4LP2B

Crystal structure of monomeric ligand binding domain of s. typhimurium cysb, a lysr transcriptional regulator at 2.2a
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
239
structure length
239
Chain Sequence
EHTWPDKGSLYIATTHTQARYALPGVIKGFIERYPRVSLHMHQGSPTQIAEAVSKGNADFAIATEALHLYDDLVMLPCYHWNRSIVVTPDHPLAATSSVTIEALAQYPLVTYTFGFTGRSELDTAFNRAGLTPRIVFTATDADVIKTYVRLGLGVGVIASMAVDPLADPDLVRIDAHDIFSHSTTKIGFRRSTFLRSYMYDFIQRFAPHLTRDVVDTAVALRSNEEIEAMFQDIKLPEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Gene regulation
molecule keywords HTH-type transcriptional regulator CysB
publication title Crystal structure of monomeric ligand binding domain of S. typhimurium CysB, a LysR transcriptional regulator at 2.2A
rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 64
structure length 239
sequence length 239
ec nomenclature
pdb deposition date 2013-07-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lp2B01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4lp2B02
1CB6A 3O2AA 2UVIA 3G7WA 5ICTA 1LGBC 4YAHX 3K1PA 4ECFA 4LUBA 1R9QA 3UP9A 2ZNSA 3KJTA 1PB7A 2QRYA 1EZOA 2GH9A 3SDFA 2QL3A 2P2AA 1AOVA 2DP8A 1LFGA 1JW4A 1MG1A 4EF2A 4ESXA 3FGSA 3L6HA 4BDMA 4N6PA 4NTLA 3MW0A 3A09A 2H98A 3HO7A 5DEXB 4HTGA 4GL0A 4DLDA 1AL3A 5IAIA 5DYHA 2Y7WA 4R6YA 3T9XB 2VOZA 4G68C 2DYXA 4F31B 1YPNA 1A8EA 3RTWB 4ZEIA 2DE4A 4RPOA 4I9DA 2PMSA 1N84A 5L9MA 1OQHA 2YJPA 3V5AA 4ZECA 1H45A 3CFZA 5J1DA 1KWHA 1A7LA 3ECRA 1LCTA 3TFLA 1YTVA 3O28A 2DS9A 2FA7A 2X26A 3ONMA 4GIZA 2PVUA 3SETA 5AA4B 2XXIA 4K3FA 5H8QB 1MQDA 3W9VA 4BLAA 2F78A 3T66A 5CC2A 2YPNA 4ONYA 3MZ1A 3U93A 1YAEA 1R1NA 1ZBMA 2DQVA 3HCQA 3U72A 1IEJA 1B5HA 5TPAA 4EF1A 3MVWA 2UYFA 1A40A 4H0WA 2R6GE 3MWBA 2XXPA 1BLFA 3H6VA 3FVGA 4OTEA 1EU8A 1MM6A 5CBSA 1FQBA 4YB5A 1MXVA 3IOWA 1HSJA 3G3IA 5LOMA 4NF4A 3KN3A 2ZMBA 3K6WA 1R9LA 3DM0A 3O97A 3H6WA 2A5TB 1M5FA 3FD3A 2UVGA 4H65A 1ELJA 3D4GA 4ESWA 4PQJA 3CG3A 3TTNA 4G8NA 4IGTA 1PC3A 1Z7ME 3GZGA 3N6TA 4BDLA 2DVZA 3ILTB 1B05A 4YKKA 2QS1A 1ZMGA 4G68B 4LVQA 4ZEKA 5B7DA 2I4BA 3RPWA 1ZLQA 3MC2A 2DVCA 5H8NB 1LFHA 3MZBA 4R2BA 2X7QA 3VVDA 4IO7A 1MQIA 1SI1A 5H8HA 5DVIA 2XX8A 1LLSA 1P1OA 2OZZA 5KDTA 4F1UA 3VLVA 3OEMA 3PPPA 5ICQA 3PUXE 3IB1A 4U23A 1MQJA 3T9HB 5I57B 1SDXA 4O3AA 1H76A 4NMYA 1MDP1 3T22A 2Y7RA 1PEBA 4BDOA 3DP8A 3OO8A 1HSEA 4PFWA 4OMBA 3IOTA 4LONB 2NXOA 4IY5A 2VD2A 4F3GA 3PPOA 3EF7A 1CE2A 4OERA 3CVGA 2R71A 4P11A 1Y20A 4JWOA 4OYVA 4EQ7A 3PUVE 2OWSA 1URSA 3PPNA 3VFJA 1UTBA 2H99A 3B6TA 3TCGA 3H7MA 1MH4A 3TKDA 2O68A 2RKMA 5FTIA 5H8FB 4KR5A 1XS5A 1GTKA 3MP8A 3HHFA 1BIYA 4ZZEA 3K6VA 3M3LA 4POWA 4LATA 5EHMA 1JNFA 1DTGA 4JBZA 5ISUA 2RCAA 4OWDA 1B46A 3PMXA 3K01A 3K0VA 2HXWA 3UIFA 3N26A 2O1LA 3PUWE 3R6UA 3TPAA 1N3XA 3UN6A 4DDDA 4BDNA 2F6PA 4F22A 4GXAA 3FV2A 5I59B 3M8UA 3S4UA 4F1YA 3O66A 5ELVA 2PT1A 3KG2A 4GVOA 5EYFA 3SERA 3C34A 3KOSA 3R26A 1XC1A 3EPEA 3QSLA 3QUJA 5HBCA 2DXRA 3QK6A 3U94A 1LAXA 4ZEBA 5BWJA 1MQGA 3H6TA 4ZE9A 4GL8A 3PMVA 4MBPA 3VVFA 3IR1A 5K2YA 5KCJA 1XVXA 5DVJA 2V25A 3FVKA 4NF8A 1FQEA 2H5YA 3C36A 3PU5A 3JV9A 5L8DA 4MLVA 2B3BA 3RLFE 1B4HA 3TYHA 1IIWA 1NH8A 3OD7A 4DZ1A 2F6GA 1O63A 1MQHA 1JW5A 4IO4A 4OVJA 1AH5A 4NWCA 1B7HA 4R9GA 1B3HA 3CSGA 1XVYA 2Z23A 4NEDA 3OMBA 1S9TA 2GHBA 3HPIA 2HAVA 1RKMA 1Y3QA 4WXJA 3S9MC 3FXUA 2QJEA 2XX9A 1ZU0A 2B65A 1LB9A 1II5A 4WKMA 2H4IA 4JSOA 4BDRA 3U92A 1B1HA 1JVXA 4U22A 2O69A 2XD2A 5I58B 3B7DA 5B70A 2NOOA 4X1DA 3G3HA 1TFAA 1S50A 3FJ7A 2DE3A 3G3GA 2HFBA 5TU0A 3UORA 3JYRA 5I2NB 3C35A 1DOTA 3U1OA 4JSDA 3OO6A 1D9VA 1LB8A 3OO9A 1IXHA 3V83A 4H5FA 4U2RA 2E0SA 4YB6A 2WKYA 3Q27A 1N3WA 2O51A 4U4XA 3OSRA 4GXSB 1MY4A 2V3TA 5AA2B 1BP5A 1FTKA 1I6AA 4TLLB 2REGA 2QS3A 4GF8A 3O6HA 4WEDA 4KCCA 4QRZA 2I0CA 4NE4A 1JQFA 5I59A 4F18A 4HW8A 3CIJA 4ELOA 3OO7A 1ZIUA 2XXWA 3IOUA 2PT2A 3EQ1A 4PP0A 1Y4TA 1XHYA 2ALUA 3TMGA 2ZYNA 4JB7A 2AIXA 3TTLA 5I56A 4LP2B 3LSLA 3D4CA 4M4GA 3LSFB 4QSCA 1B3LA 4Q5TA 1B3GA 3C32A 3H6UA 2ONRA 4ZDMA 3O6GA 1P1UA 1FW0A 1SBPA 1FTMA 4HS7A 5L9OA 4KCDA 2XXHA 4IGRA 1MXYA 1Y1ZA 1M5BA 3MPLA 1MXXA 5DTBA 2I4CA 2BJJX 2XX7A 2RF1A 2PYYA 4ELPA 3F11A 5CMBA 3UA8A 1VFEA 3VXCA 4NWDA 1FQAA 1UIVA 4IY6A 1B4ZA 1SQYA 3SKPA 1IUDA 2XHDA 1FTLA 1O64A 2DOJA 2O84X 3RNNA 2DSFA 4WEPA 2AYSA 1USYH 1I6QA 2E1SA 4GD5A 4I8CA 1MXWA 2F7CA 4PFTA 5FHMA 4FORA 4R75A 3RGYA 2RCBA 3H3GA 3K6UA 4DIGA 1BTJA 3AXFA 1B3EA 3TQWA 4O3CA 1LBCA 4Z7EA 4YKPA 3RQTA 2QSXA 1EH3A 1DSNA 2R9JA 2Q8JA 4N13A 2F35A 3BFTA 4MFIA 4EQBA 3DELB 2ZNUA 1WODA 4NF5A 4P0IA 4F2OA 1GV8A 1QUKA 2H25A 3TODA 1T0KA 1B51A 1POY1 2HZKA 4LQ5A 1FQFA 4DE8A 1N0TA 1TXFA 5L9SA 4QFLA 1M5DA 3CFXA 2XXQA 4XIGQ 4FE8A 1H44A 2I48A 1P1NA 3ZSFA 3E4RA 3BKIB 3PMWA 5CRYA 3KSJA 3P7IA 3TTRA 2UXAA 5K2XA 4BDQA 3IO6A 4RA1A 4GWOA 5JTYB 1DPEA 3K00A 4KFQA 4R73A 4F19A 1MXUA 3ODBA 3FIRA 5DEXA 2GHAA 3GBBA 2OCUA 4PE5B 2B3FA 5ITPA 1MY3A 1Q1KA 3MPKA 5IKBA 1EZ9A 4YU0A 3G3FA 2QMXA 1A54A 3N94A 3CRBA 1MRPA 1UTHB 4NF6B 1B52A 2REJA 3O9PA 4TOZA 1EZPA 5FHNA 2F97A 4F2QA 3B6WA 4QFKA 1B1XA 1M5CA 2XXUA 3HV1A 1SW4A 4H5GA 2Y7KA 4DCYA 3OELA 1MPDA 4U4SA 2DWIA 2ZNTA 1WDNA 2CZLA 3BFUA 3CI8A 3MAMA 1AIVA 1QKAA 4FEBA 5TP9B 1NMUA 1MY0A 1FTJA 3PPQA 4H8IA 5AA4A 3E3KA 3MVZA 5H8QA 4QFPA 3DP6A 3DLNA 2PX1A 3N6UA 4F3BA 4THIA 4U1OA 3OXNA 4DXBA 1LAGE 1LFIA 1A8FA 1LBBA 2Y7PA 3TTMA 3MBPA 4E0XA 1B9JA 4FAJA 1DMBA 3KJ7A 4M1VA 3S9EA 3MUQA 3IJXB 5A5XB 2ESNA 3O6IA 4HCWA 1SW2A 3LBSA 4QF9A 4PFYA 3FVOA 4YKIA 3HHGA 3E13X 5AA2D 1SVXB 2OLBA 4LA9A 2A5TA 1R6ZA 3QAXA 1JW1A 1NKXA 1DPPA 1PBPA 1VE4A 3SEUA 2F36A 1RYXA 1GVCA 3SEVA 3CG1A 4FECA 4RK9A 1B3FA 1DTZA 4MLQA 3GXAA 4G2ZA 4OEVA 2HZLA 3LUYA 5EHSA 3TDJA 1A55A 5KZTA 3I5OA 3IK6B 4X1BA 3EHTA 2ABHA 4RK2A 4G68A 3V89B 1IQ7A 1F9BA 3W9WA 4F3SA 4U21A 5H8NA 2UYEA 2F8DA 4LZ5A 3VLUA 1FCKA 3ZS6A 2V3UA 5AA1A 4G8MA 3OSQA 4FJPA 1XOCA 5I57A 1NNPA 5JEIA 2W7YA 5JK4A 3IB0A 2Y7IA 4FEDA 2Q2AA 3FVNA 4N07A 1IZ1A 1VSOA 3KEIA 4LQ2A 4C1TA 1URDA 5CMKA 4ELRA 3G3KA 2Z8FA 1SYHA 4OETA 3G3JA 1UIUA 1H3DA 2GRVA 3HSTA 3H4ZA 4KYDA 2GFEA 2DE2A 1SI0A 2O7UA 4XKRA 2OWTA 4EDPA 2OJTA 1FQDA 1LAHE 2LAOA 2PBWA 1Z7NE 3QXMA 1OQGA 5H8FA 5HM4B 3RN8A 1OIBA 1OVBA 3FV1A 1ATGA 4JWXA 1SYIA 2RC7A 4YKJA 3Q28A 3KZGA 4EQ9A 3K2DA 3T9UA 1MXZA 1B0HA 2F34A 2UVJA 3FJGA 4JWYA 3SEWA 4DXUA 1B0LA 1RYOA 4I62A 3ZKLA 1D9YA 3CR9A 3A3UA 4PETA 3B6QA 4RYAA 2ONKE 3ZKKA 1L5TA 3QIMA 2XXVA 3ILUB 3OOAA 4FIMA 1HSLA 3PUZE 4R6KA 4F3PA 3MVYA 2FNCA 2ZXTA 3RT8A 3VDFA 4IB2A 3LC8A 4TLMB 1B58A 1MY1A 1OVTA 4ZS9A 3TAJA 3HN0A 4H1XA 2IA4A 4Q8RA 1SW5A 1QULA 4YMAA 3PD8A 2G93A 1MPCA 4XXUA 3Q25A 1Q35A 3IX1A 2ZYMA 2OK2A 1Y9UA 3RTFB 1M5EA 2IEEA 3I3VA 5H8HB 4F1VA 1US5A 5ITOA 5KDTB 1B2HA 2I6EA 3MJNA 1LCFA 4ND9A 1IXCA 3BBRA 3K02A 3IOVA 3VXBA 2KLFA 3C31A 4DXCA 2P0SA 1VFDA 1H43A 3FZVA 1NL5A 2XXXA 2Q2CA 1TT1A 4RXLA 4R2FA 4Q0CA 1Y4CA 3IORA 4TQUQ 2I3WA 4F39A 2CMOA 1FQCA 4IO2A 4KI0E 3K6XA 3U8QA 4IO6A 4C1UA 3RT6B 2THIA 3S9LC 3UGWA 3VV5A 2VP1A 1NNTA 3C33A 4DCXA 3KN7A 1UTBB 2AL4A 4PFUA 4OFLA 1Y3PA 1URGA 3T96B 4KYEA 2QS4A 3K1MA 4I1DA 2QS2A 1ANFA 2Q88A 5I58A 4RJZA 2Z8EA 4MH5A 3N5LA 2HAUA 2A5SA 3KBRA 1NH7A 3PGFA 5I2NA 4Q30B 4ZZAA 4OEUA 5HPQA 4EUOA 3WAEA 2HEUA 2O7IA 3GBAA 4IO5A 5DVFA 3I6VA 1S7YA 1JEUA 4UA8A 1OLCA 2UVHA 5M2VA 4YICA 4KHZE 5AA2A 1JVYA 3FXQA 4L17A 1VR5A 2G29A 4X48A 4C0RA 4OHNA 4OXVA 2XXYA 4JDFA 4ISUA 1B5IA 2I0BA 1SW1A 1P99A 1FTOA 4MF3A 2I3VA 3OENA 4AB5A 2NUVA 3TQLA 4RY1A 1NFTA 1Y3NA 1LAFE 4KPTA 2YLNA 3LSWA 4XKQA 4GFRA 2ONSA 1N7XA 5KCJB 3CFLA 4XTCQ 1LSTA 1NNFA 2QPQA 4NF8B 3VE1B 5BUUA 1B40A 2X7PA 3JZJA 4IO3A 3H03A 5I2KB 2F7AA 3MZ9A 2DWAA 1MS7A 2D3IA 4OESA 2Y84A 3S2VA 3M3KA 4OQOA 3EHSA 3T9VA 4POXA 3R7XA 3FASA 1ZJLA 2Q9TA 3KOTA 2O6AA 2ZYKA 4R9FA 1XT8A 4R72A 3WAFA 5AE4A 1J1NA 2ZYOA 4ZEFA 2XXTA 4QSEA 3A3CA 5F1QA 5CMMA 4RPNA 2NVUB 2O1MA 2ANJA 3USDA 1D4NA 5CI5A 2RC9A 5CM6A 1QKBA 3IO4A 1IITA 4H6DA 2Q89A 4AB6A 4OFJA 3IJOB 3QYTA 2DXYA 4HCYA 2XD3A 1B7UA 5FHOA 3MP1A 3FJMA 2HQ0A 4EXKA 1N7WA 3SESA 1I6BA 3FXRA 4F29A 2VD3A 3VLWA 3UK4A 4R6HA 5F7VA 2RINA 5I84A 2I58A 4GLIA 4EXLA 3MVXA 1QW0A 1N04A 1QUJA 1TFDA 1B6HA 2P1SA 1PDAA 3MQ9A 4R74A 2QMWA 3T93B 4UACA 4QSDA 1TWYA 5FTHA 1POTA 5CBRA 3Q29A 1WVJA 4P0GA 3FUZA 3MP6A 1OMPA 2D21A 2H9BA 1MDQA 4QHQA 1Y1MA 1US4A 4KD5A 4FATA 2NWJA 4OENA 1QVSA 3TEPA 4O3BA 2F7BA 3THIA 4KYSA 3RY3A 1UQWA 4LZ7A 1GR2A 3SEYA 2AL5A 3TUSA 4GQOA 4ZE8A 1GGGA 1PBQA 4JXIA 4ELQA 2V93A 4XKPA 4QFOA 3O29A 3E9XA 3PD9A 4YZZA 3GLBA 2HCAA 3RUMA 3PPRA 5H8SA 1JETA 2DWJA 1N76A 2I49A 5I56B 1A99A 4OZ9A 3TELA 4E0WA 3K4UA 1SD3A 1AMFA 3DP4A 3KGCA 2Z8DA 1P1WA 4YMBA 2V3QA 3TCFA 5JTYA 1I69A 3Q26A 4OFOA 1NNKA 3FATA 3C4MA 3L6GA 1IXIA 3W15C 5I2KA 4KQPA 2D5WA 2OBGA 1O7TA 3KFMA 4H8JA 3VVEA 1OLAA 3EN3A 2V84A 2F5XA 3LSXA 3M3FA 1UTHA 3V8XB 4NF6A 3TTKA 4GRKA 5DT6A 4LZ8A 3OEKA 1MH3A 3QUFA 3KN8A 2FYIA 3SEXA 1ZTYA 3CSBA 1JEVA 2RC8A 1MM7A 5AA3A 4H67A 3S9NC 1IXGA 1D3KA 5CMCA 3C9HA 3TZAA 1PB8A 3IL1B 1YCJA 3IB2A 4YB7A 4XKNA 3IAZA 5TP9A 3K1NA 2XXRA 2VGQA 3PUYE 2DWHA 1ZKBA 4AQ4A 4G4PA 1B32A 3LR1A 5TPAB 1B7ZA 1PB9A 1QUIA 3PV0E 1USYE 2M8CA 4NF5B 4ZEDA 4QFNA 2VHAA 2Z22A 4RNSA 4G77A 4GOTA 4U1ZA 1MPBA 1QJMA 4NF4B 1P1QA 1MY2A 4G8HA 4Z0IA 1B5JA 3H06B 3EHUA 5A5XA 1BKAA 3KSXA 4X9TA 3TCHA
chains in the Genus database with same CATH superfamily
1CB6A 3O2AA 2UVIA 1FBGA 3G7WA 5ICTA 1LGBC 4YAHX 2WBBA 3K1PA 4ECFA 4LUBA 1IMDA 1R9QA 3UP9A 2ZNSA 3KJTA 1PB7A 2QRYA 1EZOA 2GH9A 3SDFA 4H45A 2QL3A 1BK4A 2P2AA 1NV2A 1AOVA 2DP8A 1LFGA 1JW4A 1INPA 1MG1A 4EF2A 4ESXA 3FGSA 3L6HA 4BDMA 3IFCA 4N6PA 4NTLA 3MW0A 3A09A 2H98A 3HO7A 5DEXB 4HTGA 4GL0A 5EQAA 4DLDA 1AL3A 4OVRA 5IAIA 5DYHA 2Y7WA 4R6YA 3T9XB 2VOZA 4G68C 2DYXA 4F31B 1YPNA 1A8EA 2Y5LA 3RTWB 4NQ8A 4ZEIA 2DE4A 4RPOA 4I9DA 1K9YA 2PMSA 2KR0A 1N84A 5L9MA 1NV3A 1OQHA 2YJPA 3V5AA 4ZECA 1H45A 3CFZA 5J1DA 1KWHA 2XXKA 1A7LA 3ECRA 1LCTA 3TFLA 1YTVA 3O28A 2DS9A 2FA7A 2X26A 2B4LA 3ONMA 4GIZA 2PVUA 3SETA 2ZZVA 5AA4B 2XXIA 4K3FA 5H8QB 1MQDA 3W9VA 4BLAA 2F78A 5LTCA 3T66A 4N6DA 2XWKA 2B4MA 5CC2A 2YPNA 4ONYA 3MZ1A 3E78A 3U93A 1YAEA 1R1NA 1ZBMA 2DQVA 3HCQA 1Q9DA 3U72A 1IEJA 1B5HA 1FJ6A 5TPAA 2F3BA 4EF1A 3MVWA 2UYFA 1A40A 4H0WA 2R6GE 3CHGA 3MWBA 2XXPA 1BLFA 3H6VA 3FVGA 4OTEA 1EU8A 1MM6A 4GWSA 5CBSA 1FQBA 4YB5A 1MXVA 3IOWA 1HSJA 2OWZA 3QMFA 3G3IA 5LOMA 4NF4A 1LBYA 3KN3A 3RPLB 2ZMBA 3K6WA 1R9LA 3DM0A 3O97A 3H6WA 2A5TB 1M5FA 3FD3A 2UVGA 1FPGA 4H65A 1ELJA 3D4GA 4ESWA 4PQJA 3CG3A 3TTNA 2P3VA 4G8NA 3TCHA 4IGTA 1PC3A 1Z7ME 3GZGA 3N6TA 4BDLA 2DVZA 2FHYA 3ILTB 1B05A 4YKKA 2QS1A 1ZMGA 4G68B 4LVQA 4ZEKA 5B7DA 2I4BA 3RPWA 1ZLQA 3MC2A 1KA0A 2DVCA 5H8NB 1LFHA 5EYHA 3MZBA 4R2BA 2X7QA 3VVDA 4IO7A 1MQIA 1SI1A 5H8HA 5DVIA 2XX8A 1LLSA 1P1OA 2OZZA 5KDTA 4F1UA 3VLVA 3OEMA 3PPPA 5ICQA 4MX6A 5IZ3A 3PUXE 3IB1A 4U23A 1MQJA 3T9HB 5I57B 1SDXA 4GBWA 4O3AA 1DBZA 1H76A 4NMYA 1MDP1 3T22A 2Y7RA 3B50A 1PEBA 1NV5A 4BDOA 3DP8A 3OO8A 1HSEA 1FPDA 4PFWA 4N8YA 4OMBA 3IOTA 4LONB 2NXOA 4IY5A 4H46A 2VD2A 4F3GA 3PPOA 3LUZA 3EF7A 1CE2A 4OERA 3CVGA 2R71A 4P11A 1Y20A 4PF8A 5IGAA 4JWOA 4OYVA 1FPJA 4EQ7A 3PUVE 2OWSA 3HFUA 1URSA 3PPNA 3VFJA 4NHBA 1UTBA 1FPBA 2H99A 3B6TA 3TCGA 3H7MA 4AS5A 1MH4A 3TKDA 2O68A 2RKMA 5FTIA 5H8FB 4KR5A 1XS5A 2GQ1A 1GTKA 3MP8A 3HHFA 4HE2A 1BIYA 4ZZEA 3K6VA 3M3LA 4POWA 4LATA 5EHMA 1JNFA 4HE0A 1DTGA 1KA1A 4JBZA 5ISUA 1EYIA 2RCAA 4OWDA 1B46A 4PDHA 2ZZXA 3PMXA 2Q74A 1FBCA 3K01A 3K0VA 2HXWA 3UIFA 3N26A 2O1LA 3PUWE 3R6UA 3TPAA 1N3XA 3UN6A 2KQZA 4DDDA 4BDNA 2F6PA 3D1RA 2ZZWA 4F22A 4GXAA 3FV2A 5I59B 3M8UA 4PE3A 3S4UA 2F3DA 4F1YA 3O66A 4NAPA 5ELVA 2PT1A 3KG2A 4GVOA 5EYFA 3SERA 3C34A 4GX3A 3KOSA 1G0IA 3RPLA 3R26A 1XC1A 3EPEA 4MMPA 3QSLA 3PTYA 3QUJA 5HBCA 2OX3A 2DXRA 4P9KA 3QK6A 3U94A 4MNIA 1LAXA 4ZEBA 5BWJA 1MQGA 3H6TA 4PBQA 4ZE9A 4GL8A 3PMVA 4MBPA 3VVFA 3IR1A 5K2YA 5KCJA 1XVXA 5DVJA 2V25A 3FVKA 4NF8A 1FQEA 2H5YA 3C36A 3PU5A 3JV9A 5L8DA 4MJOA 4MLVA 2B3BA 4JVDA 3RLFE 1B4HA 3TYHA 1IIWA 1NH8A 3OD7A 4DZ1A 5F24A 2F6GA 4OVTA 1O63A 1MQHA 1JW5A 4IO4A 4OVJA 1AH5A 4NWCA 1B7HA 4R9GA 1NUYA 5I5PA 1B3HA 3CSGA 1XI6A 1XVYA 2Z23A 4NEDA 3OMBA 1S9TA 2GHBA 3HPIA 2HAVA 1RKMA 1Y3QA 4WXJA 3S9MC 3FXUA 2QJEA 2XX9A 5IZ1A 1ZU0A 2B65A 1LB9A 1II5A 1FTAA 4WKMA 3E79A 2H4IA 4JSOA 4BDRA 3U92A 1B1HA 4PBHA 1JVXA 3LV0A 1NV0A 4U22A 2O69A 2XD2A 4IR8A 5I58B 3B7DA 5B70A 2NOOA 4X1DA 3G3HA 1TFAA 1S50A 4P56A 3FJ7A 2DE3A 3G3GA 2HFBA 5TU0A 3UORA 3JYRA 5I2NB 4I40A 3C35A 1DOTA 3U1OA 4JSDA 3OO6A 1D9VA 1LB8A 4FBPA 3OO9A 1IXHA 3V83A 4H5FA 4U2RA 2E0SA 4YB6A 2WKYA 3Q27A 1N3WA 1EYKA 2O51A 1IMCA 4U4XA 3OSRA 4GXSB 4PTKA 1MY4A 2V3TA 5AA2B 1BP5A 1FTKA 2HHMA 1I6AA 4TLLB 2REGA 2QS3A 2FBPA 4GF8A 4PGPA 3O6HA 4WEDA 4KCCA 1FJ9A 4QRZA 2I0CA 4NE4A 1IMAA 1JQFA 5I59A 4F18A 4HW8A 3CIJA 4ELOA 3OO7A 1ZIUA 2XXWA 3IOUA 4DI4B 2PT2A 1NV4A 3EQ1A 4PP0A 2QVRA 1Y4TA 2CZKA 1XHYA 4NGUA 2ALUA 3TMGA 1LBZA 2ZYNA 4JB7A 1YXIA 2AIXA 3TTLA 5I56A 4LP2B 3LSLA 3D4CA 4OVSA 4M4GA 3LSFB 2XA5A 4G61A 4QSCA 1B3LA 4Q5TA 1G0HA 1CNQA 1B3GA 3C32A 3H6UA 2ONRA 4ZDMA 3O6GA 1P1UA 1FSAA 4N4UA 3FXBA 1FW0A 1SBPA 1FTMA 4HS7A 5L9OA 4KCDA 2XXHA 4IGRA 1MXYA 1Y1ZA 1M5BA 3MPLA 1MXXA 5DTBA 2I4CA 1LBWA 2BJJX 2XX7A 2RF1A 2PYYA 4ELPA 3F11A 5CMBA 3UA8A 1VFEA 3VXCA 4NWDA 2P3NA 1FQAA 1UIVA 4IY6A 1B4ZA 4GWYA 1SQYA 3SKPA 1IUDA 5ET7A 2XHDA 1FTLA 1O64A 2DOJA 2O84X 3RNNA 2DSFA 4WEPA 2AYSA 1USYH 1I6QA 2E1SA 4GD5A 4I8CA 1MXWA 2HXRA 2F7CA 4PFTA 5FHMA 4FORA 4GX4A 4R75A 3RGYA 2RCBA 3H3GA 1NUZA 3K6UA 4DIGA 1BTJA 4I3EA 3AXFA 1B3EA 3TQWA 4O3CA 1LBCA 4Z7EA 4YKPA 3RQTA 2QSXA 1EH3A 1NV1A 1DSNA 2R9JA 2Q8JA 4N13A 2F35A 3BFTA 4MFIA 4EQBA 3DELB 2ZNUA 1WODA 4NF5A 4P0IA 4F2OA 1GV8A 5EQ9A 1QUKA 2H25A 3TODA 1T0KA 1B51A 1POY1 2HZKA 4LQ5A 1FQFA 4MNPA 4DE8A 1N0TA 1TXFA 5L9SA 4QFLA 1IMFA 1M5DA 4LN5A 3BIGA 4N91A 3CFXA 2XXQA 3NOHA 4XIGQ 3GYYA 3SZPA 4FE8A 1H44A 3MYUA 2I48A 1P1NA 3ZSFA 3E4RA 3BKIB 3PMWA 5CRYA 3KSJA 4GBVA 2BJIA 4MEVA 3P7IA 3TTRA 2UXAA 5K2XA 4BDQA 3IO6A 4RA1A 4GWOA 5JTYB 1DPEA 3K00A 5A5LA 4KFQA 4QBAA 4R73A 4F19A 4GWUA 1MXUA 3ODBA 3FIRA 5DEXA 2GHAA 3GBBA 2OCUA 2JJKA 4PE5B 2B3FA 5ITPA 1MY3A 1Q1KA 3KBZA 3MPKA 5IKBA 1EZ9A 2VPNA 4YU0A 3G3FA 1FBEA 1FRPA 2QMXA 1A54A 3N94A 3CRBA 1MRPA 1UTHB 4NF6B 1B52A 2REJA 3O9PA 4TOZA 1EZPA 5FHNA 2F97A 4F2QA 3B6WA 4QFKA 1B1XA 1M5CA 5ET6A 2XXUA 5I3SA 3HV1A 1SW4A 4H5GA 2Y7KA 5ESYA 4DCYA 3OELA 1MPDA 4MAGA 4U4SA 2DWIA 2ZNTA 1WDNA 2CZLA 3BFUA 4NG7A 3CI8A 3MAMA 1AIVA 1QKAA 4FEBA 5TP9B 1NMUA 1MY0A 1FTJA 3PPQA 4H8IA 5AA4A 3E3KA 3MVZA 4MIJA 5H8QA 4QFPA 3DP6A 2XWVA 3DLNA 2PX1A 4O8MA 3N6UA 4F3BA 5I7IA 4THIA 4U1OA 3OXNA 4N6KA 4DXBA 1LAGE 1LFIA 1A8FA 1LBBA 2Y7PA 3TTMA 3MBPA 4E0XA 1B9JA 4FAJA 1FPIA 1DMBA 1JP4A 1LEVA 3KJ7A 4M1VA 3S9EA 3MUQA 4PC9A 3IJXB 4O7IA 3A29A 5A5XB 2ESNA 2L5VA 3O6IA 4HCWA 1SW2A 4MHFA 3LBSA 2QVVA 4QF9A 4PFYA 3FVOA 4YKIA 2VT5A 3HHGA 3E13X 5AA2D 1SVXB 2OLBA 4LA9A 4N17A 2A5TA 1R6ZA 3QAXA 4MCOA 1SPIA 1NUXA 1JW1A 1NKXA 4XF5A 1DPPA 1PBPA 1VE4A 3SEUA 2F36A 1RYXA 1GVCA 3SEVA 3CG1A 4FECA 4RK9A 1B3FA 1DTZA 1NUWA 4MLQA 3GXAA 4G2ZA 4OEVA 2HZLA 3EKIA 3LUYA 5EHSA 3TDJA 1A55A 3T0JA 5KZTA 3I5OA 3IK6B 4X1BA 3EHTA 2ABHA 4RK2A 4G68A 3V89B 1IQ7A 1F9BA 3W9WA 4F3SA 4U21A 5H8NA 2UYEA 3KC1A 3RYDA 2F8DA 4LZ5A 4PDDA 3VLUA 1AWBA 1FCKA 3ZS6A 2V3UA 5AA1A 4G8MA 3OSQA 2R8TA 4X04A 4FJPA 1XOCA 2WBDA 5I57A 1NNPA 5JEIA 2W7YA 4JVIA 5JK4A 3IB0A 2Y7IA 4FEDA 2Q2AA 3FVNA 4N07A 1IZ1A 1VSOA 3KEIA 4LQ2A 4C1TA 1URDA 5CMKA 4ELRA 3G3KA 2Z8FA 1SYHA 4OETA 3G3JA 1UIUA 1H3DA 2GRVA 5IZZA 3HSTA 3H4ZA 4KYDA 2GFEA 2DE2A 1SI0A 5ET5A 2O7UA 4XKRA 2OWTA 4EDPA 1KZ8A 2OJTA 1FQDA 1LAHE 2LAOA 2PBWA 1Z7NE 3BIHA 4NF0A 3QXMA 1NV7A 1OQGA 5H8FA 5HM4B 3RN8A 1OIBA 1OVBA 3FV1A 1ATGA 4JWXA 2QFLA 1SYIA 2RC7A 4YKJA 3Q28A 3KZGA 4EQ9A 3K2DA 3T9UA 1MXZA 1B0HA 2F34A 2UVJA 3FJGA 4JWYA 4PAKA 3SEWA 4DXUA 1B0LA 1RYOA 4I62A 3ZKLA 1D9YA 3CR9A 3A3UA 4PETA 3B6QA 4RYAA 2ONKE 3ZKKA 1L5TA 4OVQA 3QIMA 2XXVA 3ILUB 4N81A 3OOAA 4FIMA 1HSLA 3PUZE 4PCDA 4R6KA 4F3PA 3MVYA 2FNCA 2ZXTA 3RT8A 3VDFA 4IB2A 3LC8A 4TLMB 4MNCA 1B58A 1MY1A 1OVTA 4ZS9A 3TAJA 2PFZA 3HN0A 4H1XA 4PFRA 2IA4A 1NI9A 4Q8RA 1SW5A 1QULA 4YMAA 3PD8A 2G93A 1MPCA 4XXUA 3Q25A 1Q35A 3IX1A 2ZYMA 2OK2A 4OVPA 4JVCA 3FBPA 1Y9UA 4KXPA 3RTFB 1M5EA 2IEEA 3I3VA 2CZIA 5H8HB 4F1VA 1US5A 4PFIA 5ITOA 5KDTB 1B2HA 5DW8A 4NX1A 2I6EA 2CEYA 3MJNA 1LCFA 5IZ3B 2WYKA 4ND9A 1IXCA 3BBRA 3K02A 3IOVA 3VXBA 5EQ7A 2KLFA 3C31A 4DXCA 2P0SA 1VFDA 1H43A 3FZVA 1NL5A 2XXXA 2V4CA 2Q2CA 1TT1A 4RXLA 4R2FA 4Q0CA 5EQ8A 1Y4CA 3IORA 4TQUQ 2I3WA 4F39A 2CMOA 4HXVA 1FQCA 4IO2A 4KI0E 3K6XA 3U8QA 4IO6A 4C1UA 1FPFA 2XWOA 3ISPA 2THIA 3RT6B 3S9LC 3UGWA 3VV5A 2VP1A 4XEQA 1NNTA 3C33A 4DCXA 3KN7A 4P8BA 1UTBB 2AL4A 4PFUA 4OFLA 1Y3PA 1URGA 3T96B 4KYEA 1YYZA 2QS4A 3K1MA 4I1DA 2QS2A 1ANFA 2Q88A 5I58A 4RJZA 2Z8EA 4MH5A 3N5LA 4OA4A 2HAUA 2Y5KA 2A5SA 3KBRA 1NH7A 3PGFA 5I2NA 4Q30B 4ZZAA 4OEUA 4UABA 5HPQA 4EUOA 3WAEA 2HEUA 2O7IA 2VPOA 3GBAA 4IO5A 5DVFA 3I6VA 1S7YA 1JEUA 4UA8A 1OLCA 2UVHA 2FVZA 5T3JA 5M2VA 4YICA 4KHZE 5AA2A 1JVYA 3FXQA 4L17A 1VR5A 2G29A 4X48A 4C0RA 4OHNA 4OXVA 2XXYA 4JDFA 4ISUA 1DCUA 1B5IA 4O94A 2I0BA 1SW1A 4PAIA 1P99A 1FTOA 4MF3A 2I3VA 4O7MA 3OENA 4AB5A 2NUVA 3TQLA 4RY1A 1NFTA 1Y3NA 1K9ZA 1LAFE 4KPTA 1FBDA 2YLNA 2XWIA 3LSWA 4XKQA 4GFRA 2ONSA 1N7XA 5KCJB 3CFLA 4XTCQ 1LSTA 1NNFA 2QPQA 4NF8B 3VE1B 5BUUA 1B40A 4PFBA 2X7PA 3JZJA 4IO3A 3H03A 5I2KB 2F7AA 3MZ9A 2DWAA 1RDYA 1QGXA 1MS7A 2D3IA 4OESA 3MSTA 1VDWA 2Y84A 3S2VA 3M3KA 4OQOA 2WX9A 1RDXA 3EHSA 3T9VA 4POXA 3R7XA 3FASA 1ZJLA 2Q9TA 4OANA 3KOTA 2O6AA 2ZYKA 2CZHA 4R9FA 1XT8A 4R72A 3WAFA 5J16A 5AE4A 1J1NA 2ZYOA 4ZEFA 2XXTA 4QSEA 3A3CA 5F1QA 5CMMA 2QVUA 4RPNA 2NVUB 2O1MA 2ANJA 3USDA 1D4NA 5CI5A 2RC9A 5CM6A 1QKBA 4N8GA 3IO4A 1IITA 4H6DA 2Q89A 4AB6A 1IMEA 4OFJA 3IJOB 3QYTA 2DXYA 4HCYA 2XD3A 1B7UA 5FHOA 3MP1A 3FJMA 5IM2A 2HQ0A 4EXKA 4XFEA 1N7WA 3SESA 1I6BA 3FXRA 4F29A 2VD3A 3VLWA 3UK4A 4R6HA 5F7VA 2RINA 3B8BA 4HE1A 5I84A 4PGNA 2I58A 2WEFA 4GLIA 4EXLA 3MVXA 2HPGA 5EYGA 1QW0A 1N04A 1QUJA 1TFDA 1IMBA 2DDKA 1LBXA 1B6HA 2P1SA 1PDAA 3MQ9A 4R74A 2QMWA 3T93B 4UACA 3IFAA 4QSDA 1TWYA 4P47A 1FBPA 5FTHA 1POTA 5CBRA 3Q29A 1WVJA 1LBVA 4P0GA 3FUZA 3MP6A 4P3LA 1OMPA 2D21A 4P1EA 2H9BA 3U65A 1MDQA 1FPEA 4QHQA 3T1BA 1Y1MA 1EYJA 1US4A 4KD5A 4FATA 2NWJA 4OENA 1QVSA 3TEPA 4O3BA 2F7BA 3THIA 4QXDA 4KYSA 3RY3A 1RDZA 1UQWA 4LZ7A 1GR2A 3SEYA 2AL5A 3TUSA 4GQOA 4ZE8A 1GGGA 1PBQA 3KC0A 4JXIA 4GWWA 4ELQA 2V93A 4XKPA 4QFOA 3O29A 3E9XA 3PD9A 4YZZA 3GLBA 2HCAA 3RUMA 3PPRA 5H8SA 1JETA 2DWJA 4PF6A 1N76A 2I49A 5I56B 1A99A 4OZ9A 3TELA 4E0WA 3K4UA 1SD3A 1AMFA 3DP4A 3KGCA 2Z8DA 1P1WA 4YMBA 2V3QA 3TCFA 5JTYA 1I69A 3Q26A 4OFOA 1NNKA 4PAFA 3FATA 3C4MA 2FIEA 5FBPA 3L6GA 1IXIA 3W15C 2PCRA 1YZ0A 5I2KA 4KQPA 2D5WA 2OBGA 1O7TA 2CEXA 3KFMA 4H8JA 3VVEA 1OLAA 3EN3A 2PFYA 2V84A 2F5XA 3LSXA 3M3FA 5ET8A 2WYPA 1UTHA 3V8XB 4NF6A 4GX6A 4X8RA 3TTKA 4GRKA 5DT6A 4LZ8A 3OEKA 1MH3A 3QUFA 3KN8A 2FYIA 3SEXA 1FBFA 1ZTYA 2MKZA 3CSBA 4GWXA 1JEVA 2RC8A 1MM7A 5AA3A 4H67A 3S9NC 1IXGA 3ROJA 1D3KA 2Q8MA 5CMCA 3C9HA 3TZAA 1FBHA 1PB8A 1DK4A 3IL1B 4NN3A 1YCJA 3IB2A 4YB7A 4XKNA 3IAZA 4I3YA 5TP9A 3K1NA 2XXRA 2VGQA 3PUYE 2DWHA 1ZKBA 4AQ4A 4G4PA 1B32A 3LR1A 5TPAB 1B7ZA 1PB9A 1QUIA 1NV6A 3PV0E 1USYE 2M8CA 4NF5B 4ZEDA 4QFNA 1FPLA 2VHAA 2Z22A 4RNSA 4G77A 4GOTA 4U1ZA 1MPBA 1QJMA 2FIXA 1FPKA 4NF4B 1P1QA 1MY2A 4G8HA 4N15A 4Z0IA 4AS4A 1B5JA 3H06B 1D9QA 3EHUA 5A5XA 4DI3D 1BKAA 4GWZA 3KSXA 4X9TA 5LDZA 4P1LA
chains in the Genus database with same CATH topology
1CB6A 3O2AA 2UVIA 3G7WA 5ICTA 1LGBC 4YAHX 3K1PA 4ECFA 4LUBA 1R9QA 3UP9A 2ZNSA 3KJTA 1PB7A 2QRYA 1EZOA 2GH9A 3SDFA 2QL3A 2P2AA 1AOVA 2DP8A 1LFGA 1JW4A 1MG1A 4EF2A 4ESXA 3FGSA 3L6HA 4BDMA 4N6PA 4NTLA 3MW0A 3A09A 2H98A 3HO7A 5DEXB 4HTGA 4GL0A 4DLDA 1AL3A 5IAIA 5DYHA 2Y7WA 4R6YA 3T9XB 2VOZA 4G68C 2DYXA 4F31B 1YPNA 1A8EA 3RTWB 4ZEIA 2DE4A 4RPOA 4I9DA 2PMSA 1N84A 5L9MA 1OQHA 2YJPA 3V5AA 4ZECA 1H45A 3CFZA 5J1DA 1KWHA 1A7LA 3ECRA 1LCTA 3TFLA 1YTVA 3O28A 2DS9A 2FA7A 2X26A 3ONMA 4GIZA 2PVUA 3SETA 5AA4B 2XXIA 4K3FA 5H8QB 1MQDA 3W9VA 4BLAA 2F78A 3T66A 5CC2A 2YPNA 4ONYA 3MZ1A 3U93A 1YAEA 1R1NA 1ZBMA 2DQVA 3HCQA 3U72A 1IEJA 1B5HA 5TPAA 4EF1A 3MVWA 2UYFA 1A40A 4H0WA 2R6GE 3MWBA 2XXPA 1BLFA 3H6VA 3FVGA 4OTEA 1EU8A 1MM6A 5CBSA 1FQBA 4YB5A 1MXVA 3IOWA 1HSJA 3G3IA 5LOMA 4NF4A 3KN3A 2ZMBA 3K6WA 1R9LA 3DM0A 3O97A 3H6WA 2A5TB 1M5FA 3FD3A 2UVGA 4H65A 1ELJA 3D4GA 4ESWA 4PQJA 3CG3A 3TTNA 4G8NA 4IGTA 1PC3A 1Z7ME 3GZGA 3N6TA 4BDLA 2DVZA 3ILTB 1B05A 4YKKA 2QS1A 1ZMGA 4G68B 4LVQA 4ZEKA 5B7DA 2I4BA 3RPWA 1ZLQA 3MC2A 2DVCA 5H8NB 1LFHA 3MZBA 4R2BA 2X7QA 3VVDA 4IO7A 1MQIA 1SI1A 5H8HA 5DVIA 2XX8A 1LLSA 1P1OA 2OZZA 5KDTA 4F1UA 3VLVA 3OEMA 3PPPA 5ICQA 3PUXE 3IB1A 4U23A 1MQJA 3T9HB 5I57B 1SDXA 4O3AA 1H76A 4NMYA 1MDP1 3T22A 2Y7RA 1PEBA 4BDOA 3DP8A 3OO8A 1HSEA 4PFWA 4OMBA 3IOTA 4LONB 2NXOA 4IY5A 2VD2A 4F3GA 3PPOA 3EF7A 1CE2A 4OERA 3CVGA 2R71A 4P11A 1Y20A 4JWOA 4OYVA 4EQ7A 3PUVE 2OWSA 1URSA 3PPNA 3VFJA 1UTBA 2H99A 3B6TA 3TCGA 3H7MA 1MH4A 3TKDA 2O68A 2RKMA 5FTIA 5H8FB 4KR5A 1XS5A 1GTKA 3MP8A 3HHFA 1BIYA 4ZZEA 3K6VA 3M3LA 4POWA 4LATA 5EHMA 1JNFA 1DTGA 4JBZA 5ISUA 2RCAA 4OWDA 1B46A 3PMXA 3K01A 3K0VA 2HXWA 3UIFA 3N26A 2O1LA 3PUWE 3R6UA 3TPAA 1N3XA 3UN6A 4DDDA 4BDNA 2F6PA 4F22A 4GXAA 3FV2A 5I59B 3M8UA 3S4UA 4F1YA 3O66A 5ELVA 2PT1A 3KG2A 4GVOA 5EYFA 3SERA 3C34A 3KOSA 3R26A 1XC1A 3EPEA 3QSLA 3QUJA 5HBCA 2DXRA 3QK6A 3U94A 1LAXA 4ZEBA 5BWJA 1MQGA 3H6TA 4ZE9A 4GL8A 3PMVA 4MBPA 3VVFA 3IR1A 5K2YA 5KCJA 1XVXA 5DVJA 2V25A 3FVKA 4NF8A 1FQEA 2H5YA 3C36A 3PU5A 3JV9A 5L8DA 4MLVA 2B3BA 3RLFE 1B4HA 3TYHA 1IIWA 1NH8A 3OD7A 4DZ1A 2F6GA 1O63A 1MQHA 1JW5A 4IO4A 4OVJA 1AH5A 4NWCA 1B7HA 4R9GA 1B3HA 3CSGA 1XVYA 2Z23A 4NEDA 3OMBA 1S9TA 2GHBA 3HPIA 2HAVA 1RKMA 1Y3QA 4WXJA 3S9MC 3FXUA 2QJEA 2XX9A 1ZU0A 2B65A 1LB9A 1II5A 4WKMA 2H4IA 4JSOA 4BDRA 3U92A 1B1HA 1JVXA 4U22A 2O69A 2XD2A 5I58B 3B7DA 5B70A 2NOOA 4X1DA 3G3HA 1TFAA 1S50A 3FJ7A 2DE3A 3G3GA 2HFBA 5TU0A 3UORA 3JYRA 5I2NB 3C35A 1DOTA 3U1OA 4JSDA 3OO6A 1D9VA 1LB8A 3OO9A 1IXHA 3V83A 4H5FA 4U2RA 2E0SA 4YB6A 2WKYA 3Q27A 1N3WA 2O51A 4U4XA 3OSRA 4GXSB 1MY4A 2V3TA 5AA2B 1BP5A 1FTKA 1I6AA 4TLLB 2REGA 2QS3A 4GF8A 3O6HA 4WEDA 4KCCA 4QRZA 2I0CA 4NE4A 1JQFA 5I59A 4F18A 4HW8A 3CIJA 4ELOA 3OO7A 1ZIUA 2XXWA 3IOUA 2PT2A 3EQ1A 4PP0A 1Y4TA 1XHYA 2ALUA 3TMGA 2ZYNA 4JB7A 2AIXA 3TTLA 5I56A 4LP2B 3LSLA 3D4CA 4M4GA 3LSFB 4QSCA 1B3LA 4Q5TA 1B3GA 3C32A 3H6UA 2ONRA 4ZDMA 3O6GA 1P1UA 1FW0A 1SBPA 1FTMA 4HS7A 5L9OA 4KCDA 2XXHA 4IGRA 1MXYA 1Y1ZA 1M5BA 3MPLA 1MXXA 5DTBA 2I4CA 2BJJX 2XX7A 2RF1A 2PYYA 4ELPA 3F11A 5CMBA 3UA8A 1VFEA 3VXCA 4NWDA 1FQAA 1UIVA 4IY6A 1B4ZA 1SQYA 3SKPA 1IUDA 2XHDA 1FTLA 1O64A 2DOJA 2O84X 3RNNA 2DSFA 4WEPA 2AYSA 1USYH 1I6QA 2E1SA 4GD5A 4I8CA 1MXWA 2F7CA 4PFTA 5FHMA 4FORA 4R75A 3RGYA 2RCBA 3H3GA 3K6UA 4DIGA 1BTJA 3AXFA 1B3EA 3TQWA 4O3CA 1LBCA 4Z7EA 4YKPA 3RQTA 2QSXA 1EH3A 1DSNA 2R9JA 2Q8JA 4N13A 2F35A 3BFTA 4MFIA 4EQBA 3DELB 2ZNUA 1WODA 4NF5A 4P0IA 4F2OA 1GV8A 1QUKA 2H25A 3TODA 1T0KA 1B51A 1POY1 2HZKA 4LQ5A 1FQFA 4DE8A 1N0TA 1TXFA 5L9SA 4QFLA 1M5DA 3CFXA 2XXQA 4XIGQ 4FE8A 1H44A 2I48A 1P1NA 3ZSFA 3E4RA 3BKIB 3PMWA 5CRYA 3KSJA 3P7IA 3TTRA 2UXAA 5K2XA 4BDQA 3IO6A 4RA1A 4GWOA 5JTYB 1DPEA 3K00A 4KFQA 4R73A 4F19A 1MXUA 3ODBA 3FIRA 5DEXA 2GHAA 3GBBA 2OCUA 4PE5B 2B3FA 5ITPA 1MY3A 1Q1KA 3MPKA 5IKBA 1EZ9A 4YU0A 3G3FA 2QMXA 1A54A 3N94A 3CRBA 1MRPA 1UTHB 4NF6B 1B52A 2REJA 3O9PA 4TOZA 1EZPA 5FHNA 2F97A 4F2QA 3B6WA 4QFKA 1B1XA 1M5CA 2XXUA 3HV1A 1SW4A 4H5GA 2Y7KA 4DCYA 3OELA 1MPDA 4U4SA 2DWIA 2ZNTA 1WDNA 2CZLA 3BFUA 3CI8A 3MAMA 1AIVA 1QKAA 4FEBA 5TP9B 1NMUA 1MY0A 1FTJA 3PPQA 4H8IA 5AA4A 3E3KA 3MVZA 5H8QA 4QFPA 3DP6A 3DLNA 2PX1A 3N6UA 4F3BA 4THIA 4U1OA 3OXNA 4DXBA 1LAGE 1LFIA 1A8FA 1LBBA 2Y7PA 3TTMA 3MBPA 4E0XA 1B9JA 4FAJA 1DMBA 3KJ7A 4M1VA 3S9EA 3MUQA 3IJXB 5A5XB 2ESNA 3O6IA 4HCWA 1SW2A 3LBSA 4QF9A 4PFYA 3FVOA 4YKIA 3HHGA 3E13X 5AA2D 1SVXB 2OLBA 4LA9A 2A5TA 1R6ZA 3QAXA 1JW1A 1NKXA 1DPPA 1PBPA 1VE4A 3SEUA 2F36A 1RYXA 1GVCA 3SEVA 3CG1A 4FECA 4RK9A 1B3FA 1DTZA 4MLQA 3GXAA 4G2ZA 4OEVA 2HZLA 3LUYA 5EHSA 3TDJA 1A55A 5KZTA 3I5OA 3IK6B 4X1BA 3EHTA 2ABHA 4RK2A 4G68A 3V89B 1IQ7A 1F9BA 3W9WA 4F3SA 4U21A 5H8NA 2UYEA 2F8DA 4LZ5A 3VLUA 1FCKA 3ZS6A 2V3UA 5AA1A 4G8MA 3OSQA 4FJPA 1XOCA 5I57A 1NNPA 5JEIA 2W7YA 5JK4A 3IB0A 2Y7IA 4FEDA 2Q2AA 3FVNA 4N07A 1IZ1A 1VSOA 3KEIA 4LQ2A 4C1TA 1URDA 5CMKA 4ELRA 3G3KA 2Z8FA 1SYHA 4OETA 3G3JA 1UIUA 1H3DA 2GRVA 3HSTA 3H4ZA 4KYDA 2GFEA 2DE2A 1SI0A 2O7UA 4XKRA 2OWTA 4EDPA 2OJTA 1FQDA 1LAHE 2LAOA 2PBWA 1Z7NE 3QXMA 1OQGA 5H8FA 5HM4B 3RN8A 1OIBA 1OVBA 3FV1A 1ATGA 4JWXA 1SYIA 2RC7A 4YKJA 3Q28A 3KZGA 4EQ9A 3K2DA 3T9UA 1MXZA 1B0HA 2F34A 2UVJA 3FJGA 4JWYA 3SEWA 4DXUA 1B0LA 1RYOA 4I62A 3ZKLA 1D9YA 3CR9A 3A3UA 4PETA 3B6QA 4RYAA 2ONKE 3ZKKA 1L5TA 3QIMA 2XXVA 3ILUB 3OOAA 4FIMA 1HSLA 3PUZE 4R6KA 4F3PA 3MVYA 2FNCA 2ZXTA 3RT8A 3VDFA 4IB2A 3LC8A 4TLMB 1B58A 1MY1A 1OVTA 4ZS9A 3TAJA 3HN0A 4H1XA 2IA4A 4Q8RA 1SW5A 1QULA 4YMAA 3PD8A 2G93A 1MPCA 4XXUA 3Q25A 1Q35A 3IX1A 2ZYMA 2OK2A 1Y9UA 3RTFB 1M5EA 2IEEA 3I3VA 5H8HB 4F1VA 1US5A 5ITOA 5KDTB 1B2HA 2I6EA 3MJNA 1LCFA 4ND9A 1IXCA 3BBRA 3K02A 3IOVA 3VXBA 2KLFA 3C31A 4DXCA 2P0SA 1VFDA 1H43A 3FZVA 1NL5A 2XXXA 2Q2CA 1TT1A 4RXLA 4R2FA 4Q0CA 1Y4CA 3IORA 4TQUQ 2I3WA 4F39A 2CMOA 1FQCA 4IO2A 4KI0E 3K6XA 3U8QA 4IO6A 4C1UA 3RT6B 2THIA 3S9LC 3UGWA 3VV5A 2VP1A 1NNTA 3C33A 4DCXA 3KN7A 1UTBB 2AL4A 4PFUA 4OFLA 1Y3PA 1URGA 3T96B 4KYEA 2QS4A 3K1MA 4I1DA 2QS2A 1ANFA 2Q88A 5I58A 4RJZA 2Z8EA 4MH5A 3N5LA 2HAUA 2A5SA 3KBRA 1NH7A 3PGFA 5I2NA 4Q30B 4ZZAA 4OEUA 5HPQA 4EUOA 3WAEA 2HEUA 2O7IA 3GBAA 4IO5A 5DVFA 3I6VA 1S7YA 1JEUA 4UA8A 1OLCA 2UVHA 5M2VA 4YICA 4KHZE 5AA2A 1JVYA 3FXQA 4L17A 1VR5A 2G29A 4X48A 4C0RA 4OHNA 4OXVA 2XXYA 4JDFA 4ISUA 1B5IA 2I0BA 1SW1A 1P99A 1FTOA 4MF3A 2I3VA 3OENA 4AB5A 2NUVA 3TQLA 4RY1A 1NFTA 1Y3NA 1LAFE 4KPTA 2YLNA 3LSWA 4XKQA 4GFRA 2ONSA 1N7XA 5KCJB 3CFLA 4XTCQ 1LSTA 1NNFA 2QPQA 4NF8B 3VE1B 5BUUA 1B40A 2X7PA 3JZJA 4IO3A 3H03A 5I2KB 2F7AA 3MZ9A 2DWAA 1MS7A 2D3IA 4OESA 2Y84A 3S2VA 3M3KA 4OQOA 3EHSA 3T9VA 4POXA 3R7XA 3FASA 1ZJLA 2Q9TA 3KOTA 2O6AA 2ZYKA 4R9FA 1XT8A 4R72A 3WAFA 5AE4A 1J1NA 2ZYOA 4ZEFA 2XXTA 4QSEA 3A3CA 5F1QA 5CMMA 4RPNA 2NVUB 2O1MA 2ANJA 3USDA 1D4NA 5CI5A 2RC9A 5CM6A 1QKBA 3IO4A 1IITA 4H6DA 2Q89A 4AB6A 4OFJA 3IJOB 3QYTA 2DXYA 4HCYA 2XD3A 1B7UA 5FHOA 3MP1A 3FJMA 2HQ0A 4EXKA 1N7WA 3SESA 1I6BA 3FXRA 4F29A 2VD3A 3VLWA 3UK4A 4R6HA 5F7VA 2RINA 5I84A 2I58A 4GLIA 4EXLA 3MVXA 1QW0A 1N04A 1QUJA 1TFDA 1B6HA 2P1SA 1PDAA 3MQ9A 4R74A 2QMWA 3T93B 4UACA 4QSDA 1TWYA 5FTHA 1POTA 5CBRA 3Q29A 1WVJA 4P0GA 3FUZA 3MP6A 1OMPA 2D21A 2H9BA 1MDQA 4QHQA 1Y1MA 1US4A 4KD5A 4FATA 2NWJA 4OENA 1QVSA 3TEPA 4O3BA 2F7BA 3THIA 4KYSA 3RY3A 1UQWA 4LZ7A 1GR2A 3SEYA 2AL5A 3TUSA 4GQOA 4ZE8A 1GGGA 1PBQA 4JXIA 4ELQA 2V93A 4XKPA 4QFOA 3O29A 3E9XA 3PD9A 4YZZA 3GLBA 2HCAA 3RUMA 3PPRA 5H8SA 1JETA 2DWJA 1N76A 2I49A 5I56B 1A99A 4OZ9A 3TELA 4E0WA 3K4UA 1SD3A 1AMFA 3DP4A 3KGCA 2Z8DA 1P1WA 4YMBA 2V3QA 3TCFA 5JTYA 1I69A 3Q26A 4OFOA 1NNKA 3FATA 3C4MA 3L6GA 1IXIA 3W15C 5I2KA 4KQPA 2D5WA 2OBGA 1O7TA 3KFMA 4H8JA 3VVEA 1OLAA 3EN3A 2V84A 2F5XA 3LSXA 3M3FA 1UTHA 3V8XB 4NF6A 3TTKA 4GRKA 5DT6A 4LZ8A 3OEKA 1MH3A 3QUFA 3KN8A 2FYIA 3SEXA 1ZTYA 3CSBA 1JEVA 2RC8A 1MM7A 5AA3A 4H67A 3S9NC 1IXGA 1D3KA 5CMCA 3C9HA 3TZAA 1PB8A 3IL1B 1YCJA 3IB2A 4YB7A 4XKNA 3IAZA 5TP9A 3K1NA 2XXRA 2VGQA 3PUYE 2DWHA 1ZKBA 4AQ4A 4G4PA 1B32A 3LR1A 5TPAB 1B7ZA 1PB9A 1QUIA 3PV0E 1USYE 2M8CA 4NF5B 4ZEDA 4QFNA 2VHAA 2Z22A 4RNSA 4G77A 4GOTA 4U1ZA 1MPBA 1QJMA 4NF4B 1P1QA 1MY2A 4G8HA 4Z0IA 1B5JA 3H06B 3EHUA 5A5XA 1BKAA 3KSXA 4X9TA 3TCHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CB6 A;  3O2A A;  2UVI A;  3G7W A;  5ICT A;  1LGB C;  4YAH X;  3K1P A;  4ECF A;  4LUB A;  1R9Q A;  3UP9 A;  2ZNS A;  3KJT A;  1PB7 A;  2QRY A;  1EZO A;  2GH9 A;  3SDF A;  2QL3 A;  2P2A A;  1AOV A;  2DP8 A;  1LFG A;  1JW4 A;  1MG1 A;  4EF2 A;  4ESX A;  3FGS A;  3L6H A;  4BDM A;  4N6P A;  4NTL A;  3MW0 A;  3A09 A;  2H98 A;  3HO7 A;  5DEX B;  4HTG A;  4GL0 A;  4DLD A;  1AL3 A;  5IAI A;  5DYH A;  2Y7W A;  4R6Y A;  3T9X B;  2VOZ A;  4G68 C;  2DYX A;  4F31 B;  1YPN A;  1A8E A;  3RTW B;  4ZEI A;  2DE4 A;  4RPO A;  4I9D A;  2PMS A;  1N84 A;  5L9M A;  1OQH A;  2YJP A;  3V5A A;  4ZEC A;  1H45 A;  3CFZ A;  5J1D A;  1KWH A;  1A7L A;  3ECR A;  1LCT A;  3TFL A;  1YTV A;  3O28 A;  2DS9 A;  2FA7 A;  2X26 A;  3ONM A;  4GIZ A;  2PVU A;  3SET A;  5AA4 B;  2XXI A;  4K3F A;  5H8Q B;  1MQD A;  3W9V A;  4BLA A;  2F78 A;  3T66 A;  5CC2 A;  2YPN A;  4ONY A;  3MZ1 A;  3U93 A;  1YAE A;  1R1N A;  1ZBM A;  2DQV A;  3HCQ A;  3U72 A;  1IEJ A;  1B5H A;  5TPA A;  4EF1 A;  3MVW A;  2UYF A;  1A40 A;  4H0W A;  2R6G E;  3MWB A;  2XXP A;  1BLF A;  3H6V A;  3FVG A;  4OTE A;  1EU8 A;  1MM6 A;  5CBS A;  1FQB A;  4YB5 A;  1MXV A;  3IOW A;  1HSJ A;  3G3I A;  5LOM A;  4NF4 A;  3KN3 A;  2ZMB A;  3K6W A;  1R9L A;  3DM0 A;  3O97 A;  3H6W A;  2A5T B;  1M5F A;  3FD3 A;  2UVG A;  4H65 A;  1ELJ A;  3D4G A;  4ESW A;  4PQJ A;  3CG3 A;  3TTN A;  4G8N A;  4IGT A;  1PC3 A;  1Z7M E;  3GZG A;  3N6T A;  4BDL A;  2DVZ A;  3ILT B;  1B05 A;  4YKK A;  2QS1 A;  1ZMG A;  4G68 B;  4LVQ A;  4ZEK A;  5B7D A;  2I4B A;  3RPW A;  1ZLQ A;  3MC2 A;  2DVC A;  5H8N B;  1LFH A;  3MZB A;  4R2B A;  2X7Q A;  3VVD A;  4IO7 A;  1MQI A;  1SI1 A;  5H8H A;  5DVI A;  2XX8 A;  1LLS A;  1P1O A;  2OZZ A;  5KDT A;  4F1U A;  3VLV A;  3OEM A;  3PPP A;  5ICQ A;  3PUX E;  3IB1 A;  4U23 A;  1MQJ A;  3T9H B;  5I57 B;  1SDX A;  4O3A A;  1H76 A;  4NMY A;  1MDP 1;  3T22 A;  2Y7R A;  1PEB A;  4BDO A;  3DP8 A;  3OO8 A;  1HSE A;  4PFW A;  4OMB A;  3IOT A;  4LON B;  2NXO A;  4IY5 A;  2VD2 A;  4F3G A;  3PPO A;  3EF7 A;  1CE2 A;  4OER A;  3CVG A;  2R71 A;  4P11 A;  1Y20 A;  4JWO A;  4OYV A;  4EQ7 A;  3PUV E;  2OWS A;  1URS A;  3PPN A;  3VFJ A;  1UTB A;  2H99 A;  3B6T A;  3TCG A;  3H7M A;  1MH4 A;  3TKD A;  2O68 A;  2RKM A;  5FTI A;  5H8F B;  4KR5 A;  1XS5 A;  1GTK A;  3MP8 A;  3HHF A;  1BIY A;  4ZZE A;  3K6V A;  3M3L A;  4POW A;  4LAT A;  5EHM A;  1JNF A;  1DTG A;  4JBZ A;  5ISU A;  2RCA A;  4OWD A;  1B46 A;  3PMX A;  3K01 A;  3K0V A;  2HXW A;  3UIF A;  3N26 A;  2O1L A;  3PUW E;  3R6U A;  3TPA A;  1N3X A;  3UN6 A;  4DDD A;  4BDN A;  2F6P A;  4F22 A;  4GXA A;  3FV2 A;  5I59 B;  3M8U A;  3S4U A;  4F1Y A;  3O66 A;  5ELV A;  2PT1 A;  3KG2 A;  4GVO A;  5EYF A;  3SER A;  3C34 A;  3KOS A;  3R26 A;  1XC1 A;  3EPE A;  3QSL A;  3QUJ A;  5HBC A;  2DXR A;  3QK6 A;  3U94 A;  1LAX A;  4ZEB A;  5BWJ A;  1MQG A;  3H6T A;  4ZE9 A;  4GL8 A;  3PMV A;  4MBP A;  3VVF A;  3IR1 A;  5K2Y A;  5KCJ A;  1XVX A;  5DVJ A;  2V25 A;  3FVK A;  4NF8 A;  1FQE A;  2H5Y A;  3C36 A;  3PU5 A;  3JV9 A;  5L8D A;  4MLV A;  2B3B A;  3RLF E;  1B4H A;  3TYH A;  1IIW A;  1NH8 A;  3OD7 A;  4DZ1 A;  2F6G A;  1O63 A;  1MQH A;  1JW5 A;  4IO4 A;  4OVJ A;  1AH5 A;  4NWC A;  1B7H A;  4R9G A;  1B3H A;  3CSG A;  1XVY A;  2Z23 A;  4NED A;  3OMB A;  1S9T A;  2GHB A;  3HPI A;  2HAV A;  1RKM A;  1Y3Q A;  4WXJ A;  3S9M C;  3FXU A;  2QJE A;  2XX9 A;  1ZU0 A;  2B65 A;  1LB9 A;  1II5 A;  4WKM A;  2H4I A;  4JSO A;  4BDR A;  3U92 A;  1B1H A;  1JVX A;  4U22 A;  2O69 A;  2XD2 A;  5I58 B;  3B7D A;  5B70 A;  2NOO A;  4X1D A;  3G3H A;  1TFA A;  1S50 A;  3FJ7 A;  2DE3 A;  3G3G A;  2HFB A;  5TU0 A;  3UOR A;  3JYR A;  5I2N B;  3C35 A;  1DOT A;  3U1O A;  4JSD A;  3OO6 A;  1D9V A;  1LB8 A;  3OO9 A;  1IXH A;  3V83 A;  4H5F A;  4U2R A;  2E0S A;  4YB6 A;  2WKY A;  3Q27 A;  1N3W A;  2O51 A;  4U4X A;  3OSR A;  4GXS B;  1MY4 A;  2V3T A;  5AA2 B;  1BP5 A;  1FTK A;  1I6A A;  4TLL B;  2REG A;  2QS3 A;  4GF8 A;  3O6H A;  4WED A;  4KCC A;  4QRZ A;  2I0C A;  4NE4 A;  1JQF A;  5I59 A;  4F18 A;  4HW8 A;  3CIJ A;  4ELO A;  3OO7 A;  1ZIU A;  2XXW A;  3IOU A;  2PT2 A;  3EQ1 A;  4PP0 A;  1Y4T A;  1XHY A;  2ALU A;  3TMG A;  2ZYN A;  4JB7 A;  2AIX A;  3TTL A;  5I56 A;  4LP2 B;  3LSL A;  3D4C A;  4M4G A;  3LSF B;  4QSC A;  1B3L A;  4Q5T A;  1B3G A;  3C32 A;  3H6U A;  2ONR A;  4ZDM A;  3O6G A;  1P1U A;  1FW0 A;  1SBP A;  1FTM A;  4HS7 A;  5L9O A;  4KCD A;  2XXH A;  4IGR A;  1MXY A;  1Y1Z A;  1M5B A;  3MPL A;  1MXX A;  5DTB A;  2I4C A;  2BJJ X;  2XX7 A;  2RF1 A;  2PYY A;  4ELP A;  3F11 A;  5CMB A;  3UA8 A;  1VFE A;  3VXC A;  4NWD A;  1FQA A;  1UIV A;  4IY6 A;  1B4Z A;  1SQY A;  3SKP A;  1IUD A;  2XHD A;  1FTL A;  1O64 A;  2DOJ A;  2O84 X;  3RNN A;  2DSF A;  4WEP A;  2AYS A;  1USY H;  1I6Q A;  2E1S A;  4GD5 A;  4I8C A;  1MXW A;  2F7C A;  4PFT A;  5FHM A;  4FOR A;  4R75 A;  3RGY A;  2RCB A;  3H3G A;  3K6U A;  4DIG A;  1BTJ A;  3AXF A;  1B3E A;  3TQW A;  4O3C A;  1LBC A;  4Z7E A;  4YKP A;  3RQT A;  2QSX A;  1EH3 A;  1DSN A;  2R9J A;  2Q8J A;  4N13 A;  2F35 A;  3BFT A;  4MFI A;  4EQB A;  3DEL B;  2ZNU A;  1WOD A;  4NF5 A;  4P0I A;  4F2O A;  1GV8 A;  1QUK A;  2H25 A;  3TOD A;  1T0K A;  1B51 A;  1POY 1;  2HZK A;  4LQ5 A;  1FQF A;  4DE8 A;  1N0T A;  1TXF A;  5L9S A;  4QFL A;  1M5D A;  3CFX A;  2XXQ A;  4XIG Q;  4FE8 A;  1H44 A;  2I48 A;  1P1N A;  3ZSF A;  3E4R A;  3BKI B;  3PMW A;  5CRY A;  3KSJ A;  3P7I A;  3TTR A;  2UXA A;  5K2X A;  4BDQ A;  3IO6 A;  4RA1 A;  4GWO A;  5JTY B;  1DPE A;  3K00 A;  4KFQ A;  4R73 A;  4F19 A;  1MXU A;  3ODB A;  3FIR A;  5DEX A;  2GHA A;  3GBB A;  2OCU A;  4PE5 B;  2B3F A;  5ITP A;  1MY3 A;  1Q1K A;  3MPK A;  5IKB A;  1EZ9 A;  4YU0 A;  3G3F A;  2QMX A;  1A54 A;  3N94 A;  3CRB A;  1MRP A;  1UTH B;  4NF6 B;  1B52 A;  2REJ A;  3O9P A;  4TOZ A;  1EZP A;  5FHN A;  2F97 A;  4F2Q A;  3B6W A;  4QFK A;  1B1X A;  1M5C A;  2XXU A;  3HV1 A;  1SW4 A;  4H5G A;  2Y7K A;  4DCY A;  3OEL A;  1MPD A;  4U4S A;  2DWI A;  2ZNT A;  1WDN A;  2CZL A;  3BFU A;  3CI8 A;  3MAM A;  1AIV A;  1QKA A;  4FEB A;  5TP9 B;  1NMU A;  1MY0 A;  1FTJ A;  3PPQ A;  4H8I A;  5AA4 A;  3E3K A;  3MVZ A;  5H8Q A;  4QFP A;  3DP6 A;  3DLN A;  2PX1 A;  3N6U A;  4F3B A;  4THI A;  4U1O A;  3OXN A;  4DXB A;  1LAG E;  1LFI A;  1A8F A;  1LBB A;  2Y7P A;  3TTM A;  3MBP A;  4E0X A;  1B9J A;  4FAJ A;  1DMB A;  3KJ7 A;  4M1V A;  3S9E A;  3MUQ A;  3IJX B;  5A5X B;  2ESN A;  3O6I A;  4HCW A;  1SW2 A;  3LBS A;  4QF9 A;  4PFY A;  3FVO A;  4YKI A;  3HHG A;  3E13 X;  5AA2 D;  1SVX B;  2OLB A;  4LA9 A;  2A5T A;  1R6Z A;  3QAX A;  1JW1 A;  1NKX A;  1DPP A;  1PBP A;  1VE4 A;  3SEU A;  2F36 A;  1RYX A;  1GVC A;  3SEV A;  3CG1 A;  4FEC A;  4RK9 A;  1B3F A;  1DTZ A;  4MLQ A;  3GXA A;  4G2Z A;  4OEV A;  2HZL A;  3LUY A;  5EHS A;  3TDJ A;  1A55 A;  5KZT A;  3I5O A;  3IK6 B;  4X1B A;  3EHT A;  2ABH A;  4RK2 A;  4G68 A;  3V89 B;  1IQ7 A;  1F9B A;  3W9W A;  4F3S A;  4U21 A;  5H8N A;  2UYE A;  2F8D A;  4LZ5 A;  3VLU A;  1FCK A;  3ZS6 A;  2V3U A;  5AA1 A;  4G8M A;  3OSQ A;  4FJP A;  1XOC A;  5I57 A;  1NNP A;  5JEI A;  2W7Y A;  5JK4 A;  3IB0 A;  2Y7I A;  4FED A;  2Q2A A;  3FVN A;  4N07 A;  1IZ1 A;  1VSO A;  3KEI A;  4LQ2 A;  4C1T A;  1URD A;  5CMK A;  4ELR A;  3G3K A;  2Z8F A;  1SYH A;  4OET A;  3G3J A;  1UIU A;  1H3D A;  2GRV A;  3HST A;  3H4Z A;  4KYD A;  2GFE A;  2DE2 A;  1SI0 A;  2O7U A;  4XKR A;  2OWT A;  4EDP A;  2OJT A;  1FQD A;  1LAH E;  2LAO A;  2PBW A;  1Z7N E;  3QXM A;  1OQG A;  5H8F A;  5HM4 B;  3RN8 A;  1OIB A;  1OVB A;  3FV1 A;  1ATG A;  4JWX A;  1SYI A;  2RC7 A;  4YKJ A;  3Q28 A;  3KZG A;  4EQ9 A;  3K2D A;  3T9U A;  1MXZ A;  1B0H A;  2F34 A;  2UVJ A;  3FJG A;  4JWY A;  3SEW A;  4DXU A;  1B0L A;  1RYO A;  4I62 A;  3ZKL A;  1D9Y A;  3CR9 A;  3A3U A;  4PET A;  3B6Q A;  4RYA A;  2ONK E;  3ZKK A;  1L5T A;  3QIM A;  2XXV A;  3ILU B;  3OOA A;  4FIM A;  1HSL A;  3PUZ E;  4R6K A;  4F3P A;  3MVY A;  2FNC A;  2ZXT A;  3RT8 A;  3VDF A;  4IB2 A;  3LC8 A;  4TLM B;  1B58 A;  1MY1 A;  1OVT A;  4ZS9 A;  3TAJ A;  3HN0 A;  4H1X A;  2IA4 A;  4Q8R A;  1SW5 A;  1QUL A;  4YMA A;  3PD8 A;  2G93 A;  1MPC A;  4XXU A;  3Q25 A;  1Q35 A;  3IX1 A;  2ZYM A;  2OK2 A;  1Y9U A;  3RTF B;  1M5E A;  2IEE A;  3I3V A;  5H8H B;  4F1V A;  1US5 A;  5ITO A;  5KDT B;  1B2H A;  2I6E A;  3MJN A;  1LCF A;  4ND9 A;  1IXC A;  3BBR A;  3K02 A;  3IOV A;  3VXB A;  2KLF A;  3C31 A;  4DXC A;  2P0S A;  1VFD A;  1H43 A;  3FZV A;  1NL5 A;  2XXX A;  2Q2C A;  1TT1 A;  4RXL A;  4R2F A;  4Q0C A;  1Y4C A;  3IOR A;  4TQU Q;  2I3W A;  4F39 A;  2CMO A;  1FQC A;  4IO2 A;  4KI0 E;  3K6X A;  3U8Q A;  4IO6 A;  4C1U A;  3RT6 B;  2THI A;  3S9L C;  3UGW A;  3VV5 A;  2VP1 A;  1NNT A;  3C33 A;  4DCX A;  3KN7 A;  1UTB B;  2AL4 A;  4PFU A;  4OFL A;  1Y3P A;  1URG A;  3T96 B;  4KYE A;  2QS4 A;  3K1M A;  4I1D A;  2QS2 A;  1ANF A;  2Q88 A;  5I58 A;  4RJZ A;  2Z8E A;  4MH5 A;  3N5L A;  2HAU A;  2A5S A;  3KBR A;  1NH7 A;  3PGF A;  5I2N A;  4Q30 B;  4ZZA A;  4OEU A;  5HPQ A;  4EUO A;  3WAE A;  2HEU A;  2O7I A;  3GBA A;  4IO5 A;  5DVF A;  3I6V A;  1S7Y A;  1JEU A;  4UA8 A;  1OLC A;  2UVH A;  5M2V A;  4YIC A;  4KHZ E;  5AA2 A;  1JVY A;  3FXQ A;  4L17 A;  1VR5 A;  2G29 A;  4X48 A;  4C0R A;  4OHN A;  4OXV A;  2XXY A;  4JDF A;  4ISU A;  1B5I A;  2I0B A;  1SW1 A;  1P99 A;  1FTO A;  4MF3 A;  2I3V A;  3OEN A;  4AB5 A;  2NUV A;  3TQL A;  4RY1 A;  1NFT A;  1Y3N A;  1LAF E;  4KPT A;  2YLN A;  3LSW A;  4XKQ A;  4GFR A;  2ONS A;  1N7X A;  5KCJ B;  3CFL A;  4XTC Q;  1LST A;  1NNF A;  2QPQ A;  4NF8 B;  3VE1 B;  5BUU A;  1B40 A;  2X7P A;  3JZJ A;  4IO3 A;  3H03 A;  5I2K B;  2F7A A;  3MZ9 A;  2DWA A;  1MS7 A;  2D3I A;  4OES A;  2Y84 A;  3S2V A;  3M3K A;  4OQO A;  3EHS A;  3T9V A;  4POX A;  3R7X A;  3FAS A;  1ZJL A;  2Q9T A;  3KOT A;  2O6A A;  2ZYK A;  4R9F A;  1XT8 A;  4R72 A;  3WAF A;  5AE4 A;  1J1N A;  2ZYO A;  4ZEF A;  2XXT A;  4QSE A;  3A3C A;  5F1Q A;  5CMM A;  4RPN A;  2NVU B;  2O1M A;  2ANJ A;  3USD A;  1D4N A;  5CI5 A;  2RC9 A;  5CM6 A;  1QKB A;  3IO4 A;  1IIT A;  4H6D A;  2Q89 A;  4AB6 A;  4OFJ A;  3IJO B;  3QYT A;  2DXY A;  4HCY A;  2XD3 A;  1B7U A;  5FHO A;  3MP1 A;  3FJM A;  2HQ0 A;  4EXK A;  1N7W A;  3SES A;  1I6B A;  3FXR A;  4F29 A;  2VD3 A;  3VLW A;  3UK4 A;  4R6H A;  5F7V A;  2RIN A;  5I84 A;  2I58 A;  4GLI A;  4EXL A;  3MVX A;  1QW0 A;  1N04 A;  1QUJ A;  1TFD A;  1B6H A;  2P1S A;  1PDA A;  3MQ9 A;  4R74 A;  2QMW A;  3T93 B;  4UAC A;  4QSD A;  1TWY A;  5FTH A;  1POT A;  5CBR A;  3Q29 A;  1WVJ A;  4P0G A;  3FUZ A;  3MP6 A;  1OMP A;  2D21 A;  2H9B A;  1MDQ A;  4QHQ A;  1Y1M A;  1US4 A;  4KD5 A;  4FAT A;  2NWJ A;  4OEN A;  1QVS A;  3TEP A;  4O3B A;  2F7B A;  3THI A;  4KYS A;  3RY3 A;  1UQW A;  4LZ7 A;  1GR2 A;  3SEY A;  2AL5 A;  3TUS A;  4GQO A;  4ZE8 A;  1GGG A;  1PBQ A;  4JXI A;  4ELQ A;  2V93 A;  4XKP A;  4QFO A;  3O29 A;  3E9X A;  3PD9 A;  4YZZ A;  3GLB A;  2HCA A;  3RUM A;  3PPR A;  5H8S A;  1JET A;  2DWJ A;  1N76 A;  2I49 A;  5I56 B;  1A99 A;  4OZ9 A;  3TEL A;  4E0W A;  3K4U A;  1SD3 A;  1AMF A;  3DP4 A;  3KGC A;  2Z8D A;  1P1W A;  4YMB A;  2V3Q A;  3TCF A;  5JTY A;  1I69 A;  3Q26 A;  4OFO A;  1NNK A;  3FAT A;  3C4M A;  3L6G A;  1IXI A;  3W15 C;  5I2K A;  4KQP A;  2D5W A;  2OBG A;  1O7T A;  3KFM A;  4H8J A;  3VVE A;  1OLA A;  3EN3 A;  2V84 A;  2F5X A;  3LSX A;  3M3F A;  1UTH A;  3V8X B;  4NF6 A;  3TTK A;  4GRK A;  5DT6 A;  4LZ8 A;  3OEK A;  1MH3 A;  3QUF A;  3KN8 A;  2FYI A;  3SEX A;  1ZTY A;  3CSB A;  1JEV A;  2RC8 A;  1MM7 A;  5AA3 A;  4H67 A;  3S9N C;  1IXG A;  1D3K A;  5CMC A;  3C9H A;  3TZA A;  1PB8 A;  3IL1 B;  1YCJ A;  3IB2 A;  4YB7 A;  4XKN A;  3IAZ A;  5TP9 A;  3K1N A;  2XXR A;  2VGQ A;  3PUY E;  2DWH A;  1ZKB A;  4AQ4 A;  4G4P A;  1B32 A;  3LR1 A;  5TPA B;  1B7Z A;  1PB9 A;  1QUI A;  3PV0 E;  1USY E;  2M8C A;  4NF5 B;  4ZED A;  4QFN A;  2VHA A;  2Z22 A;  4RNS A;  4G77 A;  4GOT A;  4U1Z A;  1MPB A;  1QJM A;  4NF4 B;  1P1Q A;  1MY2 A;  4G8H A;  4Z0I A;  1B5J A;  3H06 B;  3EHU A;  5A5X A;  1BKA A;  3KSX A;  4X9T A;  3TCH A; 
#chains in the Genus database with same CATH topology
 1CB6 A;  3O2A A;  2UVI A;  1FBG A;  3G7W A;  5ICT A;  1LGB C;  4YAH X;  2WBB A;  3K1P A;  4ECF A;  4LUB A;  1IMD A;  1R9Q A;  3UP9 A;  2ZNS A;  3KJT A;  1PB7 A;  2QRY A;  1EZO A;  2GH9 A;  3SDF A;  4H45 A;  2QL3 A;  1BK4 A;  2P2A A;  1NV2 A;  1AOV A;  2DP8 A;  1LFG A;  1JW4 A;  1INP A;  1MG1 A;  4EF2 A;  4ESX A;  3FGS A;  3L6H A;  4BDM A;  3IFC A;  4N6P A;  4NTL A;  3MW0 A;  3A09 A;  2H98 A;  3HO7 A;  5DEX B;  4HTG A;  4GL0 A;  5EQA A;  4DLD A;  1AL3 A;  4OVR A;  5IAI A;  5DYH A;  2Y7W A;  4R6Y A;  3T9X B;  2VOZ A;  4G68 C;  2DYX A;  4F31 B;  1YPN A;  1A8E A;  2Y5L A;  3RTW B;  4NQ8 A;  4ZEI A;  2DE4 A;  4RPO A;  4I9D A;  1K9Y A;  2PMS A;  2KR0 A;  1N84 A;  5L9M A;  1NV3 A;  1OQH A;  2YJP A;  3V5A A;  4ZEC A;  1H45 A;  3CFZ A;  5J1D A;  1KWH A;  2XXK A;  1A7L A;  3ECR A;  1LCT A;  3TFL A;  1YTV A;  3O28 A;  2DS9 A;  2FA7 A;  2X26 A;  2B4L A;  3ONM A;  4GIZ A;  2PVU A;  3SET A;  2ZZV A;  5AA4 B;  2XXI A;  4K3F A;  5H8Q B;  1MQD A;  3W9V A;  4BLA A;  2F78 A;  5LTC A;  3T66 A;  4N6D A;  2XWK A;  2B4M A;  5CC2 A;  2YPN A;  4ONY A;  3MZ1 A;  3E78 A;  3U93 A;  1YAE A;  1R1N A;  1ZBM A;  2DQV A;  3HCQ A;  1Q9D A;  3U72 A;  1IEJ A;  1B5H A;  1FJ6 A;  5TPA A;  2F3B A;  4EF1 A;  3MVW A;  2UYF A;  1A40 A;  4H0W A;  2R6G E;  3CHG A;  3MWB A;  2XXP A;  1BLF A;  3H6V A;  3FVG A;  4OTE A;  1EU8 A;  1MM6 A;  4GWS A;  5CBS A;  1FQB A;  4YB5 A;  1MXV A;  3IOW A;  1HSJ A;  2OWZ A;  3QMF A;  3G3I A;  5LOM A;  4NF4 A;  1LBY A;  3KN3 A;  3RPL B;  2ZMB A;  3K6W A;  1R9L A;  3DM0 A;  3O97 A;  3H6W A;  2A5T B;  1M5F A;  3FD3 A;  2UVG A;  1FPG A;  4H65 A;  1ELJ A;  3D4G A;  4ESW A;  4PQJ A;  3CG3 A;  3TTN A;  2P3V A;  4G8N A;  3TCH A;  4IGT A;  1PC3 A;  1Z7M E;  3GZG A;  3N6T A;  4BDL A;  2DVZ A;  2FHY A;  3ILT B;  1B05 A;  4YKK A;  2QS1 A;  1ZMG A;  4G68 B;  4LVQ A;  4ZEK A;  5B7D A;  2I4B A;  3RPW A;  1ZLQ A;  3MC2 A;  1KA0 A;  2DVC A;  5H8N B;  1LFH A;  5EYH A;  3MZB A;  4R2B A;  2X7Q A;  3VVD A;  4IO7 A;  1MQI A;  1SI1 A;  5H8H A;  5DVI A;  2XX8 A;  1LLS A;  1P1O A;  2OZZ A;  5KDT A;  4F1U A;  3VLV A;  3OEM A;  3PPP A;  5ICQ A;  4MX6 A;  5IZ3 A;  3PUX E;  3IB1 A;  4U23 A;  1MQJ A;  3T9H B;  5I57 B;  1SDX A;  4GBW A;  4O3A A;  1DBZ A;  1H76 A;  4NMY A;  1MDP 1;  3T22 A;  2Y7R A;  3B50 A;  1PEB A;  1NV5 A;  4BDO A;  3DP8 A;  3OO8 A;  1HSE A;  1FPD A;  4PFW A;  4N8Y A;  4OMB A;  3IOT A;  4LON B;  2NXO A;  4IY5 A;  4H46 A;  2VD2 A;  4F3G A;  3PPO A;  3LUZ A;  3EF7 A;  1CE2 A;  4OER A;  3CVG A;  2R71 A;  4P11 A;  1Y20 A;  4PF8 A;  5IGA A;  4JWO A;  4OYV A;  1FPJ A;  4EQ7 A;  3PUV E;  2OWS A;  3HFU A;  1URS A;  3PPN A;  3VFJ A;  4NHB A;  1UTB A;  1FPB A;  2H99 A;  3B6T A;  3TCG A;  3H7M A;  4AS5 A;  1MH4 A;  3TKD A;  2O68 A;  2RKM A;  5FTI A;  5H8F B;  4KR5 A;  1XS5 A;  2GQ1 A;  1GTK A;  3MP8 A;  3HHF A;  4HE2 A;  1BIY A;  4ZZE A;  3K6V A;  3M3L A;  4POW A;  4LAT A;  5EHM A;  1JNF A;  4HE0 A;  1DTG A;  1KA1 A;  4JBZ A;  5ISU A;  1EYI A;  2RCA A;  4OWD A;  1B46 A;  4PDH A;  2ZZX A;  3PMX A;  2Q74 A;  1FBC A;  3K01 A;  3K0V A;  2HXW A;  3UIF A;  3N26 A;  2O1L A;  3PUW E;  3R6U A;  3TPA A;  1N3X A;  3UN6 A;  2KQZ A;  4DDD A;  4BDN A;  2F6P A;  3D1R A;  2ZZW A;  4F22 A;  4GXA A;  3FV2 A;  5I59 B;  3M8U A;  4PE3 A;  3S4U A;  2F3D A;  4F1Y A;  3O66 A;  4NAP A;  5ELV A;  2PT1 A;  3KG2 A;  4GVO A;  5EYF A;  3SER A;  3C34 A;  4GX3 A;  3KOS A;  1G0I A;  3RPL A;  3R26 A;  1XC1 A;  3EPE A;  4MMP A;  3QSL A;  3PTY A;  3QUJ A;  5HBC A;  2OX3 A;  2DXR A;  4P9K A;  3QK6 A;  3U94 A;  4MNI A;  1LAX A;  4ZEB A;  5BWJ A;  1MQG A;  3H6T A;  4PBQ A;  4ZE9 A;  4GL8 A;  3PMV A;  4MBP A;  3VVF A;  3IR1 A;  5K2Y A;  5KCJ A;  1XVX A;  5DVJ A;  2V25 A;  3FVK A;  4NF8 A;  1FQE A;  2H5Y A;  3C36 A;  3PU5 A;  3JV9 A;  5L8D A;  4MJO A;  4MLV A;  2B3B A;  4JVD A;  3RLF E;  1B4H A;  3TYH A;  1IIW A;  1NH8 A;  3OD7 A;  4DZ1 A;  5F24 A;  2F6G A;  4OVT A;  1O63 A;  1MQH A;  1JW5 A;  4IO4 A;  4OVJ A;  1AH5 A;  4NWC A;  1B7H A;  4R9G A;  1NUY A;  5I5P A;  1B3H A;  3CSG A;  1XI6 A;  1XVY A;  2Z23 A;  4NED A;  3OMB A;  1S9T A;  2GHB A;  3HPI A;  2HAV A;  1RKM A;  1Y3Q A;  4WXJ A;  3S9M C;  3FXU A;  2QJE A;  2XX9 A;  5IZ1 A;  1ZU0 A;  2B65 A;  1LB9 A;  1II5 A;  1FTA A;  4WKM A;  3E79 A;  2H4I A;  4JSO A;  4BDR A;  3U92 A;  1B1H A;  4PBH A;  1JVX A;  3LV0 A;  1NV0 A;  4U22 A;  2O69 A;  2XD2 A;  4IR8 A;  5I58 B;  3B7D A;  5B70 A;  2NOO A;  4X1D A;  3G3H A;  1TFA A;  1S50 A;  4P56 A;  3FJ7 A;  2DE3 A;  3G3G A;  2HFB A;  5TU0 A;  3UOR A;  3JYR A;  5I2N B;  4I40 A;  3C35 A;  1DOT A;  3U1O A;  4JSD A;  3OO6 A;  1D9V A;  1LB8 A;  4FBP A;  3OO9 A;  1IXH A;  3V83 A;  4H5F A;  4U2R A;  2E0S A;  4YB6 A;  2WKY A;  3Q27 A;  1N3W A;  1EYK A;  2O51 A;  1IMC A;  4U4X A;  3OSR A;  4GXS B;  4PTK A;  1MY4 A;  2V3T A;  5AA2 B;  1BP5 A;  1FTK A;  2HHM A;  1I6A A;  4TLL B;  2REG A;  2QS3 A;  2FBP A;  4GF8 A;  4PGP A;  3O6H A;  4WED A;  4KCC A;  1FJ9 A;  4QRZ A;  2I0C A;  4NE4 A;  1IMA A;  1JQF A;  5I59 A;  4F18 A;  4HW8 A;  3CIJ A;  4ELO A;  3OO7 A;  1ZIU A;  2XXW A;  3IOU A;  4DI4 B;  2PT2 A;  1NV4 A;  3EQ1 A;  4PP0 A;  2QVR A;  1Y4T A;  2CZK A;  1XHY A;  4NGU A;  2ALU A;  3TMG A;  1LBZ A;  2ZYN A;  4JB7 A;  1YXI A;  2AIX A;  3TTL A;  5I56 A;  4LP2 B;  3LSL A;  3D4C A;  4OVS A;  4M4G A;  3LSF B;  2XA5 A;  4G61 A;  4QSC A;  1B3L A;  4Q5T A;  1G0H A;  1CNQ A;  1B3G A;  3C32 A;  3H6U A;  2ONR A;  4ZDM A;  3O6G A;  1P1U A;  1FSA A;  4N4U A;  3FXB A;  1FW0 A;  1SBP A;  1FTM A;  4HS7 A;  5L9O A;  4KCD A;  2XXH A;  4IGR A;  1MXY A;  1Y1Z A;  1M5B A;  3MPL A;  1MXX A;  5DTB A;  2I4C A;  1LBW A;  2BJJ X;  2XX7 A;  2RF1 A;  2PYY A;  4ELP A;  3F11 A;  5CMB A;  3UA8 A;  1VFE A;  3VXC A;  4NWD A;  2P3N A;  1FQA A;  1UIV A;  4IY6 A;  1B4Z A;  4GWY A;  1SQY A;  3SKP A;  1IUD A;  5ET7 A;  2XHD A;  1FTL A;  1O64 A;  2DOJ A;  2O84 X;  3RNN A;  2DSF A;  4WEP A;  2AYS A;  1USY H;  1I6Q A;  2E1S A;  4GD5 A;  4I8C A;  1MXW A;  2HXR A;  2F7C A;  4PFT A;  5FHM A;  4FOR A;  4GX4 A;  4R75 A;  3RGY A;  2RCB A;  3H3G A;  1NUZ A;  3K6U A;  4DIG A;  1BTJ A;  4I3E A;  3AXF A;  1B3E A;  3TQW A;  4O3C A;  1LBC A;  4Z7E A;  4YKP A;  3RQT A;  2QSX A;  1EH3 A;  1NV1 A;  1DSN A;  2R9J A;  2Q8J A;  4N13 A;  2F35 A;  3BFT A;  4MFI A;  4EQB A;  3DEL B;  2ZNU A;  1WOD A;  4NF5 A;  4P0I A;  4F2O A;  1GV8 A;  5EQ9 A;  1QUK A;  2H25 A;  3TOD A;  1T0K A;  1B51 A;  1POY 1;  2HZK A;  4LQ5 A;  1FQF A;  4MNP A;  4DE8 A;  1N0T A;  1TXF A;  5L9S A;  4QFL A;  1IMF A;  1M5D A;  4LN5 A;  3BIG A;  4N91 A;  3CFX A;  2XXQ A;  3NOH A;  4XIG Q;  3GYY A;  3SZP A;  4FE8 A;  1H44 A;  3MYU A;  2I48 A;  1P1N A;  3ZSF A;  3E4R A;  3BKI B;  3PMW A;  5CRY A;  3KSJ A;  4GBV A;  2BJI A;  4MEV A;  3P7I A;  3TTR A;  2UXA A;  5K2X A;  4BDQ A;  3IO6 A;  4RA1 A;  4GWO A;  5JTY B;  1DPE A;  3K00 A;  5A5L A;  4KFQ A;  4QBA A;  4R73 A;  4F19 A;  4GWU A;  1MXU A;  3ODB A;  3FIR A;  5DEX A;  2GHA A;  3GBB A;  2OCU A;  2JJK A;  4PE5 B;  2B3F A;  5ITP A;  1MY3 A;  1Q1K A;  3KBZ A;  3MPK A;  5IKB A;  1EZ9 A;  2VPN A;  4YU0 A;  3G3F A;  1FBE A;  1FRP A;  2QMX A;  1A54 A;  3N94 A;  3CRB A;  1MRP A;  1UTH B;  4NF6 B;  1B52 A;  2REJ A;  3O9P A;  4TOZ A;  1EZP A;  5FHN A;  2F97 A;  4F2Q A;  3B6W A;  4QFK A;  1B1X A;  1M5C A;  5ET6 A;  2XXU A;  5I3S A;  3HV1 A;  1SW4 A;  4H5G A;  2Y7K A;  5ESY A;  4DCY A;  3OEL A;  1MPD A;  4MAG A;  4U4S A;  2DWI A;  2ZNT A;  1WDN A;  2CZL A;  3BFU A;  4NG7 A;  3CI8 A;  3MAM A;  1AIV A;  1QKA A;  4FEB A;  5TP9 B;  1NMU A;  1MY0 A;  1FTJ A;  3PPQ A;  4H8I A;  5AA4 A;  3E3K A;  3MVZ A;  4MIJ A;  5H8Q A;  4QFP A;  3DP6 A;  2XWV A;  3DLN A;  2PX1 A;  4O8M A;  3N6U A;  4F3B A;  5I7I A;  4THI A;  4U1O A;  3OXN A;  4N6K A;  4DXB A;  1LAG E;  1LFI A;  1A8F A;  1LBB A;  2Y7P A;  3TTM A;  3MBP A;  4E0X A;  1B9J A;  4FAJ A;  1FPI A;  1DMB A;  1JP4 A;  1LEV A;  3KJ7 A;  4M1V A;  3S9E A;  3MUQ A;  4PC9 A;  3IJX B;  4O7I A;  3A29 A;  5A5X B;  2ESN A;  2L5V A;  3O6I A;  4HCW A;  1SW2 A;  4MHF A;  3LBS A;  2QVV A;  4QF9 A;  4PFY A;  3FVO A;  4YKI A;  2VT5 A;  3HHG A;  3E13 X;  5AA2 D;  1SVX B;  2OLB A;  4LA9 A;  4N17 A;  2A5T A;  1R6Z A;  3QAX A;  4MCO A;  1SPI A;  1NUX A;  1JW1 A;  1NKX A;  4XF5 A;  1DPP A;  1PBP A;  1VE4 A;  3SEU A;  2F36 A;  1RYX A;  1GVC A;  3SEV A;  3CG1 A;  4FEC A;  4RK9 A;  1B3F A;  1DTZ A;  1NUW A;  4MLQ A;  3GXA A;  4G2Z A;  4OEV A;  2HZL A;  3EKI A;  3LUY A;  5EHS A;  3TDJ A;  1A55 A;  3T0J A;  5KZT A;  3I5O A;  3IK6 B;  4X1B A;  3EHT A;  2ABH A;  4RK2 A;  4G68 A;  3V89 B;  1IQ7 A;  1F9B A;  3W9W A;  4F3S A;  4U21 A;  5H8N A;  2UYE A;  3KC1 A;  3RYD A;  2F8D A;  4LZ5 A;  4PDD A;  3VLU A;  1AWB A;  1FCK A;  3ZS6 A;  2V3U A;  5AA1 A;  4G8M A;  3OSQ A;  2R8T A;  4X04 A;  4FJP A;  1XOC A;  2WBD A;  5I57 A;  1NNP A;  5JEI A;  2W7Y A;  4JVI A;  5JK4 A;  3IB0 A;  2Y7I A;  4FED A;  2Q2A A;  3FVN A;  4N07 A;  1IZ1 A;  1VSO A;  3KEI A;  4LQ2 A;  4C1T A;  1URD A;  5CMK A;  4ELR A;  3G3K A;  2Z8F A;  1SYH A;  4OET A;  3G3J A;  1UIU A;  1H3D A;  2GRV A;  5IZZ A;  3HST A;  3H4Z A;  4KYD A;  2GFE A;  2DE2 A;  1SI0 A;  5ET5 A;  2O7U A;  4XKR A;  2OWT A;  4EDP A;  1KZ8 A;  2OJT A;  1FQD A;  1LAH E;  2LAO A;  2PBW A;  1Z7N E;  3BIH A;  4NF0 A;  3QXM A;  1NV7 A;  1OQG A;  5H8F A;  5HM4 B;  3RN8 A;  1OIB A;  1OVB A;  3FV1 A;  1ATG A;  4JWX A;  2QFL A;  1SYI A;  2RC7 A;  4YKJ A;  3Q28 A;  3KZG A;  4EQ9 A;  3K2D A;  3T9U A;  1MXZ A;  1B0H A;  2F34 A;  2UVJ A;  3FJG A;  4JWY A;  4PAK A;  3SEW A;  4DXU A;  1B0L A;  1RYO A;  4I62 A;  3ZKL A;  1D9Y A;  3CR9 A;  3A3U A;  4PET A;  3B6Q A;  4RYA A;  2ONK E;  3ZKK A;  1L5T A;  4OVQ A;  3QIM A;  2XXV A;  3ILU B;  4N81 A;  3OOA A;  4FIM A;  1HSL A;  3PUZ E;  4PCD A;  4R6K A;  4F3P A;  3MVY A;  2FNC A;  2ZXT A;  3RT8 A;  3VDF A;  4IB2 A;  3LC8 A;  4TLM B;  4MNC A;  1B58 A;  1MY1 A;  1OVT A;  4ZS9 A;  3TAJ A;  2PFZ A;  3HN0 A;  4H1X A;  4PFR A;  2IA4 A;  1NI9 A;  4Q8R A;  1SW5 A;  1QUL A;  4YMA A;  3PD8 A;  2G93 A;  1MPC A;  4XXU A;  3Q25 A;  1Q35 A;  3IX1 A;  2ZYM A;  2OK2 A;  4OVP A;  4JVC A;  3FBP A;  1Y9U A;  4KXP A;  3RTF B;  1M5E A;  2IEE A;  3I3V A;  2CZI A;  5H8H B;  4F1V A;  1US5 A;  4PFI A;  5ITO A;  5KDT B;  1B2H A;  5DW8 A;  4NX1 A;  2I6E A;  2CEY A;  3MJN A;  1LCF A;  5IZ3 B;  2WYK A;  4ND9 A;  1IXC A;  3BBR A;  3K02 A;  3IOV A;  3VXB A;  5EQ7 A;  2KLF A;  3C31 A;  4DXC A;  2P0S A;  1VFD A;  1H43 A;  3FZV A;  1NL5 A;  2XXX A;  2V4C A;  2Q2C A;  1TT1 A;  4RXL A;  4R2F A;  4Q0C A;  5EQ8 A;  1Y4C A;  3IOR A;  4TQU Q;  2I3W A;  4F39 A;  2CMO A;  4HXV A;  1FQC A;  4IO2 A;  4KI0 E;  3K6X A;  3U8Q A;  4IO6 A;  4C1U A;  1FPF A;  2XWO A;  3ISP A;  2THI A;  3RT6 B;  3S9L C;  3UGW A;  3VV5 A;  2VP1 A;  4XEQ A;  1NNT A;  3C33 A;  4DCX A;  3KN7 A;  4P8B A;  1UTB B;  2AL4 A;  4PFU A;  4OFL A;  1Y3P A;  1URG A;  3T96 B;  4KYE A;  1YYZ A;  2QS4 A;  3K1M A;  4I1D A;  2QS2 A;  1ANF A;  2Q88 A;  5I58 A;  4RJZ A;  2Z8E A;  4MH5 A;  3N5L A;  4OA4 A;  2HAU A;  2Y5K A;  2A5S A;  3KBR A;  1NH7 A;  3PGF A;  5I2N A;  4Q30 B;  4ZZA A;  4OEU A;  4UAB A;  5HPQ A;  4EUO A;  3WAE A;  2HEU A;  2O7I A;  2VPO A;  3GBA A;  4IO5 A;  5DVF A;  3I6V A;  1S7Y A;  1JEU A;  4UA8 A;  1OLC A;  2UVH A;  2FVZ A;  5T3J A;  5M2V A;  4YIC A;  4KHZ E;  5AA2 A;  1JVY A;  3FXQ A;  4L17 A;  1VR5 A;  2G29 A;  4X48 A;  4C0R A;  4OHN A;  4OXV A;  2XXY A;  4JDF A;  4ISU A;  1DCU A;  1B5I A;  4O94 A;  2I0B A;  1SW1 A;  4PAI A;  1P99 A;  1FTO A;  4MF3 A;  2I3V A;  4O7M A;  3OEN A;  4AB5 A;  2NUV A;  3TQL A;  4RY1 A;  1NFT A;  1Y3N A;  1K9Z A;  1LAF E;  4KPT A;  1FBD A;  2YLN A;  2XWI A;  3LSW A;  4XKQ A;  4GFR A;  2ONS A;  1N7X A;  5KCJ B;  3CFL A;  4XTC Q;  1LST A;  1NNF A;  2QPQ A;  4NF8 B;  3VE1 B;  5BUU A;  1B40 A;  4PFB A;  2X7P A;  3JZJ A;  4IO3 A;  3H03 A;  5I2K B;  2F7A A;  3MZ9 A;  2DWA A;  1RDY A;  1QGX A;  1MS7 A;  2D3I A;  4OES A;  3MST A;  1VDW A;  2Y84 A;  3S2V A;  3M3K A;  4OQO A;  2WX9 A;  1RDX A;  3EHS A;  3T9V A;  4POX A;  3R7X A;  3FAS A;  1ZJL A;  2Q9T A;  4OAN A;  3KOT A;  2O6A A;  2ZYK A;  2CZH A;  4R9F A;  1XT8 A;  4R72 A;  3WAF A;  5J16 A;  5AE4 A;  1J1N A;  2ZYO A;  4ZEF A;  2XXT A;  4QSE A;  3A3C A;  5F1Q A;  5CMM A;  2QVU A;  4RPN A;  2NVU B;  2O1M A;  2ANJ A;  3USD A;  1D4N A;  5CI5 A;  2RC9 A;  5CM6 A;  1QKB A;  4N8G A;  3IO4 A;  1IIT A;  4H6D A;  2Q89 A;  4AB6 A;  1IME A;  4OFJ A;  3IJO B;  3QYT A;  2DXY A;  4HCY A;  2XD3 A;  1B7U A;  5FHO A;  3MP1 A;  3FJM A;  5IM2 A;  2HQ0 A;  4EXK A;  4XFE A;  1N7W A;  3SES A;  1I6B A;  3FXR A;  4F29 A;  2VD3 A;  3VLW A;  3UK4 A;  4R6H A;  5F7V A;  2RIN A;  3B8B A;  4HE1 A;  5I84 A;  4PGN A;  2I58 A;  2WEF A;  4GLI A;  4EXL A;  3MVX A;  2HPG A;  5EYG A;  1QW0 A;  1N04 A;  1QUJ A;  1TFD A;  1IMB A;  2DDK A;  1LBX A;  1B6H A;  2P1S A;  1PDA A;  3MQ9 A;  4R74 A;  2QMW A;  3T93 B;  4UAC A;  3IFA A;  4QSD A;  1TWY A;  4P47 A;  1FBP A;  5FTH A;  1POT A;  5CBR A;  3Q29 A;  1WVJ A;  1LBV A;  4P0G A;  3FUZ A;  3MP6 A;  4P3L A;  1OMP A;  2D21 A;  4P1E A;  2H9B A;  3U65 A;  1MDQ A;  1FPE A;  4QHQ A;  3T1B A;  1Y1M A;  1EYJ A;  1US4 A;  4KD5 A;  4FAT A;  2NWJ A;  4OEN A;  1QVS A;  3TEP A;  4O3B A;  2F7B A;  3THI A;  4QXD A;  4KYS A;  3RY3 A;  1RDZ A;  1UQW A;  4LZ7 A;  1GR2 A;  3SEY A;  2AL5 A;  3TUS A;  4GQO A;  4ZE8 A;  1GGG A;  1PBQ A;  3KC0 A;  4JXI A;  4GWW A;  4ELQ A;  2V93 A;  4XKP A;  4QFO A;  3O29 A;  3E9X A;  3PD9 A;  4YZZ A;  3GLB A;  2HCA A;  3RUM A;  3PPR A;  5H8S A;  1JET A;  2DWJ A;  4PF6 A;  1N76 A;  2I49 A;  5I56 B;  1A99 A;  4OZ9 A;  3TEL A;  4E0W A;  3K4U A;  1SD3 A;  1AMF A;  3DP4 A;  3KGC A;  2Z8D A;  1P1W A;  4YMB A;  2V3Q A;  3TCF A;  5JTY A;  1I69 A;  3Q26 A;  4OFO A;  1NNK A;  4PAF A;  3FAT A;  3C4M A;  2FIE A;  5FBP A;  3L6G A;  1IXI A;  3W15 C;  2PCR A;  1YZ0 A;  5I2K A;  4KQP A;  2D5W A;  2OBG A;  1O7T A;  2CEX A;  3KFM A;  4H8J A;  3VVE A;  1OLA A;  3EN3 A;  2PFY A;  2V84 A;  2F5X A;  3LSX A;  3M3F A;  5ET8 A;  2WYP A;  1UTH A;  3V8X B;  4NF6 A;  4GX6 A;  4X8R A;  3TTK A;  4GRK A;  5DT6 A;  4LZ8 A;  3OEK A;  1MH3 A;  3QUF A;  3KN8 A;  2FYI A;  3SEX A;  1FBF A;  1ZTY A;  2MKZ A;  3CSB A;  4GWX A;  1JEV A;  2RC8 A;  1MM7 A;  5AA3 A;  4H67 A;  3S9N C;  1IXG A;  3ROJ A;  1D3K A;  2Q8M A;  5CMC A;  3C9H A;  3TZA A;  1FBH A;  1PB8 A;  1DK4 A;  3IL1 B;  4NN3 A;  1YCJ A;  3IB2 A;  4YB7 A;  4XKN A;  3IAZ A;  4I3Y A;  5TP9 A;  3K1N A;  2XXR A;  2VGQ A;  3PUY E;  2DWH A;  1ZKB A;  4AQ4 A;  4G4P A;  1B32 A;  3LR1 A;  5TPA B;  1B7Z A;  1PB9 A;  1QUI A;  1NV6 A;  3PV0 E;  1USY E;  2M8C A;  4NF5 B;  4ZED A;  4QFN A;  1FPL A;  2VHA A;  2Z22 A;  4RNS A;  4G77 A;  4GOT A;  4U1Z A;  1MPB A;  1QJM A;  2FIX A;  1FPK A;  4NF4 B;  1P1Q A;  1MY2 A;  4G8H A;  4N15 A;  4Z0I A;  4AS4 A;  1B5J A;  3H06 B;  1D9Q A;  3EHU A;  5A5X A;  4DI3 D;  1BKA A;  4GWZ A;  3KSX A;  4X9T A;  5LDZ A;  4P1L A; 
#chains in the Genus database with same CATH homology
 1CB6 A;  3O2A A;  2UVI A;  3G7W A;  5ICT A;  1LGB C;  4YAH X;  3K1P A;  4ECF A;  4LUB A;  1R9Q A;  3UP9 A;  2ZNS A;  3KJT A;  1PB7 A;  2QRY A;  1EZO A;  2GH9 A;  3SDF A;  2QL3 A;  2P2A A;  1AOV A;  2DP8 A;  1LFG A;  1JW4 A;  1MG1 A;  4EF2 A;  4ESX A;  3FGS A;  3L6H A;  4BDM A;  4N6P A;  4NTL A;  3MW0 A;  3A09 A;  2H98 A;  3HO7 A;  5DEX B;  4HTG A;  4GL0 A;  4DLD A;  1AL3 A;  5IAI A;  5DYH A;  2Y7W A;  4R6Y A;  3T9X B;  2VOZ A;  4G68 C;  2DYX A;  4F31 B;  1YPN A;  1A8E A;  3RTW B;  4ZEI A;  2DE4 A;  4RPO A;  4I9D A;  2PMS A;  1N84 A;  5L9M A;  1OQH A;  2YJP A;  3V5A A;  4ZEC A;  1H45 A;  3CFZ A;  5J1D A;  1KWH A;  1A7L A;  3ECR A;  1LCT A;  3TFL A;  1YTV A;  3O28 A;  2DS9 A;  2FA7 A;  2X26 A;  3ONM A;  4GIZ A;  2PVU A;  3SET A;  5AA4 B;  2XXI A;  4K3F A;  5H8Q B;  1MQD A;  3W9V A;  4BLA A;  2F78 A;  3T66 A;  5CC2 A;  2YPN A;  4ONY A;  3MZ1 A;  3U93 A;  1YAE A;  1R1N A;  1ZBM A;  2DQV A;  3HCQ A;  3U72 A;  1IEJ A;  1B5H A;  5TPA A;  4EF1 A;  3MVW A;  2UYF A;  1A40 A;  4H0W A;  2R6G E;  3MWB A;  2XXP A;  1BLF A;  3H6V A;  3FVG A;  4OTE A;  1EU8 A;  1MM6 A;  5CBS A;  1FQB A;  4YB5 A;  1MXV A;  3IOW A;  1HSJ A;  3G3I A;  5LOM A;  4NF4 A;  3KN3 A;  2ZMB A;  3K6W A;  1R9L A;  3DM0 A;  3O97 A;  3H6W A;  2A5T B;  1M5F A;  3FD3 A;  2UVG A;  4H65 A;  1ELJ A;  3D4G A;  4ESW A;  4PQJ A;  3CG3 A;  3TTN A;  4G8N A;  4IGT A;  1PC3 A;  1Z7M E;  3GZG A;  3N6T A;  4BDL A;  2DVZ A;  3ILT B;  1B05 A;  4YKK A;  2QS1 A;  1ZMG A;  4G68 B;  4LVQ A;  4ZEK A;  5B7D A;  2I4B A;  3RPW A;  1ZLQ A;  3MC2 A;  2DVC A;  5H8N B;  1LFH A;  3MZB A;  4R2B A;  2X7Q A;  3VVD A;  4IO7 A;  1MQI A;  1SI1 A;  5H8H A;  5DVI A;  2XX8 A;  1LLS A;  1P1O A;  2OZZ A;  5KDT A;  4F1U A;  3VLV A;  3OEM A;  3PPP A;  5ICQ A;  3PUX E;  3IB1 A;  4U23 A;  1MQJ A;  3T9H B;  5I57 B;  1SDX A;  4O3A A;  1H76 A;  4NMY A;  1MDP 1;  3T22 A;  2Y7R A;  1PEB A;  4BDO A;  3DP8 A;  3OO8 A;  1HSE A;  4PFW A;  4OMB A;  3IOT A;  4LON B;  2NXO A;  4IY5 A;  2VD2 A;  4F3G A;  3PPO A;  3EF7 A;  1CE2 A;  4OER A;  3CVG A;  2R71 A;  4P11 A;  1Y20 A;  4JWO A;  4OYV A;  4EQ7 A;  3PUV E;  2OWS A;  1URS A;  3PPN A;  3VFJ A;  1UTB A;  2H99 A;  3B6T A;  3TCG A;  3H7M A;  1MH4 A;  3TKD A;  2O68 A;  2RKM A;  5FTI A;  5H8F B;  4KR5 A;  1XS5 A;  1GTK A;  3MP8 A;  3HHF A;  1BIY A;  4ZZE A;  3K6V A;  3M3L A;  4POW A;  4LAT A;  5EHM A;  1JNF A;  1DTG A;  4JBZ A;  5ISU A;  2RCA A;  4OWD A;  1B46 A;  3PMX A;  3K01 A;  3K0V A;  2HXW A;  3UIF A;  3N26 A;  2O1L A;  3PUW E;  3R6U A;  3TPA A;  1N3X A;  3UN6 A;  4DDD A;  4BDN A;  2F6P A;  4F22 A;  4GXA A;  3FV2 A;  5I59 B;  3M8U A;  3S4U A;  4F1Y A;  3O66 A;  5ELV A;  2PT1 A;  3KG2 A;  4GVO A;  5EYF A;  3SER A;  3C34 A;  3KOS A;  3R26 A;  1XC1 A;  3EPE A;  3QSL A;  3QUJ A;  5HBC A;  2DXR A;  3QK6 A;  3U94 A;  1LAX A;  4ZEB A;  5BWJ A;  1MQG A;  3H6T A;  4ZE9 A;  4GL8 A;  3PMV A;  4MBP A;  3VVF A;  3IR1 A;  5K2Y A;  5KCJ A;  1XVX A;  5DVJ A;  2V25 A;  3FVK A;  4NF8 A;  1FQE A;  2H5Y A;  3C36 A;  3PU5 A;  3JV9 A;  5L8D A;  4MLV A;  2B3B A;  3RLF E;  1B4H A;  3TYH A;  1IIW A;  1NH8 A;  3OD7 A;  4DZ1 A;  2F6G A;  1O63 A;  1MQH A;  1JW5 A;  4IO4 A;  4OVJ A;  1AH5 A;  4NWC A;  1B7H A;  4R9G A;  1B3H A;  3CSG A;  1XVY A;  2Z23 A;  4NED A;  3OMB A;  1S9T A;  2GHB A;  3HPI A;  2HAV A;  1RKM A;  1Y3Q A;  4WXJ A;  3S9M C;  3FXU A;  2QJE A;  2XX9 A;  1ZU0 A;  2B65 A;  1LB9 A;  1II5 A;  4WKM A;  2H4I A;  4JSO A;  4BDR A;  3U92 A;  1B1H A;  1JVX A;  4U22 A;  2O69 A;  2XD2 A;  5I58 B;  3B7D A;  5B70 A;  2NOO A;  4X1D A;  3G3H A;  1TFA A;  1S50 A;  3FJ7 A;  2DE3 A;  3G3G A;  2HFB A;  5TU0 A;  3UOR A;  3JYR A;  5I2N B;  3C35 A;  1DOT A;  3U1O A;  4JSD A;  3OO6 A;  1D9V A;  1LB8 A;  3OO9 A;  1IXH A;  3V83 A;  4H5F A;  4U2R A;  2E0S A;  4YB6 A;  2WKY A;  3Q27 A;  1N3W A;  2O51 A;  4U4X A;  3OSR A;  4GXS B;  1MY4 A;  2V3T A;  5AA2 B;  1BP5 A;  1FTK A;  1I6A A;  4TLL B;  2REG A;  2QS3 A;  4GF8 A;  3O6H A;  4WED A;  4KCC A;  4QRZ A;  2I0C A;  4NE4 A;  1JQF A;  5I59 A;  4F18 A;  4HW8 A;  3CIJ A;  4ELO A;  3OO7 A;  1ZIU A;  2XXW A;  3IOU A;  2PT2 A;  3EQ1 A;  4PP0 A;  1Y4T A;  1XHY A;  2ALU A;  3TMG A;  2ZYN A;  4JB7 A;  2AIX A;  3TTL A;  5I56 A;  4LP2 B;  3LSL A;  3D4C A;  4M4G A;  3LSF B;  4QSC A;  1B3L A;  4Q5T A;  1B3G A;  3C32 A;  3H6U A;  2ONR A;  4ZDM A;  3O6G A;  1P1U A;  1FW0 A;  1SBP A;  1FTM A;  4HS7 A;  5L9O A;  4KCD A;  2XXH A;  4IGR A;  1MXY A;  1Y1Z A;  1M5B A;  3MPL A;  1MXX A;  5DTB A;  2I4C A;  2BJJ X;  2XX7 A;  2RF1 A;  2PYY A;  4ELP A;  3F11 A;  5CMB A;  3UA8 A;  1VFE A;  3VXC A;  4NWD A;  1FQA A;  1UIV A;  4IY6 A;  1B4Z A;  1SQY A;  3SKP A;  1IUD A;  2XHD A;  1FTL A;  1O64 A;  2DOJ A;  2O84 X;  3RNN A;  2DSF A;  4WEP A;  2AYS A;  1USY H;  1I6Q A;  2E1S A;  4GD5 A;  4I8C A;  1MXW A;  2F7C A;  4PFT A;  5FHM A;  4FOR A;  4R75 A;  3RGY A;  2RCB A;  3H3G A;  3K6U A;  4DIG A;  1BTJ A;  3AXF A;  1B3E A;  3TQW A;  4O3C A;  1LBC A;  4Z7E A;  4YKP A;  3RQT A;  2QSX A;  1EH3 A;  1DSN A;  2R9J A;  2Q8J A;  4N13 A;  2F35 A;  3BFT A;  4MFI A;  4EQB A;  3DEL B;  2ZNU A;  1WOD A;  4NF5 A;  4P0I A;  4F2O A;  1GV8 A;  1QUK A;  2H25 A;  3TOD A;  1T0K A;  1B51 A;  1POY 1;  2HZK A;  4LQ5 A;  1FQF A;  4DE8 A;  1N0T A;  1TXF A;  5L9S A;  4QFL A;  1M5D A;  3CFX A;  2XXQ A;  4XIG Q;  4FE8 A;  1H44 A;  2I48 A;  1P1N A;  3ZSF A;  3E4R A;  3BKI B;  3PMW A;  5CRY A;  3KSJ A;  3P7I A;  3TTR A;  2UXA A;  5K2X A;  4BDQ A;  3IO6 A;  4RA1 A;  4GWO A;  5JTY B;  1DPE A;  3K00 A;  4KFQ A;  4R73 A;  4F19 A;  1MXU A;  3ODB A;  3FIR A;  5DEX A;  2GHA A;  3GBB A;  2OCU A;  4PE5 B;  2B3F A;  5ITP A;  1MY3 A;  1Q1K A;  3MPK A;  5IKB A;  1EZ9 A;  4YU0 A;  3G3F A;  2QMX A;  1A54 A;  3N94 A;  3CRB A;  1MRP A;  1UTH B;  4NF6 B;  1B52 A;  2REJ A;  3O9P A;  4TOZ A;  1EZP A;  5FHN A;  2F97 A;  4F2Q A;  3B6W A;  4QFK A;  1B1X A;  1M5C A;  2XXU A;  3HV1 A;  1SW4 A;  4H5G A;  2Y7K A;  4DCY A;  3OEL A;  1MPD A;  4U4S A;  2DWI A;  2ZNT A;  1WDN A;  2CZL A;  3BFU A;  3CI8 A;  3MAM A;  1AIV A;  1QKA A;  4FEB A;  5TP9 B;  1NMU A;  1MY0 A;  1FTJ A;  3PPQ A;  4H8I A;  5AA4 A;  3E3K A;  3MVZ A;  5H8Q A;  4QFP A;  3DP6 A;  3DLN A;  2PX1 A;  3N6U A;  4F3B A;  4THI A;  4U1O A;  3OXN A;  4DXB A;  1LAG E;  1LFI A;  1A8F A;  1LBB A;  2Y7P A;  3TTM A;  3MBP A;  4E0X A;  1B9J A;  4FAJ A;  1DMB A;  3KJ7 A;  4M1V A;  3S9E A;  3MUQ A;  3IJX B;  5A5X B;  2ESN A;  3O6I A;  4HCW A;  1SW2 A;  3LBS A;  4QF9 A;  4PFY A;  3FVO A;  4YKI A;  3HHG A;  3E13 X;  5AA2 D;  1SVX B;  2OLB A;  4LA9 A;  2A5T A;  1R6Z A;  3QAX A;  1JW1 A;  1NKX A;  1DPP A;  1PBP A;  1VE4 A;  3SEU A;  2F36 A;  1RYX A;  1GVC A;  3SEV A;  3CG1 A;  4FEC A;  4RK9 A;  1B3F A;  1DTZ A;  4MLQ A;  3GXA A;  4G2Z A;  4OEV A;  2HZL A;  3LUY A;  5EHS A;  3TDJ A;  1A55 A;  5KZT A;  3I5O A;  3IK6 B;  4X1B A;  3EHT A;  2ABH A;  4RK2 A;  4G68 A;  3V89 B;  1IQ7 A;  1F9B A;  3W9W A;  4F3S A;  4U21 A;  5H8N A;  2UYE A;  2F8D A;  4LZ5 A;  3VLU A;  1FCK A;  3ZS6 A;  2V3U A;  5AA1 A;  4G8M A;  3OSQ A;  4FJP A;  1XOC A;  5I57 A;  1NNP A;  5JEI A;  2W7Y A;  5JK4 A;  3IB0 A;  2Y7I A;  4FED A;  2Q2A A;  3FVN A;  4N07 A;  1IZ1 A;  1VSO A;  3KEI A;  4LQ2 A;  4C1T A;  1URD A;  5CMK A;  4ELR A;  3G3K A;  2Z8F A;  1SYH A;  4OET A;  3G3J A;  1UIU A;  1H3D A;  2GRV A;  3HST A;  3H4Z A;  4KYD A;  2GFE A;  2DE2 A;  1SI0 A;  2O7U A;  4XKR A;  2OWT A;  4EDP A;  2OJT A;  1FQD A;  1LAH E;  2LAO A;  2PBW A;  1Z7N E;  3QXM A;  1OQG A;  5H8F A;  5HM4 B;  3RN8 A;  1OIB A;  1OVB A;  3FV1 A;  1ATG A;  4JWX A;  1SYI A;  2RC7 A;  4YKJ A;  3Q28 A;  3KZG A;  4EQ9 A;  3K2D A;  3T9U A;  1MXZ A;  1B0H A;  2F34 A;  2UVJ A;  3FJG A;  4JWY A;  3SEW A;  4DXU A;  1B0L A;  1RYO A;  4I62 A;  3ZKL A;  1D9Y A;  3CR9 A;  3A3U A;  4PET A;  3B6Q A;  4RYA A;  2ONK E;  3ZKK A;  1L5T A;  3QIM A;  2XXV A;  3ILU B;  3OOA A;  4FIM A;  1HSL A;  3PUZ E;  4R6K A;  4F3P A;  3MVY A;  2FNC A;  2ZXT A;  3RT8 A;  3VDF A;  4IB2 A;  3LC8 A;  4TLM B;  1B58 A;  1MY1 A;  1OVT A;  4ZS9 A;  3TAJ A;  3HN0 A;  4H1X A;  2IA4 A;  4Q8R A;  1SW5 A;  1QUL A;  4YMA A;  3PD8 A;  2G93 A;  1MPC A;  4XXU A;  3Q25 A;  1Q35 A;  3IX1 A;  2ZYM A;  2OK2 A;  1Y9U A;  3RTF B;  1M5E A;  2IEE A;  3I3V A;  5H8H B;  4F1V A;  1US5 A;  5ITO A;  5KDT B;  1B2H A;  2I6E A;  3MJN A;  1LCF A;  4ND9 A;  1IXC A;  3BBR A;  3K02 A;  3IOV A;  3VXB A;  2KLF A;  3C31 A;  4DXC A;  2P0S A;  1VFD A;  1H43 A;  3FZV A;  1NL5 A;  2XXX A;  2Q2C A;  1TT1 A;  4RXL A;  4R2F A;  4Q0C A;  1Y4C A;  3IOR A;  4TQU Q;  2I3W A;  4F39 A;  2CMO A;  1FQC A;  4IO2 A;  4KI0 E;  3K6X A;  3U8Q A;  4IO6 A;  4C1U A;  3RT6 B;  2THI A;  3S9L C;  3UGW A;  3VV5 A;  2VP1 A;  1NNT A;  3C33 A;  4DCX A;  3KN7 A;  1UTB B;  2AL4 A;  4PFU A;  4OFL A;  1Y3P A;  1URG A;  3T96 B;  4KYE A;  2QS4 A;  3K1M A;  4I1D A;  2QS2 A;  1ANF A;  2Q88 A;  5I58 A;  4RJZ A;  2Z8E A;  4MH5 A;  3N5L A;  2HAU A;  2A5S A;  3KBR A;  1NH7 A;  3PGF A;  5I2N A;  4Q30 B;  4ZZA A;  4OEU A;  5HPQ A;  4EUO A;  3WAE A;  2HEU A;  2O7I A;  3GBA A;  4IO5 A;  5DVF A;  3I6V A;  1S7Y A;  1JEU A;  4UA8 A;  1OLC A;  2UVH A;  5M2V A;  4YIC A;  4KHZ E;  5AA2 A;  1JVY A;  3FXQ A;  4L17 A;  1VR5 A;  2G29 A;  4X48 A;  4C0R A;  4OHN A;  4OXV A;  2XXY A;  4JDF A;  4ISU A;  1B5I A;  2I0B A;  1SW1 A;  1P99 A;  1FTO A;  4MF3 A;  2I3V A;  3OEN A;  4AB5 A;  2NUV A;  3TQL A;  4RY1 A;  1NFT A;  1Y3N A;  1LAF E;  4KPT A;  2YLN A;  3LSW A;  4XKQ A;  4GFR A;  2ONS A;  1N7X A;  5KCJ B;  3CFL A;  4XTC Q;  1LST A;  1NNF A;  2QPQ A;  4NF8 B;  3VE1 B;  5BUU A;  1B40 A;  2X7P A;  3JZJ A;  4IO3 A;  3H03 A;  5I2K B;  2F7A A;  3MZ9 A;  2DWA A;  1MS7 A;  2D3I A;  4OES A;  2Y84 A;  3S2V A;  3M3K A;  4OQO A;  3EHS A;  3T9V A;  4POX A;  3R7X A;  3FAS A;  1ZJL A;  2Q9T A;  3KOT A;  2O6A A;  2ZYK A;  4R9F A;  1XT8 A;  4R72 A;  3WAF A;  5AE4 A;  1J1N A;  2ZYO A;  4ZEF A;  2XXT A;  4QSE A;  3A3C A;  5F1Q A;  5CMM A;  4RPN A;  2NVU B;  2O1M A;  2ANJ A;  3USD A;  1D4N A;  5CI5 A;  2RC9 A;  5CM6 A;  1QKB A;  3IO4 A;  1IIT A;  4H6D A;  2Q89 A;  4AB6 A;  4OFJ A;  3IJO B;  3QYT A;  2DXY A;  4HCY A;  2XD3 A;  1B7U A;  5FHO A;  3MP1 A;  3FJM A;  2HQ0 A;  4EXK A;  1N7W A;  3SES A;  1I6B A;  3FXR A;  4F29 A;  2VD3 A;  3VLW A;  3UK4 A;  4R6H A;  5F7V A;  2RIN A;  5I84 A;  2I58 A;  4GLI A;  4EXL A;  3MVX A;  1QW0 A;  1N04 A;  1QUJ A;  1TFD A;  1B6H A;  2P1S A;  1PDA A;  3MQ9 A;  4R74 A;  2QMW A;  3T93 B;  4UAC A;  4QSD A;  1TWY A;  5FTH A;  1POT A;  5CBR A;  3Q29 A;  1WVJ A;  4P0G A;  3FUZ A;  3MP6 A;  1OMP A;  2D21 A;  2H9B A;  1MDQ A;  4QHQ A;  1Y1M A;  1US4 A;  4KD5 A;  4FAT A;  2NWJ A;  4OEN A;  1QVS A;  3TEP A;  4O3B A;  2F7B A;  3THI A;  4KYS A;  3RY3 A;  1UQW A;  4LZ7 A;  1GR2 A;  3SEY A;  2AL5 A;  3TUS A;  4GQO A;  4ZE8 A;  1GGG A;  1PBQ A;  4JXI A;  4ELQ A;  2V93 A;  4XKP A;  4QFO A;  3O29 A;  3E9X A;  3PD9 A;  4YZZ A;  3GLB A;  2HCA A;  3RUM A;  3PPR A;  5H8S A;  1JET A;  2DWJ A;  1N76 A;  2I49 A;  5I56 B;  1A99 A;  4OZ9 A;  3TEL A;  4E0W A;  3K4U A;  1SD3 A;  1AMF A;  3DP4 A;  3KGC A;  2Z8D A;  1P1W A;  4YMB A;  2V3Q A;  3TCF A;  5JTY A;  1I69 A;  3Q26 A;  4OFO A;  1NNK A;  3FAT A;  3C4M A;  3L6G A;  1IXI A;  3W15 C;  5I2K A;  4KQP A;  2D5W A;  2OBG A;  1O7T A;  3KFM A;  4H8J A;  3VVE A;  1OLA A;  3EN3 A;  2V84 A;  2F5X A;  3LSX A;  3M3F A;  1UTH A;  3V8X B;  4NF6 A;  3TTK A;  4GRK A;  5DT6 A;  4LZ8 A;  3OEK A;  1MH3 A;  3QUF A;  3KN8 A;  2FYI A;  3SEX A;  1ZTY A;  3CSB A;  1JEV A;  2RC8 A;  1MM7 A;  5AA3 A;  4H67 A;  3S9N C;  1IXG A;  1D3K A;  5CMC A;  3C9H A;  3TZA A;  1PB8 A;  3IL1 B;  1YCJ A;  3IB2 A;  4YB7 A;  4XKN A;  3IAZ A;  5TP9 A;  3K1N A;  2XXR A;  2VGQ A;  3PUY E;  2DWH A;  1ZKB A;  4AQ4 A;  4G4P A;  1B32 A;  3LR1 A;  5TPA B;  1B7Z A;  1PB9 A;  1QUI A;  3PV0 E;  1USY E;  2M8C A;  4NF5 B;  4ZED A;  4QFN A;  2VHA A;  2Z22 A;  4RNS A;  4G77 A;  4GOT A;  4U1Z A;  1MPB A;  1QJM A;  4NF4 B;  1P1Q A;  1MY2 A;  4G8H A;  4Z0I A;  1B5J A;  3H06 B;  3EHU A;  5A5X A;  1BKA A;  3KSX A;  4X9T A;  3TCH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...