2CZLA

Crystal structure of mqnd (ttha1568), a menaquinone biosynthetic enzyme from thermus thermophilus hb8 (cys11 modified with beta-mercaptoethanol)
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
270
structure length
269
Chain Sequence
ALRLGFSPPNDTFIFYALVHGRVESPVPLEPVLEDVETLNRWALEGRLPLTKLSYAAYAQVRDRYVALRSGGALGRGVGPLVVARGPLQALEGLRVAVPGRHTTAYFLLSLYAQGFVPVEVRYDRILPMVAQGEVEAGLIIHESRFTYPRYGLVQVVDLGAWWEERTGLPLPLGAILARRDLGEGLIRALDEAVRRSVAYALAHPEEALDYMRAHAQELSDEVIWAHVHTYVNAFSLDVGEEGERAVARLFAEAEARGLAAPSPRPLFV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords hypothetical protein TTHA1568
publication title Crystal structure of MqnD (TTHA1568), a menaquinone biosynthetic enzyme from Thermus thermophilus HB8.
pubmed doi rcsb
source organism Thermus thermophilus
total genus 94
structure length 269
sequence length 270
ec nomenclature
pdb deposition date 2005-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02621 VitK2_biosynth Menaquinone biosynthesis
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2czlA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2czlA02
2HEUA 1IUDA 3O6HA 4TOZA 3RTWB 4GXSB 3B6TA 3T93B 1FTKA 1QKAA 1EZOA 3ZSFA 3R26A 4R2FA 1MM6A 1LFIA 3KSJA 3CSBA 3H6VA 3FD3A 3W9VA 1MQJA 1YTVA 1MPDA 2XX7A 1SBPA 1B40A 2E1SA 4Q30B 3FV1A 4L17A 1B05A 4U1ZA 2RC9A 4PFTA 3GZGA 2F5XA 1TFAA 3CG1A 4DDDA 3T9VA 2H99A 3V83A 1NNKA 4KYSA 2V93A 1OIBA 1SQYA 4IO3A 5BUUA 4RYAA 2X26A 4LZ7A 4LP2B 5CMBA 1I6BA 3ILUB 3C36A 2XXYA 1H44A 3WAFA 4XKQA 4DZ1A 1TWYA 3TQLA 4NF4A 2X7PA 2Z8FA 3ZKLA 2M8CA 5J1DA 5L9MA 4GOTA 2HQ0A 1JEUA 1H76A 1ZJLA 4PP0A 5I56B 2E0SA 3U8QA 3CRBA 4G68C 2I6EA 4IO4A 1B32A 1MY3A 1MRPA 1M5FA 3H6UA 4OERA 3BFUA 2Q8JA 5DVIA 1ATGA 2ESNA 1R6ZA 3PV0E 5H8NB 5DEXB 2XD3A 4DIGA 4ECFA 2O1MA 1D3KA 2H5YA 3UP9A 3TKDA 3PD9A 3USDA 1TT1A 3MVXA 4H1XA 2R71A 4ESWA 4QFPA 3PD8A 2QRYA 4FECA 4EQ7A 1LBBA 1KWHA 1IITA 4KI0E 4F31B 4ZEFA 3CI8A 2P1SA 4MF3A 2QS2A 1MPBA 4F3SA 4DE8A 1QKBA 2OJTA 5TU0A 4OXVA 1JW5A 4KYEA 1UQWA 1B51A 2DWHA 2F7BA 3KN7A 2PVUA 3SEUA 4R9FA 3FVKA 4NWDA 1URGA 1QUKA 1LAGE 1OVBA 2PT1A 1PB7A 4GRKA 4LZ5A 3FGSA 3T9UA 4ONYA 3M3FA 2VGQA 1ZBMA 4IGTA 3QUFA 1A55A 3MPLA 4EQBA 1NL5A 3V8XB 2ZYNA 4OTEA 4R9GA 5AE4A 2I4CA 3PUYE 3KOSA 4KD5A 1N0TA 1YCJA 4IO6A 3H6WA 3TCGA 3LBSA 1S9TA 3PPPA 4JBZA 2DE2A 1IXIA 4PFYA 4OFLA 1Y4TA 4POWA 1MDP1 1FQFA 4X1BA 2G29A 1B0HA 2DOJA 3EPEA 3KBRA 5ITOA 3FXQA 1WODA 3AXFA 4YMAA 2XD2A 5TP9A 3MC2A 3FXUA 3K01A 3QIMA 4U4SA 2QL3A 4EF1A 1RYXA 3TTLA 1FTLA 2F7AA 3IO6A 3RLFE 2V84A 1PC3A 2HXWA 1YAEA 3S9NC 5I59B 1BIYA 1OLAA 4N07A 2DQVA 2QJEA 2AL4A 1P99A 1UIVA 3IOUA 3VLWA 3G3HA 5A5XB 4H5FA 2NVUB 1SW1A 2Q9TA 2XXUA 1R1NA 1SW5A 5H8QB 4THIA 4M1VA 3HHGA 4YB6A 3A09A 1QJMA 5DT6A 1A40A 5H8FA 2A5TB 2V3QA 4GL0A 1LAFE 4DXUA 3MWBA 4POXA 3UA8A 3RT6B 2CZLA 4EXKA 1ELJA 2REGA 4KQPA 3DELB 3TQWA 3S9MC 4BDQA 2B3FA 4IO5A 1ZIUA 2UYEA 3N94A 4BDNA 4DXCA 3IORA 5ICQA 5CC2A 3S9EA 1MXVA 3Q25A 5ELVA 3K6UA 3IOTA 1OQHA 1JW4A 4XKRA 1Y4CA 5AA2D 1AMFA 1Y20A 4ZDMA 5HBCA 5K2XA 1PB8A 2DSFA 2DXRA 5I57A 3IR1A 1AH5A 4QFKA 1B2HA 1M5BA 2ZNUA 3HHFA 5EHMA 4YU0A 1UTBA 4GL8A 5BWJA 2YPNA 3OSRA 1RKMA 4O3BA 4EF2A 1BP5A 4NF8A 3H3GA 3CSGA 1DOTA 4ZZEA 1JETA 3U93A 1SDXA 1B7ZA 4ESXA 4NE4A 1H43A 3FVGA 4LQ2A 5L8DA 2Z8DA 2ANJA 4F1YA 3CFXA 4R74A 1NH8A 4GLIA 4NF4B 3FJMA 3BFTA 3LSFB 1LCTA 3C35A 1P1UA 1M5DA 2Q89A 3HPIA 1IXGA 3K00A 1MY1A 1N3XA 1GV8A 2GH9A 2X7QA 2H25A 1LGBC 4IO2A 4LVQA 3DM0A 4HCWA 2QS4A 3PMWA 3C32A 4RXLA 3MVZA 1RYOA 3UN6A 2DWIA 4XKNA 1N84A 3OO7A 4MH5A 4F3GA 1IIWA 3IOVA 1A8EA 4IY6A 4OETA 4EQ9A 4ELPA 2HCAA 4F39A 5L9SA 3CFZA 3C34A 4N6PA 4QSDA 3DLNA 1L5TA 1GR2A 4OEVA 2ABHA 2RC8A 1BKAA 3S9LC 4ZEDA 1MQIA 3OMBA 3KJTA 3SEVA 1VE4A 3ECRA 1SW2A 2F6GA 2Y7KA 2UVIA 3IB0A 1I69A 5AA2A 2Y7IA 3MW0A 2NXOA 5I58A 3T66A 3EHTA 2RF1A 4U21A 3W9WA 3DP6A 2OWSA 5I2NA 4BDLA 3IOWA 3L6GA 3MQ9A 3RGYA 1SI1A 3KOTA 2DVCA 3QK6A 4LA9A 4QFLA 1USYH 3G3KA 4XIGQ 2V3TA 2QS1A 1IEJA 2F8DA 3WAEA 1LAHE 1N7XA 4F19A 2O69A 3OELA 2HAUA 3O97A 2DWJA 1S50A 4WXJA 4BDRA 2AYSA 2F78A 3C31A 2DYXA 2R6GE 2GFEA 4ZEKA 1SYHA 4OYVA 1MM7A 2VOZA 2Z23A 1Z7ME 3O29A 1OMPA 1MQHA 2HAVA 3V5AA 4R73A 3M8UA 4ZE8A 5K2YA 1JVYA 4MLQA 2NOOA 1LCFA 3QXMA 4KFQA 2Q2AA 4TLLB 3KGCA 5TP9B 1MQGA 4LQ5A 2F34A 3TEPA 4PFUA 3VVDA 2P2AA 4YZZA 3QUJA 1POY1 3K0VA 4U1OA 4ISUA 2O84X 3KSXA 1DMBA 3ZS6A 4I1DA 1P1QA 4EDPA 3H4ZA 3KG2A 3UGWA 4PE5B 4E0WA 5LOMA 3PMXA 4IGRA 2QPQA 4JWXA 5CRYA 3S2VA 4F18A 3K6VA 2ZNSA 5FHOA 4E0XA 1NFTA 1Y9UA 4R6HA 3H03A 3MPKA 4QHQA 4MBPA 5H8FB 4BLAA 2V25A 3IJXB 3SESA 3TZAA 1MG1A 3A3UA 4OESA 3LUYA 3THIA 3EHSA 2XX8A 4FEBA 3QSLA 2UVHA 3O2AA 3FIRA 3TFLA 3N6TA 1B1HA 2FYIA 2QSXA 3H7MA 1JVXA 4F2OA 2F36A 2WKYA 3JZJA 4RK9A 1Y3NA 4I9DA 2AIXA 4G8HA 1MY2A 2QS3A 1NMUA 2GHBA 5I2KB 3B7DA 5I57B 4G8NA 3O9PA 5AA1A 2GHAA 3I5OA 2THIA 2O7IA 3VFJA 2ZNTA 3SETA 1M5EA 1HSJA 3N26A 4NTLA 4GWOA 1SVXB 3N5LA 1UTBB 4Z0IA 4EUOA 2UYFA 3RNNA 1ZTYA 5ISUA 4NF8B 4UA8A 3HV1A 4P0IA 5CBRA 5CM6A 1OVTA 2XXQA 3CG3A 1SD3A 1B5JA 3RTFB 2YLNA 4FORA 1VFDA 5JEIA 1S7YA 4PETA 4F22A 3O6GA 4NMYA 3UK4A 3KZGA 3MZ9A 3FJGA 4F29A 1NKXA 3FASA 2OLBA 5EYFA 5L9OA 4ZEIA 5F1QA 2HFBA 3JV9A 2DE3A 1DTZA 3PUXE 1NNPA 4KPTA 3MBPA 1MXZA 1PBPA 3RQTA 2DP8A 1EU8A 1B46A 3M3LA 1WDNA 3GBBA 2DWAA 4O3AA 4DLDA 1Q1KA 2D21A 2H9BA 2QMWA 4HS7A 1LFGA 4OENA 1EZPA 2NUVA 1P1OA 3VLVA 5ITPA 2DS9A 1XC1A 3H06B 2VP1A 2F7CA 4KYDA 2F97A 4XKPA 3G3GA 3I6VA 3RPWA 4FAJA 3I3VA 2PT2A 1LSTA 1B3EA 4HTGA 1JW1A 3FATA 3DP8A 2Y84A 5H8HA 3HSTA 3DP4A 1M5CA 2D3IA 3TUSA 3IK6B 5AA2B 1NNFA 1QUIA 2UVJA 5I58B 1GTKA 4QFNA 3OEMA 5IAIA 4G77A 5I2NB 1D9VA 4YKPA 1AOVA 3V89B 5DVJA 3PUWE 2I3VA 1UTHA 2XXHA 4AB5A 1Z7NE 1DTGA 3EQ1A 1B0LA 1FTOA 4DXBA 4C0RA 5I2KA 3Q28A 4RNSA 2IEEA 1SW4A 4FJPA 2I3WA 1QW0A 1IXCA 3CFLA 1WVJA 2VD2A 4OFJA 4OFOA 3BBRA 1II5A 1YPNA 3PPOA 3JYRA 4DCXA 4LONB 3OENA 1A7LA 1SI0A 3Q27A 3KJ7A 3MAMA 2ZXTA 4R6KA 3BKIB 3K1PA 1PDAA 3OOAA 3CIJA 1PB9A 4U4XA 1DPEA 5CI5A 4QSEA 1SYIA 3OO9A 4F2QA 3SEXA 1AIVA 2Y7WA 3ILTB 3U94A 3GBAA 1XT8A 3TDJA 2OWTA 4QF9A 4GVOA 1Q35A 4JXIA 4GFRA 3C9HA 1MS7A 3L6HA 3FJ7A 4FATA 3S4UA 4Z7EA 3M3KA 2RCBA 2I4BA 2D5WA 3PPNA 1MXWA 5TPAA 2ZYKA 2RCAA 1MPCA 3MVWA 1BTJA 4FE8A 4C1UA 4F3BA 4EXLA 3OXNA 4OZ9A 1H3DA 1IXHA 3MZBA 2OCUA 2B3BA 1B58A 3T96B 1ZLQA 1MY4A 2W7YA 3VXBA 1Y1MA 3VXCA 2IA4A 2Z22A 4NEDA 3CR9A 3TPAA 2XXXA 1CB6A 2O6AA 4G68A 1UIUA 2G93A 3R6UA 3MP8A 2O51A 1EH3A 2I58A 2HZLA 4N13A 4H5GA 4HCYA 2RC7A 3SDFA 1B3FA 5JTYA 2HZKA 4KCCA 4R75A 3EF7A 4ZEBA 1D9YA 4MLVA 4RPOA 2QMXA 4H8IA 1PBQA 2Z8EA 3UIFA 5H8SA 5I84A 2VD3A 4H0WA 4H6DA 1R9LA 3OO8A 3P7IA 3G7WA 3LR1A 1MH3A 3LSWA 3FZVA 1FQDA 1LBCA 3FVOA 3K1NA 4LZ8A 3F11A 4PQJA 1USYE 2ZMBA 1B52A 4F3PA 4QRZA 2PBWA 3E9XA 1QVSA 1ZU0A 1O63A 3LSXA 1BLFA 2O1LA 4DCYA 3B6QA 1T0KA 1EZ9A 5M2VA 1GGGA 4LUBA 3EHUA 5IKBA 3C33A 1AL3A 1MQDA 2OZZA 4JB7A 1DPPA 4G8MA 5KCJB 1TFDA 1B7HA 1IQ7A 1TXFA 3D4GA 1Y1ZA 1B9JA 5DTBA 1A99A 5KZTA 3IL1B 2H98A 3RY3A 3VLUA 3TODA 4F1UA 4ELQA 4JWOA 3Q26A 1JNFA 1N04A 4IB2A 2YJPA 4Q0CA 1FCKA 2XXWA 4OMBA 3VVEA 1FQBA 1R9QA 3VVFA 3K6WA 1VSOA 4RJZA 4F1VA 5CMKA 1O7TA 3R7XA 3SERA 4GIZA 3PGFA 3D4CA 1JQFA 5AA4A 5B7DA 5KDTA 3OEKA 1XVYA 3HN0A 3MVYA 5FHMA 1N3WA 3TYHA 1J1NA 4KCDA 4OWDA 4K3FA 4JSOA 4YKJA 4AQ4A 4YMBA 1CE2A 4NF6A 3IB1A 2OBGA 4ZECA 1I6AA 2H4IA 1B6HA 2I0BA 3K6XA 5F7VA 1XHYA 2VHAA 4Q8RA 3LC8A 4BDOA 5H8HB 1Y3PA 4HW8A 3LSLA 4X1DA 1O64A 1B4HA 2P0SA 4P11A 2ONKE 1US5A 1JEVA 4ND9A 3IJOB 4G4PA 5EHSA 1ANFA 4IO7A 4ZE9A 1US4A 3PPQA 3FUZA 3IX1A 4JWYA 1UTHB 2B65A 4NF5A 2Y7RA 3KN8A 4PFWA 1HSLA 3T9HB 1PEBA 2PYYA 3RT8A 4R72A 4OEUA 4WEPA 2CMOA 1F9BA 3KFMA 2FA7A 2I0CA 5HM4B 3MP1A 3K02A 2I49A 4YAHX 2DE4A 1LAXA 4ZZAA 4BDMA 4RPNA 1N76A 3ZKKA 1QULA 4AB6A 1ZMGA 1LFHA 4JSDA 1XVXA 1B4ZA 5DYHA 1OLCA 3KN3A 3G3FA 3PUZE 3K4UA 3PUVE 3G3IA 4OQOA 2XXIA 4YB7A 3T22A 3FXRA 3PPRA 3H6TA 4ELOA 2O7UA 5KCJA 2LAOA 4R2BA 4FEDA 3EN3A 2ZYOA 3VDFA 1A8FA 3IB2A 2RKMA 1HSEA 2XXVA 3VV5A 3N6UA 3PU5A 4I62A 2ZYMA 4M4GA 2FNCA 3QAXA 1LLSA 2ONSA 4NWCA 4H67A 3TTRA 3ODBA 5AA3A 5TPAB 1FTJA 3TCFA 2BJJX 1VR5A 3TTNA 3TAJA 2F35A 3UORA 4UACA 2Y7PA 4QSCA 2XXTA 2REJA 4RY1A 3IAZA 2RINA 3E13X 5I56A 2Q2CA 1FQAA 3QYTA 4GD5A 4U22A 3OO6A 2O68A 3GXAA 3U72A 5CMMA 1MXUA 4G68B 1IZ1A 3SEYA 3VE1B 1B3LA 3FVNA 5H8NA 4ZS9A 5DEXA 4RK2A 4RA1A 1QUJA 4IY5A 5JTYB 4OHNA 5ICTA 1FQCA 4OVJA 3HCQA 4XXUA 5FTHA 3K1MA 2GRVA 2R9JA 4WKMA 4KHZE 3OSQA 2NWJA 1MDQA 3T9XB 4LATA 2XHDA 3GLBA 3W15C 3SEWA 3OD7A 2PX1A 4I8CA 3TCHA 4KR5A 3E4RA 2A5SA 4C1TA 1NNTA 3TTKA 5CMCA 4YKKA 4XTCQ 1LB9A 2OK2A 4GQOA 3O66A 4G2ZA 2F6PA 3O28A 5DVFA 5CBSA 1LB8A 1B7UA 4JDFA 2PMSA 5HPQA 4FIMA 2DVZA 3KEIA 1H45A 4YKIA 3O6IA 1B3GA 4QFOA 4X9TA 1NH7A 1B5HA 1FW0A 3B6WA 2Q88A 1MH4A 3RUMA 3U1OA 5FTIA 3Q29A 3E3KA 3RN8A 2AL5A 3CVGA 4U2RA 3TELA 5B70A 3TMGA 1ZKBA 2XXRA 1Y3QA 4YICA 3SKPA 4TLMB 1A54A 3C4MA 4MFIA 3MUQA 1B5IA 5FHNA 3MP6A 3U92A 1XOCA 4YB5A 1URDA 1N7WA 4H65A 4O3CA 1POTA 1DSNA 1I6QA 5AA4B 5KDTB 1FTMA 2UVGA 1D4NA 4Q5TA 4WEDA 3PMVA 2XX9A 1P1WA 3FV2A 1GVCA 4TQUQ 3IO4A 2DXYA 1VFEA 3A3CA 1B1XA 4NF6B 4X48A 3TTMA 1MXXA 2I48A 2KLFA 3K2DA 5JK4A 4R6YA 4P0GA 5I59A 4GXAA 3MZ1A 5A5XA 3MJNA 5H8QA 1OQGA 1FQEA 4H8JA 1URSA 1XS5A 3HO7A 1MXYA 1P1NA 4GF8A 2ONRA 1B3HA 3G3JA 2A5TA 1MY0A 2UXAA 2XXPA 4ELRA 2ALUA 3ONMA 2V3UA 4U23A 4NF5B
chains in the Genus database with same CATH superfamily
2ZZXA 1FPIA 2HEUA 1IUDA 3O6HA 4TOZA 2OX3A 3RTWB 4GXSB 3B6TA 3T93B 1FTKA 3EKIA 1QKAA 4MNIA 1EZOA 5IM2A 3ZSFA 3R26A 4R2FA 1MM6A 1LFIA 4IR8A 3KSJA 3CSBA 3H6VA 3FD3A 3W9VA 1MQJA 1YTVA 1MPDA 2JJKA 2XX7A 1SBPA 1B40A 2E1SA 4Q30B 3FV1A 4L17A 1B05A 4U1ZA 2RC9A 4PFTA 1FRPA 3GZGA 2F5XA 2WYPA 1TFAA 3CG1A 4DDDA 3T9VA 2H99A 2Q74A 3V83A 1NNKA 4KYSA 2V93A 3MSTA 1OIBA 1SQYA 4IO3A 5BUUA 4RYAA 2X26A 4LZ7A 4LP2B 5CMBA 1I6BA 3ILUB 3C36A 2XXYA 1H44A 3WAFA 4XKQA 4DZ1A 1TWYA 3TQLA 4NF4A 4GWWA 2X7PA 3IFCA 2Z8FA 3ZKLA 2M8CA 5J1DA 5L9MA 4NG7A 1YXIA 4GOTA 2HQ0A 1FBDA 1JEUA 1H76A 1ZJLA 5IZZA 4PP0A 5I56B 2E0SA 3RPLA 3U8QA 3CRBA 4G68C 2I6EA 4IO4A 1B32A 1MY3A 1MRPA 1M5FA 3H6UA 1IMFA 4OERA 3BFUA 2Q8JA 5DVIA 1ATGA 2ESNA 4I40A 1R6ZA 3PV0E 5H8NB 5DEXB 2XD3A 4DIGA 4ECFA 2O1MA 1FBEA 1D3KA 5ET6A 2H5YA 3UP9A 3TKDA 3PD9A 3USDA 1TT1A 3MVXA 2QVUA 3T0JA 4N6KA 3U65A 4H1XA 2R71A 4ESWA 4QFPA 3PD8A 2QRYA 4FECA 4EQ7A 1LBBA 2P3VA 1KWHA 1IITA 4KI0E 4F31B 4GWUA 4ZEFA 1K9YA 3CI8A 2P1SA 4MF3A 2QS2A 1MPBA 4F3SA 4GX4A 4DE8A 1QKBA 2OJTA 5TU0A 4OXVA 1JW5A 4KYEA 1UQWA 4PFBA 1B51A 2DWHA 2F7BA 3KN7A 2PVUA 5IZ3A 4PBQA 3SEUA 4R9FA 3QMFA 4XFEA 3FVKA 4NWDA 1URGA 1QUKA 1LAGE 1OVBA 2PT1A 1PB7A 4GRKA 2Q8MA 4N8GA 1AWBA 4LZ5A 3FGSA 4HE2A 3T9UA 4ONYA 1KZ8A 3M3FA 2VGQA 1ZBMA 4IGTA 3QUFA 1A55A 3MPLA 4GBVA 4EQBA 1NL5A 3V8XB 2ZYNA 4OTEA 3RYDA 4R9GA 5AE4A 2I4CA 3PUYE 3KOSA 4KD5A 1N0TA 1FPFA 1YCJA 4P1EA 4IO6A 3H6WA 3TCGA 3LBSA 1S9TA 3PPPA 4JBZA 2DE2A 1IXIA 4PFYA 4OFLA 1Y4TA 4NQ8A 4POWA 1MDP1 1FQFA 4X1BA 2G29A 1B0HA 3LUZA 2DOJA 3EPEA 3KBRA 5ITOA 3FXQA 3LV0A 1WODA 3AXFA 4YMAA 2XD2A 1IMAA 5TP9A 1FPEA 3MC2A 3FXUA 3K01A 3QIMA 4U4SA 2QL3A 4EF1A 1RYXA 3TTLA 1FTLA 2F7AA 3IO6A 2FIXA 4GWXA 3RLFE 2V84A 1PC3A 2HXWA 4N15A 1YAEA 3S9NC 5I59B 1BIYA 1OLAA 2FHYA 4N07A 2XWVA 2DQVA 2QJEA 2AL4A 4G61A 1P99A 4GX3A 1UIVA 3IOUA 3VLWA 3G3HA 5A5XB 5EQ7A 4H5FA 2NVUB 1SW1A 2Q9TA 1Q9DA 2XXUA 1R1NA 1SW5A 4XEQA 4THIA 5H8QB 4M1VA 3HHGA 4YB6A 3A09A 1QJMA 5DT6A 1A40A 5H8FA 2A5TB 2V3QA 2WBBA 4GL0A 1DCUA 1LAFE 4DXUA 4NHBA 3MWBA 4POXA 1FPKA 3UA8A 3RT6B 2CZLA 4EXKA 1ELJA 2REGA 4KQPA 1RDYA 3DELB 3TQWA 3S9MC 4BDQA 2B3FA 4IO5A 1ZIUA 4X8RA 1DBZA 5LTCA 2UYEA 3N94A 4QXDA 4BDNA 4DXCA 3IORA 5ICQA 5CC2A 3S9EA 1MXVA 3Q25A 5ELVA 2DDKA 3K6UA 3IOTA 1OQHA 1JW4A 4XKRA 1Y4CA 5AA2D 1AMFA 1Y20A 4ZDMA 5HBCA 5K2XA 1PB8A 2DSFA 2DXRA 5I57A 3IR1A 1AH5A 4QFKA 1KA1A 1B2HA 1LBXA 1M5BA 4PF6A 2ZNUA 3HHFA 5EHMA 1CNQA 4YU0A 1UTBA 4GL8A 5BWJA 2YPNA 3OSRA 1RKMA 4O3BA 4EF2A 1BP5A 4NF8A 4NGUA 3H3GA 3CSGA 1DOTA 4ZZEA 1JETA 1RDZA 5F24A 3U93A 1SDXA 1B7ZA 4ESXA 4NE4A 1H43A 3FVGA 4LQ2A 5L8DA 1G0HA 2Z8DA 2ANJA 4F1YA 3CFXA 4R74A 1NH8A 4GLIA 4NF4B 3FJMA 3BFTA 3LSFB 1LCTA 2F3DA 3C35A 1P1UA 1M5DA 1FBHA 2Q89A 4PGNA 3HPIA 1IXGA 4GWSA 4GWYA 3RPLB 3FBPA 3K00A 1MY1A 1N3XA 1GV8A 2GH9A 2X7QA 4QBAA 3ROJA 2H25A 1LGBC 2QVRA 4IO2A 4LVQA 3DM0A 4HCWA 2QS4A 3PMWA 3C32A 4RXLA 3MVZA 1RYOA 3UN6A 5I3SA 2DWIA 4XKNA 1N84A 3IFAA 3OO7A 4MH5A 4F3GA 1IIWA 1FPGA 1A8EA 3IOVA 4IY6A 4OETA 4EQ9A 4ELPA 2HCAA 4F39A 5L9SA 3CFZA 3C34A 1VDWA 4N6PA 4QSDA 4JVIA 3DLNA 1L5TA 1GR2A 4OEVA 2ABHA 2RC8A 1BKAA 3S9LC 4ZEDA 1MQIA 3OMBA 3KJTA 3SEVA 1VE4A 1NV7A 3ECRA 5IGAA 1SW2A 2F6GA 2Y7KA 2UVIA 3IB0A 5IZ3B 1I69A 5AA2A 2Y7IA 3MW0A 2NXOA 5I58A 3T66A 3EHTA 2RF1A 4U21A 3W9WA 3DP6A 2OWSA 5I2NA 4BDLA 3IOWA 3L6GA 3MQ9A 3RGYA 1SI1A 2XWIA 1YZ0A 3KOTA 2WBDA 2DVCA 3QK6A 4LA9A 4QFLA 1USYH 3G3KA 4XIGQ 2V3TA 1IMCA 2QS1A 3KC1A 1IEJA 2F8DA 2V4CA 4P9KA 3WAEA 1LAHE 1N7XA 4F19A 2O69A 3OELA 2HAUA 3O97A 2DWJA 1S50A 4LN5A 4WXJA 4BDRA 2AYSA 2F78A 3C31A 2DYXA 2R6GE 2GFEA 4ZEKA 1SYHA 4OYVA 4HXVA 1MM7A 2VOZA 1IMBA 2Z23A 1Z7ME 3O29A 1OMPA 1MQHA 2HAVA 5T3JA 3V5AA 2WYKA 4R73A 3M8UA 4ZE8A 5K2YA 1JVYA 4MLQA 2NOOA 1LCFA 3QXMA 4KFQA 2Q2AA 4TLLB 3KGCA 5TP9B 1MQGA 4LQ5A 2F34A 3TEPA 1NV4A 4PFUA 4H46A 3VVDA 2P2AA 4YZZA 3QUJA 1POY1 3K0VA 4U1OA 4ISUA 2O84X 4N8YA 1NUYA 3KSXA 1DMBA 3ZS6A 4I1DA 3SZPA 1P1QA 4EDPA 3H4ZA 3KG2A 1FJ9A 1FSAA 3UGWA 4PE5B 4E0WA 5LOMA 3E79A 3PMXA 4IGRA 4MEVA 2QPQA 4JWXA 5CRYA 3S2VA 4F18A 3K6VA 2ZNSA 5FHOA 4E0XA 5FBPA 1NFTA 1Y9UA 4P56A 4R6HA 4MMPA 4NAPA 3H03A 3MPKA 4PDDA 4QHQA 4MBPA 5H8FB 4BLAA 4P8BA 2V25A 1FPJA 3IJXB 3SESA 3TZAA 1MG1A 3A3UA 1FPLA 4OESA 3LUYA 4OVQA 3THIA 2CZIA 3EHSA 2XX8A 4FEBA 3QSLA 2UVHA 4JVDA 3O2AA 1LBZA 3FIRA 3N6TA 3TFLA 1B1HA 2FYIA 2QSXA 3H7MA 4RK9A 1JVXA 2F36A 2WKYA 3JZJA 4F2OA 1Y3NA 4I9DA 2AIXA 4NX1A 4G8HA 1MY2A 2QVVA 2QS3A 1NMUA 4HE1A 2GHBA 4DI3D 5I2KB 3B7DA 5I57B 4G8NA 3O9PA 5AA1A 2WX9A 2GHAA 3I5OA 2THIA 2O7IA 2VPOA 3VFJA 2ZNTA 3SETA 1M5EA 1HSJA 3N26A 4NTLA 4GWOA 1SVXB 3N5LA 1UTBB 4Z0IA 4MAGA 4EUOA 2UYFA 2BJIA 3RNNA 1ZTYA 5ISUA 4NF8B 4UA8A 3HV1A 4N91A 4P0IA 5CBRA 5CM6A 1OVTA 2XXQA 3CG3A 1SD3A 1B5JA 3RTFB 2YLNA 4FORA 2PFYA 1G0IA 1VFDA 5JEIA 1S7YA 4N4UA 4PETA 4F22A 3O6GA 4NMYA 3UK4A 3KZGA 3MZ9A 3FJGA 1NKXA 4F29A 3FASA 2OLBA 5EYFA 4MCOA 5L9OA 4ZEIA 4PFRA 5F1QA 2HFBA 3JV9A 2DE3A 1DTZA 3PUXE 1NNPA 4KPTA 3MBPA 1MXZA 1PBPA 3RQTA 2DP8A 1EU8A 1B46A 3M3LA 1WDNA 3GBBA 2DWAA 1KA0A 4O3AA 4DLDA 1Q1KA 2D21A 2H9BA 2QMWA 3NOHA 4HS7A 4I3EA 1LFGA 1NV6A 4OENA 1EZPA 2CZHA 2NUVA 3T1BA 1DK4A 2F3BA 1P1OA 3VLVA 5ITPA 2DS9A 1XC1A 2B4MA 3H06B 2VP1A 2F7CA 4KYDA 2F97A 4XKPA 3G3GA 3I6VA 3RPWA 4OA4A 4FAJA 3I3VA 2PT2A 1LSTA 1B3EA 4HTGA 1NUXA 1JW1A 3FATA 3DP8A 2Y84A 5H8HA 3HSTA 3DP4A 1M5CA 2D3IA 3TUSA 3IK6B 5AA2B 2FIEA 4N6DA 1FJ6A 1NNFA 1QUIA 2UVJA 5I58B 1GTKA 4QFNA 3OEMA 2P3NA 3GYYA 5IAIA 4G77A 5I2NB 1D9VA 4YKPA 1AOVA 1IMDA 3V89B 5DVJA 3PUWE 2I3VA 1UTHA 2XXHA 4AB5A 1Z7NE 1IMEA 1DTGA 3EQ1A 1B0LA 2XWKA 5ET8A 1FTOA 4DXBA 4C0RA 5I2KA 3Q28A 4RNSA 4I3YA 2IEEA 1SW4A 2FVZA 4FJPA 2I3WA 1QW0A 1IXCA 3CFLA 1WVJA 2VD2A 4OFJA 4OFOA 3BBRA 1II5A 1YPNA 3PPOA 3JYRA 4DCXA 4LONB 3OENA 1A7LA 1SI0A 4P3LA 3Q27A 3KJ7A 2XXKA 3KC0A 3MAMA 2ZXTA 4R6KA 3BKIB 3K1PA 1PDAA 3OOAA 3CIJA 1PB9A 4U4XA 1DPEA 5CI5A 4QSEA 1SYIA 3OO9A 4F2QA 2L5VA 3SEXA 1AIVA 2Y7WA 3ILTB 3U94A 3GBAA 1XT8A 3TDJA 2OWTA 4OVSA 4QF9A 4GVOA 1Q35A 5LDZA 4JXIA 4GFRA 3C9HA 1MS7A 3L6HA 3FJ7A 4FATA 3S4UA 4Z7EA 1NV1A 3M3KA 2RCBA 2I4BA 4O7MA 2D5WA 3PPNA 1MXWA 1EYKA 5TPAA 2ZYKA 2RCAA 1MPCA 1FBGA 3MVWA 1BTJA 4FE8A 4C1UA 4F3BA 4EXLA 3OXNA 4OZ9A 1H3DA 1IXHA 3MZBA 5EYGA 2OCUA 2B3BA 1B58A 4NN3A 3T96B 1ZLQA 5EQ8A 1MY4A 2W7YA 3VXBA 4MHFA 1Y1MA 3VXCA 2IA4A 2Z22A 4NEDA 3BIGA 3CR9A 3TPAA 2XXXA 1CB6A 4X04A 2O6AA 4G68A 1UIUA 2G93A 3R6UA 3MP8A 2O51A 1EH3A 2I58A 2HZLA 4N13A 4H5GA 4HCYA 2RC7A 3SDFA 1B3FA 5JTYA 1NUWA 5A5LA 2HZKA 4KCCA 4R75A 3EF7A 4ZEBA 1D9YA 4MLVA 4RPOA 2QMXA 4H8IA 1PBQA 2Z8EA 3UIFA 5H8SA 2VT5A 5I84A 2VD3A 4H0WA 4H6DA 3HFUA 1R9LA 3OO8A 3P7IA 3G7WA 4GBWA 3LR1A 1MH3A 3LSWA 3FZVA 1FQDA 1LBCA 3FVOA 4O94A 3K1NA 4LZ8A 3F11A 4PQJA 1USYE 4PC9A 2ZMBA 1B52A 3PTYA 4F3PA 4QRZA 2PBWA 3E9XA 1QVSA 2PCRA 1ZU0A 2ZZVA 1O63A 3LSXA 1BLFA 1RDXA 2O1LA 4DCYA 3B6QA 1T0KA 1EZ9A 5M2VA 1GGGA 4LUBA 3EHUA 4PF8A 1FBFA 5IKBA 3C33A 1FTAA 1AL3A 1MQDA 2OZZA 1K9ZA 4JB7A 4GX6A 1DPPA 4G8MA 5KCJB 1TFDA 1B7HA 1IQ7A 1TXFA 3D4GA 1Y1ZA 1B9JA 5DTBA 1A99A 2FBPA 5KZTA 2MKZA 3IL1B 2H98A 3RY3A 3VLUA 3TODA 4F1UA 4ELQA 4JWOA 3Q26A 1YYZA 1JNFA 1N04A 4IB2A 2YJPA 4Q0CA 1FCKA 2XXWA 3E78A 4PDHA 4OMBA 3VVEA 1FQBA 1R9QA 3VVFA 3D1RA 3K6WA 1VSOA 4H45A 2CEXA 4RJZA 2HXRA 4F1VA 5CMKA 1NV3A 1NUZA 1O7TA 3R7XA 2Y5LA 3SERA 4GIZA 4UABA 3PGFA 4MJOA 3D4CA 1JQFA 5AA4A 5B7DA 5KDTA 3OEKA 5ESYA 1XVYA 3HN0A 3MVYA 4PBHA 5FHMA 1N3WA 3TYHA 1J1NA 3FXBA 4KCDA 4OWDA 2R8TA 4N81A 1NV0A 4K3FA 4JSOA 4YKJA 4AQ4A 4YMBA 1CE2A 4NF6A 2B4LA 3IB1A 2OBGA 4ZECA 1I6AA 2H4IA 4KXPA 3B8BA 1B6HA 2I0BA 3K6XA 5F7VA 1XHYA 2VHAA 4Q8RA 3LC8A 2OWZA 4BDOA 5H8HB 2Y5KA 4OANA 1Y3PA 4HW8A 3LSLA 4X1DA 1O64A 1B4HA 2P0SA 4PAIA 4P11A 2ONKE 1US5A 1JEVA 4ND9A 4P1LA 3IJOB 2KR0A 4G4PA 5EHSA 1ANFA 4IO7A 4ZE9A 1US4A 3PPQA 4HE0A 3FUZA 3IX1A 4JWYA 1UTHB 2B65A 4OVRA 4NF5A 2Y7RA 3KN8A 4PFWA 1HSLA 3B50A 3T9HB 1PEBA 2PYYA 3RT8A 2XA5A 4R72A 5ET5A 4OEUA 4WEPA 2CMOA 1NV5A 1F9BA 2HPGA 3KFMA 5EQ9A 5I7IA 2FA7A 2I0CA 4MNPA 3MP1A 5HM4B 3K02A 2I49A 4YAHX 2DE4A 1LAXA 4ZZAA 1EYIA 4BDMA 4RPNA 1N76A 3ZKKA 1QULA 4AB6A 1ZMGA 1LFHA 4JSDA 1XVXA 4PCDA 1B4ZA 1D9QA 3CHGA 5DYHA 1OLCA 3KN3A 2CZKA 3G3FA 3PUZE 4MIJA 3K4UA 4MX6A 3PUVE 3G3IA 1NV2A 4OQOA 2XXIA 4YB7A 3T22A 2VPNA 3FXRA 3PPRA 3H6TA 4JVCA 4ELOA 1INPA 2O7UA 2WEFA 5KCJA 3A29A 2LAOA 4R2BA 3ISPA 4FEDA 3EN3A 2ZYOA 3VDFA 1A8FA 3IB2A 2RKMA 1HSEA 2XXVA 3VV5A 3N6UA 3PU5A 4I62A 2ZYMA 4M4GA 1XI6A 4O7IA 2FNCA 3QAXA 1LLSA 2ONSA 4NWCA 4H67A 3TTRA 3ODBA 5AA3A 5TPAB 1FTJA 3TCFA 2BJJX 1VR5A 3TTNA 5ET7A 4XF5A 3TAJA 2F35A 2XWOA 3UORA 4UACA 2Y7PA 4QSCA 2XXTA 2REJA 4RY1A 3IAZA 2RINA 3BIHA 3E13X 5I56A 2Q2CA 1FQAA 3QYTA 4GD5A 4U22A 3OO6A 2O68A 3GXAA 3U72A 5CMMA 1LEVA 1MXUA 4G68B 4PE3A 1IZ1A 4N17A 3SEYA 1B3LA 3FVNA 3VE1B 5H8NA 4ZS9A 4PFIA 5DEXA 4RK2A 4RA1A 1QUJA 4FBPA 4IY5A 5JTYB 4OHNA 4AS5A 1FQCA 5ICTA 5I5PA 1NI9A 3MYUA 4OVJA 3HCQA 4XXUA 5FTHA 3K1MA 2GRVA 1LBYA 2R9JA 4WKMA 4PAFA 4KHZE 3OSQA 2NWJA 1MDQA 4PAKA 3T9XB 4LATA 5DW8A 1EYJA 2XHDA 3GLBA 3W15C 3SEWA 3OD7A 2PX1A 4I8CA 4DI4B 3TCHA 4KR5A 5IZ1A 3E4RA 5J16A 2A5SA 4C1TA 1NNTA 3TTKA 5CMCA 4YKKA 4XTCQ 1LB9A 2OK2A 4GQOA 3O66A 4G2ZA 2F6PA 3O28A 2KQZA 5DVFA 5CBSA 1LB8A 1B7UA 4JDFA 2PMSA 5HPQA 4AS4A 1SPIA 4FIMA 1FPBA 2DVZA 3KEIA 1H45A 4YKIA 3O6IA 4OVTA 1BK4A 1B3GA 4QFOA 4X9TA 1NH7A 1B5HA 1FW0A 1JP4A 3B6WA 4P47A 2Q88A 1MH4A 3RUMA 4MNCA 3U1OA 5FTIA 3Q29A 3E3KA 3RN8A 2AL5A 3CVGA 4U2RA 3TELA 5B70A 2QFLA 3TMGA 5EYHA 1ZKBA 4GWZA 2XXRA 4OVPA 1LBVA 1Y3QA 4YICA 3SKPA 4TLMB 1A54A 2PFZA 3C4MA 4MFIA 3MUQA 2CEYA 1B5IA 5FHNA 3MP6A 3U92A 1QGXA 1XOCA 4YB5A 1URDA 1N7WA 4H65A 4O3CA 1POTA 1DSNA 1I6QA 5AA4B 5KDTB 1FTMA 2UVGA 1D4NA 4Q5TA 4WEDA 3PMVA 2XX9A 1P1WA 4O8MA 3FV2A 1GVCA 4TQUQ 3IO4A 2ZZWA 4PGPA 2DXYA 1VFEA 3KBZA 3A3CA 1B1XA 4NF6B 1FPDA 4X48A 3TTMA 1MXXA 2I48A 2KLFA 3K2DA 5JK4A 4R6YA 4P0GA 5I59A 2GQ1A 4GXAA 3MZ1A 5A5XA 4PTKA 3MJNA 5H8QA 1OQGA 1FQEA 4H8JA 1URSA 1FBCA 1XS5A 4NF0A 2HHMA 1FBPA 3HO7A 5EQAA 1MXYA 1P1NA 1LBWA 4GF8A 2ONRA 1B3HA 3G3JA 2A5TA 1MY0A 2UXAA 2XXPA 4ELRA 2ALUA 3ONMA 2V3UA 4U23A 4NF5B
chains in the Genus database with same CATH topology
2HEUA 1IUDA 3O6HA 4TOZA 3RTWB 4GXSB 3B6TA 3T93B 1FTKA 1QKAA 1EZOA 3ZSFA 3R26A 4R2FA 1MM6A 1LFIA 3KSJA 3CSBA 3H6VA 3FD3A 3W9VA 1MQJA 1YTVA 1MPDA 2XX7A 1SBPA 1B40A 2E1SA 4Q30B 3FV1A 4L17A 1B05A 4U1ZA 2RC9A 4PFTA 3GZGA 2F5XA 1TFAA 3CG1A 4DDDA 3T9VA 2H99A 3V83A 1NNKA 4KYSA 2V93A 1OIBA 1SQYA 4IO3A 5BUUA 4RYAA 2X26A 4LZ7A 4LP2B 5CMBA 1I6BA 3ILUB 3C36A 2XXYA 1H44A 3WAFA 4XKQA 4DZ1A 1TWYA 3TQLA 4NF4A 2X7PA 2Z8FA 3ZKLA 2M8CA 5J1DA 5L9MA 4GOTA 2HQ0A 1JEUA 1H76A 1ZJLA 4PP0A 5I56B 2E0SA 3U8QA 3CRBA 4G68C 2I6EA 4IO4A 1B32A 1MY3A 1MRPA 1M5FA 3H6UA 4OERA 3BFUA 2Q8JA 5DVIA 1ATGA 2ESNA 1R6ZA 3PV0E 5H8NB 5DEXB 2XD3A 4DIGA 4ECFA 2O1MA 1D3KA 2H5YA 3UP9A 3TKDA 3PD9A 3USDA 1TT1A 3MVXA 4H1XA 2R71A 4ESWA 4QFPA 3PD8A 2QRYA 4FECA 4EQ7A 1LBBA 1KWHA 1IITA 4KI0E 4F31B 4ZEFA 3CI8A 2P1SA 4MF3A 2QS2A 1MPBA 4F3SA 4DE8A 1QKBA 2OJTA 5TU0A 4OXVA 1JW5A 4KYEA 1UQWA 1B51A 2DWHA 2F7BA 3KN7A 2PVUA 3SEUA 4R9FA 3FVKA 4NWDA 1URGA 1QUKA 1LAGE 1OVBA 2PT1A 1PB7A 4GRKA 4LZ5A 3FGSA 3T9UA 4ONYA 3M3FA 2VGQA 1ZBMA 4IGTA 3QUFA 1A55A 3MPLA 4EQBA 1NL5A 3V8XB 2ZYNA 4OTEA 4R9GA 5AE4A 2I4CA 3PUYE 3KOSA 4KD5A 1N0TA 1YCJA 4IO6A 3H6WA 3TCGA 3LBSA 1S9TA 3PPPA 4JBZA 2DE2A 1IXIA 4PFYA 4OFLA 1Y4TA 4POWA 1MDP1 1FQFA 4X1BA 2G29A 1B0HA 2DOJA 3EPEA 3KBRA 5ITOA 3FXQA 1WODA 3AXFA 4YMAA 2XD2A 5TP9A 3MC2A 3FXUA 3K01A 3QIMA 4U4SA 2QL3A 4EF1A 1RYXA 3TTLA 1FTLA 2F7AA 3IO6A 3RLFE 2V84A 1PC3A 2HXWA 1YAEA 3S9NC 5I59B 1BIYA 1OLAA 4N07A 2DQVA 2QJEA 2AL4A 1P99A 1UIVA 3IOUA 3VLWA 3G3HA 5A5XB 4H5FA 2NVUB 1SW1A 2Q9TA 2XXUA 1R1NA 1SW5A 5H8QB 4THIA 4M1VA 3HHGA 4YB6A 3A09A 1QJMA 5DT6A 1A40A 5H8FA 2A5TB 2V3QA 4GL0A 1LAFE 4DXUA 3MWBA 4POXA 3UA8A 3RT6B 2CZLA 4EXKA 1ELJA 2REGA 4KQPA 3DELB 3TQWA 3S9MC 4BDQA 2B3FA 4IO5A 1ZIUA 2UYEA 3N94A 4BDNA 4DXCA 3IORA 5ICQA 5CC2A 3S9EA 1MXVA 3Q25A 5ELVA 3K6UA 3IOTA 1OQHA 1JW4A 4XKRA 1Y4CA 5AA2D 1AMFA 1Y20A 4ZDMA 5HBCA 5K2XA 1PB8A 2DSFA 2DXRA 5I57A 3IR1A 1AH5A 4QFKA 1B2HA 1M5BA 2ZNUA 3HHFA 5EHMA 4YU0A 1UTBA 4GL8A 5BWJA 2YPNA 3OSRA 1RKMA 4O3BA 4EF2A 1BP5A 4NF8A 3H3GA 3CSGA 1DOTA 4ZZEA 1JETA 3U93A 1SDXA 1B7ZA 4ESXA 4NE4A 1H43A 3FVGA 4LQ2A 5L8DA 2Z8DA 2ANJA 4F1YA 3CFXA 4R74A 1NH8A 4GLIA 4NF4B 3FJMA 3BFTA 3LSFB 1LCTA 3C35A 1P1UA 1M5DA 2Q89A 3HPIA 1IXGA 3K00A 1MY1A 1N3XA 1GV8A 2GH9A 2X7QA 2H25A 1LGBC 4IO2A 4LVQA 3DM0A 4HCWA 2QS4A 3PMWA 3C32A 4RXLA 3MVZA 1RYOA 3UN6A 2DWIA 4XKNA 1N84A 3OO7A 4MH5A 4F3GA 1IIWA 3IOVA 1A8EA 4IY6A 4OETA 4EQ9A 4ELPA 2HCAA 4F39A 5L9SA 3CFZA 3C34A 4N6PA 4QSDA 3DLNA 1L5TA 1GR2A 4OEVA 2ABHA 2RC8A 1BKAA 3S9LC 4ZEDA 1MQIA 3OMBA 3KJTA 3SEVA 1VE4A 3ECRA 1SW2A 2F6GA 2Y7KA 2UVIA 3IB0A 1I69A 5AA2A 2Y7IA 3MW0A 2NXOA 5I58A 3T66A 3EHTA 2RF1A 4U21A 3W9WA 3DP6A 2OWSA 5I2NA 4BDLA 3IOWA 3L6GA 3MQ9A 3RGYA 1SI1A 3KOTA 2DVCA 3QK6A 4LA9A 4QFLA 1USYH 3G3KA 4XIGQ 2V3TA 2QS1A 1IEJA 2F8DA 3WAEA 1LAHE 1N7XA 4F19A 2O69A 3OELA 2HAUA 3O97A 2DWJA 1S50A 4WXJA 4BDRA 2AYSA 2F78A 3C31A 2DYXA 2R6GE 2GFEA 4ZEKA 1SYHA 4OYVA 1MM7A 2VOZA 2Z23A 1Z7ME 3O29A 1OMPA 1MQHA 2HAVA 3V5AA 4R73A 3M8UA 4ZE8A 5K2YA 1JVYA 4MLQA 2NOOA 1LCFA 3QXMA 4KFQA 2Q2AA 4TLLB 3KGCA 5TP9B 1MQGA 4LQ5A 2F34A 3TEPA 4PFUA 3VVDA 2P2AA 4YZZA 3QUJA 1POY1 3K0VA 4U1OA 4ISUA 2O84X 3KSXA 1DMBA 3ZS6A 4I1DA 1P1QA 4EDPA 3H4ZA 3KG2A 3UGWA 4PE5B 4E0WA 5LOMA 3PMXA 4IGRA 2QPQA 4JWXA 5CRYA 3S2VA 4F18A 3K6VA 2ZNSA 5FHOA 4E0XA 1NFTA 1Y9UA 4R6HA 3H03A 3MPKA 4QHQA 4MBPA 5H8FB 4BLAA 2V25A 3IJXB 3SESA 3TZAA 1MG1A 3A3UA 4OESA 3LUYA 3THIA 3EHSA 2XX8A 4FEBA 3QSLA 2UVHA 3O2AA 3FIRA 3TFLA 3N6TA 1B1HA 2FYIA 2QSXA 3H7MA 1JVXA 4F2OA 2F36A 2WKYA 3JZJA 4RK9A 1Y3NA 4I9DA 2AIXA 4G8HA 1MY2A 2QS3A 1NMUA 2GHBA 5I2KB 3B7DA 5I57B 4G8NA 3O9PA 5AA1A 2GHAA 3I5OA 2THIA 2O7IA 3VFJA 2ZNTA 3SETA 1M5EA 1HSJA 3N26A 4NTLA 4GWOA 1SVXB 3N5LA 1UTBB 4Z0IA 4EUOA 2UYFA 3RNNA 1ZTYA 5ISUA 4NF8B 4UA8A 3HV1A 4P0IA 5CBRA 5CM6A 1OVTA 2XXQA 3CG3A 1SD3A 1B5JA 3RTFB 2YLNA 4FORA 1VFDA 5JEIA 1S7YA 4PETA 4F22A 3O6GA 4NMYA 3UK4A 3KZGA 3MZ9A 3FJGA 4F29A 1NKXA 3FASA 2OLBA 5EYFA 5L9OA 4ZEIA 5F1QA 2HFBA 3JV9A 2DE3A 1DTZA 3PUXE 1NNPA 4KPTA 3MBPA 1MXZA 1PBPA 3RQTA 2DP8A 1EU8A 1B46A 3M3LA 1WDNA 3GBBA 2DWAA 4O3AA 4DLDA 1Q1KA 2D21A 2H9BA 2QMWA 4HS7A 1LFGA 4OENA 1EZPA 2NUVA 1P1OA 3VLVA 5ITPA 2DS9A 1XC1A 3H06B 2VP1A 2F7CA 4KYDA 2F97A 4XKPA 3G3GA 3I6VA 3RPWA 4FAJA 3I3VA 2PT2A 1LSTA 1B3EA 4HTGA 1JW1A 3FATA 3DP8A 2Y84A 5H8HA 3HSTA 3DP4A 1M5CA 2D3IA 3TUSA 3IK6B 5AA2B 1NNFA 1QUIA 2UVJA 5I58B 1GTKA 4QFNA 3OEMA 5IAIA 4G77A 5I2NB 1D9VA 4YKPA 1AOVA 3V89B 5DVJA 3PUWE 2I3VA 1UTHA 2XXHA 4AB5A 1Z7NE 1DTGA 3EQ1A 1B0LA 1FTOA 4DXBA 4C0RA 5I2KA 3Q28A 4RNSA 2IEEA 1SW4A 4FJPA 2I3WA 1QW0A 1IXCA 3CFLA 1WVJA 2VD2A 4OFJA 4OFOA 3BBRA 1II5A 1YPNA 3PPOA 3JYRA 4DCXA 4LONB 3OENA 1A7LA 1SI0A 3Q27A 3KJ7A 3MAMA 2ZXTA 4R6KA 3BKIB 3K1PA 1PDAA 3OOAA 3CIJA 1PB9A 4U4XA 1DPEA 5CI5A 4QSEA 1SYIA 3OO9A 4F2QA 3SEXA 1AIVA 2Y7WA 3ILTB 3U94A 3GBAA 1XT8A 3TDJA 2OWTA 4QF9A 4GVOA 1Q35A 4JXIA 4GFRA 3C9HA 1MS7A 3L6HA 3FJ7A 4FATA 3S4UA 4Z7EA 3M3KA 2RCBA 2I4BA 2D5WA 3PPNA 1MXWA 5TPAA 2ZYKA 2RCAA 1MPCA 3MVWA 1BTJA 4FE8A 4C1UA 4F3BA 4EXLA 3OXNA 4OZ9A 1H3DA 1IXHA 3MZBA 2OCUA 2B3BA 1B58A 3T96B 1ZLQA 1MY4A 2W7YA 3VXBA 1Y1MA 3VXCA 2IA4A 2Z22A 4NEDA 3CR9A 3TPAA 2XXXA 1CB6A 2O6AA 4G68A 1UIUA 2G93A 3R6UA 3MP8A 2O51A 1EH3A 2I58A 2HZLA 4N13A 4H5GA 4HCYA 2RC7A 3SDFA 1B3FA 5JTYA 2HZKA 4KCCA 4R75A 3EF7A 4ZEBA 1D9YA 4MLVA 4RPOA 2QMXA 4H8IA 1PBQA 2Z8EA 3UIFA 5H8SA 5I84A 2VD3A 4H0WA 4H6DA 1R9LA 3OO8A 3P7IA 3G7WA 3LR1A 1MH3A 3LSWA 3FZVA 1FQDA 1LBCA 3FVOA 3K1NA 4LZ8A 3F11A 4PQJA 1USYE 2ZMBA 1B52A 4F3PA 4QRZA 2PBWA 3E9XA 1QVSA 1ZU0A 1O63A 3LSXA 1BLFA 2O1LA 4DCYA 3B6QA 1T0KA 1EZ9A 5M2VA 1GGGA 4LUBA 3EHUA 5IKBA 3C33A 1AL3A 1MQDA 2OZZA 4JB7A 1DPPA 4G8MA 5KCJB 1TFDA 1B7HA 1IQ7A 1TXFA 3D4GA 1Y1ZA 1B9JA 5DTBA 1A99A 5KZTA 3IL1B 2H98A 3RY3A 3VLUA 3TODA 4F1UA 4ELQA 4JWOA 3Q26A 1JNFA 1N04A 4IB2A 2YJPA 4Q0CA 1FCKA 2XXWA 4OMBA 3VVEA 1FQBA 1R9QA 3VVFA 3K6WA 1VSOA 4RJZA 4F1VA 5CMKA 1O7TA 3R7XA 3SERA 4GIZA 3PGFA 3D4CA 1JQFA 5AA4A 5B7DA 5KDTA 3OEKA 1XVYA 3HN0A 3MVYA 5FHMA 1N3WA 3TYHA 1J1NA 4KCDA 4OWDA 4K3FA 4JSOA 4YKJA 4AQ4A 4YMBA 1CE2A 4NF6A 3IB1A 2OBGA 4ZECA 1I6AA 2H4IA 1B6HA 2I0BA 3K6XA 5F7VA 1XHYA 2VHAA 4Q8RA 3LC8A 4BDOA 5H8HB 1Y3PA 4HW8A 3LSLA 4X1DA 1O64A 1B4HA 2P0SA 4P11A 2ONKE 1US5A 1JEVA 4ND9A 3IJOB 4G4PA 5EHSA 1ANFA 4IO7A 4ZE9A 1US4A 3PPQA 3FUZA 3IX1A 4JWYA 1UTHB 2B65A 4NF5A 2Y7RA 3KN8A 4PFWA 1HSLA 3T9HB 1PEBA 2PYYA 3RT8A 4R72A 4OEUA 4WEPA 2CMOA 1F9BA 3KFMA 2FA7A 2I0CA 5HM4B 3MP1A 3K02A 2I49A 4YAHX 2DE4A 1LAXA 4ZZAA 4BDMA 4RPNA 1N76A 3ZKKA 1QULA 4AB6A 1ZMGA 1LFHA 4JSDA 1XVXA 1B4ZA 5DYHA 1OLCA 3KN3A 3G3FA 3PUZE 3K4UA 3PUVE 3G3IA 4OQOA 2XXIA 4YB7A 3T22A 3FXRA 3PPRA 3H6TA 4ELOA 2O7UA 5KCJA 2LAOA 4R2BA 4FEDA 3EN3A 2ZYOA 3VDFA 1A8FA 3IB2A 2RKMA 1HSEA 2XXVA 3VV5A 3N6UA 3PU5A 4I62A 2ZYMA 4M4GA 2FNCA 3QAXA 1LLSA 2ONSA 4NWCA 4H67A 3TTRA 3ODBA 5AA3A 5TPAB 1FTJA 3TCFA 2BJJX 1VR5A 3TTNA 3TAJA 2F35A 3UORA 4UACA 2Y7PA 4QSCA 2XXTA 2REJA 4RY1A 3IAZA 2RINA 3E13X 5I56A 2Q2CA 1FQAA 3QYTA 4GD5A 4U22A 3OO6A 2O68A 3GXAA 3U72A 5CMMA 1MXUA 4G68B 1IZ1A 3SEYA 3VE1B 1B3LA 3FVNA 5H8NA 4ZS9A 5DEXA 4RK2A 4RA1A 1QUJA 4IY5A 5JTYB 4OHNA 5ICTA 1FQCA 4OVJA 3HCQA 4XXUA 5FTHA 3K1MA 2GRVA 2R9JA 4WKMA 4KHZE 3OSQA 2NWJA 1MDQA 3T9XB 4LATA 2XHDA 3GLBA 3W15C 3SEWA 3OD7A 2PX1A 4I8CA 3TCHA 4KR5A 3E4RA 2A5SA 4C1TA 1NNTA 3TTKA 5CMCA 4YKKA 4XTCQ 1LB9A 2OK2A 4GQOA 3O66A 4G2ZA 2F6PA 3O28A 5DVFA 5CBSA 1LB8A 1B7UA 4JDFA 2PMSA 5HPQA 4FIMA 2DVZA 3KEIA 1H45A 4YKIA 3O6IA 1B3GA 4QFOA 4X9TA 1NH7A 1B5HA 1FW0A 3B6WA 2Q88A 1MH4A 3RUMA 3U1OA 5FTIA 3Q29A 3E3KA 3RN8A 2AL5A 3CVGA 4U2RA 3TELA 5B70A 3TMGA 1ZKBA 2XXRA 1Y3QA 4YICA 3SKPA 4TLMB 1A54A 3C4MA 4MFIA 3MUQA 1B5IA 5FHNA 3MP6A 3U92A 1XOCA 4YB5A 1URDA 1N7WA 4H65A 4O3CA 1POTA 1DSNA 1I6QA 5AA4B 5KDTB 1FTMA 2UVGA 1D4NA 4Q5TA 4WEDA 3PMVA 2XX9A 1P1WA 3FV2A 1GVCA 4TQUQ 3IO4A 2DXYA 1VFEA 3A3CA 1B1XA 4NF6B 4X48A 3TTMA 1MXXA 2I48A 2KLFA 3K2DA 5JK4A 4R6YA 4P0GA 5I59A 4GXAA 3MZ1A 5A5XA 3MJNA 5H8QA 1OQGA 1FQEA 4H8JA 1URSA 1XS5A 3HO7A 1MXYA 1P1NA 4GF8A 2ONRA 1B3HA 3G3JA 2A5TA 1MY0A 2UXAA 2XXPA 4ELRA 2ALUA 3ONMA 2V3UA 4U23A 4NF5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HEU A;  1IUD A;  3O6H A;  4TOZ A;  3RTW B;  4GXS B;  3B6T A;  3T93 B;  1FTK A;  1QKA A;  1EZO A;  3ZSF A;  3R26 A;  4R2F A;  1MM6 A;  1LFI A;  3KSJ A;  3CSB A;  3H6V A;  3FD3 A;  3W9V A;  1MQJ A;  1YTV A;  1MPD A;  2XX7 A;  1SBP A;  1B40 A;  2E1S A;  4Q30 B;  3FV1 A;  4L17 A;  1B05 A;  4U1Z A;  2RC9 A;  4PFT A;  3GZG A;  2F5X A;  1TFA A;  3CG1 A;  4DDD A;  3T9V A;  2H99 A;  3V83 A;  1NNK A;  4KYS A;  2V93 A;  1OIB A;  1SQY A;  4IO3 A;  5BUU A;  4RYA A;  2X26 A;  4LZ7 A;  4LP2 B;  5CMB A;  1I6B A;  3ILU B;  3C36 A;  2XXY A;  1H44 A;  3WAF A;  4XKQ A;  4DZ1 A;  1TWY A;  3TQL A;  4NF4 A;  2X7P A;  2Z8F A;  3ZKL A;  2M8C A;  5J1D A;  5L9M A;  4GOT A;  2HQ0 A;  1JEU A;  1H76 A;  1ZJL A;  4PP0 A;  5I56 B;  2E0S A;  3U8Q A;  3CRB A;  4G68 C;  2I6E A;  4IO4 A;  1B32 A;  1MY3 A;  1MRP A;  1M5F A;  3H6U A;  4OER A;  3BFU A;  2Q8J A;  5DVI A;  1ATG A;  2ESN A;  1R6Z A;  3PV0 E;  5H8N B;  5DEX B;  2XD3 A;  4DIG A;  4ECF A;  2O1M A;  1D3K A;  2H5Y A;  3UP9 A;  3TKD A;  3PD9 A;  3USD A;  1TT1 A;  3MVX A;  4H1X A;  2R71 A;  4ESW A;  4QFP A;  3PD8 A;  2QRY A;  4FEC A;  4EQ7 A;  1LBB A;  1KWH A;  1IIT A;  4KI0 E;  4F31 B;  4ZEF A;  3CI8 A;  2P1S A;  4MF3 A;  2QS2 A;  1MPB A;  4F3S A;  4DE8 A;  1QKB A;  2OJT A;  5TU0 A;  4OXV A;  1JW5 A;  4KYE A;  1UQW A;  1B51 A;  2DWH A;  2F7B A;  3KN7 A;  2PVU A;  3SEU A;  4R9F A;  3FVK A;  4NWD A;  1URG A;  1QUK A;  1LAG E;  1OVB A;  2PT1 A;  1PB7 A;  4GRK A;  4LZ5 A;  3FGS A;  3T9U A;  4ONY A;  3M3F A;  2VGQ A;  1ZBM A;  4IGT A;  3QUF A;  1A55 A;  3MPL A;  4EQB A;  1NL5 A;  3V8X B;  2ZYN A;  4OTE A;  4R9G A;  5AE4 A;  2I4C A;  3PUY E;  3KOS A;  4KD5 A;  1N0T A;  1YCJ A;  4IO6 A;  3H6W A;  3TCG A;  3LBS A;  1S9T A;  3PPP A;  4JBZ A;  2DE2 A;  1IXI A;  4PFY A;  4OFL A;  1Y4T A;  4POW A;  1MDP 1;  1FQF A;  4X1B A;  2G29 A;  1B0H A;  2DOJ A;  3EPE A;  3KBR A;  5ITO A;  3FXQ A;  1WOD A;  3AXF A;  4YMA A;  2XD2 A;  5TP9 A;  3MC2 A;  3FXU A;  3K01 A;  3QIM A;  4U4S A;  2QL3 A;  4EF1 A;  1RYX A;  3TTL A;  1FTL A;  2F7A A;  3IO6 A;  3RLF E;  2V84 A;  1PC3 A;  2HXW A;  1YAE A;  3S9N C;  5I59 B;  1BIY A;  1OLA A;  4N07 A;  2DQV A;  2QJE A;  2AL4 A;  1P99 A;  1UIV A;  3IOU A;  3VLW A;  3G3H A;  5A5X B;  4H5F A;  2NVU B;  1SW1 A;  2Q9T A;  2XXU A;  1R1N A;  1SW5 A;  5H8Q B;  4THI A;  4M1V A;  3HHG A;  4YB6 A;  3A09 A;  1QJM A;  5DT6 A;  1A40 A;  5H8F A;  2A5T B;  2V3Q A;  4GL0 A;  1LAF E;  4DXU A;  3MWB A;  4POX A;  3UA8 A;  3RT6 B;  2CZL A;  4EXK A;  1ELJ A;  2REG A;  4KQP A;  3DEL B;  3TQW A;  3S9M C;  4BDQ A;  2B3F A;  4IO5 A;  1ZIU A;  2UYE A;  3N94 A;  4BDN A;  4DXC A;  3IOR A;  5ICQ A;  5CC2 A;  3S9E A;  1MXV A;  3Q25 A;  5ELV A;  3K6U A;  3IOT A;  1OQH A;  1JW4 A;  4XKR A;  1Y4C A;  5AA2 D;  1AMF A;  1Y20 A;  4ZDM A;  5HBC A;  5K2X A;  1PB8 A;  2DSF A;  2DXR A;  5I57 A;  3IR1 A;  1AH5 A;  4QFK A;  1B2H A;  1M5B A;  2ZNU A;  3HHF A;  5EHM A;  4YU0 A;  1UTB A;  4GL8 A;  5BWJ A;  2YPN A;  3OSR A;  1RKM A;  4O3B A;  4EF2 A;  1BP5 A;  4NF8 A;  3H3G A;  3CSG A;  1DOT A;  4ZZE A;  1JET A;  3U93 A;  1SDX A;  1B7Z A;  4ESX A;  4NE4 A;  1H43 A;  3FVG A;  4LQ2 A;  5L8D A;  2Z8D A;  2ANJ A;  4F1Y A;  3CFX A;  4R74 A;  1NH8 A;  4GLI A;  4NF4 B;  3FJM A;  3BFT A;  3LSF B;  1LCT A;  3C35 A;  1P1U A;  1M5D A;  2Q89 A;  3HPI A;  1IXG A;  3K00 A;  1MY1 A;  1N3X A;  1GV8 A;  2GH9 A;  2X7Q A;  2H25 A;  1LGB C;  4IO2 A;  4LVQ A;  3DM0 A;  4HCW A;  2QS4 A;  3PMW A;  3C32 A;  4RXL A;  3MVZ A;  1RYO A;  3UN6 A;  2DWI A;  4XKN A;  1N84 A;  3OO7 A;  4MH5 A;  4F3G A;  1IIW A;  3IOV A;  1A8E A;  4IY6 A;  4OET A;  4EQ9 A;  4ELP A;  2HCA A;  4F39 A;  5L9S A;  3CFZ A;  3C34 A;  4N6P A;  4QSD A;  3DLN A;  1L5T A;  1GR2 A;  4OEV A;  2ABH A;  2RC8 A;  1BKA A;  3S9L C;  4ZED A;  1MQI A;  3OMB A;  3KJT A;  3SEV A;  1VE4 A;  3ECR A;  1SW2 A;  2F6G A;  2Y7K A;  2UVI A;  3IB0 A;  1I69 A;  5AA2 A;  2Y7I A;  3MW0 A;  2NXO A;  5I58 A;  3T66 A;  3EHT A;  2RF1 A;  4U21 A;  3W9W A;  3DP6 A;  2OWS A;  5I2N A;  4BDL A;  3IOW A;  3L6G A;  3MQ9 A;  3RGY A;  1SI1 A;  3KOT A;  2DVC A;  3QK6 A;  4LA9 A;  4QFL A;  1USY H;  3G3K A;  4XIG Q;  2V3T A;  2QS1 A;  1IEJ A;  2F8D A;  3WAE A;  1LAH E;  1N7X A;  4F19 A;  2O69 A;  3OEL A;  2HAU A;  3O97 A;  2DWJ A;  1S50 A;  4WXJ A;  4BDR A;  2AYS A;  2F78 A;  3C31 A;  2DYX A;  2R6G E;  2GFE A;  4ZEK A;  1SYH A;  4OYV A;  1MM7 A;  2VOZ A;  2Z23 A;  1Z7M E;  3O29 A;  1OMP A;  1MQH A;  2HAV A;  3V5A A;  4R73 A;  3M8U A;  4ZE8 A;  5K2Y A;  1JVY A;  4MLQ A;  2NOO A;  1LCF A;  3QXM A;  4KFQ A;  2Q2A A;  4TLL B;  3KGC A;  5TP9 B;  1MQG A;  4LQ5 A;  2F34 A;  3TEP A;  4PFU A;  3VVD A;  2P2A A;  4YZZ A;  3QUJ A;  1POY 1;  3K0V A;  4U1O A;  4ISU A;  2O84 X;  3KSX A;  1DMB A;  3ZS6 A;  4I1D A;  1P1Q A;  4EDP A;  3H4Z A;  3KG2 A;  3UGW A;  4PE5 B;  4E0W A;  5LOM A;  3PMX A;  4IGR A;  2QPQ A;  4JWX A;  5CRY A;  3S2V A;  4F18 A;  3K6V A;  2ZNS A;  5FHO A;  4E0X A;  1NFT A;  1Y9U A;  4R6H A;  3H03 A;  3MPK A;  4QHQ A;  4MBP A;  5H8F B;  4BLA A;  2V25 A;  3IJX B;  3SES A;  3TZA A;  1MG1 A;  3A3U A;  4OES A;  3LUY A;  3THI A;  3EHS A;  2XX8 A;  4FEB A;  3QSL A;  2UVH A;  3O2A A;  3FIR A;  3TFL A;  3N6T A;  1B1H A;  2FYI A;  2QSX A;  3H7M A;  1JVX A;  4F2O A;  2F36 A;  2WKY A;  3JZJ A;  4RK9 A;  1Y3N A;  4I9D A;  2AIX A;  4G8H A;  1MY2 A;  2QS3 A;  1NMU A;  2GHB A;  5I2K B;  3B7D A;  5I57 B;  4G8N A;  3O9P A;  5AA1 A;  2GHA A;  3I5O A;  2THI A;  2O7I A;  3VFJ A;  2ZNT A;  3SET A;  1M5E A;  1HSJ A;  3N26 A;  4NTL A;  4GWO A;  1SVX B;  3N5L A;  1UTB B;  4Z0I A;  4EUO A;  2UYF A;  3RNN A;  1ZTY A;  5ISU A;  4NF8 B;  4UA8 A;  3HV1 A;  4P0I A;  5CBR A;  5CM6 A;  1OVT A;  2XXQ A;  3CG3 A;  1SD3 A;  1B5J A;  3RTF B;  2YLN A;  4FOR A;  1VFD A;  5JEI A;  1S7Y A;  4PET A;  4F22 A;  3O6G A;  4NMY A;  3UK4 A;  3KZG A;  3MZ9 A;  3FJG A;  4F29 A;  1NKX A;  3FAS A;  2OLB A;  5EYF A;  5L9O A;  4ZEI A;  5F1Q A;  2HFB A;  3JV9 A;  2DE3 A;  1DTZ A;  3PUX E;  1NNP A;  4KPT A;  3MBP A;  1MXZ A;  1PBP A;  3RQT A;  2DP8 A;  1EU8 A;  1B46 A;  3M3L A;  1WDN A;  3GBB A;  2DWA A;  4O3A A;  4DLD A;  1Q1K A;  2D21 A;  2H9B A;  2QMW A;  4HS7 A;  1LFG A;  4OEN A;  1EZP A;  2NUV A;  1P1O A;  3VLV A;  5ITP A;  2DS9 A;  1XC1 A;  3H06 B;  2VP1 A;  2F7C A;  4KYD A;  2F97 A;  4XKP A;  3G3G A;  3I6V A;  3RPW A;  4FAJ A;  3I3V A;  2PT2 A;  1LST A;  1B3E A;  4HTG A;  1JW1 A;  3FAT A;  3DP8 A;  2Y84 A;  5H8H A;  3HST A;  3DP4 A;  1M5C A;  2D3I A;  3TUS A;  3IK6 B;  5AA2 B;  1NNF A;  1QUI A;  2UVJ A;  5I58 B;  1GTK A;  4QFN A;  3OEM A;  5IAI A;  4G77 A;  5I2N B;  1D9V A;  4YKP A;  1AOV A;  3V89 B;  5DVJ A;  3PUW E;  2I3V A;  1UTH A;  2XXH A;  4AB5 A;  1Z7N E;  1DTG A;  3EQ1 A;  1B0L A;  1FTO A;  4DXB A;  4C0R A;  5I2K A;  3Q28 A;  4RNS A;  2IEE A;  1SW4 A;  4FJP A;  2I3W A;  1QW0 A;  1IXC A;  3CFL A;  1WVJ A;  2VD2 A;  4OFJ A;  4OFO A;  3BBR A;  1II5 A;  1YPN A;  3PPO A;  3JYR A;  4DCX A;  4LON B;  3OEN A;  1A7L A;  1SI0 A;  3Q27 A;  3KJ7 A;  3MAM A;  2ZXT A;  4R6K A;  3BKI B;  3K1P A;  1PDA A;  3OOA A;  3CIJ A;  1PB9 A;  4U4X A;  1DPE A;  5CI5 A;  4QSE A;  1SYI A;  3OO9 A;  4F2Q A;  3SEX A;  1AIV A;  2Y7W A;  3ILT B;  3U94 A;  3GBA A;  1XT8 A;  3TDJ A;  2OWT A;  4QF9 A;  4GVO A;  1Q35 A;  4JXI A;  4GFR A;  3C9H A;  1MS7 A;  3L6H A;  3FJ7 A;  4FAT A;  3S4U A;  4Z7E A;  3M3K A;  2RCB A;  2I4B A;  2D5W A;  3PPN A;  1MXW A;  5TPA A;  2ZYK A;  2RCA A;  1MPC A;  3MVW A;  1BTJ A;  4FE8 A;  4C1U A;  4F3B A;  4EXL A;  3OXN A;  4OZ9 A;  1H3D A;  1IXH A;  3MZB A;  2OCU A;  2B3B A;  1B58 A;  3T96 B;  1ZLQ A;  1MY4 A;  2W7Y A;  3VXB A;  1Y1M A;  3VXC A;  2IA4 A;  2Z22 A;  4NED A;  3CR9 A;  3TPA A;  2XXX A;  1CB6 A;  2O6A A;  4G68 A;  1UIU A;  2G93 A;  3R6U A;  3MP8 A;  2O51 A;  1EH3 A;  2I58 A;  2HZL A;  4N13 A;  4H5G A;  4HCY A;  2RC7 A;  3SDF A;  1B3F A;  5JTY A;  2HZK A;  4KCC A;  4R75 A;  3EF7 A;  4ZEB A;  1D9Y A;  4MLV A;  4RPO A;  2QMX A;  4H8I A;  1PBQ A;  2Z8E A;  3UIF A;  5H8S A;  5I84 A;  2VD3 A;  4H0W A;  4H6D A;  1R9L A;  3OO8 A;  3P7I A;  3G7W A;  3LR1 A;  1MH3 A;  3LSW A;  3FZV A;  1FQD A;  1LBC A;  3FVO A;  3K1N A;  4LZ8 A;  3F11 A;  4PQJ A;  1USY E;  2ZMB A;  1B52 A;  4F3P A;  4QRZ A;  2PBW A;  3E9X A;  1QVS A;  1ZU0 A;  1O63 A;  3LSX A;  1BLF A;  2O1L A;  4DCY A;  3B6Q A;  1T0K A;  1EZ9 A;  5M2V A;  1GGG A;  4LUB A;  3EHU A;  5IKB A;  3C33 A;  1AL3 A;  1MQD A;  2OZZ A;  4JB7 A;  1DPP A;  4G8M A;  5KCJ B;  1TFD A;  1B7H A;  1IQ7 A;  1TXF A;  3D4G A;  1Y1Z A;  1B9J A;  5DTB A;  1A99 A;  5KZT A;  3IL1 B;  2H98 A;  3RY3 A;  3VLU A;  3TOD A;  4F1U A;  4ELQ A;  4JWO A;  3Q26 A;  1JNF A;  1N04 A;  4IB2 A;  2YJP A;  4Q0C A;  1FCK A;  2XXW A;  4OMB A;  3VVE A;  1FQB A;  1R9Q A;  3VVF A;  3K6W A;  1VSO A;  4RJZ A;  4F1V A;  5CMK A;  1O7T A;  3R7X A;  3SER A;  4GIZ A;  3PGF A;  3D4C A;  1JQF A;  5AA4 A;  5B7D A;  5KDT A;  3OEK A;  1XVY A;  3HN0 A;  3MVY A;  5FHM A;  1N3W A;  3TYH A;  1J1N A;  4KCD A;  4OWD A;  4K3F A;  4JSO A;  4YKJ A;  4AQ4 A;  4YMB A;  1CE2 A;  4NF6 A;  3IB1 A;  2OBG A;  4ZEC A;  1I6A A;  2H4I A;  1B6H A;  2I0B A;  3K6X A;  5F7V A;  1XHY A;  2VHA A;  4Q8R A;  3LC8 A;  4BDO A;  5H8H B;  1Y3P A;  4HW8 A;  3LSL A;  4X1D A;  1O64 A;  1B4H A;  2P0S A;  4P11 A;  2ONK E;  1US5 A;  1JEV A;  4ND9 A;  3IJO B;  4G4P A;  5EHS A;  1ANF A;  4IO7 A;  4ZE9 A;  1US4 A;  3PPQ A;  3FUZ A;  3IX1 A;  4JWY A;  1UTH B;  2B65 A;  4NF5 A;  2Y7R A;  3KN8 A;  4PFW A;  1HSL A;  3T9H B;  1PEB A;  2PYY A;  3RT8 A;  4R72 A;  4OEU A;  4WEP A;  2CMO A;  1F9B A;  3KFM A;  2FA7 A;  2I0C A;  5HM4 B;  3MP1 A;  3K02 A;  2I49 A;  4YAH X;  2DE4 A;  1LAX A;  4ZZA A;  4BDM A;  4RPN A;  1N76 A;  3ZKK A;  1QUL A;  4AB6 A;  1ZMG A;  1LFH A;  4JSD A;  1XVX A;  1B4Z A;  5DYH A;  1OLC A;  3KN3 A;  3G3F A;  3PUZ E;  3K4U A;  3PUV E;  3G3I A;  4OQO A;  2XXI A;  4YB7 A;  3T22 A;  3FXR A;  3PPR A;  3H6T A;  4ELO A;  2O7U A;  5KCJ A;  2LAO A;  4R2B A;  4FED A;  3EN3 A;  2ZYO A;  3VDF A;  1A8F A;  3IB2 A;  2RKM A;  1HSE A;  2XXV A;  3VV5 A;  3N6U A;  3PU5 A;  4I62 A;  2ZYM A;  4M4G A;  2FNC A;  3QAX A;  1LLS A;  2ONS A;  4NWC A;  4H67 A;  3TTR A;  3ODB A;  5AA3 A;  5TPA B;  1FTJ A;  3TCF A;  2BJJ X;  1VR5 A;  3TTN A;  3TAJ A;  2F35 A;  3UOR A;  4UAC A;  2Y7P A;  4QSC A;  2XXT A;  2REJ A;  4RY1 A;  3IAZ A;  2RIN A;  3E13 X;  5I56 A;  2Q2C A;  1FQA A;  3QYT A;  4GD5 A;  4U22 A;  3OO6 A;  2O68 A;  3GXA A;  3U72 A;  5CMM A;  1MXU A;  4G68 B;  1IZ1 A;  3SEY A;  3VE1 B;  1B3L A;  3FVN A;  5H8N A;  4ZS9 A;  5DEX A;  4RK2 A;  4RA1 A;  1QUJ A;  4IY5 A;  5JTY B;  4OHN A;  5ICT A;  1FQC A;  4OVJ A;  3HCQ A;  4XXU A;  5FTH A;  3K1M A;  2GRV A;  2R9J A;  4WKM A;  4KHZ E;  3OSQ A;  2NWJ A;  1MDQ A;  3T9X B;  4LAT A;  2XHD A;  3GLB A;  3W15 C;  3SEW A;  3OD7 A;  2PX1 A;  4I8C A;  3TCH A;  4KR5 A;  3E4R A;  2A5S A;  4C1T A;  1NNT A;  3TTK A;  5CMC A;  4YKK A;  4XTC Q;  1LB9 A;  2OK2 A;  4GQO A;  3O66 A;  4G2Z A;  2F6P A;  3O28 A;  5DVF A;  5CBS A;  1LB8 A;  1B7U A;  4JDF A;  2PMS A;  5HPQ A;  4FIM A;  2DVZ A;  3KEI A;  1H45 A;  4YKI A;  3O6I A;  1B3G A;  4QFO A;  4X9T A;  1NH7 A;  1B5H A;  1FW0 A;  3B6W A;  2Q88 A;  1MH4 A;  3RUM A;  3U1O A;  5FTI A;  3Q29 A;  3E3K A;  3RN8 A;  2AL5 A;  3CVG A;  4U2R A;  3TEL A;  5B70 A;  3TMG A;  1ZKB A;  2XXR A;  1Y3Q A;  4YIC A;  3SKP A;  4TLM B;  1A54 A;  3C4M A;  4MFI A;  3MUQ A;  1B5I A;  5FHN A;  3MP6 A;  3U92 A;  1XOC A;  4YB5 A;  1URD A;  1N7W A;  4H65 A;  4O3C A;  1POT A;  1DSN A;  1I6Q A;  5AA4 B;  5KDT B;  1FTM A;  2UVG A;  1D4N A;  4Q5T A;  4WED A;  3PMV A;  2XX9 A;  1P1W A;  3FV2 A;  1GVC A;  4TQU Q;  3IO4 A;  2DXY A;  1VFE A;  3A3C A;  1B1X A;  4NF6 B;  4X48 A;  3TTM A;  1MXX A;  2I48 A;  2KLF A;  3K2D A;  5JK4 A;  4R6Y A;  4P0G A;  5I59 A;  4GXA A;  3MZ1 A;  5A5X A;  3MJN A;  5H8Q A;  1OQG A;  1FQE A;  4H8J A;  1URS A;  1XS5 A;  3HO7 A;  1MXY A;  1P1N A;  4GF8 A;  2ONR A;  1B3H A;  3G3J A;  2A5T A;  1MY0 A;  2UXA A;  2XXP A;  4ELR A;  2ALU A;  3ONM A;  2V3U A;  4U23 A;  4NF5 B; 
#chains in the Genus database with same CATH topology
 2ZZX A;  1FPI A;  2HEU A;  1IUD A;  3O6H A;  4TOZ A;  2OX3 A;  3RTW B;  4GXS B;  3B6T A;  3T93 B;  1FTK A;  3EKI A;  1QKA A;  4MNI A;  1EZO A;  5IM2 A;  3ZSF A;  3R26 A;  4R2F A;  1MM6 A;  1LFI A;  4IR8 A;  3KSJ A;  3CSB A;  3H6V A;  3FD3 A;  3W9V A;  1MQJ A;  1YTV A;  1MPD A;  2JJK A;  2XX7 A;  1SBP A;  1B40 A;  2E1S A;  4Q30 B;  3FV1 A;  4L17 A;  1B05 A;  4U1Z A;  2RC9 A;  4PFT A;  1FRP A;  3GZG A;  2F5X A;  2WYP A;  1TFA A;  3CG1 A;  4DDD A;  3T9V A;  2H99 A;  2Q74 A;  3V83 A;  1NNK A;  4KYS A;  2V93 A;  3MST A;  1OIB A;  1SQY A;  4IO3 A;  5BUU A;  4RYA A;  2X26 A;  4LZ7 A;  4LP2 B;  5CMB A;  1I6B A;  3ILU B;  3C36 A;  2XXY A;  1H44 A;  3WAF A;  4XKQ A;  4DZ1 A;  1TWY A;  3TQL A;  4NF4 A;  4GWW A;  2X7P A;  3IFC A;  2Z8F A;  3ZKL A;  2M8C A;  5J1D A;  5L9M A;  4NG7 A;  1YXI A;  4GOT A;  2HQ0 A;  1FBD A;  1JEU A;  1H76 A;  1ZJL A;  5IZZ A;  4PP0 A;  5I56 B;  2E0S A;  3RPL A;  3U8Q A;  3CRB A;  4G68 C;  2I6E A;  4IO4 A;  1B32 A;  1MY3 A;  1MRP A;  1M5F A;  3H6U A;  1IMF A;  4OER A;  3BFU A;  2Q8J A;  5DVI A;  1ATG A;  2ESN A;  4I40 A;  1R6Z A;  3PV0 E;  5H8N B;  5DEX B;  2XD3 A;  4DIG A;  4ECF A;  2O1M A;  1FBE A;  1D3K A;  5ET6 A;  2H5Y A;  3UP9 A;  3TKD A;  3PD9 A;  3USD A;  1TT1 A;  3MVX A;  2QVU A;  3T0J A;  4N6K A;  3U65 A;  4H1X A;  2R71 A;  4ESW A;  4QFP A;  3PD8 A;  2QRY A;  4FEC A;  4EQ7 A;  1LBB A;  2P3V A;  1KWH A;  1IIT A;  4KI0 E;  4F31 B;  4GWU A;  4ZEF A;  1K9Y A;  3CI8 A;  2P1S A;  4MF3 A;  2QS2 A;  1MPB A;  4F3S A;  4GX4 A;  4DE8 A;  1QKB A;  2OJT A;  5TU0 A;  4OXV A;  1JW5 A;  4KYE A;  1UQW A;  4PFB A;  1B51 A;  2DWH A;  2F7B A;  3KN7 A;  2PVU A;  5IZ3 A;  4PBQ A;  3SEU A;  4R9F A;  3QMF A;  4XFE A;  3FVK A;  4NWD A;  1URG A;  1QUK A;  1LAG E;  1OVB A;  2PT1 A;  1PB7 A;  4GRK A;  2Q8M A;  4N8G A;  1AWB A;  4LZ5 A;  3FGS A;  4HE2 A;  3T9U A;  4ONY A;  1KZ8 A;  3M3F A;  2VGQ A;  1ZBM A;  4IGT A;  3QUF A;  1A55 A;  3MPL A;  4GBV A;  4EQB A;  1NL5 A;  3V8X B;  2ZYN A;  4OTE A;  3RYD A;  4R9G A;  5AE4 A;  2I4C A;  3PUY E;  3KOS A;  4KD5 A;  1N0T A;  1FPF A;  1YCJ A;  4P1E A;  4IO6 A;  3H6W A;  3TCG A;  3LBS A;  1S9T A;  3PPP A;  4JBZ A;  2DE2 A;  1IXI A;  4PFY A;  4OFL A;  1Y4T A;  4NQ8 A;  4POW A;  1MDP 1;  1FQF A;  4X1B A;  2G29 A;  1B0H A;  3LUZ A;  2DOJ A;  3EPE A;  3KBR A;  5ITO A;  3FXQ A;  3LV0 A;  1WOD A;  3AXF A;  4YMA A;  2XD2 A;  1IMA A;  5TP9 A;  1FPE A;  3MC2 A;  3FXU A;  3K01 A;  3QIM A;  4U4S A;  2QL3 A;  4EF1 A;  1RYX A;  3TTL A;  1FTL A;  2F7A A;  3IO6 A;  2FIX A;  4GWX A;  3RLF E;  2V84 A;  1PC3 A;  2HXW A;  4N15 A;  1YAE A;  3S9N C;  5I59 B;  1BIY A;  1OLA A;  2FHY A;  4N07 A;  2XWV A;  2DQV A;  2QJE A;  2AL4 A;  4G61 A;  1P99 A;  4GX3 A;  1UIV A;  3IOU A;  3VLW A;  3G3H A;  5A5X B;  5EQ7 A;  4H5F A;  2NVU B;  1SW1 A;  2Q9T A;  1Q9D A;  2XXU A;  1R1N A;  1SW5 A;  4XEQ A;  4THI A;  5H8Q B;  4M1V A;  3HHG A;  4YB6 A;  3A09 A;  1QJM A;  5DT6 A;  1A40 A;  5H8F A;  2A5T B;  2V3Q A;  2WBB A;  4GL0 A;  1DCU A;  1LAF E;  4DXU A;  4NHB A;  3MWB A;  4POX A;  1FPK A;  3UA8 A;  3RT6 B;  2CZL A;  4EXK A;  1ELJ A;  2REG A;  4KQP A;  1RDY A;  3DEL B;  3TQW A;  3S9M C;  4BDQ A;  2B3F A;  4IO5 A;  1ZIU A;  4X8R A;  1DBZ A;  5LTC A;  2UYE A;  3N94 A;  4QXD A;  4BDN A;  4DXC A;  3IOR A;  5ICQ A;  5CC2 A;  3S9E A;  1MXV A;  3Q25 A;  5ELV A;  2DDK A;  3K6U A;  3IOT A;  1OQH A;  1JW4 A;  4XKR A;  1Y4C A;  5AA2 D;  1AMF A;  1Y20 A;  4ZDM A;  5HBC A;  5K2X A;  1PB8 A;  2DSF A;  2DXR A;  5I57 A;  3IR1 A;  1AH5 A;  4QFK A;  1KA1 A;  1B2H A;  1LBX A;  1M5B A;  4PF6 A;  2ZNU A;  3HHF A;  5EHM A;  1CNQ A;  4YU0 A;  1UTB A;  4GL8 A;  5BWJ A;  2YPN A;  3OSR A;  1RKM A;  4O3B A;  4EF2 A;  1BP5 A;  4NF8 A;  4NGU A;  3H3G A;  3CSG A;  1DOT A;  4ZZE A;  1JET A;  1RDZ A;  5F24 A;  3U93 A;  1SDX A;  1B7Z A;  4ESX A;  4NE4 A;  1H43 A;  3FVG A;  4LQ2 A;  5L8D A;  1G0H A;  2Z8D A;  2ANJ A;  4F1Y A;  3CFX A;  4R74 A;  1NH8 A;  4GLI A;  4NF4 B;  3FJM A;  3BFT A;  3LSF B;  1LCT A;  2F3D A;  3C35 A;  1P1U A;  1M5D A;  1FBH A;  2Q89 A;  4PGN A;  3HPI A;  1IXG A;  4GWS A;  4GWY A;  3RPL B;  3FBP A;  3K00 A;  1MY1 A;  1N3X A;  1GV8 A;  2GH9 A;  2X7Q A;  4QBA A;  3ROJ A;  2H25 A;  1LGB C;  2QVR A;  4IO2 A;  4LVQ A;  3DM0 A;  4HCW A;  2QS4 A;  3PMW A;  3C32 A;  4RXL A;  3MVZ A;  1RYO A;  3UN6 A;  5I3S A;  2DWI A;  4XKN A;  1N84 A;  3IFA A;  3OO7 A;  4MH5 A;  4F3G A;  1IIW A;  1FPG A;  1A8E A;  3IOV A;  4IY6 A;  4OET A;  4EQ9 A;  4ELP A;  2HCA A;  4F39 A;  5L9S A;  3CFZ A;  3C34 A;  1VDW A;  4N6P A;  4QSD A;  4JVI A;  3DLN A;  1L5T A;  1GR2 A;  4OEV A;  2ABH A;  2RC8 A;  1BKA A;  3S9L C;  4ZED A;  1MQI A;  3OMB A;  3KJT A;  3SEV A;  1VE4 A;  1NV7 A;  3ECR A;  5IGA A;  1SW2 A;  2F6G A;  2Y7K A;  2UVI A;  3IB0 A;  5IZ3 B;  1I69 A;  5AA2 A;  2Y7I A;  3MW0 A;  2NXO A;  5I58 A;  3T66 A;  3EHT A;  2RF1 A;  4U21 A;  3W9W A;  3DP6 A;  2OWS A;  5I2N A;  4BDL A;  3IOW A;  3L6G A;  3MQ9 A;  3RGY A;  1SI1 A;  2XWI A;  1YZ0 A;  3KOT A;  2WBD A;  2DVC A;  3QK6 A;  4LA9 A;  4QFL A;  1USY H;  3G3K A;  4XIG Q;  2V3T A;  1IMC A;  2QS1 A;  3KC1 A;  1IEJ A;  2F8D A;  2V4C A;  4P9K A;  3WAE A;  1LAH E;  1N7X A;  4F19 A;  2O69 A;  3OEL A;  2HAU A;  3O97 A;  2DWJ A;  1S50 A;  4LN5 A;  4WXJ A;  4BDR A;  2AYS A;  2F78 A;  3C31 A;  2DYX A;  2R6G E;  2GFE A;  4ZEK A;  1SYH A;  4OYV A;  4HXV A;  1MM7 A;  2VOZ A;  1IMB A;  2Z23 A;  1Z7M E;  3O29 A;  1OMP A;  1MQH A;  2HAV A;  5T3J A;  3V5A A;  2WYK A;  4R73 A;  3M8U A;  4ZE8 A;  5K2Y A;  1JVY A;  4MLQ A;  2NOO A;  1LCF A;  3QXM A;  4KFQ A;  2Q2A A;  4TLL B;  3KGC A;  5TP9 B;  1MQG A;  4LQ5 A;  2F34 A;  3TEP A;  1NV4 A;  4PFU A;  4H46 A;  3VVD A;  2P2A A;  4YZZ A;  3QUJ A;  1POY 1;  3K0V A;  4U1O A;  4ISU A;  2O84 X;  4N8Y A;  1NUY A;  3KSX A;  1DMB A;  3ZS6 A;  4I1D A;  3SZP A;  1P1Q A;  4EDP A;  3H4Z A;  3KG2 A;  1FJ9 A;  1FSA A;  3UGW A;  4PE5 B;  4E0W A;  5LOM A;  3E79 A;  3PMX A;  4IGR A;  4MEV A;  2QPQ A;  4JWX A;  5CRY A;  3S2V A;  4F18 A;  3K6V A;  2ZNS A;  5FHO A;  4E0X A;  5FBP A;  1NFT A;  1Y9U A;  4P56 A;  4R6H A;  4MMP A;  4NAP A;  3H03 A;  3MPK A;  4PDD A;  4QHQ A;  4MBP A;  5H8F B;  4BLA A;  4P8B A;  2V25 A;  1FPJ A;  3IJX B;  3SES A;  3TZA A;  1MG1 A;  3A3U A;  1FPL A;  4OES A;  3LUY A;  4OVQ A;  3THI A;  2CZI A;  3EHS A;  2XX8 A;  4FEB A;  3QSL A;  2UVH A;  4JVD A;  3O2A A;  1LBZ A;  3FIR A;  3N6T A;  3TFL A;  1B1H A;  2FYI A;  2QSX A;  3H7M A;  4RK9 A;  1JVX A;  2F36 A;  2WKY A;  3JZJ A;  4F2O A;  1Y3N A;  4I9D A;  2AIX A;  4NX1 A;  4G8H A;  1MY2 A;  2QVV A;  2QS3 A;  1NMU A;  4HE1 A;  2GHB A;  4DI3 D;  5I2K B;  3B7D A;  5I57 B;  4G8N A;  3O9P A;  5AA1 A;  2WX9 A;  2GHA A;  3I5O A;  2THI A;  2O7I A;  2VPO A;  3VFJ A;  2ZNT A;  3SET A;  1M5E A;  1HSJ A;  3N26 A;  4NTL A;  4GWO A;  1SVX B;  3N5L A;  1UTB B;  4Z0I A;  4MAG A;  4EUO A;  2UYF A;  2BJI A;  3RNN A;  1ZTY A;  5ISU A;  4NF8 B;  4UA8 A;  3HV1 A;  4N91 A;  4P0I A;  5CBR A;  5CM6 A;  1OVT A;  2XXQ A;  3CG3 A;  1SD3 A;  1B5J A;  3RTF B;  2YLN A;  4FOR A;  2PFY A;  1G0I A;  1VFD A;  5JEI A;  1S7Y A;  4N4U A;  4PET A;  4F22 A;  3O6G A;  4NMY A;  3UK4 A;  3KZG A;  3MZ9 A;  3FJG A;  1NKX A;  4F29 A;  3FAS A;  2OLB A;  5EYF A;  4MCO A;  5L9O A;  4ZEI A;  4PFR A;  5F1Q A;  2HFB A;  3JV9 A;  2DE3 A;  1DTZ A;  3PUX E;  1NNP A;  4KPT A;  3MBP A;  1MXZ A;  1PBP A;  3RQT A;  2DP8 A;  1EU8 A;  1B46 A;  3M3L A;  1WDN A;  3GBB A;  2DWA A;  1KA0 A;  4O3A A;  4DLD A;  1Q1K A;  2D21 A;  2H9B A;  2QMW A;  3NOH A;  4HS7 A;  4I3E A;  1LFG A;  1NV6 A;  4OEN A;  1EZP A;  2CZH A;  2NUV A;  3T1B A;  1DK4 A;  2F3B A;  1P1O A;  3VLV A;  5ITP A;  2DS9 A;  1XC1 A;  2B4M A;  3H06 B;  2VP1 A;  2F7C A;  4KYD A;  2F97 A;  4XKP A;  3G3G A;  3I6V A;  3RPW A;  4OA4 A;  4FAJ A;  3I3V A;  2PT2 A;  1LST A;  1B3E A;  4HTG A;  1NUX A;  1JW1 A;  3FAT A;  3DP8 A;  2Y84 A;  5H8H A;  3HST A;  3DP4 A;  1M5C A;  2D3I A;  3TUS A;  3IK6 B;  5AA2 B;  2FIE A;  4N6D A;  1FJ6 A;  1NNF A;  1QUI A;  2UVJ A;  5I58 B;  1GTK A;  4QFN A;  3OEM A;  2P3N A;  3GYY A;  5IAI A;  4G77 A;  5I2N B;  1D9V A;  4YKP A;  1AOV A;  1IMD A;  3V89 B;  5DVJ A;  3PUW E;  2I3V A;  1UTH A;  2XXH A;  4AB5 A;  1Z7N E;  1IME A;  1DTG A;  3EQ1 A;  1B0L A;  2XWK A;  5ET8 A;  1FTO A;  4DXB A;  4C0R A;  5I2K A;  3Q28 A;  4RNS A;  4I3Y A;  2IEE A;  1SW4 A;  2FVZ A;  4FJP A;  2I3W A;  1QW0 A;  1IXC A;  3CFL A;  1WVJ A;  2VD2 A;  4OFJ A;  4OFO A;  3BBR A;  1II5 A;  1YPN A;  3PPO A;  3JYR A;  4DCX A;  4LON B;  3OEN A;  1A7L A;  1SI0 A;  4P3L A;  3Q27 A;  3KJ7 A;  2XXK A;  3KC0 A;  3MAM A;  2ZXT A;  4R6K A;  3BKI B;  3K1P A;  1PDA A;  3OOA A;  3CIJ A;  1PB9 A;  4U4X A;  1DPE A;  5CI5 A;  4QSE A;  1SYI A;  3OO9 A;  4F2Q A;  2L5V A;  3SEX A;  1AIV A;  2Y7W A;  3ILT B;  3U94 A;  3GBA A;  1XT8 A;  3TDJ A;  2OWT A;  4OVS A;  4QF9 A;  4GVO A;  1Q35 A;  5LDZ A;  4JXI A;  4GFR A;  3C9H A;  1MS7 A;  3L6H A;  3FJ7 A;  4FAT A;  3S4U A;  4Z7E A;  1NV1 A;  3M3K A;  2RCB A;  2I4B A;  4O7M A;  2D5W A;  3PPN A;  1MXW A;  1EYK A;  5TPA A;  2ZYK A;  2RCA A;  1MPC A;  1FBG A;  3MVW A;  1BTJ A;  4FE8 A;  4C1U A;  4F3B A;  4EXL A;  3OXN A;  4OZ9 A;  1H3D A;  1IXH A;  3MZB A;  5EYG A;  2OCU A;  2B3B A;  1B58 A;  4NN3 A;  3T96 B;  1ZLQ A;  5EQ8 A;  1MY4 A;  2W7Y A;  3VXB A;  4MHF A;  1Y1M A;  3VXC A;  2IA4 A;  2Z22 A;  4NED A;  3BIG A;  3CR9 A;  3TPA A;  2XXX A;  1CB6 A;  4X04 A;  2O6A A;  4G68 A;  1UIU A;  2G93 A;  3R6U A;  3MP8 A;  2O51 A;  1EH3 A;  2I58 A;  2HZL A;  4N13 A;  4H5G A;  4HCY A;  2RC7 A;  3SDF A;  1B3F A;  5JTY A;  1NUW A;  5A5L A;  2HZK A;  4KCC A;  4R75 A;  3EF7 A;  4ZEB A;  1D9Y A;  4MLV A;  4RPO A;  2QMX A;  4H8I A;  1PBQ A;  2Z8E A;  3UIF A;  5H8S A;  2VT5 A;  5I84 A;  2VD3 A;  4H0W A;  4H6D A;  3HFU A;  1R9L A;  3OO8 A;  3P7I A;  3G7W A;  4GBW A;  3LR1 A;  1MH3 A;  3LSW A;  3FZV A;  1FQD A;  1LBC A;  3FVO A;  4O94 A;  3K1N A;  4LZ8 A;  3F11 A;  4PQJ A;  1USY E;  4PC9 A;  2ZMB A;  1B52 A;  3PTY A;  4F3P A;  4QRZ A;  2PBW A;  3E9X A;  1QVS A;  2PCR A;  1ZU0 A;  2ZZV A;  1O63 A;  3LSX A;  1BLF A;  1RDX A;  2O1L A;  4DCY A;  3B6Q A;  1T0K A;  1EZ9 A;  5M2V A;  1GGG A;  4LUB A;  3EHU A;  4PF8 A;  1FBF A;  5IKB A;  3C33 A;  1FTA A;  1AL3 A;  1MQD A;  2OZZ A;  1K9Z A;  4JB7 A;  4GX6 A;  1DPP A;  4G8M A;  5KCJ B;  1TFD A;  1B7H A;  1IQ7 A;  1TXF A;  3D4G A;  1Y1Z A;  1B9J A;  5DTB A;  1A99 A;  2FBP A;  5KZT A;  2MKZ A;  3IL1 B;  2H98 A;  3RY3 A;  3VLU A;  3TOD A;  4F1U A;  4ELQ A;  4JWO A;  3Q26 A;  1YYZ A;  1JNF A;  1N04 A;  4IB2 A;  2YJP A;  4Q0C A;  1FCK A;  2XXW A;  3E78 A;  4PDH A;  4OMB A;  3VVE A;  1FQB A;  1R9Q A;  3VVF A;  3D1R A;  3K6W A;  1VSO A;  4H45 A;  2CEX A;  4RJZ A;  2HXR A;  4F1V A;  5CMK A;  1NV3 A;  1NUZ A;  1O7T A;  3R7X A;  2Y5L A;  3SER A;  4GIZ A;  4UAB A;  3PGF A;  4MJO A;  3D4C A;  1JQF A;  5AA4 A;  5B7D A;  5KDT A;  3OEK A;  5ESY A;  1XVY A;  3HN0 A;  3MVY A;  4PBH A;  5FHM A;  1N3W A;  3TYH A;  1J1N A;  3FXB A;  4KCD A;  4OWD A;  2R8T A;  4N81 A;  1NV0 A;  4K3F A;  4JSO A;  4YKJ A;  4AQ4 A;  4YMB A;  1CE2 A;  4NF6 A;  2B4L A;  3IB1 A;  2OBG A;  4ZEC A;  1I6A A;  2H4I A;  4KXP A;  3B8B A;  1B6H A;  2I0B A;  3K6X A;  5F7V A;  1XHY A;  2VHA A;  4Q8R A;  3LC8 A;  2OWZ A;  4BDO A;  5H8H B;  2Y5K A;  4OAN A;  1Y3P A;  4HW8 A;  3LSL A;  4X1D A;  1O64 A;  1B4H A;  2P0S A;  4PAI A;  4P11 A;  2ONK E;  1US5 A;  1JEV A;  4ND9 A;  4P1L A;  3IJO B;  2KR0 A;  4G4P A;  5EHS A;  1ANF A;  4IO7 A;  4ZE9 A;  1US4 A;  3PPQ A;  4HE0 A;  3FUZ A;  3IX1 A;  4JWY A;  1UTH B;  2B65 A;  4OVR A;  4NF5 A;  2Y7R A;  3KN8 A;  4PFW A;  1HSL A;  3B50 A;  3T9H B;  1PEB A;  2PYY A;  3RT8 A;  2XA5 A;  4R72 A;  5ET5 A;  4OEU A;  4WEP A;  2CMO A;  1NV5 A;  1F9B A;  2HPG A;  3KFM A;  5EQ9 A;  5I7I A;  2FA7 A;  2I0C A;  4MNP A;  3MP1 A;  5HM4 B;  3K02 A;  2I49 A;  4YAH X;  2DE4 A;  1LAX A;  4ZZA A;  1EYI A;  4BDM A;  4RPN A;  1N76 A;  3ZKK A;  1QUL A;  4AB6 A;  1ZMG A;  1LFH A;  4JSD A;  1XVX A;  4PCD A;  1B4Z A;  1D9Q A;  3CHG A;  5DYH A;  1OLC A;  3KN3 A;  2CZK A;  3G3F A;  3PUZ E;  4MIJ A;  3K4U A;  4MX6 A;  3PUV E;  3G3I A;  1NV2 A;  4OQO A;  2XXI A;  4YB7 A;  3T22 A;  2VPN A;  3FXR A;  3PPR A;  3H6T A;  4JVC A;  4ELO A;  1INP A;  2O7U A;  2WEF A;  5KCJ A;  3A29 A;  2LAO A;  4R2B A;  3ISP A;  4FED A;  3EN3 A;  2ZYO A;  3VDF A;  1A8F A;  3IB2 A;  2RKM A;  1HSE A;  2XXV A;  3VV5 A;  3N6U A;  3PU5 A;  4I62 A;  2ZYM A;  4M4G A;  1XI6 A;  4O7I A;  2FNC A;  3QAX A;  1LLS A;  2ONS A;  4NWC A;  4H67 A;  3TTR A;  3ODB A;  5AA3 A;  5TPA B;  1FTJ A;  3TCF A;  2BJJ X;  1VR5 A;  3TTN A;  5ET7 A;  4XF5 A;  3TAJ A;  2F35 A;  2XWO A;  3UOR A;  4UAC A;  2Y7P A;  4QSC A;  2XXT A;  2REJ A;  4RY1 A;  3IAZ A;  2RIN A;  3BIH A;  3E13 X;  5I56 A;  2Q2C A;  1FQA A;  3QYT A;  4GD5 A;  4U22 A;  3OO6 A;  2O68 A;  3GXA A;  3U72 A;  5CMM A;  1LEV A;  1MXU A;  4G68 B;  4PE3 A;  1IZ1 A;  4N17 A;  3SEY A;  1B3L A;  3FVN A;  3VE1 B;  5H8N A;  4ZS9 A;  4PFI A;  5DEX A;  4RK2 A;  4RA1 A;  1QUJ A;  4FBP A;  4IY5 A;  5JTY B;  4OHN A;  4AS5 A;  1FQC A;  5ICT A;  5I5P A;  1NI9 A;  3MYU A;  4OVJ A;  3HCQ A;  4XXU A;  5FTH A;  3K1M A;  2GRV A;  1LBY A;  2R9J A;  4WKM A;  4PAF A;  4KHZ E;  3OSQ A;  2NWJ A;  1MDQ A;  4PAK A;  3T9X B;  4LAT A;  5DW8 A;  1EYJ A;  2XHD A;  3GLB A;  3W15 C;  3SEW A;  3OD7 A;  2PX1 A;  4I8C A;  4DI4 B;  3TCH A;  4KR5 A;  5IZ1 A;  3E4R A;  5J16 A;  2A5S A;  4C1T A;  1NNT A;  3TTK A;  5CMC A;  4YKK A;  4XTC Q;  1LB9 A;  2OK2 A;  4GQO A;  3O66 A;  4G2Z A;  2F6P A;  3O28 A;  2KQZ A;  5DVF A;  5CBS A;  1LB8 A;  1B7U A;  4JDF A;  2PMS A;  5HPQ A;  4AS4 A;  1SPI A;  4FIM A;  1FPB A;  2DVZ A;  3KEI A;  1H45 A;  4YKI A;  3O6I A;  4OVT A;  1BK4 A;  1B3G A;  4QFO A;  4X9T A;  1NH7 A;  1B5H A;  1FW0 A;  1JP4 A;  3B6W A;  4P47 A;  2Q88 A;  1MH4 A;  3RUM A;  4MNC A;  3U1O A;  5FTI A;  3Q29 A;  3E3K A;  3RN8 A;  2AL5 A;  3CVG A;  4U2R A;  3TEL A;  5B70 A;  2QFL A;  3TMG A;  5EYH A;  1ZKB A;  4GWZ A;  2XXR A;  4OVP A;  1LBV A;  1Y3Q A;  4YIC A;  3SKP A;  4TLM B;  1A54 A;  2PFZ A;  3C4M A;  4MFI A;  3MUQ A;  2CEY A;  1B5I A;  5FHN A;  3MP6 A;  3U92 A;  1QGX A;  1XOC A;  4YB5 A;  1URD A;  1N7W A;  4H65 A;  4O3C A;  1POT A;  1DSN A;  1I6Q A;  5AA4 B;  5KDT B;  1FTM A;  2UVG A;  1D4N A;  4Q5T A;  4WED A;  3PMV A;  2XX9 A;  1P1W A;  4O8M A;  3FV2 A;  1GVC A;  4TQU Q;  3IO4 A;  2ZZW A;  4PGP A;  2DXY A;  1VFE A;  3KBZ A;  3A3C A;  1B1X A;  4NF6 B;  1FPD A;  4X48 A;  3TTM A;  1MXX A;  2I48 A;  2KLF A;  3K2D A;  5JK4 A;  4R6Y A;  4P0G A;  5I59 A;  2GQ1 A;  4GXA A;  3MZ1 A;  5A5X A;  4PTK A;  3MJN A;  5H8Q A;  1OQG A;  1FQE A;  4H8J A;  1URS A;  1FBC A;  1XS5 A;  4NF0 A;  2HHM A;  1FBP A;  3HO7 A;  5EQA A;  1MXY A;  1P1N A;  1LBW A;  4GF8 A;  2ONR A;  1B3H A;  3G3J A;  2A5T A;  1MY0 A;  2UXA A;  2XXP A;  4ELR A;  2ALU A;  3ONM A;  2V3U A;  4U23 A;  4NF5 B; 
#chains in the Genus database with same CATH homology
 2HEU A;  1IUD A;  3O6H A;  4TOZ A;  3RTW B;  4GXS B;  3B6T A;  3T93 B;  1FTK A;  1QKA A;  1EZO A;  3ZSF A;  3R26 A;  4R2F A;  1MM6 A;  1LFI A;  3KSJ A;  3CSB A;  3H6V A;  3FD3 A;  3W9V A;  1MQJ A;  1YTV A;  1MPD A;  2XX7 A;  1SBP A;  1B40 A;  2E1S A;  4Q30 B;  3FV1 A;  4L17 A;  1B05 A;  4U1Z A;  2RC9 A;  4PFT A;  3GZG A;  2F5X A;  1TFA A;  3CG1 A;  4DDD A;  3T9V A;  2H99 A;  3V83 A;  1NNK A;  4KYS A;  2V93 A;  1OIB A;  1SQY A;  4IO3 A;  5BUU A;  4RYA A;  2X26 A;  4LZ7 A;  4LP2 B;  5CMB A;  1I6B A;  3ILU B;  3C36 A;  2XXY A;  1H44 A;  3WAF A;  4XKQ A;  4DZ1 A;  1TWY A;  3TQL A;  4NF4 A;  2X7P A;  2Z8F A;  3ZKL A;  2M8C A;  5J1D A;  5L9M A;  4GOT A;  2HQ0 A;  1JEU A;  1H76 A;  1ZJL A;  4PP0 A;  5I56 B;  2E0S A;  3U8Q A;  3CRB A;  4G68 C;  2I6E A;  4IO4 A;  1B32 A;  1MY3 A;  1MRP A;  1M5F A;  3H6U A;  4OER A;  3BFU A;  2Q8J A;  5DVI A;  1ATG A;  2ESN A;  1R6Z A;  3PV0 E;  5H8N B;  5DEX B;  2XD3 A;  4DIG A;  4ECF A;  2O1M A;  1D3K A;  2H5Y A;  3UP9 A;  3TKD A;  3PD9 A;  3USD A;  1TT1 A;  3MVX A;  4H1X A;  2R71 A;  4ESW A;  4QFP A;  3PD8 A;  2QRY A;  4FEC A;  4EQ7 A;  1LBB A;  1KWH A;  1IIT A;  4KI0 E;  4F31 B;  4ZEF A;  3CI8 A;  2P1S A;  4MF3 A;  2QS2 A;  1MPB A;  4F3S A;  4DE8 A;  1QKB A;  2OJT A;  5TU0 A;  4OXV A;  1JW5 A;  4KYE A;  1UQW A;  1B51 A;  2DWH A;  2F7B A;  3KN7 A;  2PVU A;  3SEU A;  4R9F A;  3FVK A;  4NWD A;  1URG A;  1QUK A;  1LAG E;  1OVB A;  2PT1 A;  1PB7 A;  4GRK A;  4LZ5 A;  3FGS A;  3T9U A;  4ONY A;  3M3F A;  2VGQ A;  1ZBM A;  4IGT A;  3QUF A;  1A55 A;  3MPL A;  4EQB A;  1NL5 A;  3V8X B;  2ZYN A;  4OTE A;  4R9G A;  5AE4 A;  2I4C A;  3PUY E;  3KOS A;  4KD5 A;  1N0T A;  1YCJ A;  4IO6 A;  3H6W A;  3TCG A;  3LBS A;  1S9T A;  3PPP A;  4JBZ A;  2DE2 A;  1IXI A;  4PFY A;  4OFL A;  1Y4T A;  4POW A;  1MDP 1;  1FQF A;  4X1B A;  2G29 A;  1B0H A;  2DOJ A;  3EPE A;  3KBR A;  5ITO A;  3FXQ A;  1WOD A;  3AXF A;  4YMA A;  2XD2 A;  5TP9 A;  3MC2 A;  3FXU A;  3K01 A;  3QIM A;  4U4S A;  2QL3 A;  4EF1 A;  1RYX A;  3TTL A;  1FTL A;  2F7A A;  3IO6 A;  3RLF E;  2V84 A;  1PC3 A;  2HXW A;  1YAE A;  3S9N C;  5I59 B;  1BIY A;  1OLA A;  4N07 A;  2DQV A;  2QJE A;  2AL4 A;  1P99 A;  1UIV A;  3IOU A;  3VLW A;  3G3H A;  5A5X B;  4H5F A;  2NVU B;  1SW1 A;  2Q9T A;  2XXU A;  1R1N A;  1SW5 A;  5H8Q B;  4THI A;  4M1V A;  3HHG A;  4YB6 A;  3A09 A;  1QJM A;  5DT6 A;  1A40 A;  5H8F A;  2A5T B;  2V3Q A;  4GL0 A;  1LAF E;  4DXU A;  3MWB A;  4POX A;  3UA8 A;  3RT6 B;  2CZL A;  4EXK A;  1ELJ A;  2REG A;  4KQP A;  3DEL B;  3TQW A;  3S9M C;  4BDQ A;  2B3F A;  4IO5 A;  1ZIU A;  2UYE A;  3N94 A;  4BDN A;  4DXC A;  3IOR A;  5ICQ A;  5CC2 A;  3S9E A;  1MXV A;  3Q25 A;  5ELV A;  3K6U A;  3IOT A;  1OQH A;  1JW4 A;  4XKR A;  1Y4C A;  5AA2 D;  1AMF A;  1Y20 A;  4ZDM A;  5HBC A;  5K2X A;  1PB8 A;  2DSF A;  2DXR A;  5I57 A;  3IR1 A;  1AH5 A;  4QFK A;  1B2H A;  1M5B A;  2ZNU A;  3HHF A;  5EHM A;  4YU0 A;  1UTB A;  4GL8 A;  5BWJ A;  2YPN A;  3OSR A;  1RKM A;  4O3B A;  4EF2 A;  1BP5 A;  4NF8 A;  3H3G A;  3CSG A;  1DOT A;  4ZZE A;  1JET A;  3U93 A;  1SDX A;  1B7Z A;  4ESX A;  4NE4 A;  1H43 A;  3FVG A;  4LQ2 A;  5L8D A;  2Z8D A;  2ANJ A;  4F1Y A;  3CFX A;  4R74 A;  1NH8 A;  4GLI A;  4NF4 B;  3FJM A;  3BFT A;  3LSF B;  1LCT A;  3C35 A;  1P1U A;  1M5D A;  2Q89 A;  3HPI A;  1IXG A;  3K00 A;  1MY1 A;  1N3X A;  1GV8 A;  2GH9 A;  2X7Q A;  2H25 A;  1LGB C;  4IO2 A;  4LVQ A;  3DM0 A;  4HCW A;  2QS4 A;  3PMW A;  3C32 A;  4RXL A;  3MVZ A;  1RYO A;  3UN6 A;  2DWI A;  4XKN A;  1N84 A;  3OO7 A;  4MH5 A;  4F3G A;  1IIW A;  3IOV A;  1A8E A;  4IY6 A;  4OET A;  4EQ9 A;  4ELP A;  2HCA A;  4F39 A;  5L9S A;  3CFZ A;  3C34 A;  4N6P A;  4QSD A;  3DLN A;  1L5T A;  1GR2 A;  4OEV A;  2ABH A;  2RC8 A;  1BKA A;  3S9L C;  4ZED A;  1MQI A;  3OMB A;  3KJT A;  3SEV A;  1VE4 A;  3ECR A;  1SW2 A;  2F6G A;  2Y7K A;  2UVI A;  3IB0 A;  1I69 A;  5AA2 A;  2Y7I A;  3MW0 A;  2NXO A;  5I58 A;  3T66 A;  3EHT A;  2RF1 A;  4U21 A;  3W9W A;  3DP6 A;  2OWS A;  5I2N A;  4BDL A;  3IOW A;  3L6G A;  3MQ9 A;  3RGY A;  1SI1 A;  3KOT A;  2DVC A;  3QK6 A;  4LA9 A;  4QFL A;  1USY H;  3G3K A;  4XIG Q;  2V3T A;  2QS1 A;  1IEJ A;  2F8D A;  3WAE A;  1LAH E;  1N7X A;  4F19 A;  2O69 A;  3OEL A;  2HAU A;  3O97 A;  2DWJ A;  1S50 A;  4WXJ A;  4BDR A;  2AYS A;  2F78 A;  3C31 A;  2DYX A;  2R6G E;  2GFE A;  4ZEK A;  1SYH A;  4OYV A;  1MM7 A;  2VOZ A;  2Z23 A;  1Z7M E;  3O29 A;  1OMP A;  1MQH A;  2HAV A;  3V5A A;  4R73 A;  3M8U A;  4ZE8 A;  5K2Y A;  1JVY A;  4MLQ A;  2NOO A;  1LCF A;  3QXM A;  4KFQ A;  2Q2A A;  4TLL B;  3KGC A;  5TP9 B;  1MQG A;  4LQ5 A;  2F34 A;  3TEP A;  4PFU A;  3VVD A;  2P2A A;  4YZZ A;  3QUJ A;  1POY 1;  3K0V A;  4U1O A;  4ISU A;  2O84 X;  3KSX A;  1DMB A;  3ZS6 A;  4I1D A;  1P1Q A;  4EDP A;  3H4Z A;  3KG2 A;  3UGW A;  4PE5 B;  4E0W A;  5LOM A;  3PMX A;  4IGR A;  2QPQ A;  4JWX A;  5CRY A;  3S2V A;  4F18 A;  3K6V A;  2ZNS A;  5FHO A;  4E0X A;  1NFT A;  1Y9U A;  4R6H A;  3H03 A;  3MPK A;  4QHQ A;  4MBP A;  5H8F B;  4BLA A;  2V25 A;  3IJX B;  3SES A;  3TZA A;  1MG1 A;  3A3U A;  4OES A;  3LUY A;  3THI A;  3EHS A;  2XX8 A;  4FEB A;  3QSL A;  2UVH A;  3O2A A;  3FIR A;  3TFL A;  3N6T A;  1B1H A;  2FYI A;  2QSX A;  3H7M A;  1JVX A;  4F2O A;  2F36 A;  2WKY A;  3JZJ A;  4RK9 A;  1Y3N A;  4I9D A;  2AIX A;  4G8H A;  1MY2 A;  2QS3 A;  1NMU A;  2GHB A;  5I2K B;  3B7D A;  5I57 B;  4G8N A;  3O9P A;  5AA1 A;  2GHA A;  3I5O A;  2THI A;  2O7I A;  3VFJ A;  2ZNT A;  3SET A;  1M5E A;  1HSJ A;  3N26 A;  4NTL A;  4GWO A;  1SVX B;  3N5L A;  1UTB B;  4Z0I A;  4EUO A;  2UYF A;  3RNN A;  1ZTY A;  5ISU A;  4NF8 B;  4UA8 A;  3HV1 A;  4P0I A;  5CBR A;  5CM6 A;  1OVT A;  2XXQ A;  3CG3 A;  1SD3 A;  1B5J A;  3RTF B;  2YLN A;  4FOR A;  1VFD A;  5JEI A;  1S7Y A;  4PET A;  4F22 A;  3O6G A;  4NMY A;  3UK4 A;  3KZG A;  3MZ9 A;  3FJG A;  4F29 A;  1NKX A;  3FAS A;  2OLB A;  5EYF A;  5L9O A;  4ZEI A;  5F1Q A;  2HFB A;  3JV9 A;  2DE3 A;  1DTZ A;  3PUX E;  1NNP A;  4KPT A;  3MBP A;  1MXZ A;  1PBP A;  3RQT A;  2DP8 A;  1EU8 A;  1B46 A;  3M3L A;  1WDN A;  3GBB A;  2DWA A;  4O3A A;  4DLD A;  1Q1K A;  2D21 A;  2H9B A;  2QMW A;  4HS7 A;  1LFG A;  4OEN A;  1EZP A;  2NUV A;  1P1O A;  3VLV A;  5ITP A;  2DS9 A;  1XC1 A;  3H06 B;  2VP1 A;  2F7C A;  4KYD A;  2F97 A;  4XKP A;  3G3G A;  3I6V A;  3RPW A;  4FAJ A;  3I3V A;  2PT2 A;  1LST A;  1B3E A;  4HTG A;  1JW1 A;  3FAT A;  3DP8 A;  2Y84 A;  5H8H A;  3HST A;  3DP4 A;  1M5C A;  2D3I A;  3TUS A;  3IK6 B;  5AA2 B;  1NNF A;  1QUI A;  2UVJ A;  5I58 B;  1GTK A;  4QFN A;  3OEM A;  5IAI A;  4G77 A;  5I2N B;  1D9V A;  4YKP A;  1AOV A;  3V89 B;  5DVJ A;  3PUW E;  2I3V A;  1UTH A;  2XXH A;  4AB5 A;  1Z7N E;  1DTG A;  3EQ1 A;  1B0L A;  1FTO A;  4DXB A;  4C0R A;  5I2K A;  3Q28 A;  4RNS A;  2IEE A;  1SW4 A;  4FJP A;  2I3W A;  1QW0 A;  1IXC A;  3CFL A;  1WVJ A;  2VD2 A;  4OFJ A;  4OFO A;  3BBR A;  1II5 A;  1YPN A;  3PPO A;  3JYR A;  4DCX A;  4LON B;  3OEN A;  1A7L A;  1SI0 A;  3Q27 A;  3KJ7 A;  3MAM A;  2ZXT A;  4R6K A;  3BKI B;  3K1P A;  1PDA A;  3OOA A;  3CIJ A;  1PB9 A;  4U4X A;  1DPE A;  5CI5 A;  4QSE A;  1SYI A;  3OO9 A;  4F2Q A;  3SEX A;  1AIV A;  2Y7W A;  3ILT B;  3U94 A;  3GBA A;  1XT8 A;  3TDJ A;  2OWT A;  4QF9 A;  4GVO A;  1Q35 A;  4JXI A;  4GFR A;  3C9H A;  1MS7 A;  3L6H A;  3FJ7 A;  4FAT A;  3S4U A;  4Z7E A;  3M3K A;  2RCB A;  2I4B A;  2D5W A;  3PPN A;  1MXW A;  5TPA A;  2ZYK A;  2RCA A;  1MPC A;  3MVW A;  1BTJ A;  4FE8 A;  4C1U A;  4F3B A;  4EXL A;  3OXN A;  4OZ9 A;  1H3D A;  1IXH A;  3MZB A;  2OCU A;  2B3B A;  1B58 A;  3T96 B;  1ZLQ A;  1MY4 A;  2W7Y A;  3VXB A;  1Y1M A;  3VXC A;  2IA4 A;  2Z22 A;  4NED A;  3CR9 A;  3TPA A;  2XXX A;  1CB6 A;  2O6A A;  4G68 A;  1UIU A;  2G93 A;  3R6U A;  3MP8 A;  2O51 A;  1EH3 A;  2I58 A;  2HZL A;  4N13 A;  4H5G A;  4HCY A;  2RC7 A;  3SDF A;  1B3F A;  5JTY A;  2HZK A;  4KCC A;  4R75 A;  3EF7 A;  4ZEB A;  1D9Y A;  4MLV A;  4RPO A;  2QMX A;  4H8I A;  1PBQ A;  2Z8E A;  3UIF A;  5H8S A;  5I84 A;  2VD3 A;  4H0W A;  4H6D A;  1R9L A;  3OO8 A;  3P7I A;  3G7W A;  3LR1 A;  1MH3 A;  3LSW A;  3FZV A;  1FQD A;  1LBC A;  3FVO A;  3K1N A;  4LZ8 A;  3F11 A;  4PQJ A;  1USY E;  2ZMB A;  1B52 A;  4F3P A;  4QRZ A;  2PBW A;  3E9X A;  1QVS A;  1ZU0 A;  1O63 A;  3LSX A;  1BLF A;  2O1L A;  4DCY A;  3B6Q A;  1T0K A;  1EZ9 A;  5M2V A;  1GGG A;  4LUB A;  3EHU A;  5IKB A;  3C33 A;  1AL3 A;  1MQD A;  2OZZ A;  4JB7 A;  1DPP A;  4G8M A;  5KCJ B;  1TFD A;  1B7H A;  1IQ7 A;  1TXF A;  3D4G A;  1Y1Z A;  1B9J A;  5DTB A;  1A99 A;  5KZT A;  3IL1 B;  2H98 A;  3RY3 A;  3VLU A;  3TOD A;  4F1U A;  4ELQ A;  4JWO A;  3Q26 A;  1JNF A;  1N04 A;  4IB2 A;  2YJP A;  4Q0C A;  1FCK A;  2XXW A;  4OMB A;  3VVE A;  1FQB A;  1R9Q A;  3VVF A;  3K6W A;  1VSO A;  4RJZ A;  4F1V A;  5CMK A;  1O7T A;  3R7X A;  3SER A;  4GIZ A;  3PGF A;  3D4C A;  1JQF A;  5AA4 A;  5B7D A;  5KDT A;  3OEK A;  1XVY A;  3HN0 A;  3MVY A;  5FHM A;  1N3W A;  3TYH A;  1J1N A;  4KCD A;  4OWD A;  4K3F A;  4JSO A;  4YKJ A;  4AQ4 A;  4YMB A;  1CE2 A;  4NF6 A;  3IB1 A;  2OBG A;  4ZEC A;  1I6A A;  2H4I A;  1B6H A;  2I0B A;  3K6X A;  5F7V A;  1XHY A;  2VHA A;  4Q8R A;  3LC8 A;  4BDO A;  5H8H B;  1Y3P A;  4HW8 A;  3LSL A;  4X1D A;  1O64 A;  1B4H A;  2P0S A;  4P11 A;  2ONK E;  1US5 A;  1JEV A;  4ND9 A;  3IJO B;  4G4P A;  5EHS A;  1ANF A;  4IO7 A;  4ZE9 A;  1US4 A;  3PPQ A;  3FUZ A;  3IX1 A;  4JWY A;  1UTH B;  2B65 A;  4NF5 A;  2Y7R A;  3KN8 A;  4PFW A;  1HSL A;  3T9H B;  1PEB A;  2PYY A;  3RT8 A;  4R72 A;  4OEU A;  4WEP A;  2CMO A;  1F9B A;  3KFM A;  2FA7 A;  2I0C A;  5HM4 B;  3MP1 A;  3K02 A;  2I49 A;  4YAH X;  2DE4 A;  1LAX A;  4ZZA A;  4BDM A;  4RPN A;  1N76 A;  3ZKK A;  1QUL A;  4AB6 A;  1ZMG A;  1LFH A;  4JSD A;  1XVX A;  1B4Z A;  5DYH A;  1OLC A;  3KN3 A;  3G3F A;  3PUZ E;  3K4U A;  3PUV E;  3G3I A;  4OQO A;  2XXI A;  4YB7 A;  3T22 A;  3FXR A;  3PPR A;  3H6T A;  4ELO A;  2O7U A;  5KCJ A;  2LAO A;  4R2B A;  4FED A;  3EN3 A;  2ZYO A;  3VDF A;  1A8F A;  3IB2 A;  2RKM A;  1HSE A;  2XXV A;  3VV5 A;  3N6U A;  3PU5 A;  4I62 A;  2ZYM A;  4M4G A;  2FNC A;  3QAX A;  1LLS A;  2ONS A;  4NWC A;  4H67 A;  3TTR A;  3ODB A;  5AA3 A;  5TPA B;  1FTJ A;  3TCF A;  2BJJ X;  1VR5 A;  3TTN A;  3TAJ A;  2F35 A;  3UOR A;  4UAC A;  2Y7P A;  4QSC A;  2XXT A;  2REJ A;  4RY1 A;  3IAZ A;  2RIN A;  3E13 X;  5I56 A;  2Q2C A;  1FQA A;  3QYT A;  4GD5 A;  4U22 A;  3OO6 A;  2O68 A;  3GXA A;  3U72 A;  5CMM A;  1MXU A;  4G68 B;  1IZ1 A;  3SEY A;  3VE1 B;  1B3L A;  3FVN A;  5H8N A;  4ZS9 A;  5DEX A;  4RK2 A;  4RA1 A;  1QUJ A;  4IY5 A;  5JTY B;  4OHN A;  5ICT A;  1FQC A;  4OVJ A;  3HCQ A;  4XXU A;  5FTH A;  3K1M A;  2GRV A;  2R9J A;  4WKM A;  4KHZ E;  3OSQ A;  2NWJ A;  1MDQ A;  3T9X B;  4LAT A;  2XHD A;  3GLB A;  3W15 C;  3SEW A;  3OD7 A;  2PX1 A;  4I8C A;  3TCH A;  4KR5 A;  3E4R A;  2A5S A;  4C1T A;  1NNT A;  3TTK A;  5CMC A;  4YKK A;  4XTC Q;  1LB9 A;  2OK2 A;  4GQO A;  3O66 A;  4G2Z A;  2F6P A;  3O28 A;  5DVF A;  5CBS A;  1LB8 A;  1B7U A;  4JDF A;  2PMS A;  5HPQ A;  4FIM A;  2DVZ A;  3KEI A;  1H45 A;  4YKI A;  3O6I A;  1B3G A;  4QFO A;  4X9T A;  1NH7 A;  1B5H A;  1FW0 A;  3B6W A;  2Q88 A;  1MH4 A;  3RUM A;  3U1O A;  5FTI A;  3Q29 A;  3E3K A;  3RN8 A;  2AL5 A;  3CVG A;  4U2R A;  3TEL A;  5B70 A;  3TMG A;  1ZKB A;  2XXR A;  1Y3Q A;  4YIC A;  3SKP A;  4TLM B;  1A54 A;  3C4M A;  4MFI A;  3MUQ A;  1B5I A;  5FHN A;  3MP6 A;  3U92 A;  1XOC A;  4YB5 A;  1URD A;  1N7W A;  4H65 A;  4O3C A;  1POT A;  1DSN A;  1I6Q A;  5AA4 B;  5KDT B;  1FTM A;  2UVG A;  1D4N A;  4Q5T A;  4WED A;  3PMV A;  2XX9 A;  1P1W A;  3FV2 A;  1GVC A;  4TQU Q;  3IO4 A;  2DXY A;  1VFE A;  3A3C A;  1B1X A;  4NF6 B;  4X48 A;  3TTM A;  1MXX A;  2I48 A;  2KLF A;  3K2D A;  5JK4 A;  4R6Y A;  4P0G A;  5I59 A;  4GXA A;  3MZ1 A;  5A5X A;  3MJN A;  5H8Q A;  1OQG A;  1FQE A;  4H8J A;  1URS A;  1XS5 A;  3HO7 A;  1MXY A;  1P1N A;  4GF8 A;  2ONR A;  1B3H A;  3G3J A;  2A5T A;  1MY0 A;  2UXA A;  2XXP A;  4ELR A;  2ALU A;  3ONM A;  2V3U A;  4U23 A;  4NF5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...