2H99A

Crystal structure of the effector binding domain of a benm variant (r156h,t157s)
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
215
structure length
215
Chain Sequence
KTIRIGFVGSLLFGLLPRIIHLYRQAHPNLRIELYEMGTKAQTEALKEGRIDAGFGRLKISDPAIKHSLLRNERLMVAVHASHPLNQMKDKGVHLNDLIDEKILLYPSSPKPNFSTHVMNIFSDHGLEPTKINEVREVQLALGLVAAGEGISLVPASTQSIQLFNLSYVPLLDPDAITPIYIAVRNMEESTYIYSLYETIRQIYAYEGFTEPPNW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords HTH-type transcriptional regulator benM
publication title Inducer responses of BenM, a LysR-type transcriptional regulator from Acinetobacter baylyi ADP1.
pubmed doi rcsb
source organism Acinetobacter sp.
total genus 71
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h99A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2h99A02
5ICTA 3TYHA 4YAHX 1P1OA 3QUJA 4RA1A 1MQDA 4ELRA 3FV2A 3PD8A 4BDLA 5BWJA 3FJMA 1UTBA 1SDXA 2ZXTA 5I2NA 3SEYA 1MPBA 3IB0A 1Y4TA 3CG1A 1EZOA 2Y7PA 1R1NA 4ZEDA 3UGWA 2CZLA 4GL0A 4XKPA 1MDP1 3DM0A 3ODBA 4OFJA 1HSLA 3B6WA 1SYIA 3FVGA 3SESA 1NMUA 3O28A 4LQ2A 1FQDA 2I58A 3U72A 2P0SA 5FTIA 3OEKA 3CIJA 1OVBA 3C35A 1JVYA 4OETA 1MQJA 3T96B 3PV0E 3N94A 4ZDMA 4IGRA 3KSJA 1MXZA 4NWDA 3O6GA 5TU0A 1BTJA 4G8MA 2GRVA 4PE5B 4LUBA 2O68A 4I62A 4RYAA 1TFDA 4R6YA 1SW1A 4Q5TA 2VOZA 3IR1A 3G3JA 1B5IA 2ZNUA 4U21A 3G3GA 3TZAA 1RKMA 2GHBA 2H98A 1N0TA 5FHMA 3TKDA 2RCAA 2HAVA 2OWSA 4OEVA 2FNCA 3O6IA 4IO4A 4GIZA 1I6BA 2HFBA 3UA8A 3ECRA 4R6KA 2HZKA 4WKMA 4ELPA 3CVGA 3LSLA 4QFKA 1FTLA 3D4GA 3Q26A 2PT1A 3K01A 2I4CA 3RY3A 5ISUA 4RK2A 2Z8FA 1TFAA 5HPQA 3E9XA 4OENA 4IY5A 3GBBA 5EHSA 4PP0A 4FE8A 2ESNA 3C32A 2B3FA 5H8NA 4EF1A 4F29A 2XXHA 3GBAA 3H6UA 1JW1A 4IO7A 3BKIB 4HTGA 5L9MA 4IO2A 5IKBA 3E13X 3PUVE 1Z7ME 3P7IA 4G8HA 2F7BA 4G77A 4AB6A 4XTCQ 1B51A 5CBRA 2UVIA 3KZGA 4KFQA 4FIMA 4GD5A 2XHDA 4GF8A 4DCYA 3DP8A 3CG3A 4H5FA 3C4MA 4P0GA 3K0VA 3E3KA 3TTKA 1B6HA 1WDNA 1IUDA 3IOUA 3VXCA 2NWJA 2Q8JA 3G3KA 3Q27A 4G4PA 3MZ9A 2QS3A 4GQOA 5JTYA 3FD3A 2PT2A 4KCCA 5DVFA 5JK4A 1JW5A 4YKKA 1ANFA 2E0SA 4FAJA 4TOZA 4YB7A 3RTFB 3JV9A 3TCGA 1GVCA 1WVJA 1B0LA 2XXTA 3OO9A 1VFEA 4NWCA 3U93A 3A09A 2ONKE 1IZ1A 4WEPA 4F1VA 4F3GA 4H5GA 1MXYA 1MM6A 2B65A 2I3VA 1B9JA 1S9TA 5TP9A 4F18A 1FCKA 2X7QA 5CMBA 1LSTA 2H9BA 4RPOA 1LCTA 2F36A 4YKJA 1UIVA 2DWAA 5ITPA 4WEDA 1IITA 1R9QA 1MPCA 4IO3A 4OFOA 3LR1A 1IXIA 4UACA 1N04A 2QL3A 3TODA 1URGA 1FTKA 3USDA 3MJNA 4RPNA 3WAEA 3IOWA 3QUFA 1Y1MA 3C33A 4EDPA 3IK6B 4HS7A 4FJPA 1SI1A 1LFHA 4KD5A 3MZBA 3QSLA 4N6PA 4OHNA 2RC7A 1QJMA 4QSEA 1PC3A 3CSGA 1PB8A 2A5SA 1ZJLA 3CFZA 3IB2A 1MG1A 3V83A 5AA4A 3ZS6A 3OD7A 4TLLB 1LLSA 5L8DA 1AOVA 4OTEA 4PFYA 3PPOA 1B32A 1RYOA 1MXVA 2QS4A 3U1OA 4OQOA 3H6VA 4R75A 4Q30B 2QMXA 4LP2B 4BLAA 1NNPA 1ZTYA 5KCJA 3F11A 2OZZA 3MW0A 5A5XA 1MPDA 5H8NB 3S9NC 1I6AA 3FUZA 3IOTA 2Y84A 4EUOA 4QF9A 4HW8A 5I58A 2OCUA 2G29A 1SW4A 3FVOA 1M5EA 1ZIUA 4O3AA 3MC2A 1CE2A 2UVHA 1PBPA 3QXMA 3FJGA 1SI0A 1YTVA 3SEVA 5CBSA 4F1YA 1B4HA 4KHZE 4R73A 3KEIA 2P1SA 1HSJA 1H45A 4P11A 4TLMB 1M5FA 1LBBA 3C31A 3TMGA 2DWHA 2V25A 3FXRA 4F1UA 1URSA 4U1OA 1GGGA 3S9EA 5I57A 2Z23A 3FJ7A 4ESXA 1B3EA 4YKPA 5K2XA 4GL8A 3B6QA 1DPEA 1GTKA 1Y3NA 4ZEIA 3LSWA 3RQTA 3GXAA 4O3CA 3T9UA 4NF4B 3PGFA 5DYHA 4G68A 3HO7A 2UXAA 4ZEKA 1AMFA 3MVWA 3TEPA 2IEEA 4LQ5A 2O7UA 2DE4A 4POWA 5DVIA 3IX1A 4KYDA 3VVFA 4F3SA 2H4IA 1LAFE 3SEUA 2OLBA 1US5A 1N3WA 3PUXE 3TPAA 3VXBA 4ELQA 2Q2CA 3HCQA 4FECA 4BDMA 4QFOA 3LSXA 4I8CA 2PBWA 1FTMA 1QKAA 2V84A 1PEBA 3RPWA 2R9JA 2THIA 2F35A 4F2QA 3KJ7A 1URDA 3RT6B 2HEUA 2M8CA 3TTRA 1AL3A 1FQAA 3H3GA 2Q2AA 3O2AA 1MXXA 4KYSA 3T9HB 4UA8A 3KN3A 3T22A 2RC8A 4YB6A 3RLFE 1B1HA 1I69A 4PQJA 1P1UA 1YPNA 4Q0CA 4R9GA 4C0RA 2H5YA 4JB7A 1ZBMA 3IO6A 1R9LA 3L6HA 3V89B 3H4ZA 1MXWA 1P1WA 3LC8A 2ZNSA 4R6HA 2REJA 4M4GA 1A99A 3EHTA 3HHGA 3VVDA 1H44A 3B7DA 3TELA 4IY6A 3WAFA 4JXIA 3TFLA 1SW2A 1D9VA 1ZMGA 3OEMA 5AA4B 2W7YA 4OZ9A 2ONSA 4OVJA 5L9SA 5IAIA 2GFEA 2F97A 3H6TA 4OEUA 3BFUA 1JETA 4GXAA 3PPNA 3DP4A 3IO4A 5A5XB 3O9PA 3UN6A 2I6EA 4EXKA 4R74A 5L9OA 2QSXA 3KGCA 2PVUA 3JYRA 1FQBA 5I56A 4JDFA 2QS1A 3LBSA 2V3QA 1B46A 2YJPA 4YU0A 2VD3A 3CRBA 5CM6A 3UP9A 2F7CA 2O69A 2AYSA 2QJEA 1UTHB 2F34A 1O64A 1EU8A 2DWJA 2Z8DA 3MZ1A 2OWTA 1POTA 1NFTA 2DXYA 4OESA 1DSNA 1AIVA 5H8QA 5AA1A 3T66A 3O97A 3EPEA 1EZ9A 2F7AA 3C9HA 1Q1KA 3OO7A 1M5CA 2Y7RA 3CSBA 1USYH 3G3IA 3KJTA 4POXA 2IA4A 1H43A 4RY1A 4MFIA 1FTOA 1B0HA 5H8HB 3IJOB 3MVXA 3MPKA 2XXQA 1OMPA 1R6ZA 3MVYA 5TPAA 4HCWA 4RNSA 3RT8A 5AA2D 4DCXA 4DIGA 3W9VA 1GR2A 4KI0E 5CC2A 3IOVA 1BLFA 2V93A 2Z8EA 3K02A 5KDTB 4DXUA 4RXLA 1LAXA 4U23A 1Q35A 3GLBA 4XKRA 3VVEA 3VDFA 1MDQA 2UYEA 5I84A 4OXVA 5AA2A 3PUWE 3DP6A 3PMXA 3MPLA 2XXUA 1VE4A 4OFLA 1QUJA 2DVZA 2PYYA 2A5TA 1NNFA 2HQ0A 1LB9A 4AQ4A 4AB5A 4YKIA 1S7YA 3SDFA 1YCJA 3PMVA 4DDDA 1JEUA 4EQBA 4NMYA 3MBPA 2ZYKA 1UTBB 4ND9A 4MLVA 4X1BA 4QSDA 5I2NB 1Y9UA 3OO6A 2HZLA 2G93A 4F3BA 3OENA 4U1ZA 4QHQA 2XXIA 4FORA 2Y7WA 2DE2A 4ELOA 1BKAA 4DXCA 3RUMA 4L17A 4DLDA 1A7LA 4LZ5A 4P0IA 3RNNA 3AXFA 1IQ7A 1NKXA 1Y20A 2VGQA 4JSOA 2XXXA 3IB1A 4NF6A 5H8FA 2O7IA 1ATGA 3TCFA 4I9DA 3Q25A 1IXHA 3FV1A 5KZTA 1P99A 1B3FA 4C1TA 4F19A 1JEVA 3OOAA 1XHYA 3VLUA 1VFDA 4NF8A 4QSCA 4NF5A 1A55A 3PUYE 1T0KA 2ANJA 5I2KA 4PFTA 2NUVA 3K2DA 4GVOA 5CMMA 3FATA 1O63A 3S4UA 3G7WA 4NEDA 1JW4A 4YB5A 4YMAA 1OQGA 3HHFA 3L6GA 4F2OA 3BBRA 3I3VA 1LFGA 4LA9A 1QW0A 3EHSA 5AA3A 1NNKA 2GHAA 1VSOA 2RC9A 2UVJA 3M3FA 1PB9A 4U4SA 3DELB 5BUUA 2REGA 4KR5A 1B5HA 5EYFA 3V5AA 3K6WA 4HCYA 4ZZAA 1AH5A 1JNFA 4ISUA 1XT8A 2RCBA 3MP8A 3S9LC 3MWBA 2VHAA 3KN8A 5TPAB 3M3KA 1XC1A 1LBCA 3PPRA 4Q8RA 2R6GE 4IGTA 5CMKA 2XX7A 4LZ7A 4OERA 2XXPA 1JQFA 3IL1B 4WXJA 3I5OA 2I0BA 4R2FA 3PD9A 1MXUA 4ZZEA 3TAJA 5M2VA 4GOTA 2VD2A 2OK2A 3LSFB 3CI8A 3LUYA 4H8JA 2XXVA 2PMSA 2NXOA 1PDAA 2ZYMA 5FTHA 1FQEA 3KBRA 3RGYA 5AA2B 4E0WA 5DTBA 2B3BA 1B3LA 1N76A 4F31B 4JSDA 3O66A 1OVTA 3I6VA 1MQHA 4XKQA 1MY4A 2AL4A 2UYFA 4ZE8A 3H6WA 2XX8A 3KFMA 1Y3PA 4JBZA 4MH5A 3OSRA 1M5BA 1YAEA 1B58A 5JTYB 4G2ZA 3KSXA 3VV5A 1M5DA 4KYEA 5LOMA 3SERA 3VLWA 4LATA 4EF2A 3CR9A 3MUQA 3TQLA 1P1NA 3MQ9A 3V8XB 1FTJA 1VR5A 4ECFA 1DMBA 5HM4B 2AIXA 1HSEA 2RINA 3K6UA 1N84A 4GXSB 1XVYA 5J1DA 1QUKA 1NH7A 2ONRA 3K4UA 5TP9B 4IO6A 2ZYNA 1LCFA 4PETA 3KG2A 4JWOA 1EH3A 1SQYA 1II5A 4ZECA 2D5WA 3PPPA 2Q89A 5ITOA 4G68C 3MP1A 4EQ9A 1F9BA 2BJJX 4NF8B 4EXLA 2Q9TA 3UK4A 3EHUA 2ZMBA 2I4BA 4KQPA 3RN8A 4LONB 4NE4A 1SD3A 4U22A 1LB8A 3U8QA 4E0XA 1DOTA 3OSQA 3FXUA 4RJZA 1ELJA 1EZPA 4GFRA 3EN3A 3ZSFA 4IO5A 2O1LA 2RF1A 3O6HA 4FEBA 1XVXA 2HAUA 2P2AA 1BP5A 3K1NA 3JZJA 1J1NA 2NOOA 3ZKKA 3Q29A 4KPTA 1ZU0A 3IAZA 1NNTA 1D9YA 1NL5A 2FYIA 4Z0IA 4F39A 3KN7A 4XIGQ 1B52A 3H7MA 4JWYA 4M1VA 2AL5A 4LVQA 4YMBA 1LAHE 2ZNTA 1P1QA 1L5TA 4X1DA 5KCJB 2DXRA 1MY1A 1A8EA 2ZYOA 4H1XA 4ZE9A 1B05A 2X7PA 1IIWA 1FW0A 2V3UA 1MQIA 1MQGA 2D21A 3SKPA 3A3CA 3K00A 5I58B 3Q28A 1D4NA 3M3LA 1A8FA 2DWIA 2QPQA 3VFJA 5FHOA 3SEWA 3W15C 2QRYA 2I0CA 1OQHA 3G3FA 2Y7IA 2YPNA 2WKYA 4BDNA 1TXFA 3N6UA 4QFLA 4Z7EA 1LAGE 4KCDA 4DE8A 1PB7A 3OO8A 1MRPA 5B7DA 1LFIA 2DE3A 4DXBA 3TTMA 3O29A 1DTZA 4F22A 2Y7KA 1IXCA 5I57B 2RKMA 4MF3A 3T9VA 4H67A 5DEXA 5EHMA 1OLAA 4QFNA 3FASA 4X48A 4XKNA 2O1MA 1MM7A 3T93B 4IB2A 1N3XA 1SYHA 4R2BA 2DS9A 3TUSA 1ZKBA 4G68B 1XS5A 1OIBA 4PFWA 2DSFA 2XD3A 1SVXB 3MVZA 5DT6A 2F6GA 4RK9A 5HBCA 3K1PA 3QAXA 3ILUB 4ZEFA 3FGSA 3VLVA 2V3TA 3ZKLA 1Y3QA 1B5JA 3S9MC 1MY0A 4H6DA 5FHNA 1S50A 3ILTB 3N5LA 4FATA 1USYE 4GWOA 3SEXA 4DZ1A 1TWYA 2DVCA 3OMBA 2XXRA 3N6TA 4BDRA 1N7XA 2H99A 4NTLA 1MY2A 2R71A 3TDJA 1XOCA 1O7TA 5CRYA 2D3IA 2F6PA 1IXGA 3H03A 1RYXA 3C34A 3W9WA 2YLNA 3N26A 3MAMA 3FIRA 1D3KA 2ABHA 2H25A 1B40A 1FQCA 3CFLA 1SW5A 3PPQA 2OJTA 3KOTA 4XXUA 2PX1A 2VP1A 4ESWA 4NF4A 4N07A 3QIMA 2DYXA 3FVKA 3RTWB 4U2RA 3K6VA 5F1QA 3BFTA 2O6AA 3G3HA 2LAOA 3VE1B 1MS7A 5I59A 2Q88A 3QK6A 3DLNA 3R26A 2F5XA 3OXNA 4C1UA 4ZS9A 4X9TA 1BIYA 2DQVA 4R9FA 3HN0A 5I56B 1B7HA 3HV1A 1B2HA 1B3HA 3T9XB 1B1XA 4OMBA 3TQWA 3GZGA 2QS2A 4TQUQ 2I48A 5JEIA 3PUZE 1Z7NE 1PBQA 1FQFA 3H06B 4I1DA 4F3PA 5H8QB 2QMWA 4U4XA 4N13A 1WODA 1N7WA 4THIA 3IJXB 3FVNA 3FZVA 2KLFA 3U94A 3S2VA 4MBPA 2XD2A 4JWXA 4H65A 3R6UA 3U92A 5DEXB 1Y1ZA 4YZZA 3EQ1A 4BDQA 3C36A 3TCHA 2UVGA 1MH4A 3OELA 3PMWA 2I49A 4QRZA 2XXWA 4FEDA 1GV8A 1SBPA 1UQWA 5H8SA 3K1MA 3A3UA 2HCAA 4LZ8A 4OWDA 3PU5A 2O84X 2NVUB 4OYVA 1B7ZA 3D4CA 1MY3A 2F8DA 2DOJA 1Y4CA 3R7XA 1OLCA 2GH9A 2XXYA 1A54A 4H8IA 2E1SA 3TTLA 3KOSA 2CMOA 3TTNA 1US4A 1B4ZA 5ICQA 1MH3A 1B3GA 1UTHA 3MP6A 2OBGA 1QULA 5CI5A 2ALUA 2A5TB 1LGBC 3HSTA 5F7VA 2DP8A 4ZEBA 1CB6A 1POY1 2FA7A 4R72A 1KWHA 3K6XA 4BDOA 4QFPA 4GRKA 5H8HA 5DVJA 5B70A 3SETA 1A40A 2I3WA 2HXWA 1QUIA 1UIUA 3IORA 1NH8A 1TT1A 4EQ7A 3UIFA 2Z22A 5ELVA 3ONMA 2F78A 1JVXA 5CMCA 5KDTA 4NF6B 2O51A 5I59B 4H0WA 1QVSA 5H8FB 3E4RA 4GLIA 5AE4A 3FXQA 5K2YA 3B6TA 3QYTA 4G8NA 3CFXA 2XX9A 3EF7A 4NF5B 4MLQA 5I2KB 4K3FA 4O3BA 4YICA 1ZLQA 1H3DA 1IEJA 1B7UA 4PFUA 1H76A 3HPIA 3THIA 3M8UA 2X26A 4ONYA 1QKBA 1DPPA 1DTGA 3UORA 1I6QA
chains in the Genus database with same CATH superfamily
5ICTA 3TYHA 4YAHX 1P1OA 3QUJA 4RA1A 1MQDA 4ELRA 3FV2A 3PD8A 4BDLA 5BWJA 3FJMA 4FBPA 1UTBA 1SDXA 2ZXTA 5I2NA 3SEYA 1MPBA 3IB0A 1Y4TA 3CG1A 1EZOA 4P3LA 2Y7PA 1R1NA 4ZEDA 3UGWA 2CZLA 4GL0A 4XKPA 1MDP1 3DM0A 4OVRA 3ODBA 4OFJA 1HSLA 4I3EA 3B6WA 1SYIA 3FVGA 3SESA 2ZZVA 1NMUA 3O28A 4LQ2A 1FQDA 4DI4B 2I58A 3U72A 2P0SA 2PCRA 5FTIA 3OEKA 3CIJA 1OVBA 3C35A 1JVYA 4P56A 1LBWA 4OETA 1MQJA 3T96B 3PV0E 3N94A 4ZDMA 4IGRA 3KSJA 1MXZA 4NWDA 3O6GA 4GWZA 2P3VA 1BTJA 5TU0A 4G8MA 4MNCA 2GRVA 4PE5B 4LUBA 2O68A 4O94A 4I62A 4JVDA 4RYAA 1TFDA 4R6YA 1SW1A 4Q5TA 2VOZA 3IR1A 3G3JA 1B5IA 2ZNUA 4U21A 3G3GA 3TZAA 1RKMA 2GHBA 5T3JA 2H98A 1N0TA 5FHMA 3TKDA 2RCAA 1RDXA 2HAVA 2OWSA 4OEVA 3E78A 2FNCA 4NF0A 3O6IA 4IO4A 4GIZA 3KBZA 1I6BA 2HFBA 3UA8A 4KXPA 3ECRA 4N81A 4R6KA 2HZKA 4WKMA 4ELPA 3CVGA 3LSLA 4QFKA 1FTLA 3D4GA 4PFBA 3Q26A 2P3NA 2PT1A 3K01A 5ET7A 2I4CA 4PBHA 3RY3A 5ISUA 4RK2A 2Z8FA 1TFAA 5HPQA 2F3DA 3E9XA 4O8MA 4MNPA 4OENA 4IY5A 3GBBA 5EHSA 5J16A 4PP0A 4FE8A 2ESNA 3C32A 2WEFA 2B3FA 5H8NA 3ROJA 4EF1A 1FJ6A 4F29A 2XXHA 3GBAA 5IZZA 3H6UA 1JW1A 4IO7A 3BKIB 4HTGA 5L9MA 4IO2A 5IKBA 3E13X 4NHBA 3PUVE 1Z7ME 3P7IA 1YZ0A 4G8HA 2F7BA 4G77A 4AB6A 1D9QA 4XTCQ 1B51A 5CBRA 2UVIA 1FPKA 3KZGA 4KFQA 4FIMA 4GD5A 2XHDA 2CEYA 4GF8A 1FPJA 2B4MA 1RDZA 4DCYA 1LBXA 3CG3A 3DP8A 4H5FA 5F24A 3C4MA 1BK4A 4P0GA 3K0VA 3E3KA 4PGPA 4PBQA 3TTKA 1B6HA 1WDNA 1IUDA 3IOUA 3VXCA 2NWJA 2Q8JA 4P8BA 3G3KA 3Q27A 4G4PA 1AWBA 3MZ9A 2QS3A 4GQOA 5JTYA 3FD3A 2PT2A 4KCCA 5DVFA 5JK4A 4PDDA 1JW5A 4YKKA 1ANFA 2E0SA 4FAJA 4TOZA 4YB7A 4GWWA 3RTFB 3JV9A 1FBDA 3TCGA 1GVCA 1WVJA 1B0LA 2XXTA 3OO9A 1VFEA 4NWCA 3U93A 3A09A 2ONKE 1IZ1A 4WEPA 4F1VA 4F3GA 4H5GA 1MXYA 1MM6A 2B65A 2I3VA 1B9JA 1S9TA 5TP9A 4F18A 1FCKA 2X7QA 5CMBA 4JVIA 2QVVA 1LSTA 2H9BA 4RPOA 1LCTA 4IR8A 4UABA 2F36A 4YKJA 2PFYA 1UIVA 2DWAA 2FIEA 4WEDA 1IITA 5ITPA 1R9QA 1MPCA 4IO3A 2QVUA 4OFOA 3LR1A 1IXIA 4UACA 4NGUA 1N04A 2QL3A 3TODA 1URGA 1FTKA 3USDA 3MJNA 4RPNA 3WAEA 3IOWA 3QUFA 1Y1MA 3C33A 4EDPA 3IK6B 4HS7A 2VPNA 4FJPA 1EYKA 4P47A 1SI1A 1YXIA 1LFHA 4KD5A 3MZBA 3QSLA 4N6PA 4OHNA 2RC7A 1QJMA 4QSEA 1PC3A 3CSGA 1PB8A 2A5SA 1ZJLA 3CFZA 5EQAA 3IB2A 5LTCA 1MG1A 3V83A 5AA4A 3ZS6A 3OD7A 4TLLB 2XWKA 3RPLA 1LLSA 5L8DA 1AOVA 4OTEA 4PFYA 3PPOA 1B32A 1RYOA 1MXVA 2QS4A 3U1OA 4OQOA 3H6VA 4PE3A 4R75A 4Q30B 1CNQA 2QMXA 4LP2B 4BLAA 1NNPA 1ZTYA 5KCJA 3F11A 2OZZA 3MW0A 5A5XA 1MPDA 5H8NB 3S9NC 1I6AA 3D1RA 4OVTA 3FUZA 3IOTA 2FVZA 3SZPA 2Y84A 4NN3A 4GBVA 4EUOA 4QF9A 4HW8A 5I58A 2OCUA 2G29A 1SW4A 4PDHA 3FVOA 4AS5A 1M5EA 1ZIUA 4O3AA 5LDZA 3MC2A 4QBAA 2CZHA 1CE2A 2UVHA 1PBPA 3QXMA 3FJGA 1SI0A 4PAFA 1YTVA 3SEVA 5CBSA 4F1YA 1B4HA 2JJKA 4KHZE 4R73A 5ET6A 3KEIA 2P1SA 1HSJA 1H45A 4P11A 2WYKA 4TLMB 1M5FA 1LBBA 3C31A 3MSTA 3TMGA 2DWHA 2V25A 3FXRA 4F1UA 1URSA 4U1OA 1GGGA 3S9EA 2WBDA 2WX9A 5I57A 2Z23A 3FJ7A 4ESXA 2KQZA 1B3EA 4YKPA 5K2XA 4GL8A 3B6QA 1DPEA 1GTKA 1Y3NA 4ZEIA 3LSWA 3RQTA 3GXAA 4O3CA 2V4CA 3T9UA 4NF4B 3PGFA 5DYHA 4G68A 3HO7A 2UXAA 4X8RA 4ZEKA 1AMFA 3MVWA 3TEPA 2IEEA 4LQ5A 2O7UA 2DE4A 4POWA 5DVIA 3IX1A 4KYDA 3VVFA 4F3SA 2H4IA 1LAFE 3SEUA 2OLBA 1US5A 1N3WA 3PUXE 3TPAA 3VXBA 4ELQA 2Q2CA 1KA0A 3HCQA 4FECA 4BDMA 4QFOA 3LSXA 4I8CA 4NG7A 2PBWA 1FTMA 1QKAA 2V84A 1PEBA 3RPWA 2R9JA 2THIA 2F35A 4F2QA 4MCOA 3KJ7A 1URDA 3RT6B 1NV4A 4MAGA 2HEUA 2M8CA 3TTRA 1AL3A 1FQAA 3LUZA 3H3GA 2Q2AA 4OANA 3O2AA 1MXXA 4KYSA 3T9HB 4UA8A 3KN3A 3T22A 2RC8A 4YB6A 3RLFE 4XF5A 1B1HA 1I69A 4PQJA 1P1UA 1YPNA 4Q0CA 4R9GA 4C0RA 2H5YA 4NX1A 4JB7A 1ZBMA 1DBZA 3IO6A 1R9LA 3L6HA 3V89B 3H4ZA 1MXWA 1P1WA 3LC8A 2ZNSA 4R6HA 2REJA 4M4GA 5IGAA 1A99A 3QMFA 2CZIA 3EHTA 3HHGA 3VVDA 1H44A 3B7DA 3TELA 3NOHA 4IY6A 4GX3A 3WAFA 4JXIA 3TFLA 1SW2A 1D9VA 1ZMGA 3OEMA 5AA4B 3RPLB 2W7YA 4OZ9A 2ONSA 3E79A 4OVJA 5L9SA 5IAIA 2GFEA 1FBFA 2F97A 3H6TA 4OEUA 4MNIA 3BFUA 1JETA 4GXAA 3PPNA 3DP4A 3IO4A 5A5XB 3O9PA 3UN6A 4P1LA 2I6EA 4EXKA 1K9ZA 1KZ8A 4R74A 5L9OA 2QSXA 3KGCA 1NI9A 2PVUA 4LN5A 3JYRA 1FQBA 5I56A 1FTAA 4JDFA 2QS1A 3LBSA 2V3QA 1B46A 2YJPA 4YU0A 2VD3A 1NUZA 3CRBA 5CM6A 3UP9A 2F7CA 3CHGA 2O69A 2AYSA 4N4UA 2QJEA 1UTHB 4OVQA 2F34A 1O64A 1EU8A 2DWJA 2Z8DA 3MZ1A 2OWTA 1POTA 1NFTA 4PF8A 1FBPA 2DXYA 4OESA 1DSNA 1AIVA 1LBZA 5H8QA 1FPGA 4I40A 5AA1A 3T66A 3O97A 3EPEA 1EZ9A 2F7AA 3C9HA 1Q1KA 1JP4A 1M5CA 3OO7A 2Y7RA 3CSBA 4N17A 1USYH 3G3IA 3KJTA 4POXA 2IA4A 1H43A 4RY1A 4MFIA 1FTOA 1B0HA 5H8HB 3IJOB 3MVXA 3MPKA 2XXQA 1OMPA 1R6ZA 3MVYA 5TPAA 4HCWA 4RNSA 3RT8A 5AA2D 4N8YA 4DCXA 4DIGA 3W9VA 1GR2A 4KI0E 5CC2A 3IOVA 1XI6A 1BLFA 1FPDA 2V93A 2Z8EA 3K02A 5KDTB 4DXUA 4RXLA 1LAXA 4U23A 1Q35A 1NV2A 3GLBA 4XKRA 2VPOA 3VVEA 3VDFA 1MDQA 1NV5A 2R8TA 5EQ8A 2UYEA 5I84A 4OXVA 3PTYA 4GWYA 2XA5A 5AA2A 3PUWE 1DCUA 3DP6A 3PMXA 3MPLA 2XXUA 1VE4A 4OFLA 1QUJA 2DVZA 2PYYA 3B8BA 2A5TA 1NNFA 2HQ0A 1LB9A 4AQ4A 4AB5A 4YKIA 2XWOA 1S7YA 3SDFA 1YCJA 3PMVA 2KR0A 4DDDA 2HPGA 1JEUA 4EQBA 4NMYA 3MBPA 2ZYKA 1UTBB 1FPFA 4ND9A 4MLVA 4X1BA 4QSDA 5I2NB 1Y9UA 3OO6A 2HZLA 2G93A 4F3BA 3OENA 4GX4A 4U1ZA 4QHQA 2XXIA 2CEXA 4FORA 2HXRA 2Y7WA 2DE2A 5FBPA 4ELOA 1BKAA 1G0IA 4DXCA 3RUMA 4L17A 4DLDA 1A7LA 4LZ5A 4P0IA 1IQ7A 3AXFA 1NKXA 3RNNA 1Y20A 2VGQA 4JSOA 2XXXA 3IB1A 4NF6A 2BJIA 5H8FA 1INPA 2O7IA 1ATGA 1LEVA 5ET5A 3TCFA 4I9DA 3Q25A 1IXHA 3FV1A 5KZTA 2FIXA 1P99A 1B3FA 4C1TA 4F19A 1JEVA 3OOAA 1XHYA 3VLUA 1VFDA 4NF8A 4QSCA 4NF5A 1A55A 2XWIA 3PUYE 1T0KA 5IZ3A 2ANJA 5I2KA 4PFTA 2NUVA 3K2DA 4GVOA 5CMMA 3FATA 2WYPA 1O63A 3S4UA 3G7WA 4NEDA 2MKZA 1JW4A 4YB5A 4YMAA 1OQGA 3HHFA 3L6GA 4F2OA 3BBRA 3I3VA 1LFGA 4LA9A 1QW0A 3EHSA 5AA3A 1NNKA 2GHAA 1VSOA 2RC9A 2UVJA 3M3FA 2GQ1A 1PB9A 4U4SA 3DELB 4KR5A 2REGA 5BUUA 1B5HA 1EYIA 5IM2A 4PAKA 5EYFA 3V5AA 4DI3D 1FBHA 3K6WA 1NV6A 4HCYA 4ZZAA 1AH5A 1JNFA 1FPEA 4ISUA 1XT8A 2RCBA 3MP8A 3S9LC 3MWBA 2VHAA 3KN8A 5TPAB 3M3KA 1XC1A 1LBCA 3PPRA 4Q8RA 1G0HA 2R6GE 4IGTA 5CMKA 2XX7A 4LZ7A 1FSAA 4OERA 2XXPA 1JQFA 3IL1B 4WXJA 5IZ1A 3I5OA 2I0BA 4MEVA 4R2FA 3PD9A 1MXUA 4ZZEA 3TAJA 5M2VA 4GOTA 2VD2A 2OK2A 3LSFB 2QVRA 3CI8A 4X04A 3LUYA 4H8JA 2XXVA 2PMSA 4PFIA 2NXOA 1PDAA 2ZYMA 5FTHA 1FQEA 3KBRA 3RGYA 5AA2B 4E0WA 5DTBA 2B3BA 1B3LA 1N76A 4F31B 4JSDA 4PCDA 4N6DA 3O66A 1OVTA 3I6VA 1MQHA 4XKQA 1MY4A 2AL4A 2UYFA 2Q8MA 4MIJA 4ZE8A 3H6WA 2XX8A 3KFMA 1Y3PA 4JBZA 4MH5A 3OSRA 1M5BA 1YAEA 1B58A 3FBPA 4G2ZA 1NUWA 5JTYB 3KSXA 3VV5A 1M5DA 4P1EA 4KYEA 5LOMA 3SERA 3VLWA 3HFUA 4LATA 4EF2A 3CR9A 3MUQA 3TQLA 2CZKA 3T0JA 1IMCA 1P1NA 3MQ9A 3V8XB 1FTJA 1VR5A 4ECFA 4PTKA 1DMBA 5HM4B 2AIXA 4P9KA 1HSEA 4GWUA 3U65A 2RINA 3K6UA 1N84A 4GXSB 1XVYA 5J1DA 1QUKA 1NH7A 2ONRA 3K4UA 5TP9B 4IO6A 2ZYNA 1LCFA 4PETA 2Q74A 3KG2A 4JWOA 1YYZA 1FBEA 1EH3A 1SQYA 1II5A 4ZECA 2D5WA 2VT5A 3PPPA 2Q89A 5ITOA 4G68C 3MP1A 4EQ9A 1F9BA 2BJJX 4NF8B 4EXLA 2Q9TA 3UK4A 3EHUA 2ZMBA 5IZ3B 4HXVA 2I4BA 4KQPA 1QGXA 3RN8A 4LONB 4NE4A 1SD3A 4U22A 1LB8A 3U8QA 4E0XA 1DOTA 3OSQA 3FXUA 4RJZA 1ELJA 1EZPA 4GFRA 1LBYA 3EN3A 3ZSFA 4GWSA 4IO5A 2O1LA 2RF1A 3O6HA 4FEBA 1XVXA 2HAUA 2P2AA 4OVPA 1BP5A 3K1NA 3JZJA 1VDWA 1J1NA 2XXKA 2Y5KA 2NOOA 3ZKKA 3Q29A 4KPTA 1ZU0A 1IMDA 4PAIA 3IAZA 1NNTA 1FPLA 1D9YA 1LBVA 1NL5A 2FYIA 4Z0IA 4F39A 3KN7A 4XIGQ 1B52A 3H7MA 4JWYA 4M1VA 4NAPA 2AL5A 1Q9DA 4LVQA 4YMBA 1LAHE 2ZNTA 1P1QA 4N91A 1L5TA 4X1DA 5KCJB 2DXRA 1MY1A 1A8EA 1IMBA 2ZYOA 4H1XA 4ZE9A 1B05A 1IMAA 2X7PA 1IIWA 5EYHA 1FW0A 2V3UA 1MQIA 1MQGA 2D21A 3SKPA 3A3CA 3K00A 5I58B 3Q28A 1D4NA 3M3LA 1A8FA 2Y5LA 2DWIA 4N8GA 2QPQA 3VFJA 4O7MA 5FHOA 3SEWA 3W15C 2QRYA 5ESYA 2I0CA 1OQHA 3G3FA 2B4LA 2Y7IA 2HHMA 2YPNA 2WKYA 1TXFA 4BDNA 3KC1A 3N6UA 4QFLA 4Z7EA 1LAGE 4KCDA 4DE8A 1PB7A 3OO8A 1MRPA 5B7DA 1LFIA 2DE3A 4DXBA 3EKIA 3TTMA 3O29A 1DTZA 4F22A 2Y7KA 1IXCA 1FRPA 5I57B 5I7IA 2RKMA 4MF3A 4H45A 3T9VA 4H67A 5DEXA 5EHMA 1OLAA 4QFNA 3FASA 4X48A 4XKNA 2O1MA 1MM7A 3T93B 4IB2A 1N3XA 1SYHA 4R2BA 2DS9A 3TUSA 1ZKBA 4G68B 1XS5A 1OIBA 4PFWA 2DSFA 4PGNA 2XD3A 1SVXB 3MVZA 5DT6A 2F6GA 4RK9A 1NV0A 3ISPA 5HBCA 4OVSA 3K1PA 3QAXA 4XFEA 3ILUB 4ZEFA 3FGSA 3VLVA 2V3TA 3ZKLA 1Y3QA 2ZZXA 1B5JA 3T1BA 3S9MC 1MY0A 4H6DA 3GYYA 3BIGA 5FHNA 1S50A 3ILTB 3N5LA 4FATA 1USYE 4GWXA 4GWOA 3SEXA 4DZ1A 1TWYA 1NUXA 2DVCA 3OMBA 2XXRA 3BIHA 3N6TA 4BDRA 1N7XA 3MYUA 4PF6A 2H99A 1IMEA 4NTLA 1MY2A 2R71A 1FPIA 3TDJA 1XOCA 1O7TA 5CRYA 3LV0A 2D3IA 2F6PA 1IXGA 3H03A 1RYXA 3C34A 3W9WA 2YLNA 4MMPA 3N26A 3MAMA 3FIRA 1D3KA 4MX6A 2ABHA 2H25A 1B40A 1FQCA 3CFLA 1SW5A 4HE0A 4QXDA 3PPQA 2F3BA 4MHFA 2OJTA 3KOTA 1EYJA 5DW8A 4XXUA 2PX1A 2VP1A 4ESWA 4NF4A 4OA4A 4N07A 3QIMA 2DYXA 3KC0A 3FVKA 3RTWB 4U2RA 3K6VA 5F1QA 3BFTA 5I5PA 2O6AA 3G3HA 2LAOA 3VE1B 1MS7A 5I59A 2Q88A 3QK6A 3DLNA 3R26A 1NUYA 2F5XA 3OXNA 4C1UA 4H46A 4ZS9A 4O7IA 4X9TA 1BIYA 1K9YA 4NQ8A 5EYGA 2DQVA 4R9FA 3HN0A 3IFAA 5I56B 1B7HA 4HE2A 3HV1A 1B2HA 1B3HA 4XEQA 5EQ9A 3T9XB 1RDYA 1B1XA 4OMBA 2OWZA 3TQWA 3GZGA 2QS2A 1NV1A 4TQUQ 3A29A 1FJ9A 2I48A 2QFLA 5JEIA 3PUZE 4MJOA 1Z7NE 2FBPA 1PBQA 1FQFA 4N6KA 3H06B 4I1DA 4F3PA 5H8QB 2QMWA 4U4XA 4N13A 1WODA 4JVCA 1N7WA 4THIA 3IJXB 3B50A 3FVNA 3FZVA 2KLFA 3U94A 4HE1A 3S2VA 4MBPA 2XD2A 4JWXA 4H65A 5EQ7A 3R6UA 5DEXB 3U92A 1Y1ZA 4YZZA 3EQ1A 4BDQA 3C36A 3TCHA 1SPIA 2UVGA 1MH4A 3OELA 3PMWA 2I49A 4QRZA 2XXWA 4FEDA 1GV8A 1SBPA 2L5VA 1UQWA 5H8SA 3K1MA 3A3UA 2HCAA 4LZ8A 4OWDA 1IMFA 3PU5A 2O84X 2NVUB 4OYVA 1B7ZA 5I3SA 4I3YA 3D4CA 1MY3A 2F8DA 2DOJA 1Y4CA 3R7XA 3RYDA 1OLCA 2GH9A 2XXYA 1A54A 4H8IA 2E1SA 3TTLA 3KOSA 2CMOA 3TTNA 1US4A 1B4ZA 5ICQA 1MH3A 1B3GA 2ZZWA 1UTHA 3MP6A 2OBGA 1QULA 5CI5A 2FHYA 2ALUA 2A5TB 1LGBC 2PFZA 3FXBA 3HSTA 1FBGA 5F7VA 2DP8A 4ZEBA 1CB6A 2WBBA 1POY1 2FA7A 4R72A 1KWHA 3K6XA 5A5LA 4BDOA 1DK4A 1NV3A 1FPBA 4QFPA 4GRKA 5H8HA 5DVJA 4GX6A 5B70A 5ET8A 3SETA 1A40A 1NV7A 2I3WA 2HXWA 1QUIA 1UIUA 3IORA 1NH8A 1TT1A 4EQ7A 3UIFA 2Z22A 5ELVA 3ONMA 2F78A 1JVXA 5CMCA 5KDTA 4NF6B 2O51A 5I59B 4H0WA 1QVSA 5H8FB 3E4RA 1KA1A 2XWVA 2DDKA 4GLIA 5AE4A 4AS4A 3FXQA 5K2YA 3B6TA 3IFCA 3QYTA 4G8NA 4G61A 3CFXA 2XX9A 3EF7A 4NF5B 4MLQA 5I2KB 4K3FA 4O3BA 4YICA 1ZLQA 1H3DA 1IEJA 1B7UA 4N15A 4PFUA 4GBWA 1H76A 3HPIA 3THIA 3M8UA 2X26A 4ONYA 1QKBA 1DPPA 4PC9A 1DTGA 1FBCA 3UORA 2OX3A 4PFRA 1I6QA
chains in the Genus database with same CATH topology
5ICTA 3TYHA 4YAHX 1P1OA 3QUJA 4RA1A 1MQDA 4ELRA 3FV2A 3PD8A 4BDLA 5BWJA 3FJMA 1UTBA 1SDXA 2ZXTA 5I2NA 3SEYA 1MPBA 3IB0A 1Y4TA 3CG1A 1EZOA 2Y7PA 1R1NA 4ZEDA 3UGWA 2CZLA 4GL0A 4XKPA 1MDP1 3DM0A 3ODBA 4OFJA 1HSLA 3B6WA 1SYIA 3FVGA 3SESA 1NMUA 3O28A 4LQ2A 1FQDA 2I58A 3U72A 2P0SA 5FTIA 3OEKA 3CIJA 1OVBA 3C35A 1JVYA 4OETA 1MQJA 3T96B 3PV0E 3N94A 4ZDMA 4IGRA 3KSJA 1MXZA 4NWDA 3O6GA 5TU0A 1BTJA 4G8MA 2GRVA 4PE5B 4LUBA 2O68A 4I62A 4RYAA 1TFDA 4R6YA 1SW1A 4Q5TA 2VOZA 3IR1A 3G3JA 1B5IA 2ZNUA 4U21A 3G3GA 3TZAA 1RKMA 2GHBA 2H98A 1N0TA 5FHMA 3TKDA 2RCAA 2HAVA 2OWSA 4OEVA 2FNCA 3O6IA 4IO4A 4GIZA 1I6BA 2HFBA 3UA8A 3ECRA 4R6KA 2HZKA 4WKMA 4ELPA 3CVGA 3LSLA 4QFKA 1FTLA 3D4GA 3Q26A 2PT1A 3K01A 2I4CA 3RY3A 5ISUA 4RK2A 2Z8FA 1TFAA 5HPQA 3E9XA 4OENA 4IY5A 3GBBA 5EHSA 4PP0A 4FE8A 2ESNA 3C32A 2B3FA 5H8NA 4EF1A 4F29A 2XXHA 3GBAA 3H6UA 1JW1A 4IO7A 3BKIB 4HTGA 5L9MA 4IO2A 5IKBA 3E13X 3PUVE 1Z7ME 3P7IA 4G8HA 2F7BA 4G77A 4AB6A 4XTCQ 1B51A 5CBRA 2UVIA 3KZGA 4KFQA 4FIMA 4GD5A 2XHDA 4GF8A 4DCYA 3DP8A 3CG3A 4H5FA 3C4MA 4P0GA 3K0VA 3E3KA 3TTKA 1B6HA 1WDNA 1IUDA 3IOUA 3VXCA 2NWJA 2Q8JA 3G3KA 3Q27A 4G4PA 3MZ9A 2QS3A 4GQOA 5JTYA 3FD3A 2PT2A 4KCCA 5DVFA 5JK4A 1JW5A 4YKKA 1ANFA 2E0SA 4FAJA 4TOZA 4YB7A 3RTFB 3JV9A 3TCGA 1GVCA 1WVJA 1B0LA 2XXTA 3OO9A 1VFEA 4NWCA 3U93A 3A09A 2ONKE 1IZ1A 4WEPA 4F1VA 4F3GA 4H5GA 1MXYA 1MM6A 2B65A 2I3VA 1B9JA 1S9TA 5TP9A 4F18A 1FCKA 2X7QA 5CMBA 1LSTA 2H9BA 4RPOA 1LCTA 2F36A 4YKJA 1UIVA 2DWAA 5ITPA 4WEDA 1IITA 1R9QA 1MPCA 4IO3A 4OFOA 3LR1A 1IXIA 4UACA 1N04A 2QL3A 3TODA 1URGA 1FTKA 3USDA 3MJNA 4RPNA 3WAEA 3IOWA 3QUFA 1Y1MA 3C33A 4EDPA 3IK6B 4HS7A 4FJPA 1SI1A 1LFHA 4KD5A 3MZBA 3QSLA 4N6PA 4OHNA 2RC7A 1QJMA 4QSEA 1PC3A 3CSGA 1PB8A 2A5SA 1ZJLA 3CFZA 3IB2A 1MG1A 3V83A 5AA4A 3ZS6A 3OD7A 4TLLB 1LLSA 5L8DA 1AOVA 4OTEA 4PFYA 3PPOA 1B32A 1RYOA 1MXVA 2QS4A 3U1OA 4OQOA 3H6VA 4R75A 4Q30B 2QMXA 4LP2B 4BLAA 1NNPA 1ZTYA 5KCJA 3F11A 2OZZA 3MW0A 5A5XA 1MPDA 5H8NB 3S9NC 1I6AA 3FUZA 3IOTA 2Y84A 4EUOA 4QF9A 4HW8A 5I58A 2OCUA 2G29A 1SW4A 3FVOA 1M5EA 1ZIUA 4O3AA 3MC2A 1CE2A 2UVHA 1PBPA 3QXMA 3FJGA 1SI0A 1YTVA 3SEVA 5CBSA 4F1YA 1B4HA 4KHZE 4R73A 3KEIA 2P1SA 1HSJA 1H45A 4P11A 4TLMB 1M5FA 1LBBA 3C31A 3TMGA 2DWHA 2V25A 3FXRA 4F1UA 1URSA 4U1OA 1GGGA 3S9EA 5I57A 2Z23A 3FJ7A 4ESXA 1B3EA 4YKPA 5K2XA 4GL8A 3B6QA 1DPEA 1GTKA 1Y3NA 4ZEIA 3LSWA 3RQTA 3GXAA 4O3CA 3T9UA 4NF4B 3PGFA 5DYHA 4G68A 3HO7A 2UXAA 4ZEKA 1AMFA 3MVWA 3TEPA 2IEEA 4LQ5A 2O7UA 2DE4A 4POWA 5DVIA 3IX1A 4KYDA 3VVFA 4F3SA 2H4IA 1LAFE 3SEUA 2OLBA 1US5A 1N3WA 3PUXE 3TPAA 3VXBA 4ELQA 2Q2CA 3HCQA 4FECA 4BDMA 4QFOA 3LSXA 4I8CA 2PBWA 1FTMA 1QKAA 2V84A 1PEBA 3RPWA 2R9JA 2THIA 2F35A 4F2QA 3KJ7A 1URDA 3RT6B 2HEUA 2M8CA 3TTRA 1AL3A 1FQAA 3H3GA 2Q2AA 3O2AA 1MXXA 4KYSA 3T9HB 4UA8A 3KN3A 3T22A 2RC8A 4YB6A 3RLFE 1B1HA 1I69A 4PQJA 1P1UA 1YPNA 4Q0CA 4R9GA 4C0RA 2H5YA 4JB7A 1ZBMA 3IO6A 1R9LA 3L6HA 3V89B 3H4ZA 1MXWA 1P1WA 3LC8A 2ZNSA 4R6HA 2REJA 4M4GA 1A99A 3EHTA 3HHGA 3VVDA 1H44A 3B7DA 3TELA 4IY6A 3WAFA 4JXIA 3TFLA 1SW2A 1D9VA 1ZMGA 3OEMA 5AA4B 2W7YA 4OZ9A 2ONSA 4OVJA 5L9SA 5IAIA 2GFEA 2F97A 3H6TA 4OEUA 3BFUA 1JETA 4GXAA 3PPNA 3DP4A 3IO4A 5A5XB 3O9PA 3UN6A 2I6EA 4EXKA 4R74A 5L9OA 2QSXA 3KGCA 2PVUA 3JYRA 1FQBA 5I56A 4JDFA 2QS1A 3LBSA 2V3QA 1B46A 2YJPA 4YU0A 2VD3A 3CRBA 5CM6A 3UP9A 2F7CA 2O69A 2AYSA 2QJEA 1UTHB 2F34A 1O64A 1EU8A 2DWJA 2Z8DA 3MZ1A 2OWTA 1POTA 1NFTA 2DXYA 4OESA 1DSNA 1AIVA 5H8QA 5AA1A 3T66A 3O97A 3EPEA 1EZ9A 2F7AA 3C9HA 1Q1KA 3OO7A 1M5CA 2Y7RA 3CSBA 1USYH 3G3IA 3KJTA 4POXA 2IA4A 1H43A 4RY1A 4MFIA 1FTOA 1B0HA 5H8HB 3IJOB 3MVXA 3MPKA 2XXQA 1OMPA 1R6ZA 3MVYA 5TPAA 4HCWA 4RNSA 3RT8A 5AA2D 4DCXA 4DIGA 3W9VA 1GR2A 4KI0E 5CC2A 3IOVA 1BLFA 2V93A 2Z8EA 3K02A 5KDTB 4DXUA 4RXLA 1LAXA 4U23A 1Q35A 3GLBA 4XKRA 3VVEA 3VDFA 1MDQA 2UYEA 5I84A 4OXVA 5AA2A 3PUWE 3DP6A 3PMXA 3MPLA 2XXUA 1VE4A 4OFLA 1QUJA 2DVZA 2PYYA 2A5TA 1NNFA 2HQ0A 1LB9A 4AQ4A 4AB5A 4YKIA 1S7YA 3SDFA 1YCJA 3PMVA 4DDDA 1JEUA 4EQBA 4NMYA 3MBPA 2ZYKA 1UTBB 4ND9A 4MLVA 4X1BA 4QSDA 5I2NB 1Y9UA 3OO6A 2HZLA 2G93A 4F3BA 3OENA 4U1ZA 4QHQA 2XXIA 4FORA 2Y7WA 2DE2A 4ELOA 1BKAA 4DXCA 3RUMA 4L17A 4DLDA 1A7LA 4LZ5A 4P0IA 3RNNA 3AXFA 1IQ7A 1NKXA 1Y20A 2VGQA 4JSOA 2XXXA 3IB1A 4NF6A 5H8FA 2O7IA 1ATGA 3TCFA 4I9DA 3Q25A 1IXHA 3FV1A 5KZTA 1P99A 1B3FA 4C1TA 4F19A 1JEVA 3OOAA 1XHYA 3VLUA 1VFDA 4NF8A 4QSCA 4NF5A 1A55A 3PUYE 1T0KA 2ANJA 5I2KA 4PFTA 2NUVA 3K2DA 4GVOA 5CMMA 3FATA 1O63A 3S4UA 3G7WA 4NEDA 1JW4A 4YB5A 4YMAA 1OQGA 3HHFA 3L6GA 4F2OA 3BBRA 3I3VA 1LFGA 4LA9A 1QW0A 3EHSA 5AA3A 1NNKA 2GHAA 1VSOA 2RC9A 2UVJA 3M3FA 1PB9A 4U4SA 3DELB 5BUUA 2REGA 4KR5A 1B5HA 5EYFA 3V5AA 3K6WA 4HCYA 4ZZAA 1AH5A 1JNFA 4ISUA 1XT8A 2RCBA 3MP8A 3S9LC 3MWBA 2VHAA 3KN8A 5TPAB 3M3KA 1XC1A 1LBCA 3PPRA 4Q8RA 2R6GE 4IGTA 5CMKA 2XX7A 4LZ7A 4OERA 2XXPA 1JQFA 3IL1B 4WXJA 3I5OA 2I0BA 4R2FA 3PD9A 1MXUA 4ZZEA 3TAJA 5M2VA 4GOTA 2VD2A 2OK2A 3LSFB 3CI8A 3LUYA 4H8JA 2XXVA 2PMSA 2NXOA 1PDAA 2ZYMA 5FTHA 1FQEA 3KBRA 3RGYA 5AA2B 4E0WA 5DTBA 2B3BA 1B3LA 1N76A 4F31B 4JSDA 3O66A 1OVTA 3I6VA 1MQHA 4XKQA 1MY4A 2AL4A 2UYFA 4ZE8A 3H6WA 2XX8A 3KFMA 1Y3PA 4JBZA 4MH5A 3OSRA 1M5BA 1YAEA 1B58A 5JTYB 4G2ZA 3KSXA 3VV5A 1M5DA 4KYEA 5LOMA 3SERA 3VLWA 4LATA 4EF2A 3CR9A 3MUQA 3TQLA 1P1NA 3MQ9A 3V8XB 1FTJA 1VR5A 4ECFA 1DMBA 5HM4B 2AIXA 1HSEA 2RINA 3K6UA 1N84A 4GXSB 1XVYA 5J1DA 1QUKA 1NH7A 2ONRA 3K4UA 5TP9B 4IO6A 2ZYNA 1LCFA 4PETA 3KG2A 4JWOA 1EH3A 1SQYA 1II5A 4ZECA 2D5WA 3PPPA 2Q89A 5ITOA 4G68C 3MP1A 4EQ9A 1F9BA 2BJJX 4NF8B 4EXLA 2Q9TA 3UK4A 3EHUA 2ZMBA 2I4BA 4KQPA 3RN8A 4LONB 4NE4A 1SD3A 4U22A 1LB8A 3U8QA 4E0XA 1DOTA 3OSQA 3FXUA 4RJZA 1ELJA 1EZPA 4GFRA 3EN3A 3ZSFA 4IO5A 2O1LA 2RF1A 3O6HA 4FEBA 1XVXA 2HAUA 2P2AA 1BP5A 3K1NA 3JZJA 1J1NA 2NOOA 3ZKKA 3Q29A 4KPTA 1ZU0A 3IAZA 1NNTA 1D9YA 1NL5A 2FYIA 4Z0IA 4F39A 3KN7A 4XIGQ 1B52A 3H7MA 4JWYA 4M1VA 2AL5A 4LVQA 4YMBA 1LAHE 2ZNTA 1P1QA 1L5TA 4X1DA 5KCJB 2DXRA 1MY1A 1A8EA 2ZYOA 4H1XA 4ZE9A 1B05A 2X7PA 1IIWA 1FW0A 2V3UA 1MQIA 1MQGA 2D21A 3SKPA 3A3CA 3K00A 5I58B 3Q28A 1D4NA 3M3LA 1A8FA 2DWIA 2QPQA 3VFJA 5FHOA 3SEWA 3W15C 2QRYA 2I0CA 1OQHA 3G3FA 2Y7IA 2YPNA 2WKYA 4BDNA 1TXFA 3N6UA 4QFLA 4Z7EA 1LAGE 4KCDA 4DE8A 1PB7A 3OO8A 1MRPA 5B7DA 1LFIA 2DE3A 4DXBA 3TTMA 3O29A 1DTZA 4F22A 2Y7KA 1IXCA 5I57B 2RKMA 4MF3A 3T9VA 4H67A 5DEXA 5EHMA 1OLAA 4QFNA 3FASA 4X48A 4XKNA 2O1MA 1MM7A 3T93B 4IB2A 1N3XA 1SYHA 4R2BA 2DS9A 3TUSA 1ZKBA 4G68B 1XS5A 1OIBA 4PFWA 2DSFA 2XD3A 1SVXB 3MVZA 5DT6A 2F6GA 4RK9A 5HBCA 3K1PA 3QAXA 3ILUB 4ZEFA 3FGSA 3VLVA 2V3TA 3ZKLA 1Y3QA 1B5JA 3S9MC 1MY0A 4H6DA 5FHNA 1S50A 3ILTB 3N5LA 4FATA 1USYE 4GWOA 3SEXA 4DZ1A 1TWYA 2DVCA 3OMBA 2XXRA 3N6TA 4BDRA 1N7XA 2H99A 4NTLA 1MY2A 2R71A 3TDJA 1XOCA 1O7TA 5CRYA 2D3IA 2F6PA 1IXGA 3H03A 1RYXA 3C34A 3W9WA 2YLNA 3N26A 3MAMA 3FIRA 1D3KA 2ABHA 2H25A 1B40A 1FQCA 3CFLA 1SW5A 3PPQA 2OJTA 3KOTA 4XXUA 2PX1A 2VP1A 4ESWA 4NF4A 4N07A 3QIMA 2DYXA 3FVKA 3RTWB 4U2RA 3K6VA 5F1QA 3BFTA 2O6AA 3G3HA 2LAOA 3VE1B 1MS7A 5I59A 2Q88A 3QK6A 3DLNA 3R26A 2F5XA 3OXNA 4C1UA 4ZS9A 4X9TA 1BIYA 2DQVA 4R9FA 3HN0A 5I56B 1B7HA 3HV1A 1B2HA 1B3HA 3T9XB 1B1XA 4OMBA 3TQWA 3GZGA 2QS2A 4TQUQ 2I48A 5JEIA 3PUZE 1Z7NE 1PBQA 1FQFA 3H06B 4I1DA 4F3PA 5H8QB 2QMWA 4U4XA 4N13A 1WODA 1N7WA 4THIA 3IJXB 3FVNA 3FZVA 2KLFA 3U94A 3S2VA 4MBPA 2XD2A 4JWXA 4H65A 3R6UA 3U92A 5DEXB 1Y1ZA 4YZZA 3EQ1A 4BDQA 3C36A 3TCHA 2UVGA 1MH4A 3OELA 3PMWA 2I49A 4QRZA 2XXWA 4FEDA 1GV8A 1SBPA 1UQWA 5H8SA 3K1MA 3A3UA 2HCAA 4LZ8A 4OWDA 3PU5A 2O84X 2NVUB 4OYVA 1B7ZA 3D4CA 1MY3A 2F8DA 2DOJA 1Y4CA 3R7XA 1OLCA 2GH9A 2XXYA 1A54A 4H8IA 2E1SA 3TTLA 3KOSA 2CMOA 3TTNA 1US4A 1B4ZA 5ICQA 1MH3A 1B3GA 1UTHA 3MP6A 2OBGA 1QULA 5CI5A 2ALUA 2A5TB 1LGBC 3HSTA 5F7VA 2DP8A 4ZEBA 1CB6A 1POY1 2FA7A 4R72A 1KWHA 3K6XA 4BDOA 4QFPA 4GRKA 5H8HA 5DVJA 5B70A 3SETA 1A40A 2I3WA 2HXWA 1QUIA 1UIUA 3IORA 1NH8A 1TT1A 4EQ7A 3UIFA 2Z22A 5ELVA 3ONMA 2F78A 1JVXA 5CMCA 5KDTA 4NF6B 2O51A 5I59B 4H0WA 1QVSA 5H8FB 3E4RA 4GLIA 5AE4A 3FXQA 5K2YA 3B6TA 3QYTA 4G8NA 3CFXA 2XX9A 3EF7A 4NF5B 4MLQA 5I2KB 4K3FA 4O3BA 4YICA 1ZLQA 1H3DA 1IEJA 1B7UA 4PFUA 1H76A 3HPIA 3THIA 3M8UA 2X26A 4ONYA 1QKBA 1DPPA 1DTGA 3UORA 1I6QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5ICT A;  3TYH A;  4YAH X;  1P1O A;  3QUJ A;  4RA1 A;  1MQD A;  4ELR A;  3FV2 A;  3PD8 A;  4BDL A;  5BWJ A;  3FJM A;  1UTB A;  1SDX A;  2ZXT A;  5I2N A;  3SEY A;  1MPB A;  3IB0 A;  1Y4T A;  3CG1 A;  1EZO A;  2Y7P A;  1R1N A;  4ZED A;  3UGW A;  2CZL A;  4GL0 A;  4XKP A;  1MDP 1;  3DM0 A;  3ODB A;  4OFJ A;  1HSL A;  3B6W A;  1SYI A;  3FVG A;  3SES A;  1NMU A;  3O28 A;  4LQ2 A;  1FQD A;  2I58 A;  3U72 A;  2P0S A;  5FTI A;  3OEK A;  3CIJ A;  1OVB A;  3C35 A;  1JVY A;  4OET A;  1MQJ A;  3T96 B;  3PV0 E;  3N94 A;  4ZDM A;  4IGR A;  3KSJ A;  1MXZ A;  4NWD A;  3O6G A;  5TU0 A;  1BTJ A;  4G8M A;  2GRV A;  4PE5 B;  4LUB A;  2O68 A;  4I62 A;  4RYA A;  1TFD A;  4R6Y A;  1SW1 A;  4Q5T A;  2VOZ A;  3IR1 A;  3G3J A;  1B5I A;  2ZNU A;  4U21 A;  3G3G A;  3TZA A;  1RKM A;  2GHB A;  2H98 A;  1N0T A;  5FHM A;  3TKD A;  2RCA A;  2HAV A;  2OWS A;  4OEV A;  2FNC A;  3O6I A;  4IO4 A;  4GIZ A;  1I6B A;  2HFB A;  3UA8 A;  3ECR A;  4R6K A;  2HZK A;  4WKM A;  4ELP A;  3CVG A;  3LSL A;  4QFK A;  1FTL A;  3D4G A;  3Q26 A;  2PT1 A;  3K01 A;  2I4C A;  3RY3 A;  5ISU A;  4RK2 A;  2Z8F A;  1TFA A;  5HPQ A;  3E9X A;  4OEN A;  4IY5 A;  3GBB A;  5EHS A;  4PP0 A;  4FE8 A;  2ESN A;  3C32 A;  2B3F A;  5H8N A;  4EF1 A;  4F29 A;  2XXH A;  3GBA A;  3H6U A;  1JW1 A;  4IO7 A;  3BKI B;  4HTG A;  5L9M A;  4IO2 A;  5IKB A;  3E13 X;  3PUV E;  1Z7M E;  3P7I A;  4G8H A;  2F7B A;  4G77 A;  4AB6 A;  4XTC Q;  1B51 A;  5CBR A;  2UVI A;  3KZG A;  4KFQ A;  4FIM A;  4GD5 A;  2XHD A;  4GF8 A;  4DCY A;  3DP8 A;  3CG3 A;  4H5F A;  3C4M A;  4P0G A;  3K0V A;  3E3K A;  3TTK A;  1B6H A;  1WDN A;  1IUD A;  3IOU A;  3VXC A;  2NWJ A;  2Q8J A;  3G3K A;  3Q27 A;  4G4P A;  3MZ9 A;  2QS3 A;  4GQO A;  5JTY A;  3FD3 A;  2PT2 A;  4KCC A;  5DVF A;  5JK4 A;  1JW5 A;  4YKK A;  1ANF A;  2E0S A;  4FAJ A;  4TOZ A;  4YB7 A;  3RTF B;  3JV9 A;  3TCG A;  1GVC A;  1WVJ A;  1B0L A;  2XXT A;  3OO9 A;  1VFE A;  4NWC A;  3U93 A;  3A09 A;  2ONK E;  1IZ1 A;  4WEP A;  4F1V A;  4F3G A;  4H5G A;  1MXY A;  1MM6 A;  2B65 A;  2I3V A;  1B9J A;  1S9T A;  5TP9 A;  4F18 A;  1FCK A;  2X7Q A;  5CMB A;  1LST A;  2H9B A;  4RPO A;  1LCT A;  2F36 A;  4YKJ A;  1UIV A;  2DWA A;  5ITP A;  4WED A;  1IIT A;  1R9Q A;  1MPC A;  4IO3 A;  4OFO A;  3LR1 A;  1IXI A;  4UAC A;  1N04 A;  2QL3 A;  3TOD A;  1URG A;  1FTK A;  3USD A;  3MJN A;  4RPN A;  3WAE A;  3IOW A;  3QUF A;  1Y1M A;  3C33 A;  4EDP A;  3IK6 B;  4HS7 A;  4FJP A;  1SI1 A;  1LFH A;  4KD5 A;  3MZB A;  3QSL A;  4N6P A;  4OHN A;  2RC7 A;  1QJM A;  4QSE A;  1PC3 A;  3CSG A;  1PB8 A;  2A5S A;  1ZJL A;  3CFZ A;  3IB2 A;  1MG1 A;  3V83 A;  5AA4 A;  3ZS6 A;  3OD7 A;  4TLL B;  1LLS A;  5L8D A;  1AOV A;  4OTE A;  4PFY A;  3PPO A;  1B32 A;  1RYO A;  1MXV A;  2QS4 A;  3U1O A;  4OQO A;  3H6V A;  4R75 A;  4Q30 B;  2QMX A;  4LP2 B;  4BLA A;  1NNP A;  1ZTY A;  5KCJ A;  3F11 A;  2OZZ A;  3MW0 A;  5A5X A;  1MPD A;  5H8N B;  3S9N C;  1I6A A;  3FUZ A;  3IOT A;  2Y84 A;  4EUO A;  4QF9 A;  4HW8 A;  5I58 A;  2OCU A;  2G29 A;  1SW4 A;  3FVO A;  1M5E A;  1ZIU A;  4O3A A;  3MC2 A;  1CE2 A;  2UVH A;  1PBP A;  3QXM A;  3FJG A;  1SI0 A;  1YTV A;  3SEV A;  5CBS A;  4F1Y A;  1B4H A;  4KHZ E;  4R73 A;  3KEI A;  2P1S A;  1HSJ A;  1H45 A;  4P11 A;  4TLM B;  1M5F A;  1LBB A;  3C31 A;  3TMG A;  2DWH A;  2V25 A;  3FXR A;  4F1U A;  1URS A;  4U1O A;  1GGG A;  3S9E A;  5I57 A;  2Z23 A;  3FJ7 A;  4ESX A;  1B3E A;  4YKP A;  5K2X A;  4GL8 A;  3B6Q A;  1DPE A;  1GTK A;  1Y3N A;  4ZEI A;  3LSW A;  3RQT A;  3GXA A;  4O3C A;  3T9U A;  4NF4 B;  3PGF A;  5DYH A;  4G68 A;  3HO7 A;  2UXA A;  4ZEK A;  1AMF A;  3MVW A;  3TEP A;  2IEE A;  4LQ5 A;  2O7U A;  2DE4 A;  4POW A;  5DVI A;  3IX1 A;  4KYD A;  3VVF A;  4F3S A;  2H4I A;  1LAF E;  3SEU A;  2OLB A;  1US5 A;  1N3W A;  3PUX E;  3TPA A;  3VXB A;  4ELQ A;  2Q2C A;  3HCQ A;  4FEC A;  4BDM A;  4QFO A;  3LSX A;  4I8C A;  2PBW A;  1FTM A;  1QKA A;  2V84 A;  1PEB A;  3RPW A;  2R9J A;  2THI A;  2F35 A;  4F2Q A;  3KJ7 A;  1URD A;  3RT6 B;  2HEU A;  2M8C A;  3TTR A;  1AL3 A;  1FQA A;  3H3G A;  2Q2A A;  3O2A A;  1MXX A;  4KYS A;  3T9H B;  4UA8 A;  3KN3 A;  3T22 A;  2RC8 A;  4YB6 A;  3RLF E;  1B1H A;  1I69 A;  4PQJ A;  1P1U A;  1YPN A;  4Q0C A;  4R9G A;  4C0R A;  2H5Y A;  4JB7 A;  1ZBM A;  3IO6 A;  1R9L A;  3L6H A;  3V89 B;  3H4Z A;  1MXW A;  1P1W A;  3LC8 A;  2ZNS A;  4R6H A;  2REJ A;  4M4G A;  1A99 A;  3EHT A;  3HHG A;  3VVD A;  1H44 A;  3B7D A;  3TEL A;  4IY6 A;  3WAF A;  4JXI A;  3TFL A;  1SW2 A;  1D9V A;  1ZMG A;  3OEM A;  5AA4 B;  2W7Y A;  4OZ9 A;  2ONS A;  4OVJ A;  5L9S A;  5IAI A;  2GFE A;  2F97 A;  3H6T A;  4OEU A;  3BFU A;  1JET A;  4GXA A;  3PPN A;  3DP4 A;  3IO4 A;  5A5X B;  3O9P A;  3UN6 A;  2I6E A;  4EXK A;  4R74 A;  5L9O A;  2QSX A;  3KGC A;  2PVU A;  3JYR A;  1FQB A;  5I56 A;  4JDF A;  2QS1 A;  3LBS A;  2V3Q A;  1B46 A;  2YJP A;  4YU0 A;  2VD3 A;  3CRB A;  5CM6 A;  3UP9 A;  2F7C A;  2O69 A;  2AYS A;  2QJE A;  1UTH B;  2F34 A;  1O64 A;  1EU8 A;  2DWJ A;  2Z8D A;  3MZ1 A;  2OWT A;  1POT A;  1NFT A;  2DXY A;  4OES A;  1DSN A;  1AIV A;  5H8Q A;  5AA1 A;  3T66 A;  3O97 A;  3EPE A;  1EZ9 A;  2F7A A;  3C9H A;  1Q1K A;  3OO7 A;  1M5C A;  2Y7R A;  3CSB A;  1USY H;  3G3I A;  3KJT A;  4POX A;  2IA4 A;  1H43 A;  4RY1 A;  4MFI A;  1FTO A;  1B0H A;  5H8H B;  3IJO B;  3MVX A;  3MPK A;  2XXQ A;  1OMP A;  1R6Z A;  3MVY A;  5TPA A;  4HCW A;  4RNS A;  3RT8 A;  5AA2 D;  4DCX A;  4DIG A;  3W9V A;  1GR2 A;  4KI0 E;  5CC2 A;  3IOV A;  1BLF A;  2V93 A;  2Z8E A;  3K02 A;  5KDT B;  4DXU A;  4RXL A;  1LAX A;  4U23 A;  1Q35 A;  3GLB A;  4XKR A;  3VVE A;  3VDF A;  1MDQ A;  2UYE A;  5I84 A;  4OXV A;  5AA2 A;  3PUW E;  3DP6 A;  3PMX A;  3MPL A;  2XXU A;  1VE4 A;  4OFL A;  1QUJ A;  2DVZ A;  2PYY A;  2A5T A;  1NNF A;  2HQ0 A;  1LB9 A;  4AQ4 A;  4AB5 A;  4YKI A;  1S7Y A;  3SDF A;  1YCJ A;  3PMV A;  4DDD A;  1JEU A;  4EQB A;  4NMY A;  3MBP A;  2ZYK A;  1UTB B;  4ND9 A;  4MLV A;  4X1B A;  4QSD A;  5I2N B;  1Y9U A;  3OO6 A;  2HZL A;  2G93 A;  4F3B A;  3OEN A;  4U1Z A;  4QHQ A;  2XXI A;  4FOR A;  2Y7W A;  2DE2 A;  4ELO A;  1BKA A;  4DXC A;  3RUM A;  4L17 A;  4DLD A;  1A7L A;  4LZ5 A;  4P0I A;  3RNN A;  3AXF A;  1IQ7 A;  1NKX A;  1Y20 A;  2VGQ A;  4JSO A;  2XXX A;  3IB1 A;  4NF6 A;  5H8F A;  2O7I A;  1ATG A;  3TCF A;  4I9D A;  3Q25 A;  1IXH A;  3FV1 A;  5KZT A;  1P99 A;  1B3F A;  4C1T A;  4F19 A;  1JEV A;  3OOA A;  1XHY A;  3VLU A;  1VFD A;  4NF8 A;  4QSC A;  4NF5 A;  1A55 A;  3PUY E;  1T0K A;  2ANJ A;  5I2K A;  4PFT A;  2NUV A;  3K2D A;  4GVO A;  5CMM A;  3FAT A;  1O63 A;  3S4U A;  3G7W A;  4NED A;  1JW4 A;  4YB5 A;  4YMA A;  1OQG A;  3HHF A;  3L6G A;  4F2O A;  3BBR A;  3I3V A;  1LFG A;  4LA9 A;  1QW0 A;  3EHS A;  5AA3 A;  1NNK A;  2GHA A;  1VSO A;  2RC9 A;  2UVJ A;  3M3F A;  1PB9 A;  4U4S A;  3DEL B;  5BUU A;  2REG A;  4KR5 A;  1B5H A;  5EYF A;  3V5A A;  3K6W A;  4HCY A;  4ZZA A;  1AH5 A;  1JNF A;  4ISU A;  1XT8 A;  2RCB A;  3MP8 A;  3S9L C;  3MWB A;  2VHA A;  3KN8 A;  5TPA B;  3M3K A;  1XC1 A;  1LBC A;  3PPR A;  4Q8R A;  2R6G E;  4IGT A;  5CMK A;  2XX7 A;  4LZ7 A;  4OER A;  2XXP A;  1JQF A;  3IL1 B;  4WXJ A;  3I5O A;  2I0B A;  4R2F A;  3PD9 A;  1MXU A;  4ZZE A;  3TAJ A;  5M2V A;  4GOT A;  2VD2 A;  2OK2 A;  3LSF B;  3CI8 A;  3LUY A;  4H8J A;  2XXV A;  2PMS A;  2NXO A;  1PDA A;  2ZYM A;  5FTH A;  1FQE A;  3KBR A;  3RGY A;  5AA2 B;  4E0W A;  5DTB A;  2B3B A;  1B3L A;  1N76 A;  4F31 B;  4JSD A;  3O66 A;  1OVT A;  3I6V A;  1MQH A;  4XKQ A;  1MY4 A;  2AL4 A;  2UYF A;  4ZE8 A;  3H6W A;  2XX8 A;  3KFM A;  1Y3P A;  4JBZ A;  4MH5 A;  3OSR A;  1M5B A;  1YAE A;  1B58 A;  5JTY B;  4G2Z A;  3KSX A;  3VV5 A;  1M5D A;  4KYE A;  5LOM A;  3SER A;  3VLW A;  4LAT A;  4EF2 A;  3CR9 A;  3MUQ A;  3TQL A;  1P1N A;  3MQ9 A;  3V8X B;  1FTJ A;  1VR5 A;  4ECF A;  1DMB A;  5HM4 B;  2AIX A;  1HSE A;  2RIN A;  3K6U A;  1N84 A;  4GXS B;  1XVY A;  5J1D A;  1QUK A;  1NH7 A;  2ONR A;  3K4U A;  5TP9 B;  4IO6 A;  2ZYN A;  1LCF A;  4PET A;  3KG2 A;  4JWO A;  1EH3 A;  1SQY A;  1II5 A;  4ZEC A;  2D5W A;  3PPP A;  2Q89 A;  5ITO A;  4G68 C;  3MP1 A;  4EQ9 A;  1F9B A;  2BJJ X;  4NF8 B;  4EXL A;  2Q9T A;  3UK4 A;  3EHU A;  2ZMB A;  2I4B A;  4KQP A;  3RN8 A;  4LON B;  4NE4 A;  1SD3 A;  4U22 A;  1LB8 A;  3U8Q A;  4E0X A;  1DOT A;  3OSQ A;  3FXU A;  4RJZ A;  1ELJ A;  1EZP A;  4GFR A;  3EN3 A;  3ZSF A;  4IO5 A;  2O1L A;  2RF1 A;  3O6H A;  4FEB A;  1XVX A;  2HAU A;  2P2A A;  1BP5 A;  3K1N A;  3JZJ A;  1J1N A;  2NOO A;  3ZKK A;  3Q29 A;  4KPT A;  1ZU0 A;  3IAZ A;  1NNT A;  1D9Y A;  1NL5 A;  2FYI A;  4Z0I A;  4F39 A;  3KN7 A;  4XIG Q;  1B52 A;  3H7M A;  4JWY A;  4M1V A;  2AL5 A;  4LVQ A;  4YMB A;  1LAH E;  2ZNT A;  1P1Q A;  1L5T A;  4X1D A;  5KCJ B;  2DXR A;  1MY1 A;  1A8E A;  2ZYO A;  4H1X A;  4ZE9 A;  1B05 A;  2X7P A;  1IIW A;  1FW0 A;  2V3U A;  1MQI A;  1MQG A;  2D21 A;  3SKP A;  3A3C A;  3K00 A;  5I58 B;  3Q28 A;  1D4N A;  3M3L A;  1A8F A;  2DWI A;  2QPQ A;  3VFJ A;  5FHO A;  3SEW A;  3W15 C;  2QRY A;  2I0C A;  1OQH A;  3G3F A;  2Y7I A;  2YPN A;  2WKY A;  4BDN A;  1TXF A;  3N6U A;  4QFL A;  4Z7E A;  1LAG E;  4KCD A;  4DE8 A;  1PB7 A;  3OO8 A;  1MRP A;  5B7D A;  1LFI A;  2DE3 A;  4DXB A;  3TTM A;  3O29 A;  1DTZ A;  4F22 A;  2Y7K A;  1IXC A;  5I57 B;  2RKM A;  4MF3 A;  3T9V A;  4H67 A;  5DEX A;  5EHM A;  1OLA A;  4QFN A;  3FAS A;  4X48 A;  4XKN A;  2O1M A;  1MM7 A;  3T93 B;  4IB2 A;  1N3X A;  1SYH A;  4R2B A;  2DS9 A;  3TUS A;  1ZKB A;  4G68 B;  1XS5 A;  1OIB A;  4PFW A;  2DSF A;  2XD3 A;  1SVX B;  3MVZ A;  5DT6 A;  2F6G A;  4RK9 A;  5HBC A;  3K1P A;  3QAX A;  3ILU B;  4ZEF A;  3FGS A;  3VLV A;  2V3T A;  3ZKL A;  1Y3Q A;  1B5J A;  3S9M C;  1MY0 A;  4H6D A;  5FHN A;  1S50 A;  3ILT B;  3N5L A;  4FAT A;  1USY E;  4GWO A;  3SEX A;  4DZ1 A;  1TWY A;  2DVC A;  3OMB A;  2XXR A;  3N6T A;  4BDR A;  1N7X A;  2H99 A;  4NTL A;  1MY2 A;  2R71 A;  3TDJ A;  1XOC A;  1O7T A;  5CRY A;  2D3I A;  2F6P A;  1IXG A;  3H03 A;  1RYX A;  3C34 A;  3W9W A;  2YLN A;  3N26 A;  3MAM A;  3FIR A;  1D3K A;  2ABH A;  2H25 A;  1B40 A;  1FQC A;  3CFL A;  1SW5 A;  3PPQ A;  2OJT A;  3KOT A;  4XXU A;  2PX1 A;  2VP1 A;  4ESW A;  4NF4 A;  4N07 A;  3QIM A;  2DYX A;  3FVK A;  3RTW B;  4U2R A;  3K6V A;  5F1Q A;  3BFT A;  2O6A A;  3G3H A;  2LAO A;  3VE1 B;  1MS7 A;  5I59 A;  2Q88 A;  3QK6 A;  3DLN A;  3R26 A;  2F5X A;  3OXN A;  4C1U A;  4ZS9 A;  4X9T A;  1BIY A;  2DQV A;  4R9F A;  3HN0 A;  5I56 B;  1B7H A;  3HV1 A;  1B2H A;  1B3H A;  3T9X B;  1B1X A;  4OMB A;  3TQW A;  3GZG A;  2QS2 A;  4TQU Q;  2I48 A;  5JEI A;  3PUZ E;  1Z7N E;  1PBQ A;  1FQF A;  3H06 B;  4I1D A;  4F3P A;  5H8Q B;  2QMW A;  4U4X A;  4N13 A;  1WOD A;  1N7W A;  4THI A;  3IJX B;  3FVN A;  3FZV A;  2KLF A;  3U94 A;  3S2V A;  4MBP A;  2XD2 A;  4JWX A;  4H65 A;  3R6U A;  3U92 A;  5DEX B;  1Y1Z A;  4YZZ A;  3EQ1 A;  4BDQ A;  3C36 A;  3TCH A;  2UVG A;  1MH4 A;  3OEL A;  3PMW A;  2I49 A;  4QRZ A;  2XXW A;  4FED A;  1GV8 A;  1SBP A;  1UQW A;  5H8S A;  3K1M A;  3A3U A;  2HCA A;  4LZ8 A;  4OWD A;  3PU5 A;  2O84 X;  2NVU B;  4OYV A;  1B7Z A;  3D4C A;  1MY3 A;  2F8D A;  2DOJ A;  1Y4C A;  3R7X A;  1OLC A;  2GH9 A;  2XXY A;  1A54 A;  4H8I A;  2E1S A;  3TTL A;  3KOS A;  2CMO A;  3TTN A;  1US4 A;  1B4Z A;  5ICQ A;  1MH3 A;  1B3G A;  1UTH A;  3MP6 A;  2OBG A;  1QUL A;  5CI5 A;  2ALU A;  2A5T B;  1LGB C;  3HST A;  5F7V A;  2DP8 A;  4ZEB A;  1CB6 A;  1POY 1;  2FA7 A;  4R72 A;  1KWH A;  3K6X A;  4BDO A;  4QFP A;  4GRK A;  5H8H A;  5DVJ A;  5B70 A;  3SET A;  1A40 A;  2I3W A;  2HXW A;  1QUI A;  1UIU A;  3IOR A;  1NH8 A;  1TT1 A;  4EQ7 A;  3UIF A;  2Z22 A;  5ELV A;  3ONM A;  2F78 A;  1JVX A;  5CMC A;  5KDT A;  4NF6 B;  2O51 A;  5I59 B;  4H0W A;  1QVS A;  5H8F B;  3E4R A;  4GLI A;  5AE4 A;  3FXQ A;  5K2Y A;  3B6T A;  3QYT A;  4G8N A;  3CFX A;  2XX9 A;  3EF7 A;  4NF5 B;  4MLQ A;  5I2K B;  4K3F A;  4O3B A;  4YIC A;  1ZLQ A;  1H3D A;  1IEJ A;  1B7U A;  4PFU A;  1H76 A;  3HPI A;  3THI A;  3M8U A;  2X26 A;  4ONY A;  1QKB A;  1DPP A;  1DTG A;  3UOR A;  1I6Q A; 
#chains in the Genus database with same CATH topology
 5ICT A;  3TYH A;  4YAH X;  1P1O A;  3QUJ A;  4RA1 A;  1MQD A;  4ELR A;  3FV2 A;  3PD8 A;  4BDL A;  5BWJ A;  3FJM A;  4FBP A;  1UTB A;  1SDX A;  2ZXT A;  5I2N A;  3SEY A;  1MPB A;  3IB0 A;  1Y4T A;  3CG1 A;  1EZO A;  4P3L A;  2Y7P A;  1R1N A;  4ZED A;  3UGW A;  2CZL A;  4GL0 A;  4XKP A;  1MDP 1;  3DM0 A;  4OVR A;  3ODB A;  4OFJ A;  1HSL A;  4I3E A;  3B6W A;  1SYI A;  3FVG A;  3SES A;  2ZZV A;  1NMU A;  3O28 A;  4LQ2 A;  1FQD A;  4DI4 B;  2I58 A;  3U72 A;  2P0S A;  2PCR A;  5FTI A;  3OEK A;  3CIJ A;  1OVB A;  3C35 A;  1JVY A;  4P56 A;  1LBW A;  4OET A;  1MQJ A;  3T96 B;  3PV0 E;  3N94 A;  4ZDM A;  4IGR A;  3KSJ A;  1MXZ A;  4NWD A;  3O6G A;  4GWZ A;  2P3V A;  1BTJ A;  5TU0 A;  4G8M A;  4MNC A;  2GRV A;  4PE5 B;  4LUB A;  2O68 A;  4O94 A;  4I62 A;  4JVD A;  4RYA A;  1TFD A;  4R6Y A;  1SW1 A;  4Q5T A;  2VOZ A;  3IR1 A;  3G3J A;  1B5I A;  2ZNU A;  4U21 A;  3G3G A;  3TZA A;  1RKM A;  2GHB A;  5T3J A;  2H98 A;  1N0T A;  5FHM A;  3TKD A;  2RCA A;  1RDX A;  2HAV A;  2OWS A;  4OEV A;  3E78 A;  2FNC A;  4NF0 A;  3O6I A;  4IO4 A;  4GIZ A;  3KBZ A;  1I6B A;  2HFB A;  3UA8 A;  4KXP A;  3ECR A;  4N81 A;  4R6K A;  2HZK A;  4WKM A;  4ELP A;  3CVG A;  3LSL A;  4QFK A;  1FTL A;  3D4G A;  4PFB A;  3Q26 A;  2P3N A;  2PT1 A;  3K01 A;  5ET7 A;  2I4C A;  4PBH A;  3RY3 A;  5ISU A;  4RK2 A;  2Z8F A;  1TFA A;  5HPQ A;  2F3D A;  3E9X A;  4O8M A;  4MNP A;  4OEN A;  4IY5 A;  3GBB A;  5EHS A;  5J16 A;  4PP0 A;  4FE8 A;  2ESN A;  3C32 A;  2WEF A;  2B3F A;  5H8N A;  3ROJ A;  4EF1 A;  1FJ6 A;  4F29 A;  2XXH A;  3GBA A;  5IZZ A;  3H6U A;  1JW1 A;  4IO7 A;  3BKI B;  4HTG A;  5L9M A;  4IO2 A;  5IKB A;  3E13 X;  4NHB A;  3PUV E;  1Z7M E;  3P7I A;  1YZ0 A;  4G8H A;  2F7B A;  4G77 A;  4AB6 A;  1D9Q A;  4XTC Q;  1B51 A;  5CBR A;  2UVI A;  1FPK A;  3KZG A;  4KFQ A;  4FIM A;  4GD5 A;  2XHD A;  2CEY A;  4GF8 A;  1FPJ A;  2B4M A;  1RDZ A;  4DCY A;  1LBX A;  3CG3 A;  3DP8 A;  4H5F A;  5F24 A;  3C4M A;  1BK4 A;  4P0G A;  3K0V A;  3E3K A;  4PGP A;  4PBQ A;  3TTK A;  1B6H A;  1WDN A;  1IUD A;  3IOU A;  3VXC A;  2NWJ A;  2Q8J A;  4P8B A;  3G3K A;  3Q27 A;  4G4P A;  1AWB A;  3MZ9 A;  2QS3 A;  4GQO A;  5JTY A;  3FD3 A;  2PT2 A;  4KCC A;  5DVF A;  5JK4 A;  4PDD A;  1JW5 A;  4YKK A;  1ANF A;  2E0S A;  4FAJ A;  4TOZ A;  4YB7 A;  4GWW A;  3RTF B;  3JV9 A;  1FBD A;  3TCG A;  1GVC A;  1WVJ A;  1B0L A;  2XXT A;  3OO9 A;  1VFE A;  4NWC A;  3U93 A;  3A09 A;  2ONK E;  1IZ1 A;  4WEP A;  4F1V A;  4F3G A;  4H5G A;  1MXY A;  1MM6 A;  2B65 A;  2I3V A;  1B9J A;  1S9T A;  5TP9 A;  4F18 A;  1FCK A;  2X7Q A;  5CMB A;  4JVI A;  2QVV A;  1LST A;  2H9B A;  4RPO A;  1LCT A;  4IR8 A;  4UAB A;  2F36 A;  4YKJ A;  2PFY A;  1UIV A;  2DWA A;  2FIE A;  4WED A;  1IIT A;  5ITP A;  1R9Q A;  1MPC A;  4IO3 A;  2QVU A;  4OFO A;  3LR1 A;  1IXI A;  4UAC A;  4NGU A;  1N04 A;  2QL3 A;  3TOD A;  1URG A;  1FTK A;  3USD A;  3MJN A;  4RPN A;  3WAE A;  3IOW A;  3QUF A;  1Y1M A;  3C33 A;  4EDP A;  3IK6 B;  4HS7 A;  2VPN A;  4FJP A;  1EYK A;  4P47 A;  1SI1 A;  1YXI A;  1LFH A;  4KD5 A;  3MZB A;  3QSL A;  4N6P A;  4OHN A;  2RC7 A;  1QJM A;  4QSE A;  1PC3 A;  3CSG A;  1PB8 A;  2A5S A;  1ZJL A;  3CFZ A;  5EQA A;  3IB2 A;  5LTC A;  1MG1 A;  3V83 A;  5AA4 A;  3ZS6 A;  3OD7 A;  4TLL B;  2XWK A;  3RPL A;  1LLS A;  5L8D A;  1AOV A;  4OTE A;  4PFY A;  3PPO A;  1B32 A;  1RYO A;  1MXV A;  2QS4 A;  3U1O A;  4OQO A;  3H6V A;  4PE3 A;  4R75 A;  4Q30 B;  1CNQ A;  2QMX A;  4LP2 B;  4BLA A;  1NNP A;  1ZTY A;  5KCJ A;  3F11 A;  2OZZ A;  3MW0 A;  5A5X A;  1MPD A;  5H8N B;  3S9N C;  1I6A A;  3D1R A;  4OVT A;  3FUZ A;  3IOT A;  2FVZ A;  3SZP A;  2Y84 A;  4NN3 A;  4GBV A;  4EUO A;  4QF9 A;  4HW8 A;  5I58 A;  2OCU A;  2G29 A;  1SW4 A;  4PDH A;  3FVO A;  4AS5 A;  1M5E A;  1ZIU A;  4O3A A;  5LDZ A;  3MC2 A;  4QBA A;  2CZH A;  1CE2 A;  2UVH A;  1PBP A;  3QXM A;  3FJG A;  1SI0 A;  4PAF A;  1YTV A;  3SEV A;  5CBS A;  4F1Y A;  1B4H A;  2JJK A;  4KHZ E;  4R73 A;  5ET6 A;  3KEI A;  2P1S A;  1HSJ A;  1H45 A;  4P11 A;  2WYK A;  4TLM B;  1M5F A;  1LBB A;  3C31 A;  3MST A;  3TMG A;  2DWH A;  2V25 A;  3FXR A;  4F1U A;  1URS A;  4U1O A;  1GGG A;  3S9E A;  2WBD A;  2WX9 A;  5I57 A;  2Z23 A;  3FJ7 A;  4ESX A;  2KQZ A;  1B3E A;  4YKP A;  5K2X A;  4GL8 A;  3B6Q A;  1DPE A;  1GTK A;  1Y3N A;  4ZEI A;  3LSW A;  3RQT A;  3GXA A;  4O3C A;  2V4C A;  3T9U A;  4NF4 B;  3PGF A;  5DYH A;  4G68 A;  3HO7 A;  2UXA A;  4X8R A;  4ZEK A;  1AMF A;  3MVW A;  3TEP A;  2IEE A;  4LQ5 A;  2O7U A;  2DE4 A;  4POW A;  5DVI A;  3IX1 A;  4KYD A;  3VVF A;  4F3S A;  2H4I A;  1LAF E;  3SEU A;  2OLB A;  1US5 A;  1N3W A;  3PUX E;  3TPA A;  3VXB A;  4ELQ A;  2Q2C A;  1KA0 A;  3HCQ A;  4FEC A;  4BDM A;  4QFO A;  3LSX A;  4I8C A;  4NG7 A;  2PBW A;  1FTM A;  1QKA A;  2V84 A;  1PEB A;  3RPW A;  2R9J A;  2THI A;  2F35 A;  4F2Q A;  4MCO A;  3KJ7 A;  1URD A;  3RT6 B;  1NV4 A;  4MAG A;  2HEU A;  2M8C A;  3TTR A;  1AL3 A;  1FQA A;  3LUZ A;  3H3G A;  2Q2A A;  4OAN A;  3O2A A;  1MXX A;  4KYS A;  3T9H B;  4UA8 A;  3KN3 A;  3T22 A;  2RC8 A;  4YB6 A;  3RLF E;  4XF5 A;  1B1H A;  1I69 A;  4PQJ A;  1P1U A;  1YPN A;  4Q0C A;  4R9G A;  4C0R A;  2H5Y A;  4NX1 A;  4JB7 A;  1ZBM A;  1DBZ A;  3IO6 A;  1R9L A;  3L6H A;  3V89 B;  3H4Z A;  1MXW A;  1P1W A;  3LC8 A;  2ZNS A;  4R6H A;  2REJ A;  4M4G A;  5IGA A;  1A99 A;  3QMF A;  2CZI A;  3EHT A;  3HHG A;  3VVD A;  1H44 A;  3B7D A;  3TEL A;  3NOH A;  4IY6 A;  4GX3 A;  3WAF A;  4JXI A;  3TFL A;  1SW2 A;  1D9V A;  1ZMG A;  3OEM A;  5AA4 B;  3RPL B;  2W7Y A;  4OZ9 A;  2ONS A;  3E79 A;  4OVJ A;  5L9S A;  5IAI A;  2GFE A;  1FBF A;  2F97 A;  3H6T A;  4OEU A;  4MNI A;  3BFU A;  1JET A;  4GXA A;  3PPN A;  3DP4 A;  3IO4 A;  5A5X B;  3O9P A;  3UN6 A;  4P1L A;  2I6E A;  4EXK A;  1K9Z A;  1KZ8 A;  4R74 A;  5L9O A;  2QSX A;  3KGC A;  1NI9 A;  2PVU A;  4LN5 A;  3JYR A;  1FQB A;  5I56 A;  1FTA A;  4JDF A;  2QS1 A;  3LBS A;  2V3Q A;  1B46 A;  2YJP A;  4YU0 A;  2VD3 A;  1NUZ A;  3CRB A;  5CM6 A;  3UP9 A;  2F7C A;  3CHG A;  2O69 A;  2AYS A;  4N4U A;  2QJE A;  1UTH B;  4OVQ A;  2F34 A;  1O64 A;  1EU8 A;  2DWJ A;  2Z8D A;  3MZ1 A;  2OWT A;  1POT A;  1NFT A;  4PF8 A;  1FBP A;  2DXY A;  4OES A;  1DSN A;  1AIV A;  1LBZ A;  5H8Q A;  1FPG A;  4I40 A;  5AA1 A;  3T66 A;  3O97 A;  3EPE A;  1EZ9 A;  2F7A A;  3C9H A;  1Q1K A;  1JP4 A;  1M5C A;  3OO7 A;  2Y7R A;  3CSB A;  4N17 A;  1USY H;  3G3I A;  3KJT A;  4POX A;  2IA4 A;  1H43 A;  4RY1 A;  4MFI A;  1FTO A;  1B0H A;  5H8H B;  3IJO B;  3MVX A;  3MPK A;  2XXQ A;  1OMP A;  1R6Z A;  3MVY A;  5TPA A;  4HCW A;  4RNS A;  3RT8 A;  5AA2 D;  4N8Y A;  4DCX A;  4DIG A;  3W9V A;  1GR2 A;  4KI0 E;  5CC2 A;  3IOV A;  1XI6 A;  1BLF A;  1FPD A;  2V93 A;  2Z8E A;  3K02 A;  5KDT B;  4DXU A;  4RXL A;  1LAX A;  4U23 A;  1Q35 A;  1NV2 A;  3GLB A;  4XKR A;  2VPO A;  3VVE A;  3VDF A;  1MDQ A;  1NV5 A;  2R8T A;  5EQ8 A;  2UYE A;  5I84 A;  4OXV A;  3PTY A;  4GWY A;  2XA5 A;  5AA2 A;  3PUW E;  1DCU A;  3DP6 A;  3PMX A;  3MPL A;  2XXU A;  1VE4 A;  4OFL A;  1QUJ A;  2DVZ A;  2PYY A;  3B8B A;  2A5T A;  1NNF A;  2HQ0 A;  1LB9 A;  4AQ4 A;  4AB5 A;  4YKI A;  2XWO A;  1S7Y A;  3SDF A;  1YCJ A;  3PMV A;  2KR0 A;  4DDD A;  2HPG A;  1JEU A;  4EQB A;  4NMY A;  3MBP A;  2ZYK A;  1UTB B;  1FPF A;  4ND9 A;  4MLV A;  4X1B A;  4QSD A;  5I2N B;  1Y9U A;  3OO6 A;  2HZL A;  2G93 A;  4F3B A;  3OEN A;  4GX4 A;  4U1Z A;  4QHQ A;  2XXI A;  2CEX A;  4FOR A;  2HXR A;  2Y7W A;  2DE2 A;  5FBP A;  4ELO A;  1BKA A;  1G0I A;  4DXC A;  3RUM A;  4L17 A;  4DLD A;  1A7L A;  4LZ5 A;  4P0I A;  1IQ7 A;  3AXF A;  1NKX A;  3RNN A;  1Y20 A;  2VGQ A;  4JSO A;  2XXX A;  3IB1 A;  4NF6 A;  2BJI A;  5H8F A;  1INP A;  2O7I A;  1ATG A;  1LEV A;  5ET5 A;  3TCF A;  4I9D A;  3Q25 A;  1IXH A;  3FV1 A;  5KZT A;  2FIX A;  1P99 A;  1B3F A;  4C1T A;  4F19 A;  1JEV A;  3OOA A;  1XHY A;  3VLU A;  1VFD A;  4NF8 A;  4QSC A;  4NF5 A;  1A55 A;  2XWI A;  3PUY E;  1T0K A;  5IZ3 A;  2ANJ A;  5I2K A;  4PFT A;  2NUV A;  3K2D A;  4GVO A;  5CMM A;  3FAT A;  2WYP A;  1O63 A;  3S4U A;  3G7W A;  4NED A;  2MKZ A;  1JW4 A;  4YB5 A;  4YMA A;  1OQG A;  3HHF A;  3L6G A;  4F2O A;  3BBR A;  3I3V A;  1LFG A;  4LA9 A;  1QW0 A;  3EHS A;  5AA3 A;  1NNK A;  2GHA A;  1VSO A;  2RC9 A;  2UVJ A;  3M3F A;  2GQ1 A;  1PB9 A;  4U4S A;  3DEL B;  4KR5 A;  2REG A;  5BUU A;  1B5H A;  1EYI A;  5IM2 A;  4PAK A;  5EYF A;  3V5A A;  4DI3 D;  1FBH A;  3K6W A;  1NV6 A;  4HCY A;  4ZZA A;  1AH5 A;  1JNF A;  1FPE A;  4ISU A;  1XT8 A;  2RCB A;  3MP8 A;  3S9L C;  3MWB A;  2VHA A;  3KN8 A;  5TPA B;  3M3K A;  1XC1 A;  1LBC A;  3PPR A;  4Q8R A;  1G0H A;  2R6G E;  4IGT A;  5CMK A;  2XX7 A;  4LZ7 A;  1FSA A;  4OER A;  2XXP A;  1JQF A;  3IL1 B;  4WXJ A;  5IZ1 A;  3I5O A;  2I0B A;  4MEV A;  4R2F A;  3PD9 A;  1MXU A;  4ZZE A;  3TAJ A;  5M2V A;  4GOT A;  2VD2 A;  2OK2 A;  3LSF B;  2QVR A;  3CI8 A;  4X04 A;  3LUY A;  4H8J A;  2XXV A;  2PMS A;  4PFI A;  2NXO A;  1PDA A;  2ZYM A;  5FTH A;  1FQE A;  3KBR A;  3RGY A;  5AA2 B;  4E0W A;  5DTB A;  2B3B A;  1B3L A;  1N76 A;  4F31 B;  4JSD A;  4PCD A;  4N6D A;  3O66 A;  1OVT A;  3I6V A;  1MQH A;  4XKQ A;  1MY4 A;  2AL4 A;  2UYF A;  2Q8M A;  4MIJ A;  4ZE8 A;  3H6W A;  2XX8 A;  3KFM A;  1Y3P A;  4JBZ A;  4MH5 A;  3OSR A;  1M5B A;  1YAE A;  1B58 A;  3FBP A;  4G2Z A;  1NUW A;  5JTY B;  3KSX A;  3VV5 A;  1M5D A;  4P1E A;  4KYE A;  5LOM A;  3SER A;  3VLW A;  3HFU A;  4LAT A;  4EF2 A;  3CR9 A;  3MUQ A;  3TQL A;  2CZK A;  3T0J A;  1IMC A;  1P1N A;  3MQ9 A;  3V8X B;  1FTJ A;  1VR5 A;  4ECF A;  4PTK A;  1DMB A;  5HM4 B;  2AIX A;  4P9K A;  1HSE A;  4GWU A;  3U65 A;  2RIN A;  3K6U A;  1N84 A;  4GXS B;  1XVY A;  5J1D A;  1QUK A;  1NH7 A;  2ONR A;  3K4U A;  5TP9 B;  4IO6 A;  2ZYN A;  1LCF A;  4PET A;  2Q74 A;  3KG2 A;  4JWO A;  1YYZ A;  1FBE A;  1EH3 A;  1SQY A;  1II5 A;  4ZEC A;  2D5W A;  2VT5 A;  3PPP A;  2Q89 A;  5ITO A;  4G68 C;  3MP1 A;  4EQ9 A;  1F9B A;  2BJJ X;  4NF8 B;  4EXL A;  2Q9T A;  3UK4 A;  3EHU A;  2ZMB A;  5IZ3 B;  4HXV A;  2I4B A;  4KQP A;  1QGX A;  3RN8 A;  4LON B;  4NE4 A;  1SD3 A;  4U22 A;  1LB8 A;  3U8Q A;  4E0X A;  1DOT A;  3OSQ A;  3FXU A;  4RJZ A;  1ELJ A;  1EZP A;  4GFR A;  1LBY A;  3EN3 A;  3ZSF A;  4GWS A;  4IO5 A;  2O1L A;  2RF1 A;  3O6H A;  4FEB A;  1XVX A;  2HAU A;  2P2A A;  4OVP A;  1BP5 A;  3K1N A;  3JZJ A;  1VDW A;  1J1N A;  2XXK A;  2Y5K A;  2NOO A;  3ZKK A;  3Q29 A;  4KPT A;  1ZU0 A;  1IMD A;  4PAI A;  3IAZ A;  1NNT A;  1FPL A;  1D9Y A;  1LBV A;  1NL5 A;  2FYI A;  4Z0I A;  4F39 A;  3KN7 A;  4XIG Q;  1B52 A;  3H7M A;  4JWY A;  4M1V A;  4NAP A;  2AL5 A;  1Q9D A;  4LVQ A;  4YMB A;  1LAH E;  2ZNT A;  1P1Q A;  4N91 A;  1L5T A;  4X1D A;  5KCJ B;  2DXR A;  1MY1 A;  1A8E A;  1IMB A;  2ZYO A;  4H1X A;  4ZE9 A;  1B05 A;  1IMA A;  2X7P A;  1IIW A;  5EYH A;  1FW0 A;  2V3U A;  1MQI A;  1MQG A;  2D21 A;  3SKP A;  3A3C A;  3K00 A;  5I58 B;  3Q28 A;  1D4N A;  3M3L A;  1A8F A;  2Y5L A;  2DWI A;  4N8G A;  2QPQ A;  3VFJ A;  4O7M A;  5FHO A;  3SEW A;  3W15 C;  2QRY A;  5ESY A;  2I0C A;  1OQH A;  3G3F A;  2B4L A;  2Y7I A;  2HHM A;  2YPN A;  2WKY A;  1TXF A;  4BDN A;  3KC1 A;  3N6U A;  4QFL A;  4Z7E A;  1LAG E;  4KCD A;  4DE8 A;  1PB7 A;  3OO8 A;  1MRP A;  5B7D A;  1LFI A;  2DE3 A;  4DXB A;  3EKI A;  3TTM A;  3O29 A;  1DTZ A;  4F22 A;  2Y7K A;  1IXC A;  1FRP A;  5I57 B;  5I7I A;  2RKM A;  4MF3 A;  4H45 A;  3T9V A;  4H67 A;  5DEX A;  5EHM A;  1OLA A;  4QFN A;  3FAS A;  4X48 A;  4XKN A;  2O1M A;  1MM7 A;  3T93 B;  4IB2 A;  1N3X A;  1SYH A;  4R2B A;  2DS9 A;  3TUS A;  1ZKB A;  4G68 B;  1XS5 A;  1OIB A;  4PFW A;  2DSF A;  4PGN A;  2XD3 A;  1SVX B;  3MVZ A;  5DT6 A;  2F6G A;  4RK9 A;  1NV0 A;  3ISP A;  5HBC A;  4OVS A;  3K1P A;  3QAX A;  4XFE A;  3ILU B;  4ZEF A;  3FGS A;  3VLV A;  2V3T A;  3ZKL A;  1Y3Q A;  2ZZX A;  1B5J A;  3T1B A;  3S9M C;  1MY0 A;  4H6D A;  3GYY A;  3BIG A;  5FHN A;  1S50 A;  3ILT B;  3N5L A;  4FAT A;  1USY E;  4GWX A;  4GWO A;  3SEX A;  4DZ1 A;  1TWY A;  1NUX A;  2DVC A;  3OMB A;  2XXR A;  3BIH A;  3N6T A;  4BDR A;  1N7X A;  3MYU A;  4PF6 A;  2H99 A;  1IME A;  4NTL A;  1MY2 A;  2R71 A;  1FPI A;  3TDJ A;  1XOC A;  1O7T A;  5CRY A;  3LV0 A;  2D3I A;  2F6P A;  1IXG A;  3H03 A;  1RYX A;  3C34 A;  3W9W A;  2YLN A;  4MMP A;  3N26 A;  3MAM A;  3FIR A;  1D3K A;  4MX6 A;  2ABH A;  2H25 A;  1B40 A;  1FQC A;  3CFL A;  1SW5 A;  4HE0 A;  4QXD A;  3PPQ A;  2F3B A;  4MHF A;  2OJT A;  3KOT A;  1EYJ A;  5DW8 A;  4XXU A;  2PX1 A;  2VP1 A;  4ESW A;  4NF4 A;  4OA4 A;  4N07 A;  3QIM A;  2DYX A;  3KC0 A;  3FVK A;  3RTW B;  4U2R A;  3K6V A;  5F1Q A;  3BFT A;  5I5P A;  2O6A A;  3G3H A;  2LAO A;  3VE1 B;  1MS7 A;  5I59 A;  2Q88 A;  3QK6 A;  3DLN A;  3R26 A;  1NUY A;  2F5X A;  3OXN A;  4C1U A;  4H46 A;  4ZS9 A;  4O7I A;  4X9T A;  1BIY A;  1K9Y A;  4NQ8 A;  5EYG A;  2DQV A;  4R9F A;  3HN0 A;  3IFA A;  5I56 B;  1B7H A;  4HE2 A;  3HV1 A;  1B2H A;  1B3H A;  4XEQ A;  5EQ9 A;  3T9X B;  1RDY A;  1B1X A;  4OMB A;  2OWZ A;  3TQW A;  3GZG A;  2QS2 A;  1NV1 A;  4TQU Q;  3A29 A;  1FJ9 A;  2I48 A;  2QFL A;  5JEI A;  3PUZ E;  4MJO A;  1Z7N E;  2FBP A;  1PBQ A;  1FQF A;  4N6K A;  3H06 B;  4I1D A;  4F3P A;  5H8Q B;  2QMW A;  4U4X A;  4N13 A;  1WOD A;  4JVC A;  1N7W A;  4THI A;  3IJX B;  3B50 A;  3FVN A;  3FZV A;  2KLF A;  3U94 A;  4HE1 A;  3S2V A;  4MBP A;  2XD2 A;  4JWX A;  4H65 A;  5EQ7 A;  3R6U A;  5DEX B;  3U92 A;  1Y1Z A;  4YZZ A;  3EQ1 A;  4BDQ A;  3C36 A;  3TCH A;  1SPI A;  2UVG A;  1MH4 A;  3OEL A;  3PMW A;  2I49 A;  4QRZ A;  2XXW A;  4FED A;  1GV8 A;  1SBP A;  2L5V A;  1UQW A;  5H8S A;  3K1M A;  3A3U A;  2HCA A;  4LZ8 A;  4OWD A;  1IMF A;  3PU5 A;  2O84 X;  2NVU B;  4OYV A;  1B7Z A;  5I3S A;  4I3Y A;  3D4C A;  1MY3 A;  2F8D A;  2DOJ A;  1Y4C A;  3R7X A;  3RYD A;  1OLC A;  2GH9 A;  2XXY A;  1A54 A;  4H8I A;  2E1S A;  3TTL A;  3KOS A;  2CMO A;  3TTN A;  1US4 A;  1B4Z A;  5ICQ A;  1MH3 A;  1B3G A;  2ZZW A;  1UTH A;  3MP6 A;  2OBG A;  1QUL A;  5CI5 A;  2FHY A;  2ALU A;  2A5T B;  1LGB C;  2PFZ A;  3FXB A;  3HST A;  1FBG A;  5F7V A;  2DP8 A;  4ZEB A;  1CB6 A;  2WBB A;  1POY 1;  2FA7 A;  4R72 A;  1KWH A;  3K6X A;  5A5L A;  4BDO A;  1DK4 A;  1NV3 A;  1FPB A;  4QFP A;  4GRK A;  5H8H A;  5DVJ A;  4GX6 A;  5B70 A;  5ET8 A;  3SET A;  1A40 A;  1NV7 A;  2I3W A;  2HXW A;  1QUI A;  1UIU A;  3IOR A;  1NH8 A;  1TT1 A;  4EQ7 A;  3UIF A;  2Z22 A;  5ELV A;  3ONM A;  2F78 A;  1JVX A;  5CMC A;  5KDT A;  4NF6 B;  2O51 A;  5I59 B;  4H0W A;  1QVS A;  5H8F B;  3E4R A;  1KA1 A;  2XWV A;  2DDK A;  4GLI A;  5AE4 A;  4AS4 A;  3FXQ A;  5K2Y A;  3B6T A;  3IFC A;  3QYT A;  4G8N A;  4G61 A;  3CFX A;  2XX9 A;  3EF7 A;  4NF5 B;  4MLQ A;  5I2K B;  4K3F A;  4O3B A;  4YIC A;  1ZLQ A;  1H3D A;  1IEJ A;  1B7U A;  4N15 A;  4PFU A;  4GBW A;  1H76 A;  3HPI A;  3THI A;  3M8U A;  2X26 A;  4ONY A;  1QKB A;  1DPP A;  4PC9 A;  1DTG A;  1FBC A;  3UOR A;  2OX3 A;  4PFR A;  1I6Q A; 
#chains in the Genus database with same CATH homology
 5ICT A;  3TYH A;  4YAH X;  1P1O A;  3QUJ A;  4RA1 A;  1MQD A;  4ELR A;  3FV2 A;  3PD8 A;  4BDL A;  5BWJ A;  3FJM A;  1UTB A;  1SDX A;  2ZXT A;  5I2N A;  3SEY A;  1MPB A;  3IB0 A;  1Y4T A;  3CG1 A;  1EZO A;  2Y7P A;  1R1N A;  4ZED A;  3UGW A;  2CZL A;  4GL0 A;  4XKP A;  1MDP 1;  3DM0 A;  3ODB A;  4OFJ A;  1HSL A;  3B6W A;  1SYI A;  3FVG A;  3SES A;  1NMU A;  3O28 A;  4LQ2 A;  1FQD A;  2I58 A;  3U72 A;  2P0S A;  5FTI A;  3OEK A;  3CIJ A;  1OVB A;  3C35 A;  1JVY A;  4OET A;  1MQJ A;  3T96 B;  3PV0 E;  3N94 A;  4ZDM A;  4IGR A;  3KSJ A;  1MXZ A;  4NWD A;  3O6G A;  5TU0 A;  1BTJ A;  4G8M A;  2GRV A;  4PE5 B;  4LUB A;  2O68 A;  4I62 A;  4RYA A;  1TFD A;  4R6Y A;  1SW1 A;  4Q5T A;  2VOZ A;  3IR1 A;  3G3J A;  1B5I A;  2ZNU A;  4U21 A;  3G3G A;  3TZA A;  1RKM A;  2GHB A;  2H98 A;  1N0T A;  5FHM A;  3TKD A;  2RCA A;  2HAV A;  2OWS A;  4OEV A;  2FNC A;  3O6I A;  4IO4 A;  4GIZ A;  1I6B A;  2HFB A;  3UA8 A;  3ECR A;  4R6K A;  2HZK A;  4WKM A;  4ELP A;  3CVG A;  3LSL A;  4QFK A;  1FTL A;  3D4G A;  3Q26 A;  2PT1 A;  3K01 A;  2I4C A;  3RY3 A;  5ISU A;  4RK2 A;  2Z8F A;  1TFA A;  5HPQ A;  3E9X A;  4OEN A;  4IY5 A;  3GBB A;  5EHS A;  4PP0 A;  4FE8 A;  2ESN A;  3C32 A;  2B3F A;  5H8N A;  4EF1 A;  4F29 A;  2XXH A;  3GBA A;  3H6U A;  1JW1 A;  4IO7 A;  3BKI B;  4HTG A;  5L9M A;  4IO2 A;  5IKB A;  3E13 X;  3PUV E;  1Z7M E;  3P7I A;  4G8H A;  2F7B A;  4G77 A;  4AB6 A;  4XTC Q;  1B51 A;  5CBR A;  2UVI A;  3KZG A;  4KFQ A;  4FIM A;  4GD5 A;  2XHD A;  4GF8 A;  4DCY A;  3DP8 A;  3CG3 A;  4H5F A;  3C4M A;  4P0G A;  3K0V A;  3E3K A;  3TTK A;  1B6H A;  1WDN A;  1IUD A;  3IOU A;  3VXC A;  2NWJ A;  2Q8J A;  3G3K A;  3Q27 A;  4G4P A;  3MZ9 A;  2QS3 A;  4GQO A;  5JTY A;  3FD3 A;  2PT2 A;  4KCC A;  5DVF A;  5JK4 A;  1JW5 A;  4YKK A;  1ANF A;  2E0S A;  4FAJ A;  4TOZ A;  4YB7 A;  3RTF B;  3JV9 A;  3TCG A;  1GVC A;  1WVJ A;  1B0L A;  2XXT A;  3OO9 A;  1VFE A;  4NWC A;  3U93 A;  3A09 A;  2ONK E;  1IZ1 A;  4WEP A;  4F1V A;  4F3G A;  4H5G A;  1MXY A;  1MM6 A;  2B65 A;  2I3V A;  1B9J A;  1S9T A;  5TP9 A;  4F18 A;  1FCK A;  2X7Q A;  5CMB A;  1LST A;  2H9B A;  4RPO A;  1LCT A;  2F36 A;  4YKJ A;  1UIV A;  2DWA A;  5ITP A;  4WED A;  1IIT A;  1R9Q A;  1MPC A;  4IO3 A;  4OFO A;  3LR1 A;  1IXI A;  4UAC A;  1N04 A;  2QL3 A;  3TOD A;  1URG A;  1FTK A;  3USD A;  3MJN A;  4RPN A;  3WAE A;  3IOW A;  3QUF A;  1Y1M A;  3C33 A;  4EDP A;  3IK6 B;  4HS7 A;  4FJP A;  1SI1 A;  1LFH A;  4KD5 A;  3MZB A;  3QSL A;  4N6P A;  4OHN A;  2RC7 A;  1QJM A;  4QSE A;  1PC3 A;  3CSG A;  1PB8 A;  2A5S A;  1ZJL A;  3CFZ A;  3IB2 A;  1MG1 A;  3V83 A;  5AA4 A;  3ZS6 A;  3OD7 A;  4TLL B;  1LLS A;  5L8D A;  1AOV A;  4OTE A;  4PFY A;  3PPO A;  1B32 A;  1RYO A;  1MXV A;  2QS4 A;  3U1O A;  4OQO A;  3H6V A;  4R75 A;  4Q30 B;  2QMX A;  4LP2 B;  4BLA A;  1NNP A;  1ZTY A;  5KCJ A;  3F11 A;  2OZZ A;  3MW0 A;  5A5X A;  1MPD A;  5H8N B;  3S9N C;  1I6A A;  3FUZ A;  3IOT A;  2Y84 A;  4EUO A;  4QF9 A;  4HW8 A;  5I58 A;  2OCU A;  2G29 A;  1SW4 A;  3FVO A;  1M5E A;  1ZIU A;  4O3A A;  3MC2 A;  1CE2 A;  2UVH A;  1PBP A;  3QXM A;  3FJG A;  1SI0 A;  1YTV A;  3SEV A;  5CBS A;  4F1Y A;  1B4H A;  4KHZ E;  4R73 A;  3KEI A;  2P1S A;  1HSJ A;  1H45 A;  4P11 A;  4TLM B;  1M5F A;  1LBB A;  3C31 A;  3TMG A;  2DWH A;  2V25 A;  3FXR A;  4F1U A;  1URS A;  4U1O A;  1GGG A;  3S9E A;  5I57 A;  2Z23 A;  3FJ7 A;  4ESX A;  1B3E A;  4YKP A;  5K2X A;  4GL8 A;  3B6Q A;  1DPE A;  1GTK A;  1Y3N A;  4ZEI A;  3LSW A;  3RQT A;  3GXA A;  4O3C A;  3T9U A;  4NF4 B;  3PGF A;  5DYH A;  4G68 A;  3HO7 A;  2UXA A;  4ZEK A;  1AMF A;  3MVW A;  3TEP A;  2IEE A;  4LQ5 A;  2O7U A;  2DE4 A;  4POW A;  5DVI A;  3IX1 A;  4KYD A;  3VVF A;  4F3S A;  2H4I A;  1LAF E;  3SEU A;  2OLB A;  1US5 A;  1N3W A;  3PUX E;  3TPA A;  3VXB A;  4ELQ A;  2Q2C A;  3HCQ A;  4FEC A;  4BDM A;  4QFO A;  3LSX A;  4I8C A;  2PBW A;  1FTM A;  1QKA A;  2V84 A;  1PEB A;  3RPW A;  2R9J A;  2THI A;  2F35 A;  4F2Q A;  3KJ7 A;  1URD A;  3RT6 B;  2HEU A;  2M8C A;  3TTR A;  1AL3 A;  1FQA A;  3H3G A;  2Q2A A;  3O2A A;  1MXX A;  4KYS A;  3T9H B;  4UA8 A;  3KN3 A;  3T22 A;  2RC8 A;  4YB6 A;  3RLF E;  1B1H A;  1I69 A;  4PQJ A;  1P1U A;  1YPN A;  4Q0C A;  4R9G A;  4C0R A;  2H5Y A;  4JB7 A;  1ZBM A;  3IO6 A;  1R9L A;  3L6H A;  3V89 B;  3H4Z A;  1MXW A;  1P1W A;  3LC8 A;  2ZNS A;  4R6H A;  2REJ A;  4M4G A;  1A99 A;  3EHT A;  3HHG A;  3VVD A;  1H44 A;  3B7D A;  3TEL A;  4IY6 A;  3WAF A;  4JXI A;  3TFL A;  1SW2 A;  1D9V A;  1ZMG A;  3OEM A;  5AA4 B;  2W7Y A;  4OZ9 A;  2ONS A;  4OVJ A;  5L9S A;  5IAI A;  2GFE A;  2F97 A;  3H6T A;  4OEU A;  3BFU A;  1JET A;  4GXA A;  3PPN A;  3DP4 A;  3IO4 A;  5A5X B;  3O9P A;  3UN6 A;  2I6E A;  4EXK A;  4R74 A;  5L9O A;  2QSX A;  3KGC A;  2PVU A;  3JYR A;  1FQB A;  5I56 A;  4JDF A;  2QS1 A;  3LBS A;  2V3Q A;  1B46 A;  2YJP A;  4YU0 A;  2VD3 A;  3CRB A;  5CM6 A;  3UP9 A;  2F7C A;  2O69 A;  2AYS A;  2QJE A;  1UTH B;  2F34 A;  1O64 A;  1EU8 A;  2DWJ A;  2Z8D A;  3MZ1 A;  2OWT A;  1POT A;  1NFT A;  2DXY A;  4OES A;  1DSN A;  1AIV A;  5H8Q A;  5AA1 A;  3T66 A;  3O97 A;  3EPE A;  1EZ9 A;  2F7A A;  3C9H A;  1Q1K A;  3OO7 A;  1M5C A;  2Y7R A;  3CSB A;  1USY H;  3G3I A;  3KJT A;  4POX A;  2IA4 A;  1H43 A;  4RY1 A;  4MFI A;  1FTO A;  1B0H A;  5H8H B;  3IJO B;  3MVX A;  3MPK A;  2XXQ A;  1OMP A;  1R6Z A;  3MVY A;  5TPA A;  4HCW A;  4RNS A;  3RT8 A;  5AA2 D;  4DCX A;  4DIG A;  3W9V A;  1GR2 A;  4KI0 E;  5CC2 A;  3IOV A;  1BLF A;  2V93 A;  2Z8E A;  3K02 A;  5KDT B;  4DXU A;  4RXL A;  1LAX A;  4U23 A;  1Q35 A;  3GLB A;  4XKR A;  3VVE A;  3VDF A;  1MDQ A;  2UYE A;  5I84 A;  4OXV A;  5AA2 A;  3PUW E;  3DP6 A;  3PMX A;  3MPL A;  2XXU A;  1VE4 A;  4OFL A;  1QUJ A;  2DVZ A;  2PYY A;  2A5T A;  1NNF A;  2HQ0 A;  1LB9 A;  4AQ4 A;  4AB5 A;  4YKI A;  1S7Y A;  3SDF A;  1YCJ A;  3PMV A;  4DDD A;  1JEU A;  4EQB A;  4NMY A;  3MBP A;  2ZYK A;  1UTB B;  4ND9 A;  4MLV A;  4X1B A;  4QSD A;  5I2N B;  1Y9U A;  3OO6 A;  2HZL A;  2G93 A;  4F3B A;  3OEN A;  4U1Z A;  4QHQ A;  2XXI A;  4FOR A;  2Y7W A;  2DE2 A;  4ELO A;  1BKA A;  4DXC A;  3RUM A;  4L17 A;  4DLD A;  1A7L A;  4LZ5 A;  4P0I A;  3RNN A;  3AXF A;  1IQ7 A;  1NKX A;  1Y20 A;  2VGQ A;  4JSO A;  2XXX A;  3IB1 A;  4NF6 A;  5H8F A;  2O7I A;  1ATG A;  3TCF A;  4I9D A;  3Q25 A;  1IXH A;  3FV1 A;  5KZT A;  1P99 A;  1B3F A;  4C1T A;  4F19 A;  1JEV A;  3OOA A;  1XHY A;  3VLU A;  1VFD A;  4NF8 A;  4QSC A;  4NF5 A;  1A55 A;  3PUY E;  1T0K A;  2ANJ A;  5I2K A;  4PFT A;  2NUV A;  3K2D A;  4GVO A;  5CMM A;  3FAT A;  1O63 A;  3S4U A;  3G7W A;  4NED A;  1JW4 A;  4YB5 A;  4YMA A;  1OQG A;  3HHF A;  3L6G A;  4F2O A;  3BBR A;  3I3V A;  1LFG A;  4LA9 A;  1QW0 A;  3EHS A;  5AA3 A;  1NNK A;  2GHA A;  1VSO A;  2RC9 A;  2UVJ A;  3M3F A;  1PB9 A;  4U4S A;  3DEL B;  5BUU A;  2REG A;  4KR5 A;  1B5H A;  5EYF A;  3V5A A;  3K6W A;  4HCY A;  4ZZA A;  1AH5 A;  1JNF A;  4ISU A;  1XT8 A;  2RCB A;  3MP8 A;  3S9L C;  3MWB A;  2VHA A;  3KN8 A;  5TPA B;  3M3K A;  1XC1 A;  1LBC A;  3PPR A;  4Q8R A;  2R6G E;  4IGT A;  5CMK A;  2XX7 A;  4LZ7 A;  4OER A;  2XXP A;  1JQF A;  3IL1 B;  4WXJ A;  3I5O A;  2I0B A;  4R2F A;  3PD9 A;  1MXU A;  4ZZE A;  3TAJ A;  5M2V A;  4GOT A;  2VD2 A;  2OK2 A;  3LSF B;  3CI8 A;  3LUY A;  4H8J A;  2XXV A;  2PMS A;  2NXO A;  1PDA A;  2ZYM A;  5FTH A;  1FQE A;  3KBR A;  3RGY A;  5AA2 B;  4E0W A;  5DTB A;  2B3B A;  1B3L A;  1N76 A;  4F31 B;  4JSD A;  3O66 A;  1OVT A;  3I6V A;  1MQH A;  4XKQ A;  1MY4 A;  2AL4 A;  2UYF A;  4ZE8 A;  3H6W A;  2XX8 A;  3KFM A;  1Y3P A;  4JBZ A;  4MH5 A;  3OSR A;  1M5B A;  1YAE A;  1B58 A;  5JTY B;  4G2Z A;  3KSX A;  3VV5 A;  1M5D A;  4KYE A;  5LOM A;  3SER A;  3VLW A;  4LAT A;  4EF2 A;  3CR9 A;  3MUQ A;  3TQL A;  1P1N A;  3MQ9 A;  3V8X B;  1FTJ A;  1VR5 A;  4ECF A;  1DMB A;  5HM4 B;  2AIX A;  1HSE A;  2RIN A;  3K6U A;  1N84 A;  4GXS B;  1XVY A;  5J1D A;  1QUK A;  1NH7 A;  2ONR A;  3K4U A;  5TP9 B;  4IO6 A;  2ZYN A;  1LCF A;  4PET A;  3KG2 A;  4JWO A;  1EH3 A;  1SQY A;  1II5 A;  4ZEC A;  2D5W A;  3PPP A;  2Q89 A;  5ITO A;  4G68 C;  3MP1 A;  4EQ9 A;  1F9B A;  2BJJ X;  4NF8 B;  4EXL A;  2Q9T A;  3UK4 A;  3EHU A;  2ZMB A;  2I4B A;  4KQP A;  3RN8 A;  4LON B;  4NE4 A;  1SD3 A;  4U22 A;  1LB8 A;  3U8Q A;  4E0X A;  1DOT A;  3OSQ A;  3FXU A;  4RJZ A;  1ELJ A;  1EZP A;  4GFR A;  3EN3 A;  3ZSF A;  4IO5 A;  2O1L A;  2RF1 A;  3O6H A;  4FEB A;  1XVX A;  2HAU A;  2P2A A;  1BP5 A;  3K1N A;  3JZJ A;  1J1N A;  2NOO A;  3ZKK A;  3Q29 A;  4KPT A;  1ZU0 A;  3IAZ A;  1NNT A;  1D9Y A;  1NL5 A;  2FYI A;  4Z0I A;  4F39 A;  3KN7 A;  4XIG Q;  1B52 A;  3H7M A;  4JWY A;  4M1V A;  2AL5 A;  4LVQ A;  4YMB A;  1LAH E;  2ZNT A;  1P1Q A;  1L5T A;  4X1D A;  5KCJ B;  2DXR A;  1MY1 A;  1A8E A;  2ZYO A;  4H1X A;  4ZE9 A;  1B05 A;  2X7P A;  1IIW A;  1FW0 A;  2V3U A;  1MQI A;  1MQG A;  2D21 A;  3SKP A;  3A3C A;  3K00 A;  5I58 B;  3Q28 A;  1D4N A;  3M3L A;  1A8F A;  2DWI A;  2QPQ A;  3VFJ A;  5FHO A;  3SEW A;  3W15 C;  2QRY A;  2I0C A;  1OQH A;  3G3F A;  2Y7I A;  2YPN A;  2WKY A;  4BDN A;  1TXF A;  3N6U A;  4QFL A;  4Z7E A;  1LAG E;  4KCD A;  4DE8 A;  1PB7 A;  3OO8 A;  1MRP A;  5B7D A;  1LFI A;  2DE3 A;  4DXB A;  3TTM A;  3O29 A;  1DTZ A;  4F22 A;  2Y7K A;  1IXC A;  5I57 B;  2RKM A;  4MF3 A;  3T9V A;  4H67 A;  5DEX A;  5EHM A;  1OLA A;  4QFN A;  3FAS A;  4X48 A;  4XKN A;  2O1M A;  1MM7 A;  3T93 B;  4IB2 A;  1N3X A;  1SYH A;  4R2B A;  2DS9 A;  3TUS A;  1ZKB A;  4G68 B;  1XS5 A;  1OIB A;  4PFW A;  2DSF A;  2XD3 A;  1SVX B;  3MVZ A;  5DT6 A;  2F6G A;  4RK9 A;  5HBC A;  3K1P A;  3QAX A;  3ILU B;  4ZEF A;  3FGS A;  3VLV A;  2V3T A;  3ZKL A;  1Y3Q A;  1B5J A;  3S9M C;  1MY0 A;  4H6D A;  5FHN A;  1S50 A;  3ILT B;  3N5L A;  4FAT A;  1USY E;  4GWO A;  3SEX A;  4DZ1 A;  1TWY A;  2DVC A;  3OMB A;  2XXR A;  3N6T A;  4BDR A;  1N7X A;  2H99 A;  4NTL A;  1MY2 A;  2R71 A;  3TDJ A;  1XOC A;  1O7T A;  5CRY A;  2D3I A;  2F6P A;  1IXG A;  3H03 A;  1RYX A;  3C34 A;  3W9W A;  2YLN A;  3N26 A;  3MAM A;  3FIR A;  1D3K A;  2ABH A;  2H25 A;  1B40 A;  1FQC A;  3CFL A;  1SW5 A;  3PPQ A;  2OJT A;  3KOT A;  4XXU A;  2PX1 A;  2VP1 A;  4ESW A;  4NF4 A;  4N07 A;  3QIM A;  2DYX A;  3FVK A;  3RTW B;  4U2R A;  3K6V A;  5F1Q A;  3BFT A;  2O6A A;  3G3H A;  2LAO A;  3VE1 B;  1MS7 A;  5I59 A;  2Q88 A;  3QK6 A;  3DLN A;  3R26 A;  2F5X A;  3OXN A;  4C1U A;  4ZS9 A;  4X9T A;  1BIY A;  2DQV A;  4R9F A;  3HN0 A;  5I56 B;  1B7H A;  3HV1 A;  1B2H A;  1B3H A;  3T9X B;  1B1X A;  4OMB A;  3TQW A;  3GZG A;  2QS2 A;  4TQU Q;  2I48 A;  5JEI A;  3PUZ E;  1Z7N E;  1PBQ A;  1FQF A;  3H06 B;  4I1D A;  4F3P A;  5H8Q B;  2QMW A;  4U4X A;  4N13 A;  1WOD A;  1N7W A;  4THI A;  3IJX B;  3FVN A;  3FZV A;  2KLF A;  3U94 A;  3S2V A;  4MBP A;  2XD2 A;  4JWX A;  4H65 A;  3R6U A;  3U92 A;  5DEX B;  1Y1Z A;  4YZZ A;  3EQ1 A;  4BDQ A;  3C36 A;  3TCH A;  2UVG A;  1MH4 A;  3OEL A;  3PMW A;  2I49 A;  4QRZ A;  2XXW A;  4FED A;  1GV8 A;  1SBP A;  1UQW A;  5H8S A;  3K1M A;  3A3U A;  2HCA A;  4LZ8 A;  4OWD A;  3PU5 A;  2O84 X;  2NVU B;  4OYV A;  1B7Z A;  3D4C A;  1MY3 A;  2F8D A;  2DOJ A;  1Y4C A;  3R7X A;  1OLC A;  2GH9 A;  2XXY A;  1A54 A;  4H8I A;  2E1S A;  3TTL A;  3KOS A;  2CMO A;  3TTN A;  1US4 A;  1B4Z A;  5ICQ A;  1MH3 A;  1B3G A;  1UTH A;  3MP6 A;  2OBG A;  1QUL A;  5CI5 A;  2ALU A;  2A5T B;  1LGB C;  3HST A;  5F7V A;  2DP8 A;  4ZEB A;  1CB6 A;  1POY 1;  2FA7 A;  4R72 A;  1KWH A;  3K6X A;  4BDO A;  4QFP A;  4GRK A;  5H8H A;  5DVJ A;  5B70 A;  3SET A;  1A40 A;  2I3W A;  2HXW A;  1QUI A;  1UIU A;  3IOR A;  1NH8 A;  1TT1 A;  4EQ7 A;  3UIF A;  2Z22 A;  5ELV A;  3ONM A;  2F78 A;  1JVX A;  5CMC A;  5KDT A;  4NF6 B;  2O51 A;  5I59 B;  4H0W A;  1QVS A;  5H8F B;  3E4R A;  4GLI A;  5AE4 A;  3FXQ A;  5K2Y A;  3B6T A;  3QYT A;  4G8N A;  3CFX A;  2XX9 A;  3EF7 A;  4NF5 B;  4MLQ A;  5I2K B;  4K3F A;  4O3B A;  4YIC A;  1ZLQ A;  1H3D A;  1IEJ A;  1B7U A;  4PFU A;  1H76 A;  3HPI A;  3THI A;  3M8U A;  2X26 A;  4ONY A;  1QKB A;  1DPP A;  1DTG A;  3UOR A;  1I6Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...