2FYIA

Crystal structure of the cofactor-binding domain of the cbl transcriptional regulator
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
223
structure length
223
Chain Sequence
SHMTNDTSGVLTIATTHTQARYSLPEVIKAFRELFPEVRLELIQGTPQEIATLLQNGEADIGIASERLSNDPQLVAFPWFRWHHSLLVPHDHPLTQISPLTLESIAKWPLITYRQGITGRSRIDDAFARKGLLADIVLSAQDSDVIKTYVALGLGIGLVAEQSSGEQEEENLIRLDTRHLFDANTVWLGLKRGQLQRNYVWRFLELCNAGLSVEDIKRQVMES
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator cbl
publication title Structural Basis of the Sulphate Starvation Response in E. coli: Crystal Structure and Mutational Analysis of the Cofactor-binding Domain of the Cbl Transcriptional Regulator.
pubmed doi rcsb
source organism Escherichia coli k12
total genus 63
structure length 223
sequence length 223
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2006-02-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fyiA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2fyiA02
3O9PA 4GQOA 2FNCA 2A5SA 1IXIA 3CSGA 4ISUA 2GRVA 2E1SA 4IB2A 1B3GA 3ILUB 2ONSA 1LCTA 3KN3A 2F36A 4EF2A 2RKMA 2HQ0A 4OZ9A 3TODA 4PP0A 3HPIA 1EZPA 2PX1A 4LP2B 4DIGA 2F5XA 5LOMA 4LZ8A 3OENA 4O3CA 4DCYA 5I58B 3PUZE 2Z8EA 3PPPA 3TTLA 4ESXA 3KN8A 3BFTA 3S9MC 2O1LA 3N6TA 1IEJA 2OWTA 1JEUA 1MY4A 3TUSA 4FJPA 4LA9A 4LZ7A 4FIMA 4P0GA 2OJTA 4U4SA 3TCGA 2V3TA 3PMVA 2ZNUA 1NNKA 2H25A 2YPNA 4OFOA 5I2KB 3TCHA 4YB6A 1P1WA 4NF5A 1Y3QA 4F2OA 3O66A 1BKAA 2DWAA 2XXIA 3MJNA 5EHSA 3GZGA 2XD3A 1LFIA 4IO3A 4GXAA 4K3FA 3MUQA 4GLIA 4R2BA 1EU8A 1ELJA 4FAJA 2F78A 3V8XB 4JDFA 2V3QA 1O63A 2I0BA 3UK4A 3MPKA 1B5IA 3B6QA 3FVGA 2OK2A 5I58A 2ZYMA 3U94A 1M5FA 1SD3A 3TQWA 1TXFA 3KN7A 1NNPA 5DTBA 4F3BA 1MQGA 4OXVA 4C0RA 4ZS9A 4PETA 3L6HA 3RNNA 4IO2A 2Z8DA 3EPEA 4MBPA 2F7AA 1URDA 1M5DA 3GBBA 1N3XA 2XXQA 5I2KA 2Y7IA 1J1NA 1QW0A 4FORA 4KYEA 3FIRA 4JBZA 1FCKA 1II5A 2H5YA 2GH9A 4OEVA 3ZKKA 1B7UA 5L9SA 3C36A 1QVSA 2Q89A 5F7VA 2Z8FA 4R6KA 3K6UA 2XXTA 1B46A 3IOTA 2F34A 3QSLA 4E0XA 1QUJA 3S9NC 4F3GA 3O6IA 4KYSA 3EN3A 2I6EA 2O69A 3MZ9A 2B65A 4OESA 4R6HA 4LQ5A 1B7ZA 1QKBA 1IZ1A 4JWOA 1MPCA 2LAOA 3KFMA 3FD3A 4G68C 4G8HA 1CB6A 3KSXA 2G29A 2UXAA 1MM7A 2RCAA 1P1QA 3TEPA 4R73A 4ND9A 1VSOA 2XXVA 3IR1A 5AA1A 1SQYA 2F35A 3K2DA 3PMXA 3QUJA 4ECFA 1SW5A 1IXCA 1POTA 1OIBA 4KI0E 1NKXA 3V5AA 2QS4A 1USYE 3CRBA 3SEUA 3HSTA 1LAFE 2NWJA 4BLAA 4H5FA 4ZE8A 3MP8A 2ZMBA 2F8DA 2O7IA 3SEWA 4NF8B 3CVGA 3LSLA 5FTHA 1B3HA 1B1XA 1JETA 1M5CA 3H7MA 3IL1B 2OBGA 2ABHA 1B6HA 4P0IA 1Z7NE 3G3HA 1B3LA 2I4BA 3JYRA 3T9HB 3OO9A 5DVFA 3EHSA 3U93A 2DE2A 5DYHA 3CFLA 3RGYA 3SERA 2VOZA 2NOOA 4XXUA 1PC3A 5TP9B 4JSDA 4MFIA 4XTCQ 1PBPA 1I6QA 4HCYA 2Q2CA 5A5XB 3H3GA 4GIZA 2RC7A 4QFLA 1RYXA 4M4GA 2FA7A 2R6GE 3S9EA 3H6VA 4RY1A 4KHZE 4U21A 2AL4A 4DXBA 4ZEDA 4IO4A 1B2HA 4NF8A 4OEUA 4F1UA 2IA4A 3N6UA 1A55A 1MY0A 5H8NB 1MXVA 5JEIA 4GFRA 1ZMGA 1QUKA 3OO6A 4JWYA 5DT6A 5H8HB 2THIA 4GOTA 4N13A 1SYHA 3V83A 4AB5A 3RT6B 4F1YA 3PUWE 5BUUA 3ZS6A 4YMBA 1OQHA 2DE3A 3VVFA 2Z22A 3RUMA 4GL8A 1I6BA 1OQGA 3D4GA 4KD5A 1GGGA 5B70A 1MDP1 1BIYA 3GBAA 3G3FA 3KJ7A 3G3GA 4XKRA 3UORA 5TP9A 1R9QA 1B05A 3FXQA 4RPNA 3ODBA 4UACA 3C34A 1AOVA 4ELQA 1O7TA 2QSXA 1UIUA 5A5XA 4ELRA 1PB7A 4R9FA 4KYDA 5F1QA 3SEYA 5AA2B 1Z7ME 4H5GA 1B5HA 4EF1A 1XC1A 2WKYA 1LBCA 2I0CA 4YICA 1H45A 1Y4CA 1GTKA 4JWXA 5H8HA 2H98A 3D4CA 3USDA 5B7DA 1IXHA 1MY2A 1Y4TA 2W7YA 3HCQA 3R7XA 3EHUA 4OHNA 1MG1A 1MXZA 1WODA 3PUYE 4KPTA 3OMBA 4ELOA 4H8IA 4NF6B 1A99A 1LB8A 1RYOA 1SI0A 1VFDA 4R9GA 1UIVA 2D3IA 3AXFA 1MY1A 2Y7RA 1Y1MA 3I5OA 4PFWA 3O97A 3PMWA 2DVCA 1MRPA 5JK4A 3E13X 4F31B 1MS7A 3VXCA 4G77A 4NF5B 4OENA 1UTHB 5AA2A 4G8MA 3U8QA 1B58A 1XOCA 3MC2A 1R6ZA 3CIJA 3IOUA 1GVCA 3ZKLA 4R2FA 2O1MA 2YJPA 2Q8JA 1B32A 2ZXTA 3TPAA 4PQJA 4NWCA 3MVWA 1NFTA 4C1TA 4F1VA 1I6AA 3IX1A 4ZDMA 4GWOA 4IY6A 1TFDA 1ZJLA 4NTLA 4HS7A 1FQEA 3MVYA 4KR5A 5FTIA 2UYFA 4X1DA 2PVUA 2QMWA 1DTGA 3PPNA 3FV1A 4EQ7A 3H6UA 4EXKA 1B0LA 2D5WA 2GHAA 4F29A 5L8DA 1WDNA 4QRZA 2DXYA 4POWA 1ZTYA 4NF6A 1FTJA 1OLCA 1Y1ZA 3LSXA 3TTKA 4E0WA 4U1OA 2XXXA 1JW5A 3FZVA 3BFUA 2QL3A 2ONKE 1N76A 4BDOA 4PFTA 1S9TA 3G7WA 3Q28A 4YB7A 3P7IA 3SEXA 1UTHA 4NE4A 3U1OA 3LSFB 4R75A 3H06B 1PB9A 1TT1A 3MBPA 3QYTA 4ZZEA 2UVHA 1USYH 3I3VA 3ONMA 2XX7A 3B6WA 4QFOA 2OWSA 5L9MA 4PE5B 2DOJA 5HM4B 4KCCA 5I2NB 4I8CA 1IXGA 2DWHA 3KZGA 2V3UA 5CRYA 1N04A 1JVYA 1EZOA 2OLBA 1NH8A 5FHNA 5BWJA 4F3PA 3HHFA 3PUXE 4M1VA 1ZKBA 1FTKA 2I58A 3S9LC 2A5TB 3T22A 3MPLA 1ZBMA 4X9TA 1UTBB 4H65A 1H3DA 1US4A 3W9WA 4RXLA 4ESWA 4H8JA 1TWYA 3K1NA 1HSLA 3MP1A 2O6AA 1IITA 2RF1A 4NEDA 2XX9A 1LCFA 4GD5A 3VV5A 4LONB 3T93B 2F6GA 4ELPA 3KBRA 3OEMA 1JQFA 1ZIUA 4X1BA 3CI8A 3FXRA 5ICTA 1POY1 1RKMA 1JW4A 1M5BA 1QUIA 5IKBA 4LZ5A 3BKIB 2HZKA 3KSJA 1B0HA 2P2AA 5I2NA 2QRYA 1O64A 1R9LA 2ESNA 4NF4B 1XHYA 2ZNSA 1Y9UA 3A3UA 2I3VA 1XS5A 1B40A 2UVIA 3OEKA 4ZZAA 1DPEA 2A5TA 3LUYA 4DLDA 5ITOA 4LATA 4TQUQ 3KG2A 3K4UA 1UTBA 3EQ1A 1AMFA 3VFJA 3EF7A 1VR5A 2DWIA 4MF3A 1Y20A 3MAMA 1AL3A 2F6PA 5CI5A 4QFPA 5CBSA 2B3BA 3TMGA 3G3KA 3M3KA 3KOSA 2I3WA 3H4ZA 4UA8A 4DE8A 1URGA 4XIGQ 2VD2A 1OVBA 1SBPA 3VVEA 2ZNTA 2M8CA 1IQ7A 5DEXB 2XX8A 3VDFA 2XXRA 1ANFA 1DOTA 5I57B 1Y3PA 4WXJA 2XXWA 4U23A 2XXPA 1DSNA 5CMCA 2IEEA 5CM6A 1FQBA 1ATGA 5IAIA 3W15C 3MVXA 2KLFA 4RNSA 4NF4A 3QIMA 2AL5A 1MXWA 1B5JA 3WAEA 3UP9A 1XVYA 1N84A 3O2AA 4BDQA 1GR2A 4R72A 3FUZA 1YTVA 1BLFA 4IGTA 4TLMB 3T96B 2CMOA 3UA8A 1N0TA 3FGSA 4O3AA 4IO5A 1FTOA 4KFQA 3IB0A 5FHMA 3H6TA 4IGRA 3FVOA 2H4IA 4XKNA 3G3JA 1LFHA 4I62A 5EHMA 4ZEFA 4PFYA 1XVXA 3C4MA 3QXMA 3T66A 5KDTA 5CBRA 4QF9A 3T9XB 1MH4A 2VHAA 5H8QB 1HSJA 1IUDA 2HXWA 5EYFA 3MQ9A 5DEXA 1A8FA 3TDJA 1NNTA 2I48A 5I57A 1PB8A 2XXUA 3MVZA 3A09A 2RC8A 3O28A 1LBBA 4QSEA 5L9OA 4YU0A 3OD7A 2P1SA 2F7BA 5K2XA 3SKPA 3G3IA 5DVIA 5FHOA 4OVJA 3KGCA 1WVJA 1NNFA 1YAEA 4NWDA 2HAVA 4FECA 3VLWA 1BP5A 2RC9A 2PYYA 3SEVA 4WKMA 3M3FA 4YKPA 2PBWA 3TCFA 3SDFA 2DWJA 3CG1A 3M3LA 1OMPA 4AQ4A 1LGBC 3H03A 2X26A 1YCJA 1EZ9A 3IORA 4IO6A 3FVNA 3K0VA 1AH5A 4EXLA 4L17A 3UGWA 5I56B 1D3KA 4R6YA 5H8QA 4LVQA 3DELB 5ELVA 3HHGA 3O6HA 1T0KA 3RTFB 3LSWA 1JW1A 2F97A 4H1XA 1B4ZA 3RQTA 1B9JA 1A40A 4DXCA 4YAHX 4RPOA 2Z23A 1EH3A 3E9XA 1QJMA 3HV1A 4RA1A 5ICQA 4Q5TA 2DQVA 2OZZA 1I69A 3FJ7A 4QSDA 5I59B 4Q30B 1FQDA 5HPQA 1B52A 3U92A 1LAGE 4Z7EA 1LAXA 1AIVA 3MP6A 4GVOA 4G2ZA 1SI1A 3T9UA 3V89B 2DVZA 1US5A 3PU5A 3VLVA 2Y7KA 2QPQA 1MPBA 3HO7A 1QKAA 4N07A 1GV8A 2HZLA 3A3CA 1P1NA 2FYIA 4OFLA 3FVKA 2PMSA 2RCBA 2PT1A 5I56A 1H43A 3H6WA 3DM0A 2QJEA 2QS2A 3E4RA 3S2VA 5ITPA 2VD3A 4HW8A 3RPWA 2I49A 2HFBA 3GLBA 4IY5A 3O6GA 3E3KA 1MDQA 3MWBA 3RLFE 2Y7WA 4H67A 3ILTB 5I59A 1NH7A 3DP8A 2P0SA 2CZLA 4HTGA 3QK6A 1MQHA 1SW2A 4YB5A 4OQOA 1FQCA 3K1MA 4QSCA 3GXAA 2X7PA 4YMAA 5K2YA 1A54A 1QULA 3IOWA 3LBSA 4GXSB 2DYXA 1MQIA 1D4NA 1SDXA 3N26A 5KCJB 4BDRA 3C33A 5HBCA 2UVJA 4QFKA 3RTWB 2BJJX 3IJXB 2XXHA 3QAXA 3FJGA 2R71A 4ONYA 4Z0IA 1P99A 4FEDA 1MQDA 1BTJA 4F18A 4C1UA 1Y3NA 3KEIA 5AA4B 5JTYA 1VFEA 3Q27A 1LSTA 2AYSA 3RY3A 1MQJA 3VE1B 3PD8A 4F19A 2DE4A 2OCUA 1FQAA 3OELA 1FQFA 3JZJA 1M5EA 3C31A 4NMYA 1LLSA 4RJZA 5CC2A 2Q88A 1MH3A 2I4CA 4YKKA 4AB6A 1NL5A 4JXIA 3L6GA 1Q35A 2XD2A 1PDAA 4MLQA 4N6PA 3IOVA 5H8FB 3TTRA 4DDDA 1DTZA 3B6TA 3S4UA 3TTNA 1PBQA 4U2RA 3IO6A 2REJA 4LQ2A 5TPAB 4IO7A 5KCJA 3CR9A 3U72A 3TKDA 3MW0A 4OMBA 3PPQA 4FATA 3KOTA 4MH5A 3PUVE 2Y84A 4YKJA 2YLNA 1LAHE 2D21A 1IIWA 1P1UA 4TOZA 4ZEBA 4F39A 3DP4A 2GHBA 5AA4A 1MXXA 3PPRA 5CMKA 4ZECA 1KWHA 4O3BA 3R6UA 4ZEKA 3TFLA 2G93A 4KQPA 2B3FA 3N94A 3QUFA 3CSBA 1L5TA 4XKQA 2X7QA 3FJMA 3EHTA 3IO4A 1SW1A 3K6XA 3VXBA 4WEDA 3K02A 2Y7PA 2ZYNA 3FXUA 4H6DA 4BDMA 5DVJA 3C9HA 2O68A 3FATA 5H8FA 3CFZA 2VGQA 4JB7A 2Q9TA 2ALUA 3TAJA 5TPAA 2HEUA 3OSRA 3VLUA 2DSFA 3IAZA 5KDTB 3PV0E 4QHQA 5AA3A 1N7WA 4YZZA 4GL0A 5I84A 4EQBA 3TYHA 1H76A 3PD9A 1LB9A 1B7HA 4H0WA 1XT8A 3K6WA 2NXOA 1D9YA 4RK2A 1JVXA 1H44A 2QS3A 4PFUA 4FEBA 4U1ZA 2ONRA 1A7LA 3UIFA 5TU0A 1FTMA 3TTMA 1MXYA 5M2VA 3TZAA 3BBRA 1HSEA 2Q2AA 3RN8A 1MY3A 3PPOA 4I1DA 1URSA 3UN6A 2V84A 3K01A 2XHDA 4U22A 4TLLB 4XKPA 2AIXA 4OTEA 3OOAA 1A8EA 4ZEIA 3K00A 4G8NA 3I6VA 1Q1KA 1SYIA 2HCAA 3F11A 3SETA 2NUVA 5AE4A 4OYVA 2O51A 3HN0A 1S50A 4GRKA 3VVDA 3ZSFA 2R9JA 4ZE9A 2F7CA 3OO8A 4F2QA 3PGFA 4P11A 4DXUA 4RK9A 3SESA 4BDNA 4FE8A 2RINA 5CMBA 4OERA 3IB1A 2UVGA 1DMBA 1MM6A 5H8SA 3OSQA 2UYEA 1JNFA 1B4HA 4R74A 1YPNA 4BDLA 3CG3A 3C32A 3R26A 1PEBA 3TELA 1OLAA 3W9VA 3IK6B 4DCXA 3CFXA 4EDPA 3K1PA 1MPDA 1VE4A 5ISUA 2QMXA 3FASA 1UQWA 3K6VA 1SVXB 1DPPA 5AA2D 2V93A 4X48A 1MXUA 4G68B 1F9BA 2O84X 3JV9A 3OXNA 3B7DA 3WAFA 4U4XA 1NMUA 4I9DA 4OWDA 1ZLQA 2XXYA 2DS9A 1LFGA 2GFEA 5KZTA 1D9VA 3DP6A 2ZYKA 3MZBA 2NVUB 3TQLA 4DZ1A 4F3SA 1B3EA 2DP8A 3T9VA 3FV2A 4THIA 1FW0A 4POXA 3IJOB 4F22A 5CMMA 1ZU0A 1B3FA 1TFAA 4MLVA 3OO7A 4GF8A 5H8NA 1JEVA 3Q29A 4G4PA 2ANJA 4LUBA 1S7YA 3MZ1A 2E0SA 3O29A 4G68A 3DLNA 2HAUA 3RT8A 4YKIA 1N7XA 2REGA 1FTLA 3THIA 2H9BA 2O7UA 4OETA 4KCDA 4QFNA 3M8UA 3Q26A 4Q8RA 1B51A 4HCWA 4WEPA 4Q0CA 3LC8A 3KJTA 4JSOA 3LR1A 2PT2A 2DXRA 5J1DA 4RYAA 3C35A 5JTYB 1B1HA 4EUOA 3N5LA 1SW4A 1OVTA 2V25A 2VP1A 4OFJA 2QS1A 1P1OA 3Q25A 2ZYOA 1R1NA 3ECRA 4EQ9A 1CE2A 2H99A 3IB2A 1N3WA
chains in the Genus database with same CATH superfamily
3O9PA 4GQOA 2FNCA 3IFCA 2A5SA 1IXIA 3CSGA 4ISUA 2GRVA 2E1SA 4IB2A 1B3GA 3ILUB 2ONSA 1LCTA 3KN3A 2F36A 4EF2A 2RKMA 2HQ0A 4OZ9A 3TODA 4PP0A 3HPIA 1EZPA 2PX1A 4LP2B 4DIGA 5IZ3A 2F5XA 5LOMA 4LZ8A 3OENA 1JP4A 4O3CA 4DCYA 4PBQA 5I58B 3PUZE 2XWOA 2Z8EA 3PPPA 3TTLA 4ESXA 3KN8A 4MNIA 3BFTA 3S9MC 2O1LA 3N6TA 1IEJA 2OWTA 4DI4B 1JEUA 1MY4A 3TUSA 4FJPA 4LA9A 4LZ7A 4PF6A 4P9KA 4FIMA 4P0GA 2OJTA 4U4SA 3TCGA 2V3TA 3PMVA 2ZNUA 1NNKA 2H25A 2YPNA 1IMBA 4OFOA 5I2KB 3QMFA 3TCHA 4YB6A 1LBWA 1P1WA 4NF5A 1Y3QA 4F2OA 3O66A 1BKAA 2DWAA 2XXIA 3MJNA 5EHSA 3GZGA 2XD3A 1LFIA 5IM2A 4IO3A 4GXAA 4K3FA 3MUQA 4GLIA 4MMPA 4R2BA 1NV6A 1EU8A 1ELJA 4FAJA 2F78A 3V8XB 4JDFA 2V3QA 1O63A 2I0BA 3UK4A 4PCDA 3MPKA 1B5IA 3B6QA 3FVGA 2OK2A 5I58A 2ZYMA 3U94A 1M5FA 1SD3A 3TQWA 3BIGA 2Y5KA 1TXFA 3KN7A 1NNPA 5DTBA 4MAGA 4F3BA 1MQGA 4OXVA 4C0RA 4ZS9A 5I5PA 4PETA 3L6HA 3RNNA 3E78A 4IO2A 2Z8DA 3EPEA 3RYDA 4MBPA 2F7AA 1URDA 1M5DA 3GBBA 4GX6A 1N3XA 2XXQA 5I2KA 2Y7IA 1J1NA 1QW0A 4FORA 4KYEA 3FIRA 4HE1A 4JBZA 1FCKA 1II5A 2H5YA 2GH9A 4OEVA 3ZKKA 2QVVA 1B7UA 5L9SA 3C36A 1QVSA 2P3NA 2Q89A 5F7VA 2Z8FA 4R6KA 3K6UA 2XXTA 1B46A 3IOTA 2F34A 3QSLA 4E0XA 1QUJA 3S9NC 4F3GA 3KC0A 3O6IA 4KYSA 4KXPA 3EN3A 2I6EA 2O69A 3MZ9A 4MHFA 2B65A 4OESA 4R6HA 1IMDA 4LQ5A 4N6KA 1B7ZA 1QKBA 1IZ1A 4HE2A 4JWOA 1MPCA 1YXIA 2LAOA 3KFMA 3FD3A 1NUWA 4G68C 4G8HA 1CB6A 3KSXA 2G29A 2PFZA 2UXAA 1MM7A 2RCAA 1P1QA 3TEPA 4R73A 1YYZA 4ND9A 1VSOA 2XXVA 3IR1A 5AA1A 1SQYA 2F35A 3K2DA 3PMXA 3QUJA 1NUXA 4ECFA 1SW5A 4QBAA 1IXCA 1POTA 1OIBA 1D9QA 4KI0E 2Q74A 1NKXA 3V5AA 2QS4A 1USYE 3CRBA 3SEUA 3HSTA 1LAFE 4OVSA 2NWJA 4H5FA 4BLAA 4N15A 4P47A 4ZE8A 1FJ6A 3MP8A 2ZMBA 2F8DA 2O7IA 3SEWA 4NF8B 5ET5A 4GWUA 3CVGA 3LSLA 5FTHA 1B3HA 1B1XA 1JETA 1M5CA 3H7MA 3IL1B 2OBGA 2HPGA 2ABHA 1B6HA 4P0IA 1Z7NE 3G3HA 2Y5LA 4PC9A 3ROJA 1B3LA 2I4BA 3JYRA 3T9HB 3OO9A 2CZHA 5DVFA 3EHSA 3U93A 5IZ1A 2DE2A 5DYHA 3CFLA 3RGYA 2MKZA 3KC1A 3SERA 2VOZA 2NOOA 4XXUA 1PC3A 4PAKA 4JSDA 5TP9B 4MFIA 4XTCQ 1PBPA 2B4LA 3NOHA 1I6QA 3B50A 4HCYA 4GWXA 2Q2CA 4O7MA 3H3GA 5A5XB 4GIZA 2RC7A 2CEYA 1RYXA 4M4GA 4QFLA 2FA7A 2R6GE 3S9EA 3H6VA 4RY1A 4KHZE 3IFAA 4U21A 2AL4A 4DXBA 4ZEDA 5ET6A 3E79A 4IO4A 1B2HA 4NF8A 4OEUA 4F1UA 2IA4A 1YZ0A 3N6UA 1A55A 1MY0A 5H8NB 1MXVA 5JEIA 4GFRA 1ZMGA 1QUKA 3OO6A 4JWYA 5DT6A 5H8HB 2THIA 4GOTA 4N13A 1SYHA 3V83A 4AB5A 1FPEA 3RT6B 4F1YA 4NHBA 3PUWE 5BUUA 3ZS6A 4YMBA 1LBVA 1OQHA 2DE3A 3VVFA 2Z22A 3RUMA 4GL8A 1LBXA 1I6BA 1OQGA 3D4GA 4KD5A 1GGGA 5B70A 1MDP1 1BIYA 3GBAA 3G3FA 3KJ7A 3PTYA 3G3GA 4XKRA 3UORA 5TP9A 1R9QA 1B05A 3FXQA 4NF0A 4RPNA 3ODBA 1RDYA 4UACA 3C34A 1AOVA 4ELQA 1O7TA 2QSXA 1UIUA 5A5XA 4ELRA 2FVZA 1K9YA 4N4UA 1PB7A 4R9FA 4KYDA 5F1QA 3SEYA 5AA2B 2WEFA 1Z7ME 4H5GA 1B5HA 4EF1A 1XC1A 4I3EA 3LUZA 2WKYA 4OA4A 5ESYA 1LBCA 2I0CA 4YICA 1H45A 1Y4CA 1GTKA 4JWXA 5H8HA 2H98A 3D4CA 3USDA 5ET8A 5B7DA 1IXHA 1KA1A 1MY2A 1Y4TA 2W7YA 3HCQA 3R7XA 3EHUA 4OHNA 4MCOA 1MG1A 4OVQA 5EYGA 1MXZA 1WODA 3PUYE 4KPTA 3OMBA 4ELOA 4H8IA 4NF6B 1A99A 1LB8A 1QGXA 1RYOA 1SI0A 2Q8MA 1VFDA 4R9GA 1UIVA 2D3IA 3AXFA 1MY1A 3MYUA 2Y7RA 1Y1MA 3I5OA 4PFWA 3O97A 3PMWA 2DVCA 1MRPA 5JK4A 3E13X 4F31B 1MS7A 3VXCA 4G77A 4NF5B 4PDDA 4OENA 1UTHB 5AA2A 4G8MA 3U8QA 2JJKA 1B58A 1XOCA 3MC2A 1DBZA 1R6ZA 3CIJA 3IOUA 1GVCA 3ZKLA 4R2FA 2O1MA 2YJPA 4GWZA 2Q8JA 1B32A 2ZXTA 3TPAA 4PQJA 1AWBA 4NWCA 3MVWA 1NFTA 4C1TA 4F1VA 1I6AA 4HXVA 3IX1A 4ZDMA 4GWOA 4IY6A 1TFDA 1ZJLA 5ET7A 1NUYA 4NTLA 4HS7A 1FQEA 3MVYA 4AS5A 4NN3A 4KR5A 5FTIA 2F3BA 2UYFA 4X1DA 4PTKA 2PVUA 2QMWA 1DTGA 3PPNA 3FV1A 4EQ7A 3H6UA 4EXKA 1B0LA 2D5WA 2GHAA 4F29A 5L8DA 1WDNA 4NQ8A 4QRZA 2DXYA 4POWA 1ZTYA 4NF6A 1FTJA 4X04A 1OLCA 1BK4A 1Y1ZA 3LSXA 3TTKA 4E0WA 4U1OA 2XXXA 1JW5A 3FZVA 4PF8A 1INPA 3BFUA 2QL3A 2ONKE 1FPFA 1N76A 4BDOA 1NV2A 4PFBA 4PFTA 1S9TA 3G7WA 3Q28A 4YB7A 2PFYA 3P7IA 2CZKA 3SEXA 1UTHA 4NE4A 3U1OA 3LSFB 4R75A 3H06B 1PB9A 1TT1A 3MBPA 3QYTA 4ZZEA 2UVHA 1USYH 3I3VA 3ONMA 2XX7A 3B6WA 4QFOA 2OWSA 5L9MA 4PE5B 2DOJA 2HHMA 2XWVA 5HM4B 4KCCA 5I2NB 4I8CA 1IXGA 2DWHA 3KZGA 2V3UA 5CRYA 1N04A 4NAPA 1JVYA 1EZOA 2XWKA 3RPLB 2OLBA 1NH8A 5FHNA 5BWJA 4O8MA 4F3PA 3HHFA 3PUXE 4M1VA 1ZKBA 1FTKA 2I58A 3S9LC 3FBPA 2A5TB 3T22A 3MPLA 1ZBMA 4X9TA 1UTBB 4H65A 4HE0A 1H3DA 2FBPA 1US4A 3W9WA 4RXLA 4P3LA 5LDZA 2PCRA 4ESWA 4H8JA 1TWYA 3K1NA 1HSLA 5I7IA 3MP1A 2O6AA 1IITA 2RF1A 4NEDA 4P1LA 1LCFA 2XX9A 4GD5A 3VV5A 4LONB 3T93B 2F6GA 4OVTA 4ELPA 3KBRA 3OEMA 1JQFA 1ZIUA 4X1BA 3CI8A 2P3VA 3FXRA 4N17A 5ICTA 1POY1 1CNQA 1NV4A 1RKMA 1JW4A 1FBGA 1M5BA 1QUIA 5IKBA 2CEXA 4LZ5A 3BKIB 2HZKA 3KSJA 1B0HA 2P2AA 5I2NA 2QRYA 1O64A 1R9LA 3EKIA 4N91A 2ESNA 4H46A 4NF4B 1XHYA 5T3JA 2ZNSA 3RPLA 1Y9UA 3A3UA 2I3VA 1XS5A 1B40A 2UVIA 3OEKA 4ZZAA 1DPEA 2A5TA 3LUYA 4DLDA 5ITOA 4LATA 2OWZA 4TQUQ 4I40A 3KG2A 3K4UA 1UTBA 3EQ1A 1AMFA 3VFJA 3EF7A 1VR5A 2DWIA 4MF3A 1Y20A 3MAMA 2R8TA 1AL3A 2F6PA 5CI5A 4QFPA 5CBSA 2B3BA 4I3YA 2FIXA 3TMGA 3G3KA 3M3KA 3KOSA 2I3WA 4PBHA 3H4ZA 4UA8A 4DE8A 1URGA 4XIGQ 2VD2A 1OVBA 1SBPA 3VVEA 2ZNTA 4PFRA 2M8CA 1IQ7A 5DEXB 2XX8A 3VDFA 2XXRA 1ANFA 1DCUA 1DOTA 5I57B 1Y3PA 4WXJA 2XXWA 4U23A 2XXPA 1DSNA 5CMCA 2IEEA 1G0IA 5A5LA 5CM6A 1FQBA 1ATGA 5IAIA 3MVXA 2KLFA 3W15C 1FBFA 4RNSA 4NF4A 5F24A 3QIMA 2AL5A 1MXWA 1B5JA 1FTAA 3WAEA 3UP9A 1EYIA 1G0HA 1XVYA 1N84A 3O2AA 4BDQA 1GR2A 4R72A 3FUZA 5EQ7A 1YTVA 4NGUA 1BLFA 4IGTA 4MEVA 4TLMB 4GWSA 3T96B 2CMOA 2B4MA 3UA8A 1N0TA 2ZZVA 3FGSA 4PGNA 4O3AA 4IO5A 1FTOA 4KFQA 2QFLA 3IB0A 5FHMA 3H6TA 4IGRA 3FVOA 5FBPA 1NV1A 2H4IA 4XKNA 3G3JA 1LFHA 4I62A 2ZZXA 5EHMA 4ZEFA 4PFYA 1XVXA 3C4MA 3QXMA 3T66A 5KDTA 5CBRA 1FPIA 4QF9A 3T9XB 1MH4A 2VHAA 5H8QB 1HSJA 1DK4A 1IUDA 2HXWA 5EYFA 3MQ9A 5DEXA 1A8FA 3TDJA 1NNTA 2I48A 5I57A 1PB8A 2XXUA 3MVZA 3A09A 2RC8A 3O28A 5DW8A 1LBBA 3T1BA 2FHYA 4PGPA 4QSEA 1RDZA 5L9OA 4YU0A 3OD7A 4AS4A 2P1SA 2F7BA 2F3DA 5K2XA 3SKPA 3G3IA 5DVIA 5FHOA 4OVJA 4N8YA 3KGCA 1WVJA 1FBPA 1FPGA 1NNFA 1YAEA 4NWDA 2HAVA 4FECA 3VLWA 1BP5A 2RC9A 2PYYA 3SEVA 4GX4A 4WKMA 3M3FA 4YKPA 2PBWA 3TCFA 3SDFA 2DWJA 3CG1A 3M3LA 4QXDA 1OMPA 4AQ4A 1LGBC 1FSAA 4UABA 3H03A 2X26A 1YCJA 1EZ9A 3IORA 4IO6A 3FVNA 3K0VA 3T0JA 1AH5A 4EXLA 4L17A 3UGWA 1FBHA 5I56B 1D3KA 4R6YA 5H8QA 4LVQA 3DELB 5ELVA 3HHGA 3O6HA 1T0KA 3RTFB 3LSWA 1JW1A 2F97A 4LN5A 4H1XA 1B4ZA 3RQTA 1B9JA 1A40A 4MNPA 4DXCA 4YAHX 4RPOA 2Z23A 1EH3A 3E9XA 1QJMA 3HV1A 4RA1A 5ICQA 4Q5TA 2DQVA 2OZZA 1FRPA 1I69A 4P56A 3FJ7A 4QSDA 1K9ZA 4Q30B 1FQDA 5I59B 5HPQA 1B52A 3U92A 5EQ8A 1LAGE 4Z7EA 1LAXA 4MNCA 1AIVA 3MP6A 4GVOA 4G2ZA 1SI1A 3T9UA 3V89B 2DVZA 1US5A 3PU5A 1FPKA 3VLVA 2Y7KA 2QPQA 1MPBA 4XEQA 2FIEA 3HO7A 1QKAA 4N07A 3U65A 1GV8A 2HZLA 3A3CA 1P1NA 2FYIA 4OFLA 3FVKA 2PMSA 5I3SA 2RCBA 2PT1A 2WYPA 1H43A 5I56A 3H6WA 2VT5A 3DM0A 2QJEA 4N8GA 2QS2A 1SPIA 3E4RA 3S2VA 5IZZA 5ITPA 2VD3A 2V4CA 4HW8A 5LTCA 3RPWA 2I49A 2HFBA 3GLBA 4IY5A 1NV0A 5EQ9A 3O6GA 3E3KA 1MDQA 3MWBA 3RLFE 2Y7WA 4H67A 3ILTB 5I59A 1NH7A 3DP8A 2P0SA 1NUZA 2CZLA 4HTGA 4OVRA 4GWWA 3QK6A 1MQHA 1SW2A 4YB5A 4OQOA 1FQCA 1NV3A 3K1MA 4QSCA 3GXAA 2X7PA 4YMAA 5K2YA 1A54A 5EQAA 1QULA 3IOWA 3LBSA 4GXSB 2DYXA 1MQIA 1D4NA 1SDXA 4P8BA 3N26A 5KCJB 4BDRA 3C33A 5HBCA 4NG7A 3BIHA 2UVJA 4QFKA 3RTWB 2BJJX 3IJXB 2QVUA 1FPDA 2XXHA 3QAXA 2VPNA 3FJGA 2R71A 4ONYA 4PFIA 4GWYA 4Z0IA 4GBWA 1P99A 4FEDA 1MQDA 1BTJA 4F18A 1Y3NA 3KEIA 4C1UA 5AA4B 5JTYA 1VFEA 3Q27A 1LSTA 2AYSA 3RY3A 1MQJA 3VE1B 2KQZA 3PD8A 4F19A 4H45A 2DE4A 2OCUA 1FQAA 3OELA 1FQFA 3JZJA 1M5EA 3C31A 4NMYA 1LLSA 4RJZA 5CC2A 2Q88A 1MH3A 2I4CA 4YKKA 4AB6A 1NL5A 4JXIA 3L6GA 1Q35A 2XD2A 1PDAA 4MLQA 4N6PA 3IOVA 1FPLA 5H8FB 3TTRA 4DDDA 1DTZA 3B6TA 3S4UA 3TTNA 1PBQA 4U2RA 3IO6A 2REJA 4LQ2A 5TPAB 4IO7A 5KCJA 3CR9A 3U72A 4O94A 3TKDA 3MW0A 4OMBA 3PPQA 4FATA 3KOTA 4MH5A 3PUVE 3MSTA 2Y84A 4YKJA 1RDXA 2YLNA 1LAHE 2D21A 1IIWA 1P1UA 4TOZA 4ZEBA 4F39A 3DP4A 2GHBA 5AA4A 1MXXA 3PPRA 2HXRA 2GQ1A 4MX6A 5CMKA 4ZECA 1KWHA 4JVDA 3R6UA 4O3BA 4ZEKA 3TFLA 1Q9DA 2G93A 4KQPA 4IR8A 2B3FA 3N94A 4N81A 1EYKA 3QUFA 3CSBA 1FJ9A 1L5TA 4XKQA 2X7QA 1NI9A 3FJMA 3EHTA 3IO4A 1SW1A 4PDHA 3K6XA 1FBDA 1EYJA 3VXBA 4WEDA 4N6DA 3K02A 2Y7PA 2ZYNA 3FXUA 4H6DA 4BDMA 5DVJA 4XFEA 3C9HA 4G61A 2O68A 3FATA 5H8FA 4DI3D 3CFZA 4X8RA 1FPJA 1LEVA 2VGQA 4JB7A 2Q9TA 2ALUA 3TAJA 5TPAA 2HEUA 3OSRA 3VLUA 2DSFA 3IAZA 5KDTB 3PV0E 1IMAA 4QHQA 5AA3A 1N7WA 4YZZA 4GL0A 5I84A 4EQBA 3TYHA 1H76A 3PD9A 1LB9A 1B7HA 4H0WA 1XT8A 1FBEA 3K6WA 2NXOA 1D9YA 4RK2A 1JVXA 1H44A 2QS3A 5J16A 4PFUA 4FEBA 4U1ZA 2ONRA 1A7LA 3UIFA 4GX3A 4OANA 1KA0A 5TU0A 1FTMA 3LV0A 3TTMA 1MXYA 5M2VA 2KR0A 3TZAA 2XA5A 3BBRA 4PAIA 3SZPA 1XI6A 1HSEA 3D1RA 2Q2AA 3RN8A 1MY3A 3PPOA 4I1DA 1URSA 3UN6A 2VPOA 2V84A 2XXKA 3K01A 2XHDA 4U22A 4TLLB 3CHGA 1FBCA 4XKPA 4OTEA 2AIXA 1LBZA 1A8EA 3OOAA 4ZEIA 3K00A 4G8NA 3I6VA 1Q1KA 1SYIA 2HCAA 3F11A 1LBYA 3SETA 2NUVA 3GYYA 5AE4A 4OYVA 2O51A 3HN0A 1S50A 4GRKA 3VVDA 3ZSFA 2R9JA 4NX1A 2ZZWA 2WBBA 4ZE9A 2F7CA 3OO8A 1NV7A 2WBDA 4F2QA 3PGFA 4P11A 2BJIA 4DXUA 3ISPA 4RK9A 3SESA 4BDNA 4FE8A 2RINA 5CMBA 4OERA 1FPBA 4JVCA 3IB1A 2UVGA 1DMBA 1MM6A 1NV5A 5H8SA 3OSQA 2UYEA 1JNFA 2WX9A 1B4HA 4R74A 4XF5A 1YPNA 4BDLA 3CG3A 3C32A 3R26A 1PEBA 3TELA 1OLAA 3W9VA 3IK6B 1IMEA 4DCXA 3CFXA 4MJOA 4EDPA 3K1PA 1MPDA 1VE4A 5ISUA 2QMXA 3FASA 3HFUA 1UQWA 3K6VA 1SVXB 1DPPA 5AA2D 2V93A 4X48A 3FXBA 1MXUA 4G68B 1F9BA 2O84X 3JV9A 3OXNA 3B7DA 3WAFA 5EYHA 4U4XA 1NMUA 4I9DA 4OWDA 1ZLQA 2XXYA 2CZIA 2DS9A 1LFGA 2GFEA 4OVPA 5KZTA 1D9VA 3DP6A 5IGAA 2ZYKA 3MZBA 2NVUB 3TQLA 4DZ1A 2L5VA 4F3SA 1B3EA 2DP8A 3T9VA 4GBVA 3FV2A 4THIA 1FW0A 4FBPA 4POXA 3IJOB 1IMCA 4F22A 5CMMA 1ZU0A 4MIJA 1B3FA 1TFAA 4MLVA 3OO7A 4GF8A 5H8NA 1JEVA 3Q29A 4G4PA 2ANJA 3A29A 4LUBA 1S7YA 3MZ1A 2E0SA 3B8BA 3O29A 4G68A 3DLNA 2HAUA 3RT8A 4YKIA 3KBZA 5IZ3B 1N7XA 4P1EA 2REGA 4O7IA 1FTLA 3THIA 2H9BA 2O7UA 1IMFA 4OETA 4KCDA 2OX3A 4QFNA 2WYKA 3M8UA 2DDKA 3Q26A 4Q8RA 1B51A 4HCWA 4WEPA 4Q0CA 3LC8A 3KJTA 4JSOA 3LR1A 2PT2A 2DXRA 5J1DA 4RYAA 4JVIA 1KZ8A 3C35A 5JTYB 1B1HA 4EUOA 3N5LA 1SW4A 4PAFA 1OVTA 4PE3A 2V25A 2VP1A 4OFJA 2QS1A 1P1OA 3Q25A 2ZYOA 1R1NA 3ECRA 4EQ9A 1CE2A 2QVRA 1VDWA 2H99A 2XWIA 3IB2A 1N3WA
chains in the Genus database with same CATH topology
3O9PA 4GQOA 2FNCA 2A5SA 1IXIA 3CSGA 4ISUA 2GRVA 2E1SA 4IB2A 1B3GA 3ILUB 2ONSA 1LCTA 3KN3A 2F36A 4EF2A 2RKMA 2HQ0A 4OZ9A 3TODA 4PP0A 3HPIA 1EZPA 2PX1A 4LP2B 4DIGA 2F5XA 5LOMA 4LZ8A 3OENA 4O3CA 4DCYA 5I58B 3PUZE 2Z8EA 3PPPA 3TTLA 4ESXA 3KN8A 3BFTA 3S9MC 2O1LA 3N6TA 1IEJA 2OWTA 1JEUA 1MY4A 3TUSA 4FJPA 4LA9A 4LZ7A 4FIMA 4P0GA 2OJTA 4U4SA 3TCGA 2V3TA 3PMVA 2ZNUA 1NNKA 2H25A 2YPNA 4OFOA 5I2KB 3TCHA 4YB6A 1P1WA 4NF5A 1Y3QA 4F2OA 3O66A 1BKAA 2DWAA 2XXIA 3MJNA 5EHSA 3GZGA 2XD3A 1LFIA 4IO3A 4GXAA 4K3FA 3MUQA 4GLIA 4R2BA 1EU8A 1ELJA 4FAJA 2F78A 3V8XB 4JDFA 2V3QA 1O63A 2I0BA 3UK4A 3MPKA 1B5IA 3B6QA 3FVGA 2OK2A 5I58A 2ZYMA 3U94A 1M5FA 1SD3A 3TQWA 1TXFA 3KN7A 1NNPA 5DTBA 4F3BA 1MQGA 4OXVA 4C0RA 4ZS9A 4PETA 3L6HA 3RNNA 4IO2A 2Z8DA 3EPEA 4MBPA 2F7AA 1URDA 1M5DA 3GBBA 1N3XA 2XXQA 5I2KA 2Y7IA 1J1NA 1QW0A 4FORA 4KYEA 3FIRA 4JBZA 1FCKA 1II5A 2H5YA 2GH9A 4OEVA 3ZKKA 1B7UA 5L9SA 3C36A 1QVSA 2Q89A 5F7VA 2Z8FA 4R6KA 3K6UA 2XXTA 1B46A 3IOTA 2F34A 3QSLA 4E0XA 1QUJA 3S9NC 4F3GA 3O6IA 4KYSA 3EN3A 2I6EA 2O69A 3MZ9A 2B65A 4OESA 4R6HA 4LQ5A 1B7ZA 1QKBA 1IZ1A 4JWOA 1MPCA 2LAOA 3KFMA 3FD3A 4G68C 4G8HA 1CB6A 3KSXA 2G29A 2UXAA 1MM7A 2RCAA 1P1QA 3TEPA 4R73A 4ND9A 1VSOA 2XXVA 3IR1A 5AA1A 1SQYA 2F35A 3K2DA 3PMXA 3QUJA 4ECFA 1SW5A 1IXCA 1POTA 1OIBA 4KI0E 1NKXA 3V5AA 2QS4A 1USYE 3CRBA 3SEUA 3HSTA 1LAFE 2NWJA 4BLAA 4H5FA 4ZE8A 3MP8A 2ZMBA 2F8DA 2O7IA 3SEWA 4NF8B 3CVGA 3LSLA 5FTHA 1B3HA 1B1XA 1JETA 1M5CA 3H7MA 3IL1B 2OBGA 2ABHA 1B6HA 4P0IA 1Z7NE 3G3HA 1B3LA 2I4BA 3JYRA 3T9HB 3OO9A 5DVFA 3EHSA 3U93A 2DE2A 5DYHA 3CFLA 3RGYA 3SERA 2VOZA 2NOOA 4XXUA 1PC3A 5TP9B 4JSDA 4MFIA 4XTCQ 1PBPA 1I6QA 4HCYA 2Q2CA 5A5XB 3H3GA 4GIZA 2RC7A 4QFLA 1RYXA 4M4GA 2FA7A 2R6GE 3S9EA 3H6VA 4RY1A 4KHZE 4U21A 2AL4A 4DXBA 4ZEDA 4IO4A 1B2HA 4NF8A 4OEUA 4F1UA 2IA4A 3N6UA 1A55A 1MY0A 5H8NB 1MXVA 5JEIA 4GFRA 1ZMGA 1QUKA 3OO6A 4JWYA 5DT6A 5H8HB 2THIA 4GOTA 4N13A 1SYHA 3V83A 4AB5A 3RT6B 4F1YA 3PUWE 5BUUA 3ZS6A 4YMBA 1OQHA 2DE3A 3VVFA 2Z22A 3RUMA 4GL8A 1I6BA 1OQGA 3D4GA 4KD5A 1GGGA 5B70A 1MDP1 1BIYA 3GBAA 3G3FA 3KJ7A 3G3GA 4XKRA 3UORA 5TP9A 1R9QA 1B05A 3FXQA 4RPNA 3ODBA 4UACA 3C34A 1AOVA 4ELQA 1O7TA 2QSXA 1UIUA 5A5XA 4ELRA 1PB7A 4R9FA 4KYDA 5F1QA 3SEYA 5AA2B 1Z7ME 4H5GA 1B5HA 4EF1A 1XC1A 2WKYA 1LBCA 2I0CA 4YICA 1H45A 1Y4CA 1GTKA 4JWXA 5H8HA 2H98A 3D4CA 3USDA 5B7DA 1IXHA 1MY2A 1Y4TA 2W7YA 3HCQA 3R7XA 3EHUA 4OHNA 1MG1A 1MXZA 1WODA 3PUYE 4KPTA 3OMBA 4ELOA 4H8IA 4NF6B 1A99A 1LB8A 1RYOA 1SI0A 1VFDA 4R9GA 1UIVA 2D3IA 3AXFA 1MY1A 2Y7RA 1Y1MA 3I5OA 4PFWA 3O97A 3PMWA 2DVCA 1MRPA 5JK4A 3E13X 4F31B 1MS7A 3VXCA 4G77A 4NF5B 4OENA 1UTHB 5AA2A 4G8MA 3U8QA 1B58A 1XOCA 3MC2A 1R6ZA 3CIJA 3IOUA 1GVCA 3ZKLA 4R2FA 2O1MA 2YJPA 2Q8JA 1B32A 2ZXTA 3TPAA 4PQJA 4NWCA 3MVWA 1NFTA 4C1TA 4F1VA 1I6AA 3IX1A 4ZDMA 4GWOA 4IY6A 1TFDA 1ZJLA 4NTLA 4HS7A 1FQEA 3MVYA 4KR5A 5FTIA 2UYFA 4X1DA 2PVUA 2QMWA 1DTGA 3PPNA 3FV1A 4EQ7A 3H6UA 4EXKA 1B0LA 2D5WA 2GHAA 4F29A 5L8DA 1WDNA 4QRZA 2DXYA 4POWA 1ZTYA 4NF6A 1FTJA 1OLCA 1Y1ZA 3LSXA 3TTKA 4E0WA 4U1OA 2XXXA 1JW5A 3FZVA 3BFUA 2QL3A 2ONKE 1N76A 4BDOA 4PFTA 1S9TA 3G7WA 3Q28A 4YB7A 3P7IA 3SEXA 1UTHA 4NE4A 3U1OA 3LSFB 4R75A 3H06B 1PB9A 1TT1A 3MBPA 3QYTA 4ZZEA 2UVHA 1USYH 3I3VA 3ONMA 2XX7A 3B6WA 4QFOA 2OWSA 5L9MA 4PE5B 2DOJA 5HM4B 4KCCA 5I2NB 4I8CA 1IXGA 2DWHA 3KZGA 2V3UA 5CRYA 1N04A 1JVYA 1EZOA 2OLBA 1NH8A 5FHNA 5BWJA 4F3PA 3HHFA 3PUXE 4M1VA 1ZKBA 1FTKA 2I58A 3S9LC 2A5TB 3T22A 3MPLA 1ZBMA 4X9TA 1UTBB 4H65A 1H3DA 1US4A 3W9WA 4RXLA 4ESWA 4H8JA 1TWYA 3K1NA 1HSLA 3MP1A 2O6AA 1IITA 2RF1A 4NEDA 2XX9A 1LCFA 4GD5A 3VV5A 4LONB 3T93B 2F6GA 4ELPA 3KBRA 3OEMA 1JQFA 1ZIUA 4X1BA 3CI8A 3FXRA 5ICTA 1POY1 1RKMA 1JW4A 1M5BA 1QUIA 5IKBA 4LZ5A 3BKIB 2HZKA 3KSJA 1B0HA 2P2AA 5I2NA 2QRYA 1O64A 1R9LA 2ESNA 4NF4B 1XHYA 2ZNSA 1Y9UA 3A3UA 2I3VA 1XS5A 1B40A 2UVIA 3OEKA 4ZZAA 1DPEA 2A5TA 3LUYA 4DLDA 5ITOA 4LATA 4TQUQ 3KG2A 3K4UA 1UTBA 3EQ1A 1AMFA 3VFJA 3EF7A 1VR5A 2DWIA 4MF3A 1Y20A 3MAMA 1AL3A 2F6PA 5CI5A 4QFPA 5CBSA 2B3BA 3TMGA 3G3KA 3M3KA 3KOSA 2I3WA 3H4ZA 4UA8A 4DE8A 1URGA 4XIGQ 2VD2A 1OVBA 1SBPA 3VVEA 2ZNTA 2M8CA 1IQ7A 5DEXB 2XX8A 3VDFA 2XXRA 1ANFA 1DOTA 5I57B 1Y3PA 4WXJA 2XXWA 4U23A 2XXPA 1DSNA 5CMCA 2IEEA 5CM6A 1FQBA 1ATGA 5IAIA 3W15C 3MVXA 2KLFA 4RNSA 4NF4A 3QIMA 2AL5A 1MXWA 1B5JA 3WAEA 3UP9A 1XVYA 1N84A 3O2AA 4BDQA 1GR2A 4R72A 3FUZA 1YTVA 1BLFA 4IGTA 4TLMB 3T96B 2CMOA 3UA8A 1N0TA 3FGSA 4O3AA 4IO5A 1FTOA 4KFQA 3IB0A 5FHMA 3H6TA 4IGRA 3FVOA 2H4IA 4XKNA 3G3JA 1LFHA 4I62A 5EHMA 4ZEFA 4PFYA 1XVXA 3C4MA 3QXMA 3T66A 5KDTA 5CBRA 4QF9A 3T9XB 1MH4A 2VHAA 5H8QB 1HSJA 1IUDA 2HXWA 5EYFA 3MQ9A 5DEXA 1A8FA 3TDJA 1NNTA 2I48A 5I57A 1PB8A 2XXUA 3MVZA 3A09A 2RC8A 3O28A 1LBBA 4QSEA 5L9OA 4YU0A 3OD7A 2P1SA 2F7BA 5K2XA 3SKPA 3G3IA 5DVIA 5FHOA 4OVJA 3KGCA 1WVJA 1NNFA 1YAEA 4NWDA 2HAVA 4FECA 3VLWA 1BP5A 2RC9A 2PYYA 3SEVA 4WKMA 3M3FA 4YKPA 2PBWA 3TCFA 3SDFA 2DWJA 3CG1A 3M3LA 1OMPA 4AQ4A 1LGBC 3H03A 2X26A 1YCJA 1EZ9A 3IORA 4IO6A 3FVNA 3K0VA 1AH5A 4EXLA 4L17A 3UGWA 5I56B 1D3KA 4R6YA 5H8QA 4LVQA 3DELB 5ELVA 3HHGA 3O6HA 1T0KA 3RTFB 3LSWA 1JW1A 2F97A 4H1XA 1B4ZA 3RQTA 1B9JA 1A40A 4DXCA 4YAHX 4RPOA 2Z23A 1EH3A 3E9XA 1QJMA 3HV1A 4RA1A 5ICQA 4Q5TA 2DQVA 2OZZA 1I69A 3FJ7A 4QSDA 5I59B 4Q30B 1FQDA 5HPQA 1B52A 3U92A 1LAGE 4Z7EA 1LAXA 1AIVA 3MP6A 4GVOA 4G2ZA 1SI1A 3T9UA 3V89B 2DVZA 1US5A 3PU5A 3VLVA 2Y7KA 2QPQA 1MPBA 3HO7A 1QKAA 4N07A 1GV8A 2HZLA 3A3CA 1P1NA 2FYIA 4OFLA 3FVKA 2PMSA 2RCBA 2PT1A 5I56A 1H43A 3H6WA 3DM0A 2QJEA 2QS2A 3E4RA 3S2VA 5ITPA 2VD3A 4HW8A 3RPWA 2I49A 2HFBA 3GLBA 4IY5A 3O6GA 3E3KA 1MDQA 3MWBA 3RLFE 2Y7WA 4H67A 3ILTB 5I59A 1NH7A 3DP8A 2P0SA 2CZLA 4HTGA 3QK6A 1MQHA 1SW2A 4YB5A 4OQOA 1FQCA 3K1MA 4QSCA 3GXAA 2X7PA 4YMAA 5K2YA 1A54A 1QULA 3IOWA 3LBSA 4GXSB 2DYXA 1MQIA 1D4NA 1SDXA 3N26A 5KCJB 4BDRA 3C33A 5HBCA 2UVJA 4QFKA 3RTWB 2BJJX 3IJXB 2XXHA 3QAXA 3FJGA 2R71A 4ONYA 4Z0IA 1P99A 4FEDA 1MQDA 1BTJA 4F18A 4C1UA 1Y3NA 3KEIA 5AA4B 5JTYA 1VFEA 3Q27A 1LSTA 2AYSA 3RY3A 1MQJA 3VE1B 3PD8A 4F19A 2DE4A 2OCUA 1FQAA 3OELA 1FQFA 3JZJA 1M5EA 3C31A 4NMYA 1LLSA 4RJZA 5CC2A 2Q88A 1MH3A 2I4CA 4YKKA 4AB6A 1NL5A 4JXIA 3L6GA 1Q35A 2XD2A 1PDAA 4MLQA 4N6PA 3IOVA 5H8FB 3TTRA 4DDDA 1DTZA 3B6TA 3S4UA 3TTNA 1PBQA 4U2RA 3IO6A 2REJA 4LQ2A 5TPAB 4IO7A 5KCJA 3CR9A 3U72A 3TKDA 3MW0A 4OMBA 3PPQA 4FATA 3KOTA 4MH5A 3PUVE 2Y84A 4YKJA 2YLNA 1LAHE 2D21A 1IIWA 1P1UA 4TOZA 4ZEBA 4F39A 3DP4A 2GHBA 5AA4A 1MXXA 3PPRA 5CMKA 4ZECA 1KWHA 4O3BA 3R6UA 4ZEKA 3TFLA 2G93A 4KQPA 2B3FA 3N94A 3QUFA 3CSBA 1L5TA 4XKQA 2X7QA 3FJMA 3EHTA 3IO4A 1SW1A 3K6XA 3VXBA 4WEDA 3K02A 2Y7PA 2ZYNA 3FXUA 4H6DA 4BDMA 5DVJA 3C9HA 2O68A 3FATA 5H8FA 3CFZA 2VGQA 4JB7A 2Q9TA 2ALUA 3TAJA 5TPAA 2HEUA 3OSRA 3VLUA 2DSFA 3IAZA 5KDTB 3PV0E 4QHQA 5AA3A 1N7WA 4YZZA 4GL0A 5I84A 4EQBA 3TYHA 1H76A 3PD9A 1LB9A 1B7HA 4H0WA 1XT8A 3K6WA 2NXOA 1D9YA 4RK2A 1JVXA 1H44A 2QS3A 4PFUA 4FEBA 4U1ZA 2ONRA 1A7LA 3UIFA 5TU0A 1FTMA 3TTMA 1MXYA 5M2VA 3TZAA 3BBRA 1HSEA 2Q2AA 3RN8A 1MY3A 3PPOA 4I1DA 1URSA 3UN6A 2V84A 3K01A 2XHDA 4U22A 4TLLB 4XKPA 2AIXA 4OTEA 3OOAA 1A8EA 4ZEIA 3K00A 4G8NA 3I6VA 1Q1KA 1SYIA 2HCAA 3F11A 3SETA 2NUVA 5AE4A 4OYVA 2O51A 3HN0A 1S50A 4GRKA 3VVDA 3ZSFA 2R9JA 4ZE9A 2F7CA 3OO8A 4F2QA 3PGFA 4P11A 4DXUA 4RK9A 3SESA 4BDNA 4FE8A 2RINA 5CMBA 4OERA 3IB1A 2UVGA 1DMBA 1MM6A 5H8SA 3OSQA 2UYEA 1JNFA 1B4HA 4R74A 1YPNA 4BDLA 3CG3A 3C32A 3R26A 1PEBA 3TELA 1OLAA 3W9VA 3IK6B 4DCXA 3CFXA 4EDPA 3K1PA 1MPDA 1VE4A 5ISUA 2QMXA 3FASA 1UQWA 3K6VA 1SVXB 1DPPA 5AA2D 2V93A 4X48A 1MXUA 4G68B 1F9BA 2O84X 3JV9A 3OXNA 3B7DA 3WAFA 4U4XA 1NMUA 4I9DA 4OWDA 1ZLQA 2XXYA 2DS9A 1LFGA 2GFEA 5KZTA 1D9VA 3DP6A 2ZYKA 3MZBA 2NVUB 3TQLA 4DZ1A 4F3SA 1B3EA 2DP8A 3T9VA 3FV2A 4THIA 1FW0A 4POXA 3IJOB 4F22A 5CMMA 1ZU0A 1B3FA 1TFAA 4MLVA 3OO7A 4GF8A 5H8NA 1JEVA 3Q29A 4G4PA 2ANJA 4LUBA 1S7YA 3MZ1A 2E0SA 3O29A 4G68A 3DLNA 2HAUA 3RT8A 4YKIA 1N7XA 2REGA 1FTLA 3THIA 2H9BA 2O7UA 4OETA 4KCDA 4QFNA 3M8UA 3Q26A 4Q8RA 1B51A 4HCWA 4WEPA 4Q0CA 3LC8A 3KJTA 4JSOA 3LR1A 2PT2A 2DXRA 5J1DA 4RYAA 3C35A 5JTYB 1B1HA 4EUOA 3N5LA 1SW4A 1OVTA 2V25A 2VP1A 4OFJA 2QS1A 1P1OA 3Q25A 2ZYOA 1R1NA 3ECRA 4EQ9A 1CE2A 2H99A 3IB2A 1N3WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O9P A;  4GQO A;  2FNC A;  2A5S A;  1IXI A;  3CSG A;  4ISU A;  2GRV A;  2E1S A;  4IB2 A;  1B3G A;  3ILU B;  2ONS A;  1LCT A;  3KN3 A;  2F36 A;  4EF2 A;  2RKM A;  2HQ0 A;  4OZ9 A;  3TOD A;  4PP0 A;  3HPI A;  1EZP A;  2PX1 A;  4LP2 B;  4DIG A;  2F5X A;  5LOM A;  4LZ8 A;  3OEN A;  4O3C A;  4DCY A;  5I58 B;  3PUZ E;  2Z8E A;  3PPP A;  3TTL A;  4ESX A;  3KN8 A;  3BFT A;  3S9M C;  2O1L A;  3N6T A;  1IEJ A;  2OWT A;  1JEU A;  1MY4 A;  3TUS A;  4FJP A;  4LA9 A;  4LZ7 A;  4FIM A;  4P0G A;  2OJT A;  4U4S A;  3TCG A;  2V3T A;  3PMV A;  2ZNU A;  1NNK A;  2H25 A;  2YPN A;  4OFO A;  5I2K B;  3TCH A;  4YB6 A;  1P1W A;  4NF5 A;  1Y3Q A;  4F2O A;  3O66 A;  1BKA A;  2DWA A;  2XXI A;  3MJN A;  5EHS A;  3GZG A;  2XD3 A;  1LFI A;  4IO3 A;  4GXA A;  4K3F A;  3MUQ A;  4GLI A;  4R2B A;  1EU8 A;  1ELJ A;  4FAJ A;  2F78 A;  3V8X B;  4JDF A;  2V3Q A;  1O63 A;  2I0B A;  3UK4 A;  3MPK A;  1B5I A;  3B6Q A;  3FVG A;  2OK2 A;  5I58 A;  2ZYM A;  3U94 A;  1M5F A;  1SD3 A;  3TQW A;  1TXF A;  3KN7 A;  1NNP A;  5DTB A;  4F3B A;  1MQG A;  4OXV A;  4C0R A;  4ZS9 A;  4PET A;  3L6H A;  3RNN A;  4IO2 A;  2Z8D A;  3EPE A;  4MBP A;  2F7A A;  1URD A;  1M5D A;  3GBB A;  1N3X A;  2XXQ A;  5I2K A;  2Y7I A;  1J1N A;  1QW0 A;  4FOR A;  4KYE A;  3FIR A;  4JBZ A;  1FCK A;  1II5 A;  2H5Y A;  2GH9 A;  4OEV A;  3ZKK A;  1B7U A;  5L9S A;  3C36 A;  1QVS A;  2Q89 A;  5F7V A;  2Z8F A;  4R6K A;  3K6U A;  2XXT A;  1B46 A;  3IOT A;  2F34 A;  3QSL A;  4E0X A;  1QUJ A;  3S9N C;  4F3G A;  3O6I A;  4KYS A;  3EN3 A;  2I6E A;  2O69 A;  3MZ9 A;  2B65 A;  4OES A;  4R6H A;  4LQ5 A;  1B7Z A;  1QKB A;  1IZ1 A;  4JWO A;  1MPC A;  2LAO A;  3KFM A;  3FD3 A;  4G68 C;  4G8H A;  1CB6 A;  3KSX A;  2G29 A;  2UXA A;  1MM7 A;  2RCA A;  1P1Q A;  3TEP A;  4R73 A;  4ND9 A;  1VSO A;  2XXV A;  3IR1 A;  5AA1 A;  1SQY A;  2F35 A;  3K2D A;  3PMX A;  3QUJ A;  4ECF A;  1SW5 A;  1IXC A;  1POT A;  1OIB A;  4KI0 E;  1NKX A;  3V5A A;  2QS4 A;  1USY E;  3CRB A;  3SEU A;  3HST A;  1LAF E;  2NWJ A;  4BLA A;  4H5F A;  4ZE8 A;  3MP8 A;  2ZMB A;  2F8D A;  2O7I A;  3SEW A;  4NF8 B;  3CVG A;  3LSL A;  5FTH A;  1B3H A;  1B1X A;  1JET A;  1M5C A;  3H7M A;  3IL1 B;  2OBG A;  2ABH A;  1B6H A;  4P0I A;  1Z7N E;  3G3H A;  1B3L A;  2I4B A;  3JYR A;  3T9H B;  3OO9 A;  5DVF A;  3EHS A;  3U93 A;  2DE2 A;  5DYH A;  3CFL A;  3RGY A;  3SER A;  2VOZ A;  2NOO A;  4XXU A;  1PC3 A;  5TP9 B;  4JSD A;  4MFI A;  4XTC Q;  1PBP A;  1I6Q A;  4HCY A;  2Q2C A;  5A5X B;  3H3G A;  4GIZ A;  2RC7 A;  4QFL A;  1RYX A;  4M4G A;  2FA7 A;  2R6G E;  3S9E A;  3H6V A;  4RY1 A;  4KHZ E;  4U21 A;  2AL4 A;  4DXB A;  4ZED A;  4IO4 A;  1B2H A;  4NF8 A;  4OEU A;  4F1U A;  2IA4 A;  3N6U A;  1A55 A;  1MY0 A;  5H8N B;  1MXV A;  5JEI A;  4GFR A;  1ZMG A;  1QUK A;  3OO6 A;  4JWY A;  5DT6 A;  5H8H B;  2THI A;  4GOT A;  4N13 A;  1SYH A;  3V83 A;  4AB5 A;  3RT6 B;  4F1Y A;  3PUW E;  5BUU A;  3ZS6 A;  4YMB A;  1OQH A;  2DE3 A;  3VVF A;  2Z22 A;  3RUM A;  4GL8 A;  1I6B A;  1OQG A;  3D4G A;  4KD5 A;  1GGG A;  5B70 A;  1MDP 1;  1BIY A;  3GBA A;  3G3F A;  3KJ7 A;  3G3G A;  4XKR A;  3UOR A;  5TP9 A;  1R9Q A;  1B05 A;  3FXQ A;  4RPN A;  3ODB A;  4UAC A;  3C34 A;  1AOV A;  4ELQ A;  1O7T A;  2QSX A;  1UIU A;  5A5X A;  4ELR A;  1PB7 A;  4R9F A;  4KYD A;  5F1Q A;  3SEY A;  5AA2 B;  1Z7M E;  4H5G A;  1B5H A;  4EF1 A;  1XC1 A;  2WKY A;  1LBC A;  2I0C A;  4YIC A;  1H45 A;  1Y4C A;  1GTK A;  4JWX A;  5H8H A;  2H98 A;  3D4C A;  3USD A;  5B7D A;  1IXH A;  1MY2 A;  1Y4T A;  2W7Y A;  3HCQ A;  3R7X A;  3EHU A;  4OHN A;  1MG1 A;  1MXZ A;  1WOD A;  3PUY E;  4KPT A;  3OMB A;  4ELO A;  4H8I A;  4NF6 B;  1A99 A;  1LB8 A;  1RYO A;  1SI0 A;  1VFD A;  4R9G A;  1UIV A;  2D3I A;  3AXF A;  1MY1 A;  2Y7R A;  1Y1M A;  3I5O A;  4PFW A;  3O97 A;  3PMW A;  2DVC A;  1MRP A;  5JK4 A;  3E13 X;  4F31 B;  1MS7 A;  3VXC A;  4G77 A;  4NF5 B;  4OEN A;  1UTH B;  5AA2 A;  4G8M A;  3U8Q A;  1B58 A;  1XOC A;  3MC2 A;  1R6Z A;  3CIJ A;  3IOU A;  1GVC A;  3ZKL A;  4R2F A;  2O1M A;  2YJP A;  2Q8J A;  1B32 A;  2ZXT A;  3TPA A;  4PQJ A;  4NWC A;  3MVW A;  1NFT A;  4C1T A;  4F1V A;  1I6A A;  3IX1 A;  4ZDM A;  4GWO A;  4IY6 A;  1TFD A;  1ZJL A;  4NTL A;  4HS7 A;  1FQE A;  3MVY A;  4KR5 A;  5FTI A;  2UYF A;  4X1D A;  2PVU A;  2QMW A;  1DTG A;  3PPN A;  3FV1 A;  4EQ7 A;  3H6U A;  4EXK A;  1B0L A;  2D5W A;  2GHA A;  4F29 A;  5L8D A;  1WDN A;  4QRZ A;  2DXY A;  4POW A;  1ZTY A;  4NF6 A;  1FTJ A;  1OLC A;  1Y1Z A;  3LSX A;  3TTK A;  4E0W A;  4U1O A;  2XXX A;  1JW5 A;  3FZV A;  3BFU A;  2QL3 A;  2ONK E;  1N76 A;  4BDO A;  4PFT A;  1S9T A;  3G7W A;  3Q28 A;  4YB7 A;  3P7I A;  3SEX A;  1UTH A;  4NE4 A;  3U1O A;  3LSF B;  4R75 A;  3H06 B;  1PB9 A;  1TT1 A;  3MBP A;  3QYT A;  4ZZE A;  2UVH A;  1USY H;  3I3V A;  3ONM A;  2XX7 A;  3B6W A;  4QFO A;  2OWS A;  5L9M A;  4PE5 B;  2DOJ A;  5HM4 B;  4KCC A;  5I2N B;  4I8C A;  1IXG A;  2DWH A;  3KZG A;  2V3U A;  5CRY A;  1N04 A;  1JVY A;  1EZO A;  2OLB A;  1NH8 A;  5FHN A;  5BWJ A;  4F3P A;  3HHF A;  3PUX E;  4M1V A;  1ZKB A;  1FTK A;  2I58 A;  3S9L C;  2A5T B;  3T22 A;  3MPL A;  1ZBM A;  4X9T A;  1UTB B;  4H65 A;  1H3D A;  1US4 A;  3W9W A;  4RXL A;  4ESW A;  4H8J A;  1TWY A;  3K1N A;  1HSL A;  3MP1 A;  2O6A A;  1IIT A;  2RF1 A;  4NED A;  2XX9 A;  1LCF A;  4GD5 A;  3VV5 A;  4LON B;  3T93 B;  2F6G A;  4ELP A;  3KBR A;  3OEM A;  1JQF A;  1ZIU A;  4X1B A;  3CI8 A;  3FXR A;  5ICT A;  1POY 1;  1RKM A;  1JW4 A;  1M5B A;  1QUI A;  5IKB A;  4LZ5 A;  3BKI B;  2HZK A;  3KSJ A;  1B0H A;  2P2A A;  5I2N A;  2QRY A;  1O64 A;  1R9L A;  2ESN A;  4NF4 B;  1XHY A;  2ZNS A;  1Y9U A;  3A3U A;  2I3V A;  1XS5 A;  1B40 A;  2UVI A;  3OEK A;  4ZZA A;  1DPE A;  2A5T A;  3LUY A;  4DLD A;  5ITO A;  4LAT A;  4TQU Q;  3KG2 A;  3K4U A;  1UTB A;  3EQ1 A;  1AMF A;  3VFJ A;  3EF7 A;  1VR5 A;  2DWI A;  4MF3 A;  1Y20 A;  3MAM A;  1AL3 A;  2F6P A;  5CI5 A;  4QFP A;  5CBS A;  2B3B A;  3TMG A;  3G3K A;  3M3K A;  3KOS A;  2I3W A;  3H4Z A;  4UA8 A;  4DE8 A;  1URG A;  4XIG Q;  2VD2 A;  1OVB A;  1SBP A;  3VVE A;  2ZNT A;  2M8C A;  1IQ7 A;  5DEX B;  2XX8 A;  3VDF A;  2XXR A;  1ANF A;  1DOT A;  5I57 B;  1Y3P A;  4WXJ A;  2XXW A;  4U23 A;  2XXP A;  1DSN A;  5CMC A;  2IEE A;  5CM6 A;  1FQB A;  1ATG A;  5IAI A;  3W15 C;  3MVX A;  2KLF A;  4RNS A;  4NF4 A;  3QIM A;  2AL5 A;  1MXW A;  1B5J A;  3WAE A;  3UP9 A;  1XVY A;  1N84 A;  3O2A A;  4BDQ A;  1GR2 A;  4R72 A;  3FUZ A;  1YTV A;  1BLF A;  4IGT A;  4TLM B;  3T96 B;  2CMO A;  3UA8 A;  1N0T A;  3FGS A;  4O3A A;  4IO5 A;  1FTO A;  4KFQ A;  3IB0 A;  5FHM A;  3H6T A;  4IGR A;  3FVO A;  2H4I A;  4XKN A;  3G3J A;  1LFH A;  4I62 A;  5EHM A;  4ZEF A;  4PFY A;  1XVX A;  3C4M A;  3QXM A;  3T66 A;  5KDT A;  5CBR A;  4QF9 A;  3T9X B;  1MH4 A;  2VHA A;  5H8Q B;  1HSJ A;  1IUD A;  2HXW A;  5EYF A;  3MQ9 A;  5DEX A;  1A8F A;  3TDJ A;  1NNT A;  2I48 A;  5I57 A;  1PB8 A;  2XXU A;  3MVZ A;  3A09 A;  2RC8 A;  3O28 A;  1LBB A;  4QSE A;  5L9O A;  4YU0 A;  3OD7 A;  2P1S A;  2F7B A;  5K2X A;  3SKP A;  3G3I A;  5DVI A;  5FHO A;  4OVJ A;  3KGC A;  1WVJ A;  1NNF A;  1YAE A;  4NWD A;  2HAV A;  4FEC A;  3VLW A;  1BP5 A;  2RC9 A;  2PYY A;  3SEV A;  4WKM A;  3M3F A;  4YKP A;  2PBW A;  3TCF A;  3SDF A;  2DWJ A;  3CG1 A;  3M3L A;  1OMP A;  4AQ4 A;  1LGB C;  3H03 A;  2X26 A;  1YCJ A;  1EZ9 A;  3IOR A;  4IO6 A;  3FVN A;  3K0V A;  1AH5 A;  4EXL A;  4L17 A;  3UGW A;  5I56 B;  1D3K A;  4R6Y A;  5H8Q A;  4LVQ A;  3DEL B;  5ELV A;  3HHG A;  3O6H A;  1T0K A;  3RTF B;  3LSW A;  1JW1 A;  2F97 A;  4H1X A;  1B4Z A;  3RQT A;  1B9J A;  1A40 A;  4DXC A;  4YAH X;  4RPO A;  2Z23 A;  1EH3 A;  3E9X A;  1QJM A;  3HV1 A;  4RA1 A;  5ICQ A;  4Q5T A;  2DQV A;  2OZZ A;  1I69 A;  3FJ7 A;  4QSD A;  5I59 B;  4Q30 B;  1FQD A;  5HPQ A;  1B52 A;  3U92 A;  1LAG E;  4Z7E A;  1LAX A;  1AIV A;  3MP6 A;  4GVO A;  4G2Z A;  1SI1 A;  3T9U A;  3V89 B;  2DVZ A;  1US5 A;  3PU5 A;  3VLV A;  2Y7K A;  2QPQ A;  1MPB A;  3HO7 A;  1QKA A;  4N07 A;  1GV8 A;  2HZL A;  3A3C A;  1P1N A;  2FYI A;  4OFL A;  3FVK A;  2PMS A;  2RCB A;  2PT1 A;  5I56 A;  1H43 A;  3H6W A;  3DM0 A;  2QJE A;  2QS2 A;  3E4R A;  3S2V A;  5ITP A;  2VD3 A;  4HW8 A;  3RPW A;  2I49 A;  2HFB A;  3GLB A;  4IY5 A;  3O6G A;  3E3K A;  1MDQ A;  3MWB A;  3RLF E;  2Y7W A;  4H67 A;  3ILT B;  5I59 A;  1NH7 A;  3DP8 A;  2P0S A;  2CZL A;  4HTG A;  3QK6 A;  1MQH A;  1SW2 A;  4YB5 A;  4OQO A;  1FQC A;  3K1M A;  4QSC A;  3GXA A;  2X7P A;  4YMA A;  5K2Y A;  1A54 A;  1QUL A;  3IOW A;  3LBS A;  4GXS B;  2DYX A;  1MQI A;  1D4N A;  1SDX A;  3N26 A;  5KCJ B;  4BDR A;  3C33 A;  5HBC A;  2UVJ A;  4QFK A;  3RTW B;  2BJJ X;  3IJX B;  2XXH A;  3QAX A;  3FJG A;  2R71 A;  4ONY A;  4Z0I A;  1P99 A;  4FED A;  1MQD A;  1BTJ A;  4F18 A;  4C1U A;  1Y3N A;  3KEI A;  5AA4 B;  5JTY A;  1VFE A;  3Q27 A;  1LST A;  2AYS A;  3RY3 A;  1MQJ A;  3VE1 B;  3PD8 A;  4F19 A;  2DE4 A;  2OCU A;  1FQA A;  3OEL A;  1FQF A;  3JZJ A;  1M5E A;  3C31 A;  4NMY A;  1LLS A;  4RJZ A;  5CC2 A;  2Q88 A;  1MH3 A;  2I4C A;  4YKK A;  4AB6 A;  1NL5 A;  4JXI A;  3L6G A;  1Q35 A;  2XD2 A;  1PDA A;  4MLQ A;  4N6P A;  3IOV A;  5H8F B;  3TTR A;  4DDD A;  1DTZ A;  3B6T A;  3S4U A;  3TTN A;  1PBQ A;  4U2R A;  3IO6 A;  2REJ A;  4LQ2 A;  5TPA B;  4IO7 A;  5KCJ A;  3CR9 A;  3U72 A;  3TKD A;  3MW0 A;  4OMB A;  3PPQ A;  4FAT A;  3KOT A;  4MH5 A;  3PUV E;  2Y84 A;  4YKJ A;  2YLN A;  1LAH E;  2D21 A;  1IIW A;  1P1U A;  4TOZ A;  4ZEB A;  4F39 A;  3DP4 A;  2GHB A;  5AA4 A;  1MXX A;  3PPR A;  5CMK A;  4ZEC A;  1KWH A;  4O3B A;  3R6U A;  4ZEK A;  3TFL A;  2G93 A;  4KQP A;  2B3F A;  3N94 A;  3QUF A;  3CSB A;  1L5T A;  4XKQ A;  2X7Q A;  3FJM A;  3EHT A;  3IO4 A;  1SW1 A;  3K6X A;  3VXB A;  4WED A;  3K02 A;  2Y7P A;  2ZYN A;  3FXU A;  4H6D A;  4BDM A;  5DVJ A;  3C9H A;  2O68 A;  3FAT A;  5H8F A;  3CFZ A;  2VGQ A;  4JB7 A;  2Q9T A;  2ALU A;  3TAJ A;  5TPA A;  2HEU A;  3OSR A;  3VLU A;  2DSF A;  3IAZ A;  5KDT B;  3PV0 E;  4QHQ A;  5AA3 A;  1N7W A;  4YZZ A;  4GL0 A;  5I84 A;  4EQB A;  3TYH A;  1H76 A;  3PD9 A;  1LB9 A;  1B7H A;  4H0W A;  1XT8 A;  3K6W A;  2NXO A;  1D9Y A;  4RK2 A;  1JVX A;  1H44 A;  2QS3 A;  4PFU A;  4FEB A;  4U1Z A;  2ONR A;  1A7L A;  3UIF A;  5TU0 A;  1FTM A;  3TTM A;  1MXY A;  5M2V A;  3TZA A;  3BBR A;  1HSE A;  2Q2A A;  3RN8 A;  1MY3 A;  3PPO A;  4I1D A;  1URS A;  3UN6 A;  2V84 A;  3K01 A;  2XHD A;  4U22 A;  4TLL B;  4XKP A;  2AIX A;  4OTE A;  3OOA A;  1A8E A;  4ZEI A;  3K00 A;  4G8N A;  3I6V A;  1Q1K A;  1SYI A;  2HCA A;  3F11 A;  3SET A;  2NUV A;  5AE4 A;  4OYV A;  2O51 A;  3HN0 A;  1S50 A;  4GRK A;  3VVD A;  3ZSF A;  2R9J A;  4ZE9 A;  2F7C A;  3OO8 A;  4F2Q A;  3PGF A;  4P11 A;  4DXU A;  4RK9 A;  3SES A;  4BDN A;  4FE8 A;  2RIN A;  5CMB A;  4OER A;  3IB1 A;  2UVG A;  1DMB A;  1MM6 A;  5H8S A;  3OSQ A;  2UYE A;  1JNF A;  1B4H A;  4R74 A;  1YPN A;  4BDL A;  3CG3 A;  3C32 A;  3R26 A;  1PEB A;  3TEL A;  1OLA A;  3W9V A;  3IK6 B;  4DCX A;  3CFX A;  4EDP A;  3K1P A;  1MPD A;  1VE4 A;  5ISU A;  2QMX A;  3FAS A;  1UQW A;  3K6V A;  1SVX B;  1DPP A;  5AA2 D;  2V93 A;  4X48 A;  1MXU A;  4G68 B;  1F9B A;  2O84 X;  3JV9 A;  3OXN A;  3B7D A;  3WAF A;  4U4X A;  1NMU A;  4I9D A;  4OWD A;  1ZLQ A;  2XXY A;  2DS9 A;  1LFG A;  2GFE A;  5KZT A;  1D9V A;  3DP6 A;  2ZYK A;  3MZB A;  2NVU B;  3TQL A;  4DZ1 A;  4F3S A;  1B3E A;  2DP8 A;  3T9V A;  3FV2 A;  4THI A;  1FW0 A;  4POX A;  3IJO B;  4F22 A;  5CMM A;  1ZU0 A;  1B3F A;  1TFA A;  4MLV A;  3OO7 A;  4GF8 A;  5H8N A;  1JEV A;  3Q29 A;  4G4P A;  2ANJ A;  4LUB A;  1S7Y A;  3MZ1 A;  2E0S A;  3O29 A;  4G68 A;  3DLN A;  2HAU A;  3RT8 A;  4YKI A;  1N7X A;  2REG A;  1FTL A;  3THI A;  2H9B A;  2O7U A;  4OET A;  4KCD A;  4QFN A;  3M8U A;  3Q26 A;  4Q8R A;  1B51 A;  4HCW A;  4WEP A;  4Q0C A;  3LC8 A;  3KJT A;  4JSO A;  3LR1 A;  2PT2 A;  2DXR A;  5J1D A;  4RYA A;  3C35 A;  5JTY B;  1B1H A;  4EUO A;  3N5L A;  1SW4 A;  1OVT A;  2V25 A;  2VP1 A;  4OFJ A;  2QS1 A;  1P1O A;  3Q25 A;  2ZYO A;  1R1N A;  3ECR A;  4EQ9 A;  1CE2 A;  2H99 A;  3IB2 A;  1N3W A; 
#chains in the Genus database with same CATH topology
 3O9P A;  4GQO A;  2FNC A;  3IFC A;  2A5S A;  1IXI A;  3CSG A;  4ISU A;  2GRV A;  2E1S A;  4IB2 A;  1B3G A;  3ILU B;  2ONS A;  1LCT A;  3KN3 A;  2F36 A;  4EF2 A;  2RKM A;  2HQ0 A;  4OZ9 A;  3TOD A;  4PP0 A;  3HPI A;  1EZP A;  2PX1 A;  4LP2 B;  4DIG A;  5IZ3 A;  2F5X A;  5LOM A;  4LZ8 A;  3OEN A;  1JP4 A;  4O3C A;  4DCY A;  4PBQ A;  5I58 B;  3PUZ E;  2XWO A;  2Z8E A;  3PPP A;  3TTL A;  4ESX A;  3KN8 A;  4MNI A;  3BFT A;  3S9M C;  2O1L A;  3N6T A;  1IEJ A;  2OWT A;  4DI4 B;  1JEU A;  1MY4 A;  3TUS A;  4FJP A;  4LA9 A;  4LZ7 A;  4PF6 A;  4P9K A;  4FIM A;  4P0G A;  2OJT A;  4U4S A;  3TCG A;  2V3T A;  3PMV A;  2ZNU A;  1NNK A;  2H25 A;  2YPN A;  1IMB A;  4OFO A;  5I2K B;  3QMF A;  3TCH A;  4YB6 A;  1LBW A;  1P1W A;  4NF5 A;  1Y3Q A;  4F2O A;  3O66 A;  1BKA A;  2DWA A;  2XXI A;  3MJN A;  5EHS A;  3GZG A;  2XD3 A;  1LFI A;  5IM2 A;  4IO3 A;  4GXA A;  4K3F A;  3MUQ A;  4GLI A;  4MMP A;  4R2B A;  1NV6 A;  1EU8 A;  1ELJ A;  4FAJ A;  2F78 A;  3V8X B;  4JDF A;  2V3Q A;  1O63 A;  2I0B A;  3UK4 A;  4PCD A;  3MPK A;  1B5I A;  3B6Q A;  3FVG A;  2OK2 A;  5I58 A;  2ZYM A;  3U94 A;  1M5F A;  1SD3 A;  3TQW A;  3BIG A;  2Y5K A;  1TXF A;  3KN7 A;  1NNP A;  5DTB A;  4MAG A;  4F3B A;  1MQG A;  4OXV A;  4C0R A;  4ZS9 A;  5I5P A;  4PET A;  3L6H A;  3RNN A;  3E78 A;  4IO2 A;  2Z8D A;  3EPE A;  3RYD A;  4MBP A;  2F7A A;  1URD A;  1M5D A;  3GBB A;  4GX6 A;  1N3X A;  2XXQ A;  5I2K A;  2Y7I A;  1J1N A;  1QW0 A;  4FOR A;  4KYE A;  3FIR A;  4HE1 A;  4JBZ A;  1FCK A;  1II5 A;  2H5Y A;  2GH9 A;  4OEV A;  3ZKK A;  2QVV A;  1B7U A;  5L9S A;  3C36 A;  1QVS A;  2P3N A;  2Q89 A;  5F7V A;  2Z8F A;  4R6K A;  3K6U A;  2XXT A;  1B46 A;  3IOT A;  2F34 A;  3QSL A;  4E0X A;  1QUJ A;  3S9N C;  4F3G A;  3KC0 A;  3O6I A;  4KYS A;  4KXP A;  3EN3 A;  2I6E A;  2O69 A;  3MZ9 A;  4MHF A;  2B65 A;  4OES A;  4R6H A;  1IMD A;  4LQ5 A;  4N6K A;  1B7Z A;  1QKB A;  1IZ1 A;  4HE2 A;  4JWO A;  1MPC A;  1YXI A;  2LAO A;  3KFM A;  3FD3 A;  1NUW A;  4G68 C;  4G8H A;  1CB6 A;  3KSX A;  2G29 A;  2PFZ A;  2UXA A;  1MM7 A;  2RCA A;  1P1Q A;  3TEP A;  4R73 A;  1YYZ A;  4ND9 A;  1VSO A;  2XXV A;  3IR1 A;  5AA1 A;  1SQY A;  2F35 A;  3K2D A;  3PMX A;  3QUJ A;  1NUX A;  4ECF A;  1SW5 A;  4QBA A;  1IXC A;  1POT A;  1OIB A;  1D9Q A;  4KI0 E;  2Q74 A;  1NKX A;  3V5A A;  2QS4 A;  1USY E;  3CRB A;  3SEU A;  3HST A;  1LAF E;  4OVS A;  2NWJ A;  4H5F A;  4BLA A;  4N15 A;  4P47 A;  4ZE8 A;  1FJ6 A;  3MP8 A;  2ZMB A;  2F8D A;  2O7I A;  3SEW A;  4NF8 B;  5ET5 A;  4GWU A;  3CVG A;  3LSL A;  5FTH A;  1B3H A;  1B1X A;  1JET A;  1M5C A;  3H7M A;  3IL1 B;  2OBG A;  2HPG A;  2ABH A;  1B6H A;  4P0I A;  1Z7N E;  3G3H A;  2Y5L A;  4PC9 A;  3ROJ A;  1B3L A;  2I4B A;  3JYR A;  3T9H B;  3OO9 A;  2CZH A;  5DVF A;  3EHS A;  3U93 A;  5IZ1 A;  2DE2 A;  5DYH A;  3CFL A;  3RGY A;  2MKZ A;  3KC1 A;  3SER A;  2VOZ A;  2NOO A;  4XXU A;  1PC3 A;  4PAK A;  4JSD A;  5TP9 B;  4MFI A;  4XTC Q;  1PBP A;  2B4L A;  3NOH A;  1I6Q A;  3B50 A;  4HCY A;  4GWX A;  2Q2C A;  4O7M A;  3H3G A;  5A5X B;  4GIZ A;  2RC7 A;  2CEY A;  1RYX A;  4M4G A;  4QFL A;  2FA7 A;  2R6G E;  3S9E A;  3H6V A;  4RY1 A;  4KHZ E;  3IFA A;  4U21 A;  2AL4 A;  4DXB A;  4ZED A;  5ET6 A;  3E79 A;  4IO4 A;  1B2H A;  4NF8 A;  4OEU A;  4F1U A;  2IA4 A;  1YZ0 A;  3N6U A;  1A55 A;  1MY0 A;  5H8N B;  1MXV A;  5JEI A;  4GFR A;  1ZMG A;  1QUK A;  3OO6 A;  4JWY A;  5DT6 A;  5H8H B;  2THI A;  4GOT A;  4N13 A;  1SYH A;  3V83 A;  4AB5 A;  1FPE A;  3RT6 B;  4F1Y A;  4NHB A;  3PUW E;  5BUU A;  3ZS6 A;  4YMB A;  1LBV A;  1OQH A;  2DE3 A;  3VVF A;  2Z22 A;  3RUM A;  4GL8 A;  1LBX A;  1I6B A;  1OQG A;  3D4G A;  4KD5 A;  1GGG A;  5B70 A;  1MDP 1;  1BIY A;  3GBA A;  3G3F A;  3KJ7 A;  3PTY A;  3G3G A;  4XKR A;  3UOR A;  5TP9 A;  1R9Q A;  1B05 A;  3FXQ A;  4NF0 A;  4RPN A;  3ODB A;  1RDY A;  4UAC A;  3C34 A;  1AOV A;  4ELQ A;  1O7T A;  2QSX A;  1UIU A;  5A5X A;  4ELR A;  2FVZ A;  1K9Y A;  4N4U A;  1PB7 A;  4R9F A;  4KYD A;  5F1Q A;  3SEY A;  5AA2 B;  2WEF A;  1Z7M E;  4H5G A;  1B5H A;  4EF1 A;  1XC1 A;  4I3E A;  3LUZ A;  2WKY A;  4OA4 A;  5ESY A;  1LBC A;  2I0C A;  4YIC A;  1H45 A;  1Y4C A;  1GTK A;  4JWX A;  5H8H A;  2H98 A;  3D4C A;  3USD A;  5ET8 A;  5B7D A;  1IXH A;  1KA1 A;  1MY2 A;  1Y4T A;  2W7Y A;  3HCQ A;  3R7X A;  3EHU A;  4OHN A;  4MCO A;  1MG1 A;  4OVQ A;  5EYG A;  1MXZ A;  1WOD A;  3PUY E;  4KPT A;  3OMB A;  4ELO A;  4H8I A;  4NF6 B;  1A99 A;  1LB8 A;  1QGX A;  1RYO A;  1SI0 A;  2Q8M A;  1VFD A;  4R9G A;  1UIV A;  2D3I A;  3AXF A;  1MY1 A;  3MYU A;  2Y7R A;  1Y1M A;  3I5O A;  4PFW A;  3O97 A;  3PMW A;  2DVC A;  1MRP A;  5JK4 A;  3E13 X;  4F31 B;  1MS7 A;  3VXC A;  4G77 A;  4NF5 B;  4PDD A;  4OEN A;  1UTH B;  5AA2 A;  4G8M A;  3U8Q A;  2JJK A;  1B58 A;  1XOC A;  3MC2 A;  1DBZ A;  1R6Z A;  3CIJ A;  3IOU A;  1GVC A;  3ZKL A;  4R2F A;  2O1M A;  2YJP A;  4GWZ A;  2Q8J A;  1B32 A;  2ZXT A;  3TPA A;  4PQJ A;  1AWB A;  4NWC A;  3MVW A;  1NFT A;  4C1T A;  4F1V A;  1I6A A;  4HXV A;  3IX1 A;  4ZDM A;  4GWO A;  4IY6 A;  1TFD A;  1ZJL A;  5ET7 A;  1NUY A;  4NTL A;  4HS7 A;  1FQE A;  3MVY A;  4AS5 A;  4NN3 A;  4KR5 A;  5FTI A;  2F3B A;  2UYF A;  4X1D A;  4PTK A;  2PVU A;  2QMW A;  1DTG A;  3PPN A;  3FV1 A;  4EQ7 A;  3H6U A;  4EXK A;  1B0L A;  2D5W A;  2GHA A;  4F29 A;  5L8D A;  1WDN A;  4NQ8 A;  4QRZ A;  2DXY A;  4POW A;  1ZTY A;  4NF6 A;  1FTJ A;  4X04 A;  1OLC A;  1BK4 A;  1Y1Z A;  3LSX A;  3TTK A;  4E0W A;  4U1O A;  2XXX A;  1JW5 A;  3FZV A;  4PF8 A;  1INP A;  3BFU A;  2QL3 A;  2ONK E;  1FPF A;  1N76 A;  4BDO A;  1NV2 A;  4PFB A;  4PFT A;  1S9T A;  3G7W A;  3Q28 A;  4YB7 A;  2PFY A;  3P7I A;  2CZK A;  3SEX A;  1UTH A;  4NE4 A;  3U1O A;  3LSF B;  4R75 A;  3H06 B;  1PB9 A;  1TT1 A;  3MBP A;  3QYT A;  4ZZE A;  2UVH A;  1USY H;  3I3V A;  3ONM A;  2XX7 A;  3B6W A;  4QFO A;  2OWS A;  5L9M A;  4PE5 B;  2DOJ A;  2HHM A;  2XWV A;  5HM4 B;  4KCC A;  5I2N B;  4I8C A;  1IXG A;  2DWH A;  3KZG A;  2V3U A;  5CRY A;  1N04 A;  4NAP A;  1JVY A;  1EZO A;  2XWK A;  3RPL B;  2OLB A;  1NH8 A;  5FHN A;  5BWJ A;  4O8M A;  4F3P A;  3HHF A;  3PUX E;  4M1V A;  1ZKB A;  1FTK A;  2I58 A;  3S9L C;  3FBP A;  2A5T B;  3T22 A;  3MPL A;  1ZBM A;  4X9T A;  1UTB B;  4H65 A;  4HE0 A;  1H3D A;  2FBP A;  1US4 A;  3W9W A;  4RXL A;  4P3L A;  5LDZ A;  2PCR A;  4ESW A;  4H8J A;  1TWY A;  3K1N A;  1HSL A;  5I7I A;  3MP1 A;  2O6A A;  1IIT A;  2RF1 A;  4NED A;  4P1L A;  1LCF A;  2XX9 A;  4GD5 A;  3VV5 A;  4LON B;  3T93 B;  2F6G A;  4OVT A;  4ELP A;  3KBR A;  3OEM A;  1JQF A;  1ZIU A;  4X1B A;  3CI8 A;  2P3V A;  3FXR A;  4N17 A;  5ICT A;  1POY 1;  1CNQ A;  1NV4 A;  1RKM A;  1JW4 A;  1FBG A;  1M5B A;  1QUI A;  5IKB A;  2CEX A;  4LZ5 A;  3BKI B;  2HZK A;  3KSJ A;  1B0H A;  2P2A A;  5I2N A;  2QRY A;  1O64 A;  1R9L A;  3EKI A;  4N91 A;  2ESN A;  4H46 A;  4NF4 B;  1XHY A;  5T3J A;  2ZNS A;  3RPL A;  1Y9U A;  3A3U A;  2I3V A;  1XS5 A;  1B40 A;  2UVI A;  3OEK A;  4ZZA A;  1DPE A;  2A5T A;  3LUY A;  4DLD A;  5ITO A;  4LAT A;  2OWZ A;  4TQU Q;  4I40 A;  3KG2 A;  3K4U A;  1UTB A;  3EQ1 A;  1AMF A;  3VFJ A;  3EF7 A;  1VR5 A;  2DWI A;  4MF3 A;  1Y20 A;  3MAM A;  2R8T A;  1AL3 A;  2F6P A;  5CI5 A;  4QFP A;  5CBS A;  2B3B A;  4I3Y A;  2FIX A;  3TMG A;  3G3K A;  3M3K A;  3KOS A;  2I3W A;  4PBH A;  3H4Z A;  4UA8 A;  4DE8 A;  1URG A;  4XIG Q;  2VD2 A;  1OVB A;  1SBP A;  3VVE A;  2ZNT A;  4PFR A;  2M8C A;  1IQ7 A;  5DEX B;  2XX8 A;  3VDF A;  2XXR A;  1ANF A;  1DCU A;  1DOT A;  5I57 B;  1Y3P A;  4WXJ A;  2XXW A;  4U23 A;  2XXP A;  1DSN A;  5CMC A;  2IEE A;  1G0I A;  5A5L A;  5CM6 A;  1FQB A;  1ATG A;  5IAI A;  3MVX A;  2KLF A;  3W15 C;  1FBF A;  4RNS A;  4NF4 A;  5F24 A;  3QIM A;  2AL5 A;  1MXW A;  1B5J A;  1FTA A;  3WAE A;  3UP9 A;  1EYI A;  1G0H A;  1XVY A;  1N84 A;  3O2A A;  4BDQ A;  1GR2 A;  4R72 A;  3FUZ A;  5EQ7 A;  1YTV A;  4NGU A;  1BLF A;  4IGT A;  4MEV A;  4TLM B;  4GWS A;  3T96 B;  2CMO A;  2B4M A;  3UA8 A;  1N0T A;  2ZZV A;  3FGS A;  4PGN A;  4O3A A;  4IO5 A;  1FTO A;  4KFQ A;  2QFL A;  3IB0 A;  5FHM A;  3H6T A;  4IGR A;  3FVO A;  5FBP A;  1NV1 A;  2H4I A;  4XKN A;  3G3J A;  1LFH A;  4I62 A;  2ZZX A;  5EHM A;  4ZEF A;  4PFY A;  1XVX A;  3C4M A;  3QXM A;  3T66 A;  5KDT A;  5CBR A;  1FPI A;  4QF9 A;  3T9X B;  1MH4 A;  2VHA A;  5H8Q B;  1HSJ A;  1DK4 A;  1IUD A;  2HXW A;  5EYF A;  3MQ9 A;  5DEX A;  1A8F A;  3TDJ A;  1NNT A;  2I48 A;  5I57 A;  1PB8 A;  2XXU A;  3MVZ A;  3A09 A;  2RC8 A;  3O28 A;  5DW8 A;  1LBB A;  3T1B A;  2FHY A;  4PGP A;  4QSE A;  1RDZ A;  5L9O A;  4YU0 A;  3OD7 A;  4AS4 A;  2P1S A;  2F7B A;  2F3D A;  5K2X A;  3SKP A;  3G3I A;  5DVI A;  5FHO A;  4OVJ A;  4N8Y A;  3KGC A;  1WVJ A;  1FBP A;  1FPG A;  1NNF A;  1YAE A;  4NWD A;  2HAV A;  4FEC A;  3VLW A;  1BP5 A;  2RC9 A;  2PYY A;  3SEV A;  4GX4 A;  4WKM A;  3M3F A;  4YKP A;  2PBW A;  3TCF A;  3SDF A;  2DWJ A;  3CG1 A;  3M3L A;  4QXD A;  1OMP A;  4AQ4 A;  1LGB C;  1FSA A;  4UAB A;  3H03 A;  2X26 A;  1YCJ A;  1EZ9 A;  3IOR A;  4IO6 A;  3FVN A;  3K0V A;  3T0J A;  1AH5 A;  4EXL A;  4L17 A;  3UGW A;  1FBH A;  5I56 B;  1D3K A;  4R6Y A;  5H8Q A;  4LVQ A;  3DEL B;  5ELV A;  3HHG A;  3O6H A;  1T0K A;  3RTF B;  3LSW A;  1JW1 A;  2F97 A;  4LN5 A;  4H1X A;  1B4Z A;  3RQT A;  1B9J A;  1A40 A;  4MNP A;  4DXC A;  4YAH X;  4RPO A;  2Z23 A;  1EH3 A;  3E9X A;  1QJM A;  3HV1 A;  4RA1 A;  5ICQ A;  4Q5T A;  2DQV A;  2OZZ A;  1FRP A;  1I69 A;  4P56 A;  3FJ7 A;  4QSD A;  1K9Z A;  4Q30 B;  1FQD A;  5I59 B;  5HPQ A;  1B52 A;  3U92 A;  5EQ8 A;  1LAG E;  4Z7E A;  1LAX A;  4MNC A;  1AIV A;  3MP6 A;  4GVO A;  4G2Z A;  1SI1 A;  3T9U A;  3V89 B;  2DVZ A;  1US5 A;  3PU5 A;  1FPK A;  3VLV A;  2Y7K A;  2QPQ A;  1MPB A;  4XEQ A;  2FIE A;  3HO7 A;  1QKA A;  4N07 A;  3U65 A;  1GV8 A;  2HZL A;  3A3C A;  1P1N A;  2FYI A;  4OFL A;  3FVK A;  2PMS A;  5I3S A;  2RCB A;  2PT1 A;  2WYP A;  1H43 A;  5I56 A;  3H6W A;  2VT5 A;  3DM0 A;  2QJE A;  4N8G A;  2QS2 A;  1SPI A;  3E4R A;  3S2V A;  5IZZ A;  5ITP A;  2VD3 A;  2V4C A;  4HW8 A;  5LTC A;  3RPW A;  2I49 A;  2HFB A;  3GLB A;  4IY5 A;  1NV0 A;  5EQ9 A;  3O6G A;  3E3K A;  1MDQ A;  3MWB A;  3RLF E;  2Y7W A;  4H67 A;  3ILT B;  5I59 A;  1NH7 A;  3DP8 A;  2P0S A;  1NUZ A;  2CZL A;  4HTG A;  4OVR A;  4GWW A;  3QK6 A;  1MQH A;  1SW2 A;  4YB5 A;  4OQO A;  1FQC A;  1NV3 A;  3K1M A;  4QSC A;  3GXA A;  2X7P A;  4YMA A;  5K2Y A;  1A54 A;  5EQA A;  1QUL A;  3IOW A;  3LBS A;  4GXS B;  2DYX A;  1MQI A;  1D4N A;  1SDX A;  4P8B A;  3N26 A;  5KCJ B;  4BDR A;  3C33 A;  5HBC A;  4NG7 A;  3BIH A;  2UVJ A;  4QFK A;  3RTW B;  2BJJ X;  3IJX B;  2QVU A;  1FPD A;  2XXH A;  3QAX A;  2VPN A;  3FJG A;  2R71 A;  4ONY A;  4PFI A;  4GWY A;  4Z0I A;  4GBW A;  1P99 A;  4FED A;  1MQD A;  1BTJ A;  4F18 A;  1Y3N A;  3KEI A;  4C1U A;  5AA4 B;  5JTY A;  1VFE A;  3Q27 A;  1LST A;  2AYS A;  3RY3 A;  1MQJ A;  3VE1 B;  2KQZ A;  3PD8 A;  4F19 A;  4H45 A;  2DE4 A;  2OCU A;  1FQA A;  3OEL A;  1FQF A;  3JZJ A;  1M5E A;  3C31 A;  4NMY A;  1LLS A;  4RJZ A;  5CC2 A;  2Q88 A;  1MH3 A;  2I4C A;  4YKK A;  4AB6 A;  1NL5 A;  4JXI A;  3L6G A;  1Q35 A;  2XD2 A;  1PDA A;  4MLQ A;  4N6P A;  3IOV A;  1FPL A;  5H8F B;  3TTR A;  4DDD A;  1DTZ A;  3B6T A;  3S4U A;  3TTN A;  1PBQ A;  4U2R A;  3IO6 A;  2REJ A;  4LQ2 A;  5TPA B;  4IO7 A;  5KCJ A;  3CR9 A;  3U72 A;  4O94 A;  3TKD A;  3MW0 A;  4OMB A;  3PPQ A;  4FAT A;  3KOT A;  4MH5 A;  3PUV E;  3MST A;  2Y84 A;  4YKJ A;  1RDX A;  2YLN A;  1LAH E;  2D21 A;  1IIW A;  1P1U A;  4TOZ A;  4ZEB A;  4F39 A;  3DP4 A;  2GHB A;  5AA4 A;  1MXX A;  3PPR A;  2HXR A;  2GQ1 A;  4MX6 A;  5CMK A;  4ZEC A;  1KWH A;  4JVD A;  3R6U A;  4O3B A;  4ZEK A;  3TFL A;  1Q9D A;  2G93 A;  4KQP A;  4IR8 A;  2B3F A;  3N94 A;  4N81 A;  1EYK A;  3QUF A;  3CSB A;  1FJ9 A;  1L5T A;  4XKQ A;  2X7Q A;  1NI9 A;  3FJM A;  3EHT A;  3IO4 A;  1SW1 A;  4PDH A;  3K6X A;  1FBD A;  1EYJ A;  3VXB A;  4WED A;  4N6D A;  3K02 A;  2Y7P A;  2ZYN A;  3FXU A;  4H6D A;  4BDM A;  5DVJ A;  4XFE A;  3C9H A;  4G61 A;  2O68 A;  3FAT A;  5H8F A;  4DI3 D;  3CFZ A;  4X8R A;  1FPJ A;  1LEV A;  2VGQ A;  4JB7 A;  2Q9T A;  2ALU A;  3TAJ A;  5TPA A;  2HEU A;  3OSR A;  3VLU A;  2DSF A;  3IAZ A;  5KDT B;  3PV0 E;  1IMA A;  4QHQ A;  5AA3 A;  1N7W A;  4YZZ A;  4GL0 A;  5I84 A;  4EQB A;  3TYH A;  1H76 A;  3PD9 A;  1LB9 A;  1B7H A;  4H0W A;  1XT8 A;  1FBE A;  3K6W A;  2NXO A;  1D9Y A;  4RK2 A;  1JVX A;  1H44 A;  2QS3 A;  5J16 A;  4PFU A;  4FEB A;  4U1Z A;  2ONR A;  1A7L A;  3UIF A;  4GX3 A;  4OAN A;  1KA0 A;  5TU0 A;  1FTM A;  3LV0 A;  3TTM A;  1MXY A;  5M2V A;  2KR0 A;  3TZA A;  2XA5 A;  3BBR A;  4PAI A;  3SZP A;  1XI6 A;  1HSE A;  3D1R A;  2Q2A A;  3RN8 A;  1MY3 A;  3PPO A;  4I1D A;  1URS A;  3UN6 A;  2VPO A;  2V84 A;  2XXK A;  3K01 A;  2XHD A;  4U22 A;  4TLL B;  3CHG A;  1FBC A;  4XKP A;  4OTE A;  2AIX A;  1LBZ A;  1A8E A;  3OOA A;  4ZEI A;  3K00 A;  4G8N A;  3I6V A;  1Q1K A;  1SYI A;  2HCA A;  3F11 A;  1LBY A;  3SET A;  2NUV A;  3GYY A;  5AE4 A;  4OYV A;  2O51 A;  3HN0 A;  1S50 A;  4GRK A;  3VVD A;  3ZSF A;  2R9J A;  4NX1 A;  2ZZW A;  2WBB A;  4ZE9 A;  2F7C A;  3OO8 A;  1NV7 A;  2WBD A;  4F2Q A;  3PGF A;  4P11 A;  2BJI A;  4DXU A;  3ISP A;  4RK9 A;  3SES A;  4BDN A;  4FE8 A;  2RIN A;  5CMB A;  4OER A;  1FPB A;  4JVC A;  3IB1 A;  2UVG A;  1DMB A;  1MM6 A;  1NV5 A;  5H8S A;  3OSQ A;  2UYE A;  1JNF A;  2WX9 A;  1B4H A;  4R74 A;  4XF5 A;  1YPN A;  4BDL A;  3CG3 A;  3C32 A;  3R26 A;  1PEB A;  3TEL A;  1OLA A;  3W9V A;  3IK6 B;  1IME A;  4DCX A;  3CFX A;  4MJO A;  4EDP A;  3K1P A;  1MPD A;  1VE4 A;  5ISU A;  2QMX A;  3FAS A;  3HFU A;  1UQW A;  3K6V A;  1SVX B;  1DPP A;  5AA2 D;  2V93 A;  4X48 A;  3FXB A;  1MXU A;  4G68 B;  1F9B A;  2O84 X;  3JV9 A;  3OXN A;  3B7D A;  3WAF A;  5EYH A;  4U4X A;  1NMU A;  4I9D A;  4OWD A;  1ZLQ A;  2XXY A;  2CZI A;  2DS9 A;  1LFG A;  2GFE A;  4OVP A;  5KZT A;  1D9V A;  3DP6 A;  5IGA A;  2ZYK A;  3MZB A;  2NVU B;  3TQL A;  4DZ1 A;  2L5V A;  4F3S A;  1B3E A;  2DP8 A;  3T9V A;  4GBV A;  3FV2 A;  4THI A;  1FW0 A;  4FBP A;  4POX A;  3IJO B;  1IMC A;  4F22 A;  5CMM A;  1ZU0 A;  4MIJ A;  1B3F A;  1TFA A;  4MLV A;  3OO7 A;  4GF8 A;  5H8N A;  1JEV A;  3Q29 A;  4G4P A;  2ANJ A;  3A29 A;  4LUB A;  1S7Y A;  3MZ1 A;  2E0S A;  3B8B A;  3O29 A;  4G68 A;  3DLN A;  2HAU A;  3RT8 A;  4YKI A;  3KBZ A;  5IZ3 B;  1N7X A;  4P1E A;  2REG A;  4O7I A;  1FTL A;  3THI A;  2H9B A;  2O7U A;  1IMF A;  4OET A;  4KCD A;  2OX3 A;  4QFN A;  2WYK A;  3M8U A;  2DDK A;  3Q26 A;  4Q8R A;  1B51 A;  4HCW A;  4WEP A;  4Q0C A;  3LC8 A;  3KJT A;  4JSO A;  3LR1 A;  2PT2 A;  2DXR A;  5J1D A;  4RYA A;  4JVI A;  1KZ8 A;  3C35 A;  5JTY B;  1B1H A;  4EUO A;  3N5L A;  1SW4 A;  4PAF A;  1OVT A;  4PE3 A;  2V25 A;  2VP1 A;  4OFJ A;  2QS1 A;  1P1O A;  3Q25 A;  2ZYO A;  1R1N A;  3ECR A;  4EQ9 A;  1CE2 A;  2QVR A;  1VDW A;  2H99 A;  2XWI A;  3IB2 A;  1N3W A; 
#chains in the Genus database with same CATH homology
 3O9P A;  4GQO A;  2FNC A;  2A5S A;  1IXI A;  3CSG A;  4ISU A;  2GRV A;  2E1S A;  4IB2 A;  1B3G A;  3ILU B;  2ONS A;  1LCT A;  3KN3 A;  2F36 A;  4EF2 A;  2RKM A;  2HQ0 A;  4OZ9 A;  3TOD A;  4PP0 A;  3HPI A;  1EZP A;  2PX1 A;  4LP2 B;  4DIG A;  2F5X A;  5LOM A;  4LZ8 A;  3OEN A;  4O3C A;  4DCY A;  5I58 B;  3PUZ E;  2Z8E A;  3PPP A;  3TTL A;  4ESX A;  3KN8 A;  3BFT A;  3S9M C;  2O1L A;  3N6T A;  1IEJ A;  2OWT A;  1JEU A;  1MY4 A;  3TUS A;  4FJP A;  4LA9 A;  4LZ7 A;  4FIM A;  4P0G A;  2OJT A;  4U4S A;  3TCG A;  2V3T A;  3PMV A;  2ZNU A;  1NNK A;  2H25 A;  2YPN A;  4OFO A;  5I2K B;  3TCH A;  4YB6 A;  1P1W A;  4NF5 A;  1Y3Q A;  4F2O A;  3O66 A;  1BKA A;  2DWA A;  2XXI A;  3MJN A;  5EHS A;  3GZG A;  2XD3 A;  1LFI A;  4IO3 A;  4GXA A;  4K3F A;  3MUQ A;  4GLI A;  4R2B A;  1EU8 A;  1ELJ A;  4FAJ A;  2F78 A;  3V8X B;  4JDF A;  2V3Q A;  1O63 A;  2I0B A;  3UK4 A;  3MPK A;  1B5I A;  3B6Q A;  3FVG A;  2OK2 A;  5I58 A;  2ZYM A;  3U94 A;  1M5F A;  1SD3 A;  3TQW A;  1TXF A;  3KN7 A;  1NNP A;  5DTB A;  4F3B A;  1MQG A;  4OXV A;  4C0R A;  4ZS9 A;  4PET A;  3L6H A;  3RNN A;  4IO2 A;  2Z8D A;  3EPE A;  4MBP A;  2F7A A;  1URD A;  1M5D A;  3GBB A;  1N3X A;  2XXQ A;  5I2K A;  2Y7I A;  1J1N A;  1QW0 A;  4FOR A;  4KYE A;  3FIR A;  4JBZ A;  1FCK A;  1II5 A;  2H5Y A;  2GH9 A;  4OEV A;  3ZKK A;  1B7U A;  5L9S A;  3C36 A;  1QVS A;  2Q89 A;  5F7V A;  2Z8F A;  4R6K A;  3K6U A;  2XXT A;  1B46 A;  3IOT A;  2F34 A;  3QSL A;  4E0X A;  1QUJ A;  3S9N C;  4F3G A;  3O6I A;  4KYS A;  3EN3 A;  2I6E A;  2O69 A;  3MZ9 A;  2B65 A;  4OES A;  4R6H A;  4LQ5 A;  1B7Z A;  1QKB A;  1IZ1 A;  4JWO A;  1MPC A;  2LAO A;  3KFM A;  3FD3 A;  4G68 C;  4G8H A;  1CB6 A;  3KSX A;  2G29 A;  2UXA A;  1MM7 A;  2RCA A;  1P1Q A;  3TEP A;  4R73 A;  4ND9 A;  1VSO A;  2XXV A;  3IR1 A;  5AA1 A;  1SQY A;  2F35 A;  3K2D A;  3PMX A;  3QUJ A;  4ECF A;  1SW5 A;  1IXC A;  1POT A;  1OIB A;  4KI0 E;  1NKX A;  3V5A A;  2QS4 A;  1USY E;  3CRB A;  3SEU A;  3HST A;  1LAF E;  2NWJ A;  4BLA A;  4H5F A;  4ZE8 A;  3MP8 A;  2ZMB A;  2F8D A;  2O7I A;  3SEW A;  4NF8 B;  3CVG A;  3LSL A;  5FTH A;  1B3H A;  1B1X A;  1JET A;  1M5C A;  3H7M A;  3IL1 B;  2OBG A;  2ABH A;  1B6H A;  4P0I A;  1Z7N E;  3G3H A;  1B3L A;  2I4B A;  3JYR A;  3T9H B;  3OO9 A;  5DVF A;  3EHS A;  3U93 A;  2DE2 A;  5DYH A;  3CFL A;  3RGY A;  3SER A;  2VOZ A;  2NOO A;  4XXU A;  1PC3 A;  5TP9 B;  4JSD A;  4MFI A;  4XTC Q;  1PBP A;  1I6Q A;  4HCY A;  2Q2C A;  5A5X B;  3H3G A;  4GIZ A;  2RC7 A;  4QFL A;  1RYX A;  4M4G A;  2FA7 A;  2R6G E;  3S9E A;  3H6V A;  4RY1 A;  4KHZ E;  4U21 A;  2AL4 A;  4DXB A;  4ZED A;  4IO4 A;  1B2H A;  4NF8 A;  4OEU A;  4F1U A;  2IA4 A;  3N6U A;  1A55 A;  1MY0 A;  5H8N B;  1MXV A;  5JEI A;  4GFR A;  1ZMG A;  1QUK A;  3OO6 A;  4JWY A;  5DT6 A;  5H8H B;  2THI A;  4GOT A;  4N13 A;  1SYH A;  3V83 A;  4AB5 A;  3RT6 B;  4F1Y A;  3PUW E;  5BUU A;  3ZS6 A;  4YMB A;  1OQH A;  2DE3 A;  3VVF A;  2Z22 A;  3RUM A;  4GL8 A;  1I6B A;  1OQG A;  3D4G A;  4KD5 A;  1GGG A;  5B70 A;  1MDP 1;  1BIY A;  3GBA A;  3G3F A;  3KJ7 A;  3G3G A;  4XKR A;  3UOR A;  5TP9 A;  1R9Q A;  1B05 A;  3FXQ A;  4RPN A;  3ODB A;  4UAC A;  3C34 A;  1AOV A;  4ELQ A;  1O7T A;  2QSX A;  1UIU A;  5A5X A;  4ELR A;  1PB7 A;  4R9F A;  4KYD A;  5F1Q A;  3SEY A;  5AA2 B;  1Z7M E;  4H5G A;  1B5H A;  4EF1 A;  1XC1 A;  2WKY A;  1LBC A;  2I0C A;  4YIC A;  1H45 A;  1Y4C A;  1GTK A;  4JWX A;  5H8H A;  2H98 A;  3D4C A;  3USD A;  5B7D A;  1IXH A;  1MY2 A;  1Y4T A;  2W7Y A;  3HCQ A;  3R7X A;  3EHU A;  4OHN A;  1MG1 A;  1MXZ A;  1WOD A;  3PUY E;  4KPT A;  3OMB A;  4ELO A;  4H8I A;  4NF6 B;  1A99 A;  1LB8 A;  1RYO A;  1SI0 A;  1VFD A;  4R9G A;  1UIV A;  2D3I A;  3AXF A;  1MY1 A;  2Y7R A;  1Y1M A;  3I5O A;  4PFW A;  3O97 A;  3PMW A;  2DVC A;  1MRP A;  5JK4 A;  3E13 X;  4F31 B;  1MS7 A;  3VXC A;  4G77 A;  4NF5 B;  4OEN A;  1UTH B;  5AA2 A;  4G8M A;  3U8Q A;  1B58 A;  1XOC A;  3MC2 A;  1R6Z A;  3CIJ A;  3IOU A;  1GVC A;  3ZKL A;  4R2F A;  2O1M A;  2YJP A;  2Q8J A;  1B32 A;  2ZXT A;  3TPA A;  4PQJ A;  4NWC A;  3MVW A;  1NFT A;  4C1T A;  4F1V A;  1I6A A;  3IX1 A;  4ZDM A;  4GWO A;  4IY6 A;  1TFD A;  1ZJL A;  4NTL A;  4HS7 A;  1FQE A;  3MVY A;  4KR5 A;  5FTI A;  2UYF A;  4X1D A;  2PVU A;  2QMW A;  1DTG A;  3PPN A;  3FV1 A;  4EQ7 A;  3H6U A;  4EXK A;  1B0L A;  2D5W A;  2GHA A;  4F29 A;  5L8D A;  1WDN A;  4QRZ A;  2DXY A;  4POW A;  1ZTY A;  4NF6 A;  1FTJ A;  1OLC A;  1Y1Z A;  3LSX A;  3TTK A;  4E0W A;  4U1O A;  2XXX A;  1JW5 A;  3FZV A;  3BFU A;  2QL3 A;  2ONK E;  1N76 A;  4BDO A;  4PFT A;  1S9T A;  3G7W A;  3Q28 A;  4YB7 A;  3P7I A;  3SEX A;  1UTH A;  4NE4 A;  3U1O A;  3LSF B;  4R75 A;  3H06 B;  1PB9 A;  1TT1 A;  3MBP A;  3QYT A;  4ZZE A;  2UVH A;  1USY H;  3I3V A;  3ONM A;  2XX7 A;  3B6W A;  4QFO A;  2OWS A;  5L9M A;  4PE5 B;  2DOJ A;  5HM4 B;  4KCC A;  5I2N B;  4I8C A;  1IXG A;  2DWH A;  3KZG A;  2V3U A;  5CRY A;  1N04 A;  1JVY A;  1EZO A;  2OLB A;  1NH8 A;  5FHN A;  5BWJ A;  4F3P A;  3HHF A;  3PUX E;  4M1V A;  1ZKB A;  1FTK A;  2I58 A;  3S9L C;  2A5T B;  3T22 A;  3MPL A;  1ZBM A;  4X9T A;  1UTB B;  4H65 A;  1H3D A;  1US4 A;  3W9W A;  4RXL A;  4ESW A;  4H8J A;  1TWY A;  3K1N A;  1HSL A;  3MP1 A;  2O6A A;  1IIT A;  2RF1 A;  4NED A;  2XX9 A;  1LCF A;  4GD5 A;  3VV5 A;  4LON B;  3T93 B;  2F6G A;  4ELP A;  3KBR A;  3OEM A;  1JQF A;  1ZIU A;  4X1B A;  3CI8 A;  3FXR A;  5ICT A;  1POY 1;  1RKM A;  1JW4 A;  1M5B A;  1QUI A;  5IKB A;  4LZ5 A;  3BKI B;  2HZK A;  3KSJ A;  1B0H A;  2P2A A;  5I2N A;  2QRY A;  1O64 A;  1R9L A;  2ESN A;  4NF4 B;  1XHY A;  2ZNS A;  1Y9U A;  3A3U A;  2I3V A;  1XS5 A;  1B40 A;  2UVI A;  3OEK A;  4ZZA A;  1DPE A;  2A5T A;  3LUY A;  4DLD A;  5ITO A;  4LAT A;  4TQU Q;  3KG2 A;  3K4U A;  1UTB A;  3EQ1 A;  1AMF A;  3VFJ A;  3EF7 A;  1VR5 A;  2DWI A;  4MF3 A;  1Y20 A;  3MAM A;  1AL3 A;  2F6P A;  5CI5 A;  4QFP A;  5CBS A;  2B3B A;  3TMG A;  3G3K A;  3M3K A;  3KOS A;  2I3W A;  3H4Z A;  4UA8 A;  4DE8 A;  1URG A;  4XIG Q;  2VD2 A;  1OVB A;  1SBP A;  3VVE A;  2ZNT A;  2M8C A;  1IQ7 A;  5DEX B;  2XX8 A;  3VDF A;  2XXR A;  1ANF A;  1DOT A;  5I57 B;  1Y3P A;  4WXJ A;  2XXW A;  4U23 A;  2XXP A;  1DSN A;  5CMC A;  2IEE A;  5CM6 A;  1FQB A;  1ATG A;  5IAI A;  3W15 C;  3MVX A;  2KLF A;  4RNS A;  4NF4 A;  3QIM A;  2AL5 A;  1MXW A;  1B5J A;  3WAE A;  3UP9 A;  1XVY A;  1N84 A;  3O2A A;  4BDQ A;  1GR2 A;  4R72 A;  3FUZ A;  1YTV A;  1BLF A;  4IGT A;  4TLM B;  3T96 B;  2CMO A;  3UA8 A;  1N0T A;  3FGS A;  4O3A A;  4IO5 A;  1FTO A;  4KFQ A;  3IB0 A;  5FHM A;  3H6T A;  4IGR A;  3FVO A;  2H4I A;  4XKN A;  3G3J A;  1LFH A;  4I62 A;  5EHM A;  4ZEF A;  4PFY A;  1XVX A;  3C4M A;  3QXM A;  3T66 A;  5KDT A;  5CBR A;  4QF9 A;  3T9X B;  1MH4 A;  2VHA A;  5H8Q B;  1HSJ A;  1IUD A;  2HXW A;  5EYF A;  3MQ9 A;  5DEX A;  1A8F A;  3TDJ A;  1NNT A;  2I48 A;  5I57 A;  1PB8 A;  2XXU A;  3MVZ A;  3A09 A;  2RC8 A;  3O28 A;  1LBB A;  4QSE A;  5L9O A;  4YU0 A;  3OD7 A;  2P1S A;  2F7B A;  5K2X A;  3SKP A;  3G3I A;  5DVI A;  5FHO A;  4OVJ A;  3KGC A;  1WVJ A;  1NNF A;  1YAE A;  4NWD A;  2HAV A;  4FEC A;  3VLW A;  1BP5 A;  2RC9 A;  2PYY A;  3SEV A;  4WKM A;  3M3F A;  4YKP A;  2PBW A;  3TCF A;  3SDF A;  2DWJ A;  3CG1 A;  3M3L A;  1OMP A;  4AQ4 A;  1LGB C;  3H03 A;  2X26 A;  1YCJ A;  1EZ9 A;  3IOR A;  4IO6 A;  3FVN A;  3K0V A;  1AH5 A;  4EXL A;  4L17 A;  3UGW A;  5I56 B;  1D3K A;  4R6Y A;  5H8Q A;  4LVQ A;  3DEL B;  5ELV A;  3HHG A;  3O6H A;  1T0K A;  3RTF B;  3LSW A;  1JW1 A;  2F97 A;  4H1X A;  1B4Z A;  3RQT A;  1B9J A;  1A40 A;  4DXC A;  4YAH X;  4RPO A;  2Z23 A;  1EH3 A;  3E9X A;  1QJM A;  3HV1 A;  4RA1 A;  5ICQ A;  4Q5T A;  2DQV A;  2OZZ A;  1I69 A;  3FJ7 A;  4QSD A;  5I59 B;  4Q30 B;  1FQD A;  5HPQ A;  1B52 A;  3U92 A;  1LAG E;  4Z7E A;  1LAX A;  1AIV A;  3MP6 A;  4GVO A;  4G2Z A;  1SI1 A;  3T9U A;  3V89 B;  2DVZ A;  1US5 A;  3PU5 A;  3VLV A;  2Y7K A;  2QPQ A;  1MPB A;  3HO7 A;  1QKA A;  4N07 A;  1GV8 A;  2HZL A;  3A3C A;  1P1N A;  2FYI A;  4OFL A;  3FVK A;  2PMS A;  2RCB A;  2PT1 A;  5I56 A;  1H43 A;  3H6W A;  3DM0 A;  2QJE A;  2QS2 A;  3E4R A;  3S2V A;  5ITP A;  2VD3 A;  4HW8 A;  3RPW A;  2I49 A;  2HFB A;  3GLB A;  4IY5 A;  3O6G A;  3E3K A;  1MDQ A;  3MWB A;  3RLF E;  2Y7W A;  4H67 A;  3ILT B;  5I59 A;  1NH7 A;  3DP8 A;  2P0S A;  2CZL A;  4HTG A;  3QK6 A;  1MQH A;  1SW2 A;  4YB5 A;  4OQO A;  1FQC A;  3K1M A;  4QSC A;  3GXA A;  2X7P A;  4YMA A;  5K2Y A;  1A54 A;  1QUL A;  3IOW A;  3LBS A;  4GXS B;  2DYX A;  1MQI A;  1D4N A;  1SDX A;  3N26 A;  5KCJ B;  4BDR A;  3C33 A;  5HBC A;  2UVJ A;  4QFK A;  3RTW B;  2BJJ X;  3IJX B;  2XXH A;  3QAX A;  3FJG A;  2R71 A;  4ONY A;  4Z0I A;  1P99 A;  4FED A;  1MQD A;  1BTJ A;  4F18 A;  4C1U A;  1Y3N A;  3KEI A;  5AA4 B;  5JTY A;  1VFE A;  3Q27 A;  1LST A;  2AYS A;  3RY3 A;  1MQJ A;  3VE1 B;  3PD8 A;  4F19 A;  2DE4 A;  2OCU A;  1FQA A;  3OEL A;  1FQF A;  3JZJ A;  1M5E A;  3C31 A;  4NMY A;  1LLS A;  4RJZ A;  5CC2 A;  2Q88 A;  1MH3 A;  2I4C A;  4YKK A;  4AB6 A;  1NL5 A;  4JXI A;  3L6G A;  1Q35 A;  2XD2 A;  1PDA A;  4MLQ A;  4N6P A;  3IOV A;  5H8F B;  3TTR A;  4DDD A;  1DTZ A;  3B6T A;  3S4U A;  3TTN A;  1PBQ A;  4U2R A;  3IO6 A;  2REJ A;  4LQ2 A;  5TPA B;  4IO7 A;  5KCJ A;  3CR9 A;  3U72 A;  3TKD A;  3MW0 A;  4OMB A;  3PPQ A;  4FAT A;  3KOT A;  4MH5 A;  3PUV E;  2Y84 A;  4YKJ A;  2YLN A;  1LAH E;  2D21 A;  1IIW A;  1P1U A;  4TOZ A;  4ZEB A;  4F39 A;  3DP4 A;  2GHB A;  5AA4 A;  1MXX A;  3PPR A;  5CMK A;  4ZEC A;  1KWH A;  4O3B A;  3R6U A;  4ZEK A;  3TFL A;  2G93 A;  4KQP A;  2B3F A;  3N94 A;  3QUF A;  3CSB A;  1L5T A;  4XKQ A;  2X7Q A;  3FJM A;  3EHT A;  3IO4 A;  1SW1 A;  3K6X A;  3VXB A;  4WED A;  3K02 A;  2Y7P A;  2ZYN A;  3FXU A;  4H6D A;  4BDM A;  5DVJ A;  3C9H A;  2O68 A;  3FAT A;  5H8F A;  3CFZ A;  2VGQ A;  4JB7 A;  2Q9T A;  2ALU A;  3TAJ A;  5TPA A;  2HEU A;  3OSR A;  3VLU A;  2DSF A;  3IAZ A;  5KDT B;  3PV0 E;  4QHQ A;  5AA3 A;  1N7W A;  4YZZ A;  4GL0 A;  5I84 A;  4EQB A;  3TYH A;  1H76 A;  3PD9 A;  1LB9 A;  1B7H A;  4H0W A;  1XT8 A;  3K6W A;  2NXO A;  1D9Y A;  4RK2 A;  1JVX A;  1H44 A;  2QS3 A;  4PFU A;  4FEB A;  4U1Z A;  2ONR A;  1A7L A;  3UIF A;  5TU0 A;  1FTM A;  3TTM A;  1MXY A;  5M2V A;  3TZA A;  3BBR A;  1HSE A;  2Q2A A;  3RN8 A;  1MY3 A;  3PPO A;  4I1D A;  1URS A;  3UN6 A;  2V84 A;  3K01 A;  2XHD A;  4U22 A;  4TLL B;  4XKP A;  2AIX A;  4OTE A;  3OOA A;  1A8E A;  4ZEI A;  3K00 A;  4G8N A;  3I6V A;  1Q1K A;  1SYI A;  2HCA A;  3F11 A;  3SET A;  2NUV A;  5AE4 A;  4OYV A;  2O51 A;  3HN0 A;  1S50 A;  4GRK A;  3VVD A;  3ZSF A;  2R9J A;  4ZE9 A;  2F7C A;  3OO8 A;  4F2Q A;  3PGF A;  4P11 A;  4DXU A;  4RK9 A;  3SES A;  4BDN A;  4FE8 A;  2RIN A;  5CMB A;  4OER A;  3IB1 A;  2UVG A;  1DMB A;  1MM6 A;  5H8S A;  3OSQ A;  2UYE A;  1JNF A;  1B4H A;  4R74 A;  1YPN A;  4BDL A;  3CG3 A;  3C32 A;  3R26 A;  1PEB A;  3TEL A;  1OLA A;  3W9V A;  3IK6 B;  4DCX A;  3CFX A;  4EDP A;  3K1P A;  1MPD A;  1VE4 A;  5ISU A;  2QMX A;  3FAS A;  1UQW A;  3K6V A;  1SVX B;  1DPP A;  5AA2 D;  2V93 A;  4X48 A;  1MXU A;  4G68 B;  1F9B A;  2O84 X;  3JV9 A;  3OXN A;  3B7D A;  3WAF A;  4U4X A;  1NMU A;  4I9D A;  4OWD A;  1ZLQ A;  2XXY A;  2DS9 A;  1LFG A;  2GFE A;  5KZT A;  1D9V A;  3DP6 A;  2ZYK A;  3MZB A;  2NVU B;  3TQL A;  4DZ1 A;  4F3S A;  1B3E A;  2DP8 A;  3T9V A;  3FV2 A;  4THI A;  1FW0 A;  4POX A;  3IJO B;  4F22 A;  5CMM A;  1ZU0 A;  1B3F A;  1TFA A;  4MLV A;  3OO7 A;  4GF8 A;  5H8N A;  1JEV A;  3Q29 A;  4G4P A;  2ANJ A;  4LUB A;  1S7Y A;  3MZ1 A;  2E0S A;  3O29 A;  4G68 A;  3DLN A;  2HAU A;  3RT8 A;  4YKI A;  1N7X A;  2REG A;  1FTL A;  3THI A;  2H9B A;  2O7U A;  4OET A;  4KCD A;  4QFN A;  3M8U A;  3Q26 A;  4Q8R A;  1B51 A;  4HCW A;  4WEP A;  4Q0C A;  3LC8 A;  3KJT A;  4JSO A;  3LR1 A;  2PT2 A;  2DXR A;  5J1D A;  4RYA A;  3C35 A;  5JTY B;  1B1H A;  4EUO A;  3N5L A;  1SW4 A;  1OVT A;  2V25 A;  2VP1 A;  4OFJ A;  2QS1 A;  1P1O A;  3Q25 A;  2ZYO A;  1R1N A;  3ECR A;  4EQ9 A;  1CE2 A;  2H99 A;  3IB2 A;  1N3W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...