4LP2B

Crystal structure of monomeric ligand binding domain of s. typhimurium cysb, a lysr transcriptional regulator at 2.2a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of monomeric ligand binding domain of S. typhimurium CysB, a LysR transcriptional regulator at 2.2A
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
total genus 64
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lp2B01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lp2B02
5CMCA 4R72A 4EDPA 5ITOA 2VP1A 3S9LC 1B58A 3VLUA 2DVCA 1BTJA 2XX9A 4C1TA 1MXZA 1Z7ME 4PFWA 1B32A 3R26A 4YMBA 1XVYA 5H8FA 3S2VA 3OD7A 2DWIA 3G3GA 4QSCA 2NUVA 2O1LA 1EU8A 4TOZA 4U2RA 1VSOA 1PB8A 3LUYA 4EQ7A 4Q8RA 2UYEA 3M3LA 3KN3A 1N84A 3FV2A 3TTLA 3THIA 3OO9A 5AA2D 3K01A 1ZLQA 1MXVA 4KI0E 3S9MC 3TCFA 5IAIA 1QUJA 3W9WA 4OXVA 3MVWA 1URSA 4RPOA 1MQJA 2OZZA 2F78A 3TQLA 4RYAA 4Q5TA 3KN8A 4NF6B 1XT8A 4R73A 3JYRA 3O6GA 1NH7A 4R6HA 3VVEA 2F97A 3EN3A 2A5TA 3JZJA 1JW4A 5FHNA 1SDXA 3H6UA 4EUOA 4K3FA 3MUQA 2NVUB 3PU5A 1B4ZA 1IEJA 4NF5B 2XXQA 2GRVA 4FAJA 4ZEKA 2DE2A 3U1OA 4FEBA 3VDFA 2XXWA 2XXHA 4JXIA 1ZBMA 1VE4A 1OMPA 2D21A 2Y7IA 2Q2CA 3MZ1A 4DIGA 4F22A 1B7HA 4KR5A 5DEXA 4XKRA 4LZ5A 1OQGA 2HCAA 4YB7A 3PPOA 5AE4A 3IORA 1GTKA 5L9OA 1DSNA 1MXXA 4IO7A 1EZOA 2H25A 4DLDA 3DLNA 3RQTA 1QKAA 1Y1ZA 1ZJLA 4ZEBA 3TDJA 2UVHA 1WVJA 2DWJA 2O69A 3H06B 1B05A 1H76A 2PT1A 4Z0IA 4GD5A 2Z23A 3M3FA 1POTA 4BDMA 2X7QA 4R6YA 4ELQA 2ANJA 5CRYA 5HPQA 4M1VA 3A09A 1OLAA 1IXCA 3S9EA 2NOOA 4OFLA 2FYIA 3MWBA 4NEDA 1POY1 2PT2A 2XD3A 3BBRA 3FATA 3T9XB 1VFEA 4G8MA 5HBCA 4LQ5A 4H1XA 3L6GA 2I3VA 2P0SA 1B4HA 4KHZE 3TQWA 1D9VA 3ZKKA 3SEVA 1LB9A 3U72A 1ZU0A 1T0KA 4WEDA 1R6ZA 4N07A 1D9YA 3DELB 1II5A 4DZ1A 4P11A 2GHBA 3PMWA 2OK2A 3CSBA 3UN6A 2LAOA 3WAFA 2RC8A 3TMGA 2F35A 3PGFA 1MY0A 3OXNA 1OQHA 3FJMA 3LSXA 3BFUA 3BFTA 4DXUA 2IA4A 1ZKBA 4X1DA 4WEPA 5CBRA 1US4A 4NE4A 2HAVA 5A5XB 2O84X 3P7IA 1I6AA 3EHTA 4NWDA 3U94A 5HM4B 1FTMA 2QSXA 3H6VA 4P0GA 1M5CA 4ZEIA 4YKPA 1MXWA 4DXCA 1B3FA 4BDRA 1LCFA 5L9MA 3HHGA 1RKMA 3SEXA 1D3KA 3C34A 2R6GE 1B1HA 1P1NA 1F9BA 2ZYOA 3T9HB 4LONB 1JETA 1B7UA 2PYYA 3BKIB 1ZIUA 4DDDA 2UXAA 3G3KA 1R9QA 4LQ2A 1LCTA 2WKYA 5BWJA 4RPNA 3O2AA 2QRYA 3TFLA 3CR9A 5H8QB 3FZVA 1OIBA 3UORA 3CSGA 3K02A 5I58A 4EXLA 2UVGA 5F7VA 1UTBA 2PX1A 2I4BA 1Q1KA 4YZZA 3PMVA 3O28A 3HPIA 2DWAA 1SYHA 4YKIA 3PPQA 2XXRA 3EHSA 1LB8A 5JTYB 1QUKA 4FECA 4FATA 4XKPA 1JVYA 3O66A 1P99A 1XS5A 5TP9B 3PUZE 2THIA 4ELPA 5CM6A 1YPNA 2O7IA 1B1XA 1FTJA 2XXIA 3MC2A 4EXKA 2CMOA 4ECFA 4N6PA 4YKKA 1WODA 2HXWA 1CB6A 1SW4A 3PUXE 1BP5A 1FQBA 1XHYA 5B7DA 2DXYA 4THIA 5FTHA 1A55A 3KOSA 2HEUA 2O51A 1LBBA 1B0HA 2RCAA 3E9XA 2KLFA 3D4CA 2Y7KA 1FQDA 3IOTA 4ISUA 2F7CA 3FIRA 1MQIA 2O6AA 3KSXA 1PB9A 3CRBA 4KFQA 3RTWB 4HS7A 2DQVA 3KJTA 1IXGA 4OMBA 5EHMA 3K4UA 4EQ9A 3IB1A 3MP8A 1UQWA 1XC1A 3U93A 1GR2A 3QSLA 3MQ9A 3C36A 4OFJA 1TWYA 4ESWA 3TCHA 2F34A 3FGSA 1TFAA 1B5HA 4KD5A 5I57A 3ODBA 3K2DA 2QL3A 5M2VA 3MAMA 2H9BA 4G68A 3VLVA 1QJMA 3OENA 3IAZA 5TU0A 1M5BA 2DS9A 3ONMA 3K1PA 1N3XA 1LLSA 4IO4A 3SERA 1VR5A 4MFIA 1Y3QA 4R9GA 1MPBA 2Y84A 1ZTYA 1ANFA 1B5JA 5K2YA 1YCJA 3HSTA 2VD2A 1MQDA 4TLMB 1N76A 2ZNTA 5ICQA 4H65A 4DCXA 1MY1A 3V8XB 1B2HA 1JW1A 3B6TA 3OMBA 4U1ZA 2Y7PA 5L8DA 4PE5B 5K2XA 1PEBA 2RCBA 1NNTA 1USYH 4G8HA 3C4MA 4JSOA 4GL8A 4NF8B 5I56B 2ZYNA 1SW5A 3K6UA 2ZNSA 1EZ9A 1JNFA 3RUMA 3HO7A 3C32A 3KZGA 2E0SA 2H5YA 3MP6A 5ITPA 3CFZA 1PC3A 4O3CA 3IJXB 1MQGA 2H99A 4BDOA 3MW0A 4BLAA 4OENA 4QFPA 4UACA 3PUVE 2I0CA 4NF6A 2H98A 4O3AA 4MBPA 4F19A 3RPWA 3FXUA 2P2AA 4YMAA 3UA8A 1I6BA 1TT1A 1VFDA 2OCUA 4I1DA 2XXYA 3O6IA 3B6WA 2Z8EA 3H7MA 4XTCQ 4YB5A 4NF5A 3LBSA 2RINA 3FXQA 3N6UA 2E1SA 1ATGA 4IO6A 3RGYA 3PV0E 2I49A 1MPCA 4H8JA 3CI8A 3SKPA 5KDTB 3O9PA 4G4PA 3G3FA 4MF3A 4OHNA 3VV5A 1Y4TA 4L17A 1L5TA 5H8HB 4RK2A 2IEEA 2H4IA 4R6KA 4IO3A 4F1VA 3SEUA 3HV1A 3TZAA 2BJJX 2Y7RA 1LAXA 4R74A 2DE3A 5DVFA 3MBPA 3H6TA 4GF8A 1WDNA 4FIMA 3LR1A 5DYHA 4G77A 1DPEA 1FCKA 2Y7WA 3FVOA 2D3IA 2W7YA 4QFNA 3MPLA 2V3TA 4Q0CA 3K00A 3SETA 3E13X 4LVQA 3OOAA 4OESA 2ABHA 3N26A 5H8NB 4U21A 5B70A 4GWOA 1AOVA 4YB6A 4LZ7A 3SESA 1PBPA 4E0WA 2QS2A 4OTEA 2F7AA 5AA4B 2PVUA 1MXUA 4R9FA 5AA2A 2Z8DA 4I62A 4PQJA 1B9JA 3O97A 3FV1A 4M4GA 2ZYMA 2ONSA 2V93A 1FQCA 1XOCA 3PUYE 5DEXB 2OWSA 4RNSA 2YJPA 4ZE8A 2ONKE 2YPNA 4H8IA 4POWA 4EQBA 4F2OA 3V83A 1BKAA 3PUWE 1MY4A 4GQOA 3I3VA 3ZSFA 5A5XA 3UK4A 5ELVA 2QPQA 2O7UA 4PFYA 2OWTA 4OEVA 3U8QA 2AL4A 2ZNUA 1IUDA 5KCJB 4G2ZA 4LP2B 3A3CA 3K6VA 3KJ7A 3CFXA 5F1QA 4AB5A 2P1SA 3KEIA 2DSFA 3Q26A 3QYTA 2PMSA 1B40A 4NF4B 5DTBA 4ELOA 1JW5A 3F11A 3Q27A 5J1DA 3VLWA 2NWJA 3VVFA 3CIJA 2HFBA 4ONYA 4KCCA 1NNPA 2B3FA 1LAFE 4QF9A 4MLVA 2F7BA 2QMWA 1B52A 4JWYA 1SW2A 3OELA 1B3LA 3K0VA 4MLQA 1H43A 3GLBA 4HCYA 4F1YA 5DVIA 4GL0A 4H6DA 4UA8A 5BUUA 1URGA 1QKBA 4IGTA 4ZEDA 3N5LA 4AQ4A 1TXFA 2XHDA 1IIWA 1SQYA 1QUIA 3TTKA 1M5FA 2I58A 2I48A 5JK4A 3OO7A 3Q25A 3RT8A 1IXHA 2XXUA 4LZ8A 1MPDA 3RT6B 1KWHA 1MY2A 4KYSA 5EHSA 1GGGA 4QFLA 4GIZA 5CC2A 4IO5A 1FQAA 3K1MA 1DMBA 1B46A 1UIVA 4BDLA 5I59B 1O64A 4NWCA 4U4SA 1M5EA 1P1QA 3PD8A 3MVXA 1AIVA 3DP4A 3H03A 3MZ9A 4IY5A 4I9DA 2GFEA 1SVXB 2XX8A 3MPKA 1BLFA 1MDQA 3H4ZA 1SBPA 1Y4CA 4DCYA 3LSLA 2QMXA 4XKQA 4I8CA 5TPAA 2X26A 3M3KA 4RA1A 3EQ1A 5LOMA 2XXTA 2V25A 5I2KB 3GZGA 4XIGQ 3G7WA 4U22A 5I58B 2VGQA 3R6UA 3W15C 1UTBB 2QS3A 3TYHA 4F1UA 1PB7A 4NMYA 3IO6A 2I6EA 2XX7A 3IR1A 3V5AA 4U1OA 2F36A 2CZLA 3OO6A 3KFMA 3TAJA 5AA3A 5EYFA 2F6PA 3L6HA 1B3GA 4F39A 3K6XA 3JV9A 1LGBC 1QW0A 4C1UA 1SI0A 2RKMA 3DM0A 4RJZA 3GBBA 4OWDA 4RXLA 3EF7A 1YAEA 5I2NB 1XVXA 2ESNA 3KN7A 1UIUA 1JQFA 3UP9A 3HHFA 3ILTB 4GFRA 4WKMA 4IB2A 1CE2A 1H45A 2F6GA 5FTIA 3WAEA 4PFTA 2DXRA 3KBRA 5ISUA 3MP1A 1N3WA 4X9TA 3LC8A 2G29A 2ALUA 3LSFB 2QS1A 3C33A 3RN8A 3TTRA 1IXIA 3FD3A 2O1MA 3QUJA 1B51A 4PP0A 2FA7A 1BIYA 2F8DA 3HCQA 5IKBA 3UIFA 4RK9A 5DT6A 5I57B 3QIMA 3TCGA 4WXJA 3RTFB 1JVXA 3CVGA 4G68B 4FJPA 1LAGE 3PD9A 1AH5A 2I3WA 2Q8JA 1A8FA 4MH5A 3I6VA 3ILUB 3RNNA 1FQEA 1SI1A 1Y1MA 3VE1B 2B65A 2DWHA 1FTOA 2RC9A 4F3SA 2V3QA 3T93B 3RY3A 2XXXA 5KDTA 1MG1A 4Z7EA 1Y20A 3TODA 3DP8A 3SEYA 1UTHB 5H8HA 3GBAA 4O3BA 1O63A 1B3HA 4E0XA 4JWXA 4R2BA 3IX1A 4TQUQ 4EF2A 3W9VA 3PPRA 1URDA 1R1NA 4XXUA 5H8SA 5FHMA 4U23A 3N6TA 3OSRA 4X48A 1PDAA 3N94A 1A99A 1S9TA 1P1OA 2AYSA 1QVSA 1LSTA 3K6WA 1H3DA 3IK6B 5H8FB 4ZZAA 5H8NA 4OERA 2DP8A 3TTMA 1JEUA 1A7LA 1USYE 3MVZA 2VD3A 4H0WA 3RLFE 2OBGA 3ZKLA 4HCWA 3DP6A 1LAHE 4OFOA 1MDP1 2HZLA 2ZMBA 5L9SA 5AA4A 1S50A 4DE8A 1Y3PA 2Q2AA 4JSDA 4AB6A 1DPPA 2GH9A 2UVJA 3IOVA 3B6QA 2V84A 4C0RA 2FNCA 4YU0A 3R7XA 1GV8A 1J1NA 2XD2A 1NH8A 2D5WA 3QAXA 3QXMA 5CI5A 1LBCA 4G68C 3B7DA 3UGWA 4GVOA 2GHAA 1LFHA 2ONRA 3D4GA 4ZDMA 2A5TB 2VOZA 3TELA 2OJTA 4QSDA 1O7TA 4KYEA 1A54A 3ECRA 1I6QA 5DVJA 3FUZA 3TKDA 4LUBA 4POXA 4QSEA 4N13A 3PPNA 3EHUA 4ELRA 5KCJA 4FE8A 1AMFA 2VHAA 4LA9A 5CBSA 1YTVA 1DTGA 1B7ZA 4H5FA 1OLCA 3FVKA 4ZZEA 4GXSB 1IZ1A 3FASA 3S4UA 4NF4A 4ZS9A 2G93A 1NNFA 3FJGA 2R9JA 1OVBA 2B3BA 4KYDA 4OYVA 1B6HA 4H5GA 5AA2B 4TLLB 3VXCA 3IOWA 3MZBA 4QFKA 1EH3A 1N7WA 3KG2A 3Q29A 1MQHA 4R75A 2YLNA 3C9HA 5KZTA 4NTLA 4Q30B 3GXAA 2Q88A 4QHQA 4YICA 2REJA 1HSJA 1Z7NE 3FVGA 1HSEA 3FVNA 4PETA 5CMMA 3FXRA 3U92A 2Q9TA 2ZXTA 1I69A 3C31A 3C35A 1HSLA 2RC7A 2ZYKA 1NMUA 2I4CA 1ELJA 4BDQA 3KSJA 3TTNA 4KPTA 1N04A 3K1NA 1NKXA 4XKNA 4RY1A 5H8QA 1FW0A 3MJNA 3T96B 3T9UA 2O68A 2AIXA 1Y9UA 3ZS6A 4HW8A 2X7PA 5I59A 2HAUA 4GLIA 5JTYA 2UVIA 4P0IA 4F3PA 5TP9A 3G3JA 4GXAA 4F31B 3KOTA 4OQOA 4JWOA 3T22A 4OVJA 1FTKA 1DTZA 3TUSA 2AL5A 2R71A 2XXVA 4PFUA 2REGA 3SEWA 1FQFA 3G3IA 5I2KA 1S7YA 2I0BA 4JB7A 3SDFA 3M8UA 4IY6A 1IQ7A 3FJ7A 2PBWA 2M8CA 1MS7A 1N0TA 4R2FA 3IB2A 1QULA 4GRKA 4F18A 2Q89A 2DYXA 3OEKA 4YAHX 1P1UA 1SYIA 4JBZA 3OO8A 4YKJA 3H6WA 1PBQA 2HQ0A 4H67A 1EZPA 1SD3A 5ICTA 2QJEA 1Y3NA 1M5DA 3CFLA 4ZECA 1SW1A 4IO2A 4OETA 3E4RA 1NNKA 3MVYA 4KCDA 3G3HA 3TEPA 3VVDA 4F3GA 3LSWA 5I2NA 3AXFA 1R9LA 3PPPA 3O29A 1B0LA 4F29A 3V89B 1N7XA 2NXOA 4X1BA 1OVTA 1MM7A 3KGCA 3USDA 1ZMGA 3Q28A 4F2QA 2DOJA 1MM6A 1AL3A 4ND9A 2HZKA 4ZEFA 4HTGA 4GOTA 3A3UA 1B3EA 3OEMA 3T9VA 2Z8FA 3IJOB 2A5SA 4F3BA 5TPAB 2V3UA 1DOTA 1FTLA 4ZE9A 1H44A 1B5IA 1A40A 5CMKA 1LFIA 3S9NC 1IITA 3TPAA 4BDNA 2RF1A 2DVZA 1JEVA 4EF1A 2F5XA 2Z22A 5AA1A 3H3GA 1MXYA 4NF8A 3CG1A 4QRZA 4FEDA 5I56A 1LFGA 1NFTA 3IOUA 1NL5A 3IO4A 4LATA 3T66A 3QUFA 1US5A 3QK6A 1P1WA 3CG3A 4OEUA 2OLBA 3I5OA 4OZ9A 1MY3A 1TFDA 3IB0A 1GVCA 1Q35A 3EPEA 5JEIA 1RYOA 4ESXA 1MRPA 1UTHA 3VXBA 2XXPA 2UYFA 1MH4A 4JDFA 5I84A 3E3KA 4DXBA 4KQPA 1RYXA 5FHOA 4FORA 1A8EA 1MH3A 3OSQA 3IL1B 1D4NA 5CMBA 2DE4A 4IGRA 2QS4A 4U4XA 3HN0A 3PMXA 4QFOA 3O6HA 4G8NA 3VFJA
chains in the Genus database with same CATH superfamily
5CMCA 4R72A 4EDPA 5ITOA 2VP1A 3S9LC 1B58A 3VLUA 2DVCA 1BTJA 2XX9A 4C1TA 1MXZA 1Z7ME 4PFWA 1B32A 2F3DA 4O7MA 3R26A 4YMBA 1XVYA 5H8FA 3S2VA 3OD7A 2DWIA 3G3GA 4QSCA 2NUVA 2O1LA 2B4MA 5EQ9A 1IMBA 2WYKA 1EU8A 4TOZA 4U2RA 1VDWA 1VSOA 1PB8A 3LUYA 4EQ7A 4Q8RA 2Y5KA 1FJ6A 1XI6A 2UYEA 3M3LA 3KN3A 1N84A 3FV2A 3TTLA 3IFCA 3THIA 3OO9A 5AA2D 3K01A 1ZLQA 1MXVA 4KI0E 4DI3D 3S9MC 3TCFA 1EYKA 5IAIA 2HXRA 1QUJA 4NHBA 3W9WA 4OXVA 3MVWA 2CEXA 1URSA 4RPOA 1MQJA 2OZZA 2F78A 3TQLA 1Q9DA 4RYAA 4Q5TA 3KN8A 4NF6B 1XT8A 4R73A 3JYRA 3O6GA 1NH7A 4R6HA 5A5LA 3VVEA 2F97A 3EN3A 2A5TA 3JZJA 1JW4A 5FHNA 1SDXA 3H6UA 4EUOA 4K3FA 3MUQA 2NVUB 3PU5A 2HHMA 1B4ZA 1IEJA 4NF5B 1BK4A 2XXQA 2GRVA 4FAJA 4ZEKA 2DE2A 3U1OA 1LBYA 4FEBA 4GX4A 3VDFA 2XXWA 2XXHA 4JXIA 1ZBMA 1VE4A 1OMPA 2D21A 2Y7IA 2Q2CA 3MZ1A 4DIGA 4F22A 1B7HA 4KR5A 5DEXA 4XKRA 4LZ5A 1OQGA 2HCAA 4YB7A 3PPOA 5AE4A 3IORA 1GTKA 4O7IA 5L9OA 1DSNA 1MXXA 4IO7A 1EZOA 2H25A 4DLDA 3DLNA 3RQTA 1QKAA 2XWIA 1Y1ZA 1ZJLA 4MJOA 4ZEBA 4MAGA 3TDJA 2UVHA 2ZZXA 1WVJA 2DWJA 2O69A 1NV6A 3H06B 1B05A 1H76A 2PT1A 4Z0IA 4GD5A 2Z23A 3M3FA 1POTA 4BDMA 2X7QA 4OVRA 4N4UA 4R6YA 4ELQA 2ANJA 1NV2A 5CRYA 5HPQA 4M1VA 3A09A 1OLAA 1IXCA 3S9EA 2NOOA 4OFLA 2FYIA 3MWBA 4NEDA 1POY1 2PT2A 2XD3A 3BBRA 3FATA 3T9XB 1VFEA 2WX9A 4G8MA 5HBCA 4LQ5A 2R8TA 4H1XA 3L6GA 2I3VA 2P0SA 1B4HA 4KHZE 3TQWA 1D9VA 3ZKKA 3SEVA 1LB9A 3U72A 1ZU0A 1T0KA 4WEDA 1R6ZA 4N07A 1D9YA 3DELB 1II5A 4DZ1A 4P11A 2GHBA 3PMWA 2OK2A 3CSBA 3UN6A 2LAOA 5ET5A 3WAFA 2RC8A 3TMGA 2F35A 3EKIA 3PGFA 4X8RA 1MY0A 3OXNA 1OQHA 3FJMA 3LSXA 3BFUA 3BFTA 4DXUA 2IA4A 1ZKBA 4X1DA 4WEPA 5CBRA 1US4A 4NE4A 2HAVA 5A5XB 2O84X 3P7IA 1KZ8A 1I6AA 4PF6A 3EHTA 4NWDA 3U94A 5HM4B 4AS5A 1FTMA 4P9KA 2QSXA 3H6VA 4P0GA 1M5CA 4ZEIA 3U65A 4YKPA 1MXWA 1IMCA 4DXCA 2WEFA 1B3FA 4BDRA 1LCFA 5L9MA 3HHGA 4QBAA 2MKZA 1RKMA 3SEXA 1D3KA 3C34A 2R6GE 1B1HA 1P1NA 1D9QA 1F9BA 2ZYOA 3T9HB 4LONB 1JETA 1B7UA 2PYYA 3BKIB 1ZIUA 4DDDA 1DK4A 2FIEA 2UXAA 3G3KA 5IZ3B 2PFZA 1R9QA 4LQ2A 5EYGA 1LCTA 2WKYA 3SZPA 1YZ0A 5BWJA 1LBVA 4RPNA 3O2AA 2QRYA 3TFLA 3CR9A 5H8QB 3FZVA 1OIBA 3UORA 1FPLA 3CSGA 3K02A 5I58A 4EXLA 2UVGA 5F7VA 1UTBA 2PX1A 3E78A 4PFRA 2I4BA 1Q1KA 4YZZA 3PMVA 3O28A 3HPIA 2DWAA 1SYHA 4GWZA 4YKIA 3PPQA 2XXRA 4LN5A 3EHSA 1LB8A 5JTYB 1QUKA 4FECA 2OWZA 4XKPA 4FATA 4PDHA 1JVYA 4OVQA 3O66A 1P99A 4N8YA 1XS5A 5TP9B 4PTKA 3PUZE 1FBEA 2THIA 4ELPA 5CM6A 1YPNA 1NUYA 2O7IA 3RPLA 1B1XA 1FTJA 2XXIA 3MC2A 4EXKA 2CMOA 4ECFA 4N6PA 4MNIA 4YKKA 1WODA 2HXWA 3B50A 1CB6A 1SW4A 3PUXE 1BP5A 2V4CA 1FQBA 3T0JA 1XHYA 5B7DA 2DXYA 4THIA 5FTHA 1A55A 3KOSA 2HEUA 2O51A 1LBBA 1B0HA 2RCAA 3E9XA 2KLFA 1NV1A 3D4CA 2Y7KA 1FQDA 3IOTA 2Q8MA 4ISUA 3FXBA 2F7CA 3FIRA 1MQIA 2O6AA 3KSXA 1PB9A 3CRBA 4KFQA 3RTWB 4HS7A 2DQVA 3KJTA 1IXGA 4OMBA 5EHMA 1FPKA 3K4UA 4EQ9A 3IB1A 3MP8A 1UQWA 1XC1A 3U93A 1GR2A 3QSLA 3MQ9A 3C36A 4OFJA 1TWYA 4ESWA 3TCHA 2F34A 3FGSA 2DDKA 1TFAA 1B5HA 4KD5A 5I57A 4PBHA 3ODBA 3K2DA 2QL3A 5M2VA 4MHFA 3MAMA 2XA5A 2H9BA 4G68A 3VLVA 1QJMA 3OENA 3IAZA 4P47A 5TU0A 1M5BA 2DS9A 3ONMA 5EYHA 1IMAA 3K1PA 1N3XA 1LLSA 4IO4A 3SERA 1VR5A 4MFIA 1Y3QA 2VPNA 1MPBA 4R9GA 2Y84A 4NG7A 1ZTYA 1NV3A 1ANFA 1B5JA 5K2YA 1YCJA 3HSTA 2VD2A 1MQDA 4TLMB 1N76A 2ZNTA 5ICQA 4IR8A 1LBWA 4H65A 1NV5A 4DCXA 1MY1A 1NUZA 3V8XB 1B2HA 1DBZA 1JW1A 3B6TA 3OMBA 4U1ZA 2Y7PA 5L8DA 5I3SA 4PE5B 5K2XA 1PEBA 2L5VA 2RCBA 1NNTA 2FIXA 1USYH 4G8HA 4N15A 3C4MA 4JSOA 4GL8A 4NF8B 1FBCA 4GWXA 5I56B 2ZYNA 1SW5A 3K6UA 2ZNSA 1EZ9A 1JNFA 3RUMA 3HO7A 3C32A 3KZGA 2E0SA 2H5YA 3MP6A 5ITPA 3CFZA 1PC3A 4XFEA 4FBPA 3IJXB 4O3CA 1MQGA 2H99A 4BDOA 3MW0A 4BLAA 4OENA 1EYIA 4QFPA 4UACA 3PUVE 4PDDA 3KBZA 2I0CA 4NF6A 2H98A 2KQZA 4O3AA 4MBPA 4F19A 1FPGA 1FBDA 4MNCA 3RPWA 4H45A 3FXUA 2P2AA 4YMAA 3UA8A 4OVSA 1I6BA 1TT1A 1VFDA 2OCUA 4I1DA 2XXYA 3O6IA 3B6WA 3HFUA 1YXIA 2Z8EA 3H7MA 4XTCQ 4YB5A 4NF5A 3LBSA 2RINA 3FXQA 3N6UA 2E1SA 1ATGA 4IO6A 3RGYA 4NQ8A 3PV0E 2I49A 1MPCA 4H8JA 3CI8A 3SKPA 5KDTB 5EQ8A 3CHGA 3O9PA 1JP4A 4G4PA 3G3FA 4MF3A 4OHNA 3VV5A 1LBZA 1Y4TA 3GYYA 4L17A 5H8HB 1L5TA 4RK2A 2IEEA 1FPFA 2H4IA 4R6KA 4IO3A 4F1VA 3SEUA 3HV1A 3TZAA 5IM2A 2BJJX 1FBPA 2Y7RA 1LAXA 4R74A 2DE3A 5DVFA 3MBPA 3H6TA 4QXDA 4GF8A 1IMFA 1FBFA 4HE0A 1WDNA 4I40A 4FIMA 3LR1A 5DYHA 4G77A 1NV7A 1DPEA 1FCKA 2Y7WA 4PAIA 3FVOA 2D3IA 2W7YA 4QFNA 3MPLA 2V3TA 4Q0CA 3K00A 3SETA 3E13X 2QVUA 4LVQA 3MSTA 3OOAA 4OESA 2ABHA 3N26A 5H8NB 1KA0A 4U21A 5B70A 4GWOA 4UABA 2Y5LA 1AOVA 4YB6A 4LZ7A 2XWKA 4I3EA 3SESA 1PBPA 4E0WA 2QS2A 4GBWA 4OTEA 1CNQA 2F7AA 5AA4B 2PVUA 1MXUA 2PCRA 4R9FA 5AA2A 2Z8DA 4I62A 4PQJA 1B9JA 3O97A 4PGPA 3FV1A 4M4GA 2ZYMA 2ONSA 2V93A 1FQCA 1XOCA 3PUYE 5DEXB 2OWSA 1FJ9A 1FBGA 4MEVA 4RNSA 2YJPA 4ZE8A 2ONKE 2YPNA 4H8IA 4POWA 4EQBA 1FPDA 4F2OA 3V83A 1BKAA 2VT5A 3PUWE 1MY4A 3KC1A 4GQOA 3I3VA 3ZSFA 5A5XA 3UK4A 3FBPA 1FPIA 5ELVA 2PFYA 2QPQA 2O7UA 4PFYA 2OWTA 1FPBA 4OEVA 3U8QA 4O94A 4MNPA 2AL4A 2ZNUA 1IUDA 1NUXA 5KCJB 4G2ZA 4LP2B 1FRPA 3A3CA 4KXPA 5IZ1A 2F3BA 3K6VA 3KJ7A 3CFXA 5F1QA 4AB5A 2P1SA 4PBQA 3KEIA 4P56A 1RDYA 2DSFA 3Q26A 3QYTA 2QVRA 2PMSA 5IGAA 4GWUA 1EYJA 1B40A 4NF4B 5DTBA 5DW8A 4ELOA 1JW5A 3F11A 3Q27A 2BJIA 5J1DA 3VLWA 2NWJA 5IZ3A 3VVFA 2FBPA 2HFBA 3CIJA 4ONYA 4KCCA 1NNPA 2B3FA 3T1BA 1LAFE 4QF9A 4MLVA 2F7BA 2QMWA 1B52A 4JWYA 1SW2A 3OELA 1B3LA 3K0VA 4MLQA 1H43A 3GLBA 4I3YA 4HCYA 4F1YA 5DVIA 4GL0A 4H6DA 4UA8A 5BUUA 1URGA 4N6KA 1QKBA 4IGTA 2P3VA 4ZEDA 3N5LA 4AQ4A 1TXFA 3KC0A 1QGXA 2XHDA 4PGNA 5F24A 1IIWA 1SQYA 1QUIA 3TTKA 1M5FA 2I58A 2I48A 5JK4A 3OO7A 3Q25A 1LBXA 3RT8A 1IXHA 2XXUA 4LZ8A 4AS4A 1RDXA 4N91A 1MPDA 3RT6B 1KWHA 1MY2A 4KYSA 5EHSA 1GGGA 4QFLA 4GIZA 5CC2A 4N8GA 4IO5A 4NN3A 1FQAA 3K1MA 1DMBA 1B46A 1UIVA 4BDLA 5I59B 1O64A 4OVTA 4NWCA 2ZZWA 4U4SA 5T3JA 1M5EA 3ISPA 3NOHA 1P1QA 4GBVA 4NX1A 3PD8A 3MVXA 1AIVA 3DP4A 4NF0A 3H03A 3MZ9A 2WBBA 3LV0A 4IY5A 4P8BA 4I9DA 2GFEA 1SVXB 2XX8A 3MPKA 1BLFA 1MDQA 3H4ZA 1SBPA 1Y4CA 4DCYA 4N81A 3LSLA 2QMXA 4XKQA 4I8CA 5TPAA 2X26A 3M3KA 4RA1A 3EQ1A 4XEQA 5LOMA 2XXTA 2V25A 5I2KB 3GZGA 3QMFA 4XIGQ 3G7WA 4U22A 5I58B 2VGQA 3R6UA 3W15C 1UTBB 4P1EA 2QS3A 3TYHA 4PFIA 4F1UA 1PB7A 4NMYA 3IO6A 2I6EA 2XX7A 3IR1A 5ESYA 3V5AA 4U1OA 5EQAA 1G0IA 2F36A 4MCOA 2CZLA 2XWVA 3OO6A 3KFMA 3TAJA 2KR0A 5AA3A 5EYFA 2F6PA 3L6HA 1B3GA 5ET7A 4F39A 3K6XA 4NAPA 3JV9A 3RPLB 1LGBC 1QW0A 4C1UA 1SI0A 2RKMA 3DM0A 4RJZA 3GBBA 4OWDA 4RXLA 3EF7A 1YAEA 5I2NB 1INPA 1XVXA 2ESNA 3KN7A 1UIUA 1JQFA 3UP9A 3HHFA 3ILTB 4GFRA 4WKMA 4IB2A 1CE2A 1H45A 2F6GA 5FTIA 2QVVA 3WAEA 4PFTA 2DXRA 3KBRA 5ISUA 3MP1A 1N3WA 4X9TA 3LC8A 2G29A 2ALUA 3LSFB 2QS1A 3C33A 3RN8A 3TTRA 1IXIA 2CEYA 1YYZA 3FD3A 2O1MA 3QUJA 1B51A 4PP0A 2FA7A 1BIYA 2F8DA 3HCQA 5IKBA 3UIFA 4RK9A 4GWSA 5DT6A 3LUZA 5I57B 3QIMA 3TCGA 4WXJA 3RTFB 1JVXA 3CVGA 4G68B 4FJPA 1K9YA 1LAGE 4N17A 3PD9A 2CZHA 3E79A 1AH5A 2I3WA 2Q8JA 1A8FA 4MH5A 3I6VA 3ILUB 3RNNA 1FQEA 1SI1A 1Y1MA 3VE1B 2B65A 2DWHA 1NV4A 1FTOA 2RC9A 4F3SA 2V3QA 3T93B 2ZZVA 3RY3A 2XXXA 5KDTA 1MG1A 4Z7EA 1Y20A 3TODA 3DP8A 3SEYA 1UTHB 5H8HA 3GBAA 4O3BA 1O63A 4X04A 1B3HA 2Q74A 4HE2A 4E0XA 4JWXA 4R2BA 3IX1A 4TQUQ 4EF2A 1NV0A 4O8MA 3W9VA 3PPRA 1URDA 1R1NA 4XXUA 5H8SA 5FHMA 4U23A 3N6TA 3OSRA 4X48A 1FBHA 1PDAA 3N94A 1A99A 1S9TA 1P1OA 2AYSA 2QFLA 1QVSA 5ET8A 4N6DA 1LSTA 3K6WA 4PF8A 1H3DA 3IK6B 5H8FB 1KA1A 4ZZAA 5H8NA 4OERA 2DP8A 4P3LA 1JEUA 1A7LA 1USYE 3TTMA 3MVZA 2VD3A 4H0WA 3RLFE 2OBGA 4HXVA 3ZKLA 4OVPA 4HCWA 3DP6A 1LAHE 4OFOA 2CZIA 1MDP1 2HZLA 2ZMBA 5L9SA 5AA4A 1S50A 4DE8A 1Y3PA 2Q2AA 4GX3A 4JSDA 4AB6A 1DPPA 2GH9A 2UVJA 3IOVA 3B6QA 2V84A 4C0RA 2FVZA 2FNCA 4YU0A 3R7XA 1GV8A 3PTYA 1J1NA 2XD2A 1NH8A 2D5WA 3QAXA 3QXMA 5CI5A 1LBCA 4G68C 3B7DA 4PAKA 3UGWA 4GVOA 2GHAA 4G61A 1LFHA 2ONRA 3D4GA 4ZDMA 2A5TB 2VOZA 3TELA 1FPEA 3MYUA 2OJTA 4QSDA 1O7TA 4KYEA 1A54A 3ECRA 1I6QA 5DVJA 3FUZA 3TKDA 5J16A 4LUBA 4POXA 4QSEA 4N13A 3PPNA 5EQ7A 4JVIA 3EHUA 4ELRA 5KCJA 4FE8A 1AMFA 2VHAA 4LA9A 5CBSA 3B8BA 1YTVA 1DTGA 4PCDA 1B7ZA 4H5FA 1OLCA 3FVKA 4ZZEA 1RDZA 4GXSB 1IZ1A 3FASA 3S4UA 4NF4A 4ZS9A 5ET6A 2G93A 5LDZA 1NNFA 3FJGA 2R9JA 1OVBA 2B3BA 4KYDA 4OYVA 1B6HA 4XF5A 4H5GA 5AA2B 4TLLB 3VXCA 3IOWA 4MIJA 1G0HA 3MZBA 4QFKA 1EH3A 1N7WA 3ROJA 3KG2A 3Q29A 1IMEA 4NGUA 4PFBA 1MQHA 4R75A 4GX6A 2XXKA 2YLNA 3C9HA 5KZTA 4Q30B 4NTLA 3GXAA 2Q88A 4QHQA 4YICA 2REJA 4PAFA 1HSJA 1Z7NE 3FVGA 1HSEA 3FVNA 4PETA 5CMMA 3FXRA 3U92A 2Q9TA 2ZXTA 1I69A 3C31A 3C35A 1HSLA 2RC7A 2ZYKA 1NMUA 2I4CA 1ELJA 4BDQA 3KSJA 3TTNA 4KPTA 5IZZA 1N04A 3K1NA 1NKXA 4XKNA 4RY1A 5H8QA 1FW0A 3MJNA 3T96B 3T9UA 2O68A 2AIXA 1Y9UA 3ZS6A 4HW8A 2X7PA 5I59A 2HAUA 4GLIA 2B4LA 5JTYA 2UVIA 4P0IA 4F3PA 5TP9A 3G3JA 4GXAA 4F31B 3KOTA 4OQOA 4JWOA 3T22A 4OVJA 1FTKA 2GQ1A 4MMPA 1DTZA 3TUSA 2AL5A 2R71A 2XXVA 4PFUA 2REGA 3SEWA 3BIGA 1FQFA 3G3IA 5I2KA 1S7YA 2I0BA 4JB7A 3SDFA 3M8UA 3RYDA 4IY6A 1IQ7A 3FJ7A 2PBWA 2M8CA 1MS7A 1N0TA 4R2FA 3IB2A 4DI4B 1QULA 4GRKA 4F18A 2Q89A 2FHYA 2DYXA 3OEKA 1FSAA 4GWWA 4YAHX 1P1UA 1SYIA 4JBZA 3OO8A 4YKJA 3H6WA 2CZKA 1PBQA 2HQ0A 4H67A 1EZPA 1FTAA 4OANA 1SD3A 5ICTA 2QJEA 1Y3NA 1M5DA 3CFLA 4ZECA 1SW1A 4IO2A 4OETA 3E4RA 1NNKA 4H46A 4JVDA 3MVYA 4GWYA 4KCDA 3G3HA 3TEPA 3VVDA 4F3GA 3LSWA 4JVCA 5I2NA 3AXFA 5I7IA 1R9LA 3PPPA 3O29A 1B0LA 4F29A 3V89B 1N7XA 1SPIA 1AWBA 2NXOA 4X1BA 2WBDA 1OVTA 1K9ZA 1MM7A 3KGCA 3USDA 1ZMGA 3Q28A 4F2QA 2DOJA 1MM6A 4HE1A 5FBPA 1AL3A 1IMDA 1DCUA 4ND9A 2HZKA 4ZEFA 4HTGA 4GOTA 3A3UA 1B3EA 3OEMA 3T9VA 4PE3A 1FPJA 2Z8FA 3IJOB 2A5SA 2V3UA 5TPAB 4OA4A 4F3BA 1DOTA 1NUWA 3D1RA 1FTLA 4ZE9A 1H44A 1B5IA 1A40A 5CMKA 1LFIA 3S9NC 1IITA 3TPAA 4BDNA 2RF1A 2DVZA 1JEVA 4EF1A 2F5XA 2Z22A 5AA1A 3H3GA 1MXYA 4P1LA 3BIHA 2OX3A 4NF8A 2WYPA 3CG1A 2P3NA 4QRZA 4FEDA 5I56A 2JJKA 1LFGA 1NFTA 3IOUA 1NL5A 3IO4A 4LATA 2VPOA 4MX6A 3T66A 3QUFA 1US5A 3QK6A 4OEUA 1P1WA 3CG3A 2OLBA 2XWOA 3I5OA 4OZ9A 1MY3A 5I5PA 1TFDA 4PC9A 3IB0A 1GVCA 3IFAA 2HPGA 1Q35A 3EPEA 5JEIA 1RYOA 3A29A 4ESXA 1MRPA 1UTHA 3VXBA 2XXPA 2UYFA 1MH4A 4JDFA 5I84A 3E3KA 4DXBA 1NI9A 4KQPA 1RYXA 5FHOA 4FORA 1A8EA 1MH3A 3OSQA 5LTCA 3IL1B 1LEVA 1D4NA 5CMBA 2DE4A 4IGRA 2QS4A 4U4XA 3HN0A 3PMXA 4QFOA 3O6HA 4G8NA 3VFJA
chains in the Genus database with same CATH topology
5CMCA 4R72A 4EDPA 5ITOA 2VP1A 3S9LC 1B58A 3VLUA 2DVCA 1BTJA 2XX9A 4C1TA 1MXZA 1Z7ME 4PFWA 1B32A 3R26A 4YMBA 1XVYA 5H8FA 3S2VA 3OD7A 2DWIA 3G3GA 4QSCA 2NUVA 2O1LA 1EU8A 4TOZA 4U2RA 1VSOA 1PB8A 3LUYA 4EQ7A 4Q8RA 2UYEA 3M3LA 3KN3A 1N84A 3FV2A 3TTLA 3THIA 3OO9A 5AA2D 3K01A 1ZLQA 1MXVA 4KI0E 3S9MC 3TCFA 5IAIA 1QUJA 3W9WA 4OXVA 3MVWA 1URSA 4RPOA 1MQJA 2OZZA 2F78A 3TQLA 4RYAA 4Q5TA 3KN8A 4NF6B 1XT8A 4R73A 3JYRA 3O6GA 1NH7A 4R6HA 3VVEA 2F97A 3EN3A 2A5TA 3JZJA 1JW4A 5FHNA 1SDXA 3H6UA 4EUOA 4K3FA 3MUQA 2NVUB 3PU5A 1B4ZA 1IEJA 4NF5B 2XXQA 2GRVA 4FAJA 4ZEKA 2DE2A 3U1OA 4FEBA 3VDFA 2XXWA 2XXHA 4JXIA 1ZBMA 1VE4A 1OMPA 2D21A 2Y7IA 2Q2CA 3MZ1A 4DIGA 4F22A 1B7HA 4KR5A 5DEXA 4XKRA 4LZ5A 1OQGA 2HCAA 4YB7A 3PPOA 5AE4A 3IORA 1GTKA 5L9OA 1DSNA 1MXXA 4IO7A 1EZOA 2H25A 4DLDA 3DLNA 3RQTA 1QKAA 1Y1ZA 1ZJLA 4ZEBA 3TDJA 2UVHA 1WVJA 2DWJA 2O69A 3H06B 1B05A 1H76A 2PT1A 4Z0IA 4GD5A 2Z23A 3M3FA 1POTA 4BDMA 2X7QA 4R6YA 4ELQA 2ANJA 5CRYA 5HPQA 4M1VA 3A09A 1OLAA 1IXCA 3S9EA 2NOOA 4OFLA 2FYIA 3MWBA 4NEDA 1POY1 2PT2A 2XD3A 3BBRA 3FATA 3T9XB 1VFEA 4G8MA 5HBCA 4LQ5A 4H1XA 3L6GA 2I3VA 2P0SA 1B4HA 4KHZE 3TQWA 1D9VA 3ZKKA 3SEVA 1LB9A 3U72A 1ZU0A 1T0KA 4WEDA 1R6ZA 4N07A 1D9YA 3DELB 1II5A 4DZ1A 4P11A 2GHBA 3PMWA 2OK2A 3CSBA 3UN6A 2LAOA 3WAFA 2RC8A 3TMGA 2F35A 3PGFA 1MY0A 3OXNA 1OQHA 3FJMA 3LSXA 3BFUA 3BFTA 4DXUA 2IA4A 1ZKBA 4X1DA 4WEPA 5CBRA 1US4A 4NE4A 2HAVA 5A5XB 2O84X 3P7IA 1I6AA 3EHTA 4NWDA 3U94A 5HM4B 1FTMA 2QSXA 3H6VA 4P0GA 1M5CA 4ZEIA 4YKPA 1MXWA 4DXCA 1B3FA 4BDRA 1LCFA 5L9MA 3HHGA 1RKMA 3SEXA 1D3KA 3C34A 2R6GE 1B1HA 1P1NA 1F9BA 2ZYOA 3T9HB 4LONB 1JETA 1B7UA 2PYYA 3BKIB 1ZIUA 4DDDA 2UXAA 3G3KA 1R9QA 4LQ2A 1LCTA 2WKYA 5BWJA 4RPNA 3O2AA 2QRYA 3TFLA 3CR9A 5H8QB 3FZVA 1OIBA 3UORA 3CSGA 3K02A 5I58A 4EXLA 2UVGA 5F7VA 1UTBA 2PX1A 2I4BA 1Q1KA 4YZZA 3PMVA 3O28A 3HPIA 2DWAA 1SYHA 4YKIA 3PPQA 2XXRA 3EHSA 1LB8A 5JTYB 1QUKA 4FECA 4FATA 4XKPA 1JVYA 3O66A 1P99A 1XS5A 5TP9B 3PUZE 2THIA 4ELPA 5CM6A 1YPNA 2O7IA 1B1XA 1FTJA 2XXIA 3MC2A 4EXKA 2CMOA 4ECFA 4N6PA 4YKKA 1WODA 2HXWA 1CB6A 1SW4A 3PUXE 1BP5A 1FQBA 1XHYA 5B7DA 2DXYA 4THIA 5FTHA 1A55A 3KOSA 2HEUA 2O51A 1LBBA 1B0HA 2RCAA 3E9XA 2KLFA 3D4CA 2Y7KA 1FQDA 3IOTA 4ISUA 2F7CA 3FIRA 1MQIA 2O6AA 3KSXA 1PB9A 3CRBA 4KFQA 3RTWB 4HS7A 2DQVA 3KJTA 1IXGA 4OMBA 5EHMA 3K4UA 4EQ9A 3IB1A 3MP8A 1UQWA 1XC1A 3U93A 1GR2A 3QSLA 3MQ9A 3C36A 4OFJA 1TWYA 4ESWA 3TCHA 2F34A 3FGSA 1TFAA 1B5HA 4KD5A 5I57A 3ODBA 3K2DA 2QL3A 5M2VA 3MAMA 2H9BA 4G68A 3VLVA 1QJMA 3OENA 3IAZA 5TU0A 1M5BA 2DS9A 3ONMA 3K1PA 1N3XA 1LLSA 4IO4A 3SERA 1VR5A 4MFIA 1Y3QA 4R9GA 1MPBA 2Y84A 1ZTYA 1ANFA 1B5JA 5K2YA 1YCJA 3HSTA 2VD2A 1MQDA 4TLMB 1N76A 2ZNTA 5ICQA 4H65A 4DCXA 1MY1A 3V8XB 1B2HA 1JW1A 3B6TA 3OMBA 4U1ZA 2Y7PA 5L8DA 4PE5B 5K2XA 1PEBA 2RCBA 1NNTA 1USYH 4G8HA 3C4MA 4JSOA 4GL8A 4NF8B 5I56B 2ZYNA 1SW5A 3K6UA 2ZNSA 1EZ9A 1JNFA 3RUMA 3HO7A 3C32A 3KZGA 2E0SA 2H5YA 3MP6A 5ITPA 3CFZA 1PC3A 4O3CA 3IJXB 1MQGA 2H99A 4BDOA 3MW0A 4BLAA 4OENA 4QFPA 4UACA 3PUVE 2I0CA 4NF6A 2H98A 4O3AA 4MBPA 4F19A 3RPWA 3FXUA 2P2AA 4YMAA 3UA8A 1I6BA 1TT1A 1VFDA 2OCUA 4I1DA 2XXYA 3O6IA 3B6WA 2Z8EA 3H7MA 4XTCQ 4YB5A 4NF5A 3LBSA 2RINA 3FXQA 3N6UA 2E1SA 1ATGA 4IO6A 3RGYA 3PV0E 2I49A 1MPCA 4H8JA 3CI8A 3SKPA 5KDTB 3O9PA 4G4PA 3G3FA 4MF3A 4OHNA 3VV5A 1Y4TA 4L17A 1L5TA 5H8HB 4RK2A 2IEEA 2H4IA 4R6KA 4IO3A 4F1VA 3SEUA 3HV1A 3TZAA 2BJJX 2Y7RA 1LAXA 4R74A 2DE3A 5DVFA 3MBPA 3H6TA 4GF8A 1WDNA 4FIMA 3LR1A 5DYHA 4G77A 1DPEA 1FCKA 2Y7WA 3FVOA 2D3IA 2W7YA 4QFNA 3MPLA 2V3TA 4Q0CA 3K00A 3SETA 3E13X 4LVQA 3OOAA 4OESA 2ABHA 3N26A 5H8NB 4U21A 5B70A 4GWOA 1AOVA 4YB6A 4LZ7A 3SESA 1PBPA 4E0WA 2QS2A 4OTEA 2F7AA 5AA4B 2PVUA 1MXUA 4R9FA 5AA2A 2Z8DA 4I62A 4PQJA 1B9JA 3O97A 3FV1A 4M4GA 2ZYMA 2ONSA 2V93A 1FQCA 1XOCA 3PUYE 5DEXB 2OWSA 4RNSA 2YJPA 4ZE8A 2ONKE 2YPNA 4H8IA 4POWA 4EQBA 4F2OA 3V83A 1BKAA 3PUWE 1MY4A 4GQOA 3I3VA 3ZSFA 5A5XA 3UK4A 5ELVA 2QPQA 2O7UA 4PFYA 2OWTA 4OEVA 3U8QA 2AL4A 2ZNUA 1IUDA 5KCJB 4G2ZA 4LP2B 3A3CA 3K6VA 3KJ7A 3CFXA 5F1QA 4AB5A 2P1SA 3KEIA 2DSFA 3Q26A 3QYTA 2PMSA 1B40A 4NF4B 5DTBA 4ELOA 1JW5A 3F11A 3Q27A 5J1DA 3VLWA 2NWJA 3VVFA 3CIJA 2HFBA 4ONYA 4KCCA 1NNPA 2B3FA 1LAFE 4QF9A 4MLVA 2F7BA 2QMWA 1B52A 4JWYA 1SW2A 3OELA 1B3LA 3K0VA 4MLQA 1H43A 3GLBA 4HCYA 4F1YA 5DVIA 4GL0A 4H6DA 4UA8A 5BUUA 1URGA 1QKBA 4IGTA 4ZEDA 3N5LA 4AQ4A 1TXFA 2XHDA 1IIWA 1SQYA 1QUIA 3TTKA 1M5FA 2I58A 2I48A 5JK4A 3OO7A 3Q25A 3RT8A 1IXHA 2XXUA 4LZ8A 1MPDA 3RT6B 1KWHA 1MY2A 4KYSA 5EHSA 1GGGA 4QFLA 4GIZA 5CC2A 4IO5A 1FQAA 3K1MA 1DMBA 1B46A 1UIVA 4BDLA 5I59B 1O64A 4NWCA 4U4SA 1M5EA 1P1QA 3PD8A 3MVXA 1AIVA 3DP4A 3H03A 3MZ9A 4IY5A 4I9DA 2GFEA 1SVXB 2XX8A 3MPKA 1BLFA 1MDQA 3H4ZA 1SBPA 1Y4CA 4DCYA 3LSLA 2QMXA 4XKQA 4I8CA 5TPAA 2X26A 3M3KA 4RA1A 3EQ1A 5LOMA 2XXTA 2V25A 5I2KB 3GZGA 4XIGQ 3G7WA 4U22A 5I58B 2VGQA 3R6UA 3W15C 1UTBB 2QS3A 3TYHA 4F1UA 1PB7A 4NMYA 3IO6A 2I6EA 2XX7A 3IR1A 3V5AA 4U1OA 2F36A 2CZLA 3OO6A 3KFMA 3TAJA 5AA3A 5EYFA 2F6PA 3L6HA 1B3GA 4F39A 3K6XA 3JV9A 1LGBC 1QW0A 4C1UA 1SI0A 2RKMA 3DM0A 4RJZA 3GBBA 4OWDA 4RXLA 3EF7A 1YAEA 5I2NB 1XVXA 2ESNA 3KN7A 1UIUA 1JQFA 3UP9A 3HHFA 3ILTB 4GFRA 4WKMA 4IB2A 1CE2A 1H45A 2F6GA 5FTIA 3WAEA 4PFTA 2DXRA 3KBRA 5ISUA 3MP1A 1N3WA 4X9TA 3LC8A 2G29A 2ALUA 3LSFB 2QS1A 3C33A 3RN8A 3TTRA 1IXIA 3FD3A 2O1MA 3QUJA 1B51A 4PP0A 2FA7A 1BIYA 2F8DA 3HCQA 5IKBA 3UIFA 4RK9A 5DT6A 5I57B 3QIMA 3TCGA 4WXJA 3RTFB 1JVXA 3CVGA 4G68B 4FJPA 1LAGE 3PD9A 1AH5A 2I3WA 2Q8JA 1A8FA 4MH5A 3I6VA 3ILUB 3RNNA 1FQEA 1SI1A 1Y1MA 3VE1B 2B65A 2DWHA 1FTOA 2RC9A 4F3SA 2V3QA 3T93B 3RY3A 2XXXA 5KDTA 1MG1A 4Z7EA 1Y20A 3TODA 3DP8A 3SEYA 1UTHB 5H8HA 3GBAA 4O3BA 1O63A 1B3HA 4E0XA 4JWXA 4R2BA 3IX1A 4TQUQ 4EF2A 3W9VA 3PPRA 1URDA 1R1NA 4XXUA 5H8SA 5FHMA 4U23A 3N6TA 3OSRA 4X48A 1PDAA 3N94A 1A99A 1S9TA 1P1OA 2AYSA 1QVSA 1LSTA 3K6WA 1H3DA 3IK6B 5H8FB 4ZZAA 5H8NA 4OERA 2DP8A 3TTMA 1JEUA 1A7LA 1USYE 3MVZA 2VD3A 4H0WA 3RLFE 2OBGA 3ZKLA 4HCWA 3DP6A 1LAHE 4OFOA 1MDP1 2HZLA 2ZMBA 5L9SA 5AA4A 1S50A 4DE8A 1Y3PA 2Q2AA 4JSDA 4AB6A 1DPPA 2GH9A 2UVJA 3IOVA 3B6QA 2V84A 4C0RA 2FNCA 4YU0A 3R7XA 1GV8A 1J1NA 2XD2A 1NH8A 2D5WA 3QAXA 3QXMA 5CI5A 1LBCA 4G68C 3B7DA 3UGWA 4GVOA 2GHAA 1LFHA 2ONRA 3D4GA 4ZDMA 2A5TB 2VOZA 3TELA 2OJTA 4QSDA 1O7TA 4KYEA 1A54A 3ECRA 1I6QA 5DVJA 3FUZA 3TKDA 4LUBA 4POXA 4QSEA 4N13A 3PPNA 3EHUA 4ELRA 5KCJA 4FE8A 1AMFA 2VHAA 4LA9A 5CBSA 1YTVA 1DTGA 1B7ZA 4H5FA 1OLCA 3FVKA 4ZZEA 4GXSB 1IZ1A 3FASA 3S4UA 4NF4A 4ZS9A 2G93A 1NNFA 3FJGA 2R9JA 1OVBA 2B3BA 4KYDA 4OYVA 1B6HA 4H5GA 5AA2B 4TLLB 3VXCA 3IOWA 3MZBA 4QFKA 1EH3A 1N7WA 3KG2A 3Q29A 1MQHA 4R75A 2YLNA 3C9HA 5KZTA 4NTLA 4Q30B 3GXAA 2Q88A 4QHQA 4YICA 2REJA 1HSJA 1Z7NE 3FVGA 1HSEA 3FVNA 4PETA 5CMMA 3FXRA 3U92A 2Q9TA 2ZXTA 1I69A 3C31A 3C35A 1HSLA 2RC7A 2ZYKA 1NMUA 2I4CA 1ELJA 4BDQA 3KSJA 3TTNA 4KPTA 1N04A 3K1NA 1NKXA 4XKNA 4RY1A 5H8QA 1FW0A 3MJNA 3T96B 3T9UA 2O68A 2AIXA 1Y9UA 3ZS6A 4HW8A 2X7PA 5I59A 2HAUA 4GLIA 5JTYA 2UVIA 4P0IA 4F3PA 5TP9A 3G3JA 4GXAA 4F31B 3KOTA 4OQOA 4JWOA 3T22A 4OVJA 1FTKA 1DTZA 3TUSA 2AL5A 2R71A 2XXVA 4PFUA 2REGA 3SEWA 1FQFA 3G3IA 5I2KA 1S7YA 2I0BA 4JB7A 3SDFA 3M8UA 4IY6A 1IQ7A 3FJ7A 2PBWA 2M8CA 1MS7A 1N0TA 4R2FA 3IB2A 1QULA 4GRKA 4F18A 2Q89A 2DYXA 3OEKA 4YAHX 1P1UA 1SYIA 4JBZA 3OO8A 4YKJA 3H6WA 1PBQA 2HQ0A 4H67A 1EZPA 1SD3A 5ICTA 2QJEA 1Y3NA 1M5DA 3CFLA 4ZECA 1SW1A 4IO2A 4OETA 3E4RA 1NNKA 3MVYA 4KCDA 3G3HA 3TEPA 3VVDA 4F3GA 3LSWA 5I2NA 3AXFA 1R9LA 3PPPA 3O29A 1B0LA 4F29A 3V89B 1N7XA 2NXOA 4X1BA 1OVTA 1MM7A 3KGCA 3USDA 1ZMGA 3Q28A 4F2QA 2DOJA 1MM6A 1AL3A 4ND9A 2HZKA 4ZEFA 4HTGA 4GOTA 3A3UA 1B3EA 3OEMA 3T9VA 2Z8FA 3IJOB 2A5SA 4F3BA 5TPAB 2V3UA 1DOTA 1FTLA 4ZE9A 1H44A 1B5IA 1A40A 5CMKA 1LFIA 3S9NC 1IITA 3TPAA 4BDNA 2RF1A 2DVZA 1JEVA 4EF1A 2F5XA 2Z22A 5AA1A 3H3GA 1MXYA 4NF8A 3CG1A 4QRZA 4FEDA 5I56A 1LFGA 1NFTA 3IOUA 1NL5A 3IO4A 4LATA 3T66A 3QUFA 1US5A 3QK6A 1P1WA 3CG3A 4OEUA 2OLBA 3I5OA 4OZ9A 1MY3A 1TFDA 3IB0A 1GVCA 1Q35A 3EPEA 5JEIA 1RYOA 4ESXA 1MRPA 1UTHA 3VXBA 2XXPA 2UYFA 1MH4A 4JDFA 5I84A 3E3KA 4DXBA 4KQPA 1RYXA 5FHOA 4FORA 1A8EA 1MH3A 3OSQA 3IL1B 1D4NA 5CMBA 2DE4A 4IGRA 2QS4A 4U4XA 3HN0A 3PMXA 4QFOA 3O6HA 4G8NA 3VFJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMC A;  4R72 A;  4EDP A;  5ITO A;  2VP1 A;  3S9L C;  1B58 A;  3VLU A;  2DVC A;  1BTJ A;  2XX9 A;  4C1T A;  1MXZ A;  1Z7M E;  4PFW A;  1B32 A;  3R26 A;  4YMB A;  1XVY A;  5H8F A;  3S2V A;  3OD7 A;  2DWI A;  3G3G A;  4QSC A;  2NUV A;  2O1L A;  1EU8 A;  4TOZ A;  4U2R A;  1VSO A;  1PB8 A;  3LUY A;  4EQ7 A;  4Q8R A;  2UYE A;  3M3L A;  3KN3 A;  1N84 A;  3FV2 A;  3TTL A;  3THI A;  3OO9 A;  5AA2 D;  3K01 A;  1ZLQ A;  1MXV A;  4KI0 E;  3S9M C;  3TCF A;  5IAI A;  1QUJ A;  3W9W A;  4OXV A;  3MVW A;  1URS A;  4RPO A;  1MQJ A;  2OZZ A;  2F78 A;  3TQL A;  4RYA A;  4Q5T A;  3KN8 A;  4NF6 B;  1XT8 A;  4R73 A;  3JYR A;  3O6G A;  1NH7 A;  4R6H A;  3VVE A;  2F97 A;  3EN3 A;  2A5T A;  3JZJ A;  1JW4 A;  5FHN A;  1SDX A;  3H6U A;  4EUO A;  4K3F A;  3MUQ A;  2NVU B;  3PU5 A;  1B4Z A;  1IEJ A;  4NF5 B;  2XXQ A;  2GRV A;  4FAJ A;  4ZEK A;  2DE2 A;  3U1O A;  4FEB A;  3VDF A;  2XXW A;  2XXH A;  4JXI A;  1ZBM A;  1VE4 A;  1OMP A;  2D21 A;  2Y7I A;  2Q2C A;  3MZ1 A;  4DIG A;  4F22 A;  1B7H A;  4KR5 A;  5DEX A;  4XKR A;  4LZ5 A;  1OQG A;  2HCA A;  4YB7 A;  3PPO A;  5AE4 A;  3IOR A;  1GTK A;  5L9O A;  1DSN A;  1MXX A;  4IO7 A;  1EZO A;  2H25 A;  4DLD A;  3DLN A;  3RQT A;  1QKA A;  1Y1Z A;  1ZJL A;  4ZEB A;  3TDJ A;  2UVH A;  1WVJ A;  2DWJ A;  2O69 A;  3H06 B;  1B05 A;  1H76 A;  2PT1 A;  4Z0I A;  4GD5 A;  2Z23 A;  3M3F A;  1POT A;  4BDM A;  2X7Q A;  4R6Y A;  4ELQ A;  2ANJ A;  5CRY A;  5HPQ A;  4M1V A;  3A09 A;  1OLA A;  1IXC A;  3S9E A;  2NOO A;  4OFL A;  2FYI A;  3MWB A;  4NED A;  1POY 1;  2PT2 A;  2XD3 A;  3BBR A;  3FAT A;  3T9X B;  1VFE A;  4G8M A;  5HBC A;  4LQ5 A;  4H1X A;  3L6G A;  2I3V A;  2P0S A;  1B4H A;  4KHZ E;  3TQW A;  1D9V A;  3ZKK A;  3SEV A;  1LB9 A;  3U72 A;  1ZU0 A;  1T0K A;  4WED A;  1R6Z A;  4N07 A;  1D9Y A;  3DEL B;  1II5 A;  4DZ1 A;  4P11 A;  2GHB A;  3PMW A;  2OK2 A;  3CSB A;  3UN6 A;  2LAO A;  3WAF A;  2RC8 A;  3TMG A;  2F35 A;  3PGF A;  1MY0 A;  3OXN A;  1OQH A;  3FJM A;  3LSX A;  3BFU A;  3BFT A;  4DXU A;  2IA4 A;  1ZKB A;  4X1D A;  4WEP A;  5CBR A;  1US4 A;  4NE4 A;  2HAV A;  5A5X B;  2O84 X;  3P7I A;  1I6A A;  3EHT A;  4NWD A;  3U94 A;  5HM4 B;  1FTM A;  2QSX A;  3H6V A;  4P0G A;  1M5C A;  4ZEI A;  4YKP A;  1MXW A;  4DXC A;  1B3F A;  4BDR A;  1LCF A;  5L9M A;  3HHG A;  1RKM A;  3SEX A;  1D3K A;  3C34 A;  2R6G E;  1B1H A;  1P1N A;  1F9B A;  2ZYO A;  3T9H B;  4LON B;  1JET A;  1B7U A;  2PYY A;  3BKI B;  1ZIU A;  4DDD A;  2UXA A;  3G3K A;  1R9Q A;  4LQ2 A;  1LCT A;  2WKY A;  5BWJ A;  4RPN A;  3O2A A;  2QRY A;  3TFL A;  3CR9 A;  5H8Q B;  3FZV A;  1OIB A;  3UOR A;  3CSG A;  3K02 A;  5I58 A;  4EXL A;  2UVG A;  5F7V A;  1UTB A;  2PX1 A;  2I4B A;  1Q1K A;  4YZZ A;  3PMV A;  3O28 A;  3HPI A;  2DWA A;  1SYH A;  4YKI A;  3PPQ A;  2XXR A;  3EHS A;  1LB8 A;  5JTY B;  1QUK A;  4FEC A;  4FAT A;  4XKP A;  1JVY A;  3O66 A;  1P99 A;  1XS5 A;  5TP9 B;  3PUZ E;  2THI A;  4ELP A;  5CM6 A;  1YPN A;  2O7I A;  1B1X A;  1FTJ A;  2XXI A;  3MC2 A;  4EXK A;  2CMO A;  4ECF A;  4N6P A;  4YKK A;  1WOD A;  2HXW A;  1CB6 A;  1SW4 A;  3PUX E;  1BP5 A;  1FQB A;  1XHY A;  5B7D A;  2DXY A;  4THI A;  5FTH A;  1A55 A;  3KOS A;  2HEU A;  2O51 A;  1LBB A;  1B0H A;  2RCA A;  3E9X A;  2KLF A;  3D4C A;  2Y7K A;  1FQD A;  3IOT A;  4ISU A;  2F7C A;  3FIR A;  1MQI A;  2O6A A;  3KSX A;  1PB9 A;  3CRB A;  4KFQ A;  3RTW B;  4HS7 A;  2DQV A;  3KJT A;  1IXG A;  4OMB A;  5EHM A;  3K4U A;  4EQ9 A;  3IB1 A;  3MP8 A;  1UQW A;  1XC1 A;  3U93 A;  1GR2 A;  3QSL A;  3MQ9 A;  3C36 A;  4OFJ A;  1TWY A;  4ESW A;  3TCH A;  2F34 A;  3FGS A;  1TFA A;  1B5H A;  4KD5 A;  5I57 A;  3ODB A;  3K2D A;  2QL3 A;  5M2V A;  3MAM A;  2H9B A;  4G68 A;  3VLV A;  1QJM A;  3OEN A;  3IAZ A;  5TU0 A;  1M5B A;  2DS9 A;  3ONM A;  3K1P A;  1N3X A;  1LLS A;  4IO4 A;  3SER A;  1VR5 A;  4MFI A;  1Y3Q A;  4R9G A;  1MPB A;  2Y84 A;  1ZTY A;  1ANF A;  1B5J A;  5K2Y A;  1YCJ A;  3HST A;  2VD2 A;  1MQD A;  4TLM B;  1N76 A;  2ZNT A;  5ICQ A;  4H65 A;  4DCX A;  1MY1 A;  3V8X B;  1B2H A;  1JW1 A;  3B6T A;  3OMB A;  4U1Z A;  2Y7P A;  5L8D A;  4PE5 B;  5K2X A;  1PEB A;  2RCB A;  1NNT A;  1USY H;  4G8H A;  3C4M A;  4JSO A;  4GL8 A;  4NF8 B;  5I56 B;  2ZYN A;  1SW5 A;  3K6U A;  2ZNS A;  1EZ9 A;  1JNF A;  3RUM A;  3HO7 A;  3C32 A;  3KZG A;  2E0S A;  2H5Y A;  3MP6 A;  5ITP A;  3CFZ A;  1PC3 A;  4O3C A;  3IJX B;  1MQG A;  2H99 A;  4BDO A;  3MW0 A;  4BLA A;  4OEN A;  4QFP A;  4UAC A;  3PUV E;  2I0C A;  4NF6 A;  2H98 A;  4O3A A;  4MBP A;  4F19 A;  3RPW A;  3FXU A;  2P2A A;  4YMA A;  3UA8 A;  1I6B A;  1TT1 A;  1VFD A;  2OCU A;  4I1D A;  2XXY A;  3O6I A;  3B6W A;  2Z8E A;  3H7M A;  4XTC Q;  4YB5 A;  4NF5 A;  3LBS A;  2RIN A;  3FXQ A;  3N6U A;  2E1S A;  1ATG A;  4IO6 A;  3RGY A;  3PV0 E;  2I49 A;  1MPC A;  4H8J A;  3CI8 A;  3SKP A;  5KDT B;  3O9P A;  4G4P A;  3G3F A;  4MF3 A;  4OHN A;  3VV5 A;  1Y4T A;  4L17 A;  1L5T A;  5H8H B;  4RK2 A;  2IEE A;  2H4I A;  4R6K A;  4IO3 A;  4F1V A;  3SEU A;  3HV1 A;  3TZA A;  2BJJ X;  2Y7R A;  1LAX A;  4R74 A;  2DE3 A;  5DVF A;  3MBP A;  3H6T A;  4GF8 A;  1WDN A;  4FIM A;  3LR1 A;  5DYH A;  4G77 A;  1DPE A;  1FCK A;  2Y7W A;  3FVO A;  2D3I A;  2W7Y A;  4QFN A;  3MPL A;  2V3T A;  4Q0C A;  3K00 A;  3SET A;  3E13 X;  4LVQ A;  3OOA A;  4OES A;  2ABH A;  3N26 A;  5H8N B;  4U21 A;  5B70 A;  4GWO A;  1AOV A;  4YB6 A;  4LZ7 A;  3SES A;  1PBP A;  4E0W A;  2QS2 A;  4OTE A;  2F7A A;  5AA4 B;  2PVU A;  1MXU A;  4R9F A;  5AA2 A;  2Z8D A;  4I62 A;  4PQJ A;  1B9J A;  3O97 A;  3FV1 A;  4M4G A;  2ZYM A;  2ONS A;  2V93 A;  1FQC A;  1XOC A;  3PUY E;  5DEX B;  2OWS A;  4RNS A;  2YJP A;  4ZE8 A;  2ONK E;  2YPN A;  4H8I A;  4POW A;  4EQB A;  4F2O A;  3V83 A;  1BKA A;  3PUW E;  1MY4 A;  4GQO A;  3I3V A;  3ZSF A;  5A5X A;  3UK4 A;  5ELV A;  2QPQ A;  2O7U A;  4PFY A;  2OWT A;  4OEV A;  3U8Q A;  2AL4 A;  2ZNU A;  1IUD A;  5KCJ B;  4G2Z A;  4LP2 B;  3A3C A;  3K6V A;  3KJ7 A;  3CFX A;  5F1Q A;  4AB5 A;  2P1S A;  3KEI A;  2DSF A;  3Q26 A;  3QYT A;  2PMS A;  1B40 A;  4NF4 B;  5DTB A;  4ELO A;  1JW5 A;  3F11 A;  3Q27 A;  5J1D A;  3VLW A;  2NWJ A;  3VVF A;  3CIJ A;  2HFB A;  4ONY A;  4KCC A;  1NNP A;  2B3F A;  1LAF E;  4QF9 A;  4MLV A;  2F7B A;  2QMW A;  1B52 A;  4JWY A;  1SW2 A;  3OEL A;  1B3L A;  3K0V A;  4MLQ A;  1H43 A;  3GLB A;  4HCY A;  4F1Y A;  5DVI A;  4GL0 A;  4H6D A;  4UA8 A;  5BUU A;  1URG A;  1QKB A;  4IGT A;  4ZED A;  3N5L A;  4AQ4 A;  1TXF A;  2XHD A;  1IIW A;  1SQY A;  1QUI A;  3TTK A;  1M5F A;  2I58 A;  2I48 A;  5JK4 A;  3OO7 A;  3Q25 A;  3RT8 A;  1IXH A;  2XXU A;  4LZ8 A;  1MPD A;  3RT6 B;  1KWH A;  1MY2 A;  4KYS A;  5EHS A;  1GGG A;  4QFL A;  4GIZ A;  5CC2 A;  4IO5 A;  1FQA A;  3K1M A;  1DMB A;  1B46 A;  1UIV A;  4BDL A;  5I59 B;  1O64 A;  4NWC A;  4U4S A;  1M5E A;  1P1Q A;  3PD8 A;  3MVX A;  1AIV A;  3DP4 A;  3H03 A;  3MZ9 A;  4IY5 A;  4I9D A;  2GFE A;  1SVX B;  2XX8 A;  3MPK A;  1BLF A;  1MDQ A;  3H4Z A;  1SBP A;  1Y4C A;  4DCY A;  3LSL A;  2QMX A;  4XKQ A;  4I8C A;  5TPA A;  2X26 A;  3M3K A;  4RA1 A;  3EQ1 A;  5LOM A;  2XXT A;  2V25 A;  5I2K B;  3GZG A;  4XIG Q;  3G7W A;  4U22 A;  5I58 B;  2VGQ A;  3R6U A;  3W15 C;  1UTB B;  2QS3 A;  3TYH A;  4F1U A;  1PB7 A;  4NMY A;  3IO6 A;  2I6E A;  2XX7 A;  3IR1 A;  3V5A A;  4U1O A;  2F36 A;  2CZL A;  3OO6 A;  3KFM A;  3TAJ A;  5AA3 A;  5EYF A;  2F6P A;  3L6H A;  1B3G A;  4F39 A;  3K6X A;  3JV9 A;  1LGB C;  1QW0 A;  4C1U A;  1SI0 A;  2RKM A;  3DM0 A;  4RJZ A;  3GBB A;  4OWD A;  4RXL A;  3EF7 A;  1YAE A;  5I2N B;  1XVX A;  2ESN A;  3KN7 A;  1UIU A;  1JQF A;  3UP9 A;  3HHF A;  3ILT B;  4GFR A;  4WKM A;  4IB2 A;  1CE2 A;  1H45 A;  2F6G A;  5FTI A;  3WAE A;  4PFT A;  2DXR A;  3KBR A;  5ISU A;  3MP1 A;  1N3W A;  4X9T A;  3LC8 A;  2G29 A;  2ALU A;  3LSF B;  2QS1 A;  3C33 A;  3RN8 A;  3TTR A;  1IXI A;  3FD3 A;  2O1M A;  3QUJ A;  1B51 A;  4PP0 A;  2FA7 A;  1BIY A;  2F8D A;  3HCQ A;  5IKB A;  3UIF A;  4RK9 A;  5DT6 A;  5I57 B;  3QIM A;  3TCG A;  4WXJ A;  3RTF B;  1JVX A;  3CVG A;  4G68 B;  4FJP A;  1LAG E;  3PD9 A;  1AH5 A;  2I3W A;  2Q8J A;  1A8F A;  4MH5 A;  3I6V A;  3ILU B;  3RNN A;  1FQE A;  1SI1 A;  1Y1M A;  3VE1 B;  2B65 A;  2DWH A;  1FTO A;  2RC9 A;  4F3S A;  2V3Q A;  3T93 B;  3RY3 A;  2XXX A;  5KDT A;  1MG1 A;  4Z7E A;  1Y20 A;  3TOD A;  3DP8 A;  3SEY A;  1UTH B;  5H8H A;  3GBA A;  4O3B A;  1O63 A;  1B3H A;  4E0X A;  4JWX A;  4R2B A;  3IX1 A;  4TQU Q;  4EF2 A;  3W9V A;  3PPR A;  1URD A;  1R1N A;  4XXU A;  5H8S A;  5FHM A;  4U23 A;  3N6T A;  3OSR A;  4X48 A;  1PDA A;  3N94 A;  1A99 A;  1S9T A;  1P1O A;  2AYS A;  1QVS A;  1LST A;  3K6W A;  1H3D A;  3IK6 B;  5H8F B;  4ZZA A;  5H8N A;  4OER A;  2DP8 A;  3TTM A;  1JEU A;  1A7L A;  1USY E;  3MVZ A;  2VD3 A;  4H0W A;  3RLF E;  2OBG A;  3ZKL A;  4HCW A;  3DP6 A;  1LAH E;  4OFO A;  1MDP 1;  2HZL A;  2ZMB A;  5L9S A;  5AA4 A;  1S50 A;  4DE8 A;  1Y3P A;  2Q2A A;  4JSD A;  4AB6 A;  1DPP A;  2GH9 A;  2UVJ A;  3IOV A;  3B6Q A;  2V84 A;  4C0R A;  2FNC A;  4YU0 A;  3R7X A;  1GV8 A;  1J1N A;  2XD2 A;  1NH8 A;  2D5W A;  3QAX A;  3QXM A;  5CI5 A;  1LBC A;  4G68 C;  3B7D A;  3UGW A;  4GVO A;  2GHA A;  1LFH A;  2ONR A;  3D4G A;  4ZDM A;  2A5T B;  2VOZ A;  3TEL A;  2OJT A;  4QSD A;  1O7T A;  4KYE A;  1A54 A;  3ECR A;  1I6Q A;  5DVJ A;  3FUZ A;  3TKD A;  4LUB A;  4POX A;  4QSE A;  4N13 A;  3PPN A;  3EHU A;  4ELR A;  5KCJ A;  4FE8 A;  1AMF A;  2VHA A;  4LA9 A;  5CBS A;  1YTV A;  1DTG A;  1B7Z A;  4H5F A;  1OLC A;  3FVK A;  4ZZE A;  4GXS B;  1IZ1 A;  3FAS A;  3S4U A;  4NF4 A;  4ZS9 A;  2G93 A;  1NNF A;  3FJG A;  2R9J A;  1OVB A;  2B3B A;  4KYD A;  4OYV A;  1B6H A;  4H5G A;  5AA2 B;  4TLL B;  3VXC A;  3IOW A;  3MZB A;  4QFK A;  1EH3 A;  1N7W A;  3KG2 A;  3Q29 A;  1MQH A;  4R75 A;  2YLN A;  3C9H A;  5KZT A;  4NTL A;  4Q30 B;  3GXA A;  2Q88 A;  4QHQ A;  4YIC A;  2REJ A;  1HSJ A;  1Z7N E;  3FVG A;  1HSE A;  3FVN A;  4PET A;  5CMM A;  3FXR A;  3U92 A;  2Q9T A;  2ZXT A;  1I69 A;  3C31 A;  3C35 A;  1HSL A;  2RC7 A;  2ZYK A;  1NMU A;  2I4C A;  1ELJ A;  4BDQ A;  3KSJ A;  3TTN A;  4KPT A;  1N04 A;  3K1N A;  1NKX A;  4XKN A;  4RY1 A;  5H8Q A;  1FW0 A;  3MJN A;  3T96 B;  3T9U A;  2O68 A;  2AIX A;  1Y9U A;  3ZS6 A;  4HW8 A;  2X7P A;  5I59 A;  2HAU A;  4GLI A;  5JTY A;  2UVI A;  4P0I A;  4F3P A;  5TP9 A;  3G3J A;  4GXA A;  4F31 B;  3KOT A;  4OQO A;  4JWO A;  3T22 A;  4OVJ A;  1FTK A;  1DTZ A;  3TUS A;  2AL5 A;  2R71 A;  2XXV A;  4PFU A;  2REG A;  3SEW A;  1FQF A;  3G3I A;  5I2K A;  1S7Y A;  2I0B A;  4JB7 A;  3SDF A;  3M8U A;  4IY6 A;  1IQ7 A;  3FJ7 A;  2PBW A;  2M8C A;  1MS7 A;  1N0T A;  4R2F A;  3IB2 A;  1QUL A;  4GRK A;  4F18 A;  2Q89 A;  2DYX A;  3OEK A;  4YAH X;  1P1U A;  1SYI A;  4JBZ A;  3OO8 A;  4YKJ A;  3H6W A;  1PBQ A;  2HQ0 A;  4H67 A;  1EZP A;  1SD3 A;  5ICT A;  2QJE A;  1Y3N A;  1M5D A;  3CFL A;  4ZEC A;  1SW1 A;  4IO2 A;  4OET A;  3E4R A;  1NNK A;  3MVY A;  4KCD A;  3G3H A;  3TEP A;  3VVD A;  4F3G A;  3LSW A;  5I2N A;  3AXF A;  1R9L A;  3PPP A;  3O29 A;  1B0L A;  4F29 A;  3V89 B;  1N7X A;  2NXO A;  4X1B A;  1OVT A;  1MM7 A;  3KGC A;  3USD A;  1ZMG A;  3Q28 A;  4F2Q A;  2DOJ A;  1MM6 A;  1AL3 A;  4ND9 A;  2HZK A;  4ZEF A;  4HTG A;  4GOT A;  3A3U A;  1B3E A;  3OEM A;  3T9V A;  2Z8F A;  3IJO B;  2A5S A;  4F3B A;  5TPA B;  2V3U A;  1DOT A;  1FTL A;  4ZE9 A;  1H44 A;  1B5I A;  1A40 A;  5CMK A;  1LFI A;  3S9N C;  1IIT A;  3TPA A;  4BDN A;  2RF1 A;  2DVZ A;  1JEV A;  4EF1 A;  2F5X A;  2Z22 A;  5AA1 A;  3H3G A;  1MXY A;  4NF8 A;  3CG1 A;  4QRZ A;  4FED A;  5I56 A;  1LFG A;  1NFT A;  3IOU A;  1NL5 A;  3IO4 A;  4LAT A;  3T66 A;  3QUF A;  1US5 A;  3QK6 A;  1P1W A;  3CG3 A;  4OEU A;  2OLB A;  3I5O A;  4OZ9 A;  1MY3 A;  1TFD A;  3IB0 A;  1GVC A;  1Q35 A;  3EPE A;  5JEI A;  1RYO A;  4ESX A;  1MRP A;  1UTH A;  3VXB A;  2XXP A;  2UYF A;  1MH4 A;  4JDF A;  5I84 A;  3E3K A;  4DXB A;  4KQP A;  1RYX A;  5FHO A;  4FOR A;  1A8E A;  1MH3 A;  3OSQ A;  3IL1 B;  1D4N A;  5CMB A;  2DE4 A;  4IGR A;  2QS4 A;  4U4X A;  3HN0 A;  3PMX A;  4QFO A;  3O6H A;  4G8N A;  3VFJ A; 
#chains in the Genus database with same CATH topology
 5CMC A;  4R72 A;  4EDP A;  5ITO A;  2VP1 A;  3S9L C;  1B58 A;  3VLU A;  2DVC A;  1BTJ A;  2XX9 A;  4C1T A;  1MXZ A;  1Z7M E;  4PFW A;  1B32 A;  2F3D A;  4O7M A;  3R26 A;  4YMB A;  1XVY A;  5H8F A;  3S2V A;  3OD7 A;  2DWI A;  3G3G A;  4QSC A;  2NUV A;  2O1L A;  2B4M A;  5EQ9 A;  1IMB A;  2WYK A;  1EU8 A;  4TOZ A;  4U2R A;  1VDW A;  1VSO A;  1PB8 A;  3LUY A;  4EQ7 A;  4Q8R A;  2Y5K A;  1FJ6 A;  1XI6 A;  2UYE A;  3M3L A;  3KN3 A;  1N84 A;  3FV2 A;  3TTL A;  3IFC A;  3THI A;  3OO9 A;  5AA2 D;  3K01 A;  1ZLQ A;  1MXV A;  4KI0 E;  4DI3 D;  3S9M C;  3TCF A;  1EYK A;  5IAI A;  2HXR A;  1QUJ A;  4NHB A;  3W9W A;  4OXV A;  3MVW A;  2CEX A;  1URS A;  4RPO A;  1MQJ A;  2OZZ A;  2F78 A;  3TQL A;  1Q9D A;  4RYA A;  4Q5T A;  3KN8 A;  4NF6 B;  1XT8 A;  4R73 A;  3JYR A;  3O6G A;  1NH7 A;  4R6H A;  5A5L A;  3VVE A;  2F97 A;  3EN3 A;  2A5T A;  3JZJ A;  1JW4 A;  5FHN A;  1SDX A;  3H6U A;  4EUO A;  4K3F A;  3MUQ A;  2NVU B;  3PU5 A;  2HHM A;  1B4Z A;  1IEJ A;  4NF5 B;  1BK4 A;  2XXQ A;  2GRV A;  4FAJ A;  4ZEK A;  2DE2 A;  3U1O A;  1LBY A;  4FEB A;  4GX4 A;  3VDF A;  2XXW A;  2XXH A;  4JXI A;  1ZBM A;  1VE4 A;  1OMP A;  2D21 A;  2Y7I A;  2Q2C A;  3MZ1 A;  4DIG A;  4F22 A;  1B7H A;  4KR5 A;  5DEX A;  4XKR A;  4LZ5 A;  1OQG A;  2HCA A;  4YB7 A;  3PPO A;  5AE4 A;  3IOR A;  1GTK A;  4O7I A;  5L9O A;  1DSN A;  1MXX A;  4IO7 A;  1EZO A;  2H25 A;  4DLD A;  3DLN A;  3RQT A;  1QKA A;  2XWI A;  1Y1Z A;  1ZJL A;  4MJO A;  4ZEB A;  4MAG A;  3TDJ A;  2UVH A;  2ZZX A;  1WVJ A;  2DWJ A;  2O69 A;  1NV6 A;  3H06 B;  1B05 A;  1H76 A;  2PT1 A;  4Z0I A;  4GD5 A;  2Z23 A;  3M3F A;  1POT A;  4BDM A;  2X7Q A;  4OVR A;  4N4U A;  4R6Y A;  4ELQ A;  2ANJ A;  1NV2 A;  5CRY A;  5HPQ A;  4M1V A;  3A09 A;  1OLA A;  1IXC A;  3S9E A;  2NOO A;  4OFL A;  2FYI A;  3MWB A;  4NED A;  1POY 1;  2PT2 A;  2XD3 A;  3BBR A;  3FAT A;  3T9X B;  1VFE A;  2WX9 A;  4G8M A;  5HBC A;  4LQ5 A;  2R8T A;  4H1X A;  3L6G A;  2I3V A;  2P0S A;  1B4H A;  4KHZ E;  3TQW A;  1D9V A;  3ZKK A;  3SEV A;  1LB9 A;  3U72 A;  1ZU0 A;  1T0K A;  4WED A;  1R6Z A;  4N07 A;  1D9Y A;  3DEL B;  1II5 A;  4DZ1 A;  4P11 A;  2GHB A;  3PMW A;  2OK2 A;  3CSB A;  3UN6 A;  2LAO A;  5ET5 A;  3WAF A;  2RC8 A;  3TMG A;  2F35 A;  3EKI A;  3PGF A;  4X8R A;  1MY0 A;  3OXN A;  1OQH A;  3FJM A;  3LSX A;  3BFU A;  3BFT A;  4DXU A;  2IA4 A;  1ZKB A;  4X1D A;  4WEP A;  5CBR A;  1US4 A;  4NE4 A;  2HAV A;  5A5X B;  2O84 X;  3P7I A;  1KZ8 A;  1I6A A;  4PF6 A;  3EHT A;  4NWD A;  3U94 A;  5HM4 B;  4AS5 A;  1FTM A;  4P9K A;  2QSX A;  3H6V A;  4P0G A;  1M5C A;  4ZEI A;  3U65 A;  4YKP A;  1MXW A;  1IMC A;  4DXC A;  2WEF A;  1B3F A;  4BDR A;  1LCF A;  5L9M A;  3HHG A;  4QBA A;  2MKZ A;  1RKM A;  3SEX A;  1D3K A;  3C34 A;  2R6G E;  1B1H A;  1P1N A;  1D9Q A;  1F9B A;  2ZYO A;  3T9H B;  4LON B;  1JET A;  1B7U A;  2PYY A;  3BKI B;  1ZIU A;  4DDD A;  1DK4 A;  2FIE A;  2UXA A;  3G3K A;  5IZ3 B;  2PFZ A;  1R9Q A;  4LQ2 A;  5EYG A;  1LCT A;  2WKY A;  3SZP A;  1YZ0 A;  5BWJ A;  1LBV A;  4RPN A;  3O2A A;  2QRY A;  3TFL A;  3CR9 A;  5H8Q B;  3FZV A;  1OIB A;  3UOR A;  1FPL A;  3CSG A;  3K02 A;  5I58 A;  4EXL A;  2UVG A;  5F7V A;  1UTB A;  2PX1 A;  3E78 A;  4PFR A;  2I4B A;  1Q1K A;  4YZZ A;  3PMV A;  3O28 A;  3HPI A;  2DWA A;  1SYH A;  4GWZ A;  4YKI A;  3PPQ A;  2XXR A;  4LN5 A;  3EHS A;  1LB8 A;  5JTY B;  1QUK A;  4FEC A;  2OWZ A;  4XKP A;  4FAT A;  4PDH A;  1JVY A;  4OVQ A;  3O66 A;  1P99 A;  4N8Y A;  1XS5 A;  5TP9 B;  4PTK A;  3PUZ E;  1FBE A;  2THI A;  4ELP A;  5CM6 A;  1YPN A;  1NUY A;  2O7I A;  3RPL A;  1B1X A;  1FTJ A;  2XXI A;  3MC2 A;  4EXK A;  2CMO A;  4ECF A;  4N6P A;  4MNI A;  4YKK A;  1WOD A;  2HXW A;  3B50 A;  1CB6 A;  1SW4 A;  3PUX E;  1BP5 A;  2V4C A;  1FQB A;  3T0J A;  1XHY A;  5B7D A;  2DXY A;  4THI A;  5FTH A;  1A55 A;  3KOS A;  2HEU A;  2O51 A;  1LBB A;  1B0H A;  2RCA A;  3E9X A;  2KLF A;  1NV1 A;  3D4C A;  2Y7K A;  1FQD A;  3IOT A;  2Q8M A;  4ISU A;  3FXB A;  2F7C A;  3FIR A;  1MQI A;  2O6A A;  3KSX A;  1PB9 A;  3CRB A;  4KFQ A;  3RTW B;  4HS7 A;  2DQV A;  3KJT A;  1IXG A;  4OMB A;  5EHM A;  1FPK A;  3K4U A;  4EQ9 A;  3IB1 A;  3MP8 A;  1UQW A;  1XC1 A;  3U93 A;  1GR2 A;  3QSL A;  3MQ9 A;  3C36 A;  4OFJ A;  1TWY A;  4ESW A;  3TCH A;  2F34 A;  3FGS A;  2DDK A;  1TFA A;  1B5H A;  4KD5 A;  5I57 A;  4PBH A;  3ODB A;  3K2D A;  2QL3 A;  5M2V A;  4MHF A;  3MAM A;  2XA5 A;  2H9B A;  4G68 A;  3VLV A;  1QJM A;  3OEN A;  3IAZ A;  4P47 A;  5TU0 A;  1M5B A;  2DS9 A;  3ONM A;  5EYH A;  1IMA A;  3K1P A;  1N3X A;  1LLS A;  4IO4 A;  3SER A;  1VR5 A;  4MFI A;  1Y3Q A;  2VPN A;  1MPB A;  4R9G A;  2Y84 A;  4NG7 A;  1ZTY A;  1NV3 A;  1ANF A;  1B5J A;  5K2Y A;  1YCJ A;  3HST A;  2VD2 A;  1MQD A;  4TLM B;  1N76 A;  2ZNT A;  5ICQ A;  4IR8 A;  1LBW A;  4H65 A;  1NV5 A;  4DCX A;  1MY1 A;  1NUZ A;  3V8X B;  1B2H A;  1DBZ A;  1JW1 A;  3B6T A;  3OMB A;  4U1Z A;  2Y7P A;  5L8D A;  5I3S A;  4PE5 B;  5K2X A;  1PEB A;  2L5V A;  2RCB A;  1NNT A;  2FIX A;  1USY H;  4G8H A;  4N15 A;  3C4M A;  4JSO A;  4GL8 A;  4NF8 B;  1FBC A;  4GWX A;  5I56 B;  2ZYN A;  1SW5 A;  3K6U A;  2ZNS A;  1EZ9 A;  1JNF A;  3RUM A;  3HO7 A;  3C32 A;  3KZG A;  2E0S A;  2H5Y A;  3MP6 A;  5ITP A;  3CFZ A;  1PC3 A;  4XFE A;  4FBP A;  3IJX B;  4O3C A;  1MQG A;  2H99 A;  4BDO A;  3MW0 A;  4BLA A;  4OEN A;  1EYI A;  4QFP A;  4UAC A;  3PUV E;  4PDD A;  3KBZ A;  2I0C A;  4NF6 A;  2H98 A;  2KQZ A;  4O3A A;  4MBP A;  4F19 A;  1FPG A;  1FBD A;  4MNC A;  3RPW A;  4H45 A;  3FXU A;  2P2A A;  4YMA A;  3UA8 A;  4OVS A;  1I6B A;  1TT1 A;  1VFD A;  2OCU A;  4I1D A;  2XXY A;  3O6I A;  3B6W A;  3HFU A;  1YXI A;  2Z8E A;  3H7M A;  4XTC Q;  4YB5 A;  4NF5 A;  3LBS A;  2RIN A;  3FXQ A;  3N6U A;  2E1S A;  1ATG A;  4IO6 A;  3RGY A;  4NQ8 A;  3PV0 E;  2I49 A;  1MPC A;  4H8J A;  3CI8 A;  3SKP A;  5KDT B;  5EQ8 A;  3CHG A;  3O9P A;  1JP4 A;  4G4P A;  3G3F A;  4MF3 A;  4OHN A;  3VV5 A;  1LBZ A;  1Y4T A;  3GYY A;  4L17 A;  5H8H B;  1L5T A;  4RK2 A;  2IEE A;  1FPF A;  2H4I A;  4R6K A;  4IO3 A;  4F1V A;  3SEU A;  3HV1 A;  3TZA A;  5IM2 A;  2BJJ X;  1FBP A;  2Y7R A;  1LAX A;  4R74 A;  2DE3 A;  5DVF A;  3MBP A;  3H6T A;  4QXD A;  4GF8 A;  1IMF A;  1FBF A;  4HE0 A;  1WDN A;  4I40 A;  4FIM A;  3LR1 A;  5DYH A;  4G77 A;  1NV7 A;  1DPE A;  1FCK A;  2Y7W A;  4PAI A;  3FVO A;  2D3I A;  2W7Y A;  4QFN A;  3MPL A;  2V3T A;  4Q0C A;  3K00 A;  3SET A;  3E13 X;  2QVU A;  4LVQ A;  3MST A;  3OOA A;  4OES A;  2ABH A;  3N26 A;  5H8N B;  1KA0 A;  4U21 A;  5B70 A;  4GWO A;  4UAB A;  2Y5L A;  1AOV A;  4YB6 A;  4LZ7 A;  2XWK A;  4I3E A;  3SES A;  1PBP A;  4E0W A;  2QS2 A;  4GBW A;  4OTE A;  1CNQ A;  2F7A A;  5AA4 B;  2PVU A;  1MXU A;  2PCR A;  4R9F A;  5AA2 A;  2Z8D A;  4I62 A;  4PQJ A;  1B9J A;  3O97 A;  4PGP A;  3FV1 A;  4M4G A;  2ZYM A;  2ONS A;  2V93 A;  1FQC A;  1XOC A;  3PUY E;  5DEX B;  2OWS A;  1FJ9 A;  1FBG A;  4MEV A;  4RNS A;  2YJP A;  4ZE8 A;  2ONK E;  2YPN A;  4H8I A;  4POW A;  4EQB A;  1FPD A;  4F2O A;  3V83 A;  1BKA A;  2VT5 A;  3PUW E;  1MY4 A;  3KC1 A;  4GQO A;  3I3V A;  3ZSF A;  5A5X A;  3UK4 A;  3FBP A;  1FPI A;  5ELV A;  2PFY A;  2QPQ A;  2O7U A;  4PFY A;  2OWT A;  1FPB A;  4OEV A;  3U8Q A;  4O94 A;  4MNP A;  2AL4 A;  2ZNU A;  1IUD A;  1NUX A;  5KCJ B;  4G2Z A;  4LP2 B;  1FRP A;  3A3C A;  4KXP A;  5IZ1 A;  2F3B A;  3K6V A;  3KJ7 A;  3CFX A;  5F1Q A;  4AB5 A;  2P1S A;  4PBQ A;  3KEI A;  4P56 A;  1RDY A;  2DSF A;  3Q26 A;  3QYT A;  2QVR A;  2PMS A;  5IGA A;  4GWU A;  1EYJ A;  1B40 A;  4NF4 B;  5DTB A;  5DW8 A;  4ELO A;  1JW5 A;  3F11 A;  3Q27 A;  2BJI A;  5J1D A;  3VLW A;  2NWJ A;  5IZ3 A;  3VVF A;  2FBP A;  2HFB A;  3CIJ A;  4ONY A;  4KCC A;  1NNP A;  2B3F A;  3T1B A;  1LAF E;  4QF9 A;  4MLV A;  2F7B A;  2QMW A;  1B52 A;  4JWY A;  1SW2 A;  3OEL A;  1B3L A;  3K0V A;  4MLQ A;  1H43 A;  3GLB A;  4I3Y A;  4HCY A;  4F1Y A;  5DVI A;  4GL0 A;  4H6D A;  4UA8 A;  5BUU A;  1URG A;  4N6K A;  1QKB A;  4IGT A;  2P3V A;  4ZED A;  3N5L A;  4AQ4 A;  1TXF A;  3KC0 A;  1QGX A;  2XHD A;  4PGN A;  5F24 A;  1IIW A;  1SQY A;  1QUI A;  3TTK A;  1M5F A;  2I58 A;  2I48 A;  5JK4 A;  3OO7 A;  3Q25 A;  1LBX A;  3RT8 A;  1IXH A;  2XXU A;  4LZ8 A;  4AS4 A;  1RDX A;  4N91 A;  1MPD A;  3RT6 B;  1KWH A;  1MY2 A;  4KYS A;  5EHS A;  1GGG A;  4QFL A;  4GIZ A;  5CC2 A;  4N8G A;  4IO5 A;  4NN3 A;  1FQA A;  3K1M A;  1DMB A;  1B46 A;  1UIV A;  4BDL A;  5I59 B;  1O64 A;  4OVT A;  4NWC A;  2ZZW A;  4U4S A;  5T3J A;  1M5E A;  3ISP A;  3NOH A;  1P1Q A;  4GBV A;  4NX1 A;  3PD8 A;  3MVX A;  1AIV A;  3DP4 A;  4NF0 A;  3H03 A;  3MZ9 A;  2WBB A;  3LV0 A;  4IY5 A;  4P8B A;  4I9D A;  2GFE A;  1SVX B;  2XX8 A;  3MPK A;  1BLF A;  1MDQ A;  3H4Z A;  1SBP A;  1Y4C A;  4DCY A;  4N81 A;  3LSL A;  2QMX A;  4XKQ A;  4I8C A;  5TPA A;  2X26 A;  3M3K A;  4RA1 A;  3EQ1 A;  4XEQ A;  5LOM A;  2XXT A;  2V25 A;  5I2K B;  3GZG A;  3QMF A;  4XIG Q;  3G7W A;  4U22 A;  5I58 B;  2VGQ A;  3R6U A;  3W15 C;  1UTB B;  4P1E A;  2QS3 A;  3TYH A;  4PFI A;  4F1U A;  1PB7 A;  4NMY A;  3IO6 A;  2I6E A;  2XX7 A;  3IR1 A;  5ESY A;  3V5A A;  4U1O A;  5EQA A;  1G0I A;  2F36 A;  4MCO A;  2CZL A;  2XWV A;  3OO6 A;  3KFM A;  3TAJ A;  2KR0 A;  5AA3 A;  5EYF A;  2F6P A;  3L6H A;  1B3G A;  5ET7 A;  4F39 A;  3K6X A;  4NAP A;  3JV9 A;  3RPL B;  1LGB C;  1QW0 A;  4C1U A;  1SI0 A;  2RKM A;  3DM0 A;  4RJZ A;  3GBB A;  4OWD A;  4RXL A;  3EF7 A;  1YAE A;  5I2N B;  1INP A;  1XVX A;  2ESN A;  3KN7 A;  1UIU A;  1JQF A;  3UP9 A;  3HHF A;  3ILT B;  4GFR A;  4WKM A;  4IB2 A;  1CE2 A;  1H45 A;  2F6G A;  5FTI A;  2QVV A;  3WAE A;  4PFT A;  2DXR A;  3KBR A;  5ISU A;  3MP1 A;  1N3W A;  4X9T A;  3LC8 A;  2G29 A;  2ALU A;  3LSF B;  2QS1 A;  3C33 A;  3RN8 A;  3TTR A;  1IXI A;  2CEY A;  1YYZ A;  3FD3 A;  2O1M A;  3QUJ A;  1B51 A;  4PP0 A;  2FA7 A;  1BIY A;  2F8D A;  3HCQ A;  5IKB A;  3UIF A;  4RK9 A;  4GWS A;  5DT6 A;  3LUZ A;  5I57 B;  3QIM A;  3TCG A;  4WXJ A;  3RTF B;  1JVX A;  3CVG A;  4G68 B;  4FJP A;  1K9Y A;  1LAG E;  4N17 A;  3PD9 A;  2CZH A;  3E79 A;  1AH5 A;  2I3W A;  2Q8J A;  1A8F A;  4MH5 A;  3I6V A;  3ILU B;  3RNN A;  1FQE A;  1SI1 A;  1Y1M A;  3VE1 B;  2B65 A;  2DWH A;  1NV4 A;  1FTO A;  2RC9 A;  4F3S A;  2V3Q A;  3T93 B;  2ZZV A;  3RY3 A;  2XXX A;  5KDT A;  1MG1 A;  4Z7E A;  1Y20 A;  3TOD A;  3DP8 A;  3SEY A;  1UTH B;  5H8H A;  3GBA A;  4O3B A;  1O63 A;  4X04 A;  1B3H A;  2Q74 A;  4HE2 A;  4E0X A;  4JWX A;  4R2B A;  3IX1 A;  4TQU Q;  4EF2 A;  1NV0 A;  4O8M A;  3W9V A;  3PPR A;  1URD A;  1R1N A;  4XXU A;  5H8S A;  5FHM A;  4U23 A;  3N6T A;  3OSR A;  4X48 A;  1FBH A;  1PDA A;  3N94 A;  1A99 A;  1S9T A;  1P1O A;  2AYS A;  2QFL A;  1QVS A;  5ET8 A;  4N6D A;  1LST A;  3K6W A;  4PF8 A;  1H3D A;  3IK6 B;  5H8F B;  1KA1 A;  4ZZA A;  5H8N A;  4OER A;  2DP8 A;  4P3L A;  1JEU A;  1A7L A;  1USY E;  3TTM A;  3MVZ A;  2VD3 A;  4H0W A;  3RLF E;  2OBG A;  4HXV A;  3ZKL A;  4OVP A;  4HCW A;  3DP6 A;  1LAH E;  4OFO A;  2CZI A;  1MDP 1;  2HZL A;  2ZMB A;  5L9S A;  5AA4 A;  1S50 A;  4DE8 A;  1Y3P A;  2Q2A A;  4GX3 A;  4JSD A;  4AB6 A;  1DPP A;  2GH9 A;  2UVJ A;  3IOV A;  3B6Q A;  2V84 A;  4C0R A;  2FVZ A;  2FNC A;  4YU0 A;  3R7X A;  1GV8 A;  3PTY A;  1J1N A;  2XD2 A;  1NH8 A;  2D5W A;  3QAX A;  3QXM A;  5CI5 A;  1LBC A;  4G68 C;  3B7D A;  4PAK A;  3UGW A;  4GVO A;  2GHA A;  4G61 A;  1LFH A;  2ONR A;  3D4G A;  4ZDM A;  2A5T B;  2VOZ A;  3TEL A;  1FPE A;  3MYU A;  2OJT A;  4QSD A;  1O7T A;  4KYE A;  1A54 A;  3ECR A;  1I6Q A;  5DVJ A;  3FUZ A;  3TKD A;  5J16 A;  4LUB A;  4POX A;  4QSE A;  4N13 A;  3PPN A;  5EQ7 A;  4JVI A;  3EHU A;  4ELR A;  5KCJ A;  4FE8 A;  1AMF A;  2VHA A;  4LA9 A;  5CBS A;  3B8B A;  1YTV A;  1DTG A;  4PCD A;  1B7Z A;  4H5F A;  1OLC A;  3FVK A;  4ZZE A;  1RDZ A;  4GXS B;  1IZ1 A;  3FAS A;  3S4U A;  4NF4 A;  4ZS9 A;  5ET6 A;  2G93 A;  5LDZ A;  1NNF A;  3FJG A;  2R9J A;  1OVB A;  2B3B A;  4KYD A;  4OYV A;  1B6H A;  4XF5 A;  4H5G A;  5AA2 B;  4TLL B;  3VXC A;  3IOW A;  4MIJ A;  1G0H A;  3MZB A;  4QFK A;  1EH3 A;  1N7W A;  3ROJ A;  3KG2 A;  3Q29 A;  1IME A;  4NGU A;  4PFB A;  1MQH A;  4R75 A;  4GX6 A;  2XXK A;  2YLN A;  3C9H A;  5KZT A;  4Q30 B;  4NTL A;  3GXA A;  2Q88 A;  4QHQ A;  4YIC A;  2REJ A;  4PAF A;  1HSJ A;  1Z7N E;  3FVG A;  1HSE A;  3FVN A;  4PET A;  5CMM A;  3FXR A;  3U92 A;  2Q9T A;  2ZXT A;  1I69 A;  3C31 A;  3C35 A;  1HSL A;  2RC7 A;  2ZYK A;  1NMU A;  2I4C A;  1ELJ A;  4BDQ A;  3KSJ A;  3TTN A;  4KPT A;  5IZZ A;  1N04 A;  3K1N A;  1NKX A;  4XKN A;  4RY1 A;  5H8Q A;  1FW0 A;  3MJN A;  3T96 B;  3T9U A;  2O68 A;  2AIX A;  1Y9U A;  3ZS6 A;  4HW8 A;  2X7P A;  5I59 A;  2HAU A;  4GLI A;  2B4L A;  5JTY A;  2UVI A;  4P0I A;  4F3P A;  5TP9 A;  3G3J A;  4GXA A;  4F31 B;  3KOT A;  4OQO A;  4JWO A;  3T22 A;  4OVJ A;  1FTK A;  2GQ1 A;  4MMP A;  1DTZ A;  3TUS A;  2AL5 A;  2R71 A;  2XXV A;  4PFU A;  2REG A;  3SEW A;  3BIG A;  1FQF A;  3G3I A;  5I2K A;  1S7Y A;  2I0B A;  4JB7 A;  3SDF A;  3M8U A;  3RYD A;  4IY6 A;  1IQ7 A;  3FJ7 A;  2PBW A;  2M8C A;  1MS7 A;  1N0T A;  4R2F A;  3IB2 A;  4DI4 B;  1QUL A;  4GRK A;  4F18 A;  2Q89 A;  2FHY A;  2DYX A;  3OEK A;  1FSA A;  4GWW A;  4YAH X;  1P1U A;  1SYI A;  4JBZ A;  3OO8 A;  4YKJ A;  3H6W A;  2CZK A;  1PBQ A;  2HQ0 A;  4H67 A;  1EZP A;  1FTA A;  4OAN A;  1SD3 A;  5ICT A;  2QJE A;  1Y3N A;  1M5D A;  3CFL A;  4ZEC A;  1SW1 A;  4IO2 A;  4OET A;  3E4R A;  1NNK A;  4H46 A;  4JVD A;  3MVY A;  4GWY A;  4KCD A;  3G3H A;  3TEP A;  3VVD A;  4F3G A;  3LSW A;  4JVC A;  5I2N A;  3AXF A;  5I7I A;  1R9L A;  3PPP A;  3O29 A;  1B0L A;  4F29 A;  3V89 B;  1N7X A;  1SPI A;  1AWB A;  2NXO A;  4X1B A;  2WBD A;  1OVT A;  1K9Z A;  1MM7 A;  3KGC A;  3USD A;  1ZMG A;  3Q28 A;  4F2Q A;  2DOJ A;  1MM6 A;  4HE1 A;  5FBP A;  1AL3 A;  1IMD A;  1DCU A;  4ND9 A;  2HZK A;  4ZEF A;  4HTG A;  4GOT A;  3A3U A;  1B3E A;  3OEM A;  3T9V A;  4PE3 A;  1FPJ A;  2Z8F A;  3IJO B;  2A5S A;  2V3U A;  5TPA B;  4OA4 A;  4F3B A;  1DOT A;  1NUW A;  3D1R A;  1FTL A;  4ZE9 A;  1H44 A;  1B5I A;  1A40 A;  5CMK A;  1LFI A;  3S9N C;  1IIT A;  3TPA A;  4BDN A;  2RF1 A;  2DVZ A;  1JEV A;  4EF1 A;  2F5X A;  2Z22 A;  5AA1 A;  3H3G A;  1MXY A;  4P1L A;  3BIH A;  2OX3 A;  4NF8 A;  2WYP A;  3CG1 A;  2P3N A;  4QRZ A;  4FED A;  5I56 A;  2JJK A;  1LFG A;  1NFT A;  3IOU A;  1NL5 A;  3IO4 A;  4LAT A;  2VPO A;  4MX6 A;  3T66 A;  3QUF A;  1US5 A;  3QK6 A;  4OEU A;  1P1W A;  3CG3 A;  2OLB A;  2XWO A;  3I5O A;  4OZ9 A;  1MY3 A;  5I5P A;  1TFD A;  4PC9 A;  3IB0 A;  1GVC A;  3IFA A;  2HPG A;  1Q35 A;  3EPE A;  5JEI A;  1RYO A;  3A29 A;  4ESX A;  1MRP A;  1UTH A;  3VXB A;  2XXP A;  2UYF A;  1MH4 A;  4JDF A;  5I84 A;  3E3K A;  4DXB A;  1NI9 A;  4KQP A;  1RYX A;  5FHO A;  4FOR A;  1A8E A;  1MH3 A;  3OSQ A;  5LTC A;  3IL1 B;  1LEV A;  1D4N A;  5CMB A;  2DE4 A;  4IGR A;  2QS4 A;  4U4X A;  3HN0 A;  3PMX A;  4QFO A;  3O6H A;  4G8N A;  3VFJ A; 
#chains in the Genus database with same CATH homology
 5CMC A;  4R72 A;  4EDP A;  5ITO A;  2VP1 A;  3S9L C;  1B58 A;  3VLU A;  2DVC A;  1BTJ A;  2XX9 A;  4C1T A;  1MXZ A;  1Z7M E;  4PFW A;  1B32 A;  3R26 A;  4YMB A;  1XVY A;  5H8F A;  3S2V A;  3OD7 A;  2DWI A;  3G3G A;  4QSC A;  2NUV A;  2O1L A;  1EU8 A;  4TOZ A;  4U2R A;  1VSO A;  1PB8 A;  3LUY A;  4EQ7 A;  4Q8R A;  2UYE A;  3M3L A;  3KN3 A;  1N84 A;  3FV2 A;  3TTL A;  3THI A;  3OO9 A;  5AA2 D;  3K01 A;  1ZLQ A;  1MXV A;  4KI0 E;  3S9M C;  3TCF A;  5IAI A;  1QUJ A;  3W9W A;  4OXV A;  3MVW A;  1URS A;  4RPO A;  1MQJ A;  2OZZ A;  2F78 A;  3TQL A;  4RYA A;  4Q5T A;  3KN8 A;  4NF6 B;  1XT8 A;  4R73 A;  3JYR A;  3O6G A;  1NH7 A;  4R6H A;  3VVE A;  2F97 A;  3EN3 A;  2A5T A;  3JZJ A;  1JW4 A;  5FHN A;  1SDX A;  3H6U A;  4EUO A;  4K3F A;  3MUQ A;  2NVU B;  3PU5 A;  1B4Z A;  1IEJ A;  4NF5 B;  2XXQ A;  2GRV A;  4FAJ A;  4ZEK A;  2DE2 A;  3U1O A;  4FEB A;  3VDF A;  2XXW A;  2XXH A;  4JXI A;  1ZBM A;  1VE4 A;  1OMP A;  2D21 A;  2Y7I A;  2Q2C A;  3MZ1 A;  4DIG A;  4F22 A;  1B7H A;  4KR5 A;  5DEX A;  4XKR A;  4LZ5 A;  1OQG A;  2HCA A;  4YB7 A;  3PPO A;  5AE4 A;  3IOR A;  1GTK A;  5L9O A;  1DSN A;  1MXX A;  4IO7 A;  1EZO A;  2H25 A;  4DLD A;  3DLN A;  3RQT A;  1QKA A;  1Y1Z A;  1ZJL A;  4ZEB A;  3TDJ A;  2UVH A;  1WVJ A;  2DWJ A;  2O69 A;  3H06 B;  1B05 A;  1H76 A;  2PT1 A;  4Z0I A;  4GD5 A;  2Z23 A;  3M3F A;  1POT A;  4BDM A;  2X7Q A;  4R6Y A;  4ELQ A;  2ANJ A;  5CRY A;  5HPQ A;  4M1V A;  3A09 A;  1OLA A;  1IXC A;  3S9E A;  2NOO A;  4OFL A;  2FYI A;  3MWB A;  4NED A;  1POY 1;  2PT2 A;  2XD3 A;  3BBR A;  3FAT A;  3T9X B;  1VFE A;  4G8M A;  5HBC A;  4LQ5 A;  4H1X A;  3L6G A;  2I3V A;  2P0S A;  1B4H A;  4KHZ E;  3TQW A;  1D9V A;  3ZKK A;  3SEV A;  1LB9 A;  3U72 A;  1ZU0 A;  1T0K A;  4WED A;  1R6Z A;  4N07 A;  1D9Y A;  3DEL B;  1II5 A;  4DZ1 A;  4P11 A;  2GHB A;  3PMW A;  2OK2 A;  3CSB A;  3UN6 A;  2LAO A;  3WAF A;  2RC8 A;  3TMG A;  2F35 A;  3PGF A;  1MY0 A;  3OXN A;  1OQH A;  3FJM A;  3LSX A;  3BFU A;  3BFT A;  4DXU A;  2IA4 A;  1ZKB A;  4X1D A;  4WEP A;  5CBR A;  1US4 A;  4NE4 A;  2HAV A;  5A5X B;  2O84 X;  3P7I A;  1I6A A;  3EHT A;  4NWD A;  3U94 A;  5HM4 B;  1FTM A;  2QSX A;  3H6V A;  4P0G A;  1M5C A;  4ZEI A;  4YKP A;  1MXW A;  4DXC A;  1B3F A;  4BDR A;  1LCF A;  5L9M A;  3HHG A;  1RKM A;  3SEX A;  1D3K A;  3C34 A;  2R6G E;  1B1H A;  1P1N A;  1F9B A;  2ZYO A;  3T9H B;  4LON B;  1JET A;  1B7U A;  2PYY A;  3BKI B;  1ZIU A;  4DDD A;  2UXA A;  3G3K A;  1R9Q A;  4LQ2 A;  1LCT A;  2WKY A;  5BWJ A;  4RPN A;  3O2A A;  2QRY A;  3TFL A;  3CR9 A;  5H8Q B;  3FZV A;  1OIB A;  3UOR A;  3CSG A;  3K02 A;  5I58 A;  4EXL A;  2UVG A;  5F7V A;  1UTB A;  2PX1 A;  2I4B A;  1Q1K A;  4YZZ A;  3PMV A;  3O28 A;  3HPI A;  2DWA A;  1SYH A;  4YKI A;  3PPQ A;  2XXR A;  3EHS A;  1LB8 A;  5JTY B;  1QUK A;  4FEC A;  4FAT A;  4XKP A;  1JVY A;  3O66 A;  1P99 A;  1XS5 A;  5TP9 B;  3PUZ E;  2THI A;  4ELP A;  5CM6 A;  1YPN A;  2O7I A;  1B1X A;  1FTJ A;  2XXI A;  3MC2 A;  4EXK A;  2CMO A;  4ECF A;  4N6P A;  4YKK A;  1WOD A;  2HXW A;  1CB6 A;  1SW4 A;  3PUX E;  1BP5 A;  1FQB A;  1XHY A;  5B7D A;  2DXY A;  4THI A;  5FTH A;  1A55 A;  3KOS A;  2HEU A;  2O51 A;  1LBB A;  1B0H A;  2RCA A;  3E9X A;  2KLF A;  3D4C A;  2Y7K A;  1FQD A;  3IOT A;  4ISU A;  2F7C A;  3FIR A;  1MQI A;  2O6A A;  3KSX A;  1PB9 A;  3CRB A;  4KFQ A;  3RTW B;  4HS7 A;  2DQV A;  3KJT A;  1IXG A;  4OMB A;  5EHM A;  3K4U A;  4EQ9 A;  3IB1 A;  3MP8 A;  1UQW A;  1XC1 A;  3U93 A;  1GR2 A;  3QSL A;  3MQ9 A;  3C36 A;  4OFJ A;  1TWY A;  4ESW A;  3TCH A;  2F34 A;  3FGS A;  1TFA A;  1B5H A;  4KD5 A;  5I57 A;  3ODB A;  3K2D A;  2QL3 A;  5M2V A;  3MAM A;  2H9B A;  4G68 A;  3VLV A;  1QJM A;  3OEN A;  3IAZ A;  5TU0 A;  1M5B A;  2DS9 A;  3ONM A;  3K1P A;  1N3X A;  1LLS A;  4IO4 A;  3SER A;  1VR5 A;  4MFI A;  1Y3Q A;  4R9G A;  1MPB A;  2Y84 A;  1ZTY A;  1ANF A;  1B5J A;  5K2Y A;  1YCJ A;  3HST A;  2VD2 A;  1MQD A;  4TLM B;  1N76 A;  2ZNT A;  5ICQ A;  4H65 A;  4DCX A;  1MY1 A;  3V8X B;  1B2H A;  1JW1 A;  3B6T A;  3OMB A;  4U1Z A;  2Y7P A;  5L8D A;  4PE5 B;  5K2X A;  1PEB A;  2RCB A;  1NNT A;  1USY H;  4G8H A;  3C4M A;  4JSO A;  4GL8 A;  4NF8 B;  5I56 B;  2ZYN A;  1SW5 A;  3K6U A;  2ZNS A;  1EZ9 A;  1JNF A;  3RUM A;  3HO7 A;  3C32 A;  3KZG A;  2E0S A;  2H5Y A;  3MP6 A;  5ITP A;  3CFZ A;  1PC3 A;  4O3C A;  3IJX B;  1MQG A;  2H99 A;  4BDO A;  3MW0 A;  4BLA A;  4OEN A;  4QFP A;  4UAC A;  3PUV E;  2I0C A;  4NF6 A;  2H98 A;  4O3A A;  4MBP A;  4F19 A;  3RPW A;  3FXU A;  2P2A A;  4YMA A;  3UA8 A;  1I6B A;  1TT1 A;  1VFD A;  2OCU A;  4I1D A;  2XXY A;  3O6I A;  3B6W A;  2Z8E A;  3H7M A;  4XTC Q;  4YB5 A;  4NF5 A;  3LBS A;  2RIN A;  3FXQ A;  3N6U A;  2E1S A;  1ATG A;  4IO6 A;  3RGY A;  3PV0 E;  2I49 A;  1MPC A;  4H8J A;  3CI8 A;  3SKP A;  5KDT B;  3O9P A;  4G4P A;  3G3F A;  4MF3 A;  4OHN A;  3VV5 A;  1Y4T A;  4L17 A;  1L5T A;  5H8H B;  4RK2 A;  2IEE A;  2H4I A;  4R6K A;  4IO3 A;  4F1V A;  3SEU A;  3HV1 A;  3TZA A;  2BJJ X;  2Y7R A;  1LAX A;  4R74 A;  2DE3 A;  5DVF A;  3MBP A;  3H6T A;  4GF8 A;  1WDN A;  4FIM A;  3LR1 A;  5DYH A;  4G77 A;  1DPE A;  1FCK A;  2Y7W A;  3FVO A;  2D3I A;  2W7Y A;  4QFN A;  3MPL A;  2V3T A;  4Q0C A;  3K00 A;  3SET A;  3E13 X;  4LVQ A;  3OOA A;  4OES A;  2ABH A;  3N26 A;  5H8N B;  4U21 A;  5B70 A;  4GWO A;  1AOV A;  4YB6 A;  4LZ7 A;  3SES A;  1PBP A;  4E0W A;  2QS2 A;  4OTE A;  2F7A A;  5AA4 B;  2PVU A;  1MXU A;  4R9F A;  5AA2 A;  2Z8D A;  4I62 A;  4PQJ A;  1B9J A;  3O97 A;  3FV1 A;  4M4G A;  2ZYM A;  2ONS A;  2V93 A;  1FQC A;  1XOC A;  3PUY E;  5DEX B;  2OWS A;  4RNS A;  2YJP A;  4ZE8 A;  2ONK E;  2YPN A;  4H8I A;  4POW A;  4EQB A;  4F2O A;  3V83 A;  1BKA A;  3PUW E;  1MY4 A;  4GQO A;  3I3V A;  3ZSF A;  5A5X A;  3UK4 A;  5ELV A;  2QPQ A;  2O7U A;  4PFY A;  2OWT A;  4OEV A;  3U8Q A;  2AL4 A;  2ZNU A;  1IUD A;  5KCJ B;  4G2Z A;  4LP2 B;  3A3C A;  3K6V A;  3KJ7 A;  3CFX A;  5F1Q A;  4AB5 A;  2P1S A;  3KEI A;  2DSF A;  3Q26 A;  3QYT A;  2PMS A;  1B40 A;  4NF4 B;  5DTB A;  4ELO A;  1JW5 A;  3F11 A;  3Q27 A;  5J1D A;  3VLW A;  2NWJ A;  3VVF A;  3CIJ A;  2HFB A;  4ONY A;  4KCC A;  1NNP A;  2B3F A;  1LAF E;  4QF9 A;  4MLV A;  2F7B A;  2QMW A;  1B52 A;  4JWY A;  1SW2 A;  3OEL A;  1B3L A;  3K0V A;  4MLQ A;  1H43 A;  3GLB A;  4HCY A;  4F1Y A;  5DVI A;  4GL0 A;  4H6D A;  4UA8 A;  5BUU A;  1URG A;  1QKB A;  4IGT A;  4ZED A;  3N5L A;  4AQ4 A;  1TXF A;  2XHD A;  1IIW A;  1SQY A;  1QUI A;  3TTK A;  1M5F A;  2I58 A;  2I48 A;  5JK4 A;  3OO7 A;  3Q25 A;  3RT8 A;  1IXH A;  2XXU A;  4LZ8 A;  1MPD A;  3RT6 B;  1KWH A;  1MY2 A;  4KYS A;  5EHS A;  1GGG A;  4QFL A;  4GIZ A;  5CC2 A;  4IO5 A;  1FQA A;  3K1M A;  1DMB A;  1B46 A;  1UIV A;  4BDL A;  5I59 B;  1O64 A;  4NWC A;  4U4S A;  1M5E A;  1P1Q A;  3PD8 A;  3MVX A;  1AIV A;  3DP4 A;  3H03 A;  3MZ9 A;  4IY5 A;  4I9D A;  2GFE A;  1SVX B;  2XX8 A;  3MPK A;  1BLF A;  1MDQ A;  3H4Z A;  1SBP A;  1Y4C A;  4DCY A;  3LSL A;  2QMX A;  4XKQ A;  4I8C A;  5TPA A;  2X26 A;  3M3K A;  4RA1 A;  3EQ1 A;  5LOM A;  2XXT A;  2V25 A;  5I2K B;  3GZG A;  4XIG Q;  3G7W A;  4U22 A;  5I58 B;  2VGQ A;  3R6U A;  3W15 C;  1UTB B;  2QS3 A;  3TYH A;  4F1U A;  1PB7 A;  4NMY A;  3IO6 A;  2I6E A;  2XX7 A;  3IR1 A;  3V5A A;  4U1O A;  2F36 A;  2CZL A;  3OO6 A;  3KFM A;  3TAJ A;  5AA3 A;  5EYF A;  2F6P A;  3L6H A;  1B3G A;  4F39 A;  3K6X A;  3JV9 A;  1LGB C;  1QW0 A;  4C1U A;  1SI0 A;  2RKM A;  3DM0 A;  4RJZ A;  3GBB A;  4OWD A;  4RXL A;  3EF7 A;  1YAE A;  5I2N B;  1XVX A;  2ESN A;  3KN7 A;  1UIU A;  1JQF A;  3UP9 A;  3HHF A;  3ILT B;  4GFR A;  4WKM A;  4IB2 A;  1CE2 A;  1H45 A;  2F6G A;  5FTI A;  3WAE A;  4PFT A;  2DXR A;  3KBR A;  5ISU A;  3MP1 A;  1N3W A;  4X9T A;  3LC8 A;  2G29 A;  2ALU A;  3LSF B;  2QS1 A;  3C33 A;  3RN8 A;  3TTR A;  1IXI A;  3FD3 A;  2O1M A;  3QUJ A;  1B51 A;  4PP0 A;  2FA7 A;  1BIY A;  2F8D A;  3HCQ A;  5IKB A;  3UIF A;  4RK9 A;  5DT6 A;  5I57 B;  3QIM A;  3TCG A;  4WXJ A;  3RTF B;  1JVX A;  3CVG A;  4G68 B;  4FJP A;  1LAG E;  3PD9 A;  1AH5 A;  2I3W A;  2Q8J A;  1A8F A;  4MH5 A;  3I6V A;  3ILU B;  3RNN A;  1FQE A;  1SI1 A;  1Y1M A;  3VE1 B;  2B65 A;  2DWH A;  1FTO A;  2RC9 A;  4F3S A;  2V3Q A;  3T93 B;  3RY3 A;  2XXX A;  5KDT A;  1MG1 A;  4Z7E A;  1Y20 A;  3TOD A;  3DP8 A;  3SEY A;  1UTH B;  5H8H A;  3GBA A;  4O3B A;  1O63 A;  1B3H A;  4E0X A;  4JWX A;  4R2B A;  3IX1 A;  4TQU Q;  4EF2 A;  3W9V A;  3PPR A;  1URD A;  1R1N A;  4XXU A;  5H8S A;  5FHM A;  4U23 A;  3N6T A;  3OSR A;  4X48 A;  1PDA A;  3N94 A;  1A99 A;  1S9T A;  1P1O A;  2AYS A;  1QVS A;  1LST A;  3K6W A;  1H3D A;  3IK6 B;  5H8F B;  4ZZA A;  5H8N A;  4OER A;  2DP8 A;  3TTM A;  1JEU A;  1A7L A;  1USY E;  3MVZ A;  2VD3 A;  4H0W A;  3RLF E;  2OBG A;  3ZKL A;  4HCW A;  3DP6 A;  1LAH E;  4OFO A;  1MDP 1;  2HZL A;  2ZMB A;  5L9S A;  5AA4 A;  1S50 A;  4DE8 A;  1Y3P A;  2Q2A A;  4JSD A;  4AB6 A;  1DPP A;  2GH9 A;  2UVJ A;  3IOV A;  3B6Q A;  2V84 A;  4C0R A;  2FNC A;  4YU0 A;  3R7X A;  1GV8 A;  1J1N A;  2XD2 A;  1NH8 A;  2D5W A;  3QAX A;  3QXM A;  5CI5 A;  1LBC A;  4G68 C;  3B7D A;  3UGW A;  4GVO A;  2GHA A;  1LFH A;  2ONR A;  3D4G A;  4ZDM A;  2A5T B;  2VOZ A;  3TEL A;  2OJT A;  4QSD A;  1O7T A;  4KYE A;  1A54 A;  3ECR A;  1I6Q A;  5DVJ A;  3FUZ A;  3TKD A;  4LUB A;  4POX A;  4QSE A;  4N13 A;  3PPN A;  3EHU A;  4ELR A;  5KCJ A;  4FE8 A;  1AMF A;  2VHA A;  4LA9 A;  5CBS A;  1YTV A;  1DTG A;  1B7Z A;  4H5F A;  1OLC A;  3FVK A;  4ZZE A;  4GXS B;  1IZ1 A;  3FAS A;  3S4U A;  4NF4 A;  4ZS9 A;  2G93 A;  1NNF A;  3FJG A;  2R9J A;  1OVB A;  2B3B A;  4KYD A;  4OYV A;  1B6H A;  4H5G A;  5AA2 B;  4TLL B;  3VXC A;  3IOW A;  3MZB A;  4QFK A;  1EH3 A;  1N7W A;  3KG2 A;  3Q29 A;  1MQH A;  4R75 A;  2YLN A;  3C9H A;  5KZT A;  4NTL A;  4Q30 B;  3GXA A;  2Q88 A;  4QHQ A;  4YIC A;  2REJ A;  1HSJ A;  1Z7N E;  3FVG A;  1HSE A;  3FVN A;  4PET A;  5CMM A;  3FXR A;  3U92 A;  2Q9T A;  2ZXT A;  1I69 A;  3C31 A;  3C35 A;  1HSL A;  2RC7 A;  2ZYK A;  1NMU A;  2I4C A;  1ELJ A;  4BDQ A;  3KSJ A;  3TTN A;  4KPT A;  1N04 A;  3K1N A;  1NKX A;  4XKN A;  4RY1 A;  5H8Q A;  1FW0 A;  3MJN A;  3T96 B;  3T9U A;  2O68 A;  2AIX A;  1Y9U A;  3ZS6 A;  4HW8 A;  2X7P A;  5I59 A;  2HAU A;  4GLI A;  5JTY A;  2UVI A;  4P0I A;  4F3P A;  5TP9 A;  3G3J A;  4GXA A;  4F31 B;  3KOT A;  4OQO A;  4JWO A;  3T22 A;  4OVJ A;  1FTK A;  1DTZ A;  3TUS A;  2AL5 A;  2R71 A;  2XXV A;  4PFU A;  2REG A;  3SEW A;  1FQF A;  3G3I A;  5I2K A;  1S7Y A;  2I0B A;  4JB7 A;  3SDF A;  3M8U A;  4IY6 A;  1IQ7 A;  3FJ7 A;  2PBW A;  2M8C A;  1MS7 A;  1N0T A;  4R2F A;  3IB2 A;  1QUL A;  4GRK A;  4F18 A;  2Q89 A;  2DYX A;  3OEK A;  4YAH X;  1P1U A;  1SYI A;  4JBZ A;  3OO8 A;  4YKJ A;  3H6W A;  1PBQ A;  2HQ0 A;  4H67 A;  1EZP A;  1SD3 A;  5ICT A;  2QJE A;  1Y3N A;  1M5D A;  3CFL A;  4ZEC A;  1SW1 A;  4IO2 A;  4OET A;  3E4R A;  1NNK A;  3MVY A;  4KCD A;  3G3H A;  3TEP A;  3VVD A;  4F3G A;  3LSW A;  5I2N A;  3AXF A;  1R9L A;  3PPP A;  3O29 A;  1B0L A;  4F29 A;  3V89 B;  1N7X A;  2NXO A;  4X1B A;  1OVT A;  1MM7 A;  3KGC A;  3USD A;  1ZMG A;  3Q28 A;  4F2Q A;  2DOJ A;  1MM6 A;  1AL3 A;  4ND9 A;  2HZK A;  4ZEF A;  4HTG A;  4GOT A;  3A3U A;  1B3E A;  3OEM A;  3T9V A;  2Z8F A;  3IJO B;  2A5S A;  4F3B A;  5TPA B;  2V3U A;  1DOT A;  1FTL A;  4ZE9 A;  1H44 A;  1B5I A;  1A40 A;  5CMK A;  1LFI A;  3S9N C;  1IIT A;  3TPA A;  4BDN A;  2RF1 A;  2DVZ A;  1JEV A;  4EF1 A;  2F5X A;  2Z22 A;  5AA1 A;  3H3G A;  1MXY A;  4NF8 A;  3CG1 A;  4QRZ A;  4FED A;  5I56 A;  1LFG A;  1NFT A;  3IOU A;  1NL5 A;  3IO4 A;  4LAT A;  3T66 A;  3QUF A;  1US5 A;  3QK6 A;  1P1W A;  3CG3 A;  4OEU A;  2OLB A;  3I5O A;  4OZ9 A;  1MY3 A;  1TFD A;  3IB0 A;  1GVC A;  1Q35 A;  3EPE A;  5JEI A;  1RYO A;  4ESX A;  1MRP A;  1UTH A;  3VXB A;  2XXP A;  2UYF A;  1MH4 A;  4JDF A;  5I84 A;  3E3K A;  4DXB A;  4KQP A;  1RYX A;  5FHO A;  4FOR A;  1A8E A;  1MH3 A;  3OSQ A;  3IL1 B;  1D4N A;  5CMB A;  2DE4 A;  4IGR A;  2QS4 A;  4U4X A;  3HN0 A;  3PMX A;  4QFO A;  3O6H A;  4G8N A;  3VFJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...