2H99A

Crystal structure of the effector binding domain of a benm variant (r156h,t157s)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
KTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHSLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator benM
publication title Inducer responses of BenM, a LysR-type transcriptional regulator from Acinetobacter baylyi ADP1.
pubmed doi rcsb
source organism Acinetobacter sp.
molecule tags Transcription
total genus 71
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h99A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h99A02
3CFLA 4RPNA 4OVJA 4KCDA 1UTHA 3SEUA 5I58A 1P1QA 4TLMB 3IO4A 1FCKA 1IITA 2ZMBA 1QUJA 1LB8A 1MXVA 1HSJA 5KDTA 1IQ7A 1B3LA 3FVGA 5K2XA 4MLVA 1MPBA 3LUYA 3KSJA 4YZZA 5ITOA 3HV1A 2O7UA 5TP9B 4DXCA 4N13A 2QSXA 4NEDA 1ZMGA 2ALUA 1SYHA 3CFZA 4P0IA 3V5AA 4RK2A 2O84X 4RJZA 4G68A 2Y7PA 4QFKA 4U2RA 2QS4A 5H8HA 2H25A 4PETA 3LSFB 1XT8A 2F7CA 4KHZE 2HCAA 3PUYE 3MVYA 1UIUA 2ZNSA 4LVQA 3E4RA 2M8CA 1US5A 1FTJA 1NNKA 4N6PA 4YB6A 3C34A 2HZLA 1JVYA 3E13X 1Y4TA 2PMSA 2G93A 1CE2A 2V25A 3TTMA 1B3GA 1NMUA 4YKJA 1FQEA 1I6QA 2ZYOA 4GLIA 3FVKA 4MH5A 4MFIA 5ITPA 3MUQA 3H4ZA 5DTBA 3KBRA 1H3DA 3K1NA 1IXHA 4X1BA 5KCJB 3PMWA 4K3FA 1J1NA 1GVCA 1N04A 5FTIA 3K2DA 1I6BA 2Q8JA 3RQTA 1BIYA 3IB0A 4XKRA 1YCJA 1AL3A 3OO8A 3SETA 4H8JA 1NNTA 3KGCA 2B3FA 2QJEA 1SI1A 1R9QA 4PFUA 2XX8A 1VR5A 1XHYA 2OWTA 2R71A 4H0WA 4YKKA 4R73A 4MBPA 2UVJA 3QIMA 2PVUA 3H6TA 3KJ7A 3PV0E 2B3BA 3EPEA 4DDDA 4I8CA 3CR9A 1IUDA 1I6AA 1QULA 3PGFA 4DCYA 1MG1A 1JW4A 1EU8A 4XTCQ 5M2VA 1H76A 3F11A 2O68A 4NF4B 4YB5A 1H44A 1N3XA 3Q27A 1SQYA 2HFBA 3GBAA 4KYDA 4KPTA 4I9DA 1XVXA 5CMKA 4PE5B 2O6AA 3JYRA 3K6WA 3OSQA 4YKPA 3ZKKA 4IY5A 2UYEA 5CMBA 3QK6A 2HQ0A 1R9LA 3CVGA 2RKMA 1USYH 2OK2A 3PUWE 4YB7A 2XXRA 2D21A 3IOTA 2XXPA 3R26A 4LQ2A 4I1DA 2GH9A 1LFIA 3QAXA 3S4UA 4KYSA 1A40A 3O29A 4UA8A 2Y7RA 4RA1A 1B1HA 1P1UA 3ZSFA 3UA8A 5FTHA 3I6VA 3MP6A 3TCFA 5I59B 4DE8A 3VFJA 1O7TA 4HW8A 2I49A 4GVOA 2O69A 2V3QA 4R74A 4IGTA 3EF7A 1OQHA 1Z7ME 4KQPA 2VP1A 3H06B 1R6ZA 3Q29A 4X48A 4ZEKA 1MY4A 4G8MA 4R2BA 4FORA 2XD3A 3DELB 2I4BA 2XXIA 3VLWA 3H3GA 1ZJLA 1B9JA 2DWJA 4OFJA 1DMBA 1JW5A 1PEBA 2QMXA 5IAIA 5CI5A 3N6UA 4OYVA 5A5XA 1B5JA 1MRPA 3MQ9A 3BFUA 2DOJA 1WDNA 4F1YA 3DLNA 1ELJA 3TTRA 3OMBA 3VDFA 4FE8A 1FW0A 3B6QA 1A8FA 4XKPA 4F2QA 2F35A 1T0KA 2ZNUA 4XIGQ 2XXWA 3RLFE 3OD7A 1M5DA 4QSEA 4IO2A 2PBWA 5AA2D 3VLUA 3VVEA 2XXHA 1SD3A 3WAFA 4OETA 2HZKA 2RC8A 2Q89A 3G3FA 1MQJA 3EHUA 1H45A 1B46A 3K4UA 1FQBA 2VD3A 4R9GA 5ELVA 4IO5A 3KFMA 1TXFA 2RCAA 4PQJA 3FXRA 3WAEA 1Y3QA 3ILTB 3FXUA 3OENA 1HSLA 3OEKA 5CRYA 4EXLA 4R75A 4G68C 2F7BA 4BDLA 3OO7A 4OZ9A 3LBSA 1UQWA 3KN8A 4GL0A 3K6VA 3C35A 3CRBA 3ILUB 4RNSA 1H43A 3I3VA 4EF2A 2P0SA 3FGSA 5CMMA 1M5BA 4N07A 2O1MA 2RC7A 2F6PA 1UTBB 3DP4A 3FJGA 4Q5TA 2CMOA 1II5A 4IO7A 4OEUA 1MY0A 5L9MA 1BP5A 1HSEA 5B7DA 3M3KA 1VSOA 1US4A 4GXSB 3IJXB 4X1DA 3CI8A 4KCCA 4LZ7A 3O6HA 2QS3A 4EF1A 5AA2B 3KN3A 3OOAA 3U92A 1NL5A 5HM4B 1FTKA 4O3AA 4GRKA 1LAXA 5IKBA 4QFNA 4RYAA 4DZ1A 4G8HA 1WVJA 1A7LA 2OCUA 3MVZA 1UTHB 2AL5A 3PPNA 5JTYA 5I58B 4X9TA 4ELPA 2F97A 1JVXA 5AA4A 4BLAA 4NF6B 1B3EA 5KDTB 2ONSA 3ODBA 4JSDA 2XD2A 2QPQA 3G7WA 5AA1A 4F3PA 1PB9A 5EYFA 3TKDA 1LFHA 1ZTYA 3U93A 2Y7WA 3KG2A 4G8NA 3RUMA 3I5OA 3GLBA 3K6XA 4F31B 4FJPA 2REJA 3KOSA 4G68B 1QUIA 3BBRA 5H8HB 3W9VA 2I0BA 4EDPA 1MQHA 3IJOB 2F36A 2F5XA 3TFLA 4OMBA 4ND9A 2V93A 1PBPA 4F3BA 2BJJX 4OERA 1QW0A 4JWXA 4IY6A 1N7XA 3DP8A 3N26A 4F3GA 1D4NA 2I58A 2Y84A 1MQDA 4LQ5A 3T22A 2DSFA 3IB1A 3HHGA 3LC8A 1SW2A 1RKMA 2D3IA 1IIWA 2XHDA 4H5GA 1B58A 3TTNA 3DP6A 2DVZA 2HAUA 3K00A 5JEIA 1KWHA 2AIXA 3FIRA 4JB7A 1URSA 3TODA 2GFEA 3MZ9A 1MDP1 2VD2A 1XC1A 5BUUA 4P0GA 4L17A 4H5FA 4GXAA 2H99A 4NF8A 1IEJA 3PD9A 3RT8A 1MH3A 1OVBA 1MY1A 4U23A 2QS1A 2ESNA 5JK4A 1EZ9A 3TCHA 3UN6A 3DM0A 2R9JA 4KFQA 2XX9A 1LSTA 4FEBA 1ZIUA 3MZBA 4R6KA 3O28A 3N6TA 4HCYA 5DT6A 1B7HA 1ANFA 4ELQA 2Z8DA 3H6VA 2DWIA 5DVIA 1QKAA 5AE4A 1FTLA 4PFWA 2X7QA 4GD5A 4U4XA 1P99A 2QRYA 4U22A 1FQAA 2UYFA 3FATA 3C9HA 3O6GA 2F34A 5TPAA 3IB2A 1B2HA 2F8DA 4ZZAA 3IK6B 2P1SA 3FZVA 3MBPA 4XKNA 4PP0A 2DYXA 3MP1A 2RINA 1PDAA 1SDXA 4E0XA 2VGQA 4G77A 2NWJA 3A09A 2NXOA 3FVOA 2F6GA 3CG3A 3T9UA 3MPLA 3QSLA 3IL1B 4Z0IA 4BDRA 4KR5A 3TEPA 4H67A 3E9XA 5I56A 3SEXA 2Y7IA 3USDA 2QL3A 1NKXA 3T93B 1NH8A 4FIMA 3FV1A 2O7IA 3U94A 3FV2A 3A3CA 4ECFA 1BTJA 4GQOA 4LP2B 5H8NA 1POY1 4H8IA 3LSLA 1L5TA 1OVTA 4C1UA 1MM6A 4U1ZA 4IO6A 1OQGA 4QHQA 1PB8A 4DCXA 2YJPA 1A99A 1LBBA 1Y1MA 3HO7A 4U1OA 3KSXA 3PPOA 2WKYA 2D5WA 3G3GA 3B7DA 1SW4A 3FD3A 1TWYA 3TZAA 3UIFA 4QFOA 2REGA 3OXNA 3T9XB 2G29A 1DPPA 2A5TA 4ELOA 1PC3A 1B0HA 5DEXA 1B32A 3MW0A 3C31A 3PUXE 3S2VA 1O64A 5L8DA 3MJNA 4AB6A 1AMFA 4YKIA 3MP8A 2GHAA 1QVSA 5I2KA 3N94A 4LUBA 2AYSA 4R6HA 3R6UA 1TT1A 1B4HA 4G2ZA 3SESA 1P1NA 2ZYMA 4ZECA 4DIGA 4FAJA 4AQ4A 4GWOA 3P7IA 3CIJA 1DSNA 1Y3PA 4OXVA 1NNFA 3CG1A 1BLFA 3MWBA 4U21A 3MAMA 3FXQA 2THIA 3TUSA 1B52A 2XX7A 4YMBA 1B3FA 1BKAA 1MPCA 1SW5A 2Z8FA 2FA7A 2PX1A 2HXWA 3V83A 2DE4A 1N0TA 1MY2A 4HS7A 4TQUQ 2OZZA 4M1VA 3GZGA 4ZS9A 4F1VA 2I48A 1FQCA 3FASA 3SEYA 3T9VA 5ICTA 2XXYA 5AA3A 3QUFA 2VOZA 4YMAA 2YPNA 5TU0A 3RTWB 3MVXA 1M5CA 5B70A 1MY3A 3CFXA 1SI0A 4NF5A 1LCTA 1FQFA 5I2NB 4Q8RA 1NFTA 1GV8A 1O63A 1OLAA 4OHNA 2DE3A 1URDA 5CC2A 3KN7A 5CBRA 4C1TA 3TQLA 1LAFE 3B6WA 3O97A 5HBCA 2PYYA 1POTA 3PPQA 4ZEFA 1JETA 3M3LA 1TFAA 5JTYB 2Z8EA 3T66A 2XXTA 4QSDA 3FJ7A 3UP9A 1FQDA 3KZGA 4Q0CA 1F9BA 4PFTA 2B65A 3M8UA 4ONYA 2ABHA 2KLFA 3VVFA 4EUOA 1D9YA 1Q1KA 5I57A 3SKPA 2A5SA 4DXUA 1ATGA 4BDOA 3VV5A 3PPPA 3RY3A 2RF1A 5DVFA 1M5FA 4E0WA 2R6GE 4ESXA 4EQ9A 2E1SA 2RCBA 3E3KA 3C36A 3TELA 1Q35A 4OFLA 2OBGA 3HPIA 2DS9A 3EQ1A 4JSOA 3KJTA 1B7UA 1JQFA 3PPRA 3ZKLA 2ANJA 2YLNA 3B6TA 1MXYA 4YAHX 3M3FA 3K02A 2V84A 2UVIA 1EH3A 4OTEA 4RK9A 3MVWA 2QS2A 4H6DA 1ZLQA 4H65A 1NH7A 3Q28A 2DVCA 3EN3A 1GTKA 2Z22A 1B5IA 4MF3A 1MQIA 3D4GA 2V3UA 3IOVA 3PMXA 1SVXB 2ZXTA 5H8FA 4F1UA 4F3SA 3KOTA 4EQ7A 3TAJA 1P1WA 5F1QA 1TFDA 3O9PA 4JDFA 4EQBA 4P11A 1UTBA 2E0SA 1IXGA 3MPKA 2GHBA 4KYEA 2NOOA 4NF8B 4NE4A 4YU0A 4ZE9A 3IX1A 4OFOA 2XXVA 3VXCA 5H8SA 3HCQA 5AA2A 3CSGA 2GRVA 1LLSA 3U8QA 3OSRA 4H1XA 3H03A 1A55A 4UACA 3S9NC 3TYHA 2OLBA 5BWJA 1AIVA 1S9TA 5L9OA 1ZKBA 1N76A 1B5HA 4WEDA 5CBSA 1B7ZA 2UVHA 2X26A 3O2AA 3ONMA 4LZ8A 5I84A 4NF6A 3H6WA 2ONKE 3G3JA 3BKIB 3TTKA 2P2AA 5EHMA 5FHOA 5TPAB 4O3BA 4HTGA 5J1DA 5EHSA 1ZBMA 3TCGA 4IB2A 3JV9A 1GGGA 4AB5A 4F19A 1Z7NE 5H8QA 1P1OA 3FUZA 3S9MC 4GOTA 1XVYA 1YAEA 4NMYA 3T96B 3KEIA 3H6UA 2IEEA 4RPOA 5I56B 1Y1ZA 3RPWA 3S9LC 1SYIA 1PB7A 2DXRA 4F39A 4LATA 1MXWA 1MXZA 1IXCA 1AH5A 2XXUA 4F18A 4OQOA 2I0CA 1LFGA 4XKQA 3K1PA 5H8NB 3U1OA 3MC2A 3C4MA 3HHFA 2OWSA 2Q9TA 3VLVA 2UVGA 3RTFB 3AXFA 3OEMA 5TP9A 4BDNA 4Q30B 4G4PA 1MM7A 3SDFA 3PUZE 1Y4CA 4ZEDA 4ZEIA 3LSWA 4WKMA 4DXBA 2FNCA 3OO6A 2A5TB 4YICA 4ZDMA 5ICQA 2H9BA 5DEXB 2PT2A 4GF8A 3TDJA 5L9SA 3QXMA 1CB6A 1UIVA 4ELRA 2Q2CA 4ISUA 1LAHE 3EHSA 2X7PA 5ISUA 3G3HA 1GR2A 5I2KB 1VFDA 2FYIA 3OELA 3L6HA 2H5YA 4C0RA 4IO3A 2LAOA 2DWHA 3JZJA 3TMGA 3IAZA 3VVDA 1MH4A 4GIZA 2I3VA 1RYXA 2H98A 3BFTA 1LB9A 1OIBA 4LA9A 1LCFA 1MXUA 5CM6A 3HSTA 4POWA 3K6UA 2I4CA 2UXAA 5KCJA 2XXQA 1VE4A 5DYHA 3PMVA 1B40A 1D9VA 2RC9A 2F78A 4DLDA 3L6GA 3TPAA 1WODA 5A5XB 2NVUB 1URGA 3G3KA 3RT6B 1LBCA 4QRZA 4PFYA 1EZPA 3QUJA 1LAGE 1DTZA 5FHNA 1JW1A 2CZLA 4Z7EA 1MXXA 1OLCA 3VE1B 2F7AA 4JWOA 1PBQA 1A8EA 3D4CA 3PUVE 4KD5A 1IZ1A 1JNFA 4BDMA 4NF5B 2PT1A 3LR1A 4GL8A 2XXXA 3G3IA 1S50A 1DPEA 4NF4A 3H7MA 4QFLA 5DVJA 3GXAA 2HAVA 3K0VA 4WXJA 3UORA 3FVNA 1JEUA 3SEVA 2I6EA 3SERA 1YTVA 4TLLB 1B4ZA 4RY1A 4FATA 1DTGA 4XXUA 3QYTA 1B51A 3EHTA 2H4IA 4JWYA 4HCWA 2QMWA 3U72A 1MDQA 1Y9UA 1B3HA 5I57B 4TOZA 1B05A 4FEDA 3V89B 4F29A 1B0LA 2O51A 4WEPA 2DWAA 4FECA 4BDQA 3LSXA 3O6IA 3GBBA 3K01A 2I3WA 3K1MA 2W7YA 1SW1A 5I59A 4OEVA 1QKBA 1N84A 2O1LA 1R1NA 1RYOA 3C32A 4R72A 1VFEA 3C33A 4KI0E 2ONRA 4OENA 3CSBA 4F22A 2DQVA 4LZ5A 3UK4A 3OO9A 3THIA 5AA4B 1Y3NA 3ZS6A 3VXBA 4LONB 1USYE 3IOWA 3TTLA 1YPNA 1OMPA 3RNNA 3S9EA 4ZZEA 4U4SA 2DE2A 1Y20A 5H8FB 3PU5A 2NUVA 3IO6A 1D3KA 1XOCA 1NNPA 1LGBC 4NWDA 2Q88A 2Q2AA 1XS5A 4R2FA 4M4GA 2ZYNA 5F7VA 4O3CA 3IR1A 2Z23A 4NTLA 3V8XB 5K2YA 5I2NA 5FHMA 5LOMA 1M5EA 4EXKA 3N5LA 1QJMA 1N7WA 3UGWA 4I62A 4ZE8A 2AL4A 4MLQA 3Q25A 1A54A 2OJTA 4ESWA 3PD8A 4QF9A 2ZNTA 4IGRA 1IXIA 1S7YA 3FJMA 3IOUA 1FTOA 2Y7KA 1AOVA 3A3UA 3W9WA 3R7XA 4OESA 2IA4A 2HEUA 1JEVA 3IORA 1FTMA 2V3TA 3W15C 3HN0A 4QSCA 3SEWA 2DP8A 1MPDA 3Q26A 4GFRA 2VHAA 3ECRA 1MS7A 4THIA 1DOTA 3T9HB 1ZU0A 1B6HA 3O66A 3TQWA 1QUKA 2ZYKA 4RXLA 4ZEBA 1I69A 3RN8A 4QFPA 3MZ1A 4JXIA 3RGYA 2DXYA 5H8QB 4F2OA 1MQGA 4NWCA 1EZOA 1N3WA 5CMCA 5KZTA 5HPQA 1SBPA 4OWDA 4IO4A 1B1XA 4R6YA 4R9FA 4JBZA 4POXA
chains in the Genus database with same CATH superfamily
3CFLA 2WYPA 1NV3A 4RPNA 4OVJA 4JVDA 4NX1A 4KCDA 1UTHA 3SEUA 5I58A 1P1QA 4TLMB 3IO4A 1FCKA 1IITA 2ZMBA 1QUJA 1LB8A 1DCUA 1MXVA 1HSJA 1FPDA 5KDTA 2BJIA 3FXBA 1IQ7A 1B3LA 3FVGA 5K2XA 4MLVA 1MPBA 3LUYA 3KSJA 4YZZA 5ITOA 3HV1A 2O7UA 5TP9B 5IZ3A 4N13A 4DXCA 2QSXA 2HHMA 4NEDA 1ZMGA 2ALUA 1SYHA 3MYUA 3CFZA 4P0IA 3V5AA 4RK2A 4PE3A 2O84X 4RJZA 4G68A 2Y7PA 4QFKA 4U2RA 2QS4A 5H8HA 2H25A 4PETA 3LSFB 1XT8A 2F7CA 4KHZE 2HCAA 3PUYE 1FJ9A 3MVYA 1UIUA 2ZNSA 2PFZA 4LVQA 3SZPA 3T1BA 4PAIA 3E4RA 5DW8A 2M8CA 1US5A 1FTJA 1NNKA 4N6PA 4YB6A 3C34A 2HZLA 2FHYA 1K9ZA 1JVYA 3E13X 2OX3A 1Y4TA 1FPLA 2PMSA 2G93A 1CE2A 2V25A 3TTMA 1B3GA 1NMUA 4YKJA 1FQEA 4OVTA 3HFUA 1I6QA 4P56A 2ZYOA 2WYKA 4GLIA 3FVKA 4MH5A 4MFIA 4O94A 5ITPA 3MUQA 3H4ZA 5DTBA 1G0IA 1H3DA 3KBRA 3K1NA 1IXHA 4PGNA 4X1BA 5KCJB 3PMWA 4K3FA 1J1NA 1GVCA 4MHFA 1N04A 5FTIA 4O8MA 3K2DA 1I6BA 2Q8JA 4PF6A 3RQTA 1BIYA 3IB0A 4XKRA 1YCJA 1NV1A 1AL3A 3OO8A 2ZZWA 5A5LA 3SETA 4MCOA 4H8JA 1NNTA 3KGCA 2B3FA 2QJEA 3RPLB 1Q9DA 1SI1A 1R9QA 4PFUA 2XX8A 1VR5A 1XHYA 2OWTA 2R71A 4H0WA 4YKKA 4R73A 4PDDA 4MBPA 2UVJA 3QIMA 2PVUA 3H6TA 3KJ7A 3PV0E 2B3BA 3EPEA 4DDDA 4I8CA 3CR9A 1IUDA 5IZZA 1FPIA 1I6AA 1FBHA 1QULA 2Q8MA 3PGFA 4DCYA 1MG1A 1JW4A 1EU8A 3RYDA 4XTCQ 5M2VA 1H76A 3F11A 2O68A 4PFIA 4NF4B 4YB5A 1H44A 1N3XA 3Q27A 1SQYA 2HFBA 3GBAA 4KYDA 2L5VA 4KPTA 4I9DA 1XVXA 4GBVA 4HXVA 5CMKA 2HXRA 4PE5B 5I5PA 2O6AA 3JYRA 3K6WA 3OSQA 4YKPA 3ZKKA 4IY5A 2UYEA 1FPEA 5CMBA 3QK6A 2HQ0A 1R9LA 3CVGA 2RKMA 3CHGA 1USYH 2OK2A 3PUWE 4YB7A 2XXRA 2D21A 3IOTA 4PGPA 3GYYA 2XXPA 3R26A 4LQ2A 4I1DA 3KC1A 2GH9A 1LFIA 3QAXA 3S4UA 4H46A 4KYSA 1A40A 3O29A 4UA8A 2Y7RA 4RA1A 1B1HA 3ISPA 1P1UA 3ZSFA 3UA8A 5FTHA 2FIXA 3I6VA 3MP6A 3TCFA 5I59B 4DE8A 3VFJA 1O7TA 4HW8A 2I49A 4GVOA 2O69A 2V3QA 4R74A 4IGTA 3EF7A 1OQHA 1NI9A 1Z7ME 4KQPA 2VP1A 3H06B 1R6ZA 3Q29A 4X48A 4G61A 5ET7A 4ZEKA 1MY4A 4G8MA 1VDWA 4R2BA 4OANA 4FORA 2XD3A 3DELB 1FPBA 2I4BA 2XXIA 3VLWA 3H3GA 4XEQA 1ZJLA 1B9JA 2DWJA 4OFJA 1DMBA 1JW5A 1PEBA 2QMXA 5IAIA 5CI5A 3N6UA 4OYVA 5A5XA 1B5JA 1MRPA 3MQ9A 3BFUA 2DOJA 1WDNA 2FIEA 4F1YA 3DLNA 4X8RA 1ELJA 3TTRA 3OMBA 3VDFA 4FE8A 1FW0A 3B6QA 1A8FA 4XKPA 4F2QA 2F35A 1T0KA 2ZNUA 4XIGQ 2XXWA 3RLFE 3OD7A 4HE0A 1M5DA 4QSEA 3FBPA 4IO2A 2PBWA 5AA2D 4MNIA 3VLUA 3VVEA 2XXHA 3A29A 1SD3A 3WAFA 3IFAA 4OETA 2HZKA 2RC8A 2Q89A 3G3FA 1LBZA 1MQJA 1QGXA 3EHUA 1H45A 1B46A 4GWXA 3K4UA 1FQBA 4OA4A 2VD3A 1XI6A 4R9GA 5ELVA 4IO5A 3KFMA 1TXFA 2RCAA 4PQJA 3FXRA 2KR0A 3WAEA 2QVUA 1Y3QA 3ILTB 3FXUA 3OENA 1HSLA 3OEKA 5CRYA 4EXLA 4R75A 4G68C 2F7BA 4BDLA 3OO7A 1RDYA 4DI3D 4N15A 4OZ9A 4N91A 3LBSA 1UQWA 3KBZA 3KN8A 4GL0A 4MAGA 3K6VA 3C35A 3CRBA 3ILUB 4RNSA 1H43A 2CZIA 3I3VA 4EF2A 2P0SA 3FGSA 5CMMA 1M5BA 4N07A 4PF8A 2O1MA 2RC7A 2F6PA 1UTBB 3DP4A 3FJGA 3QMFA 4Q5TA 3LV0A 2CMOA 1II5A 1LBYA 4IO7A 4OEUA 1MY0A 5ET8A 5L9MA 1BP5A 1HSEA 5B7DA 5IZ1A 3M3KA 1VSOA 1US4A 4GXSB 4MIJA 3IJXB 4X1DA 3CI8A 4KCCA 4LZ7A 3O6HA 2QS3A 4PFRA 4EF1A 5AA2B 3KN3A 5IM2A 3OOAA 3U92A 1NL5A 5HM4B 1FTKA 4O3AA 2QFLA 4GRKA 1LAXA 5IKBA 4QFNA 4RYAA 4DZ1A 4G8HA 1WVJA 1A7LA 2OCUA 3MVZA 1UTHB 2AL5A 4GBWA 2FVZA 3PPNA 5JTYA 5I58B 4X9TA 4ELPA 2F97A 1JVXA 5AA4A 4BLAA 4NF6B 3U65A 1B3EA 5IGAA 4N8GA 5KDTB 2ONSA 3ODBA 4JSDA 2XD2A 1BK4A 2QPQA 3G7WA 5AA1A 4F3PA 1PB9A 5EYFA 3TKDA 1LFHA 1ZTYA 3U93A 2Y7WA 3KG2A 4G8NA 3RUMA 3I5OA 3GLBA 3K6XA 4F31B 2XXKA 4OVSA 4FJPA 2REJA 3KOSA 4G68B 1QUIA 2Q74A 3BBRA 5H8HB 3W9VA 2I0BA 2XWIA 4EDPA 1MQHA 3IJOB 2F36A 2F5XA 4PBHA 3TFLA 2B4MA 4OMBA 4ND9A 2V93A 1PBPA 4GWZA 4F3BA 2BJJX 4OERA 1QW0A 4JWXA 4IY6A 1N7XA 3DP8A 3N26A 4F3GA 1D4NA 2I58A 5I3SA 2Y84A 1MQDA 4LQ5A 3T22A 2DSFA 3IB1A 3HHGA 3LC8A 1SW2A 1RKMA 4FBPA 2D3IA 1IIWA 1LBVA 2XHDA 4H5GA 1B58A 3TTNA 3DP6A 2DVZA 1NUWA 2HAUA 1NUXA 4PCDA 3K00A 4I3EA 5JEIA 1KWHA 2AIXA 3FIRA 4JB7A 1URSA 3TODA 1K9YA 2GFEA 3MZ9A 1MDP1 2VD2A 1XC1A 5BUUA 2CEXA 4P0GA 4L17A 4H5FA 4GXAA 2H99A 4NF8A 1IEJA 3PD9A 3RT8A 1MH3A 1OVBA 1MY1A 4N17A 4U23A 2QS1A 2ESNA 5JK4A 1EZ9A 3TCHA 3UN6A 3DM0A 2R9JA 4KFQA 2XX9A 1LSTA 4FEBA 1ZIUA 3MZBA 4R6KA 3O28A 3N6TA 4N6KA 4HCYA 5DT6A 1B7HA 4P47A 1ANFA 1FBFA 4ELQA 2B4LA 2Z8DA 3H6VA 2DWIA 5DVIA 1QKAA 4JVIA 5AE4A 1FTLA 4XFEA 4PFWA 2X7QA 4GD5A 4U4XA 1P99A 1KA1A 2QRYA 4U22A 1FQAA 2UYFA 3FATA 5EQ9A 3C9HA 3O6GA 2F34A 5TPAA 3IB2A 1B2HA 2XWVA 2F8DA 4ZZAA 3IK6B 2P1SA 3FZVA 3MBPA 4XKNA 1FBDA 4PP0A 2DYXA 3MP1A 3LUZA 2RINA 1PDAA 1SDXA 4E0XA 2VGQA 4G77A 2NWJA 4UABA 3A09A 2NXOA 3FVOA 2F6GA 1FBEA 5FBPA 3CG3A 3T9UA 3MPLA 3QSLA 3IL1B 1FBPA 4Z0IA 4BDRA 4KR5A 3TEPA 1NV4A 4H67A 3E9XA 5I56A 2CEYA 3SEXA 2Y7IA 3USDA 1RDXA 2QL3A 1NKXA 2CZHA 1LBWA 3T93B 1NH8A 4FIMA 3FV1A 2O7IA 5F24A 3U94A 3FV2A 3A3CA 4NGUA 4ECFA 1BTJA 4GQOA 4LP2B 5H8NA 1POY1 4H8IA 5EYHA 3LSLA 1L5TA 1FPGA 1OVTA 4C1UA 1MM6A 4U1ZA 4IO6A 1OQGA 4QHQA 4NN3A 1PB8A 4DCXA 2YJPA 1A99A 1LBBA 1Y1MA 2VPOA 2VT5A 3HO7A 4U1OA 3KSXA 3PPOA 2WKYA 2D5WA 3G3GA 2WBDA 3B7DA 5EQ7A 1SW4A 3FD3A 1TWYA 3TZAA 3UIFA 4QFOA 2REGA 3E79A 3OXNA 4DI4B 4N81A 3T9XB 2G29A 1DPPA 2A5TA 4ELOA 1PC3A 1NUZA 1B0HA 5DEXA 1B32A 3MW0A 3C31A 4QBAA 3PUXE 3S2VA 1O64A 5L8DA 3MJNA 4AB6A 1NUYA 1AMFA 4YKIA 3MP8A 2GHAA 1QVSA 4MMPA 5I2KA 3N94A 4LUBA 2AYSA 4R6HA 3R6UA 1TT1A 5EQ8A 1B4HA 4G2ZA 2ZZXA 3SESA 1P1NA 2ZYMA 4ZECA 4DIGA 4FAJA 1IMEA 4AQ4A 4GWOA 3P7IA 3CIJA 1DSNA 1Y3PA 4GWSA 4OXVA 1NNFA 3CG1A 1BLFA 3MWBA 3PTYA 4U21A 3EKIA 3MAMA 3FXQA 4MNPA 2THIA 2DDKA 3TUSA 1B52A 2XX7A 4YMBA 1B3FA 1BKAA 1MPCA 1SW5A 2Z8FA 2FA7A 2PX1A 2HXWA 3V83A 2DE4A 1N0TA 1MY2A 4HS7A 4TQUQ 2OZZA 4M1VA 1YYZA 3GZGA 4ZS9A 4F1VA 2I48A 1FQCA 3FASA 3SEYA 3T9VA 5ICTA 2XXYA 5AA3A 3QUFA 2VOZA 4YMAA 2YPNA 5TU0A 3RTWB 2ZZVA 3MVXA 1M5CA 5B70A 1MY3A 3CFXA 5ESYA 1SI0A 4NF5A 1LCTA 1FQFA 5I2NB 4Q8RA 1NFTA 1GV8A 1O63A 1OLAA 2KQZA 4X04A 4OHNA 2DE3A 1URDA 5ET6A 4P9KA 5CC2A 3KN7A 1LEVA 5CBRA 4C1TA 3TQLA 3BIHA 1LAFE 3B6WA 3O97A 5HBCA 2PYYA 1POTA 3PPQA 4ZEFA 1JETA 3M3LA 1TFAA 5JTYB 1G0HA 1NV6A 2Z8EA 3T66A 2XXTA 1FSAA 4QSDA 3FJ7A 3UP9A 1FQDA 3KZGA 4Q0CA 1FJ6A 1F9BA 4PFTA 2B65A 3M8UA 4ONYA 1RDZA 2ABHA 2KLFA 3VVFA 4EUOA 1D9YA 4GWYA 1Q1KA 5I57A 3SKPA 4MX6A 2A5SA 4DXUA 1ATGA 4BDOA 4GX4A 1D9QA 3VV5A 3PPPA 3RY3A 2RF1A 5DVFA 1M5FA 4E0WA 1EYIA 2R6GE 4ESXA 4EQ9A 2E1SA 2WBBA 2RCBA 3E3KA 4OVPA 4AS4A 2WEFA 3C36A 3TELA 1Q35A 5LDZA 4OFLA 2OBGA 3HPIA 2DS9A 3EQ1A 4JSOA 4OVRA 3KJTA 1B7UA 1JQFA 3PPRA 3ZKLA 1FPKA 2ANJA 2YLNA 3B6TA 4MEVA 1KA0A 2Y5LA 3T0JA 1MXYA 4YAHX 3M3FA 3K02A 2V84A 2UVIA 2P3NA 4PTKA 1EH3A 4OTEA 4RK9A 2F3DA 3MVWA 2QS2A 1KZ8A 1FPJA 4H6DA 1ZLQA 4H65A 1NH7A 3Q28A 2DVCA 3EN3A 1GTKA 2Z22A 1B5IA 4MF3A 1MQIA 3D4GA 2V3UA 3IOVA 3PMXA 1SVXB 2ZXTA 4MNCA 5IZ3B 5H8FA 4F1UA 4F3SA 3KOTA 4EQ7A 3TAJA 1P1WA 5F1QA 1TFDA 3O9PA 4JDFA 4EQBA 4P11A 1UTBA 2E0SA 1IXGA 3MPKA 2GHBA 4KYEA 2NOOA 4NF8B 4NE4A 4YU0A 5I7IA 4ZE9A 3IX1A 4OFOA 2XXVA 3VXCA 5ET5A 5H8SA 3HCQA 5AA2A 3CSGA 2GRVA 1LLSA 3U8QA 3OSRA 4H1XA 3H03A 1A55A 2CZKA 4UACA 3S9NC 3ROJA 3TYHA 2OLBA 1IMDA 4NQ8A 1AWBA 3NOHA 5BWJA 1S9TA 1AIVA 5L9OA 1ZKBA 1N76A 1B5HA 4WEDA 5CBSA 2P3VA 1B7ZA 2UVHA 2X26A 3O2AA 2XWKA 3ONMA 4LZ8A 1EYJA 5I84A 4NF6A 3H6WA 2ONKE 3G3JA 3BKIB 1FBCA 3TTKA 2P2AA 4NHBA 2QVVA 5EHMA 5FHOA 5TPAB 4N8YA 4O3BA 4HTGA 5J1DA 5EHSA 1ZBMA 3TCGA 4IB2A 3JV9A 1GGGA 4AB5A 1JP4A 2JJKA 4F19A 1Z7NE 5H8QA 1NV0A 1P1OA 3FUZA 2PFYA 3S9MC 4GOTA 1XVYA 1YAEA 4NMYA 3T96B 3KEIA 3H6UA 2IEEA 4RPOA 5I56B 1Y1ZA 3RPWA 3S9LC 1SYIA 1PB7A 2DXRA 4F39A 3B50A 4LATA 2WX9A 1MXWA 1IMCA 1MXZA 1IXCA 1AH5A 2XXUA 4F18A 4OQOA 2VPNA 2I0CA 1IMAA 1LFGA 4XKQA 3K1PA 5H8NB 3U1OA 3MC2A 3C4MA 3HHFA 2OWSA 2Q9TA 3VLVA 5EQAA 2UVGA 1DK4A 2XA5A 3RTFB 3AXFA 3OEMA 2HPGA 5TP9A 2GQ1A 4BDNA 4Q30B 4XF5A 4G4PA 1MM7A 3SDFA 3PUZE 1Y4CA 4ZEDA 4ZEIA 3LSWA 4WKMA 4DXBA 2FNCA 3OO6A 2A5TB 4QXDA 4YICA 4ZDMA 5ICQA 2H9BA 4HE1A 5DEXB 2PT2A 3E78A 4GF8A 3TDJA 5L9SA 3QXMA 2PCRA 1CB6A 1UIVA 4ELRA 2Q2CA 4ISUA 1LAHE 3EHSA 2X7PA 5ISUA 3G3HA 1GR2A 5I2KB 1VFDA 2FYIA 3OELA 3L6HA 1FPFA 2H5YA 4C0RA 4IO3A 2LAOA 2DWHA 3BIGA 4PAFA 3JZJA 3TMGA 3IAZA 3VVDA 1MH4A 4GIZA 2I3VA 1RYXA 2H98A 3BFTA 1LB9A 1OIBA 4LA9A 4JVCA 1LCFA 1MXUA 5CM6A 3HSTA 4AS5A 1CNQA 4POWA 2OWZA 3K6UA 2I4CA 2UXAA 4MJOA 5KCJA 2XXQA 1VE4A 5DYHA 4P3LA 3PMVA 1B40A 2FBPA 1INPA 1D9VA 2RC9A 2F78A 4DLDA 2Y5KA 4PAKA 3L6GA 3TPAA 1WODA 5A5XB 2NVUB 1URGA 3G3KA 3RT6B 1LBCA 4QRZA 4PFYA 1EZPA 3RPLA 3QUJA 1LAGE 1DTZA 5FHNA 1JW1A 2CZLA 4Z7EA 4GX6A 1MXXA 1OLCA 2MKZA 4GWWA 3VE1B 2F7AA 4JWOA 1PBQA 1A8EA 3D4CA 3PUVE 4KD5A 4PBQA 1YZ0A 4O7IA 1NV5A 1IZ1A 1JNFA 4BDMA 4NF5B 1IMBA 2PT1A 3LR1A 4GL8A 2XXXA 4P8BA 1YXIA 3G3IA 4P1LA 1IMFA 1S50A 1SPIA 1DPEA 4NF4A 5EYGA 3H7MA 4QFLA 5DVJA 3GXAA 2HAVA 3K0VA 4WXJA 3UORA 3KC0A 3FVNA 1JEUA 3SEVA 2I6EA 3MSTA 3SERA 1YTVA 4TLLB 1B4ZA 4RY1A 4FATA 1DTGA 4XXUA 3QYTA 1B51A 3EHTA 1NV7A 2H4IA 4NG7A 3B8BA 4PDHA 4JWYA 4HCWA 4P1EA 2QMWA 3U72A 1MDQA 1Y9UA 1B3HA 4IR8A 5I57B 4TOZA 1B05A 4FEDA 3V89B 4F29A 1B0LA 2O51A 4WEPA 2DWAA 4FECA 4BDQA 1FRPA 4H45A 3LSXA 2XWOA 3O6IA 3GBBA 3K01A 4I40A 2I3WA 3K1MA 4KXPA 2W7YA 1SW1A 5I59A 4OEVA 1QKBA 2QVRA 1N84A 2O1LA 1R1NA 1RYOA 3C32A 4R72A 1VFEA 3C33A 2F3BA 4KI0E 2ONRA 4OENA 3CSBA 4F22A 2DQVA 4LZ5A 1DBZA 3UK4A 3OO9A 3THIA 5J16A 5AA4B 1Y3NA 3ZS6A 2R8TA 3VXBA 4LONB 1USYE 3IOWA 3TTLA 1YPNA 1OMPA 3RNNA 3S9EA 4ZZEA 4U4SA 4GWUA 2DE2A 1Y20A 5H8FB 3PU5A 4N4UA 2NUVA 3IO6A 5LTCA 5T3JA 1D3KA 1XOCA 2V4CA 1NNPA 1LGBC 4NWDA 4NAPA 2Q88A 2Q2AA 1FBGA 1XS5A 1EYKA 4R2FA 4M4GA 4NF0A 2ZYNA 5F7VA 4O3CA 3IR1A 2Z23A 4NTLA 3V8XB 1FTAA 5K2YA 3D1RA 5I2NA 5FHMA 5LOMA 4PC9A 1M5EA 1LBXA 4EXKA 3N5LA 1QJMA 1N7WA 3UGWA 4I62A 4ZE8A 4HE2A 2AL4A 4MLQA 3Q25A 1A54A 2OJTA 4ESWA 3PD8A 4QF9A 2ZNTA 4IGRA 4PFBA 1IXIA 1S7YA 3FJMA 3IOUA 1FTOA 2Y7KA 1AOVA 3A3UA 3W9WA 3R7XA 4OESA 2IA4A 4OVQA 2HEUA 1JEVA 3IORA 1NV2A 1FTMA 2V3TA 3W15C 3HN0A 4QSCA 3SEWA 2DP8A 1MPDA 3Q26A 4N6DA 4I3YA 4GFRA 2VHAA 3ECRA 1MS7A 4GX3A 4THIA 1DOTA 3T9HB 1ZU0A 1B6HA 3O66A 3TQWA 1QUKA 2ZYKA 4RXLA 4ZEBA 1I69A 3RN8A 3IFCA 4LN5A 4QFPA 3MZ1A 4JXIA 3RGYA 2DXYA 5H8QB 4F2OA 1MQGA 4NWCA 1EZOA 1N3WA 5CMCA 5KZTA 5HPQA 1SBPA 4OWDA 4IO4A 1B1XA 4R6YA 4O7MA 4R9FA 4JBZA 4POXA
chains in the Genus database with same CATH topology
3CFLA 4RPNA 4OVJA 4KCDA 1UTHA 3SEUA 5I58A 1P1QA 4TLMB 3IO4A 1FCKA 1IITA 2ZMBA 1QUJA 1LB8A 1MXVA 1HSJA 5KDTA 1IQ7A 1B3LA 3FVGA 5K2XA 4MLVA 1MPBA 3LUYA 3KSJA 4YZZA 5ITOA 3HV1A 2O7UA 5TP9B 4DXCA 4N13A 2QSXA 4NEDA 1ZMGA 2ALUA 1SYHA 3CFZA 4P0IA 3V5AA 4RK2A 2O84X 4RJZA 4G68A 2Y7PA 4QFKA 4U2RA 2QS4A 5H8HA 2H25A 4PETA 3LSFB 1XT8A 2F7CA 4KHZE 2HCAA 3PUYE 3MVYA 1UIUA 2ZNSA 4LVQA 3E4RA 2M8CA 1US5A 1FTJA 1NNKA 4N6PA 4YB6A 3C34A 2HZLA 1JVYA 3E13X 1Y4TA 2PMSA 2G93A 1CE2A 2V25A 3TTMA 1B3GA 1NMUA 4YKJA 1FQEA 1I6QA 2ZYOA 4GLIA 3FVKA 4MH5A 4MFIA 5ITPA 3MUQA 3H4ZA 5DTBA 3KBRA 1H3DA 3K1NA 1IXHA 4X1BA 5KCJB 3PMWA 4K3FA 1J1NA 1GVCA 1N04A 5FTIA 3K2DA 1I6BA 2Q8JA 3RQTA 1BIYA 3IB0A 4XKRA 1YCJA 1AL3A 3OO8A 3SETA 4H8JA 1NNTA 3KGCA 2B3FA 2QJEA 1SI1A 1R9QA 4PFUA 2XX8A 1VR5A 1XHYA 2OWTA 2R71A 4H0WA 4YKKA 4R73A 4MBPA 2UVJA 3QIMA 2PVUA 3H6TA 3KJ7A 3PV0E 2B3BA 3EPEA 4DDDA 4I8CA 3CR9A 1IUDA 1I6AA 1QULA 3PGFA 4DCYA 1MG1A 1JW4A 1EU8A 4XTCQ 5M2VA 1H76A 3F11A 2O68A 4NF4B 4YB5A 1H44A 1N3XA 3Q27A 1SQYA 2HFBA 3GBAA 4KYDA 4KPTA 4I9DA 1XVXA 5CMKA 4PE5B 2O6AA 3JYRA 3K6WA 3OSQA 4YKPA 3ZKKA 4IY5A 2UYEA 5CMBA 3QK6A 2HQ0A 1R9LA 3CVGA 2RKMA 1USYH 2OK2A 3PUWE 4YB7A 2XXRA 2D21A 3IOTA 2XXPA 3R26A 4LQ2A 4I1DA 2GH9A 1LFIA 3QAXA 3S4UA 4KYSA 1A40A 3O29A 4UA8A 2Y7RA 4RA1A 1B1HA 1P1UA 3ZSFA 3UA8A 5FTHA 3I6VA 3MP6A 3TCFA 5I59B 4DE8A 3VFJA 1O7TA 4HW8A 2I49A 4GVOA 2O69A 2V3QA 4R74A 4IGTA 3EF7A 1OQHA 1Z7ME 4KQPA 2VP1A 3H06B 1R6ZA 3Q29A 4X48A 4ZEKA 1MY4A 4G8MA 4R2BA 4FORA 2XD3A 3DELB 2I4BA 2XXIA 3VLWA 3H3GA 1ZJLA 1B9JA 2DWJA 4OFJA 1DMBA 1JW5A 1PEBA 2QMXA 5IAIA 5CI5A 3N6UA 4OYVA 5A5XA 1B5JA 1MRPA 3MQ9A 3BFUA 2DOJA 1WDNA 4F1YA 3DLNA 1ELJA 3TTRA 3OMBA 3VDFA 4FE8A 1FW0A 3B6QA 1A8FA 4XKPA 4F2QA 2F35A 1T0KA 2ZNUA 4XIGQ 2XXWA 3RLFE 3OD7A 1M5DA 4QSEA 4IO2A 2PBWA 5AA2D 3VLUA 3VVEA 2XXHA 1SD3A 3WAFA 4OETA 2HZKA 2RC8A 2Q89A 3G3FA 1MQJA 3EHUA 1H45A 1B46A 3K4UA 1FQBA 2VD3A 4R9GA 5ELVA 4IO5A 3KFMA 1TXFA 2RCAA 4PQJA 3FXRA 3WAEA 1Y3QA 3ILTB 3FXUA 3OENA 1HSLA 3OEKA 5CRYA 4EXLA 4R75A 4G68C 2F7BA 4BDLA 3OO7A 4OZ9A 3LBSA 1UQWA 3KN8A 4GL0A 3K6VA 3C35A 3CRBA 3ILUB 4RNSA 1H43A 3I3VA 4EF2A 2P0SA 3FGSA 5CMMA 1M5BA 4N07A 2O1MA 2RC7A 2F6PA 1UTBB 3DP4A 3FJGA 4Q5TA 2CMOA 1II5A 4IO7A 4OEUA 1MY0A 5L9MA 1BP5A 1HSEA 5B7DA 3M3KA 1VSOA 1US4A 4GXSB 3IJXB 4X1DA 3CI8A 4KCCA 4LZ7A 3O6HA 2QS3A 4EF1A 5AA2B 3KN3A 3OOAA 3U92A 1NL5A 5HM4B 1FTKA 4O3AA 4GRKA 1LAXA 5IKBA 4QFNA 4RYAA 4DZ1A 4G8HA 1WVJA 1A7LA 2OCUA 3MVZA 1UTHB 2AL5A 3PPNA 5JTYA 5I58B 4X9TA 4ELPA 2F97A 1JVXA 5AA4A 4BLAA 4NF6B 1B3EA 5KDTB 2ONSA 3ODBA 4JSDA 2XD2A 2QPQA 3G7WA 5AA1A 4F3PA 1PB9A 5EYFA 3TKDA 1LFHA 1ZTYA 3U93A 2Y7WA 3KG2A 4G8NA 3RUMA 3I5OA 3GLBA 3K6XA 4F31B 4FJPA 2REJA 3KOSA 4G68B 1QUIA 3BBRA 5H8HB 3W9VA 2I0BA 4EDPA 1MQHA 3IJOB 2F36A 2F5XA 3TFLA 4OMBA 4ND9A 2V93A 1PBPA 4F3BA 2BJJX 4OERA 1QW0A 4JWXA 4IY6A 1N7XA 3DP8A 3N26A 4F3GA 1D4NA 2I58A 2Y84A 1MQDA 4LQ5A 3T22A 2DSFA 3IB1A 3HHGA 3LC8A 1SW2A 1RKMA 2D3IA 1IIWA 2XHDA 4H5GA 1B58A 3TTNA 3DP6A 2DVZA 2HAUA 3K00A 5JEIA 1KWHA 2AIXA 3FIRA 4JB7A 1URSA 3TODA 2GFEA 3MZ9A 1MDP1 2VD2A 1XC1A 5BUUA 4P0GA 4L17A 4H5FA 4GXAA 2H99A 4NF8A 1IEJA 3PD9A 3RT8A 1MH3A 1OVBA 1MY1A 4U23A 2QS1A 2ESNA 5JK4A 1EZ9A 3TCHA 3UN6A 3DM0A 2R9JA 4KFQA 2XX9A 1LSTA 4FEBA 1ZIUA 3MZBA 4R6KA 3O28A 3N6TA 4HCYA 5DT6A 1B7HA 1ANFA 4ELQA 2Z8DA 3H6VA 2DWIA 5DVIA 1QKAA 5AE4A 1FTLA 4PFWA 2X7QA 4GD5A 4U4XA 1P99A 2QRYA 4U22A 1FQAA 2UYFA 3FATA 3C9HA 3O6GA 2F34A 5TPAA 3IB2A 1B2HA 2F8DA 4ZZAA 3IK6B 2P1SA 3FZVA 3MBPA 4XKNA 4PP0A 2DYXA 3MP1A 2RINA 1PDAA 1SDXA 4E0XA 2VGQA 4G77A 2NWJA 3A09A 2NXOA 3FVOA 2F6GA 3CG3A 3T9UA 3MPLA 3QSLA 3IL1B 4Z0IA 4BDRA 4KR5A 3TEPA 4H67A 3E9XA 5I56A 3SEXA 2Y7IA 3USDA 2QL3A 1NKXA 3T93B 1NH8A 4FIMA 3FV1A 2O7IA 3U94A 3FV2A 3A3CA 4ECFA 1BTJA 4GQOA 4LP2B 5H8NA 1POY1 4H8IA 3LSLA 1L5TA 1OVTA 4C1UA 1MM6A 4U1ZA 4IO6A 1OQGA 4QHQA 1PB8A 4DCXA 2YJPA 1A99A 1LBBA 1Y1MA 3HO7A 4U1OA 3KSXA 3PPOA 2WKYA 2D5WA 3G3GA 3B7DA 1SW4A 3FD3A 1TWYA 3TZAA 3UIFA 4QFOA 2REGA 3OXNA 3T9XB 2G29A 1DPPA 2A5TA 4ELOA 1PC3A 1B0HA 5DEXA 1B32A 3MW0A 3C31A 3PUXE 3S2VA 1O64A 5L8DA 3MJNA 4AB6A 1AMFA 4YKIA 3MP8A 2GHAA 1QVSA 5I2KA 3N94A 4LUBA 2AYSA 4R6HA 3R6UA 1TT1A 1B4HA 4G2ZA 3SESA 1P1NA 2ZYMA 4ZECA 4DIGA 4FAJA 4AQ4A 4GWOA 3P7IA 3CIJA 1DSNA 1Y3PA 4OXVA 1NNFA 3CG1A 1BLFA 3MWBA 4U21A 3MAMA 3FXQA 2THIA 3TUSA 1B52A 2XX7A 4YMBA 1B3FA 1BKAA 1MPCA 1SW5A 2Z8FA 2FA7A 2PX1A 2HXWA 3V83A 2DE4A 1N0TA 1MY2A 4HS7A 4TQUQ 2OZZA 4M1VA 3GZGA 4ZS9A 4F1VA 2I48A 1FQCA 3FASA 3SEYA 3T9VA 5ICTA 2XXYA 5AA3A 3QUFA 2VOZA 4YMAA 2YPNA 5TU0A 3RTWB 3MVXA 1M5CA 5B70A 1MY3A 3CFXA 1SI0A 4NF5A 1LCTA 1FQFA 5I2NB 4Q8RA 1NFTA 1GV8A 1O63A 1OLAA 4OHNA 2DE3A 1URDA 5CC2A 3KN7A 5CBRA 4C1TA 3TQLA 1LAFE 3B6WA 3O97A 5HBCA 2PYYA 1POTA 3PPQA 4ZEFA 1JETA 3M3LA 1TFAA 5JTYB 2Z8EA 3T66A 2XXTA 4QSDA 3FJ7A 3UP9A 1FQDA 3KZGA 4Q0CA 1F9BA 4PFTA 2B65A 3M8UA 4ONYA 2ABHA 2KLFA 3VVFA 4EUOA 1D9YA 1Q1KA 5I57A 3SKPA 2A5SA 4DXUA 1ATGA 4BDOA 3VV5A 3PPPA 3RY3A 2RF1A 5DVFA 1M5FA 4E0WA 2R6GE 4ESXA 4EQ9A 2E1SA 2RCBA 3E3KA 3C36A 3TELA 1Q35A 4OFLA 2OBGA 3HPIA 2DS9A 3EQ1A 4JSOA 3KJTA 1B7UA 1JQFA 3PPRA 3ZKLA 2ANJA 2YLNA 3B6TA 1MXYA 4YAHX 3M3FA 3K02A 2V84A 2UVIA 1EH3A 4OTEA 4RK9A 3MVWA 2QS2A 4H6DA 1ZLQA 4H65A 1NH7A 3Q28A 2DVCA 3EN3A 1GTKA 2Z22A 1B5IA 4MF3A 1MQIA 3D4GA 2V3UA 3IOVA 3PMXA 1SVXB 2ZXTA 5H8FA 4F1UA 4F3SA 3KOTA 4EQ7A 3TAJA 1P1WA 5F1QA 1TFDA 3O9PA 4JDFA 4EQBA 4P11A 1UTBA 2E0SA 1IXGA 3MPKA 2GHBA 4KYEA 2NOOA 4NF8B 4NE4A 4YU0A 4ZE9A 3IX1A 4OFOA 2XXVA 3VXCA 5H8SA 3HCQA 5AA2A 3CSGA 2GRVA 1LLSA 3U8QA 3OSRA 4H1XA 3H03A 1A55A 4UACA 3S9NC 3TYHA 2OLBA 5BWJA 1AIVA 1S9TA 5L9OA 1ZKBA 1N76A 1B5HA 4WEDA 5CBSA 1B7ZA 2UVHA 2X26A 3O2AA 3ONMA 4LZ8A 5I84A 4NF6A 3H6WA 2ONKE 3G3JA 3BKIB 3TTKA 2P2AA 5EHMA 5FHOA 5TPAB 4O3BA 4HTGA 5J1DA 5EHSA 1ZBMA 3TCGA 4IB2A 3JV9A 1GGGA 4AB5A 4F19A 1Z7NE 5H8QA 1P1OA 3FUZA 3S9MC 4GOTA 1XVYA 1YAEA 4NMYA 3T96B 3KEIA 3H6UA 2IEEA 4RPOA 5I56B 1Y1ZA 3RPWA 3S9LC 1SYIA 1PB7A 2DXRA 4F39A 4LATA 1MXWA 1MXZA 1IXCA 1AH5A 2XXUA 4F18A 4OQOA 2I0CA 1LFGA 4XKQA 3K1PA 5H8NB 3U1OA 3MC2A 3C4MA 3HHFA 2OWSA 2Q9TA 3VLVA 2UVGA 3RTFB 3AXFA 3OEMA 5TP9A 4BDNA 4Q30B 4G4PA 1MM7A 3SDFA 3PUZE 1Y4CA 4ZEDA 4ZEIA 3LSWA 4WKMA 4DXBA 2FNCA 3OO6A 2A5TB 4YICA 4ZDMA 5ICQA 2H9BA 5DEXB 2PT2A 4GF8A 3TDJA 5L9SA 3QXMA 1CB6A 1UIVA 4ELRA 2Q2CA 4ISUA 1LAHE 3EHSA 2X7PA 5ISUA 3G3HA 1GR2A 5I2KB 1VFDA 2FYIA 3OELA 3L6HA 2H5YA 4C0RA 4IO3A 2LAOA 2DWHA 3JZJA 3TMGA 3IAZA 3VVDA 1MH4A 4GIZA 2I3VA 1RYXA 2H98A 3BFTA 1LB9A 1OIBA 4LA9A 1LCFA 1MXUA 5CM6A 3HSTA 4POWA 3K6UA 2I4CA 2UXAA 5KCJA 2XXQA 1VE4A 5DYHA 3PMVA 1B40A 1D9VA 2RC9A 2F78A 4DLDA 3L6GA 3TPAA 1WODA 5A5XB 2NVUB 1URGA 3G3KA 3RT6B 1LBCA 4QRZA 4PFYA 1EZPA 3QUJA 1LAGE 1DTZA 5FHNA 1JW1A 2CZLA 4Z7EA 1MXXA 1OLCA 3VE1B 2F7AA 4JWOA 1PBQA 1A8EA 3D4CA 3PUVE 4KD5A 1IZ1A 1JNFA 4BDMA 4NF5B 2PT1A 3LR1A 4GL8A 2XXXA 3G3IA 1S50A 1DPEA 4NF4A 3H7MA 4QFLA 5DVJA 3GXAA 2HAVA 3K0VA 4WXJA 3UORA 3FVNA 1JEUA 3SEVA 2I6EA 3SERA 1YTVA 4TLLB 1B4ZA 4RY1A 4FATA 1DTGA 4XXUA 3QYTA 1B51A 3EHTA 2H4IA 4JWYA 4HCWA 2QMWA 3U72A 1MDQA 1Y9UA 1B3HA 5I57B 4TOZA 1B05A 4FEDA 3V89B 4F29A 1B0LA 2O51A 4WEPA 2DWAA 4FECA 4BDQA 3LSXA 3O6IA 3GBBA 3K01A 2I3WA 3K1MA 2W7YA 1SW1A 5I59A 4OEVA 1QKBA 1N84A 2O1LA 1R1NA 1RYOA 3C32A 4R72A 1VFEA 3C33A 4KI0E 2ONRA 4OENA 3CSBA 4F22A 2DQVA 4LZ5A 3UK4A 3OO9A 3THIA 5AA4B 1Y3NA 3ZS6A 3VXBA 4LONB 1USYE 3IOWA 3TTLA 1YPNA 1OMPA 3RNNA 3S9EA 4ZZEA 4U4SA 2DE2A 1Y20A 5H8FB 3PU5A 2NUVA 3IO6A 1D3KA 1XOCA 1NNPA 1LGBC 4NWDA 2Q88A 2Q2AA 1XS5A 4R2FA 4M4GA 2ZYNA 5F7VA 4O3CA 3IR1A 2Z23A 4NTLA 3V8XB 5K2YA 5I2NA 5FHMA 5LOMA 1M5EA 4EXKA 3N5LA 1QJMA 1N7WA 3UGWA 4I62A 4ZE8A 2AL4A 4MLQA 3Q25A 1A54A 2OJTA 4ESWA 3PD8A 4QF9A 2ZNTA 4IGRA 1IXIA 1S7YA 3FJMA 3IOUA 1FTOA 2Y7KA 1AOVA 3A3UA 3W9WA 3R7XA 4OESA 2IA4A 2HEUA 1JEVA 3IORA 1FTMA 2V3TA 3W15C 3HN0A 4QSCA 3SEWA 2DP8A 1MPDA 3Q26A 4GFRA 2VHAA 3ECRA 1MS7A 4THIA 1DOTA 3T9HB 1ZU0A 1B6HA 3O66A 3TQWA 1QUKA 2ZYKA 4RXLA 4ZEBA 1I69A 3RN8A 4QFPA 3MZ1A 4JXIA 3RGYA 2DXYA 5H8QB 4F2OA 1MQGA 4NWCA 1EZOA 1N3WA 5CMCA 5KZTA 5HPQA 1SBPA 4OWDA 4IO4A 1B1XA 4R6YA 4R9FA 4JBZA 4POXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFL A;  4RPN A;  4OVJ A;  4KCD A;  1UTH A;  3SEU A;  5I58 A;  1P1Q A;  4TLM B;  3IO4 A;  1FCK A;  1IIT A;  2ZMB A;  1QUJ A;  1LB8 A;  1MXV A;  1HSJ A;  5KDT A;  1IQ7 A;  1B3L A;  3FVG A;  5K2X A;  4MLV A;  1MPB A;  3LUY A;  3KSJ A;  4YZZ A;  5ITO A;  3HV1 A;  2O7U A;  5TP9 B;  4DXC A;  4N13 A;  2QSX A;  4NED A;  1ZMG A;  2ALU A;  1SYH A;  3CFZ A;  4P0I A;  3V5A A;  4RK2 A;  2O84 X;  4RJZ A;  4G68 A;  2Y7P A;  4QFK A;  4U2R A;  2QS4 A;  5H8H A;  2H25 A;  4PET A;  3LSF B;  1XT8 A;  2F7C A;  4KHZ E;  2HCA A;  3PUY E;  3MVY A;  1UIU A;  2ZNS A;  4LVQ A;  3E4R A;  2M8C A;  1US5 A;  1FTJ A;  1NNK A;  4N6P A;  4YB6 A;  3C34 A;  2HZL A;  1JVY A;  3E13 X;  1Y4T A;  2PMS A;  2G93 A;  1CE2 A;  2V25 A;  3TTM A;  1B3G A;  1NMU A;  4YKJ A;  1FQE A;  1I6Q A;  2ZYO A;  4GLI A;  3FVK A;  4MH5 A;  4MFI A;  5ITP A;  3MUQ A;  3H4Z A;  5DTB A;  3KBR A;  1H3D A;  3K1N A;  1IXH A;  4X1B A;  5KCJ B;  3PMW A;  4K3F A;  1J1N A;  1GVC A;  1N04 A;  5FTI A;  3K2D A;  1I6B A;  2Q8J A;  3RQT A;  1BIY A;  3IB0 A;  4XKR A;  1YCJ A;  1AL3 A;  3OO8 A;  3SET A;  4H8J A;  1NNT A;  3KGC A;  2B3F A;  2QJE A;  1SI1 A;  1R9Q A;  4PFU A;  2XX8 A;  1VR5 A;  1XHY A;  2OWT A;  2R71 A;  4H0W A;  4YKK A;  4R73 A;  4MBP A;  2UVJ A;  3QIM A;  2PVU A;  3H6T A;  3KJ7 A;  3PV0 E;  2B3B A;  3EPE A;  4DDD A;  4I8C A;  3CR9 A;  1IUD A;  1I6A A;  1QUL A;  3PGF A;  4DCY A;  1MG1 A;  1JW4 A;  1EU8 A;  4XTC Q;  5M2V A;  1H76 A;  3F11 A;  2O68 A;  4NF4 B;  4YB5 A;  1H44 A;  1N3X A;  3Q27 A;  1SQY A;  2HFB A;  3GBA A;  4KYD A;  4KPT A;  4I9D A;  1XVX A;  5CMK A;  4PE5 B;  2O6A A;  3JYR A;  3K6W A;  3OSQ A;  4YKP A;  3ZKK A;  4IY5 A;  2UYE A;  5CMB A;  3QK6 A;  2HQ0 A;  1R9L A;  3CVG A;  2RKM A;  1USY H;  2OK2 A;  3PUW E;  4YB7 A;  2XXR A;  2D21 A;  3IOT A;  2XXP A;  3R26 A;  4LQ2 A;  4I1D A;  2GH9 A;  1LFI A;  3QAX A;  3S4U A;  4KYS A;  1A40 A;  3O29 A;  4UA8 A;  2Y7R A;  4RA1 A;  1B1H A;  1P1U A;  3ZSF A;  3UA8 A;  5FTH A;  3I6V A;  3MP6 A;  3TCF A;  5I59 B;  4DE8 A;  3VFJ A;  1O7T A;  4HW8 A;  2I49 A;  4GVO A;  2O69 A;  2V3Q A;  4R74 A;  4IGT A;  3EF7 A;  1OQH A;  1Z7M E;  4KQP A;  2VP1 A;  3H06 B;  1R6Z A;  3Q29 A;  4X48 A;  4ZEK A;  1MY4 A;  4G8M A;  4R2B A;  4FOR A;  2XD3 A;  3DEL B;  2I4B A;  2XXI A;  3VLW A;  3H3G A;  1ZJL A;  1B9J A;  2DWJ A;  4OFJ A;  1DMB A;  1JW5 A;  1PEB A;  2QMX A;  5IAI A;  5CI5 A;  3N6U A;  4OYV A;  5A5X A;  1B5J A;  1MRP A;  3MQ9 A;  3BFU A;  2DOJ A;  1WDN A;  4F1Y A;  3DLN A;  1ELJ A;  3TTR A;  3OMB A;  3VDF A;  4FE8 A;  1FW0 A;  3B6Q A;  1A8F A;  4XKP A;  4F2Q A;  2F35 A;  1T0K A;  2ZNU A;  4XIG Q;  2XXW A;  3RLF E;  3OD7 A;  1M5D A;  4QSE A;  4IO2 A;  2PBW A;  5AA2 D;  3VLU A;  3VVE A;  2XXH A;  1SD3 A;  3WAF A;  4OET A;  2HZK A;  2RC8 A;  2Q89 A;  3G3F A;  1MQJ A;  3EHU A;  1H45 A;  1B46 A;  3K4U A;  1FQB A;  2VD3 A;  4R9G A;  5ELV A;  4IO5 A;  3KFM A;  1TXF A;  2RCA A;  4PQJ A;  3FXR A;  3WAE A;  1Y3Q A;  3ILT B;  3FXU A;  3OEN A;  1HSL A;  3OEK A;  5CRY A;  4EXL A;  4R75 A;  4G68 C;  2F7B A;  4BDL A;  3OO7 A;  4OZ9 A;  3LBS A;  1UQW A;  3KN8 A;  4GL0 A;  3K6V A;  3C35 A;  3CRB A;  3ILU B;  4RNS A;  1H43 A;  3I3V A;  4EF2 A;  2P0S A;  3FGS A;  5CMM A;  1M5B A;  4N07 A;  2O1M A;  2RC7 A;  2F6P A;  1UTB B;  3DP4 A;  3FJG A;  4Q5T A;  2CMO A;  1II5 A;  4IO7 A;  4OEU A;  1MY0 A;  5L9M A;  1BP5 A;  1HSE A;  5B7D A;  3M3K A;  1VSO A;  1US4 A;  4GXS B;  3IJX B;  4X1D A;  3CI8 A;  4KCC A;  4LZ7 A;  3O6H A;  2QS3 A;  4EF1 A;  5AA2 B;  3KN3 A;  3OOA A;  3U92 A;  1NL5 A;  5HM4 B;  1FTK A;  4O3A A;  4GRK A;  1LAX A;  5IKB A;  4QFN A;  4RYA A;  4DZ1 A;  4G8H A;  1WVJ A;  1A7L A;  2OCU A;  3MVZ A;  1UTH B;  2AL5 A;  3PPN A;  5JTY A;  5I58 B;  4X9T A;  4ELP A;  2F97 A;  1JVX A;  5AA4 A;  4BLA A;  4NF6 B;  1B3E A;  5KDT B;  2ONS A;  3ODB A;  4JSD A;  2XD2 A;  2QPQ A;  3G7W A;  5AA1 A;  4F3P A;  1PB9 A;  5EYF A;  3TKD A;  1LFH A;  1ZTY A;  3U93 A;  2Y7W A;  3KG2 A;  4G8N A;  3RUM A;  3I5O A;  3GLB A;  3K6X A;  4F31 B;  4FJP A;  2REJ A;  3KOS A;  4G68 B;  1QUI A;  3BBR A;  5H8H B;  3W9V A;  2I0B A;  4EDP A;  1MQH A;  3IJO B;  2F36 A;  2F5X A;  3TFL A;  4OMB A;  4ND9 A;  2V93 A;  1PBP A;  4F3B A;  2BJJ X;  4OER A;  1QW0 A;  4JWX A;  4IY6 A;  1N7X A;  3DP8 A;  3N26 A;  4F3G A;  1D4N A;  2I58 A;  2Y84 A;  1MQD A;  4LQ5 A;  3T22 A;  2DSF A;  3IB1 A;  3HHG A;  3LC8 A;  1SW2 A;  1RKM A;  2D3I A;  1IIW A;  2XHD A;  4H5G A;  1B58 A;  3TTN A;  3DP6 A;  2DVZ A;  2HAU A;  3K00 A;  5JEI A;  1KWH A;  2AIX A;  3FIR A;  4JB7 A;  1URS A;  3TOD A;  2GFE A;  3MZ9 A;  1MDP 1;  2VD2 A;  1XC1 A;  5BUU A;  4P0G A;  4L17 A;  4H5F A;  4GXA A;  2H99 A;  4NF8 A;  1IEJ A;  3PD9 A;  3RT8 A;  1MH3 A;  1OVB A;  1MY1 A;  4U23 A;  2QS1 A;  2ESN A;  5JK4 A;  1EZ9 A;  3TCH A;  3UN6 A;  3DM0 A;  2R9J A;  4KFQ A;  2XX9 A;  1LST A;  4FEB A;  1ZIU A;  3MZB A;  4R6K A;  3O28 A;  3N6T A;  4HCY A;  5DT6 A;  1B7H A;  1ANF A;  4ELQ A;  2Z8D A;  3H6V A;  2DWI A;  5DVI A;  1QKA A;  5AE4 A;  1FTL A;  4PFW A;  2X7Q A;  4GD5 A;  4U4X A;  1P99 A;  2QRY A;  4U22 A;  1FQA A;  2UYF A;  3FAT A;  3C9H A;  3O6G A;  2F34 A;  5TPA A;  3IB2 A;  1B2H A;  2F8D A;  4ZZA A;  3IK6 B;  2P1S A;  3FZV A;  3MBP A;  4XKN A;  4PP0 A;  2DYX A;  3MP1 A;  2RIN A;  1PDA A;  1SDX A;  4E0X A;  2VGQ A;  4G77 A;  2NWJ A;  3A09 A;  2NXO A;  3FVO A;  2F6G A;  3CG3 A;  3T9U A;  3MPL A;  3QSL A;  3IL1 B;  4Z0I A;  4BDR A;  4KR5 A;  3TEP A;  4H67 A;  3E9X A;  5I56 A;  3SEX A;  2Y7I A;  3USD A;  2QL3 A;  1NKX A;  3T93 B;  1NH8 A;  4FIM A;  3FV1 A;  2O7I A;  3U94 A;  3FV2 A;  3A3C A;  4ECF A;  1BTJ A;  4GQO A;  4LP2 B;  5H8N A;  1POY 1;  4H8I A;  3LSL A;  1L5T A;  1OVT A;  4C1U A;  1MM6 A;  4U1Z A;  4IO6 A;  1OQG A;  4QHQ A;  1PB8 A;  4DCX A;  2YJP A;  1A99 A;  1LBB A;  1Y1M A;  3HO7 A;  4U1O A;  3KSX A;  3PPO A;  2WKY A;  2D5W A;  3G3G A;  3B7D A;  1SW4 A;  3FD3 A;  1TWY A;  3TZA A;  3UIF A;  4QFO A;  2REG A;  3OXN A;  3T9X B;  2G29 A;  1DPP A;  2A5T A;  4ELO A;  1PC3 A;  1B0H A;  5DEX A;  1B32 A;  3MW0 A;  3C31 A;  3PUX E;  3S2V A;  1O64 A;  5L8D A;  3MJN A;  4AB6 A;  1AMF A;  4YKI A;  3MP8 A;  2GHA A;  1QVS A;  5I2K A;  3N94 A;  4LUB A;  2AYS A;  4R6H A;  3R6U A;  1TT1 A;  1B4H A;  4G2Z A;  3SES A;  1P1N A;  2ZYM A;  4ZEC A;  4DIG A;  4FAJ A;  4AQ4 A;  4GWO A;  3P7I A;  3CIJ A;  1DSN A;  1Y3P A;  4OXV A;  1NNF A;  3CG1 A;  1BLF A;  3MWB A;  4U21 A;  3MAM A;  3FXQ A;  2THI A;  3TUS A;  1B52 A;  2XX7 A;  4YMB A;  1B3F A;  1BKA A;  1MPC A;  1SW5 A;  2Z8F A;  2FA7 A;  2PX1 A;  2HXW A;  3V83 A;  2DE4 A;  1N0T A;  1MY2 A;  4HS7 A;  4TQU Q;  2OZZ A;  4M1V A;  3GZG A;  4ZS9 A;  4F1V A;  2I48 A;  1FQC A;  3FAS A;  3SEY A;  3T9V A;  5ICT A;  2XXY A;  5AA3 A;  3QUF A;  2VOZ A;  4YMA A;  2YPN A;  5TU0 A;  3RTW B;  3MVX A;  1M5C A;  5B70 A;  1MY3 A;  3CFX A;  1SI0 A;  4NF5 A;  1LCT A;  1FQF A;  5I2N B;  4Q8R A;  1NFT A;  1GV8 A;  1O63 A;  1OLA A;  4OHN A;  2DE3 A;  1URD A;  5CC2 A;  3KN7 A;  5CBR A;  4C1T A;  3TQL A;  1LAF E;  3B6W A;  3O97 A;  5HBC A;  2PYY A;  1POT A;  3PPQ A;  4ZEF A;  1JET A;  3M3L A;  1TFA A;  5JTY B;  2Z8E A;  3T66 A;  2XXT A;  4QSD A;  3FJ7 A;  3UP9 A;  1FQD A;  3KZG A;  4Q0C A;  1F9B A;  4PFT A;  2B65 A;  3M8U A;  4ONY A;  2ABH A;  2KLF A;  3VVF A;  4EUO A;  1D9Y A;  1Q1K A;  5I57 A;  3SKP A;  2A5S A;  4DXU A;  1ATG A;  4BDO A;  3VV5 A;  3PPP A;  3RY3 A;  2RF1 A;  5DVF A;  1M5F A;  4E0W A;  2R6G E;  4ESX A;  4EQ9 A;  2E1S A;  2RCB A;  3E3K A;  3C36 A;  3TEL A;  1Q35 A;  4OFL A;  2OBG A;  3HPI A;  2DS9 A;  3EQ1 A;  4JSO A;  3KJT A;  1B7U A;  1JQF A;  3PPR A;  3ZKL A;  2ANJ A;  2YLN A;  3B6T A;  1MXY A;  4YAH X;  3M3F A;  3K02 A;  2V84 A;  2UVI A;  1EH3 A;  4OTE A;  4RK9 A;  3MVW A;  2QS2 A;  4H6D A;  1ZLQ A;  4H65 A;  1NH7 A;  3Q28 A;  2DVC A;  3EN3 A;  1GTK A;  2Z22 A;  1B5I A;  4MF3 A;  1MQI A;  3D4G A;  2V3U A;  3IOV A;  3PMX A;  1SVX B;  2ZXT A;  5H8F A;  4F1U A;  4F3S A;  3KOT A;  4EQ7 A;  3TAJ A;  1P1W A;  5F1Q A;  1TFD A;  3O9P A;  4JDF A;  4EQB A;  4P11 A;  1UTB A;  2E0S A;  1IXG A;  3MPK A;  2GHB A;  4KYE A;  2NOO A;  4NF8 B;  4NE4 A;  4YU0 A;  4ZE9 A;  3IX1 A;  4OFO A;  2XXV A;  3VXC A;  5H8S A;  3HCQ A;  5AA2 A;  3CSG A;  2GRV A;  1LLS A;  3U8Q A;  3OSR A;  4H1X A;  3H03 A;  1A55 A;  4UAC A;  3S9N C;  3TYH A;  2OLB A;  5BWJ A;  1AIV A;  1S9T A;  5L9O A;  1ZKB A;  1N76 A;  1B5H A;  4WED A;  5CBS A;  1B7Z A;  2UVH A;  2X26 A;  3O2A A;  3ONM A;  4LZ8 A;  5I84 A;  4NF6 A;  3H6W A;  2ONK E;  3G3J A;  3BKI B;  3TTK A;  2P2A A;  5EHM A;  5FHO A;  5TPA B;  4O3B A;  4HTG A;  5J1D A;  5EHS A;  1ZBM A;  3TCG A;  4IB2 A;  3JV9 A;  1GGG A;  4AB5 A;  4F19 A;  1Z7N E;  5H8Q A;  1P1O A;  3FUZ A;  3S9M C;  4GOT A;  1XVY A;  1YAE A;  4NMY A;  3T96 B;  3KEI A;  3H6U A;  2IEE A;  4RPO A;  5I56 B;  1Y1Z A;  3RPW A;  3S9L C;  1SYI A;  1PB7 A;  2DXR A;  4F39 A;  4LAT A;  1MXW A;  1MXZ A;  1IXC A;  1AH5 A;  2XXU A;  4F18 A;  4OQO A;  2I0C A;  1LFG A;  4XKQ A;  3K1P A;  5H8N B;  3U1O A;  3MC2 A;  3C4M A;  3HHF A;  2OWS A;  2Q9T A;  3VLV A;  2UVG A;  3RTF B;  3AXF A;  3OEM A;  5TP9 A;  4BDN A;  4Q30 B;  4G4P A;  1MM7 A;  3SDF A;  3PUZ E;  1Y4C A;  4ZED A;  4ZEI A;  3LSW A;  4WKM A;  4DXB A;  2FNC A;  3OO6 A;  2A5T B;  4YIC A;  4ZDM A;  5ICQ A;  2H9B A;  5DEX B;  2PT2 A;  4GF8 A;  3TDJ A;  5L9S A;  3QXM A;  1CB6 A;  1UIV A;  4ELR A;  2Q2C A;  4ISU A;  1LAH E;  3EHS A;  2X7P A;  5ISU A;  3G3H A;  1GR2 A;  5I2K B;  1VFD A;  2FYI A;  3OEL A;  3L6H A;  2H5Y A;  4C0R A;  4IO3 A;  2LAO A;  2DWH A;  3JZJ A;  3TMG A;  3IAZ A;  3VVD A;  1MH4 A;  4GIZ A;  2I3V A;  1RYX A;  2H98 A;  3BFT A;  1LB9 A;  1OIB A;  4LA9 A;  1LCF A;  1MXU A;  5CM6 A;  3HST A;  4POW A;  3K6U A;  2I4C A;  2UXA A;  5KCJ A;  2XXQ A;  1VE4 A;  5DYH A;  3PMV A;  1B40 A;  1D9V A;  2RC9 A;  2F78 A;  4DLD A;  3L6G A;  3TPA A;  1WOD A;  5A5X B;  2NVU B;  1URG A;  3G3K A;  3RT6 B;  1LBC A;  4QRZ A;  4PFY A;  1EZP A;  3QUJ A;  1LAG E;  1DTZ A;  5FHN A;  1JW1 A;  2CZL A;  4Z7E A;  1MXX A;  1OLC A;  3VE1 B;  2F7A A;  4JWO A;  1PBQ A;  1A8E A;  3D4C A;  3PUV E;  4KD5 A;  1IZ1 A;  1JNF A;  4BDM A;  4NF5 B;  2PT1 A;  3LR1 A;  4GL8 A;  2XXX A;  3G3I A;  1S50 A;  1DPE A;  4NF4 A;  3H7M A;  4QFL A;  5DVJ A;  3GXA A;  2HAV A;  3K0V A;  4WXJ A;  3UOR A;  3FVN A;  1JEU A;  3SEV A;  2I6E A;  3SER A;  1YTV A;  4TLL B;  1B4Z A;  4RY1 A;  4FAT A;  1DTG A;  4XXU A;  3QYT A;  1B51 A;  3EHT A;  2H4I A;  4JWY A;  4HCW A;  2QMW A;  3U72 A;  1MDQ A;  1Y9U A;  1B3H A;  5I57 B;  4TOZ A;  1B05 A;  4FED A;  3V89 B;  4F29 A;  1B0L A;  2O51 A;  4WEP A;  2DWA A;  4FEC A;  4BDQ A;  3LSX A;  3O6I A;  3GBB A;  3K01 A;  2I3W A;  3K1M A;  2W7Y A;  1SW1 A;  5I59 A;  4OEV A;  1QKB A;  1N84 A;  2O1L A;  1R1N A;  1RYO A;  3C32 A;  4R72 A;  1VFE A;  3C33 A;  4KI0 E;  2ONR A;  4OEN A;  3CSB A;  4F22 A;  2DQV A;  4LZ5 A;  3UK4 A;  3OO9 A;  3THI A;  5AA4 B;  1Y3N A;  3ZS6 A;  3VXB A;  4LON B;  1USY E;  3IOW A;  3TTL A;  1YPN A;  1OMP A;  3RNN A;  3S9E A;  4ZZE A;  4U4S A;  2DE2 A;  1Y20 A;  5H8F B;  3PU5 A;  2NUV A;  3IO6 A;  1D3K A;  1XOC A;  1NNP A;  1LGB C;  4NWD A;  2Q88 A;  2Q2A A;  1XS5 A;  4R2F A;  4M4G A;  2ZYN A;  5F7V A;  4O3C A;  3IR1 A;  2Z23 A;  4NTL A;  3V8X B;  5K2Y A;  5I2N A;  5FHM A;  5LOM A;  1M5E A;  4EXK A;  3N5L A;  1QJM A;  1N7W A;  3UGW A;  4I62 A;  4ZE8 A;  2AL4 A;  4MLQ A;  3Q25 A;  1A54 A;  2OJT A;  4ESW A;  3PD8 A;  4QF9 A;  2ZNT A;  4IGR A;  1IXI A;  1S7Y A;  3FJM A;  3IOU A;  1FTO A;  2Y7K A;  1AOV A;  3A3U A;  3W9W A;  3R7X A;  4OES A;  2IA4 A;  2HEU A;  1JEV A;  3IOR A;  1FTM A;  2V3T A;  3W15 C;  3HN0 A;  4QSC A;  3SEW A;  2DP8 A;  1MPD A;  3Q26 A;  4GFR A;  2VHA A;  3ECR A;  1MS7 A;  4THI A;  1DOT A;  3T9H B;  1ZU0 A;  1B6H A;  3O66 A;  3TQW A;  1QUK A;  2ZYK A;  4RXL A;  4ZEB A;  1I69 A;  3RN8 A;  4QFP A;  3MZ1 A;  4JXI A;  3RGY A;  2DXY A;  5H8Q B;  4F2O A;  1MQG A;  4NWC A;  1EZO A;  1N3W A;  5CMC A;  5KZT A;  5HPQ A;  1SBP A;  4OWD A;  4IO4 A;  1B1X A;  4R6Y A;  4R9F A;  4JBZ A;  4POX A; 
#chains in the Genus database with same CATH topology
 3CFL A;  2WYP A;  1NV3 A;  4RPN A;  4OVJ A;  4JVD A;  4NX1 A;  4KCD A;  1UTH A;  3SEU A;  5I58 A;  1P1Q A;  4TLM B;  3IO4 A;  1FCK A;  1IIT A;  2ZMB A;  1QUJ A;  1LB8 A;  1DCU A;  1MXV A;  1HSJ A;  1FPD A;  5KDT A;  2BJI A;  3FXB A;  1IQ7 A;  1B3L A;  3FVG A;  5K2X A;  4MLV A;  1MPB A;  3LUY A;  3KSJ A;  4YZZ A;  5ITO A;  3HV1 A;  2O7U A;  5TP9 B;  5IZ3 A;  4N13 A;  4DXC A;  2QSX A;  2HHM A;  4NED A;  1ZMG A;  2ALU A;  1SYH A;  3MYU A;  3CFZ A;  4P0I A;  3V5A A;  4RK2 A;  4PE3 A;  2O84 X;  4RJZ A;  4G68 A;  2Y7P A;  4QFK A;  4U2R A;  2QS4 A;  5H8H A;  2H25 A;  4PET A;  3LSF B;  1XT8 A;  2F7C A;  4KHZ E;  2HCA A;  3PUY E;  1FJ9 A;  3MVY A;  1UIU A;  2ZNS A;  2PFZ A;  4LVQ A;  3SZP A;  3T1B A;  4PAI A;  3E4R A;  5DW8 A;  2M8C A;  1US5 A;  1FTJ A;  1NNK A;  4N6P A;  4YB6 A;  3C34 A;  2HZL A;  2FHY A;  1K9Z A;  1JVY A;  3E13 X;  2OX3 A;  1Y4T A;  1FPL A;  2PMS A;  2G93 A;  1CE2 A;  2V25 A;  3TTM A;  1B3G A;  1NMU A;  4YKJ A;  1FQE A;  4OVT A;  3HFU A;  1I6Q A;  4P56 A;  2ZYO A;  2WYK A;  4GLI A;  3FVK A;  4MH5 A;  4MFI A;  4O94 A;  5ITP A;  3MUQ A;  3H4Z A;  5DTB A;  1G0I A;  1H3D A;  3KBR A;  3K1N A;  1IXH A;  4PGN A;  4X1B A;  5KCJ B;  3PMW A;  4K3F A;  1J1N A;  1GVC A;  4MHF A;  1N04 A;  5FTI A;  4O8M A;  3K2D A;  1I6B A;  2Q8J A;  4PF6 A;  3RQT A;  1BIY A;  3IB0 A;  4XKR A;  1YCJ A;  1NV1 A;  1AL3 A;  3OO8 A;  2ZZW A;  5A5L A;  3SET A;  4MCO A;  4H8J A;  1NNT A;  3KGC A;  2B3F A;  2QJE A;  3RPL B;  1Q9D A;  1SI1 A;  1R9Q A;  4PFU A;  2XX8 A;  1VR5 A;  1XHY A;  2OWT A;  2R71 A;  4H0W A;  4YKK A;  4R73 A;  4PDD A;  4MBP A;  2UVJ A;  3QIM A;  2PVU A;  3H6T A;  3KJ7 A;  3PV0 E;  2B3B A;  3EPE A;  4DDD A;  4I8C A;  3CR9 A;  1IUD A;  5IZZ A;  1FPI A;  1I6A A;  1FBH A;  1QUL A;  2Q8M A;  3PGF A;  4DCY A;  1MG1 A;  1JW4 A;  1EU8 A;  3RYD A;  4XTC Q;  5M2V A;  1H76 A;  3F11 A;  2O68 A;  4PFI A;  4NF4 B;  4YB5 A;  1H44 A;  1N3X A;  3Q27 A;  1SQY A;  2HFB A;  3GBA A;  4KYD A;  2L5V A;  4KPT A;  4I9D A;  1XVX A;  4GBV A;  4HXV A;  5CMK A;  2HXR A;  4PE5 B;  5I5P A;  2O6A A;  3JYR A;  3K6W A;  3OSQ A;  4YKP A;  3ZKK A;  4IY5 A;  2UYE A;  1FPE A;  5CMB A;  3QK6 A;  2HQ0 A;  1R9L A;  3CVG A;  2RKM A;  3CHG A;  1USY H;  2OK2 A;  3PUW E;  4YB7 A;  2XXR A;  2D21 A;  3IOT A;  4PGP A;  3GYY A;  2XXP A;  3R26 A;  4LQ2 A;  4I1D A;  3KC1 A;  2GH9 A;  1LFI A;  3QAX A;  3S4U A;  4H46 A;  4KYS A;  1A40 A;  3O29 A;  4UA8 A;  2Y7R A;  4RA1 A;  1B1H A;  3ISP A;  1P1U A;  3ZSF A;  3UA8 A;  5FTH A;  2FIX A;  3I6V A;  3MP6 A;  3TCF A;  5I59 B;  4DE8 A;  3VFJ A;  1O7T A;  4HW8 A;  2I49 A;  4GVO A;  2O69 A;  2V3Q A;  4R74 A;  4IGT A;  3EF7 A;  1OQH A;  1NI9 A;  1Z7M E;  4KQP A;  2VP1 A;  3H06 B;  1R6Z A;  3Q29 A;  4X48 A;  4G61 A;  5ET7 A;  4ZEK A;  1MY4 A;  4G8M A;  1VDW A;  4R2B A;  4OAN A;  4FOR A;  2XD3 A;  3DEL B;  1FPB A;  2I4B A;  2XXI A;  3VLW A;  3H3G A;  4XEQ A;  1ZJL A;  1B9J A;  2DWJ A;  4OFJ A;  1DMB A;  1JW5 A;  1PEB A;  2QMX A;  5IAI A;  5CI5 A;  3N6U A;  4OYV A;  5A5X A;  1B5J A;  1MRP A;  3MQ9 A;  3BFU A;  2DOJ A;  1WDN A;  2FIE A;  4F1Y A;  3DLN A;  4X8R A;  1ELJ A;  3TTR A;  3OMB A;  3VDF A;  4FE8 A;  1FW0 A;  3B6Q A;  1A8F A;  4XKP A;  4F2Q A;  2F35 A;  1T0K A;  2ZNU A;  4XIG Q;  2XXW A;  3RLF E;  3OD7 A;  4HE0 A;  1M5D A;  4QSE A;  3FBP A;  4IO2 A;  2PBW A;  5AA2 D;  4MNI A;  3VLU A;  3VVE A;  2XXH A;  3A29 A;  1SD3 A;  3WAF A;  3IFA A;  4OET A;  2HZK A;  2RC8 A;  2Q89 A;  3G3F A;  1LBZ A;  1MQJ A;  1QGX A;  3EHU A;  1H45 A;  1B46 A;  4GWX A;  3K4U A;  1FQB A;  4OA4 A;  2VD3 A;  1XI6 A;  4R9G A;  5ELV A;  4IO5 A;  3KFM A;  1TXF A;  2RCA A;  4PQJ A;  3FXR A;  2KR0 A;  3WAE A;  2QVU A;  1Y3Q A;  3ILT B;  3FXU A;  3OEN A;  1HSL A;  3OEK A;  5CRY A;  4EXL A;  4R75 A;  4G68 C;  2F7B A;  4BDL A;  3OO7 A;  1RDY A;  4DI3 D;  4N15 A;  4OZ9 A;  4N91 A;  3LBS A;  1UQW A;  3KBZ A;  3KN8 A;  4GL0 A;  4MAG A;  3K6V A;  3C35 A;  3CRB A;  3ILU B;  4RNS A;  1H43 A;  2CZI A;  3I3V A;  4EF2 A;  2P0S A;  3FGS A;  5CMM A;  1M5B A;  4N07 A;  4PF8 A;  2O1M A;  2RC7 A;  2F6P A;  1UTB B;  3DP4 A;  3FJG A;  3QMF A;  4Q5T A;  3LV0 A;  2CMO A;  1II5 A;  1LBY A;  4IO7 A;  4OEU A;  1MY0 A;  5ET8 A;  5L9M A;  1BP5 A;  1HSE A;  5B7D A;  5IZ1 A;  3M3K A;  1VSO A;  1US4 A;  4GXS B;  4MIJ A;  3IJX B;  4X1D A;  3CI8 A;  4KCC A;  4LZ7 A;  3O6H A;  2QS3 A;  4PFR A;  4EF1 A;  5AA2 B;  3KN3 A;  5IM2 A;  3OOA A;  3U92 A;  1NL5 A;  5HM4 B;  1FTK A;  4O3A A;  2QFL A;  4GRK A;  1LAX A;  5IKB A;  4QFN A;  4RYA A;  4DZ1 A;  4G8H A;  1WVJ A;  1A7L A;  2OCU A;  3MVZ A;  1UTH B;  2AL5 A;  4GBW A;  2FVZ A;  3PPN A;  5JTY A;  5I58 B;  4X9T A;  4ELP A;  2F97 A;  1JVX A;  5AA4 A;  4BLA A;  4NF6 B;  3U65 A;  1B3E A;  5IGA A;  4N8G A;  5KDT B;  2ONS A;  3ODB A;  4JSD A;  2XD2 A;  1BK4 A;  2QPQ A;  3G7W A;  5AA1 A;  4F3P A;  1PB9 A;  5EYF A;  3TKD A;  1LFH A;  1ZTY A;  3U93 A;  2Y7W A;  3KG2 A;  4G8N A;  3RUM A;  3I5O A;  3GLB A;  3K6X A;  4F31 B;  2XXK A;  4OVS A;  4FJP A;  2REJ A;  3KOS A;  4G68 B;  1QUI A;  2Q74 A;  3BBR A;  5H8H B;  3W9V A;  2I0B A;  2XWI A;  4EDP A;  1MQH A;  3IJO B;  2F36 A;  2F5X A;  4PBH A;  3TFL A;  2B4M A;  4OMB A;  4ND9 A;  2V93 A;  1PBP A;  4GWZ A;  4F3B A;  2BJJ X;  4OER A;  1QW0 A;  4JWX A;  4IY6 A;  1N7X A;  3DP8 A;  3N26 A;  4F3G A;  1D4N A;  2I58 A;  5I3S A;  2Y84 A;  1MQD A;  4LQ5 A;  3T22 A;  2DSF A;  3IB1 A;  3HHG A;  3LC8 A;  1SW2 A;  1RKM A;  4FBP A;  2D3I A;  1IIW A;  1LBV A;  2XHD A;  4H5G A;  1B58 A;  3TTN A;  3DP6 A;  2DVZ A;  1NUW A;  2HAU A;  1NUX A;  4PCD A;  3K00 A;  4I3E A;  5JEI A;  1KWH A;  2AIX A;  3FIR A;  4JB7 A;  1URS A;  3TOD A;  1K9Y A;  2GFE A;  3MZ9 A;  1MDP 1;  2VD2 A;  1XC1 A;  5BUU A;  2CEX A;  4P0G A;  4L17 A;  4H5F A;  4GXA A;  2H99 A;  4NF8 A;  1IEJ A;  3PD9 A;  3RT8 A;  1MH3 A;  1OVB A;  1MY1 A;  4N17 A;  4U23 A;  2QS1 A;  2ESN A;  5JK4 A;  1EZ9 A;  3TCH A;  3UN6 A;  3DM0 A;  2R9J A;  4KFQ A;  2XX9 A;  1LST A;  4FEB A;  1ZIU A;  3MZB A;  4R6K A;  3O28 A;  3N6T A;  4N6K A;  4HCY A;  5DT6 A;  1B7H A;  4P47 A;  1ANF A;  1FBF A;  4ELQ A;  2B4L A;  2Z8D A;  3H6V A;  2DWI A;  5DVI A;  1QKA A;  4JVI A;  5AE4 A;  1FTL A;  4XFE A;  4PFW A;  2X7Q A;  4GD5 A;  4U4X A;  1P99 A;  1KA1 A;  2QRY A;  4U22 A;  1FQA A;  2UYF A;  3FAT A;  5EQ9 A;  3C9H A;  3O6G A;  2F34 A;  5TPA A;  3IB2 A;  1B2H A;  2XWV A;  2F8D A;  4ZZA A;  3IK6 B;  2P1S A;  3FZV A;  3MBP A;  4XKN A;  1FBD A;  4PP0 A;  2DYX A;  3MP1 A;  3LUZ A;  2RIN A;  1PDA A;  1SDX A;  4E0X A;  2VGQ A;  4G77 A;  2NWJ A;  4UAB A;  3A09 A;  2NXO A;  3FVO A;  2F6G A;  1FBE A;  5FBP A;  3CG3 A;  3T9U A;  3MPL A;  3QSL A;  3IL1 B;  1FBP A;  4Z0I A;  4BDR A;  4KR5 A;  3TEP A;  1NV4 A;  4H67 A;  3E9X A;  5I56 A;  2CEY A;  3SEX A;  2Y7I A;  3USD A;  1RDX A;  2QL3 A;  1NKX A;  2CZH A;  1LBW A;  3T93 B;  1NH8 A;  4FIM A;  3FV1 A;  2O7I A;  5F24 A;  3U94 A;  3FV2 A;  3A3C A;  4NGU A;  4ECF A;  1BTJ A;  4GQO A;  4LP2 B;  5H8N A;  1POY 1;  4H8I A;  5EYH A;  3LSL A;  1L5T A;  1FPG A;  1OVT A;  4C1U A;  1MM6 A;  4U1Z A;  4IO6 A;  1OQG A;  4QHQ A;  4NN3 A;  1PB8 A;  4DCX A;  2YJP A;  1A99 A;  1LBB A;  1Y1M A;  2VPO A;  2VT5 A;  3HO7 A;  4U1O A;  3KSX A;  3PPO A;  2WKY A;  2D5W A;  3G3G A;  2WBD A;  3B7D A;  5EQ7 A;  1SW4 A;  3FD3 A;  1TWY A;  3TZA A;  3UIF A;  4QFO A;  2REG A;  3E79 A;  3OXN A;  4DI4 B;  4N81 A;  3T9X B;  2G29 A;  1DPP A;  2A5T A;  4ELO A;  1PC3 A;  1NUZ A;  1B0H A;  5DEX A;  1B32 A;  3MW0 A;  3C31 A;  4QBA A;  3PUX E;  3S2V A;  1O64 A;  5L8D A;  3MJN A;  4AB6 A;  1NUY A;  1AMF A;  4YKI A;  3MP8 A;  2GHA A;  1QVS A;  4MMP A;  5I2K A;  3N94 A;  4LUB A;  2AYS A;  4R6H A;  3R6U A;  1TT1 A;  5EQ8 A;  1B4H A;  4G2Z A;  2ZZX A;  3SES A;  1P1N A;  2ZYM A;  4ZEC A;  4DIG A;  4FAJ A;  1IME A;  4AQ4 A;  4GWO A;  3P7I A;  3CIJ A;  1DSN A;  1Y3P A;  4GWS A;  4OXV A;  1NNF A;  3CG1 A;  1BLF A;  3MWB A;  3PTY A;  4U21 A;  3EKI A;  3MAM A;  3FXQ A;  4MNP A;  2THI A;  2DDK A;  3TUS A;  1B52 A;  2XX7 A;  4YMB A;  1B3F A;  1BKA A;  1MPC A;  1SW5 A;  2Z8F A;  2FA7 A;  2PX1 A;  2HXW A;  3V83 A;  2DE4 A;  1N0T A;  1MY2 A;  4HS7 A;  4TQU Q;  2OZZ A;  4M1V A;  1YYZ A;  3GZG A;  4ZS9 A;  4F1V A;  2I48 A;  1FQC A;  3FAS A;  3SEY A;  3T9V A;  5ICT A;  2XXY A;  5AA3 A;  3QUF A;  2VOZ A;  4YMA A;  2YPN A;  5TU0 A;  3RTW B;  2ZZV A;  3MVX A;  1M5C A;  5B70 A;  1MY3 A;  3CFX A;  5ESY A;  1SI0 A;  4NF5 A;  1LCT A;  1FQF A;  5I2N B;  4Q8R A;  1NFT A;  1GV8 A;  1O63 A;  1OLA A;  2KQZ A;  4X04 A;  4OHN A;  2DE3 A;  1URD A;  5ET6 A;  4P9K A;  5CC2 A;  3KN7 A;  1LEV A;  5CBR A;  4C1T A;  3TQL A;  3BIH A;  1LAF E;  3B6W A;  3O97 A;  5HBC A;  2PYY A;  1POT A;  3PPQ A;  4ZEF A;  1JET A;  3M3L A;  1TFA A;  5JTY B;  1G0H A;  1NV6 A;  2Z8E A;  3T66 A;  2XXT A;  1FSA A;  4QSD A;  3FJ7 A;  3UP9 A;  1FQD A;  3KZG A;  4Q0C A;  1FJ6 A;  1F9B A;  4PFT A;  2B65 A;  3M8U A;  4ONY A;  1RDZ A;  2ABH A;  2KLF A;  3VVF A;  4EUO A;  1D9Y A;  4GWY A;  1Q1K A;  5I57 A;  3SKP A;  4MX6 A;  2A5S A;  4DXU A;  1ATG A;  4BDO A;  4GX4 A;  1D9Q A;  3VV5 A;  3PPP A;  3RY3 A;  2RF1 A;  5DVF A;  1M5F A;  4E0W A;  1EYI A;  2R6G E;  4ESX A;  4EQ9 A;  2E1S A;  2WBB A;  2RCB A;  3E3K A;  4OVP A;  4AS4 A;  2WEF A;  3C36 A;  3TEL A;  1Q35 A;  5LDZ A;  4OFL A;  2OBG A;  3HPI A;  2DS9 A;  3EQ1 A;  4JSO A;  4OVR A;  3KJT A;  1B7U A;  1JQF A;  3PPR A;  3ZKL A;  1FPK A;  2ANJ A;  2YLN A;  3B6T A;  4MEV A;  1KA0 A;  2Y5L A;  3T0J A;  1MXY A;  4YAH X;  3M3F A;  3K02 A;  2V84 A;  2UVI A;  2P3N A;  4PTK A;  1EH3 A;  4OTE A;  4RK9 A;  2F3D A;  3MVW A;  2QS2 A;  1KZ8 A;  1FPJ A;  4H6D A;  1ZLQ A;  4H65 A;  1NH7 A;  3Q28 A;  2DVC A;  3EN3 A;  1GTK A;  2Z22 A;  1B5I A;  4MF3 A;  1MQI A;  3D4G A;  2V3U A;  3IOV A;  3PMX A;  1SVX B;  2ZXT A;  4MNC A;  5IZ3 B;  5H8F A;  4F1U A;  4F3S A;  3KOT A;  4EQ7 A;  3TAJ A;  1P1W A;  5F1Q A;  1TFD A;  3O9P A;  4JDF A;  4EQB A;  4P11 A;  1UTB A;  2E0S A;  1IXG A;  3MPK A;  2GHB A;  4KYE A;  2NOO A;  4NF8 B;  4NE4 A;  4YU0 A;  5I7I A;  4ZE9 A;  3IX1 A;  4OFO A;  2XXV A;  3VXC A;  5ET5 A;  5H8S A;  3HCQ A;  5AA2 A;  3CSG A;  2GRV A;  1LLS A;  3U8Q A;  3OSR A;  4H1X A;  3H03 A;  1A55 A;  2CZK A;  4UAC A;  3S9N C;  3ROJ A;  3TYH A;  2OLB A;  1IMD A;  4NQ8 A;  1AWB A;  3NOH A;  5BWJ A;  1S9T A;  1AIV A;  5L9O A;  1ZKB A;  1N76 A;  1B5H A;  4WED A;  5CBS A;  2P3V A;  1B7Z A;  2UVH A;  2X26 A;  3O2A A;  2XWK A;  3ONM A;  4LZ8 A;  1EYJ A;  5I84 A;  4NF6 A;  3H6W A;  2ONK E;  3G3J A;  3BKI B;  1FBC A;  3TTK A;  2P2A A;  4NHB A;  2QVV A;  5EHM A;  5FHO A;  5TPA B;  4N8Y A;  4O3B A;  4HTG A;  5J1D A;  5EHS A;  1ZBM A;  3TCG A;  4IB2 A;  3JV9 A;  1GGG A;  4AB5 A;  1JP4 A;  2JJK A;  4F19 A;  1Z7N E;  5H8Q A;  1NV0 A;  1P1O A;  3FUZ A;  2PFY A;  3S9M C;  4GOT A;  1XVY A;  1YAE A;  4NMY A;  3T96 B;  3KEI A;  3H6U A;  2IEE A;  4RPO A;  5I56 B;  1Y1Z A;  3RPW A;  3S9L C;  1SYI A;  1PB7 A;  2DXR A;  4F39 A;  3B50 A;  4LAT A;  2WX9 A;  1MXW A;  1IMC A;  1MXZ A;  1IXC A;  1AH5 A;  2XXU A;  4F18 A;  4OQO A;  2VPN A;  2I0C A;  1IMA A;  1LFG A;  4XKQ A;  3K1P A;  5H8N B;  3U1O A;  3MC2 A;  3C4M A;  3HHF A;  2OWS A;  2Q9T A;  3VLV A;  5EQA A;  2UVG A;  1DK4 A;  2XA5 A;  3RTF B;  3AXF A;  3OEM A;  2HPG A;  5TP9 A;  2GQ1 A;  4BDN A;  4Q30 B;  4XF5 A;  4G4P A;  1MM7 A;  3SDF A;  3PUZ E;  1Y4C A;  4ZED A;  4ZEI A;  3LSW A;  4WKM A;  4DXB A;  2FNC A;  3OO6 A;  2A5T B;  4QXD A;  4YIC A;  4ZDM A;  5ICQ A;  2H9B A;  4HE1 A;  5DEX B;  2PT2 A;  3E78 A;  4GF8 A;  3TDJ A;  5L9S A;  3QXM A;  2PCR A;  1CB6 A;  1UIV A;  4ELR A;  2Q2C A;  4ISU A;  1LAH E;  3EHS A;  2X7P A;  5ISU A;  3G3H A;  1GR2 A;  5I2K B;  1VFD A;  2FYI A;  3OEL A;  3L6H A;  1FPF A;  2H5Y A;  4C0R A;  4IO3 A;  2LAO A;  2DWH A;  3BIG A;  4PAF A;  3JZJ A;  3TMG A;  3IAZ A;  3VVD A;  1MH4 A;  4GIZ A;  2I3V A;  1RYX A;  2H98 A;  3BFT A;  1LB9 A;  1OIB A;  4LA9 A;  4JVC A;  1LCF A;  1MXU A;  5CM6 A;  3HST A;  4AS5 A;  1CNQ A;  4POW A;  2OWZ A;  3K6U A;  2I4C A;  2UXA A;  4MJO A;  5KCJ A;  2XXQ A;  1VE4 A;  5DYH A;  4P3L A;  3PMV A;  1B40 A;  2FBP A;  1INP A;  1D9V A;  2RC9 A;  2F78 A;  4DLD A;  2Y5K A;  4PAK A;  3L6G A;  3TPA A;  1WOD A;  5A5X B;  2NVU B;  1URG A;  3G3K A;  3RT6 B;  1LBC A;  4QRZ A;  4PFY A;  1EZP A;  3RPL A;  3QUJ A;  1LAG E;  1DTZ A;  5FHN A;  1JW1 A;  2CZL A;  4Z7E A;  4GX6 A;  1MXX A;  1OLC A;  2MKZ A;  4GWW A;  3VE1 B;  2F7A A;  4JWO A;  1PBQ A;  1A8E A;  3D4C A;  3PUV E;  4KD5 A;  4PBQ A;  1YZ0 A;  4O7I A;  1NV5 A;  1IZ1 A;  1JNF A;  4BDM A;  4NF5 B;  1IMB A;  2PT1 A;  3LR1 A;  4GL8 A;  2XXX A;  4P8B A;  1YXI A;  3G3I A;  4P1L A;  1IMF A;  1S50 A;  1SPI A;  1DPE A;  4NF4 A;  5EYG A;  3H7M A;  4QFL A;  5DVJ A;  3GXA A;  2HAV A;  3K0V A;  4WXJ A;  3UOR A;  3KC0 A;  3FVN A;  1JEU A;  3SEV A;  2I6E A;  3MST A;  3SER A;  1YTV A;  4TLL B;  1B4Z A;  4RY1 A;  4FAT A;  1DTG A;  4XXU A;  3QYT A;  1B51 A;  3EHT A;  1NV7 A;  2H4I A;  4NG7 A;  3B8B A;  4PDH A;  4JWY A;  4HCW A;  4P1E A;  2QMW A;  3U72 A;  1MDQ A;  1Y9U A;  1B3H A;  4IR8 A;  5I57 B;  4TOZ A;  1B05 A;  4FED A;  3V89 B;  4F29 A;  1B0L A;  2O51 A;  4WEP A;  2DWA A;  4FEC A;  4BDQ A;  1FRP A;  4H45 A;  3LSX A;  2XWO A;  3O6I A;  3GBB A;  3K01 A;  4I40 A;  2I3W A;  3K1M A;  4KXP A;  2W7Y A;  1SW1 A;  5I59 A;  4OEV A;  1QKB A;  2QVR A;  1N84 A;  2O1L A;  1R1N A;  1RYO A;  3C32 A;  4R72 A;  1VFE A;  3C33 A;  2F3B A;  4KI0 E;  2ONR A;  4OEN A;  3CSB A;  4F22 A;  2DQV A;  4LZ5 A;  1DBZ A;  3UK4 A;  3OO9 A;  3THI A;  5J16 A;  5AA4 B;  1Y3N A;  3ZS6 A;  2R8T A;  3VXB A;  4LON B;  1USY E;  3IOW A;  3TTL A;  1YPN A;  1OMP A;  3RNN A;  3S9E A;  4ZZE A;  4U4S A;  4GWU A;  2DE2 A;  1Y20 A;  5H8F B;  3PU5 A;  4N4U A;  2NUV A;  3IO6 A;  5LTC A;  5T3J A;  1D3K A;  1XOC A;  2V4C A;  1NNP A;  1LGB C;  4NWD A;  4NAP A;  2Q88 A;  2Q2A A;  1FBG A;  1XS5 A;  1EYK A;  4R2F A;  4M4G A;  4NF0 A;  2ZYN A;  5F7V A;  4O3C A;  3IR1 A;  2Z23 A;  4NTL A;  3V8X B;  1FTA A;  5K2Y A;  3D1R A;  5I2N A;  5FHM A;  5LOM A;  4PC9 A;  1M5E A;  1LBX A;  4EXK A;  3N5L A;  1QJM A;  1N7W A;  3UGW A;  4I62 A;  4ZE8 A;  4HE2 A;  2AL4 A;  4MLQ A;  3Q25 A;  1A54 A;  2OJT A;  4ESW A;  3PD8 A;  4QF9 A;  2ZNT A;  4IGR A;  4PFB A;  1IXI A;  1S7Y A;  3FJM A;  3IOU A;  1FTO A;  2Y7K A;  1AOV A;  3A3U A;  3W9W A;  3R7X A;  4OES A;  2IA4 A;  4OVQ A;  2HEU A;  1JEV A;  3IOR A;  1NV2 A;  1FTM A;  2V3T A;  3W15 C;  3HN0 A;  4QSC A;  3SEW A;  2DP8 A;  1MPD A;  3Q26 A;  4N6D A;  4I3Y A;  4GFR A;  2VHA A;  3ECR A;  1MS7 A;  4GX3 A;  4THI A;  1DOT A;  3T9H B;  1ZU0 A;  1B6H A;  3O66 A;  3TQW A;  1QUK A;  2ZYK A;  4RXL A;  4ZEB A;  1I69 A;  3RN8 A;  3IFC A;  4LN5 A;  4QFP A;  3MZ1 A;  4JXI A;  3RGY A;  2DXY A;  5H8Q B;  4F2O A;  1MQG A;  4NWC A;  1EZO A;  1N3W A;  5CMC A;  5KZT A;  5HPQ A;  1SBP A;  4OWD A;  4IO4 A;  1B1X A;  4R6Y A;  4O7M A;  4R9F A;  4JBZ A;  4POX A; 
#chains in the Genus database with same CATH homology
 3CFL A;  4RPN A;  4OVJ A;  4KCD A;  1UTH A;  3SEU A;  5I58 A;  1P1Q A;  4TLM B;  3IO4 A;  1FCK A;  1IIT A;  2ZMB A;  1QUJ A;  1LB8 A;  1MXV A;  1HSJ A;  5KDT A;  1IQ7 A;  1B3L A;  3FVG A;  5K2X A;  4MLV A;  1MPB A;  3LUY A;  3KSJ A;  4YZZ A;  5ITO A;  3HV1 A;  2O7U A;  5TP9 B;  4DXC A;  4N13 A;  2QSX A;  4NED A;  1ZMG A;  2ALU A;  1SYH A;  3CFZ A;  4P0I A;  3V5A A;  4RK2 A;  2O84 X;  4RJZ A;  4G68 A;  2Y7P A;  4QFK A;  4U2R A;  2QS4 A;  5H8H A;  2H25 A;  4PET A;  3LSF B;  1XT8 A;  2F7C A;  4KHZ E;  2HCA A;  3PUY E;  3MVY A;  1UIU A;  2ZNS A;  4LVQ A;  3E4R A;  2M8C A;  1US5 A;  1FTJ A;  1NNK A;  4N6P A;  4YB6 A;  3C34 A;  2HZL A;  1JVY A;  3E13 X;  1Y4T A;  2PMS A;  2G93 A;  1CE2 A;  2V25 A;  3TTM A;  1B3G A;  1NMU A;  4YKJ A;  1FQE A;  1I6Q A;  2ZYO A;  4GLI A;  3FVK A;  4MH5 A;  4MFI A;  5ITP A;  3MUQ A;  3H4Z A;  5DTB A;  3KBR A;  1H3D A;  3K1N A;  1IXH A;  4X1B A;  5KCJ B;  3PMW A;  4K3F A;  1J1N A;  1GVC A;  1N04 A;  5FTI A;  3K2D A;  1I6B A;  2Q8J A;  3RQT A;  1BIY A;  3IB0 A;  4XKR A;  1YCJ A;  1AL3 A;  3OO8 A;  3SET A;  4H8J A;  1NNT A;  3KGC A;  2B3F A;  2QJE A;  1SI1 A;  1R9Q A;  4PFU A;  2XX8 A;  1VR5 A;  1XHY A;  2OWT A;  2R71 A;  4H0W A;  4YKK A;  4R73 A;  4MBP A;  2UVJ A;  3QIM A;  2PVU A;  3H6T A;  3KJ7 A;  3PV0 E;  2B3B A;  3EPE A;  4DDD A;  4I8C A;  3CR9 A;  1IUD A;  1I6A A;  1QUL A;  3PGF A;  4DCY A;  1MG1 A;  1JW4 A;  1EU8 A;  4XTC Q;  5M2V A;  1H76 A;  3F11 A;  2O68 A;  4NF4 B;  4YB5 A;  1H44 A;  1N3X A;  3Q27 A;  1SQY A;  2HFB A;  3GBA A;  4KYD A;  4KPT A;  4I9D A;  1XVX A;  5CMK A;  4PE5 B;  2O6A A;  3JYR A;  3K6W A;  3OSQ A;  4YKP A;  3ZKK A;  4IY5 A;  2UYE A;  5CMB A;  3QK6 A;  2HQ0 A;  1R9L A;  3CVG A;  2RKM A;  1USY H;  2OK2 A;  3PUW E;  4YB7 A;  2XXR A;  2D21 A;  3IOT A;  2XXP A;  3R26 A;  4LQ2 A;  4I1D A;  2GH9 A;  1LFI A;  3QAX A;  3S4U A;  4KYS A;  1A40 A;  3O29 A;  4UA8 A;  2Y7R A;  4RA1 A;  1B1H A;  1P1U A;  3ZSF A;  3UA8 A;  5FTH A;  3I6V A;  3MP6 A;  3TCF A;  5I59 B;  4DE8 A;  3VFJ A;  1O7T A;  4HW8 A;  2I49 A;  4GVO A;  2O69 A;  2V3Q A;  4R74 A;  4IGT A;  3EF7 A;  1OQH A;  1Z7M E;  4KQP A;  2VP1 A;  3H06 B;  1R6Z A;  3Q29 A;  4X48 A;  4ZEK A;  1MY4 A;  4G8M A;  4R2B A;  4FOR A;  2XD3 A;  3DEL B;  2I4B A;  2XXI A;  3VLW A;  3H3G A;  1ZJL A;  1B9J A;  2DWJ A;  4OFJ A;  1DMB A;  1JW5 A;  1PEB A;  2QMX A;  5IAI A;  5CI5 A;  3N6U A;  4OYV A;  5A5X A;  1B5J A;  1MRP A;  3MQ9 A;  3BFU A;  2DOJ A;  1WDN A;  4F1Y A;  3DLN A;  1ELJ A;  3TTR A;  3OMB A;  3VDF A;  4FE8 A;  1FW0 A;  3B6Q A;  1A8F A;  4XKP A;  4F2Q A;  2F35 A;  1T0K A;  2ZNU A;  4XIG Q;  2XXW A;  3RLF E;  3OD7 A;  1M5D A;  4QSE A;  4IO2 A;  2PBW A;  5AA2 D;  3VLU A;  3VVE A;  2XXH A;  1SD3 A;  3WAF A;  4OET A;  2HZK A;  2RC8 A;  2Q89 A;  3G3F A;  1MQJ A;  3EHU A;  1H45 A;  1B46 A;  3K4U A;  1FQB A;  2VD3 A;  4R9G A;  5ELV A;  4IO5 A;  3KFM A;  1TXF A;  2RCA A;  4PQJ A;  3FXR A;  3WAE A;  1Y3Q A;  3ILT B;  3FXU A;  3OEN A;  1HSL A;  3OEK A;  5CRY A;  4EXL A;  4R75 A;  4G68 C;  2F7B A;  4BDL A;  3OO7 A;  4OZ9 A;  3LBS A;  1UQW A;  3KN8 A;  4GL0 A;  3K6V A;  3C35 A;  3CRB A;  3ILU B;  4RNS A;  1H43 A;  3I3V A;  4EF2 A;  2P0S A;  3FGS A;  5CMM A;  1M5B A;  4N07 A;  2O1M A;  2RC7 A;  2F6P A;  1UTB B;  3DP4 A;  3FJG A;  4Q5T A;  2CMO A;  1II5 A;  4IO7 A;  4OEU A;  1MY0 A;  5L9M A;  1BP5 A;  1HSE A;  5B7D A;  3M3K A;  1VSO A;  1US4 A;  4GXS B;  3IJX B;  4X1D A;  3CI8 A;  4KCC A;  4LZ7 A;  3O6H A;  2QS3 A;  4EF1 A;  5AA2 B;  3KN3 A;  3OOA A;  3U92 A;  1NL5 A;  5HM4 B;  1FTK A;  4O3A A;  4GRK A;  1LAX A;  5IKB A;  4QFN A;  4RYA A;  4DZ1 A;  4G8H A;  1WVJ A;  1A7L A;  2OCU A;  3MVZ A;  1UTH B;  2AL5 A;  3PPN A;  5JTY A;  5I58 B;  4X9T A;  4ELP A;  2F97 A;  1JVX A;  5AA4 A;  4BLA A;  4NF6 B;  1B3E A;  5KDT B;  2ONS A;  3ODB A;  4JSD A;  2XD2 A;  2QPQ A;  3G7W A;  5AA1 A;  4F3P A;  1PB9 A;  5EYF A;  3TKD A;  1LFH A;  1ZTY A;  3U93 A;  2Y7W A;  3KG2 A;  4G8N A;  3RUM A;  3I5O A;  3GLB A;  3K6X A;  4F31 B;  4FJP A;  2REJ A;  3KOS A;  4G68 B;  1QUI A;  3BBR A;  5H8H B;  3W9V A;  2I0B A;  4EDP A;  1MQH A;  3IJO B;  2F36 A;  2F5X A;  3TFL A;  4OMB A;  4ND9 A;  2V93 A;  1PBP A;  4F3B A;  2BJJ X;  4OER A;  1QW0 A;  4JWX A;  4IY6 A;  1N7X A;  3DP8 A;  3N26 A;  4F3G A;  1D4N A;  2I58 A;  2Y84 A;  1MQD A;  4LQ5 A;  3T22 A;  2DSF A;  3IB1 A;  3HHG A;  3LC8 A;  1SW2 A;  1RKM A;  2D3I A;  1IIW A;  2XHD A;  4H5G A;  1B58 A;  3TTN A;  3DP6 A;  2DVZ A;  2HAU A;  3K00 A;  5JEI A;  1KWH A;  2AIX A;  3FIR A;  4JB7 A;  1URS A;  3TOD A;  2GFE A;  3MZ9 A;  1MDP 1;  2VD2 A;  1XC1 A;  5BUU A;  4P0G A;  4L17 A;  4H5F A;  4GXA A;  2H99 A;  4NF8 A;  1IEJ A;  3PD9 A;  3RT8 A;  1MH3 A;  1OVB A;  1MY1 A;  4U23 A;  2QS1 A;  2ESN A;  5JK4 A;  1EZ9 A;  3TCH A;  3UN6 A;  3DM0 A;  2R9J A;  4KFQ A;  2XX9 A;  1LST A;  4FEB A;  1ZIU A;  3MZB A;  4R6K A;  3O28 A;  3N6T A;  4HCY A;  5DT6 A;  1B7H A;  1ANF A;  4ELQ A;  2Z8D A;  3H6V A;  2DWI A;  5DVI A;  1QKA A;  5AE4 A;  1FTL A;  4PFW A;  2X7Q A;  4GD5 A;  4U4X A;  1P99 A;  2QRY A;  4U22 A;  1FQA A;  2UYF A;  3FAT A;  3C9H A;  3O6G A;  2F34 A;  5TPA A;  3IB2 A;  1B2H A;  2F8D A;  4ZZA A;  3IK6 B;  2P1S A;  3FZV A;  3MBP A;  4XKN A;  4PP0 A;  2DYX A;  3MP1 A;  2RIN A;  1PDA A;  1SDX A;  4E0X A;  2VGQ A;  4G77 A;  2NWJ A;  3A09 A;  2NXO A;  3FVO A;  2F6G A;  3CG3 A;  3T9U A;  3MPL A;  3QSL A;  3IL1 B;  4Z0I A;  4BDR A;  4KR5 A;  3TEP A;  4H67 A;  3E9X A;  5I56 A;  3SEX A;  2Y7I A;  3USD A;  2QL3 A;  1NKX A;  3T93 B;  1NH8 A;  4FIM A;  3FV1 A;  2O7I A;  3U94 A;  3FV2 A;  3A3C A;  4ECF A;  1BTJ A;  4GQO A;  4LP2 B;  5H8N A;  1POY 1;  4H8I A;  3LSL A;  1L5T A;  1OVT A;  4C1U A;  1MM6 A;  4U1Z A;  4IO6 A;  1OQG A;  4QHQ A;  1PB8 A;  4DCX A;  2YJP A;  1A99 A;  1LBB A;  1Y1M A;  3HO7 A;  4U1O A;  3KSX A;  3PPO A;  2WKY A;  2D5W A;  3G3G A;  3B7D A;  1SW4 A;  3FD3 A;  1TWY A;  3TZA A;  3UIF A;  4QFO A;  2REG A;  3OXN A;  3T9X B;  2G29 A;  1DPP A;  2A5T A;  4ELO A;  1PC3 A;  1B0H A;  5DEX A;  1B32 A;  3MW0 A;  3C31 A;  3PUX E;  3S2V A;  1O64 A;  5L8D A;  3MJN A;  4AB6 A;  1AMF A;  4YKI A;  3MP8 A;  2GHA A;  1QVS A;  5I2K A;  3N94 A;  4LUB A;  2AYS A;  4R6H A;  3R6U A;  1TT1 A;  1B4H A;  4G2Z A;  3SES A;  1P1N A;  2ZYM A;  4ZEC A;  4DIG A;  4FAJ A;  4AQ4 A;  4GWO A;  3P7I A;  3CIJ A;  1DSN A;  1Y3P A;  4OXV A;  1NNF A;  3CG1 A;  1BLF A;  3MWB A;  4U21 A;  3MAM A;  3FXQ A;  2THI A;  3TUS A;  1B52 A;  2XX7 A;  4YMB A;  1B3F A;  1BKA A;  1MPC A;  1SW5 A;  2Z8F A;  2FA7 A;  2PX1 A;  2HXW A;  3V83 A;  2DE4 A;  1N0T A;  1MY2 A;  4HS7 A;  4TQU Q;  2OZZ A;  4M1V A;  3GZG A;  4ZS9 A;  4F1V A;  2I48 A;  1FQC A;  3FAS A;  3SEY A;  3T9V A;  5ICT A;  2XXY A;  5AA3 A;  3QUF A;  2VOZ A;  4YMA A;  2YPN A;  5TU0 A;  3RTW B;  3MVX A;  1M5C A;  5B70 A;  1MY3 A;  3CFX A;  1SI0 A;  4NF5 A;  1LCT A;  1FQF A;  5I2N B;  4Q8R A;  1NFT A;  1GV8 A;  1O63 A;  1OLA A;  4OHN A;  2DE3 A;  1URD A;  5CC2 A;  3KN7 A;  5CBR A;  4C1T A;  3TQL A;  1LAF E;  3B6W A;  3O97 A;  5HBC A;  2PYY A;  1POT A;  3PPQ A;  4ZEF A;  1JET A;  3M3L A;  1TFA A;  5JTY B;  2Z8E A;  3T66 A;  2XXT A;  4QSD A;  3FJ7 A;  3UP9 A;  1FQD A;  3KZG A;  4Q0C A;  1F9B A;  4PFT A;  2B65 A;  3M8U A;  4ONY A;  2ABH A;  2KLF A;  3VVF A;  4EUO A;  1D9Y A;  1Q1K A;  5I57 A;  3SKP A;  2A5S A;  4DXU A;  1ATG A;  4BDO A;  3VV5 A;  3PPP A;  3RY3 A;  2RF1 A;  5DVF A;  1M5F A;  4E0W A;  2R6G E;  4ESX A;  4EQ9 A;  2E1S A;  2RCB A;  3E3K A;  3C36 A;  3TEL A;  1Q35 A;  4OFL A;  2OBG A;  3HPI A;  2DS9 A;  3EQ1 A;  4JSO A;  3KJT A;  1B7U A;  1JQF A;  3PPR A;  3ZKL A;  2ANJ A;  2YLN A;  3B6T A;  1MXY A;  4YAH X;  3M3F A;  3K02 A;  2V84 A;  2UVI A;  1EH3 A;  4OTE A;  4RK9 A;  3MVW A;  2QS2 A;  4H6D A;  1ZLQ A;  4H65 A;  1NH7 A;  3Q28 A;  2DVC A;  3EN3 A;  1GTK A;  2Z22 A;  1B5I A;  4MF3 A;  1MQI A;  3D4G A;  2V3U A;  3IOV A;  3PMX A;  1SVX B;  2ZXT A;  5H8F A;  4F1U A;  4F3S A;  3KOT A;  4EQ7 A;  3TAJ A;  1P1W A;  5F1Q A;  1TFD A;  3O9P A;  4JDF A;  4EQB A;  4P11 A;  1UTB A;  2E0S A;  1IXG A;  3MPK A;  2GHB A;  4KYE A;  2NOO A;  4NF8 B;  4NE4 A;  4YU0 A;  4ZE9 A;  3IX1 A;  4OFO A;  2XXV A;  3VXC A;  5H8S A;  3HCQ A;  5AA2 A;  3CSG A;  2GRV A;  1LLS A;  3U8Q A;  3OSR A;  4H1X A;  3H03 A;  1A55 A;  4UAC A;  3S9N C;  3TYH A;  2OLB A;  5BWJ A;  1AIV A;  1S9T A;  5L9O A;  1ZKB A;  1N76 A;  1B5H A;  4WED A;  5CBS A;  1B7Z A;  2UVH A;  2X26 A;  3O2A A;  3ONM A;  4LZ8 A;  5I84 A;  4NF6 A;  3H6W A;  2ONK E;  3G3J A;  3BKI B;  3TTK A;  2P2A A;  5EHM A;  5FHO A;  5TPA B;  4O3B A;  4HTG A;  5J1D A;  5EHS A;  1ZBM A;  3TCG A;  4IB2 A;  3JV9 A;  1GGG A;  4AB5 A;  4F19 A;  1Z7N E;  5H8Q A;  1P1O A;  3FUZ A;  3S9M C;  4GOT A;  1XVY A;  1YAE A;  4NMY A;  3T96 B;  3KEI A;  3H6U A;  2IEE A;  4RPO A;  5I56 B;  1Y1Z A;  3RPW A;  3S9L C;  1SYI A;  1PB7 A;  2DXR A;  4F39 A;  4LAT A;  1MXW A;  1MXZ A;  1IXC A;  1AH5 A;  2XXU A;  4F18 A;  4OQO A;  2I0C A;  1LFG A;  4XKQ A;  3K1P A;  5H8N B;  3U1O A;  3MC2 A;  3C4M A;  3HHF A;  2OWS A;  2Q9T A;  3VLV A;  2UVG A;  3RTF B;  3AXF A;  3OEM A;  5TP9 A;  4BDN A;  4Q30 B;  4G4P A;  1MM7 A;  3SDF A;  3PUZ E;  1Y4C A;  4ZED A;  4ZEI A;  3LSW A;  4WKM A;  4DXB A;  2FNC A;  3OO6 A;  2A5T B;  4YIC A;  4ZDM A;  5ICQ A;  2H9B A;  5DEX B;  2PT2 A;  4GF8 A;  3TDJ A;  5L9S A;  3QXM A;  1CB6 A;  1UIV A;  4ELR A;  2Q2C A;  4ISU A;  1LAH E;  3EHS A;  2X7P A;  5ISU A;  3G3H A;  1GR2 A;  5I2K B;  1VFD A;  2FYI A;  3OEL A;  3L6H A;  2H5Y A;  4C0R A;  4IO3 A;  2LAO A;  2DWH A;  3JZJ A;  3TMG A;  3IAZ A;  3VVD A;  1MH4 A;  4GIZ A;  2I3V A;  1RYX A;  2H98 A;  3BFT A;  1LB9 A;  1OIB A;  4LA9 A;  1LCF A;  1MXU A;  5CM6 A;  3HST A;  4POW A;  3K6U A;  2I4C A;  2UXA A;  5KCJ A;  2XXQ A;  1VE4 A;  5DYH A;  3PMV A;  1B40 A;  1D9V A;  2RC9 A;  2F78 A;  4DLD A;  3L6G A;  3TPA A;  1WOD A;  5A5X B;  2NVU B;  1URG A;  3G3K A;  3RT6 B;  1LBC A;  4QRZ A;  4PFY A;  1EZP A;  3QUJ A;  1LAG E;  1DTZ A;  5FHN A;  1JW1 A;  2CZL A;  4Z7E A;  1MXX A;  1OLC A;  3VE1 B;  2F7A A;  4JWO A;  1PBQ A;  1A8E A;  3D4C A;  3PUV E;  4KD5 A;  1IZ1 A;  1JNF A;  4BDM A;  4NF5 B;  2PT1 A;  3LR1 A;  4GL8 A;  2XXX A;  3G3I A;  1S50 A;  1DPE A;  4NF4 A;  3H7M A;  4QFL A;  5DVJ A;  3GXA A;  2HAV A;  3K0V A;  4WXJ A;  3UOR A;  3FVN A;  1JEU A;  3SEV A;  2I6E A;  3SER A;  1YTV A;  4TLL B;  1B4Z A;  4RY1 A;  4FAT A;  1DTG A;  4XXU A;  3QYT A;  1B51 A;  3EHT A;  2H4I A;  4JWY A;  4HCW A;  2QMW A;  3U72 A;  1MDQ A;  1Y9U A;  1B3H A;  5I57 B;  4TOZ A;  1B05 A;  4FED A;  3V89 B;  4F29 A;  1B0L A;  2O51 A;  4WEP A;  2DWA A;  4FEC A;  4BDQ A;  3LSX A;  3O6I A;  3GBB A;  3K01 A;  2I3W A;  3K1M A;  2W7Y A;  1SW1 A;  5I59 A;  4OEV A;  1QKB A;  1N84 A;  2O1L A;  1R1N A;  1RYO A;  3C32 A;  4R72 A;  1VFE A;  3C33 A;  4KI0 E;  2ONR A;  4OEN A;  3CSB A;  4F22 A;  2DQV A;  4LZ5 A;  3UK4 A;  3OO9 A;  3THI A;  5AA4 B;  1Y3N A;  3ZS6 A;  3VXB A;  4LON B;  1USY E;  3IOW A;  3TTL A;  1YPN A;  1OMP A;  3RNN A;  3S9E A;  4ZZE A;  4U4S A;  2DE2 A;  1Y20 A;  5H8F B;  3PU5 A;  2NUV A;  3IO6 A;  1D3K A;  1XOC A;  1NNP A;  1LGB C;  4NWD A;  2Q88 A;  2Q2A A;  1XS5 A;  4R2F A;  4M4G A;  2ZYN A;  5F7V A;  4O3C A;  3IR1 A;  2Z23 A;  4NTL A;  3V8X B;  5K2Y A;  5I2N A;  5FHM A;  5LOM A;  1M5E A;  4EXK A;  3N5L A;  1QJM A;  1N7W A;  3UGW A;  4I62 A;  4ZE8 A;  2AL4 A;  4MLQ A;  3Q25 A;  1A54 A;  2OJT A;  4ESW A;  3PD8 A;  4QF9 A;  2ZNT A;  4IGR A;  1IXI A;  1S7Y A;  3FJM A;  3IOU A;  1FTO A;  2Y7K A;  1AOV A;  3A3U A;  3W9W A;  3R7X A;  4OES A;  2IA4 A;  2HEU A;  1JEV A;  3IOR A;  1FTM A;  2V3T A;  3W15 C;  3HN0 A;  4QSC A;  3SEW A;  2DP8 A;  1MPD A;  3Q26 A;  4GFR A;  2VHA A;  3ECR A;  1MS7 A;  4THI A;  1DOT A;  3T9H B;  1ZU0 A;  1B6H A;  3O66 A;  3TQW A;  1QUK A;  2ZYK A;  4RXL A;  4ZEB A;  1I69 A;  3RN8 A;  4QFP A;  3MZ1 A;  4JXI A;  3RGY A;  2DXY A;  5H8Q B;  4F2O A;  1MQG A;  4NWC A;  1EZO A;  1N3W A;  5CMC A;  5KZT A;  5HPQ A;  1SBP A;  4OWD A;  4IO4 A;  1B1X A;  4R6Y A;  4R9F A;  4JBZ A;  4POX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...