4LP2B

Crystal structure of monomeric ligand binding domain of s. typhimurium cysb, a lysr transcriptional regulator at 2.2a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of monomeric ligand binding domain of S. typhimurium CysB, a LysR transcriptional regulator at 2.2A
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Gene regulation
total genus 64
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lp2B01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lp2B02
5I2NA 1LFIA 1P1NA 4H5FA 3FV2A 3OO6A 4HCYA 3IK6B 5K2XA 1VSOA 3FIRA 3SETA 3K01A 1POTA 3OSRA 2X7PA 4MBPA 3H7MA 1Y4CA 5I56A 1SW1A 3RY3A 4Q8RA 4F31B 3K2DA 2V3TA 3ODBA 3VVEA 3BFTA 1EH3A 3EN3A 1QULA 4ESWA 2I3VA 3C35A 4HCWA 4OVJA 3L6GA 4LQ5A 4XKPA 1AMFA 2HZKA 3Q26A 2I0CA 4YKKA 3UORA 2XX7A 2I3WA 2P2AA 3MZ9A 1JW4A 4POXA 5KZTA 3W15C 4XTCQ 5TP9B 4H6DA 1IUDA 1EU8A 3QAXA 5H8NA 4Z7EA 1GGGA 4GOTA 1MQJA 1B0HA 1GR2A 3Q25A 3OO7A 4KYDA 1N0TA 2PMSA 4RA1A 4I8CA 4XXUA 3VLUA 1JEUA 5L9OA 1WDNA 5CC2A 4GL8A 1NKXA 1S7YA 5KCJA 2I6EA 3TZAA 3IOWA 1SW4A 3K00A 2I48A 1DTZA 3K4UA 1MPBA 4OQOA 4FATA 2B3FA 3PPOA 1OVBA 4KCDA 4BDLA 1EZ9A 1FQBA 4OWDA 2HAVA 4RPOA 4NWCA 3MUQA 3FJMA 2F8DA 1GTKA 4H8JA 2UXAA 1UTHB 2FA7A 4JBZA 2V84A 1MPDA 1Z7ME 3THIA 3QSLA 2QJEA 1P1UA 2B3BA 2O1LA 5M2VA 1Y1ZA 3O6HA 4R73A 3VXBA 4QHQA 2GFEA 2UVJA 5FTIA 3TKDA 3MVYA 2OJTA 5ICTA 5AA3A 1OQHA 3CG1A 1XC1A 1AOVA 4JXIA 4OHNA 3IORA 2UVIA 1XOCA 1MQHA 4ZZAA 3EHUA 3VDFA 4FIMA 3CSBA 5I59B 3IOVA 4WEDA 5H8FA 3IAZA 2R6GE 3O6GA 1NNTA 4K3FA 3KOTA 4N07A 5CMKA 1FTMA 3B6QA 4FJPA 1J1NA 3MP1A 3O2AA 4DDDA 2HXWA 4G77A 3GBBA 1FTKA 1Y3NA 3FV1A 3FJGA 4HS7A 4ZZEA 4IY5A 3Q29A 3PPQA 1AH5A 3EHTA 2NUVA 5CMMA 1MY1A 1ZKBA 4GVOA 4OFOA 1A7LA 3HHFA 1ELJA 2ZYKA 4DCXA 1JW1A 2QS4A 4F3SA 4NEDA 1B2HA 3N6UA 5AA2B 1N7WA 1SDXA 1MXWA 1IQ7A 2PVUA 4QRZA 1M5BA 4H67A 2GH9A 4ZDMA 4JSDA 1JETA 2DE2A 2A5TB 2LAOA 1B7ZA 4F3GA 4ZEFA 5JEIA 1XVXA 2I4BA 4WXJA 1MY3A 1BIYA 3U1OA 2H25A 2BJJX 4ZEIA 1UTBB 3MWBA 4ZEDA 1FTOA 1N3XA 3H6WA 3QXMA 4Q0CA 3TDJA 3OO9A 4F29A 5CI5A 2HCAA 3PPPA 3IOUA 1YAEA 4X1DA 5A5XB 2RC8A 5HM4B 2O69A 5IAIA 1TFDA 2DQVA 2H99A 3FUZA 2QS1A 1F9BA 4YB7A 2HZLA 1TFAA 1ZIUA 5EYFA 2QMXA 4IY6A 4R9GA 4ECFA 1MQGA 4R2FA 5I56B 1CE2A 1CB6A 4OMBA 4LZ5A 2XXVA 5BWJA 4I62A 1MDP1 3N5LA 4FEDA 3Q27A 4R6YA 4F1YA 3TQWA 3SEUA 2Z8DA 3T96B 3OSQA 2I58A 2O7UA 1UIVA 1HSJA 3M3LA 2O7IA 4N6PA 1O7TA 2Z22A 3K6UA 1Q35A 3SERA 2DVCA 1AIVA 2O6AA 4DXCA 3FASA 1FTLA 2HEUA 5H8NB 3G3IA 4U1ZA 3CVGA 2PT1A 3RGYA 4ONYA 2FNCA 3BKIB 3A3UA 4JSOA 4RNSA 2XXWA 4LZ7A 4THIA 3MP6A 3RT8A 1IXIA 3IB2A 1B4ZA 5KCJB 1M5EA 3VVDA 4BDOA 3OOAA 2V3UA 3VE1B 3KJ7A 2DXYA 1QUIA 2H5YA 4TLLB 1LB8A 4ELPA 2XHDA 5AA1A 1IXCA 3OEMA 1Y3PA 2XXUA 4LVQA 4LZ8A 3U72A 1MPCA 5L9MA 4GFRA 2F6GA 2XX8A 4L17A 3S9LC 3T9XB 1MQDA 2DP8A 5LOMA 3TTRA 4F3PA 3RUMA 3ZS6A 4JWOA 3FVNA 3E13X 3UIFA 3FZVA 1ATGA 3A3CA 2D5WA 3TPAA 1JNFA 1PB7A 3V8XB 5EHMA 4DCYA 3CRBA 1FQFA 2ZMBA 1EZOA 3S9EA 3IJXB 4NF6A 4TLMB 5I2KA 4TQUQ 1N84A 1B40A 4DZ1A 2QS2A 3MW0A 2D3IA 3TELA 5DVFA 1YPNA 1SBPA 3IX1A 4EQ7A 3IL1B 3T9HB 4IO5A 1VR5A 3M8UA 5I58B 4ISUA 5F1QA 3ZSFA 5H8FB 2A5SA 1N04A 4P0IA 4JWXA 3W9VA 1WVJA 3T93B 1DSNA 2YPNA 1QVSA 4POWA 2NOOA 2XXHA 3A09A 4MLVA 1LCFA 3O6IA 1P99A 4OESA 5HPQA 2VGQA 2ONSA 1MXVA 4GWOA 1QW0A 3H03A 2Y7KA 3IO4A 2QSXA 1H45A 2F34A 1PC3A 5TU0A 2PT2A 3FXQA 1EZPA 1Y3QA 1MRPA 4KHZE 3L6HA 1XHYA 1MXYA 4G68C 3MC2A 1AL3A 3K6WA 3G3GA 1IZ1A 3KBRA 4IGRA 5CRYA 4MFIA 5ITOA 2F35A 3M3FA 3OXNA 3ZKKA 3UP9A 1MS7A 4PP0A 2F78A 3FVKA 1R9QA 4YB6A 2XXXA 1POY1 1A54A 3RQTA 1OIBA 3G3JA 2QRYA 4X9TA 2OWTA 3MAMA 4RK2A 4IO3A 3CG3A 2X26A 2O1MA 4PE5B 3I6VA 2QPQA 3C31A 1ZU0A 3PMVA 1RKMA 1LAHE 3K6VA 2F7CA 3MBPA 4KR5A 4RY1A 2XXYA 1M5DA 5KDTA 1ZMGA 3LR1A 3SKPA 3IJOB 4RJZA 4FORA 4R74A 3HV1A 4ZEBA 3G3FA 3MZ1A 4F2QA 3CFZA 3LSFB 2M8CA 2VOZA 4DIGA 2V25A 3OMBA 3BFUA 3IB1A 3LBSA 1UQWA 3C9HA 3MZBA 1ZTYA 4XIGQ 2Y7IA 1MG1A 3G3KA 2DVZA 3ILTB 4IO2A 5DEXA 1QUKA 2IA4A 1B46A 3MJNA 4ZEKA 4ZE9A 3LSXA 4ZE8A 1PB8A 4LUBA 2ZYOA 5TPAA 3SEYA 4XKRA 1DPPA 4YZZA 1NFTA 4AB6A 4F22A 2UVHA 3E9XA 4C1TA 2R71A 1JW5A 4YKPA 2ESNA 4Q30B 4GLIA 3TCFA 3KN3A 3N94A 1IIWA 3TQLA 2ZNSA 4P0GA 1USYE 3HCQA 4RPNA 1PDAA 1OQGA 3B6WA 5H8QB 4Z0IA 1NMUA 3QUJA 2GHBA 3U8QA 3R6UA 3UA8A 5JK4A 3SESA 3TUSA 5H8HA 3LC8A 4PQJA 3CI8A 4U4SA 1JVYA 4NMYA 1MY0A 1TXFA 1USYH 2REJA 1LGBC 3VVFA 4DXUA 4KCCA 4GD5A 5I57A 2B65A 1SI0A 3PUWE 2HQ0A 1L5TA 4R72A 3VV5A 1B05A 2QMWA 3OD7A 2XXQA 4M1VA 2ZNUA 4MLQA 1I69A 4H8IA 3PGFA 4ND9A 2XXPA 4NF5B 5CBRA 2XD3A 3FJ7A 3FXUA 2H4IA 5AA4B 1LCTA 3TAJA 3UGWA 4DXBA 2XXIA 2PX1A 4KPTA 1DTGA 3KJTA 3IOTA 3PU5A 4KFQA 3K1NA 3MP8A 4IGTA 2V3QA 4QSDA 1LBBA 1N76A 3MQ9A 4IO7A 3HHGA 3WAFA 4QSEA 4QFLA 3HO7A 4GF8A 3B7DA 1MXZA 1MM6A 5IKBA 1BP5A 1LFHA 1IEJA 1YTVA 3KG2A 5JTYB 1MXUA 3KEIA 1R6ZA 5I2NB 2P1SA 1R1NA 4OERA 3PPNA 1DOTA 1H43A 4GXSB 1S9TA 3MPLA 1SVXB 1MDQA 3ZKLA 4C1UA 1A8FA 5L8DA 3H6UA 2ZYNA 1OVTA 4ELRA 3TMGA 2Y7PA 4R6HA 3DP8A 3D4GA 5B70A 3KGCA 3MVZA 3FVOA 3IR1A 3SEWA 4FAJA 4H65A 4F18A 3E3KA 3GLBA 4EF2A 3T9UA 4BDMA 2Q2CA 3O9PA 2DWIA 1I6BA 2PBWA 1B9JA 4OEVA 1MY4A 4LQ2A 2I4CA 3H06B 4WEPA 3I5OA 3O28A 1B4HA 4PFTA 1MY2A 4P11A 3SEXA 1LB9A 1NH7A 2KLFA 1MH3A 1Z7NE 5DVIA 1URSA 1QKBA 3K6XA 3HPIA 2I49A 1FQCA 3MVWA 3I3VA 1LBCA 4OZ9A 2OCUA 4G2ZA 2YLNA 4OTEA 3OEKA 5HBCA 3DM0A 1SW2A 4ESXA 4U21A 4F3BA 1FQDA 2OZZA 1A8EA 1PBQA 2F7AA 4QFNA 3C4MA 3H3GA 3SEVA 3C36A 1B51A 4YICA 2O84X 5DEXB 3TODA 2Y7WA 3T66A 1PB9A 4WKMA 3DELB 4OFJA 3PMWA 5TPAB 3C32A 2D21A 4NWDA 3VLWA 2REGA 4U22A 1GVCA 3PV0E 1IXHA 3RNNA 1B3GA 1I6QA 5DT6A 4G8HA 4N13A 1XVYA 1FW0A 5BUUA 4HW8A 4KD5A 2YJPA 3U92A 3TTMA 1Y9UA 5ISUA 4YB5A 3KSXA 1A99A 5L9SA 4F1VA 4U2RA 3PUXE 3S4UA 1LLSA 2ZYMA 2DE3A 4IB2A 3QK6A 4PFYA 4TOZA 3H6VA 5CBSA 4MH5A 3VXCA 4O3CA 1NL5A 3C33A 3VLVA 2QS3A 2DXRA 2OWSA 1Y1MA 5AA2D 4F1UA 3R26A 4FE8A 3RPWA 4Q5TA 2ZXTA 4NE4A 3TTLA 1PBPA 4UACA 4ELOA 1Y4TA 1KWHA 1B6HA 5I57B 3O29A 4RK9A 3M3KA 2VD2A 1MXXA 4XKNA 1SYHA 4ZS9A 1YCJA 1SI1A 1FQAA 5DTBA 1O64A 1RYOA 1VE4A 1FTJA 3PUZE 2H9BA 3KSJA 1URGA 4U23A 3PUVE 4EQ9A 4NF8A 5B7DA 1IITA 2F36A 3F11A 5A5XA 3TCHA 3PPRA 3SDFA 4EUOA 3ECRA 2ABHA 1N7XA 4AQ4A 2XD2A 2F6PA 2RC7A 4NF4A 1NNFA 2Y7RA 3PD8A 3UN6A 3JZJA 4X1BA 1Q1KA 3FATA 4QF9A 2ONRA 1FCKA 3O66A 3TEPA 3S2VA 1GV8A 3N26A 1ANFA 4EF1A 3GBAA 1IXGA 4H1XA 3D4CA 2NWJA 4IO6A 4QFOA 3O97A 4OETA 4GRKA 2DOJA 2HFBA 3FGSA 2Z23A 2QL3A 4EXLA 2GHAA 4BDQA 1B52A 4FEBA 2UYFA 1DMBA 5DVJA 4LATA 4I1DA 3Q28A 4LP2B 2RCAA 2RCBA 3QYTA 1OMPA 3CFXA 1MH4A 1D9VA 3HSTA 4XKQA 1H3DA 2UYEA 4GL0A 3FXRA 4PFUA 2P0SA 3PMXA 3U94A 3USDA 4QSCA 2G93A 1B3HA 1MQIA 1XT8A 2XXRA 3TCGA 1QUJA 2Q9TA 2RINA 2RKMA 1O63A 1UIUA 3LUYA 3EHSA 4RYAA 4KYEA 4I9DA 1LAXA 1N3WA 4M4GA 1ZLQA 2Q8JA 5ITPA 3JYRA 4H0WA 3ONMA 3RN8A 1A55A 5CMBA 4QFKA 5CMCA 3V83A 4JB7A 3T9VA 2G29A 3K02A 4R6KA 3N6TA 3V5AA 3C34A 2ANJA 3R7XA 4KI0E 2X7QA 1D3KA 4YMAA 2VP1A 1URDA 4G68A 2CZLA 1H44A 5ICQA 3KFMA 1OLAA 5I58A 4KYSA 4LA9A 2DWHA 4GIZA 2OLBA 1Y20A 2NVUB 4U1OA 2V93A 2R9JA 3MPKA 4PETA 2O68A 1T0KA 2DWJA 3HN0A 3LSLA 4JDFA 3RTFB 2DYXA 3T22A 1B5IA 4F19A 1HSEA 3P7IA 4DE8A 2CMOA 4RXLA 3JV9A 1MM7A 4NF6B 2W7YA 4JWYA 2AL5A 5I2KB 3V89B 1SQYA 1P1OA 1H76A 2F5XA 5H8SA 1JVXA 1B3LA 1LAGE 2DWAA 2E1SA 1D4NA 1B5HA 2FYIA 1JQFA 2Z8FA 1BKAA 3LSWA 4H5GA 3K0VA 4F2OA 2HAUA 3CIJA 2ALUA 3GZGA 4QFPA 4G8NA 4ELQA 3AXFA 5CM6A 3RTWB 3TTNA 3H4ZA 2RC9A 3TYHA 2DS9A 4R2BA 1VFDA 2PYYA 4G8MA 4R9FA 5F7VA 2F97A 2GRVA 1QJMA 3PUYE 3OELA 1RYXA 3RT6B 4MF3A 5FTHA 2Z8EA 1SYIA 2H98A 5EHSA 5TP9A 4NF8B 1P1WA 3CFLA 4GXAA 2Q89A 4EQBA 3KN7A 1US5A 4NF4B 4HTGA 3WAEA 4FECA 1TWYA 2IEEA 2Q88A 3U93A 4OFLA 5ELVA 4YKIA 1P1QA 4LONB 1NH8A 1B1HA 1HSLA 3B6TA 3GXAA 1B3EA 3EF7A 3RLFE 4E0WA 5K2YA 3S9NC 2O51A 1B58A 1S50A 2UVGA 4R75A 4DLDA 1ZBMA 2ZNTA 1M5CA 3VFJA 2Q2AA 3EQ1A 1ZJLA 1VFEA 3KOSA 2I0BA 2AYSA 1PEBA 1UTHA 5KDTB 1I6AA 1II5A 3KN8A 1LAFE 1FQEA 1OLCA 1DPEA 3EPEA 3FVGA 1B7UA 1BLFA 3K1MA 4E0XA 3CSGA 5H8QA 1M5FA 1SW5A 2WKYA 3H6TA 1SD3A 2VD3A 3DP6A 4UA8A 4U4XA 3IO6A 1B7HA 4C0RA 3G7WA 3DP4A 1BTJA 4YKJA 2DSFA 4O3BA 3UK4A 3QUFA 5I59A 2NXOA 4PFWA 2OK2A 1NNPA 4OYVA 4EXKA 1JEVA 4BDNA 3IB0A 3G3HA 1QKAA 4GQOA 5J1DA 5FHMA 4IO4A 2AIXA 5FHNA 2OBGA 4F39A 4EDPA 1LFGA 3OO8A 3ILUB 1TT1A 2AL4A 4BLAA 2THIA 3DLNA 4ZECA 3MVXA 2F7BA 5I84A 4NF5A 5H8HB 2XXTA 4NTLA 1A40A 1D9YA 1R9LA 5FHOA 5AA4A 4KQPA 1B32A 3OENA 4YU0A 4BDRA 2Y84A 4YAHX 1NNKA 5DYHA 4G68B 5AA2A 1XS5A 3BBRA 2VHAA 3S9MC 1B3FA 1WODA 3CR9A 3K1PA 2DE4A 2E0SA 4X48A 2XX9A 3TFLA 3W9WA 3KZGA 2ONKE 2A5TA 3TTKA 3FD3A 4AB5A 1B5JA 4YMBA 4G4PA 4O3AA 4OENA 5AE4A 1LSTA 1US4A 2RF1A 3E4RA 1B0LA 1B1XA 1UTBA 3PD9A 3QIMA 4OXVA 4OEUA 5JTYA
chains in the Genus database with same CATH superfamily
5I2NA 1LFIA 1P1NA 4H5FA 5IGAA 5ET8A 3FV2A 3OO6A 4HCYA 3IK6B 5K2XA 5EQ9A 1VSOA 3FIRA 1IMBA 3SETA 3K01A 1POTA 1NV6A 3OSRA 2FBPA 1DK4A 1NV4A 3U65A 5ET5A 2X7PA 5T3JA 4MBPA 3H7MA 1Y4CA 5I56A 1SW1A 3RY3A 4Q8RA 4F31B 3K2DA 5LDZA 1RDYA 1NV7A 2V3TA 3ODBA 3VVEA 2KR0A 3BFTA 1EH3A 3EN3A 1QULA 4ESWA 2I3VA 3C35A 4HCWA 4OVJA 3L6GA 4LQ5A 4PFBA 4XKPA 1AMFA 2HZKA 1LBVA 1EYJA 3Q26A 2I0CA 4YKKA 4P8BA 3E78A 3UORA 2XX7A 3HFUA 2I3WA 2P2AA 3MZ9A 1JW4A 1NV5A 3KC1A 4MX6A 4POXA 5KZTA 3W15C 4XTCQ 5TP9B 4H6DA 1IUDA 1EU8A 3QAXA 5H8NA 4Z7EA 1GGGA 4GOTA 1MQJA 4QBAA 1B0HA 1GR2A 3Q25A 3OO7A 4KYDA 1N0TA 2PMSA 4RA1A 2QVVA 4I8CA 2CZKA 2Q8MA 4XXUA 3VLUA 4H45A 1JEUA 5L9OA 1WDNA 5CC2A 4P9KA 4GL8A 5I7IA 1NKXA 1S7YA 5KCJA 2I6EA 3TZAA 4OANA 3IOWA 3A29A 1SW4A 1NV3A 3K00A 4OVSA 2I48A 1DTZA 3K4UA 1MPBA 4QXDA 4OQOA 4FATA 2B3FA 1YXIA 4MHFA 5ESYA 4GWWA 3PPOA 1OVBA 4KCDA 4BDLA 1EZ9A 2FIEA 1YZ0A 1FQBA 4OWDA 2HAVA 4RPOA 4P1EA 2F3BA 4NWCA 3MUQA 1VDWA 3FJMA 2F8DA 1GTKA 4H8JA 2UXAA 1UTHB 2VT5A 4GWSA 2FA7A 3BIGA 4JBZA 2V84A 1MPDA 1Z7ME 3THIA 1K9YA 1IMDA 3QSLA 2QJEA 1P1UA 2B3BA 5EYHA 2O1LA 5M2VA 1Y1ZA 2QFLA 3O6HA 4R73A 3VXBA 4QHQA 2GFEA 2UVJA 5FTIA 3TKDA 3MVYA 2OJTA 5ICTA 2QVUA 1FBPA 5AA3A 1OQHA 5LTCA 3CG1A 1XC1A 3MSTA 2V4CA 4HXVA 1AOVA 4JXIA 4OHNA 3IORA 2UVIA 1XOCA 5EQAA 1MQHA 4ZZAA 3EHUA 3VDFA 4FIMA 3CSBA 3PTYA 5I59B 3IOVA 4WEDA 5H8FA 3IAZA 2R6GE 3O6GA 1NNTA 4K3FA 3KOTA 4N07A 5CMKA 1FTMA 3B6QA 1IMCA 4FJPA 1J1NA 3MP1A 3O2AA 4DDDA 2HXWA 4G77A 3GBBA 1FTKA 1Y3NA 3FV1A 2L5VA 2PCRA 1LEVA 3FJGA 1IMFA 4HS7A 4ZZEA 4IY5A 3Q29A 1RDZA 1FPKA 1KA1A 3PPQA 1AH5A 3EHTA 2NUVA 5CMMA 1MY1A 1ZKBA 1CNQA 4GVOA 4OFOA 1A7LA 3HHFA 1ELJA 2ZYKA 4DCXA 1JW1A 2QS4A 4F3SA 4NEDA 1B2HA 1NUZA 3N6UA 5AA2B 5IZZA 1N7WA 1SDXA 1MXWA 1IQ7A 2PVUA 4QRZA 1M5BA 4H67A 2GH9A 4ZDMA 4JSDA 1JETA 2DE2A 2A5TB 4MAGA 2LAOA 1B7ZA 4F3GA 4ZEFA 2Y5LA 1XVXA 2I4BA 3IFAA 5JEIA 4WXJA 1MY3A 1BIYA 3U1OA 1BK4A 2H25A 2BJJX 4ZEIA 1UTBB 3MWBA 4ZEDA 1FTOA 4O7MA 1N3XA 3H6WA 3QXMA 4Q0CA 3TDJA 3OO9A 4F29A 2R8TA 4I3EA 1FJ6A 5CI5A 2HCAA 3PPPA 3IOUA 4P3LA 1YAEA 4X1DA 5A5XB 2RC8A 5HM4B 2O69A 4HE1A 5IAIA 1TFDA 2DQVA 2H99A 3FUZA 2QS1A 1F9BA 4YB7A 2HZLA 2ZZXA 1TFAA 4P56A 1ZIUA 5EYFA 2QMXA 4IY6A 4R9GA 4ECFA 1KZ8A 1MQGA 4R2FA 5I56B 1CE2A 1CB6A 4OMBA 4LZ5A 2XXVA 5BWJA 4I62A 1MDP1 3N5LA 4FEDA 3Q27A 4R6YA 4F1YA 3TQWA 3SEUA 2Z8DA 1FBEA 3T96B 3OSQA 2I58A 2O7UA 1UIVA 4PFIA 4MNCA 1HSJA 3M3LA 2O7IA 1FPIA 4N6PA 2P3NA 1O7TA 2Z22A 5I5PA 3K6UA 1Q35A 3SERA 4JVCA 2DVCA 1AIVA 2O6AA 4DXCA 3FASA 4MIJA 1FTLA 2HEUA 5H8NB 3G3IA 4U1ZA 1YYZA 3CVGA 2PT1A 3RGYA 4MCOA 4ONYA 1D9QA 2FNCA 3BKIB 3A3UA 4JSOA 4RNSA 2XXWA 4LZ7A 4THIA 3MP6A 3RT8A 1NUXA 1IXIA 3IB2A 1B4ZA 5KCJB 1M5EA 3VVDA 4BDOA 3OOAA 2V3UA 1RDXA 3VE1B 3KJ7A 2DXYA 1QUIA 2H5YA 4TLLB 1LB8A 4ELPA 2XHDA 5AA1A 1IXCA 3OEMA 3CHGA 1Y3PA 2XXUA 4LVQA 4LZ8A 3U72A 2HHMA 1MPCA 5L9MA 4GFRA 2F6GA 2XX8A 5FBPA 4L17A 1NV1A 3S9LC 3T9XB 1MQDA 2DP8A 5LOMA 3TTRA 4F3PA 3RUMA 3ZS6A 4JWOA 3FVNA 3E13X 3UIFA 3FZVA 1ATGA 3A3CA 2D5WA 3TPAA 1JNFA 1PB7A 3V8XB 5EHMA 4DCYA 4JVDA 5EQ8A 3CRBA 1FQFA 2ZMBA 1EZOA 4OA4A 3S9EA 3IJXB 4NF6A 4MNPA 4TLMB 2WX9A 4OVRA 5I2KA 4N6KA 4TQUQ 1N84A 2FIXA 1B40A 4DZ1A 2QS2A 3MW0A 2D3IA 3TELA 5DVFA 5IM2A 1YPNA 1SBPA 3IX1A 4GX3A 4EQ7A 3IL1B 1FPLA 3T9HB 4IO5A 3T1BA 1VR5A 3M8UA 5I58B 4ISUA 4MJOA 5F1QA 4NN3A 3ZSFA 5H8FB 2A5SA 1N04A 4N6DA 4P0IA 4JWXA 3W9VA 1WVJA 3T93B 1DSNA 2YPNA 4N8YA 1QVSA 4POWA 2NOOA 5DW8A 2XXHA 3A09A 4MLVA 1LCFA 3O6IA 1P99A 4OESA 3KBZA 3EKIA 5HPQA 2VGQA 2ONSA 1MXVA 4GWOA 1QW0A 3H03A 2Y7KA 3IO4A 2QSXA 1H45A 2F34A 1PC3A 5TU0A 2PT2A 3FXQA 1EZPA 1Y3QA 1MRPA 4KHZE 3L6HA 1XHYA 1MXYA 4G68C 4OVQA 3MC2A 3FXBA 1AL3A 3K6WA 3G3GA 1IZ1A 3KBRA 4IGRA 5CRYA 4MFIA 2PFZA 5ITOA 2F35A 3M3FA 3OXNA 3ZKKA 3UP9A 1MS7A 4I3YA 4PP0A 2F78A 3FVKA 1R9QA 4YB6A 1IMAA 2XXXA 1POY1 4LN5A 1A54A 3RQTA 1OIBA 3G3JA 2QRYA 4X9TA 2OWTA 3MAMA 4RK2A 4IO3A 3CG3A 2X26A 2O1MA 4PE5B 3I6VA 2QPQA 3C31A 1ZU0A 3PMVA 1FPJA 1RKMA 1LAHE 3K6VA 4GBVA 2F7CA 3MBPA 4KR5A 1FPGA 4RY1A 2XXYA 1M5DA 5KDTA 4MMPA 1ZMGA 3LR1A 4PC9A 3SKPA 3IJOB 4RJZA 4FORA 4R74A 3HV1A 4ZEBA 3G3FA 3MZ1A 4F2QA 3CFZA 1NV2A 1INPA 3LSFB 4PTKA 2M8CA 2VOZA 4DIGA 2V25A 3OMBA 3BFUA 2FVZA 3LBSA 3IB1A 1UQWA 3C9HA 3MZBA 1ZTYA 4XIGQ 2Y7IA 1MG1A 3G3KA 2DVZA 4NG7A 3ILTB 1FBGA 4IO2A 5DEXA 1QUKA 2KQZA 2IA4A 1Q9DA 1B46A 3MJNA 4ZEKA 4ZE9A 3LSXA 4ZE8A 1PB8A 4LUBA 2ZYOA 4NGUA 5TPAA 3SEYA 4XKRA 1DPPA 4YZZA 2CEYA 1NFTA 4AB6A 4F22A 2UVHA 3E9XA 4C1TA 2R71A 1JW5A 4YKPA 2ESNA 4Q30B 1G0HA 4GLIA 3B50A 3TCFA 3KN3A 3N94A 1IIWA 3TQLA 2ZNSA 4P0GA 1USYE 3HCQA 4RPNA 1PDAA 1OQGA 2XXKA 3B6WA 5H8QB 4Z0IA 1NMUA 3QUJA 3GYYA 2GHBA 3U8QA 3R6UA 3UA8A 5JK4A 5F24A 3SESA 3TUSA 5H8HA 3LC8A 3MYUA 4PQJA 3CI8A 4U4SA 1JVYA 4NMYA 4N17A 1MY0A 1TXFA 1USYH 2REJA 1LGBC 3VVFA 4DXUA 4KCCA 4GD5A 5I57A 2B65A 2QVRA 1SI0A 4NAPA 4PE3A 3PUWE 4X04A 2HQ0A 1L5TA 4R72A 3VV5A 1B05A 4GBWA 3D1RA 2QMWA 2XWIA 3OD7A 2XXQA 4P1LA 4M1VA 2ZNUA 4MLQA 1I69A 4H8IA 3PGFA 4ND9A 2XXPA 4NF5B 5CBRA 2XD3A 3FJ7A 3FXUA 2CZHA 2H4IA 5AA4B 1LCTA 1FPFA 5J16A 3TAJA 4PAIA 3UGWA 4DXBA 2XXIA 2PX1A 4KPTA 1DTGA 3KJTA 3IOTA 3PU5A 4KFQA 3K1NA 3MP8A 4IGTA 2V3QA 4QSDA 1LBBA 1N76A 3MQ9A 4IO7A 4OVTA 4NQ8A 1XI6A 3HHGA 3WAFA 4QSEA 4QFLA 3HO7A 4GF8A 3B7DA 1MXZA 1MM6A 5IKBA 1BP5A 1LFHA 1IEJA 1YTVA 3KG2A 5JTYB 1MXUA 3KEIA 1R6ZA 5I2NB 2P1SA 1R1NA 4OERA 2Y5KA 3PPNA 1DOTA 1H43A 4GXSB 1S9TA 3MPLA 1SVXB 1MDQA 4O8MA 3ZKLA 4C1UA 1A8FA 5L8DA 3H6UA 1FPEA 2ZYNA 1OVTA 4ELRA 1LBWA 3TMGA 2Y7PA 4R6HA 3DP8A 3D4GA 5B70A 3KGCA 3MVZA 3FVOA 3IR1A 3SEWA 4FAJA 4H65A 2GQ1A 4F18A 1NUWA 3E3KA 3GLBA 4EF2A 3T9UA 4BDMA 2Q2CA 3O9PA 4O94A 2DWIA 5ET7A 5IZ3A 1I6BA 2PBWA 1B9JA 4OEVA 1MY4A 4LQ2A 3RPLA 2I4CA 3H06B 4WEPA 3I5OA 3O28A 1B4HA 4PFTA 1MY2A 4P11A 3SEXA 1LB9A 1NH7A 2KLFA 1MH3A 1Z7NE 5DVIA 1URSA 2FHYA 1QKBA 3K6XA 4PBHA 1AWBA 3HPIA 4OVPA 2I49A 1FRPA 1FQCA 3MVWA 3SZPA 3I3VA 1LBCA 4O7IA 3FBPA 4OZ9A 2VPNA 4XEQA 2OCUA 4G2ZA 2YLNA 4OTEA 3OEKA 5HBCA 3DM0A 1SW2A 4ESXA 2XWOA 4U21A 4F3BA 1FQDA 2OZZA 4P47A 1A8EA 4PFRA 4PF8A 1PBQA 4QFNA 2F7AA 4PCDA 3C4MA 3H3GA 3KC0A 4MNIA 3SEVA 3C36A 1B51A 4YICA 2O84X 5DEXB 3TODA 2Y7WA 3T66A 2CEXA 1PB9A 4WKMA 2CZIA 3DELB 4OFJA 3PMWA 5TPAB 3C32A 2D21A 4NWDA 3VLWA 2REGA 4U22A 1GVCA 3PV0E 1IXHA 3RNNA 1B3GA 1I6QA 1FBHA 5DT6A 4G8HA 4N13A 1XVYA 1FW0A 5BUUA 1FBFA 4KD5A 4HW8A 2YJPA 3U92A 3TTMA 3IFCA 1Y9UA 4PGNA 5ISUA 4YB5A 3KSXA 1A99A 5L9SA 4F1VA 4U2RA 3PUXE 2WYPA 3S4UA 1LLSA 2ZYMA 2DE3A 4IB2A 4NX1A 4G61A 3QK6A 4PFYA 4TOZA 1DCUA 3H6VA 5CBSA 4GWYA 4MH5A 3VXCA 4O3CA 2OWZA 1NL5A 3C33A 3VLVA 2QS3A 2DXRA 2OWSA 4AS4A 1Y1MA 5AA2D 2HPGA 3R26A 4FE8A 3NOHA 4F1UA 4AS5A 3RPWA 4Q5TA 2ZXTA 4NE4A 3TTLA 1PBPA 4UACA 4ELOA 1Y4TA 1KWHA 1B6HA 5I57B 3O29A 4RK9A 3M3KA 2VD2A 1MXXA 4XKNA 1SYHA 4ZS9A 1YCJA 1SI1A 1FQAA 5DTBA 3RYDA 5EYGA 1O64A 1RYOA 1VE4A 1FTJA 2OX3A 4GWXA 3PUZE 2H9BA 3KSJA 5IZ1A 1URGA 4U23A 3PUVE 4EQ9A 2MKZA 4NF8A 5B7DA 1FTAA 1IITA 2F36A 3F11A 5A5XA 3TCHA 3PPRA 4N91A 3SDFA 4EUOA 3ECRA 3LUZA 2ABHA 1N7XA 4AQ4A 2XD2A 2F6PA 2RC7A 4NF4A 4GX6A 1NNFA 4I40A 2Y7RA 5A5LA 3PD8A 3UN6A 3JZJA 4X1BA 1Q1KA 3FATA 1NUYA 2ONRA 4QF9A 1FCKA 1FSAA 3O66A 3TEPA 3S2VA 1GV8A 3N26A 1ANFA 4EF1A 3GBAA 1IXGA 4H1XA 3D4CA 2NWJA 4IO6A 4QFOA 3ROJA 3O97A 4OETA 4GRKA 2DOJA 2HFBA 3FGSA 2Z23A 2QL3A 4EXLA 2GHAA 4BDQA 2WBBA 2ZZVA 1B52A 4FEBA 2UYFA 2PFYA 4PBQA 1DMBA 5DVJA 4LATA 4I1DA 3Q28A 4LP2B 2RCAA 4GWUA 2RCBA 3QYTA 1OMPA 2F3DA 3CFXA 1MH4A 1D9VA 3HSTA 4XKQA 1H3DA 2UYEA 1FPBA 4N4UA 4GL0A 4MEVA 3FXRA 4PFUA 2P0SA 3PMXA 3U94A 3USDA 1KA0A 2XWVA 4QSCA 1LBXA 2G93A 1B3HA 1MQIA 1XT8A 2XXRA 3TCGA 1QUJA 2Q9TA 5IZ3B 2RINA 2RKMA 1O63A 3RPLB 1UIUA 3LUYA 3EHSA 4RYAA 2HXRA 4KYEA 4I9DA 1LAXA 1N3WA 4M4GA 1ZLQA 2Q8JA 5ITPA 3E79A 3JYRA 4H0WA 3ONMA 4KXPA 3RN8A 4DI4B 1A55A 5CMBA 2XWKA 4QFKA 4H46A 5CMCA 4NHBA 3V83A 4JB7A 3T9VA 2G29A 3K02A 4R6KA 4UABA 3N6TA 3V5AA 3C34A 2ANJA 3R7XA 3T0JA 4KI0E 2X7QA 1D3KA 4YMAA 2VP1A 1URDA 4G68A 1JP4A 4IR8A 2CZLA 5EQ7A 1H44A 5ICQA 3KFMA 3LV0A 1OLAA 5I58A 4KYSA 4LA9A 2DWHA 4GIZA 3B8BA 2OLBA 1Y20A 2NVUB 4U1OA 2V93A 2R9JA 3MPKA 4PETA 2O68A 1LBYA 1T0KA 2DWJA 3HN0A 3LSLA 4JDFA 3RTFB 2DYXA 3T22A 1B5IA 3ISPA 4F19A 1HSEA 3P7IA 4DE8A 2CMOA 4RXLA 3JV9A 1MM7A 4NF6B 2W7YA 4JWYA 2AL5A 5I2KB 3V89B 1SQYA 1P1OA 1H76A 2F5XA 4DI3D 5I3SA 5H8SA 1JVXA 1NI9A 1B3LA 1LAGE 2DWAA 2E1SA 1D4NA 1B5HA 2FYIA 1JQFA 2Z8FA 1BKAA 3LSWA 4H5GA 3K0VA 4F2OA 2HAUA 3CIJA 2ALUA 3GZGA 1EYKA 4QFPA 4G8NA 4ELQA 3AXFA 5CM6A 3RTWB 3TTNA 3H4ZA 2RC9A 3TYHA 4NF0A 2DS9A 2WYKA 4R2BA 1VFDA 2PYYA 2B4LA 4G8MA 4R9FA 5F7VA 2F97A 2GRVA 1QJMA 3PUYE 3OELA 4XF5A 2DDKA 1RYXA 3QMFA 2ZZWA 3RT6B 4MF3A 4X8RA 5FTHA 2Z8EA 1SYIA 2H98A 1FPDA 5EHSA 5TP9A 4NF8B 1P1WA 3CFLA 4PAFA 1G0IA 4GXAA 2Q89A 2VPOA 4EQBA 4HE0A 3KN7A 4PDDA 1US5A 4NF4B 4HTGA 3WAEA 4FECA 1SPIA 1TWYA 2IEEA 2Q88A 3U93A 4OFLA 5ELVA 4YKIA 1P1QA 4LONB 1NH8A 4PF6A 1B1HA 1HSLA 3B6TA 4N81A 2B4MA 1B3EA 3GXAA 3EF7A 4FBPA 3RLFE 4HE2A 4E0WA 4PGPA 5K2YA 4PDHA 3S9NC 2O51A 1B58A 1S50A 1FBDA 2UVGA 4N8GA 4R75A 4DLDA 1ZBMA 2ZNTA 5ET6A 1M5CA 3VFJA 2Q2AA 3EQ1A 1ZJLA 1VFEA 3KOSA 2JJKA 2I0BA 2AYSA 1PEBA 1UTHA 5KDTB 1I6AA 1II5A 3KN8A 1LAFE 1NV0A 1FQEA 1OLCA 1DPEA 1DBZA 3EPEA 3FVGA 1B7UA 1EYIA 1BLFA 4XFEA 3K1MA 4E0XA 3CSGA 5H8QA 1M5FA 1SW5A 2WKYA 3H6TA 1QGXA 1SD3A 2VD3A 3DP6A 4UA8A 4GWZA 4U4XA 3IO6A 1B7HA 4C0RA 3G7WA 3DP4A 1BTJA 1LBZA 4YKJA 2DSFA 4O3BA 3UK4A 3QUFA 5I59A 2NXOA 4JVIA 4PFWA 2OK2A 1NNPA 2WEFA 4OYVA 4EXKA 1JEVA 4BDNA 3IB0A 3G3HA 1QKAA 4GQOA 5J1DA 5FHMA 4IO4A 2AIXA 1FBCA 5FHNA 2OBGA 1K9ZA 2P3VA 4F39A 4EDPA 1LFGA 3OO8A 4GX4A 3ILUB 2Q74A 1TT1A 2AL4A 4BLAA 2THIA 3DLNA 4ZECA 2XA5A 3MVXA 4PAKA 2F7BA 5I84A 4NF5A 5H8HB 1FJ9A 4N15A 2XXTA 4NTLA 1A40A 1D9YA 1R9LA 5FHOA 5AA4A 4KQPA 1B32A 3OENA 4YU0A 4BDRA 2Y84A 4YAHX 1NNKA 5DYHA 4G68B 5AA2A 1XS5A 3BBRA 2BJIA 2VHAA 1IMEA 3S9MC 1B3FA 1WODA 3CR9A 3K1PA 2DE4A 2E0SA 4X48A 2XX9A 3TFLA 3W9WA 3KZGA 2ONKE 2A5TA 3BIHA 3TTKA 3FD3A 4AB5A 1B5JA 4YMBA 4G4PA 4O3AA 4OENA 5AE4A 1LSTA 1US4A 2WBDA 2RF1A 3E4RA 1B0LA 1B1XA 1UTBA 3PD9A 3QIMA 4OXVA 4OEUA 5JTYA
chains in the Genus database with same CATH topology
5I2NA 1LFIA 1P1NA 4H5FA 3FV2A 3OO6A 4HCYA 3IK6B 5K2XA 1VSOA 3FIRA 3SETA 3K01A 1POTA 3OSRA 2X7PA 4MBPA 3H7MA 1Y4CA 5I56A 1SW1A 3RY3A 4Q8RA 4F31B 3K2DA 2V3TA 3ODBA 3VVEA 3BFTA 1EH3A 3EN3A 1QULA 4ESWA 2I3VA 3C35A 4HCWA 4OVJA 3L6GA 4LQ5A 4XKPA 1AMFA 2HZKA 3Q26A 2I0CA 4YKKA 3UORA 2XX7A 2I3WA 2P2AA 3MZ9A 1JW4A 4POXA 5KZTA 3W15C 4XTCQ 5TP9B 4H6DA 1IUDA 1EU8A 3QAXA 5H8NA 4Z7EA 1GGGA 4GOTA 1MQJA 1B0HA 1GR2A 3Q25A 3OO7A 4KYDA 1N0TA 2PMSA 4RA1A 4I8CA 4XXUA 3VLUA 1JEUA 5L9OA 1WDNA 5CC2A 4GL8A 1NKXA 1S7YA 5KCJA 2I6EA 3TZAA 3IOWA 1SW4A 3K00A 2I48A 1DTZA 3K4UA 1MPBA 4OQOA 4FATA 2B3FA 3PPOA 1OVBA 4KCDA 4BDLA 1EZ9A 1FQBA 4OWDA 2HAVA 4RPOA 4NWCA 3MUQA 3FJMA 2F8DA 1GTKA 4H8JA 2UXAA 1UTHB 2FA7A 4JBZA 2V84A 1MPDA 1Z7ME 3THIA 3QSLA 2QJEA 1P1UA 2B3BA 2O1LA 5M2VA 1Y1ZA 3O6HA 4R73A 3VXBA 4QHQA 2GFEA 2UVJA 5FTIA 3TKDA 3MVYA 2OJTA 5ICTA 5AA3A 1OQHA 3CG1A 1XC1A 1AOVA 4JXIA 4OHNA 3IORA 2UVIA 1XOCA 1MQHA 4ZZAA 3EHUA 3VDFA 4FIMA 3CSBA 5I59B 3IOVA 4WEDA 5H8FA 3IAZA 2R6GE 3O6GA 1NNTA 4K3FA 3KOTA 4N07A 5CMKA 1FTMA 3B6QA 4FJPA 1J1NA 3MP1A 3O2AA 4DDDA 2HXWA 4G77A 3GBBA 1FTKA 1Y3NA 3FV1A 3FJGA 4HS7A 4ZZEA 4IY5A 3Q29A 3PPQA 1AH5A 3EHTA 2NUVA 5CMMA 1MY1A 1ZKBA 4GVOA 4OFOA 1A7LA 3HHFA 1ELJA 2ZYKA 4DCXA 1JW1A 2QS4A 4F3SA 4NEDA 1B2HA 3N6UA 5AA2B 1N7WA 1SDXA 1MXWA 1IQ7A 2PVUA 4QRZA 1M5BA 4H67A 2GH9A 4ZDMA 4JSDA 1JETA 2DE2A 2A5TB 2LAOA 1B7ZA 4F3GA 4ZEFA 5JEIA 1XVXA 2I4BA 4WXJA 1MY3A 1BIYA 3U1OA 2H25A 2BJJX 4ZEIA 1UTBB 3MWBA 4ZEDA 1FTOA 1N3XA 3H6WA 3QXMA 4Q0CA 3TDJA 3OO9A 4F29A 5CI5A 2HCAA 3PPPA 3IOUA 1YAEA 4X1DA 5A5XB 2RC8A 5HM4B 2O69A 5IAIA 1TFDA 2DQVA 2H99A 3FUZA 2QS1A 1F9BA 4YB7A 2HZLA 1TFAA 1ZIUA 5EYFA 2QMXA 4IY6A 4R9GA 4ECFA 1MQGA 4R2FA 5I56B 1CE2A 1CB6A 4OMBA 4LZ5A 2XXVA 5BWJA 4I62A 1MDP1 3N5LA 4FEDA 3Q27A 4R6YA 4F1YA 3TQWA 3SEUA 2Z8DA 3T96B 3OSQA 2I58A 2O7UA 1UIVA 1HSJA 3M3LA 2O7IA 4N6PA 1O7TA 2Z22A 3K6UA 1Q35A 3SERA 2DVCA 1AIVA 2O6AA 4DXCA 3FASA 1FTLA 2HEUA 5H8NB 3G3IA 4U1ZA 3CVGA 2PT1A 3RGYA 4ONYA 2FNCA 3BKIB 3A3UA 4JSOA 4RNSA 2XXWA 4LZ7A 4THIA 3MP6A 3RT8A 1IXIA 3IB2A 1B4ZA 5KCJB 1M5EA 3VVDA 4BDOA 3OOAA 2V3UA 3VE1B 3KJ7A 2DXYA 1QUIA 2H5YA 4TLLB 1LB8A 4ELPA 2XHDA 5AA1A 1IXCA 3OEMA 1Y3PA 2XXUA 4LVQA 4LZ8A 3U72A 1MPCA 5L9MA 4GFRA 2F6GA 2XX8A 4L17A 3S9LC 3T9XB 1MQDA 2DP8A 5LOMA 3TTRA 4F3PA 3RUMA 3ZS6A 4JWOA 3FVNA 3E13X 3UIFA 3FZVA 1ATGA 3A3CA 2D5WA 3TPAA 1JNFA 1PB7A 3V8XB 5EHMA 4DCYA 3CRBA 1FQFA 2ZMBA 1EZOA 3S9EA 3IJXB 4NF6A 4TLMB 5I2KA 4TQUQ 1N84A 1B40A 4DZ1A 2QS2A 3MW0A 2D3IA 3TELA 5DVFA 1YPNA 1SBPA 3IX1A 4EQ7A 3IL1B 3T9HB 4IO5A 1VR5A 3M8UA 5I58B 4ISUA 5F1QA 3ZSFA 5H8FB 2A5SA 1N04A 4P0IA 4JWXA 3W9VA 1WVJA 3T93B 1DSNA 2YPNA 1QVSA 4POWA 2NOOA 2XXHA 3A09A 4MLVA 1LCFA 3O6IA 1P99A 4OESA 5HPQA 2VGQA 2ONSA 1MXVA 4GWOA 1QW0A 3H03A 2Y7KA 3IO4A 2QSXA 1H45A 2F34A 1PC3A 5TU0A 2PT2A 3FXQA 1EZPA 1Y3QA 1MRPA 4KHZE 3L6HA 1XHYA 1MXYA 4G68C 3MC2A 1AL3A 3K6WA 3G3GA 1IZ1A 3KBRA 4IGRA 5CRYA 4MFIA 5ITOA 2F35A 3M3FA 3OXNA 3ZKKA 3UP9A 1MS7A 4PP0A 2F78A 3FVKA 1R9QA 4YB6A 2XXXA 1POY1 1A54A 3RQTA 1OIBA 3G3JA 2QRYA 4X9TA 2OWTA 3MAMA 4RK2A 4IO3A 3CG3A 2X26A 2O1MA 4PE5B 3I6VA 2QPQA 3C31A 1ZU0A 3PMVA 1RKMA 1LAHE 3K6VA 2F7CA 3MBPA 4KR5A 4RY1A 2XXYA 1M5DA 5KDTA 1ZMGA 3LR1A 3SKPA 3IJOB 4RJZA 4FORA 4R74A 3HV1A 4ZEBA 3G3FA 3MZ1A 4F2QA 3CFZA 3LSFB 2M8CA 2VOZA 4DIGA 2V25A 3OMBA 3BFUA 3IB1A 3LBSA 1UQWA 3C9HA 3MZBA 1ZTYA 4XIGQ 2Y7IA 1MG1A 3G3KA 2DVZA 3ILTB 4IO2A 5DEXA 1QUKA 2IA4A 1B46A 3MJNA 4ZEKA 4ZE9A 3LSXA 4ZE8A 1PB8A 4LUBA 2ZYOA 5TPAA 3SEYA 4XKRA 1DPPA 4YZZA 1NFTA 4AB6A 4F22A 2UVHA 3E9XA 4C1TA 2R71A 1JW5A 4YKPA 2ESNA 4Q30B 4GLIA 3TCFA 3KN3A 3N94A 1IIWA 3TQLA 2ZNSA 4P0GA 1USYE 3HCQA 4RPNA 1PDAA 1OQGA 3B6WA 5H8QB 4Z0IA 1NMUA 3QUJA 2GHBA 3U8QA 3R6UA 3UA8A 5JK4A 3SESA 3TUSA 5H8HA 3LC8A 4PQJA 3CI8A 4U4SA 1JVYA 4NMYA 1MY0A 1TXFA 1USYH 2REJA 1LGBC 3VVFA 4DXUA 4KCCA 4GD5A 5I57A 2B65A 1SI0A 3PUWE 2HQ0A 1L5TA 4R72A 3VV5A 1B05A 2QMWA 3OD7A 2XXQA 4M1VA 2ZNUA 4MLQA 1I69A 4H8IA 3PGFA 4ND9A 2XXPA 4NF5B 5CBRA 2XD3A 3FJ7A 3FXUA 2H4IA 5AA4B 1LCTA 3TAJA 3UGWA 4DXBA 2XXIA 2PX1A 4KPTA 1DTGA 3KJTA 3IOTA 3PU5A 4KFQA 3K1NA 3MP8A 4IGTA 2V3QA 4QSDA 1LBBA 1N76A 3MQ9A 4IO7A 3HHGA 3WAFA 4QSEA 4QFLA 3HO7A 4GF8A 3B7DA 1MXZA 1MM6A 5IKBA 1BP5A 1LFHA 1IEJA 1YTVA 3KG2A 5JTYB 1MXUA 3KEIA 1R6ZA 5I2NB 2P1SA 1R1NA 4OERA 3PPNA 1DOTA 1H43A 4GXSB 1S9TA 3MPLA 1SVXB 1MDQA 3ZKLA 4C1UA 1A8FA 5L8DA 3H6UA 2ZYNA 1OVTA 4ELRA 3TMGA 2Y7PA 4R6HA 3DP8A 3D4GA 5B70A 3KGCA 3MVZA 3FVOA 3IR1A 3SEWA 4FAJA 4H65A 4F18A 3E3KA 3GLBA 4EF2A 3T9UA 4BDMA 2Q2CA 3O9PA 2DWIA 1I6BA 2PBWA 1B9JA 4OEVA 1MY4A 4LQ2A 2I4CA 3H06B 4WEPA 3I5OA 3O28A 1B4HA 4PFTA 1MY2A 4P11A 3SEXA 1LB9A 1NH7A 2KLFA 1MH3A 1Z7NE 5DVIA 1URSA 1QKBA 3K6XA 3HPIA 2I49A 1FQCA 3MVWA 3I3VA 1LBCA 4OZ9A 2OCUA 4G2ZA 2YLNA 4OTEA 3OEKA 5HBCA 3DM0A 1SW2A 4ESXA 4U21A 4F3BA 1FQDA 2OZZA 1A8EA 1PBQA 2F7AA 4QFNA 3C4MA 3H3GA 3SEVA 3C36A 1B51A 4YICA 2O84X 5DEXB 3TODA 2Y7WA 3T66A 1PB9A 4WKMA 3DELB 4OFJA 3PMWA 5TPAB 3C32A 2D21A 4NWDA 3VLWA 2REGA 4U22A 1GVCA 3PV0E 1IXHA 3RNNA 1B3GA 1I6QA 5DT6A 4G8HA 4N13A 1XVYA 1FW0A 5BUUA 4HW8A 4KD5A 2YJPA 3U92A 3TTMA 1Y9UA 5ISUA 4YB5A 3KSXA 1A99A 5L9SA 4F1VA 4U2RA 3PUXE 3S4UA 1LLSA 2ZYMA 2DE3A 4IB2A 3QK6A 4PFYA 4TOZA 3H6VA 5CBSA 4MH5A 3VXCA 4O3CA 1NL5A 3C33A 3VLVA 2QS3A 2DXRA 2OWSA 1Y1MA 5AA2D 4F1UA 3R26A 4FE8A 3RPWA 4Q5TA 2ZXTA 4NE4A 3TTLA 1PBPA 4UACA 4ELOA 1Y4TA 1KWHA 1B6HA 5I57B 3O29A 4RK9A 3M3KA 2VD2A 1MXXA 4XKNA 1SYHA 4ZS9A 1YCJA 1SI1A 1FQAA 5DTBA 1O64A 1RYOA 1VE4A 1FTJA 3PUZE 2H9BA 3KSJA 1URGA 4U23A 3PUVE 4EQ9A 4NF8A 5B7DA 1IITA 2F36A 3F11A 5A5XA 3TCHA 3PPRA 3SDFA 4EUOA 3ECRA 2ABHA 1N7XA 4AQ4A 2XD2A 2F6PA 2RC7A 4NF4A 1NNFA 2Y7RA 3PD8A 3UN6A 3JZJA 4X1BA 1Q1KA 3FATA 4QF9A 2ONRA 1FCKA 3O66A 3TEPA 3S2VA 1GV8A 3N26A 1ANFA 4EF1A 3GBAA 1IXGA 4H1XA 3D4CA 2NWJA 4IO6A 4QFOA 3O97A 4OETA 4GRKA 2DOJA 2HFBA 3FGSA 2Z23A 2QL3A 4EXLA 2GHAA 4BDQA 1B52A 4FEBA 2UYFA 1DMBA 5DVJA 4LATA 4I1DA 3Q28A 4LP2B 2RCAA 2RCBA 3QYTA 1OMPA 3CFXA 1MH4A 1D9VA 3HSTA 4XKQA 1H3DA 2UYEA 4GL0A 3FXRA 4PFUA 2P0SA 3PMXA 3U94A 3USDA 4QSCA 2G93A 1B3HA 1MQIA 1XT8A 2XXRA 3TCGA 1QUJA 2Q9TA 2RINA 2RKMA 1O63A 1UIUA 3LUYA 3EHSA 4RYAA 4KYEA 4I9DA 1LAXA 1N3WA 4M4GA 1ZLQA 2Q8JA 5ITPA 3JYRA 4H0WA 3ONMA 3RN8A 1A55A 5CMBA 4QFKA 5CMCA 3V83A 4JB7A 3T9VA 2G29A 3K02A 4R6KA 3N6TA 3V5AA 3C34A 2ANJA 3R7XA 4KI0E 2X7QA 1D3KA 4YMAA 2VP1A 1URDA 4G68A 2CZLA 1H44A 5ICQA 3KFMA 1OLAA 5I58A 4KYSA 4LA9A 2DWHA 4GIZA 2OLBA 1Y20A 2NVUB 4U1OA 2V93A 2R9JA 3MPKA 4PETA 2O68A 1T0KA 2DWJA 3HN0A 3LSLA 4JDFA 3RTFB 2DYXA 3T22A 1B5IA 4F19A 1HSEA 3P7IA 4DE8A 2CMOA 4RXLA 3JV9A 1MM7A 4NF6B 2W7YA 4JWYA 2AL5A 5I2KB 3V89B 1SQYA 1P1OA 1H76A 2F5XA 5H8SA 1JVXA 1B3LA 1LAGE 2DWAA 2E1SA 1D4NA 1B5HA 2FYIA 1JQFA 2Z8FA 1BKAA 3LSWA 4H5GA 3K0VA 4F2OA 2HAUA 3CIJA 2ALUA 3GZGA 4QFPA 4G8NA 4ELQA 3AXFA 5CM6A 3RTWB 3TTNA 3H4ZA 2RC9A 3TYHA 2DS9A 4R2BA 1VFDA 2PYYA 4G8MA 4R9FA 5F7VA 2F97A 2GRVA 1QJMA 3PUYE 3OELA 1RYXA 3RT6B 4MF3A 5FTHA 2Z8EA 1SYIA 2H98A 5EHSA 5TP9A 4NF8B 1P1WA 3CFLA 4GXAA 2Q89A 4EQBA 3KN7A 1US5A 4NF4B 4HTGA 3WAEA 4FECA 1TWYA 2IEEA 2Q88A 3U93A 4OFLA 5ELVA 4YKIA 1P1QA 4LONB 1NH8A 1B1HA 1HSLA 3B6TA 3GXAA 1B3EA 3EF7A 3RLFE 4E0WA 5K2YA 3S9NC 2O51A 1B58A 1S50A 2UVGA 4R75A 4DLDA 1ZBMA 2ZNTA 1M5CA 3VFJA 2Q2AA 3EQ1A 1ZJLA 1VFEA 3KOSA 2I0BA 2AYSA 1PEBA 1UTHA 5KDTB 1I6AA 1II5A 3KN8A 1LAFE 1FQEA 1OLCA 1DPEA 3EPEA 3FVGA 1B7UA 1BLFA 3K1MA 4E0XA 3CSGA 5H8QA 1M5FA 1SW5A 2WKYA 3H6TA 1SD3A 2VD3A 3DP6A 4UA8A 4U4XA 3IO6A 1B7HA 4C0RA 3G7WA 3DP4A 1BTJA 4YKJA 2DSFA 4O3BA 3UK4A 3QUFA 5I59A 2NXOA 4PFWA 2OK2A 1NNPA 4OYVA 4EXKA 1JEVA 4BDNA 3IB0A 3G3HA 1QKAA 4GQOA 5J1DA 5FHMA 4IO4A 2AIXA 5FHNA 2OBGA 4F39A 4EDPA 1LFGA 3OO8A 3ILUB 1TT1A 2AL4A 4BLAA 2THIA 3DLNA 4ZECA 3MVXA 2F7BA 5I84A 4NF5A 5H8HB 2XXTA 4NTLA 1A40A 1D9YA 1R9LA 5FHOA 5AA4A 4KQPA 1B32A 3OENA 4YU0A 4BDRA 2Y84A 4YAHX 1NNKA 5DYHA 4G68B 5AA2A 1XS5A 3BBRA 2VHAA 3S9MC 1B3FA 1WODA 3CR9A 3K1PA 2DE4A 2E0SA 4X48A 2XX9A 3TFLA 3W9WA 3KZGA 2ONKE 2A5TA 3TTKA 3FD3A 4AB5A 1B5JA 4YMBA 4G4PA 4O3AA 4OENA 5AE4A 1LSTA 1US4A 2RF1A 3E4RA 1B0LA 1B1XA 1UTBA 3PD9A 3QIMA 4OXVA 4OEUA 5JTYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5I2N A;  1LFI A;  1P1N A;  4H5F A;  3FV2 A;  3OO6 A;  4HCY A;  3IK6 B;  5K2X A;  1VSO A;  3FIR A;  3SET A;  3K01 A;  1POT A;  3OSR A;  2X7P A;  4MBP A;  3H7M A;  1Y4C A;  5I56 A;  1SW1 A;  3RY3 A;  4Q8R A;  4F31 B;  3K2D A;  2V3T A;  3ODB A;  3VVE A;  3BFT A;  1EH3 A;  3EN3 A;  1QUL A;  4ESW A;  2I3V A;  3C35 A;  4HCW A;  4OVJ A;  3L6G A;  4LQ5 A;  4XKP A;  1AMF A;  2HZK A;  3Q26 A;  2I0C A;  4YKK A;  3UOR A;  2XX7 A;  2I3W A;  2P2A A;  3MZ9 A;  1JW4 A;  4POX A;  5KZT A;  3W15 C;  4XTC Q;  5TP9 B;  4H6D A;  1IUD A;  1EU8 A;  3QAX A;  5H8N A;  4Z7E A;  1GGG A;  4GOT A;  1MQJ A;  1B0H A;  1GR2 A;  3Q25 A;  3OO7 A;  4KYD A;  1N0T A;  2PMS A;  4RA1 A;  4I8C A;  4XXU A;  3VLU A;  1JEU A;  5L9O A;  1WDN A;  5CC2 A;  4GL8 A;  1NKX A;  1S7Y A;  5KCJ A;  2I6E A;  3TZA A;  3IOW A;  1SW4 A;  3K00 A;  2I48 A;  1DTZ A;  3K4U A;  1MPB A;  4OQO A;  4FAT A;  2B3F A;  3PPO A;  1OVB A;  4KCD A;  4BDL A;  1EZ9 A;  1FQB A;  4OWD A;  2HAV A;  4RPO A;  4NWC A;  3MUQ A;  3FJM A;  2F8D A;  1GTK A;  4H8J A;  2UXA A;  1UTH B;  2FA7 A;  4JBZ A;  2V84 A;  1MPD A;  1Z7M E;  3THI A;  3QSL A;  2QJE A;  1P1U A;  2B3B A;  2O1L A;  5M2V A;  1Y1Z A;  3O6H A;  4R73 A;  3VXB A;  4QHQ A;  2GFE A;  2UVJ A;  5FTI A;  3TKD A;  3MVY A;  2OJT A;  5ICT A;  5AA3 A;  1OQH A;  3CG1 A;  1XC1 A;  1AOV A;  4JXI A;  4OHN A;  3IOR A;  2UVI A;  1XOC A;  1MQH A;  4ZZA A;  3EHU A;  3VDF A;  4FIM A;  3CSB A;  5I59 B;  3IOV A;  4WED A;  5H8F A;  3IAZ A;  2R6G E;  3O6G A;  1NNT A;  4K3F A;  3KOT A;  4N07 A;  5CMK A;  1FTM A;  3B6Q A;  4FJP A;  1J1N A;  3MP1 A;  3O2A A;  4DDD A;  2HXW A;  4G77 A;  3GBB A;  1FTK A;  1Y3N A;  3FV1 A;  3FJG A;  4HS7 A;  4ZZE A;  4IY5 A;  3Q29 A;  3PPQ A;  1AH5 A;  3EHT A;  2NUV A;  5CMM A;  1MY1 A;  1ZKB A;  4GVO A;  4OFO A;  1A7L A;  3HHF A;  1ELJ A;  2ZYK A;  4DCX A;  1JW1 A;  2QS4 A;  4F3S A;  4NED A;  1B2H A;  3N6U A;  5AA2 B;  1N7W A;  1SDX A;  1MXW A;  1IQ7 A;  2PVU A;  4QRZ A;  1M5B A;  4H67 A;  2GH9 A;  4ZDM A;  4JSD A;  1JET A;  2DE2 A;  2A5T B;  2LAO A;  1B7Z A;  4F3G A;  4ZEF A;  5JEI A;  1XVX A;  2I4B A;  4WXJ A;  1MY3 A;  1BIY A;  3U1O A;  2H25 A;  2BJJ X;  4ZEI A;  1UTB B;  3MWB A;  4ZED A;  1FTO A;  1N3X A;  3H6W A;  3QXM A;  4Q0C A;  3TDJ A;  3OO9 A;  4F29 A;  5CI5 A;  2HCA A;  3PPP A;  3IOU A;  1YAE A;  4X1D A;  5A5X B;  2RC8 A;  5HM4 B;  2O69 A;  5IAI A;  1TFD A;  2DQV A;  2H99 A;  3FUZ A;  2QS1 A;  1F9B A;  4YB7 A;  2HZL A;  1TFA A;  1ZIU A;  5EYF A;  2QMX A;  4IY6 A;  4R9G A;  4ECF A;  1MQG A;  4R2F A;  5I56 B;  1CE2 A;  1CB6 A;  4OMB A;  4LZ5 A;  2XXV A;  5BWJ A;  4I62 A;  1MDP 1;  3N5L A;  4FED A;  3Q27 A;  4R6Y A;  4F1Y A;  3TQW A;  3SEU A;  2Z8D A;  3T96 B;  3OSQ A;  2I58 A;  2O7U A;  1UIV A;  1HSJ A;  3M3L A;  2O7I A;  4N6P A;  1O7T A;  2Z22 A;  3K6U A;  1Q35 A;  3SER A;  2DVC A;  1AIV A;  2O6A A;  4DXC A;  3FAS A;  1FTL A;  2HEU A;  5H8N B;  3G3I A;  4U1Z A;  3CVG A;  2PT1 A;  3RGY A;  4ONY A;  2FNC A;  3BKI B;  3A3U A;  4JSO A;  4RNS A;  2XXW A;  4LZ7 A;  4THI A;  3MP6 A;  3RT8 A;  1IXI A;  3IB2 A;  1B4Z A;  5KCJ B;  1M5E A;  3VVD A;  4BDO A;  3OOA A;  2V3U A;  3VE1 B;  3KJ7 A;  2DXY A;  1QUI A;  2H5Y A;  4TLL B;  1LB8 A;  4ELP A;  2XHD A;  5AA1 A;  1IXC A;  3OEM A;  1Y3P A;  2XXU A;  4LVQ A;  4LZ8 A;  3U72 A;  1MPC A;  5L9M A;  4GFR A;  2F6G A;  2XX8 A;  4L17 A;  3S9L C;  3T9X B;  1MQD A;  2DP8 A;  5LOM A;  3TTR A;  4F3P A;  3RUM A;  3ZS6 A;  4JWO A;  3FVN A;  3E13 X;  3UIF A;  3FZV A;  1ATG A;  3A3C A;  2D5W A;  3TPA A;  1JNF A;  1PB7 A;  3V8X B;  5EHM A;  4DCY A;  3CRB A;  1FQF A;  2ZMB A;  1EZO A;  3S9E A;  3IJX B;  4NF6 A;  4TLM B;  5I2K A;  4TQU Q;  1N84 A;  1B40 A;  4DZ1 A;  2QS2 A;  3MW0 A;  2D3I A;  3TEL A;  5DVF A;  1YPN A;  1SBP A;  3IX1 A;  4EQ7 A;  3IL1 B;  3T9H B;  4IO5 A;  1VR5 A;  3M8U A;  5I58 B;  4ISU A;  5F1Q A;  3ZSF A;  5H8F B;  2A5S A;  1N04 A;  4P0I A;  4JWX A;  3W9V A;  1WVJ A;  3T93 B;  1DSN A;  2YPN A;  1QVS A;  4POW A;  2NOO A;  2XXH A;  3A09 A;  4MLV A;  1LCF A;  3O6I A;  1P99 A;  4OES A;  5HPQ A;  2VGQ A;  2ONS A;  1MXV A;  4GWO A;  1QW0 A;  3H03 A;  2Y7K A;  3IO4 A;  2QSX A;  1H45 A;  2F34 A;  1PC3 A;  5TU0 A;  2PT2 A;  3FXQ A;  1EZP A;  1Y3Q A;  1MRP A;  4KHZ E;  3L6H A;  1XHY A;  1MXY A;  4G68 C;  3MC2 A;  1AL3 A;  3K6W A;  3G3G A;  1IZ1 A;  3KBR A;  4IGR A;  5CRY A;  4MFI A;  5ITO A;  2F35 A;  3M3F A;  3OXN A;  3ZKK A;  3UP9 A;  1MS7 A;  4PP0 A;  2F78 A;  3FVK A;  1R9Q A;  4YB6 A;  2XXX A;  1POY 1;  1A54 A;  3RQT A;  1OIB A;  3G3J A;  2QRY A;  4X9T A;  2OWT A;  3MAM A;  4RK2 A;  4IO3 A;  3CG3 A;  2X26 A;  2O1M A;  4PE5 B;  3I6V A;  2QPQ A;  3C31 A;  1ZU0 A;  3PMV A;  1RKM A;  1LAH E;  3K6V A;  2F7C A;  3MBP A;  4KR5 A;  4RY1 A;  2XXY A;  1M5D A;  5KDT A;  1ZMG A;  3LR1 A;  3SKP A;  3IJO B;  4RJZ A;  4FOR A;  4R74 A;  3HV1 A;  4ZEB A;  3G3F A;  3MZ1 A;  4F2Q A;  3CFZ A;  3LSF B;  2M8C A;  2VOZ A;  4DIG A;  2V25 A;  3OMB A;  3BFU A;  3IB1 A;  3LBS A;  1UQW A;  3C9H A;  3MZB A;  1ZTY A;  4XIG Q;  2Y7I A;  1MG1 A;  3G3K A;  2DVZ A;  3ILT B;  4IO2 A;  5DEX A;  1QUK A;  2IA4 A;  1B46 A;  3MJN A;  4ZEK A;  4ZE9 A;  3LSX A;  4ZE8 A;  1PB8 A;  4LUB A;  2ZYO A;  5TPA A;  3SEY A;  4XKR A;  1DPP A;  4YZZ A;  1NFT A;  4AB6 A;  4F22 A;  2UVH A;  3E9X A;  4C1T A;  2R71 A;  1JW5 A;  4YKP A;  2ESN A;  4Q30 B;  4GLI A;  3TCF A;  3KN3 A;  3N94 A;  1IIW A;  3TQL A;  2ZNS A;  4P0G A;  1USY E;  3HCQ A;  4RPN A;  1PDA A;  1OQG A;  3B6W A;  5H8Q B;  4Z0I A;  1NMU A;  3QUJ A;  2GHB A;  3U8Q A;  3R6U A;  3UA8 A;  5JK4 A;  3SES A;  3TUS A;  5H8H A;  3LC8 A;  4PQJ A;  3CI8 A;  4U4S A;  1JVY A;  4NMY A;  1MY0 A;  1TXF A;  1USY H;  2REJ A;  1LGB C;  3VVF A;  4DXU A;  4KCC A;  4GD5 A;  5I57 A;  2B65 A;  1SI0 A;  3PUW E;  2HQ0 A;  1L5T A;  4R72 A;  3VV5 A;  1B05 A;  2QMW A;  3OD7 A;  2XXQ A;  4M1V A;  2ZNU A;  4MLQ A;  1I69 A;  4H8I A;  3PGF A;  4ND9 A;  2XXP A;  4NF5 B;  5CBR A;  2XD3 A;  3FJ7 A;  3FXU A;  2H4I A;  5AA4 B;  1LCT A;  3TAJ A;  3UGW A;  4DXB A;  2XXI A;  2PX1 A;  4KPT A;  1DTG A;  3KJT A;  3IOT A;  3PU5 A;  4KFQ A;  3K1N A;  3MP8 A;  4IGT A;  2V3Q A;  4QSD A;  1LBB A;  1N76 A;  3MQ9 A;  4IO7 A;  3HHG A;  3WAF A;  4QSE A;  4QFL A;  3HO7 A;  4GF8 A;  3B7D A;  1MXZ A;  1MM6 A;  5IKB A;  1BP5 A;  1LFH A;  1IEJ A;  1YTV A;  3KG2 A;  5JTY B;  1MXU A;  3KEI A;  1R6Z A;  5I2N B;  2P1S A;  1R1N A;  4OER A;  3PPN A;  1DOT A;  1H43 A;  4GXS B;  1S9T A;  3MPL A;  1SVX B;  1MDQ A;  3ZKL A;  4C1U A;  1A8F A;  5L8D A;  3H6U A;  2ZYN A;  1OVT A;  4ELR A;  3TMG A;  2Y7P A;  4R6H A;  3DP8 A;  3D4G A;  5B70 A;  3KGC A;  3MVZ A;  3FVO A;  3IR1 A;  3SEW A;  4FAJ A;  4H65 A;  4F18 A;  3E3K A;  3GLB A;  4EF2 A;  3T9U A;  4BDM A;  2Q2C A;  3O9P A;  2DWI A;  1I6B A;  2PBW A;  1B9J A;  4OEV A;  1MY4 A;  4LQ2 A;  2I4C A;  3H06 B;  4WEP A;  3I5O A;  3O28 A;  1B4H A;  4PFT A;  1MY2 A;  4P11 A;  3SEX A;  1LB9 A;  1NH7 A;  2KLF A;  1MH3 A;  1Z7N E;  5DVI A;  1URS A;  1QKB A;  3K6X A;  3HPI A;  2I49 A;  1FQC A;  3MVW A;  3I3V A;  1LBC A;  4OZ9 A;  2OCU A;  4G2Z A;  2YLN A;  4OTE A;  3OEK A;  5HBC A;  3DM0 A;  1SW2 A;  4ESX A;  4U21 A;  4F3B A;  1FQD A;  2OZZ A;  1A8E A;  1PBQ A;  2F7A A;  4QFN A;  3C4M A;  3H3G A;  3SEV A;  3C36 A;  1B51 A;  4YIC A;  2O84 X;  5DEX B;  3TOD A;  2Y7W A;  3T66 A;  1PB9 A;  4WKM A;  3DEL B;  4OFJ A;  3PMW A;  5TPA B;  3C32 A;  2D21 A;  4NWD A;  3VLW A;  2REG A;  4U22 A;  1GVC A;  3PV0 E;  1IXH A;  3RNN A;  1B3G A;  1I6Q A;  5DT6 A;  4G8H A;  4N13 A;  1XVY A;  1FW0 A;  5BUU A;  4HW8 A;  4KD5 A;  2YJP A;  3U92 A;  3TTM A;  1Y9U A;  5ISU A;  4YB5 A;  3KSX A;  1A99 A;  5L9S A;  4F1V A;  4U2R A;  3PUX E;  3S4U A;  1LLS A;  2ZYM A;  2DE3 A;  4IB2 A;  3QK6 A;  4PFY A;  4TOZ A;  3H6V A;  5CBS A;  4MH5 A;  3VXC A;  4O3C A;  1NL5 A;  3C33 A;  3VLV A;  2QS3 A;  2DXR A;  2OWS A;  1Y1M A;  5AA2 D;  4F1U A;  3R26 A;  4FE8 A;  3RPW A;  4Q5T A;  2ZXT A;  4NE4 A;  3TTL A;  1PBP A;  4UAC A;  4ELO A;  1Y4T A;  1KWH A;  1B6H A;  5I57 B;  3O29 A;  4RK9 A;  3M3K A;  2VD2 A;  1MXX A;  4XKN A;  1SYH A;  4ZS9 A;  1YCJ A;  1SI1 A;  1FQA A;  5DTB A;  1O64 A;  1RYO A;  1VE4 A;  1FTJ A;  3PUZ E;  2H9B A;  3KSJ A;  1URG A;  4U23 A;  3PUV E;  4EQ9 A;  4NF8 A;  5B7D A;  1IIT A;  2F36 A;  3F11 A;  5A5X A;  3TCH A;  3PPR A;  3SDF A;  4EUO A;  3ECR A;  2ABH A;  1N7X A;  4AQ4 A;  2XD2 A;  2F6P A;  2RC7 A;  4NF4 A;  1NNF A;  2Y7R A;  3PD8 A;  3UN6 A;  3JZJ A;  4X1B A;  1Q1K A;  3FAT A;  4QF9 A;  2ONR A;  1FCK A;  3O66 A;  3TEP A;  3S2V A;  1GV8 A;  3N26 A;  1ANF A;  4EF1 A;  3GBA A;  1IXG A;  4H1X A;  3D4C A;  2NWJ A;  4IO6 A;  4QFO A;  3O97 A;  4OET A;  4GRK A;  2DOJ A;  2HFB A;  3FGS A;  2Z23 A;  2QL3 A;  4EXL A;  2GHA A;  4BDQ A;  1B52 A;  4FEB A;  2UYF A;  1DMB A;  5DVJ A;  4LAT A;  4I1D A;  3Q28 A;  4LP2 B;  2RCA A;  2RCB A;  3QYT A;  1OMP A;  3CFX A;  1MH4 A;  1D9V A;  3HST A;  4XKQ A;  1H3D A;  2UYE A;  4GL0 A;  3FXR A;  4PFU A;  2P0S A;  3PMX A;  3U94 A;  3USD A;  4QSC A;  2G93 A;  1B3H A;  1MQI A;  1XT8 A;  2XXR A;  3TCG A;  1QUJ A;  2Q9T A;  2RIN A;  2RKM A;  1O63 A;  1UIU A;  3LUY A;  3EHS A;  4RYA A;  4KYE A;  4I9D A;  1LAX A;  1N3W A;  4M4G A;  1ZLQ A;  2Q8J A;  5ITP A;  3JYR A;  4H0W A;  3ONM A;  3RN8 A;  1A55 A;  5CMB A;  4QFK A;  5CMC A;  3V83 A;  4JB7 A;  3T9V A;  2G29 A;  3K02 A;  4R6K A;  3N6T A;  3V5A A;  3C34 A;  2ANJ A;  3R7X A;  4KI0 E;  2X7Q A;  1D3K A;  4YMA A;  2VP1 A;  1URD A;  4G68 A;  2CZL A;  1H44 A;  5ICQ A;  3KFM A;  1OLA A;  5I58 A;  4KYS A;  4LA9 A;  2DWH A;  4GIZ A;  2OLB A;  1Y20 A;  2NVU B;  4U1O A;  2V93 A;  2R9J A;  3MPK A;  4PET A;  2O68 A;  1T0K A;  2DWJ A;  3HN0 A;  3LSL A;  4JDF A;  3RTF B;  2DYX A;  3T22 A;  1B5I A;  4F19 A;  1HSE A;  3P7I A;  4DE8 A;  2CMO A;  4RXL A;  3JV9 A;  1MM7 A;  4NF6 B;  2W7Y A;  4JWY A;  2AL5 A;  5I2K B;  3V89 B;  1SQY A;  1P1O A;  1H76 A;  2F5X A;  5H8S A;  1JVX A;  1B3L A;  1LAG E;  2DWA A;  2E1S A;  1D4N A;  1B5H A;  2FYI A;  1JQF A;  2Z8F A;  1BKA A;  3LSW A;  4H5G A;  3K0V A;  4F2O A;  2HAU A;  3CIJ A;  2ALU A;  3GZG A;  4QFP A;  4G8N A;  4ELQ A;  3AXF A;  5CM6 A;  3RTW B;  3TTN A;  3H4Z A;  2RC9 A;  3TYH A;  2DS9 A;  4R2B A;  1VFD A;  2PYY A;  4G8M A;  4R9F A;  5F7V A;  2F97 A;  2GRV A;  1QJM A;  3PUY E;  3OEL A;  1RYX A;  3RT6 B;  4MF3 A;  5FTH A;  2Z8E A;  1SYI A;  2H98 A;  5EHS A;  5TP9 A;  4NF8 B;  1P1W A;  3CFL A;  4GXA A;  2Q89 A;  4EQB A;  3KN7 A;  1US5 A;  4NF4 B;  4HTG A;  3WAE A;  4FEC A;  1TWY A;  2IEE A;  2Q88 A;  3U93 A;  4OFL A;  5ELV A;  4YKI A;  1P1Q A;  4LON B;  1NH8 A;  1B1H A;  1HSL A;  3B6T A;  3GXA A;  1B3E A;  3EF7 A;  3RLF E;  4E0W A;  5K2Y A;  3S9N C;  2O51 A;  1B58 A;  1S50 A;  2UVG A;  4R75 A;  4DLD A;  1ZBM A;  2ZNT A;  1M5C A;  3VFJ A;  2Q2A A;  3EQ1 A;  1ZJL A;  1VFE A;  3KOS A;  2I0B A;  2AYS A;  1PEB A;  1UTH A;  5KDT B;  1I6A A;  1II5 A;  3KN8 A;  1LAF E;  1FQE A;  1OLC A;  1DPE A;  3EPE A;  3FVG A;  1B7U A;  1BLF A;  3K1M A;  4E0X A;  3CSG A;  5H8Q A;  1M5F A;  1SW5 A;  2WKY A;  3H6T A;  1SD3 A;  2VD3 A;  3DP6 A;  4UA8 A;  4U4X A;  3IO6 A;  1B7H A;  4C0R A;  3G7W A;  3DP4 A;  1BTJ A;  4YKJ A;  2DSF A;  4O3B A;  3UK4 A;  3QUF A;  5I59 A;  2NXO A;  4PFW A;  2OK2 A;  1NNP A;  4OYV A;  4EXK A;  1JEV A;  4BDN A;  3IB0 A;  3G3H A;  1QKA A;  4GQO A;  5J1D A;  5FHM A;  4IO4 A;  2AIX A;  5FHN A;  2OBG A;  4F39 A;  4EDP A;  1LFG A;  3OO8 A;  3ILU B;  1TT1 A;  2AL4 A;  4BLA A;  2THI A;  3DLN A;  4ZEC A;  3MVX A;  2F7B A;  5I84 A;  4NF5 A;  5H8H B;  2XXT A;  4NTL A;  1A40 A;  1D9Y A;  1R9L A;  5FHO A;  5AA4 A;  4KQP A;  1B32 A;  3OEN A;  4YU0 A;  4BDR A;  2Y84 A;  4YAH X;  1NNK A;  5DYH A;  4G68 B;  5AA2 A;  1XS5 A;  3BBR A;  2VHA A;  3S9M C;  1B3F A;  1WOD A;  3CR9 A;  3K1P A;  2DE4 A;  2E0S A;  4X48 A;  2XX9 A;  3TFL A;  3W9W A;  3KZG A;  2ONK E;  2A5T A;  3TTK A;  3FD3 A;  4AB5 A;  1B5J A;  4YMB A;  4G4P A;  4O3A A;  4OEN A;  5AE4 A;  1LST A;  1US4 A;  2RF1 A;  3E4R A;  1B0L A;  1B1X A;  1UTB A;  3PD9 A;  3QIM A;  4OXV A;  4OEU A;  5JTY A; 
#chains in the Genus database with same CATH topology
 5I2N A;  1LFI A;  1P1N A;  4H5F A;  5IGA A;  5ET8 A;  3FV2 A;  3OO6 A;  4HCY A;  3IK6 B;  5K2X A;  5EQ9 A;  1VSO A;  3FIR A;  1IMB A;  3SET A;  3K01 A;  1POT A;  1NV6 A;  3OSR A;  2FBP A;  1DK4 A;  1NV4 A;  3U65 A;  5ET5 A;  2X7P A;  5T3J A;  4MBP A;  3H7M A;  1Y4C A;  5I56 A;  1SW1 A;  3RY3 A;  4Q8R A;  4F31 B;  3K2D A;  5LDZ A;  1RDY A;  1NV7 A;  2V3T A;  3ODB A;  3VVE A;  2KR0 A;  3BFT A;  1EH3 A;  3EN3 A;  1QUL A;  4ESW A;  2I3V A;  3C35 A;  4HCW A;  4OVJ A;  3L6G A;  4LQ5 A;  4PFB A;  4XKP A;  1AMF A;  2HZK A;  1LBV A;  1EYJ A;  3Q26 A;  2I0C A;  4YKK A;  4P8B A;  3E78 A;  3UOR A;  2XX7 A;  3HFU A;  2I3W A;  2P2A A;  3MZ9 A;  1JW4 A;  1NV5 A;  3KC1 A;  4MX6 A;  4POX A;  5KZT A;  3W15 C;  4XTC Q;  5TP9 B;  4H6D A;  1IUD A;  1EU8 A;  3QAX A;  5H8N A;  4Z7E A;  1GGG A;  4GOT A;  1MQJ A;  4QBA A;  1B0H A;  1GR2 A;  3Q25 A;  3OO7 A;  4KYD A;  1N0T A;  2PMS A;  4RA1 A;  2QVV A;  4I8C A;  2CZK A;  2Q8M A;  4XXU A;  3VLU A;  4H45 A;  1JEU A;  5L9O A;  1WDN A;  5CC2 A;  4P9K A;  4GL8 A;  5I7I A;  1NKX A;  1S7Y A;  5KCJ A;  2I6E A;  3TZA A;  4OAN A;  3IOW A;  3A29 A;  1SW4 A;  1NV3 A;  3K00 A;  4OVS A;  2I48 A;  1DTZ A;  3K4U A;  1MPB A;  4QXD A;  4OQO A;  4FAT A;  2B3F A;  1YXI A;  4MHF A;  5ESY A;  4GWW A;  3PPO A;  1OVB A;  4KCD A;  4BDL A;  1EZ9 A;  2FIE A;  1YZ0 A;  1FQB A;  4OWD A;  2HAV A;  4RPO A;  4P1E A;  2F3B A;  4NWC A;  3MUQ A;  1VDW A;  3FJM A;  2F8D A;  1GTK A;  4H8J A;  2UXA A;  1UTH B;  2VT5 A;  4GWS A;  2FA7 A;  3BIG A;  4JBZ A;  2V84 A;  1MPD A;  1Z7M E;  3THI A;  1K9Y A;  1IMD A;  3QSL A;  2QJE A;  1P1U A;  2B3B A;  5EYH A;  2O1L A;  5M2V A;  1Y1Z A;  2QFL A;  3O6H A;  4R73 A;  3VXB A;  4QHQ A;  2GFE A;  2UVJ A;  5FTI A;  3TKD A;  3MVY A;  2OJT A;  5ICT A;  2QVU A;  1FBP A;  5AA3 A;  1OQH A;  5LTC A;  3CG1 A;  1XC1 A;  3MST A;  2V4C A;  4HXV A;  1AOV A;  4JXI A;  4OHN A;  3IOR A;  2UVI A;  1XOC A;  5EQA A;  1MQH A;  4ZZA A;  3EHU A;  3VDF A;  4FIM A;  3CSB A;  3PTY A;  5I59 B;  3IOV A;  4WED A;  5H8F A;  3IAZ A;  2R6G E;  3O6G A;  1NNT A;  4K3F A;  3KOT A;  4N07 A;  5CMK A;  1FTM A;  3B6Q A;  1IMC A;  4FJP A;  1J1N A;  3MP1 A;  3O2A A;  4DDD A;  2HXW A;  4G77 A;  3GBB A;  1FTK A;  1Y3N A;  3FV1 A;  2L5V A;  2PCR A;  1LEV A;  3FJG A;  1IMF A;  4HS7 A;  4ZZE A;  4IY5 A;  3Q29 A;  1RDZ A;  1FPK A;  1KA1 A;  3PPQ A;  1AH5 A;  3EHT A;  2NUV A;  5CMM A;  1MY1 A;  1ZKB A;  1CNQ A;  4GVO A;  4OFO A;  1A7L A;  3HHF A;  1ELJ A;  2ZYK A;  4DCX A;  1JW1 A;  2QS4 A;  4F3S A;  4NED A;  1B2H A;  1NUZ A;  3N6U A;  5AA2 B;  5IZZ A;  1N7W A;  1SDX A;  1MXW A;  1IQ7 A;  2PVU A;  4QRZ A;  1M5B A;  4H67 A;  2GH9 A;  4ZDM A;  4JSD A;  1JET A;  2DE2 A;  2A5T B;  4MAG A;  2LAO A;  1B7Z A;  4F3G A;  4ZEF A;  2Y5L A;  1XVX A;  2I4B A;  3IFA A;  5JEI A;  4WXJ A;  1MY3 A;  1BIY A;  3U1O A;  1BK4 A;  2H25 A;  2BJJ X;  4ZEI A;  1UTB B;  3MWB A;  4ZED A;  1FTO A;  4O7M A;  1N3X A;  3H6W A;  3QXM A;  4Q0C A;  3TDJ A;  3OO9 A;  4F29 A;  2R8T A;  4I3E A;  1FJ6 A;  5CI5 A;  2HCA A;  3PPP A;  3IOU A;  4P3L A;  1YAE A;  4X1D A;  5A5X B;  2RC8 A;  5HM4 B;  2O69 A;  4HE1 A;  5IAI A;  1TFD A;  2DQV A;  2H99 A;  3FUZ A;  2QS1 A;  1F9B A;  4YB7 A;  2HZL A;  2ZZX A;  1TFA A;  4P56 A;  1ZIU A;  5EYF A;  2QMX A;  4IY6 A;  4R9G A;  4ECF A;  1KZ8 A;  1MQG A;  4R2F A;  5I56 B;  1CE2 A;  1CB6 A;  4OMB A;  4LZ5 A;  2XXV A;  5BWJ A;  4I62 A;  1MDP 1;  3N5L A;  4FED A;  3Q27 A;  4R6Y A;  4F1Y A;  3TQW A;  3SEU A;  2Z8D A;  1FBE A;  3T96 B;  3OSQ A;  2I58 A;  2O7U A;  1UIV A;  4PFI A;  4MNC A;  1HSJ A;  3M3L A;  2O7I A;  1FPI A;  4N6P A;  2P3N A;  1O7T A;  2Z22 A;  5I5P A;  3K6U A;  1Q35 A;  3SER A;  4JVC A;  2DVC A;  1AIV A;  2O6A A;  4DXC A;  3FAS A;  4MIJ A;  1FTL A;  2HEU A;  5H8N B;  3G3I A;  4U1Z A;  1YYZ A;  3CVG A;  2PT1 A;  3RGY A;  4MCO A;  4ONY A;  1D9Q A;  2FNC A;  3BKI B;  3A3U A;  4JSO A;  4RNS A;  2XXW A;  4LZ7 A;  4THI A;  3MP6 A;  3RT8 A;  1NUX A;  1IXI A;  3IB2 A;  1B4Z A;  5KCJ B;  1M5E A;  3VVD A;  4BDO A;  3OOA A;  2V3U A;  1RDX A;  3VE1 B;  3KJ7 A;  2DXY A;  1QUI A;  2H5Y A;  4TLL B;  1LB8 A;  4ELP A;  2XHD A;  5AA1 A;  1IXC A;  3OEM A;  3CHG A;  1Y3P A;  2XXU A;  4LVQ A;  4LZ8 A;  3U72 A;  2HHM A;  1MPC A;  5L9M A;  4GFR A;  2F6G A;  2XX8 A;  5FBP A;  4L17 A;  1NV1 A;  3S9L C;  3T9X B;  1MQD A;  2DP8 A;  5LOM A;  3TTR A;  4F3P A;  3RUM A;  3ZS6 A;  4JWO A;  3FVN A;  3E13 X;  3UIF A;  3FZV A;  1ATG A;  3A3C A;  2D5W A;  3TPA A;  1JNF A;  1PB7 A;  3V8X B;  5EHM A;  4DCY A;  4JVD A;  5EQ8 A;  3CRB A;  1FQF A;  2ZMB A;  1EZO A;  4OA4 A;  3S9E A;  3IJX B;  4NF6 A;  4MNP A;  4TLM B;  2WX9 A;  4OVR A;  5I2K A;  4N6K A;  4TQU Q;  1N84 A;  2FIX A;  1B40 A;  4DZ1 A;  2QS2 A;  3MW0 A;  2D3I A;  3TEL A;  5DVF A;  5IM2 A;  1YPN A;  1SBP A;  3IX1 A;  4GX3 A;  4EQ7 A;  3IL1 B;  1FPL A;  3T9H B;  4IO5 A;  3T1B A;  1VR5 A;  3M8U A;  5I58 B;  4ISU A;  4MJO A;  5F1Q A;  4NN3 A;  3ZSF A;  5H8F B;  2A5S A;  1N04 A;  4N6D A;  4P0I A;  4JWX A;  3W9V A;  1WVJ A;  3T93 B;  1DSN A;  2YPN A;  4N8Y A;  1QVS A;  4POW A;  2NOO A;  5DW8 A;  2XXH A;  3A09 A;  4MLV A;  1LCF A;  3O6I A;  1P99 A;  4OES A;  3KBZ A;  3EKI A;  5HPQ A;  2VGQ A;  2ONS A;  1MXV A;  4GWO A;  1QW0 A;  3H03 A;  2Y7K A;  3IO4 A;  2QSX A;  1H45 A;  2F34 A;  1PC3 A;  5TU0 A;  2PT2 A;  3FXQ A;  1EZP A;  1Y3Q A;  1MRP A;  4KHZ E;  3L6H A;  1XHY A;  1MXY A;  4G68 C;  4OVQ A;  3MC2 A;  3FXB A;  1AL3 A;  3K6W A;  3G3G A;  1IZ1 A;  3KBR A;  4IGR A;  5CRY A;  4MFI A;  2PFZ A;  5ITO A;  2F35 A;  3M3F A;  3OXN A;  3ZKK A;  3UP9 A;  1MS7 A;  4I3Y A;  4PP0 A;  2F78 A;  3FVK A;  1R9Q A;  4YB6 A;  1IMA A;  2XXX A;  1POY 1;  4LN5 A;  1A54 A;  3RQT A;  1OIB A;  3G3J A;  2QRY A;  4X9T A;  2OWT A;  3MAM A;  4RK2 A;  4IO3 A;  3CG3 A;  2X26 A;  2O1M A;  4PE5 B;  3I6V A;  2QPQ A;  3C31 A;  1ZU0 A;  3PMV A;  1FPJ A;  1RKM A;  1LAH E;  3K6V A;  4GBV A;  2F7C A;  3MBP A;  4KR5 A;  1FPG A;  4RY1 A;  2XXY A;  1M5D A;  5KDT A;  4MMP A;  1ZMG A;  3LR1 A;  4PC9 A;  3SKP A;  3IJO B;  4RJZ A;  4FOR A;  4R74 A;  3HV1 A;  4ZEB A;  3G3F A;  3MZ1 A;  4F2Q A;  3CFZ A;  1NV2 A;  1INP A;  3LSF B;  4PTK A;  2M8C A;  2VOZ A;  4DIG A;  2V25 A;  3OMB A;  3BFU A;  2FVZ A;  3LBS A;  3IB1 A;  1UQW A;  3C9H A;  3MZB A;  1ZTY A;  4XIG Q;  2Y7I A;  1MG1 A;  3G3K A;  2DVZ A;  4NG7 A;  3ILT B;  1FBG A;  4IO2 A;  5DEX A;  1QUK A;  2KQZ A;  2IA4 A;  1Q9D A;  1B46 A;  3MJN A;  4ZEK A;  4ZE9 A;  3LSX A;  4ZE8 A;  1PB8 A;  4LUB A;  2ZYO A;  4NGU A;  5TPA A;  3SEY A;  4XKR A;  1DPP A;  4YZZ A;  2CEY A;  1NFT A;  4AB6 A;  4F22 A;  2UVH A;  3E9X A;  4C1T A;  2R71 A;  1JW5 A;  4YKP A;  2ESN A;  4Q30 B;  1G0H A;  4GLI A;  3B50 A;  3TCF A;  3KN3 A;  3N94 A;  1IIW A;  3TQL A;  2ZNS A;  4P0G A;  1USY E;  3HCQ A;  4RPN A;  1PDA A;  1OQG A;  2XXK A;  3B6W A;  5H8Q B;  4Z0I A;  1NMU A;  3QUJ A;  3GYY A;  2GHB A;  3U8Q A;  3R6U A;  3UA8 A;  5JK4 A;  5F24 A;  3SES A;  3TUS A;  5H8H A;  3LC8 A;  3MYU A;  4PQJ A;  3CI8 A;  4U4S A;  1JVY A;  4NMY A;  4N17 A;  1MY0 A;  1TXF A;  1USY H;  2REJ A;  1LGB C;  3VVF A;  4DXU A;  4KCC A;  4GD5 A;  5I57 A;  2B65 A;  2QVR A;  1SI0 A;  4NAP A;  4PE3 A;  3PUW E;  4X04 A;  2HQ0 A;  1L5T A;  4R72 A;  3VV5 A;  1B05 A;  4GBW A;  3D1R A;  2QMW A;  2XWI A;  3OD7 A;  2XXQ A;  4P1L A;  4M1V A;  2ZNU A;  4MLQ A;  1I69 A;  4H8I A;  3PGF A;  4ND9 A;  2XXP A;  4NF5 B;  5CBR A;  2XD3 A;  3FJ7 A;  3FXU A;  2CZH A;  2H4I A;  5AA4 B;  1LCT A;  1FPF A;  5J16 A;  3TAJ A;  4PAI A;  3UGW A;  4DXB A;  2XXI A;  2PX1 A;  4KPT A;  1DTG A;  3KJT A;  3IOT A;  3PU5 A;  4KFQ A;  3K1N A;  3MP8 A;  4IGT A;  2V3Q A;  4QSD A;  1LBB A;  1N76 A;  3MQ9 A;  4IO7 A;  4OVT A;  4NQ8 A;  1XI6 A;  3HHG A;  3WAF A;  4QSE A;  4QFL A;  3HO7 A;  4GF8 A;  3B7D A;  1MXZ A;  1MM6 A;  5IKB A;  1BP5 A;  1LFH A;  1IEJ A;  1YTV A;  3KG2 A;  5JTY B;  1MXU A;  3KEI A;  1R6Z A;  5I2N B;  2P1S A;  1R1N A;  4OER A;  2Y5K A;  3PPN A;  1DOT A;  1H43 A;  4GXS B;  1S9T A;  3MPL A;  1SVX B;  1MDQ A;  4O8M A;  3ZKL A;  4C1U A;  1A8F A;  5L8D A;  3H6U A;  1FPE A;  2ZYN A;  1OVT A;  4ELR A;  1LBW A;  3TMG A;  2Y7P A;  4R6H A;  3DP8 A;  3D4G A;  5B70 A;  3KGC A;  3MVZ A;  3FVO A;  3IR1 A;  3SEW A;  4FAJ A;  4H65 A;  2GQ1 A;  4F18 A;  1NUW A;  3E3K A;  3GLB A;  4EF2 A;  3T9U A;  4BDM A;  2Q2C A;  3O9P A;  4O94 A;  2DWI A;  5ET7 A;  5IZ3 A;  1I6B A;  2PBW A;  1B9J A;  4OEV A;  1MY4 A;  4LQ2 A;  3RPL A;  2I4C A;  3H06 B;  4WEP A;  3I5O A;  3O28 A;  1B4H A;  4PFT A;  1MY2 A;  4P11 A;  3SEX A;  1LB9 A;  1NH7 A;  2KLF A;  1MH3 A;  1Z7N E;  5DVI A;  1URS A;  2FHY A;  1QKB A;  3K6X A;  4PBH A;  1AWB A;  3HPI A;  4OVP A;  2I49 A;  1FRP A;  1FQC A;  3MVW A;  3SZP A;  3I3V A;  1LBC A;  4O7I A;  3FBP A;  4OZ9 A;  2VPN A;  4XEQ A;  2OCU A;  4G2Z A;  2YLN A;  4OTE A;  3OEK A;  5HBC A;  3DM0 A;  1SW2 A;  4ESX A;  2XWO A;  4U21 A;  4F3B A;  1FQD A;  2OZZ A;  4P47 A;  1A8E A;  4PFR A;  4PF8 A;  1PBQ A;  4QFN A;  2F7A A;  4PCD A;  3C4M A;  3H3G A;  3KC0 A;  4MNI A;  3SEV A;  3C36 A;  1B51 A;  4YIC A;  2O84 X;  5DEX B;  3TOD A;  2Y7W A;  3T66 A;  2CEX A;  1PB9 A;  4WKM A;  2CZI A;  3DEL B;  4OFJ A;  3PMW A;  5TPA B;  3C32 A;  2D21 A;  4NWD A;  3VLW A;  2REG A;  4U22 A;  1GVC A;  3PV0 E;  1IXH A;  3RNN A;  1B3G A;  1I6Q A;  1FBH A;  5DT6 A;  4G8H A;  4N13 A;  1XVY A;  1FW0 A;  5BUU A;  1FBF A;  4KD5 A;  4HW8 A;  2YJP A;  3U92 A;  3TTM A;  3IFC A;  1Y9U A;  4PGN A;  5ISU A;  4YB5 A;  3KSX A;  1A99 A;  5L9S A;  4F1V A;  4U2R A;  3PUX E;  2WYP A;  3S4U A;  1LLS A;  2ZYM A;  2DE3 A;  4IB2 A;  4NX1 A;  4G61 A;  3QK6 A;  4PFY A;  4TOZ A;  1DCU A;  3H6V A;  5CBS A;  4GWY A;  4MH5 A;  3VXC A;  4O3C A;  2OWZ A;  1NL5 A;  3C33 A;  3VLV A;  2QS3 A;  2DXR A;  2OWS A;  4AS4 A;  1Y1M A;  5AA2 D;  2HPG A;  3R26 A;  4FE8 A;  3NOH A;  4F1U A;  4AS5 A;  3RPW A;  4Q5T A;  2ZXT A;  4NE4 A;  3TTL A;  1PBP A;  4UAC A;  4ELO A;  1Y4T A;  1KWH A;  1B6H A;  5I57 B;  3O29 A;  4RK9 A;  3M3K A;  2VD2 A;  1MXX A;  4XKN A;  1SYH A;  4ZS9 A;  1YCJ A;  1SI1 A;  1FQA A;  5DTB A;  3RYD A;  5EYG A;  1O64 A;  1RYO A;  1VE4 A;  1FTJ A;  2OX3 A;  4GWX A;  3PUZ E;  2H9B A;  3KSJ A;  5IZ1 A;  1URG A;  4U23 A;  3PUV E;  4EQ9 A;  2MKZ A;  4NF8 A;  5B7D A;  1FTA A;  1IIT A;  2F36 A;  3F11 A;  5A5X A;  3TCH A;  3PPR A;  4N91 A;  3SDF A;  4EUO A;  3ECR A;  3LUZ A;  2ABH A;  1N7X A;  4AQ4 A;  2XD2 A;  2F6P A;  2RC7 A;  4NF4 A;  4GX6 A;  1NNF A;  4I40 A;  2Y7R A;  5A5L A;  3PD8 A;  3UN6 A;  3JZJ A;  4X1B A;  1Q1K A;  3FAT A;  1NUY A;  2ONR A;  4QF9 A;  1FCK A;  1FSA A;  3O66 A;  3TEP A;  3S2V A;  1GV8 A;  3N26 A;  1ANF A;  4EF1 A;  3GBA A;  1IXG A;  4H1X A;  3D4C A;  2NWJ A;  4IO6 A;  4QFO A;  3ROJ A;  3O97 A;  4OET A;  4GRK A;  2DOJ A;  2HFB A;  3FGS A;  2Z23 A;  2QL3 A;  4EXL A;  2GHA A;  4BDQ A;  2WBB A;  2ZZV A;  1B52 A;  4FEB A;  2UYF A;  2PFY A;  4PBQ A;  1DMB A;  5DVJ A;  4LAT A;  4I1D A;  3Q28 A;  4LP2 B;  2RCA A;  4GWU A;  2RCB A;  3QYT A;  1OMP A;  2F3D A;  3CFX A;  1MH4 A;  1D9V A;  3HST A;  4XKQ A;  1H3D A;  2UYE A;  1FPB A;  4N4U A;  4GL0 A;  4MEV A;  3FXR A;  4PFU A;  2P0S A;  3PMX A;  3U94 A;  3USD A;  1KA0 A;  2XWV A;  4QSC A;  1LBX A;  2G93 A;  1B3H A;  1MQI A;  1XT8 A;  2XXR A;  3TCG A;  1QUJ A;  2Q9T A;  5IZ3 B;  2RIN A;  2RKM A;  1O63 A;  3RPL B;  1UIU A;  3LUY A;  3EHS A;  4RYA A;  2HXR A;  4KYE A;  4I9D A;  1LAX A;  1N3W A;  4M4G A;  1ZLQ A;  2Q8J A;  5ITP A;  3E79 A;  3JYR A;  4H0W A;  3ONM A;  4KXP A;  3RN8 A;  4DI4 B;  1A55 A;  5CMB A;  2XWK A;  4QFK A;  4H46 A;  5CMC A;  4NHB A;  3V83 A;  4JB7 A;  3T9V A;  2G29 A;  3K02 A;  4R6K A;  4UAB A;  3N6T A;  3V5A A;  3C34 A;  2ANJ A;  3R7X A;  3T0J A;  4KI0 E;  2X7Q A;  1D3K A;  4YMA A;  2VP1 A;  1URD A;  4G68 A;  1JP4 A;  4IR8 A;  2CZL A;  5EQ7 A;  1H44 A;  5ICQ A;  3KFM A;  3LV0 A;  1OLA A;  5I58 A;  4KYS A;  4LA9 A;  2DWH A;  4GIZ A;  3B8B A;  2OLB A;  1Y20 A;  2NVU B;  4U1O A;  2V93 A;  2R9J A;  3MPK A;  4PET A;  2O68 A;  1LBY A;  1T0K A;  2DWJ A;  3HN0 A;  3LSL A;  4JDF A;  3RTF B;  2DYX A;  3T22 A;  1B5I A;  3ISP A;  4F19 A;  1HSE A;  3P7I A;  4DE8 A;  2CMO A;  4RXL A;  3JV9 A;  1MM7 A;  4NF6 B;  2W7Y A;  4JWY A;  2AL5 A;  5I2K B;  3V89 B;  1SQY A;  1P1O A;  1H76 A;  2F5X A;  4DI3 D;  5I3S A;  5H8S A;  1JVX A;  1NI9 A;  1B3L A;  1LAG E;  2DWA A;  2E1S A;  1D4N A;  1B5H A;  2FYI A;  1JQF A;  2Z8F A;  1BKA A;  3LSW A;  4H5G A;  3K0V A;  4F2O A;  2HAU A;  3CIJ A;  2ALU A;  3GZG A;  1EYK A;  4QFP A;  4G8N A;  4ELQ A;  3AXF A;  5CM6 A;  3RTW B;  3TTN A;  3H4Z A;  2RC9 A;  3TYH A;  4NF0 A;  2DS9 A;  2WYK A;  4R2B A;  1VFD A;  2PYY A;  2B4L A;  4G8M A;  4R9F A;  5F7V A;  2F97 A;  2GRV A;  1QJM A;  3PUY E;  3OEL A;  4XF5 A;  2DDK A;  1RYX A;  3QMF A;  2ZZW A;  3RT6 B;  4MF3 A;  4X8R A;  5FTH A;  2Z8E A;  1SYI A;  2H98 A;  1FPD A;  5EHS A;  5TP9 A;  4NF8 B;  1P1W A;  3CFL A;  4PAF A;  1G0I A;  4GXA A;  2Q89 A;  2VPO A;  4EQB A;  4HE0 A;  3KN7 A;  4PDD A;  1US5 A;  4NF4 B;  4HTG A;  3WAE A;  4FEC A;  1SPI A;  1TWY A;  2IEE A;  2Q88 A;  3U93 A;  4OFL A;  5ELV A;  4YKI A;  1P1Q A;  4LON B;  1NH8 A;  4PF6 A;  1B1H A;  1HSL A;  3B6T A;  4N81 A;  2B4M A;  1B3E A;  3GXA A;  3EF7 A;  4FBP A;  3RLF E;  4HE2 A;  4E0W A;  4PGP A;  5K2Y A;  4PDH A;  3S9N C;  2O51 A;  1B58 A;  1S50 A;  1FBD A;  2UVG A;  4N8G A;  4R75 A;  4DLD A;  1ZBM A;  2ZNT A;  5ET6 A;  1M5C A;  3VFJ A;  2Q2A A;  3EQ1 A;  1ZJL A;  1VFE A;  3KOS A;  2JJK A;  2I0B A;  2AYS A;  1PEB A;  1UTH A;  5KDT B;  1I6A A;  1II5 A;  3KN8 A;  1LAF E;  1NV0 A;  1FQE A;  1OLC A;  1DPE A;  1DBZ A;  3EPE A;  3FVG A;  1B7U A;  1EYI A;  1BLF A;  4XFE A;  3K1M A;  4E0X A;  3CSG A;  5H8Q A;  1M5F A;  1SW5 A;  2WKY A;  3H6T A;  1QGX A;  1SD3 A;  2VD3 A;  3DP6 A;  4UA8 A;  4GWZ A;  4U4X A;  3IO6 A;  1B7H A;  4C0R A;  3G7W A;  3DP4 A;  1BTJ A;  1LBZ A;  4YKJ A;  2DSF A;  4O3B A;  3UK4 A;  3QUF A;  5I59 A;  2NXO A;  4JVI A;  4PFW A;  2OK2 A;  1NNP A;  2WEF A;  4OYV A;  4EXK A;  1JEV A;  4BDN A;  3IB0 A;  3G3H A;  1QKA A;  4GQO A;  5J1D A;  5FHM A;  4IO4 A;  2AIX A;  1FBC A;  5FHN A;  2OBG A;  1K9Z A;  2P3V A;  4F39 A;  4EDP A;  1LFG A;  3OO8 A;  4GX4 A;  3ILU B;  2Q74 A;  1TT1 A;  2AL4 A;  4BLA A;  2THI A;  3DLN A;  4ZEC A;  2XA5 A;  3MVX A;  4PAK A;  2F7B A;  5I84 A;  4NF5 A;  5H8H B;  1FJ9 A;  4N15 A;  2XXT A;  4NTL A;  1A40 A;  1D9Y A;  1R9L A;  5FHO A;  5AA4 A;  4KQP A;  1B32 A;  3OEN A;  4YU0 A;  4BDR A;  2Y84 A;  4YAH X;  1NNK A;  5DYH A;  4G68 B;  5AA2 A;  1XS5 A;  3BBR A;  2BJI A;  2VHA A;  1IME A;  3S9M C;  1B3F A;  1WOD A;  3CR9 A;  3K1P A;  2DE4 A;  2E0S A;  4X48 A;  2XX9 A;  3TFL A;  3W9W A;  3KZG A;  2ONK E;  2A5T A;  3BIH A;  3TTK A;  3FD3 A;  4AB5 A;  1B5J A;  4YMB A;  4G4P A;  4O3A A;  4OEN A;  5AE4 A;  1LST A;  1US4 A;  2WBD A;  2RF1 A;  3E4R A;  1B0L A;  1B1X A;  1UTB A;  3PD9 A;  3QIM A;  4OXV A;  4OEU A;  5JTY A; 
#chains in the Genus database with same CATH homology
 5I2N A;  1LFI A;  1P1N A;  4H5F A;  3FV2 A;  3OO6 A;  4HCY A;  3IK6 B;  5K2X A;  1VSO A;  3FIR A;  3SET A;  3K01 A;  1POT A;  3OSR A;  2X7P A;  4MBP A;  3H7M A;  1Y4C A;  5I56 A;  1SW1 A;  3RY3 A;  4Q8R A;  4F31 B;  3K2D A;  2V3T A;  3ODB A;  3VVE A;  3BFT A;  1EH3 A;  3EN3 A;  1QUL A;  4ESW A;  2I3V A;  3C35 A;  4HCW A;  4OVJ A;  3L6G A;  4LQ5 A;  4XKP A;  1AMF A;  2HZK A;  3Q26 A;  2I0C A;  4YKK A;  3UOR A;  2XX7 A;  2I3W A;  2P2A A;  3MZ9 A;  1JW4 A;  4POX A;  5KZT A;  3W15 C;  4XTC Q;  5TP9 B;  4H6D A;  1IUD A;  1EU8 A;  3QAX A;  5H8N A;  4Z7E A;  1GGG A;  4GOT A;  1MQJ A;  1B0H A;  1GR2 A;  3Q25 A;  3OO7 A;  4KYD A;  1N0T A;  2PMS A;  4RA1 A;  4I8C A;  4XXU A;  3VLU A;  1JEU A;  5L9O A;  1WDN A;  5CC2 A;  4GL8 A;  1NKX A;  1S7Y A;  5KCJ A;  2I6E A;  3TZA A;  3IOW A;  1SW4 A;  3K00 A;  2I48 A;  1DTZ A;  3K4U A;  1MPB A;  4OQO A;  4FAT A;  2B3F A;  3PPO A;  1OVB A;  4KCD A;  4BDL A;  1EZ9 A;  1FQB A;  4OWD A;  2HAV A;  4RPO A;  4NWC A;  3MUQ A;  3FJM A;  2F8D A;  1GTK A;  4H8J A;  2UXA A;  1UTH B;  2FA7 A;  4JBZ A;  2V84 A;  1MPD A;  1Z7M E;  3THI A;  3QSL A;  2QJE A;  1P1U A;  2B3B A;  2O1L A;  5M2V A;  1Y1Z A;  3O6H A;  4R73 A;  3VXB A;  4QHQ A;  2GFE A;  2UVJ A;  5FTI A;  3TKD A;  3MVY A;  2OJT A;  5ICT A;  5AA3 A;  1OQH A;  3CG1 A;  1XC1 A;  1AOV A;  4JXI A;  4OHN A;  3IOR A;  2UVI A;  1XOC A;  1MQH A;  4ZZA A;  3EHU A;  3VDF A;  4FIM A;  3CSB A;  5I59 B;  3IOV A;  4WED A;  5H8F A;  3IAZ A;  2R6G E;  3O6G A;  1NNT A;  4K3F A;  3KOT A;  4N07 A;  5CMK A;  1FTM A;  3B6Q A;  4FJP A;  1J1N A;  3MP1 A;  3O2A A;  4DDD A;  2HXW A;  4G77 A;  3GBB A;  1FTK A;  1Y3N A;  3FV1 A;  3FJG A;  4HS7 A;  4ZZE A;  4IY5 A;  3Q29 A;  3PPQ A;  1AH5 A;  3EHT A;  2NUV A;  5CMM A;  1MY1 A;  1ZKB A;  4GVO A;  4OFO A;  1A7L A;  3HHF A;  1ELJ A;  2ZYK A;  4DCX A;  1JW1 A;  2QS4 A;  4F3S A;  4NED A;  1B2H A;  3N6U A;  5AA2 B;  1N7W A;  1SDX A;  1MXW A;  1IQ7 A;  2PVU A;  4QRZ A;  1M5B A;  4H67 A;  2GH9 A;  4ZDM A;  4JSD A;  1JET A;  2DE2 A;  2A5T B;  2LAO A;  1B7Z A;  4F3G A;  4ZEF A;  5JEI A;  1XVX A;  2I4B A;  4WXJ A;  1MY3 A;  1BIY A;  3U1O A;  2H25 A;  2BJJ X;  4ZEI A;  1UTB B;  3MWB A;  4ZED A;  1FTO A;  1N3X A;  3H6W A;  3QXM A;  4Q0C A;  3TDJ A;  3OO9 A;  4F29 A;  5CI5 A;  2HCA A;  3PPP A;  3IOU A;  1YAE A;  4X1D A;  5A5X B;  2RC8 A;  5HM4 B;  2O69 A;  5IAI A;  1TFD A;  2DQV A;  2H99 A;  3FUZ A;  2QS1 A;  1F9B A;  4YB7 A;  2HZL A;  1TFA A;  1ZIU A;  5EYF A;  2QMX A;  4IY6 A;  4R9G A;  4ECF A;  1MQG A;  4R2F A;  5I56 B;  1CE2 A;  1CB6 A;  4OMB A;  4LZ5 A;  2XXV A;  5BWJ A;  4I62 A;  1MDP 1;  3N5L A;  4FED A;  3Q27 A;  4R6Y A;  4F1Y A;  3TQW A;  3SEU A;  2Z8D A;  3T96 B;  3OSQ A;  2I58 A;  2O7U A;  1UIV A;  1HSJ A;  3M3L A;  2O7I A;  4N6P A;  1O7T A;  2Z22 A;  3K6U A;  1Q35 A;  3SER A;  2DVC A;  1AIV A;  2O6A A;  4DXC A;  3FAS A;  1FTL A;  2HEU A;  5H8N B;  3G3I A;  4U1Z A;  3CVG A;  2PT1 A;  3RGY A;  4ONY A;  2FNC A;  3BKI B;  3A3U A;  4JSO A;  4RNS A;  2XXW A;  4LZ7 A;  4THI A;  3MP6 A;  3RT8 A;  1IXI A;  3IB2 A;  1B4Z A;  5KCJ B;  1M5E A;  3VVD A;  4BDO A;  3OOA A;  2V3U A;  3VE1 B;  3KJ7 A;  2DXY A;  1QUI A;  2H5Y A;  4TLL B;  1LB8 A;  4ELP A;  2XHD A;  5AA1 A;  1IXC A;  3OEM A;  1Y3P A;  2XXU A;  4LVQ A;  4LZ8 A;  3U72 A;  1MPC A;  5L9M A;  4GFR A;  2F6G A;  2XX8 A;  4L17 A;  3S9L C;  3T9X B;  1MQD A;  2DP8 A;  5LOM A;  3TTR A;  4F3P A;  3RUM A;  3ZS6 A;  4JWO A;  3FVN A;  3E13 X;  3UIF A;  3FZV A;  1ATG A;  3A3C A;  2D5W A;  3TPA A;  1JNF A;  1PB7 A;  3V8X B;  5EHM A;  4DCY A;  3CRB A;  1FQF A;  2ZMB A;  1EZO A;  3S9E A;  3IJX B;  4NF6 A;  4TLM B;  5I2K A;  4TQU Q;  1N84 A;  1B40 A;  4DZ1 A;  2QS2 A;  3MW0 A;  2D3I A;  3TEL A;  5DVF A;  1YPN A;  1SBP A;  3IX1 A;  4EQ7 A;  3IL1 B;  3T9H B;  4IO5 A;  1VR5 A;  3M8U A;  5I58 B;  4ISU A;  5F1Q A;  3ZSF A;  5H8F B;  2A5S A;  1N04 A;  4P0I A;  4JWX A;  3W9V A;  1WVJ A;  3T93 B;  1DSN A;  2YPN A;  1QVS A;  4POW A;  2NOO A;  2XXH A;  3A09 A;  4MLV A;  1LCF A;  3O6I A;  1P99 A;  4OES A;  5HPQ A;  2VGQ A;  2ONS A;  1MXV A;  4GWO A;  1QW0 A;  3H03 A;  2Y7K A;  3IO4 A;  2QSX A;  1H45 A;  2F34 A;  1PC3 A;  5TU0 A;  2PT2 A;  3FXQ A;  1EZP A;  1Y3Q A;  1MRP A;  4KHZ E;  3L6H A;  1XHY A;  1MXY A;  4G68 C;  3MC2 A;  1AL3 A;  3K6W A;  3G3G A;  1IZ1 A;  3KBR A;  4IGR A;  5CRY A;  4MFI A;  5ITO A;  2F35 A;  3M3F A;  3OXN A;  3ZKK A;  3UP9 A;  1MS7 A;  4PP0 A;  2F78 A;  3FVK A;  1R9Q A;  4YB6 A;  2XXX A;  1POY 1;  1A54 A;  3RQT A;  1OIB A;  3G3J A;  2QRY A;  4X9T A;  2OWT A;  3MAM A;  4RK2 A;  4IO3 A;  3CG3 A;  2X26 A;  2O1M A;  4PE5 B;  3I6V A;  2QPQ A;  3C31 A;  1ZU0 A;  3PMV A;  1RKM A;  1LAH E;  3K6V A;  2F7C A;  3MBP A;  4KR5 A;  4RY1 A;  2XXY A;  1M5D A;  5KDT A;  1ZMG A;  3LR1 A;  3SKP A;  3IJO B;  4RJZ A;  4FOR A;  4R74 A;  3HV1 A;  4ZEB A;  3G3F A;  3MZ1 A;  4F2Q A;  3CFZ A;  3LSF B;  2M8C A;  2VOZ A;  4DIG A;  2V25 A;  3OMB A;  3BFU A;  3IB1 A;  3LBS A;  1UQW A;  3C9H A;  3MZB A;  1ZTY A;  4XIG Q;  2Y7I A;  1MG1 A;  3G3K A;  2DVZ A;  3ILT B;  4IO2 A;  5DEX A;  1QUK A;  2IA4 A;  1B46 A;  3MJN A;  4ZEK A;  4ZE9 A;  3LSX A;  4ZE8 A;  1PB8 A;  4LUB A;  2ZYO A;  5TPA A;  3SEY A;  4XKR A;  1DPP A;  4YZZ A;  1NFT A;  4AB6 A;  4F22 A;  2UVH A;  3E9X A;  4C1T A;  2R71 A;  1JW5 A;  4YKP A;  2ESN A;  4Q30 B;  4GLI A;  3TCF A;  3KN3 A;  3N94 A;  1IIW A;  3TQL A;  2ZNS A;  4P0G A;  1USY E;  3HCQ A;  4RPN A;  1PDA A;  1OQG A;  3B6W A;  5H8Q B;  4Z0I A;  1NMU A;  3QUJ A;  2GHB A;  3U8Q A;  3R6U A;  3UA8 A;  5JK4 A;  3SES A;  3TUS A;  5H8H A;  3LC8 A;  4PQJ A;  3CI8 A;  4U4S A;  1JVY A;  4NMY A;  1MY0 A;  1TXF A;  1USY H;  2REJ A;  1LGB C;  3VVF A;  4DXU A;  4KCC A;  4GD5 A;  5I57 A;  2B65 A;  1SI0 A;  3PUW E;  2HQ0 A;  1L5T A;  4R72 A;  3VV5 A;  1B05 A;  2QMW A;  3OD7 A;  2XXQ A;  4M1V A;  2ZNU A;  4MLQ A;  1I69 A;  4H8I A;  3PGF A;  4ND9 A;  2XXP A;  4NF5 B;  5CBR A;  2XD3 A;  3FJ7 A;  3FXU A;  2H4I A;  5AA4 B;  1LCT A;  3TAJ A;  3UGW A;  4DXB A;  2XXI A;  2PX1 A;  4KPT A;  1DTG A;  3KJT A;  3IOT A;  3PU5 A;  4KFQ A;  3K1N A;  3MP8 A;  4IGT A;  2V3Q A;  4QSD A;  1LBB A;  1N76 A;  3MQ9 A;  4IO7 A;  3HHG A;  3WAF A;  4QSE A;  4QFL A;  3HO7 A;  4GF8 A;  3B7D A;  1MXZ A;  1MM6 A;  5IKB A;  1BP5 A;  1LFH A;  1IEJ A;  1YTV A;  3KG2 A;  5JTY B;  1MXU A;  3KEI A;  1R6Z A;  5I2N B;  2P1S A;  1R1N A;  4OER A;  3PPN A;  1DOT A;  1H43 A;  4GXS B;  1S9T A;  3MPL A;  1SVX B;  1MDQ A;  3ZKL A;  4C1U A;  1A8F A;  5L8D A;  3H6U A;  2ZYN A;  1OVT A;  4ELR A;  3TMG A;  2Y7P A;  4R6H A;  3DP8 A;  3D4G A;  5B70 A;  3KGC A;  3MVZ A;  3FVO A;  3IR1 A;  3SEW A;  4FAJ A;  4H65 A;  4F18 A;  3E3K A;  3GLB A;  4EF2 A;  3T9U A;  4BDM A;  2Q2C A;  3O9P A;  2DWI A;  1I6B A;  2PBW A;  1B9J A;  4OEV A;  1MY4 A;  4LQ2 A;  2I4C A;  3H06 B;  4WEP A;  3I5O A;  3O28 A;  1B4H A;  4PFT A;  1MY2 A;  4P11 A;  3SEX A;  1LB9 A;  1NH7 A;  2KLF A;  1MH3 A;  1Z7N E;  5DVI A;  1URS A;  1QKB A;  3K6X A;  3HPI A;  2I49 A;  1FQC A;  3MVW A;  3I3V A;  1LBC A;  4OZ9 A;  2OCU A;  4G2Z A;  2YLN A;  4OTE A;  3OEK A;  5HBC A;  3DM0 A;  1SW2 A;  4ESX A;  4U21 A;  4F3B A;  1FQD A;  2OZZ A;  1A8E A;  1PBQ A;  2F7A A;  4QFN A;  3C4M A;  3H3G A;  3SEV A;  3C36 A;  1B51 A;  4YIC A;  2O84 X;  5DEX B;  3TOD A;  2Y7W A;  3T66 A;  1PB9 A;  4WKM A;  3DEL B;  4OFJ A;  3PMW A;  5TPA B;  3C32 A;  2D21 A;  4NWD A;  3VLW A;  2REG A;  4U22 A;  1GVC A;  3PV0 E;  1IXH A;  3RNN A;  1B3G A;  1I6Q A;  5DT6 A;  4G8H A;  4N13 A;  1XVY A;  1FW0 A;  5BUU A;  4HW8 A;  4KD5 A;  2YJP A;  3U92 A;  3TTM A;  1Y9U A;  5ISU A;  4YB5 A;  3KSX A;  1A99 A;  5L9S A;  4F1V A;  4U2R A;  3PUX E;  3S4U A;  1LLS A;  2ZYM A;  2DE3 A;  4IB2 A;  3QK6 A;  4PFY A;  4TOZ A;  3H6V A;  5CBS A;  4MH5 A;  3VXC A;  4O3C A;  1NL5 A;  3C33 A;  3VLV A;  2QS3 A;  2DXR A;  2OWS A;  1Y1M A;  5AA2 D;  4F1U A;  3R26 A;  4FE8 A;  3RPW A;  4Q5T A;  2ZXT A;  4NE4 A;  3TTL A;  1PBP A;  4UAC A;  4ELO A;  1Y4T A;  1KWH A;  1B6H A;  5I57 B;  3O29 A;  4RK9 A;  3M3K A;  2VD2 A;  1MXX A;  4XKN A;  1SYH A;  4ZS9 A;  1YCJ A;  1SI1 A;  1FQA A;  5DTB A;  1O64 A;  1RYO A;  1VE4 A;  1FTJ A;  3PUZ E;  2H9B A;  3KSJ A;  1URG A;  4U23 A;  3PUV E;  4EQ9 A;  4NF8 A;  5B7D A;  1IIT A;  2F36 A;  3F11 A;  5A5X A;  3TCH A;  3PPR A;  3SDF A;  4EUO A;  3ECR A;  2ABH A;  1N7X A;  4AQ4 A;  2XD2 A;  2F6P A;  2RC7 A;  4NF4 A;  1NNF A;  2Y7R A;  3PD8 A;  3UN6 A;  3JZJ A;  4X1B A;  1Q1K A;  3FAT A;  4QF9 A;  2ONR A;  1FCK A;  3O66 A;  3TEP A;  3S2V A;  1GV8 A;  3N26 A;  1ANF A;  4EF1 A;  3GBA A;  1IXG A;  4H1X A;  3D4C A;  2NWJ A;  4IO6 A;  4QFO A;  3O97 A;  4OET A;  4GRK A;  2DOJ A;  2HFB A;  3FGS A;  2Z23 A;  2QL3 A;  4EXL A;  2GHA A;  4BDQ A;  1B52 A;  4FEB A;  2UYF A;  1DMB A;  5DVJ A;  4LAT A;  4I1D A;  3Q28 A;  4LP2 B;  2RCA A;  2RCB A;  3QYT A;  1OMP A;  3CFX A;  1MH4 A;  1D9V A;  3HST A;  4XKQ A;  1H3D A;  2UYE A;  4GL0 A;  3FXR A;  4PFU A;  2P0S A;  3PMX A;  3U94 A;  3USD A;  4QSC A;  2G93 A;  1B3H A;  1MQI A;  1XT8 A;  2XXR A;  3TCG A;  1QUJ A;  2Q9T A;  2RIN A;  2RKM A;  1O63 A;  1UIU A;  3LUY A;  3EHS A;  4RYA A;  4KYE A;  4I9D A;  1LAX A;  1N3W A;  4M4G A;  1ZLQ A;  2Q8J A;  5ITP A;  3JYR A;  4H0W A;  3ONM A;  3RN8 A;  1A55 A;  5CMB A;  4QFK A;  5CMC A;  3V83 A;  4JB7 A;  3T9V A;  2G29 A;  3K02 A;  4R6K A;  3N6T A;  3V5A A;  3C34 A;  2ANJ A;  3R7X A;  4KI0 E;  2X7Q A;  1D3K A;  4YMA A;  2VP1 A;  1URD A;  4G68 A;  2CZL A;  1H44 A;  5ICQ A;  3KFM A;  1OLA A;  5I58 A;  4KYS A;  4LA9 A;  2DWH A;  4GIZ A;  2OLB A;  1Y20 A;  2NVU B;  4U1O A;  2V93 A;  2R9J A;  3MPK A;  4PET A;  2O68 A;  1T0K A;  2DWJ A;  3HN0 A;  3LSL A;  4JDF A;  3RTF B;  2DYX A;  3T22 A;  1B5I A;  4F19 A;  1HSE A;  3P7I A;  4DE8 A;  2CMO A;  4RXL A;  3JV9 A;  1MM7 A;  4NF6 B;  2W7Y A;  4JWY A;  2AL5 A;  5I2K B;  3V89 B;  1SQY A;  1P1O A;  1H76 A;  2F5X A;  5H8S A;  1JVX A;  1B3L A;  1LAG E;  2DWA A;  2E1S A;  1D4N A;  1B5H A;  2FYI A;  1JQF A;  2Z8F A;  1BKA A;  3LSW A;  4H5G A;  3K0V A;  4F2O A;  2HAU A;  3CIJ A;  2ALU A;  3GZG A;  4QFP A;  4G8N A;  4ELQ A;  3AXF A;  5CM6 A;  3RTW B;  3TTN A;  3H4Z A;  2RC9 A;  3TYH A;  2DS9 A;  4R2B A;  1VFD A;  2PYY A;  4G8M A;  4R9F A;  5F7V A;  2F97 A;  2GRV A;  1QJM A;  3PUY E;  3OEL A;  1RYX A;  3RT6 B;  4MF3 A;  5FTH A;  2Z8E A;  1SYI A;  2H98 A;  5EHS A;  5TP9 A;  4NF8 B;  1P1W A;  3CFL A;  4GXA A;  2Q89 A;  4EQB A;  3KN7 A;  1US5 A;  4NF4 B;  4HTG A;  3WAE A;  4FEC A;  1TWY A;  2IEE A;  2Q88 A;  3U93 A;  4OFL A;  5ELV A;  4YKI A;  1P1Q A;  4LON B;  1NH8 A;  1B1H A;  1HSL A;  3B6T A;  3GXA A;  1B3E A;  3EF7 A;  3RLF E;  4E0W A;  5K2Y A;  3S9N C;  2O51 A;  1B58 A;  1S50 A;  2UVG A;  4R75 A;  4DLD A;  1ZBM A;  2ZNT A;  1M5C A;  3VFJ A;  2Q2A A;  3EQ1 A;  1ZJL A;  1VFE A;  3KOS A;  2I0B A;  2AYS A;  1PEB A;  1UTH A;  5KDT B;  1I6A A;  1II5 A;  3KN8 A;  1LAF E;  1FQE A;  1OLC A;  1DPE A;  3EPE A;  3FVG A;  1B7U A;  1BLF A;  3K1M A;  4E0X A;  3CSG A;  5H8Q A;  1M5F A;  1SW5 A;  2WKY A;  3H6T A;  1SD3 A;  2VD3 A;  3DP6 A;  4UA8 A;  4U4X A;  3IO6 A;  1B7H A;  4C0R A;  3G7W A;  3DP4 A;  1BTJ A;  4YKJ A;  2DSF A;  4O3B A;  3UK4 A;  3QUF A;  5I59 A;  2NXO A;  4PFW A;  2OK2 A;  1NNP A;  4OYV A;  4EXK A;  1JEV A;  4BDN A;  3IB0 A;  3G3H A;  1QKA A;  4GQO A;  5J1D A;  5FHM A;  4IO4 A;  2AIX A;  5FHN A;  2OBG A;  4F39 A;  4EDP A;  1LFG A;  3OO8 A;  3ILU B;  1TT1 A;  2AL4 A;  4BLA A;  2THI A;  3DLN A;  4ZEC A;  3MVX A;  2F7B A;  5I84 A;  4NF5 A;  5H8H B;  2XXT A;  4NTL A;  1A40 A;  1D9Y A;  1R9L A;  5FHO A;  5AA4 A;  4KQP A;  1B32 A;  3OEN A;  4YU0 A;  4BDR A;  2Y84 A;  4YAH X;  1NNK A;  5DYH A;  4G68 B;  5AA2 A;  1XS5 A;  3BBR A;  2VHA A;  3S9M C;  1B3F A;  1WOD A;  3CR9 A;  3K1P A;  2DE4 A;  2E0S A;  4X48 A;  2XX9 A;  3TFL A;  3W9W A;  3KZG A;  2ONK E;  2A5T A;  3TTK A;  3FD3 A;  4AB5 A;  1B5J A;  4YMB A;  4G4P A;  4O3A A;  4OEN A;  5AE4 A;  1LST A;  1US4 A;  2RF1 A;  3E4R A;  1B0L A;  1B1X A;  1UTB A;  3PD9 A;  3QIM A;  4OXV A;  4OEU A;  5JTY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...