A;  3HN0 A;  4TLL B;  5L9O A;  3TZA A;  5BWJ A;  1B3F A;  2RC8 A;  1B7Z A;  4H67 A;  3BFT A;  2R71 A;  4LZ5 A;  4GRK A;  1BTJ A;  3IB0 A;  3O29 A;  1N04 A;  1B5I A;  4TLM B;  4P0I A;  1ANF A;  4N07 A;  2UVH A;  5I59 B;  4DXU A;  3OEM A;  4GVO A;  1N0T A;  4ZDM A;  2FNC A;  1JW1 A;  2DVC A;  3S9M C;  1MXW A;  2D21 A;  1AIV A;  3A3C A;  1LCF A;  2PX1 A;  2PT2 A;  4NE4 A;  4UA8 A;  3EQ1 A;  3C32 A;  1WVJ A;  1NFT A;  1LCT A;  1JNF A;  1IXI A;  4N6P A;  3VFJ A;  3SEY A;  3TAJ A;  2ALU A;  2B3F A;  4U23 A;  3SDF A;  3MWB A;  5DVJ A;  3VE1 B;  3OEK A;  3CFZ A;  1H3D A;  1US5 A;  4E0X A;  1DTG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...