3FXUA

Crystal structure of tsar in complex with its effector p-toluenesulfonate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA03
1SMTA 4C1TA 1XDUA 5DCFA 1DPRA 3KN7A 3PMXA 1SD3A 3O6HA 1XDSA 3UORA 1TT1A 4EJOA 4RK2A 3ZN0A 2FMLA 3L2CA 3K0VA 1ZGJA 3HSEA 4ON0A 2PX1A 3TTRA 3HUGA 2VD2A 3H6TA 2EA2A 4M9XA 1MY4A 4CHUA 3L7WA 1O64A 5ICGA 2FQ3A 1LQ1A 2P5LC 4YAHX 2D2WA 2HKXA 4DE8A 3BP8A 4LG0A 1B7UA 3J7AO 2FMYA 3FX3A 5LBQA 4WXHA 2DS9A 4I7HA 4AVPA 2FXAA 5JR3A 4UVAA 1QPMA 4A0YA 1E2XA 1K79A 2HWVA 4G7ZF 1GR2A 4R75A 4LK0F 3TCGA 4DDDA 4HLYA 4F1YA 3COAC 5L3CA 4R8HA 3DV8A 1R00A 1IUYA 4RJZA 1B58A 2PT2A 1B46A 1CF7A 5KVRA 3WTXC 4ISUA 1WDNA 3DP6A 2OQGA 4YICA 2ISZA 3PD9A 4ELPA 4Z7EA 2COMA 1NNTA 3KP2A 5L9OA 3C36A 4EQ7A 4YMBA 4UACA 2P6TA 1G4DA 4KPTA 4XLNF 4YKKA 1JE8A 2RN7A 3ZKLA 4P96A 1PP8F 2FBKA 2L4MA 3A3CA 3IRRA 3SEUA 2REGA 2ZMEB 2G9WA 2O0YA 2RC8A 3LAJA 4OETA 4XSXF 1LLSA 2PQ8A 4BQAA 2YPNA 1PUEE 3K0LA 1IEJA 2HEUA 2I4CA 1POTA 3ISPA 4XSZF 3DP8A 3I58A 2O8XA 4GRKA 3K1MA 1XS5A 4K2EA 3TKYA 4BHCA 1ODDA 1LB8A 3MWBA 1U8RA 1B51A 4RYAA 3MVYA 1M5DA 1MY3A 5I56A 3TTNA 3T0YA 2X7QA 1OMIA 2ONSA 3VEPA 3FATA 3J80Z 1YS6A 3K6VA 2NNYA 5D6EA 5EHSA 4HLXA 2Z8FA 4LB6B 3LR1A 3MJNA 4OMZA 2M8EA 5LHIA 1LAGE 5DTBA 1IN4A 5EEHA 5AA4A 3P7IA 3RY3A 1MDMA 1UTHA 2X26A 2RF1A 1KYWA 2HAVA 1FP1D 3E3KA 5DYHA 3DXJF 5DD4A 5J1DA 4EJUA 1P1WA 1U5TB 2H4IA 1VTNC 1O3TA 1FQBA 4EM2A 2V84A 4FAJA 5FHNA 1YPNA 5CYVA 1USTA 1QZZA 1YTVA 2NRAC 3PD8A 3J80K 5H8NA 3JTHA 3JSPA 1H9TA 3HRUA 3M9AA 3KBRA 5CVJA 2PG4A 3PPNA 3R60A 4P9FA 2JT1A 2ZFWA 1KGSA 4R72A 4OU0A 4UXNA 4M71A 3LUYA 4E0WA 3OEKA 5TJJA 1J7KA 2PBIA 4Q5SF 3I54A 4LD5A 2YX7A 4U1ZA 2XHKA 3I3VA 4IO6A 1ZG3A 3CLOA 2F7BA 1IN7A 2VONA 2EV0A 1K6OA 4P11A 1MM7A 5KK1A 1XSXA 1UIUA 4JWYA 1B9NA 1Q35A 1BC8C 4N6PA 5JTYB 3PV0E 4U88A 1ANFA 3SEXA 2HOEA 1S7OA 2DE4A 4OIRF 1D9YA 3G7WA 3CIJA 2ZYMA 4G8HA 3FJMA 5DCMA 2H25A 1Y4TA 1BLFA 4KR5A 4L5IA 1UHMA 2PI0A 4R79A 4R2BA 1LCTA 3GF2A 4CZZA 3CRBA 3LA2A 3VE1B 1FQFA 4IY6A 4XKNA 2EFWA 1N0TA 2XROA 2V1UA 3AXFA 2WC2A 4OFOA 3CSGA 5D4SA 5K2XA 1B40A 5BWJA 2AXLA 4G6DA 4JWOA 3KOSA 4ZZLA 4KD5A 3KETA 2E1CA 1EH8A 2CYYA 4KIBA 2ZNZA 1T0KA 3KOTA 1UTBA 1R22A 4OESA 4E0XA 3CO6C 4DXBA 2VBZA 1H76A 2ZXTA 3MQ9A 1B5HA 5TPAA 2DVCA 4ZEIA 1OKRA 3O6GA 4GOTA 3E5XA 4YIFA 1XMAA 4EXLA 1B7ZA 3T8TA 1O7FA 1CB6A 1UHWA 2QLZA 2WV0A 3WTUC 3C9HA 4MH5A 4M1VA 1FTLA 3GWZA 2FA5A 1WRJA 1HSJA 2OZ6A 3ECOA 1S9TA 4I01A 1K78A 1UIVA 3S2WA 3RYPA 3M8FA 3CSBA 3G3GA 3JW4A 1B59A 2QBYA 2XAGA 2MD5A 4TLMB 4DXUA 4X9TA 4LK1F 4RY1A 2WKYA 5D5XB 5DT6A 5LRSA 4NE4A 3GXAA 3RTWB 3R61A 1KQ9A 2NNNA 5I59A 1H9GA 1LCFA 1R5GA 3EF7A 3DEUA 5L3FA 3KEQA 1MH4A 1DPUA 1US5A 1Z6RA 5ICEA 3PPRA 5AA3A 1MQHA 1YLFA 3QU6A 1AWCA 2UVJA 2Z22A 3L6GA 3S2VA 4LONB 2QENA 3H03A 3DPLC 5H8SA 4A2UA 1ZU0A 1B9MA 2F34A 4Y15A 1MDQA 3HTSB 4KCCA 3MVXA 3FXUA 1T38A 4MEXF 3WTYC 1HKTA 2XGXA 4IRIA 3TEPA 2BV6A 3MZ1A 1N04A 1XMKA 2QZ8A 2GHAA 2W57A 3S9NC 4YKIA 2R3SA 4IB2A 2RC4A 4A0ZA 1KA8A 1NL5A 3KGCA 1FYMA 4QSEA 3W9WA 3M7GA 3CVGA 5AIPA 1B2HA 4AIKA 3IR1A 4GD5A 3U92A 3KE2A 3JTGA 5CM6A 4MF3A 3E9XA 5D5UB 3FVOA 1FX7A 3HTUA 2H6BA 5HOOA 1IXGA 1H43A 3B6TA 5ISUA 1BIBA 2M87A 5A5XB 3R4KA 1QGPA 2EWNA 3G73A 4KMFA 3P9CA 4TOZA 2P5VA 4L17A 1F9BA 3N6UA 2VC1A 4OVJA 3BROA 1W4MA 3I0TA 2G93A 3WE2A 3CUQB 4UNOA 1PB7A 2EV6A 3MVZA 3SZPA 1IXCA 2W25A 2B65A 5D8LB 1J0RA 4PP0A 2ZNSA 3T5XA 5JVTA 4IF4A 4U21A 1MJBA 3R0AA 3LSFB 4KQPA 1MG1A 3IRQA 2A6EF 4HX4A 2DW4A 2OWTA 1QULA 4RGSA 1P1NA 1XB4A 4GXOA 4XXUA 1D3YA 2L4AA 1SMYF 3CG1A 2Y48A 2O3FA 2M30A 3T22A 1BOAA 4DIGA 2A6HF 2VOOA 2CZLA 4EM1A 1JGSA 4MEYF 3TOAA 2YX4A 3DELB 4KDPA 1ULYA 1KU9A 4N07A 4OMBA 4AD9A 2XVCA 3N26A 3OOAA 3IOVA 3WTZA 4TV7A 5CMCA 3MP8A 3QRFF 2QMXA 1NH8A 3F22A 3N6TA 4IO4A 5DVIA 3KFMA 4JSDA 1OYYA 1WKMA 3G3JA 4ESFA 1XGSA 1SFEA 3TDJA 1TW2A 3M8EA 2XXPA 3I4PA 1VR5A 4A0XA 3OSRA 2V3TA 1LBCA 3VVFA 5CMMA 2EFPA 3F8BA 4RGRA 5AA2B 1L3LA 4OMYA 3EN3A 2P1SA 5HVQC 1IRGA 4YZZA 1GVCA 2QS4A 4JBZA 2ABHA 3U72A 2BYVE 5KDTB 3QYTA 2QM3A 1U2WA 5A2QZ 5HM4B 3K1PA 1Z7ME 1FCKA 4NF4B 4EQBA 1H0MA 2F36A 2F6GA 4BXUA 3PMWA 4G4PA 4N9HA 4KMUX 4ZECA 3RIRA 2FSWA 3CR9A 5E1WA 1YG2A 4KNYA 4I09A 3G3FA 3KCCA 3TMGA 1URSA 4PGHA 1VSOA 2XD3A 5H6QA 3IKTA 2OAZA 1GTKA 2ZYNA 5LEJA 1G3YA 2DAOA 3ZSFA 4BLAA 4UA8A 4LZ8A 3HPIA 4NF6A 3R6SA 1YQAA 4FEDA 4CICA 4KN7X 2FBIA 3LC8A 3BKIB 3HRMA 3HN0A 3BFUA 5ELVA 2QQAA 3SESA 4M73A 4QF9A 1Y3PA 3RQTA 4DCXA 1C0WA 2RQPA 2DOJA 3VXBA 2V1DA 3ZMZA 3PUZE 4QWQA 3OMBA 4EV0A 2H9BA 3HRSA 2PVUA 2G29A 2Z99A 3KLNA 5HDGA 3GW2A 1DSNA 3I6VA 2HR3A 3O66A 2K27A 4THIA 5AE4A 1KWHA 3ILTB 1KQ8A 4YG2F 3V8XB 3JYRA 3JSOA 4RS8A 3GFLA 1Y9UA 4WX9A 5DVFA 5CMBA 3REOA 2XXWA 2IP2A 4ZEDA 4GQOA 3BZ6A 3WGGA 1FTKA 4HF1A 3SERA 2IEEA 1DPEA 3EUHA 1SW4A 3VLWA 3O9PA 3DFGA 3QOPA 1SI1A 3GUDA 3O2PE 4QSDA 1MY1A 2M1BA 2E7WA 4HV5A 5BQTA 5TU0A 4MQVA 5K5QA 2FEZA 2IA0A 2O51A 1FP2A 1XGNA 2IA1A 3ERED 3HV1A 2AYSA 1X3UA 5ILVA 5JFRA 2XD2A 2DT5A 1BP5A 3ZMTA 2HYFA 2X7PA 5BPDA 5JI6A 2UVHA 3CO7C 3Q27A 4OWDA 1QKAA 1YW8A 3EETA 2OU2A 3GX4X 3GZGA 3V5AA 1ZRDA 3EHUA 4ONYA 1U6GA 3BFTA 1OLAA 3MFKA 2UWMA 3U9GA 4WXJA 3ZMUA 1IF1A 3I71A 5TP9B 2VODA 3FVNA 2JPCA 1SVXB 1AMFA 5BS6A 3F21A 4RB0A 3DQVC 4ESJA 2EFQA 4G8NA 2OJTA 3I5UA 3THIA 3QAXA 3EHSA 4I62A 2W7YA 3RPWA 1KYZA 3KLOA 3PQJA 2VN2A 2O1LA 2QQBA 4WF2A 5DEXB 3ML6A 1IZ1A 3UK4A 4HDVA 1RIOH 4O3CA 3KEOA 4HW8A 1MQIA 5KCJA 1R23A 1J9IA 3OOPA 3TELA 1ON1A 2P2AA 3TOBA 5DV5A 2P5KA 4CXFA 3VLVA 2HZKA 2PN6A 4HYEA 1B3LA 4LA9A 4HV6A 1HSEA 2UVIA 3PUWE 3LAPA 4H0WA 5HBCA 2W85A 3ECRA 3TFLA 1QJMA 2XXYA 3GO5A 3SEVA 1ZN2A 1T39A 4H5GA 2QJEA 3M3LA 4BH9A 3TO6A 3FMRA 2JZYA 3W9VA 1IQ7A 3TZAA 1JEVA 1B6HA 3SEWA 5F1QA 2R7FA 3V8KA 5L3EA 1WSUA 4F2QA 1MXZA 3VFJA 5FD5A 5DD8A 4HW0A 1MXXA 1MXYA 3FXRA 5L9SA 1ZMGA 4Y17A 3BPXA 4QFKA 1YTYA 3RPUA 4HTGA 4XRFA 4IVNA 3C32A 5AONA 3CFLA 3TTMA 4RPOA 1NNPA 4FECA 5DYMA 2D1VA 2RDPA 1U5TC 2KKOA 2I0BA 3V8LA 1R1UA 1TWYA 5LHGA 2F5FA 1MPCA 2Y7IA 2Q89A 1MKMA 4F2OA 2ZYOA 5L8DA 3A09A 2O69A 1BI2A 4NF5A 1GV8A 2D3IA 4Q48A 4I0AA 2DQLA 2DPUA 2VT3A 5D5VB 3OO8A 1SI0A 5A5XA 1R1TA 4EQ9A 1RNLA 1D5VA 1ZLJA 1EZOA 1B3EA 2O1MA 2Z23A 3IB1A 1MY2A 5F6FA 4B09A 3F72A 1J2XA 4R73A 4WWCA 2X4HA 4R9FA 2HFHA 4ELOA 3U2RA 1DP7P 2RNJA 4Z2YA 1LB9A 1AOYA 4IRHA 2CO5A 4KYWA 4N0BA 2DXYA 2HS5A 4HAMA 4BYYA 1IN8A 1FBQA 2IA2A 5FB2A 4XKPA 2O7UA 4NWDA 1RZ4A 3K2ZA 3R7XA 4P9UA 2XXHA 1USYH 1MPBA 1IXRC 5J8FA 2CMOA 1LB2A 4R6KA 2VXZA 3HSFA 1LDJA 3H6VA 4GXSB 5FTHA 4ZEBA 4C0RA 3FVGA 3KN8A 3BY6A 1HKQA 5K1YA 1FQAA 5ICQA 4LFUA 5FGMA 3S9EA 4LLLA 3H06B 5CI5A 4G7OF 1J75A 1IAWA 2OA4A 1IN6A 3FUZA 2JRTA 3LA7A 3OENA 2R9JA 3VLUA 5CLSA 4H65A 1HSLA 2XXUA 2GWRA 3E97A 3WAEA 3KSJA 2BE5F 3MAJA 2MH2A 5HLHA 5E8IA 1ZREA 1LFGA 3K00A 5KZTA 5BMZA 2FU4A 2F8DA 3IOWA 4YFNF 4KFCA 3FVKA 1QUKA 3SXYA 4ZEFA 4GO1A 1P6RA 1A55A 1IXSB 2HDCA 5I57B 1W5SA 1XSDA 3MVWA 1IITA 5FFZA 4MGRA 3MUQA 2I3VA 3GLBA 4AB5A 1E17A 5H8HB 3FJGA 3PUVE 2QUFA 2HAUA 1MJAA 3DLNA 3T66A 1QQIA 2GFEA 2XX9A 4LQ2A 1H44A 4I9DA 4LZ7A 1P92A 4NF4A 4YB7A 5HPQA 1FOKA 3LWFA 3VDFA 4S04A 2KIFA 2Z33A 2IPQX 3GFIA 1ATGA 5HLGA 4WCGA 3J81Z 1SYIA 4ZZDA 1MZBA 4MLVA 3ULQB 3WODF 4DXCA 4MNUA 3KN3A 1B1XA 1QVSA 5IT9Z 4P0GA 1PDAA 4PCQA 3HCQA 2VE8A 2KRFA 1IN5A 4QFNA 3EYYA 3D5LA 1URGA 3K02A 3F6OA 5JK4A 1MRPA 3QPTA 4YIIA 5HLIA 4POWA 1UCRA 5E20A 4BDLA 4EJWA 4WXDA 3J81K 1PB8A 4R9GA 1TFDA 1M5CA 2GH9A 2BGCA 3V7RA 3QAHA 3QK6A 2DK8A 3C7JA 1M5FA 1ZTYA 4BDQA 4F22A 1ZKBA 3UIFA 1VE4A 2STTA 4X48A 1TW3A 3H6UA 3IJOB 4IGRA 4NWCA 1LAXA 1Z9CA 3F6VA 3U1DA 4NEDA 4C1UA 2G7HA 1F5TA 1I6XA 4GGGA 3RT6B 1MD0A 3HYIA 2EV5A 2K4JA 1I6QA 3EPEA 4GWOA 2NWJA 1D9VA 2R7DA 1ONVA 1FSHA 2LNBA 2Q2EA 4U0WA 2Y84A 3PMVA 1QO0D 4DCYA 3K9TA 3S9LC 2I4BA 2RCAA 2V79A 4F31B 1JW1A 2A07F 2YR2A 1MQJA 1UQWA 4RNSA 3TQNA 4PFWA 2VC0A 3CUQC 1LFHA 1WVJA 1TNSA 1P2FA 3RI4A 2QS2A 5D8KB 1D4NA 5L3DA 3CJNA 2D21A 2B0LA 4KYSA 2O84X 4RB1A 1AL3A 2O6AA 4LB5A 2LKPA 1B5JA 4NB5A 1SFUA 4HA8A 4OFLA 3Q29A 4FJPA 4G6QA 2J5OA 4ZZEA 3M3FA 2ZXJA 1V4RA 1FBSA 1Y4CA 3RLFE 3W15C 3FHZA 2CSOA 4U7DA 4IO3A 5I2NB 1RUNA 4KHZE 1REPC 1SBPA 2QQ9A 1Y20A 2F5CA 2UXNA 1NMUA 5H8FB 1ELJA 2D45A 4RGUA 6PAXA 1EU8A 2M8CA 4PFYA 5TP9A 1BIYA 3H92A 3TUSA 1G3TA 3KFWX 4QLCU 2OZUA 4F3BA 1JQFA 2FNAA 3W6JB 1USYE 5ILUA 1OYIA 2DXRA 5BUUA 2Z8EA 3MZYA 4H0EA 4WEPA 3ELKA 1OQGA 1D8JA 5F64A 2LAOA 4I0BA 3FGSA 3H3GA 4OENA 4I2OA 5DEXA 4HX7A 1HW5A 2K7LA 2P6SA 1A40A 3IO6A 3OO6A 1W7PB 4JQFA 2THIA 3N94A 4ESBA 4NF8A 3E5UA 2F6PA 1BM9A 1S3JA 1R36A 3FV2A 1BI3A 4G8MA 2OD5A 4B8XA 3SHFA 3KP5A 1QUIA 3MBPA 2WWYA 4MTDA 4R74A 4K3FA 4ZZAA 1YW7A 2A5TB 1T6SA 3TCHA 3VVDA 3WTSC 1IXHA 2UYFA 4EM0B 1B6AA 1TQPA 4M6YA 4HBLA 1I1SA 1DOTA 4YFKF 3N5LA 3O2AA 2MLKA 3E6MA 2UZKA 1B3GA 3P9KA 3ABUA 5J8CA 1FNNA 1B0LA 1HQCA 2VBWA 2F7AA 1TQIA 5JHUA 1SW5A 3HOTA 1FY7A 4JK1X 2RCBA 2H5YA 2ZYKA 5CMKA 4OINF 2NS0A 1PC3A 1FT9A 3HOSA 2BBYA 1JW4A 3BDDA 4LATA 1EH3A 2XX7A 4BAYA 3O29A 4BHPA 3K2DA 1P1OA 2XV4S 4TLLB 3SETA 2OWSA 2IA4A 4HF0A 2FF4A 4OXVA 3QP6A 3FF5A 3MCZA 1J5YA 2PLYA 2GXGA 3E3VA 2RINA 1IUDA 3IJXB 3Q26A 4H1XA 1BI0A 2VOZA 4D0PA 1PDNC 2DP8A 5CVIA 1R58A 1D3KA 1II5A 2ZO4A 1P1QA 5LOMA 4ENJA 1G3SA 4U7BA 4LP2B 1DPPA 4OIOF 3SDFA 2H6CA 1PEBA 4IO7A 3UP9A 3O6BB 2O7IA 1S7YA 2Y7WA 3MAMA 1SQYA 4A12A 4OERA 1NKXA 2KJBA 5ICTA 4L9JA 4BHBA 3H6WA 2VBXA 3T1BA 1WODA 3F11A 3U8QA 4L5JA 4M4GA 3GFJA 4WK8F 2I48A 2H27A 5CJ9A 3TQLA 3BBRA 3P7NA 1SW2A 2EA4A 1QNTA 5D5WB 2ZBKA 2XIGA 2XXVA 2ZMEA 1BI1A 1XD7A 2ZJ2A 2ALUA 1S29A 1N3WA 4HF2A 2K02A 2RC9A 1ZRCA 4EVIA 4EGZA 4WKMA 1LDKB 5K2YA 5JEIA 5FTIA 5CC2A 4HOBA 1EZPA 2DYXA 5CBRA 2Z9OA 2DFIA 3MC2A 3RKYA 3GXOA 2OLBA 2NXOA 1OVTA 4OQOA 3DP7A 3K69A 5CVUA 1MDMB 1O57A 1UTHB 1QBJA 1STZA 3PPOA 1JHFA 2F35A 1B1HA 1PBPA 3N4MA 2O6GE 1P4AA 3GFMA 1QW0A 4LMYA 3F8NA 4L18B 3OO7A 3F8CA 5A2QK 3B6WA 4ZEKA 3EQLF 5H8NB 4AIHA 4I98B 3O3KA 1B7HA 4G77A 2GAUA 4Y13A 1BIAA 3E13X 2Q9TA 5IAIA 3OV8A 3ZMSA 3WGIA 3I53A 1XSVA 3QIMA 4OIPF 2GQQA 2Y75A 1YIOA 4P5OA 3UN6A 2XRNA 3O97A 4KICA 2FNPA 4PE5B 1Z6TA 4GL8A 4JBAA 3HHHA 1UB9A 2RKMA 2Z5UA 2V93A 5ERIA 1ZJLA 2L02A 1J1NA 4HDUA 1MXWA 2ETHA 4WXCA 2L3DA 5DDGA 1U5TA 1ZH5A 3GVAA 4CO8A 4YU0A 3SEYA 2OBGA 2Y7PA 1I6BA 3LSLA 5L9MA 1MGTA 1Z7UA 3PFIA 4RA1A 5EHMA 1FQCA 2HGCA 4HZFA 1LAFE 2BEOA 3OD7A 3L00A 4I8CA 3EHTA 3K01A 1SD7A 5K5RA 5DCMB 2VOPA 1MM6A 2QWWA 1HW1A 4KT5C 4EMSA 3FV1A 1YO5C 1ZIUA 1JVXA 2DQVA 2Q2AA 1ZBMA 4MLQA 1I1GA 2XXTA 4XTCQ 2XKPA 4A5NA 2GIVA 1U3EM 3RYRA 1O3QA 2I49A 3E6BA 4CDGA 4H6DA 1ZHFA 1POY1 5H8QB 5JTYA 3Q9VA 2PMHA 4X1DA 1WI9A 3DKWA 4PZJA 3V83A 1RKMA 2Y7RA 1XGOA 1W5TA 5ICFA 3JZJA 5TPAB 3V7CA 1F4KA 5AA1A 5EEGA 1MQGA 1L0OC 4EGYA 2XXRA 1ZLQA 2DTRA 3MP6A 1CE2A 2V3UA 3IO4A 3BPVA 2KLFA 3C18A 2HZLA 3FM3A 4IRGA 4R2FA 4QHQA 4CYDA 2NYXA 5L3BA 4NQWA 4F1UA 4UVBA 4F1VA 1JNFA 4L0YB 1Y3QA 3KEIA 2QBYB 3R0JA 4GIZA 3ILUB 1JVYA 3WE3A 1XC1A 4O3BA 1A8FA 2Y7KA 2RKHA 2NOOA 2XAJA 1Y1MA 3I5OA 3F8MA 3IOTA 3RN8A 2QS3A 4ENKA 5I59B 1J59A 1FPQA 4G8XA 1OQHA 3BJAA 3A3UA 1NNFA 5K5OA 1TLHB 1P4XA 2V25A 4OEVA 4ESXA 1SW1A 3OEMA 1F1ZA 1R6ZA 4OTEA 3KP7A 4XKRA 3FXQA 2ACJA 4KIGA 2GRVA 3MZBA 4FE8A 3IOUA 4ZYEA 3S9MC 2F5XA 1OPCA 5I2NA 2E0SA 3TODA 3NEUA 3WU1B 4ELQA 4GFRA 2ISYA 2QMWA 1TXFA 2E7XA 2K86A 4MTEA 2GA2A 2XXQA 2A61A 2PBWA 4DNCA 1HKSA 2CQKA 3IWFA 1FTJA 4U0VA 5AIQA 1Q1HA 4KI0E 3RDIA 5E17F 1Y0UA 3I59B 2Q88A 2NAZA 4YKJA 3EYIA 2MLGA 1B5IA 2ZNUA 4HCWA 2RV8A 1TQMA 1N84A 3CTAA 4Z0IA 4EJVA 2F97A 4IXAA 5HS9A 5FO5A 4EXKA 2XHDA 4IO2A 2L01A 4H67A 4AB6A 3TTLA 3H3UA 3F3XA 1BC7C 1M5EA 4L9VA 2QL3A 4L9NA 4H5FA 3L09A 3FWEA 1W7PA 1P4WA 1B1BA 2D1HA 4IHSA 4F18A 2ZMBA 3RT8A 4KA4A 1DUXC 2A5TA 1XVYA 2XUBA 5DVJA 5J6XA 4PFUA 1Z7NE 1RI7A 2DU9A 3ZMVA 2RGVA 5I84A 2KIUA 2ELHA 1MS7A 1XOCA 2IRFG 4LJZF 1EV7A 1D8KA 1EH6A 2GA1A 4RAZA 4BDRA 3IX1A 1JXSA 3B6QA 3HHFA 4MQ9F 4JB7A 2Z3YA 5LHHA 5ICCA 5BOXA 3FD3A 3O28A 4GF8A 3CUQA 4DZ1A 1YS7A 1R5HA 1T98A 4NHJA 2UXXA 1TTYA 2M45A 2FE3A 4IHTA 1H45A 3MZHA 4EUOA 1YW9A 4M9SA 5LRRA 4EQQA 4RB2C 5FHOA 1Y3NA 4G9YA 1B05A 1ZGAA 2G7UA 1WQ2A 4S05A 3WTTC 1XHYA 3ODBA 4OEUA 1Z05A 1KU7A 2HFBA 5I58B 2A3SA 2DWHA 3S4UA 4G68B 4GLIA 3VFZA 4M6XA 4QFPA 2E1SA 3GZ6A 3WAFA 3HRTA 3G3ZA 3V7SA 2TDXA 3ECHA 2HTJA 2P4WA 3G3KA 3IHUA 3GBAA 1S6LA 4HCYA 2DO7A 2FOKA 3O6IA 4EJTA 4O3MA 4KN4X 5HDKA 1FYKA 3KP4A 1R1NA 2HQ0A 3TAJA 1A04A 2CFXA 5HDNA 2DVZA 3ONMA 2W24A 5ITPA 3D4CA 4RXLA 2MC3A 5AA2A 3MQ0A 5CRYA 4OHNA 2EK5A 3H3ZA 4N9IA 4ZS9A 4BDMA 3SZTA 4M72A 3WTWC 4EF1A 2O68A 2AIXA 1B3FA 1RYOA 3IB0A 3K6UA 5KDTA 4R6HA 5E1ZB 4LGWA 3P9IA 1O3SA 1B52A 3C1DA 1MDP1 3T9HB 3Q25A 4O6JA 2DPDA 4OFJA 2LF7A 5I2KB 3GZ5A 2M5WA 4NF6B 1GHCA 1MY0A 4I1DA 3TGNA 4HS7A 4ND9A 4PETA 2AL4A 4ESWA 4GYGA 3ZQ7A 1AH5A 3RUMA 4FX0A 3E6DA 1MJ9A 1HSTA 3C4MA 4IO5A 2GXBA 1FW0A 5IT3A 3IL1B 2VBYA 3E6CC 1XT8A 1Y1ZA 5F7VA 3C33A 1B4ZA 3T9VA 4ASNA 4ZE8A 3TPAA 3BWGA 4QSCA 3KP3A 4F3GA 3OXNA 4BDOA 4RPNA 1JEUA 4LZ5A 3RPQA 3DP4A 1OMPA 4UVCA 2C6YA 3T9XB 4EF2A 1BN5A 4IY5A 3HO7A 5IT9K 4FIMA 4Q4ZF 3IAZA 1FQEA 4RGXA 2ONRA 1N3XA 4PFTA 1SFXA 3TDUC 3HHGA 4U23A 1FLIA 4BDNA 2L54A 4OIQF 5CVVA 1S7AA 4AWXB 4YFXF 3MW0A 1TNTA 1URDA 3VVEA 5LGUA 1NNKA 2GHBA 3MPKA 2WTEA 4Q30B 3NQOA 2VE9A 3U1OA 1HBXG 3LFKA 3K1NA 4A5MA 1FQDA 3CFZA 1S8NA 4KCDA 4OYVA 1SD6A 3F8FA 3MPLA 3W6KB 3PPPA 4DLDA 2DWJA 1UFMA 4XKQA 3C3WA 2REJA 4QFOA 5LGTA 1LSTA 3QXMA 1O3RA 3B02A 3QPHA 3VODA 1Z91A 5H8QA 5FFXA 2I3WA 2DBBA 3IKVA 3RTRA 1F9NA 3PQKA 3C35A 3FMQA 5E1XA 1DDNA 3VV5A 5E8GA 2I58A 3TYHA 4FEBA 4MBPA 1MXUA 4M74A 3LSWA 4Q5TA 1I27A 1IRFA 2CG4A 2RC7A 5LEKA 5ILSA 3SFZA 4X1BA 3C34A 2V1XA 4HX8A 5IKBA 4O5VA 4UV9A 4U1OA 5FLXZ 3H4ZA 2E1NA 1A8EA 3KZZA 3RGYA 5KCJB 3RKWA 2EJRA 3T9UA 2OCUA 4N13A 2FA7A 5DUIA 3PGFA 1B9JA 2KJCA 1LGBC 3FZVA 2O61A 1MXVA 3T96B 1FTOA 1G6NA 4RAYA 5EYFA 1O7LA 4WEDA 2PYYA 4ETSA 1EZ9A 4P0IA 1N7XA 1LEBA 4KYDA 2Q8JA 2MA3A 5FD6A 5FLXK 5ED4A 2ONKE 2YLNA 4U0YA 3ABTA 3ZMDA 3OELA 2XASA 1SD5A 2VT2A 1LNWA 1QKBA 3OO9A 4L0ZB 2UXAA 4TQUQ 1H3DA 4POXA 1MH3A 4GCVA 1R9QA 1YFHA 2QPQA 4NMYA 4RB3C 3GYHX 3CDHA 2HZTA 4G94A 3TDZC 1DMBA 4F39A 2XXXA 2DWAA 2DQRA 2LDUA 2F78A 1Z1DA 2NVUB 5TRDA 5FHMA 2R71A 4R1HA 4LG0B 1FTMA 5D4RA 4LQ5A 3KG2A 3FIRA 2RVCA 2ZNTA 3I59A 1KU2A 2ZNYA 4L9TA 5LLQA 4LLGF 3RKXA 4NF5B 1N76A 2HTSA 1P99A 2EFNA 4QRZA 2H98A 4U4XA 1FC3A 4ZH4F 1P1UA 2ANJA 2QYOA 3OSQA 2MBFA 1EH7A 2DWIA 1OVBA 3K6XA 2V3QA 3K4UA 1SYHA 2HCAA 5ITOA 4IJAA 3ZN1A 1OLCA 2UVGA 1OR7A 4EDPA 3JAMZ 3VB2A 1GXQA 1CF7B 3UGWA 1T0FA 1RYXA 2JSCA 1XCBA 1A54A 1TFAA 2A69F 1ZLKA 4U4SA 1CGPA 4LLNA 2HQNA 1SAXA 3FM5A 3IK6B 3BOQA 2DE2A 4YKPA 3LQRA 4GL0A 4FATA 2O03A 3MEXA 2MH9A 1BKAA 2ESNA 2HEOA 1Q1KA 3HSRA 3TQWA 3KJ7A 2KIMA 1PP7U 4GYIA 3L6HA 2XKOA 1FSEA 1YAEA 5HS8A 3JAMK 3HSTA 3IWZA 1B3HA 4ZE9A 1XGMA 3D0SA 1QZYA 4G7HF 4ZYDA 3QU3A 3V89B 2QVOA 3U94A 4UUVA 1ZAOA 4ENNA 3CUOA 3MZ9A 2K4BA 1NFTA 2H99A 3VXCA 2JPBA 3QUJA 1MPDA 4GXAA 1LDDA 2QRYA 5DUKA 3QP5A 2DE3A 2AL5A 3RJPA 2DSFA 4ZDMA 4F3PA 3KJTA 3LSXA 4Q47A 5HS7A 3KZGA 2FRHA 3TTKA 1XN7A 2IJLA 2PMUA 4XBFA 2B3FA 2QS1A 3TO9A 5I56B 3IL2A 2R6GE 2VP1A 3K6WA 3QUFA 1US4A 5B7DA 2NUVA 1W7PD 5I58A 1FWZA 1XCVA 3GEZA 2XAFA 1LVAA 3CI8A 3R26A 2VD3A 3FMSA 3H7MA 3M3KA 3BJOA 2EB7A 4G68A 4F29A 3B73A 1L5TA 5AA4B 3KP6A 2ESHA 4LUBA 3MWMA 4YB6A 3I64A 1K7AA 1XVXA 4Q0CA 3KZYA 4BNCA 4JSOA 2PMSA 4KYEA 2YU3A 4IPAA 2I6EA 3DF8A 3V8JA 4PGGA 4FT8A 4QFLA 2Q8KA 4XIGQ 2F7CA 4IGTA 4A6DA 2FNCA 1A99A 4HQEA 1TBXA 2ADUA 4A6EA 3PU5A 3G3IA 3RNNA 3E5QA 1G3WA 3UA8A 1DTGA 5I57A 2V6CA 3C31A 2HYGD 4H8IA 3T93B 2F5DA 2VHAA 2A5YB 3Q9SA 4F7ZA 3Q5FA 2YPRA 2XX8A 1KU3A 2HQRA 2HKOA 3MP1A 1M5BA 4H8JA 4ECFA 2F2EA 3M1EA 5L3GA 2BJJX 3QSLA 5H8HA 2XAQA 4P55A 3SQNA 1RUOA 2STWA 2PFBA 3LSTA 2P7CB 1ZRFA 1IIWA 1V3FA 3FJ7A 1I69A 3LBSA 4OZ9A 5M2VA 4OOIA 5I2KA 5CBSA 3V4GA 2OK2A 2FBHA 3USDA 1A7LA 3WGHA 4DQ2A 4FORA 2DK5A 2Z8DA 4YMAA 2ZCWA 3R6UA 5BPIA 2IW5A 3Q28A 4R6YA 3ROUA 2OBPA 1I5ZA 2JTVA 2X0LA 2QSXA 4PQJA 2W84A 3CG3A 4UHTA 1OIBA 2HXWA 4M9ZA 1LEAA 1PB9A 1WWXA 1MQDA 2P8TA 4UV8A 2GZWA 3IC7A 1ZG1A 3TKDA 2YJPA 5LGNA 1UTBB 3IORA 2Q0OA 1KQ0A 1ZG5A 1B32A 2DLLA 1BBYA 2LF8A 5CVRA 1ZARA 3DPTA 2V9VA 1YCJA 3ZPLA 3GLXA 1FYLA 1S50A 2CWEA 2PJPA 5AA2D 4AIJA 3DM0A 3F23A 2I0CA 1JW5A 2H94A 1AIVA 1JETA 3LQQA 5H6RA 3VOEA 2Y0MA 2P7VB 1VFDA 1HW2A 1NH7A 4ENMA 1DTZA 3WTVC 1N7WA 3SKPA 1OYWA 3NRVA 5D6FA 4U2RA 1USSA 2XXIA 2VGQA 1SDXA 1K78B 2A68F 3KSXA 2A5SA 1LFIA 3TO7A 1R9LA 2ZKZA 2IVMA 1YYVA 1PBQA 1LJ9A 4FX4A 3GBBA 1T2KA 4FHTA 4JXIA 2LSOA 1QUJA 4ELRA 3M8UA 3L9FA 4RK9A 2B3BA 3E4RA 3ZP5A 2H09A 4F3SA 4U22A 2UYEA 1GXPA 3PUYE 1BJAA 1U78A 1O7TA 4HQMA 4E70A 3G3HA 4GVOA 3IB2A 1GGGA 2CGPA 3RTFB 4KFQA 2P0SA 4PDKA 4XLPF 1ZYRF 2AS5F 3AAFA 1LBBA 3PPQA 2DI3A 5B70A 1I6AA 4JDFA 4ZYHA 1IW7F 2XAHA 4CGZA 1SD4A 4JWXA 4G68C 4YB5A 5H20A 2YSRA 2CW0F 5E18F 2J5PA 1O63A 2D5WA 4G2ZA 4LVQA 2FYIA 1GVJA 2OZZA 3BJ6A 1LAHE 2PT1A 2F5EA 1B0HA 3D4GA 1ON2A 4NF8B 1NHAA 1AOVA 5H8FA 4MHGA 2PEXA 3JV9A 2IT0A 4KIFA 3N97A 1IXIA 3T8RA 1FBUA 1R1VA 3ZKKA 1JHHA 1VFEA 2Q2CA 4F19A 3LA3A 3B7DA 5DEQA 3CFXA 4NTLA 1B4HA 3TCFA 1B4AA 4Q8RA 5F1RA 4MFIA 1BTJA 3EDPA 3FASA 3EQ1A 1FZPB 4AQ4A 3HIFA 3WG9A 3ZS6A 4I02A 4KUMA 1HXDA 3U93A 1R7JA 2EFOA 4ZYGA 3PUXE 3WU0A 4O3AA 2OQRA
chains in the Genus database with same CATH superfamily
2ZSIB 1SMTA 4JYKA 2KRHA 1QU3A 4C1TA 1XDUA 2JSPA 5DCFA 1DPRA 3KN7A 3PMXA 1XPXA 4YRVA 1SD3A 3O6HA 1XDSA 2VQHA 3UORA 1TT1A 2DDKA 3S16J 4EJOA 4RK2A 3ZN0A 1FPFA 2FMLA 2ELKA 1IMEA 3L2CA 3K0VA 1ZGJA 3HSEA 4ON0A 3FXMA 2L7FP 1WJAA 2PX1A 3TTRA 3HUGA 2VD2A 3H6TA 2EA2A 4M9XA 3ZCOA 1MY4A 5DS9A 4CHUA 3S15J 3L7WA 1O64A 5ICGA 2FQ3A 1LQ1A 2P5LC 4YAHX 2D2WA 1WJ5A 2HKXA 2L9VA 4DE8A 1GVDA 2L9RA 3BP8A 1FOWA 4LG0A 1F43A 1B7UA 3I4MJ 2H1LA 3MKWB 2FMYA 3FX3A 5LBQA 3LSRA 4WXHA 3J7AO 3QYEA 4PJJA 1KZ8A 2DS9A 4FAJA 4I7HA 4PSWA 2FXAA 4AVPA 5JR3A 4UVAA 2XX8A 1QPMA 4A0YA 1E2XA 5K7ZA 1VQKI 3CDIA 1K79A 2MG4A 2HWVA 4G7ZF 1GR2A 3S3NA 2LRDA 3VPRA 1YJNI 4R75A 4B3XA 4LK0F 3TCGA 1A35A 2GOXB 4DDDA 4HLYA 2YS9A 4QSHA 1YHQI 3K7AJ 3COAC 3MD2A 4ZTFA 5L3CA 4F1YA 1FTTA 1V5FA 4R8HA 3DV8A 3CCRI 1R00A 1IUYA 5J1RA 2AO9A 4RJZA 1B58A 2MABA 2PT2A 1HCRA 1B46A 2F4MB 2V7FA 1CF7A 5KVRA 3WTXC 4JP0A 3FXBA 4ISUA 1WDNA 3DP6A 3EUHC 2B9SA 2OQGA 4YICA 4RMNA 3TL4X 2ISZA 3H36A 3PD9A 4ELPA 4Z7EA 3PNYA 4XQFA 2COMA 1JKOC 3KP2A 1NNTA 5L9OA 4BE0A 4G61A 3ZQGA 3C36A 4EQ7A 5HNFA 4YMBA 2HDDA 2L7MP 2P6TA 1G4DA 4UACA 4KPTA 4XLNF 1FJ9A 4YKKA 1JE8A 2RN7A 3ZKLA 1XI6A 4P96A 1PP8F 2FBKA 2L4MA 3A3CA 3IRRA 2VXDA 2REGA 3SEUA 2ZMEB 2G9WA 2O0YA 2RC8A 3LAJA 4OETA 4XLAA 4XSXF 5M5WJ 1LLSA 2PQ8A 4BQAA 2YPNA 4OVRA 1OLTA 1PUEE 3K0LA 1IEJA 2HEUA 2I4CA 4U87A 1POTA 5F04A 2HQ5A 3ISPA 5J47A 3K4LA 4G12A 4XSZF 1RESA 4E7IA 3DP8A 4GBWA 3BG9A 1I6HJ 3KYCB 3VYRB 4A3DJ 2IGOA 3I58A 4NNJA 1XC5A 2N8GA 1UAAA 2O8XA 4NUBA 4GRKA 3K1MA 4RLFA 3OS2A 2Z16A 5JLXA 4K2EA 3TKYA 1XS5A 4BHCA 1ODDA 2VPRA 3OMYA 1LB8A 4N17A 3MWBA 3DTEA 1U8RA 1B51A 4RYAA 3MVYA 4IR8A 4KISA 1M5DA 1MY3A 4DI3D 5I56A 3TTNA 2WADA 3T0YA 1A6IA 2X7QA 2IS2A 1OMIA 3H5AA 3RZOJ 3VEPA 1EYJA 2ONSA 2XF6A 4S0HB 1NV0A 3FATA 3J80Z 1YS6A 5LFAA 4X0GA 2V4JC 3K6VA 2NNYA 5D6EA 5EHSA 3FK7A 4HLXA 2Z8FA 4LB6B 3LR1A 3MJNA 4OMZA 2M8EA 5LHIA 1LAGE 2QVUA 5DTBA 1IN4A 2R7XA 5EEHA 5AA4A 3P7IA 2Y9YA 1MDMA 1UTHA 3RY3A 3IV5A 2X26A 1PVEA 3OYCA 3W2VA 3OYEA 1KYWA 3ZQQA 1FP1D 2HAVA 2RF1A 3E3KA 3DKXA 5DYHA 1FJ6A 3DXJF 5DD4A 5J1DA 4EJUA 1P1WA 1U5TB 2FOWA 3CMYA 1VTNC 1O3TA 4EM2A 1FPKA 1FQBA 3GTLJ 2V84A 5FHNA 4QIWN 1YPNA 5CYVA 1EA3A 1USTA 1NTCA 1QZZA 2I5UA 2NRAC 1YTVA 1XTAA 3PD8A 3J80K 5H8NA 5A5LA 3JTHA 3JSPA 4CYCA 1D0XA 1H9TA 3HRUA 3M9AA 3KBRA 3MSTA 5CVJA 4PFBA 1X4OA 2PG4A 3PPNA 1MMGA 4DZJA 3R60A 4P9FA 2JT1A 2ZFWA 1KGSA 4R72A 1NUYA 4OU0A 4UXNA 4ITVA 2NOJB 4M71A 3LUYA 4BS9A 4E0WA 1X1DA 3OEKA 5TJJA 1LFBA 1J7KA 1O4XA 2PBIA 3A01B 2O5RA 4X6AJ 4DW6A 2HXRA 4Q5SF 3I54A 2K9MA 4LD5A 2YX7A 5DM6F 2XC7A 4IOCF 4U1ZA 2XHKA 3DEEA 3I3VA 4IO6A 1ZG3A 3CLOA 2F7BA 2CZIA 1IN7A 2VONA 2PFYA 2EV0A 1K6OA 4P11A 1MM7A 5KK1A 1XSXA 1DCUA 1UIUA 4JWYA 1B9NA 1WFXA 1Q35A 1BC8C 5E79C 4PBHA 5BWJA 1WJFA 4N6PA 1X2MA 5JTYB 2XGDA 3PV0E 1FOXA 2WEFA 4U88A 1ANFA 3SEXA 5FKOA 3SDBA 2HOEA 2JQ7A 1S7OA 2M7BA 4XN3A 2DE4A 4OIRF 2BW3A 1FPGA 3GTMJ 2ICWG 2OJED 1D9YA 3CIJA 2ZYMA 1SANA 2KISA 3FJMA 3G7WA 4G8HA 5DCMA 2H25A 3OR2C 1Y4TA 1BLFA 4KR5A 4L5IA 2LKXA 1LBYA 2X6XA 1UHMA 2PI0A 2Z1DA 4R79A 4R2BA 4ZDLA 1LCTA 1Y8QB 3GF2A 4CZZA 3CRBA 3LA2A 4CSWA 4FETA 3VE1B 1FQFA 4IY6A 4XKNA 2EFWA 1N0TA 2XROA 2V1UA 3AXFA 2WC2A 4OFOA 3CSGA 5D4SA 3S1MJ 1B40A 4PAKA 2AXLA 1PUFB 2KFDA 4G6DA 4JWOA 3KOSA 3DCFA 4NQWB 4ZZLA 4KD5A 3KETA 3VSLA 2E1CA 1EH8A 2CYYA 4KIBA 2ZNZA 2XWIA 1T0KA 3KOTA 2JJ7A 1R22A 2WAQA 2K5CA 3FXLA 4N4OB 4CCNA 1W36C 2JA6J 3CCYA 4OESA 4E0XA 1IV6A 4N15A 3CO6C 4DXBA 1MBFA 3AL0B 2VBZA 2LD5A 3OSFA 1H76A 2ZXTA 1B5HA 3MQ9A 4N91A 5TPAA 2DVCA 4ZEIA 1OKRA 3O6GA 4GOTA 3E5XA 3ZXSA 4OWRB 1Y0NA 4YIFA 1XMAA 4EXLA 3FXOA 1JT0A 2XF7A 1UZCA 1B7ZA 3T8TA 1O7FA 4P56A 2EZLA 1CB6A 1UHWA 4XN0A 2QLZA 2WV0A 4E7SA 3WTUC 3C9HA 1E3HA 2VJJA 1LKXA 1FTLA 4M1VA 4MH5A 3GWZA 2FA5A 1WRJA 1HSJA 1MNDA 2OZ6A 3ECOA 1S9TA 4I01A 1K78A 1UIVA 3S2WA 3CP2A 3BTCA 4RAGA 3RYPA 3Q0UA 3M8FA 2M0MA 1R9TJ 4A3IJ 1OCTC 1FRPA 1OCRH 3JW4A 3CSBA 3G3GA 1B59A 2QBYA 3DBHB 2XAGA 3CMMA 2MD5A 4TLMB 2BVMA 2X1EA 2XGCA 4DXUA 2R7UA 4X9TA 4LK1F 4RY1A 2H8RA 1Z77A 2COBA 4C3HJ 2WKYA 2LBFB 5D5XB 5DT6A 4HE1A 5LRSA 3G1OA 5DTDA 3GXAA 4NE4A 3RTWB 3R61A 1KQ9A 1N25A 2NNNA 5I59A 1H9GA 3PUFA 1LCFA 2JA8J 1R5GA 1K4SA 3EF7A 3DEUA 3HFUA 5L3FA 3KEQA 5FROA 1FPJA 1MH4A 4PTKA 1DPUA 1IMDA 1US5A 2RREA 3L1PA 1Z6RA 5ICEA 3BG6A 3PPRA 5AA3A 1MQHA 3IH2A 2XB5A 2DA2A 5EJCA 1YLFA 3QU6A 3K70C 1AWCA 3OYKA 1DP3A 2UVJA 2Z22A 1FTAA 3L6GA 4PDDA 2NS8A 3S2VA 4LONB 2QENA 2A05A 3H03A 3DPLC 3RCOA 5EF6A 4A2UA 3JRAA 5H8SA 1KZHA 1ZU0A 2E1MB 1B9MA 3VVDA 2F34A 3GBGA 4ELQA 3BR5A 2M4GA 4Y15A 3I9V2 1LE8B 3A1YA 1MDQA 4XKCA 4O7IA 3HTSB 4KCCA 3MVXA 3FXUA 1T38A 3RQIA 3WTYC 4PJMA 2CQ7A 3LSJA 4MEXF 1HKTA 2XGXA 4IRIA 2KL4A 2DOEA 5I7IA 3TEPA 2BV6A 2R8TA 1N04A 3MZ1A 1XMKA 2KIQA 2QZ8A 2BY0A 2GHAA 4MNIA 2W57A 1NV3A 3S9NC 3CD6I 4DIQA 1DGWY 2LP0A 4YKIA 2R3SA 4IB2A 2RC4A 3SFIA 1KA8A 4A0ZA 1NL5A 2DJNA 3KGCA 4OAZA 1FYMA 4QSEA 3W9WA 3M7GA 3CVGA 5AIPA 3HOUJ 1JUSA 1B2HA 4AIKA 1W0TA 5F24A 3IR1A 4GD5A 2KP6A 2LVSA 3KE2A 3U92A 3JTGA 3LOCA 4MF3A 5CM6A 3E9XA 5D5UB 3IAS2 3E79A 2PJRB 3MP1A 3FVOA 1FX7A 3HTUA 2AHQA 2H6BA 5HOOA 1IXGA 1H43A 3B6TA 3NAUA 5ISUA 1BIBA 1NK2P 1M1EB 4IQJA 3L2UA 5FKLA 2M87A 5A5XB 3R4KA 1ORKA 1QGPA 2EWNA 3GTKJ 3G73A 4KMFA 3P9CA 4TOZA 9ANTA 2P5VA 4L17A 3ABKH 1F9BA 3N6UA 2VC1A 5J4VA 4OVJA 4D7MA 3BROA 1W4MA 3I0TA 1NV7A 2G93A 2WB1A 3L2WA 3HXLA 3WE2A 3CUQB 3K10A 4DJAA 3CC2I 4UNOA 4A3KJ 2EV6A 1PB7A 3MVZA 4MCOA 3UKGA 3SZPA 2WYKA 2XWVA 1IXCA 2W25A 2B65A 5D8LB 1J0RA 3AG4H 4NG7A 5KAFC 4PP0A 3B6AA 3T5XA 2WBMA 4PFPA 4IF4A 3WG7H 5JVTA 1MJBA 2O8KA 1AWBA 4U21A 2PMZN 3R0AA 3LSFB 4OANA 2R0QC 1I3AA 2LH9A 4KQPA 1MG1A 4PJNA 2A6EF 4HX4A 3IRQA 2DW4A 5C4JJ 1QULA 2OWTA 4RGSA 4CCLA 1P1NA 1XB4A 4GXOA 4XXUA 1D3YA 2L4AA 4IHXA 1SMYF 2ELJA 3CG1A 2Y48A 2O3FA 2MYSA 2M30A 5FKKA 3T22A 1BOAA 1EF4A 4DIGA 2A6HF 4I76A 3D1NI 2VOOA 2CZLA 1G0HA 1MSEC 1SAUA 1GLNA 3C2BA 2W00A 4EM1A 1JGSA 2ZNSA 4MEYF 4I99C 3TOAA 2H4IA 2YX4A 3DELB 3DLAA 4HE2A 4KDPA 1ULYA 1KU9A 4N07A 4OMBA 1V55H 2XVCA 4AD9A 3N26A 4AYBA 3IOVA 3WTZA 3OOAA 4PFOA 3JRHA 5EQ8A 4MFEA 4TV7A 4XICA 5CMCA 2DFHA 1A6QA 3MP8A 4KJZA 4BY1J 3QRFF 2DXIA 4DYQA 2E5NA 1FBDA 1NH8A 2QMXA 5DW8A 3F22A 3N6TA 3DPUA 4IO4A 1D0ZA 4L5EA 4HSTA 4BXXJ 1QGXA 2DMUA 1OYYA 3KFMA 4JSDA 1WKMA 5DVIA 3G3JA 3VWBA 4ESFA 1XGSA 4MMPA 1SFEA 2F5VA 3TDJA 1TW2A 3M8EA 1JKRC 2XXPA 2AQEA 3I4PA 2E2IJ 2IEKA 1VR5A 4ZZAA 2CQQA 2DFFA 4A0XA 3OSRA 1K9YA 2V3TA 1LBCA 3VVFA 5CMMA 2B7EA 3HC7A 3SEZA 2EFPA 3F8BA 4RGRA 3K4MA 1MW7A 3G1LA 5AA2B 1L3LA 4OMYA 2P3NA 3EN3A 3OL4A 5HVQC 1IRGA 2P1SA 4YZZA 1GVCA 3DU5A 2QS4A 4JBZA 2Y0SN 3D5RC 4AS5A 2ABHA 3H0GJ 5EQAA 3U72A 2BYVE 3D5SC 5KDTB 3QYTA 4IHVA 2QM3A 2QFLA 1U2WA 2GLOA 5A2QZ 5HM4B 2NVXJ 2LK2A 2ME0A 3K1PA 1Z7ME 1FCKA 4NF4B 4EQBA 1H0MA 2F36A 5KHDA 2F6GA 4BXUA 2LMDA 3PMWA 4G4PA 2DDBA 4N9HA 3WHBA 2EZIA 4Y3OA 1PYVA 2E71A 1JKQC 3LMMA 4KMUX 4N6DA 2BXYA 4ZECA 3RIRA 2FSWA 3CR9A 2O7OA 1ZR2A 2FHYA 1MBHA 4ANJA 4PGPA 5E1WA 3IP4B 1YG2A 4XLHA 4KNYA 4I09A 3G3FA 3KCCA 3TMGA 1URSA 3AG1H 4PGHA 5E3NA 1VSOA 5H6QA 3IKTA 2XD3A 4PAIA 2OAZA 1Y1WJ 1GTKA 2ZYNA 5EDNA 5LEJA 4C30A 4DYCA 1G3YA 2DAOA 2R7WA 2P0WA 3J7AY 3ZSFA 4UA8A 4BLAA 4G6TB 4LZ8A 1V54H 3HPIA 1JUPA 4OVPA 4NF6A 3R6SA 2V6EA 1YQAA 5M3MJ 2VPNA 4FEDA 4CICA 3O8GA 4KN7X 2FBIA 2QMWA 3LC8A 2R5YA 2WAEA 3BKIB 3HRMA 2HYJA 3CP8A 3HN0A 3BFUA 5ELVA 2QQAA 3CDLA 1I39A 4M73A 4QF9A 1Y3PA 3SESA 3RQTA 4BQOA 4DCXA 2DA4A 1C0WA 2RQPA 2DOJA 3QMFA 2V1DA 1YE9A 3VXBA 2DCEA 3ZMZA 3PUZE 3SZGA 2ZB9A 5M3FJ 4QWQA 2Y30A 3OMBA 2ZZWA 4XMYA 4EV0A 2H9BA 2Q2EB 3HRSA 2A6TA 2PVUA 3OYLA 2G29A 2Z99A 3KLNA 5HDGA 3GW2A 2GXAA 2RNGA 1DSNA 3I6VA 2HR3A 1ZKGA 1SVLA 5KCMA 3O66A 2K27A 4THIA 1NG7A 5AE4A 4BE2A 4A93J 2MD0A 3OYGA 4B48A 3A01A 1IV8A 2JWTA 2MFZA 1KQ8A 4YG2F 1KWHA 3PSFA 3ILTB 3V8XB 3JYRA 3JSOA 4W97A 2EBIA 4RS8A 2OC6A 3GFLA 1Y9UA 4M6VA 1QPIA 4B43A 4WX9A 5DVFA 2FVZA 5CMBA 3RPLA 2XPVA 4BJTA 3REOA 2XXWA 2IP2A 4ZEDA 1OFCX 4NC6A 4M3DA 4P1WA 3BZ6A 4D5CA 2HPIA 3WGGA 4D7NA 4GQOA 1FTKA 4HF1A 2XPUA 2IEEA 3SERA 4CH7A 1FBCA 3FISA 1DPEA 4XRMA 3EUHA 1SW4A 3VLWA 3GYYA 3DFGA 3O9PA 5F0CA 5F0HA 5FRMA 3QOPA 4IL6C 3OR1C 3GUDA 2JRMA 3O2PE 3M1CA 1MY1A 1SI1A 2M1BA 4QSDA 2E7WA 4RLQA 4BL0B 3W2AA 4HV5A 3CHGA 2IBDA 5BQTA 1FEXA 5TU0A 4MQVA 4ZC3A 2W4SA 5K5QA 2FEZA 2IA0A 2OCCH 1IC8A 2O51A 1FP2A 1XGNA 2IA1A 3ERED 3HV1A 2K9NA 2AYSA 1X3UA 3BCBA 5ILVA 2OUMA 5JFRA 2XD2A 2DT5A 1BP5A 2XSDC 4H4KC 3ZMTA 5H2FC 1K83J 4UUSB 4O94A 2HYFA 2X7PA 5BPDA 4C2UA 5JI6A 2UVHA 3CO7C 3Q27A 4OWDA 1QKAA 1YW8A 3EETA 1X4PA 2OU2A 3GX4X 3GZGA 3V5AA 1ZRDA 4ZJZA 3HOWJ 3EHUA 4ONYA 1U6GA 2PCRA 1PUFA 2BVLA 2M7AA 1YYZA 1LEVA 1OLAA 3BFTA 3EKIA 3MFKA 2UWMA 3U9GA 1OISA 4WXJA 3ZMUA 3JREA 2KZGA 1IF1A 5IOYA 3I71A 2DFEA 2X85A 4BJ6C 2VODA 5TP9B 1FBHA 3FVNA 2JPCA 1SVXB 3LSHA 2V9PA 2WA0A 1AMFA 5BS6A 2K85A 4RB0A 3F21A 3DQVC 4ESJA 2EFQA 4AC0A 3CJRB 4G8NA 3M3YJ 1X19A 3I5UA 4XIDA 2OJTA 3EHSA 3QAXA 3ABMH 4I62A 4CUGA 1QVUA 2VB6A 5IGAA 5TISC 2W7YA 3RPWA 1KYZA 3KLOA 3PQJA 2VN2A 2O1LA 1NK3P 3ASOH 2QQBA 4WF2A 5DEXB 3ML6A 1IZ1A 4HPQA 4YELA 4FTHA 3UK4A 4HDVA 3K4JA 1RIOH 2M8GX 4O3CA 2E34A 3KEOA 4HW8A 1Q1VA 1MQIA 5KCJA 1R23A 1J9IA 2ZMEC 3OOPA 2LREA 3TELA 1ON1A 2P2AA 2EINH 3TOBA 5DV5A 2P5KA 4CXFA 3VLVA 2HZKA 2PN6A 4HYEA 3JRCA 5IYCJ 1B3LA 4IOAF 4LA9A 3CCUI 4HV6A 4MNCA 1HSEA 2UVIA 3PUWE 3LAPA 4H0WA 5HBCA 2W85A 3ECRA 3TFLA 1F36A 4CCKA 3GTJJ 1QJMA 2XXYA 3GO5A 2XWKA 3K4CA 3CQZJ 4II2A 3B8BA 3SEVA 1JKPC 1ZN2A 5JVGF 4EATA 1T39A 1ZQ3P 4H5GA 2QJEA 3M3LA 4BH9A 2B4LA 4HG2A 3FMRA 2JZYA 3MN2A 3TO6A 3LSIA 3W9VA 1IQ7A 3TZAA 1JEVA 1K61A 3S93A 1D9QA 2RQQA 1B6HA 3SEWA 2HOAA 1E0EA 5F1QA 1XMXA 2R7FA 3I56I 3OYIA 4GBVA 1E3PA 2VL8A 3V8KA 5L3EA 1WSUA 4F2QA 4XLCA 1MXZA 5B1BH 5FD5A 3VFJA 3WHCA 2DOAA 5DD8A 3S8PA 4HW0A 2M2EA 3NWTA 5IYDJ 1MXXA 1MXYA 3FXRA 5L9SA 2IS1A 1LE8A 1ZMGA 4Y17A 3I55I 3BPXA 4QFKA 1NV1A 3CF2A 4MX6A 1TWAJ 3MKYB 1YTYA 2WY7Q 3NWSA 2IGKA 2K3PA 4XRFA 3RPUA 4IVNA 3L2QA 4HTGA 1LUJB 3C32A 5AONA 3CFLA 3TTMA 4RPOA 1NNPA 2M9HA 4FECA 5DM7F 5DYMA 2D1VA 2RDPA 3BTIA 1U5TC 4IQ4A 2KKOA 2I0BA 3V8LA 3NARA 3BTJA 1R1UA 1TWYA 2ZXIA 5LHGA 2F5FA 4V2FA 1MPCA 1QRYA 1YZ0A 2Y7IA 2Q89A 1FPEA 3BIGA 4MNPA 1MKMA 4F2OA 2ZYOA 2QA4I 5L8DA 3A09A 4I3EA 2O69A 1BI2A 2BHZA 4UB8C 4NF5A 2D3IA 4Q48A 1GV8A 4I0AA 1NUXA 2DQLA 1SPIA 3OIOA 2DPUA 2VT3A 5IZ1A 4BEHA 3HJEA 5D5VB 2XXKA 4MO7A 2QF7A 2K9LA 5FLMJ 3OO8A 1SI0A 5A5XA 1R1TA 4EQ9A 1RNLA 2VKEA 1D5VA 1ZLJA 2HPMA 1B3EA 2O1MA 2Z23A 1EZOA 3IB1A 1MY2A 3ZQIA 5F6FA 2CEYA 4B09A 3HKZA 3F72A 1J2XA 3KYLA 4WWCA 2BY1A 2X4HA 1HA8A 4R73A 4R9FA 1Z21A 2HFHA 4NC7A 4ELOA 3U2RA 3ZGKA 1ZELA 2B4MA 1DP7P 4ZDOA 2M4KA 2RNJA 4Z2YA 2NOGA 1X1CA 4HEA2 1B8IB 1LB9A 1AOYA 4IRHA 2NVTJ 2MW8A 5KAIC 4OA4A 2CO5A 4KYWA 4N0BA 2DXYA 2HS5A 4HAMA 4X04A 4BYYA 3OYMA 1IN8A 1FBQA 2IA2A 5FB2A 4XKPA 4PE3A 3DLLF 2O7UA 4NWDA 1RZ4A 3K2ZA 3R7XA 4YEJA 4P9UA 2XXHA 2BY2A 1USYH 1MPBA 1IXRC 5J8FA 3M8JA 2HVRA 4C9YA 2CMOA 3TTKA 2CZKA 1LB2A 4R6KA 2VXZA 3HSFA 1LDJA 3H6VA 4GXSB 2F4IA 5FTHA 4ZEBA 2LFBA 1FJLA 3HDDA 1VQOI 1U8BA 4C0RA 4IO9F 1B72A 3FVGA 3KN8A 3BY6A 1HKQA 5B66C 5K1YA 5EGOB 1FQAA 4LFUA 2KT0A 4MFDA 5ICQA 3FHNA 5FGMA 1Z7LA 3S9EA 4LLLA 2ID3A 3GTGJ 3H06B 5CI5A 4G7OF 1J75A 1IAWA 2OA4A 4IHYA 1IN6A 3AL0C 1NV4A 3FUZA 2JRTA 3LA7A 3OENA 2R9JA 1WH7A 3VLUA 5CLSA 1ZGWA 4H65A 4XFEA 1HSLA 1Z67A 3BG7A 3K6GA 2XXUA 2GWRA 2MGQA 3E97A 3KSJA 1NV6A 2CFOA 3H5NA 3WAEA 3OYJA 2BE5F 3MAJA 2MH2A 5HLHA 5E8IA 1ZREA 1LFGA 3K00A 5KZTA 2XSJC 3VYSB 5BMZA 2QSHX 2FU4A 1WHUA 3BR2A 3DTKA 2F8DA 3IOWA 4YFNF 4KFCA 4GX3A 1VQPI 3FVKA 1N77A 1QUKA 3SXYA 4ZEFA 4GO1A 1P6RA 1A55A 5LDZA 1D1AA 3UR3C 4F93B 1IXSB 2HDCA 5I57B 1W5SA 1XSDA 3MVWA 2JUCA 1IITA 5FFZA 4MGRA 4PBQA 2VKHA 3ESWB 2W1OA 1EJ9A 3MUQA 2I3VA 3GLBA 5J1YA 1E17A 4AB5A 1ZK8A 5H8HB 3FJGA 1BL0A 2QUFA 3PUVE 3G1MA 2HAUA 1MJAA 2L5QA 4GWYA 3DLNA 3T66A 2L7ZA 1QQIA 4BBSJ 2GFEA 2XX9A 4LQ2A 1H44A 4I9DA 4LZ7A 1P92A 2QKLB 1W5CC 4NF4A 4YB7A 5HPQA 3RKQA 3CF5F 1FOKA 3LWFA 3VDFA 4S04A 2KIFA 5CQGA 2Z33A 2IPQX 3GFIA 1ATGA 3LSKA 5HLGA 4WCGA 3J81Z 4NQ8A 1SYIA 3BT9A 4ZZDA 2B63J 2MSYA 1MZBA 1MMDA 4MLVA 3ULQB 2OTJI 3WODF 4BDYA 4MNUA 2XA5A 3U65A 4DXCA 3KN3A 3AKZA 1B1XA 1QVSA 5IT9Z 4X1EA 5C44J 1UHSA 4P0GA 1PDAA 3PTYA 2ZJRF 4O8MA 4PCQA 4B4CA 3HCQA 2VE8A 3S17J 2KRFA 2E1MC 3G4SI 1IN5A 4QFNA 3EYYA 4PGNA 2X1CA 4A3EJ 3D5LA 2BZTA 1URGA 3K02A 3F6OA 5JK4A 1MRPA 1X3WB 3QPTA 1GUUA 3GMEA 4XOTA 5J3LA 4YIIA 5HLIA 4POWA 1UCRA 5E20A 5ET8A 1MMAA 4BDLA 2EZKA 4EJWA 2W7NA 4WXDA 3J81K 1PB8A 1YX3A 4R9GA 3BR1A 1M5CA 1TFDA 1FBGA 2GH9A 1W0UA 3RSNA 2BGCA 3V7RA 1FBPA 3C2GA 3QAHA 3QK6A 4BQQA 2KQZA 2K3FA 3E0JB 2DK8A 3C7JA 1M5FA 1ZTYA 3PO3J 4BDQA 1ZKBA 1YRNA 3UIFA 4F22A 1VE4A 2STTA 4X48A 1TW3A 3H6UA 3IJOB 1WZ2A 4IGRA 4NWCA 1LAXA 1Z9CA 4YB6A 3F6VA 5EZHA 3U1DA 2CUJA 2NXNB 4NEDA 5EQ7A 2G7HA 3VDXA 4C1UA 1F5TA 1I6XA 4P1EA 4GGGA 2CH0A 5IYBJ 2L7KA 3RT6B 2ZZXA 1MD0A 3HYIA 2EV5A 1VQ6I 2K4JA 1I6QA 3EPEA 4GWOA 4NGUA 2NWJA 1D9VA 2R7DA 1ONVA 1FSHA 2XWOA 2LNBA 2Q2EA 4U0WA 2Y84A 3PMVA 1XS9A 1QO0D 4DCYA 2DA6A 3HG9A 3K9TA 3S9LC 2I4BA 4PF8A 2JVHA 2V79A 1IO2A 3KX2A 1JW1A 2FQ4A 3JR9A 3I4NJ 2RCAA 2A07F 2YR2A 1MQJA 1UQWA 5F0FA 5EYHA 2WAFA 4RNSA 3TQNA 5E3OA 1SVMA 4PFWA 2JA7J 2VC0A 3CUQC 2OTLI 2F3BA 1LFHA 2H1KA 2F48A 1WVJA 1TNSA 5B1AH 1P2FA 1ITYA 3RI4A 4PCDA 1ETXA 3HOYJ 4V19K 4NDLA 3CZ6A 5D8KB 1D4NA 2HQAA 5L3DA 1S72I 3HGGA 2QS2A 3E78A 3BZCA 3CJNA 2D21A 2B0LA 4QTRA 4KYSA 2O84X 4P47A 4XF5A 4RB1A 1MIJA 4QPQA 2OWZA 1AL3A 2O6AA 1WGXA 1FMWA 4J01A 4LB5A 2LKPA 3CMEI 1B5JA 1LVKA 4NB5A 1Z3YA 1SFUA 4HA8A 4PSXA 5F08A 4OFLA 3Q29A 3Q3SA 4G6QA 3LSMA 2GQ1A 2J5OA 4FJPA 4ZZEA 2DTZA 1JGGA 5IY5H 3M3FA 5GADJ 2ZXJA 1V4RA 5ET7A 1FBSA 1Y4CA 2R7RA 4RDUA 3HOVJ 5I3SA 3RLFE 1H88C 3W15C 3H9QA 5K7HA 3FHZA 2JK3A 3EPZA 2CSOA 4U7DA 3TW7A 4IO3A 5I2NB 3MZ8A 1RUNA 2DN0A 3L2VA 4KHZE 1REPC 2X1DA 1SBPA 2QQ9A 1RC9A 1Y20A 3H5RA 3HEFA 2F5CA 4MAGA 2UXNA 4JOMA 1NMUA 1UJ8A 5GAEJ 2IS6A 5H8FB 1ELJA 2D45A 2IGNA 3OYHA 4ZYAA 1TP4A 4RGUA 6PAXA 1EU8A 4AU7A 2M8CA 4PFYA 5TP9A 2HXOA 4II3A 1BIYA 3H92A 3TUSA 1G3TA 3KFWX 1FBFA 4QLCU 2OZUA 3ZR8X 1JQFA 2FNAA 4F3BA 3W6JB 1USYE 3FDYA 3JRIA 5ILUA 1OYIA 1VZ0A 1WPKA 2DXRA 5BUUA 2Z8EA 3MZYA 2Y5KA 2TRTA 4H0EA 3ELKA 4WEPA 1OQGA 4YIRX 1D8JA 1TL8A 5F64A 4BDZA 2KQRA 2LAOA 4I0BA 2TCTA 3FGSA 3H3GA 2JN6A 1PJRA 4OENA 4I2OA 5DEXA 3IUOA 4HX7A 2JA2A 3HOZJ 2M3AA 1HW5A 2K7LA 2P6SA 1A40A 3IO6A 3OO6A 5EG0B 2EIMH 3HB9A 1W7PB 4JQFA 2THIA 3N94A 4ESBA 4NF8A 3E5UA 2F6PA 1BM9A 1S3JA 1R36A 3QYFA 3S2HJ 1BI3A 4E7HA 3FV2A 1R4NB 4G8MA 3A0HC 2OD5A 4B8XA 3SHFA 1KA1A 3BQZA 3KP5A 1QUIA 3MBPA 2HVSA 2WWYA 1BR4A 4MTDA 4K3FA 1RR7A 1YW7A 3I3LA 1T6SA 1YJWI 1LBVA 3HM5A 1IDZA 1MBKA 2E1OA 3HGYA 3WTSC 3D1RA 4HXVA 1IXHA 1LFPA 3HBLA 2UYFA 4EM0B 1AA7A 1B6AA 1BJZA 3VYUB 1TQPA 3LSGA 4M6YA 2KRCA 4HBLA 1HDDC 1I1SA 4YFKF 1DOTA 3N5LA 1RPWA 2MLKA 3O2AA 3E6MA 2UZKA 1B3GA 5IM2A 2Q1ZB 3P9KA 5K2XA 3ABUA 1S5LC 2KMUA 5J8CA 1FNNA 1B0LA 1HQCA 2VBWA 2F7AA 1TQIA 5JHUA 3ZQLA 1SW5A 2L9NA 3A29A 3HOTA 1FY7A 4JK1X 4C2TA 2RCBA 1UG2A 4A3GJ 2V1NA 2H5YA 2JUGA 2ZYKA 2D5VA 5CMKA 4OINF 3LFUA 2NS0A 4N4UA 1PC3A 1FT9A 3DEWA 3HOSA 2BBYA 2NS7A 1MSFC 4W1UA 1JW4A 3BDDA 4OVSA 4LATA 2Q8MA 1EH3A 2XX7A 4BAYA 5LTCA 3O29A 4O7MA 4BHPA 3M4OJ 5M5YJ 2LY2A 3K2DA 5LD2C 1P1OA 4J19A 2XV4S 3HOXJ 4TLLB 3SETA 2OWSA 2CUEA 4C3IJ 1SEUA 1OCZH 1IMFA 2IA4A 2OV7A 1VDWA 4HF0A 2FF4A 1X58A 4GX6A 3PIPF 3OYNA 4OXVA 2FIXA 5FLVA 1BK4A 3QP6A 2WB1N 3FF5A 3FBIB 4NHBA 3MCZA 1J5YA 3A02A 1Y1VJ 4DYRA 2NVYJ 2PLYA 2GXGA 3E3VA 2RINA 1YX5A 1IUDA 2V4CA 3IJXB 3Q26A 1BI0A 2VOZA 4H1XA 2W82A 4D0PA 3PJRA 2Y31A 1PDNC 1ETQA 2F4OB 2DP8A 5CVIA 1R58A 1D3KA 1II5A 2ZO4A 1P1QA 5LOMA 4ENJA 4XORA 1G3SA 1A31A 2UUZA 4U7BA 1HOMA 3ABLH 5B5EC 4FBPA 1APLC 1QA6A 1DPPA 4LP2B 4OIOF 3SDFA 2H6CA 1PEBA 4IO7A 3UP9A 2DA7A 3O6BB 2O7IA 1S7YA 1JJ6C 2Y7WA 1QHGA 2AQFA 3MAMA 1SQYA 3QOEA 4A12A 1NKXA 2KJBA 4OERA 5ICTA 4L9JA 4BHBA 3H6WA 2VBXA 1D1CA 3T1BA 1WODA 3F11A 3U8QA 3PNVA 4L5JA 4M4GA 3GFJA 4WK8F 3PO2J 2I48A 2H27A 3M07A 5CJ9A 4AYBN 4HE0A 3BBRA 4H45A 3TQLA 3P7NA 1P9QC 1SW2A 2EA4A 1QNTA 2HVQA 5D5WB 2DYSH 2EIKH 3FIWA 2ZBKA 2E5ZA 3A4CA 4C2MJ 2WBBA 2WX9A 2XIGA 2XXVA 1LFUP 2ZXHA 4NN3A 5IOZA 4NX1A 3RPUD 1TWFJ 2ZMEA 1BI1A 4F31B 1XD7A 2ZJ2A 2ALUA 1S29A 1N3WA 3CMAI 1YI2I 4HF2A 2K02A 2L2OA 2RC9A 4E7LA 4P9KA 1ZRCA 4EVIA 2VKDA 4EGZA 1H8AC 5I5PA 4WKMA 1LDKB 5K2YA 5JEIA 5FTIA 3FK6A 4HOBA 5CC2A 2DYXA 2HDWA 5CBRA 1EZPA 2Z9OA 2DFIA 3MC2A 3RKYA 2VQGA 3GXOA 2K9SA 4ABZA 2OLBA 2NXOA 1OVTA 2Y5LA 4OQOA 4YKJA 3DP7A 3K69A 4PFIA 5CVUA 1MDMB 1O57A 4IHWA 1QBJA 1STZA 1UTHB 3SEQA 1OCOH 3PPOA 1JHFA 1X1PA 1Z3XA 2F35A 1B1HA 1PBPA 3N4MA 2O6GE 4Y33A 1P4AA 3GCMA 3H0DA 1D5YA 3GFMA 3QYBA 1QW0A 4MLOA 4LMYA 3F8NA 3K4BA 5IPAA 4L18B 3OO7A 3F8CA 2I10A 3H9GA 4P1LA 4P8BA 5A2QK 3B6WA 4ZEKA 4IZZA 4BGDA 3EQLF 5H8NB 4AIHA 3A0BC 4I98B 3O3KA 1B7HA 4G77A 2GAUA 4Y13A 1BIAA 4A3FJ 4BE1A 2K40A 1AU7A 2Q9TA 3OV8A 3ZMSA 3WGIA 3E13X 5IAIA 3I53A 1XSVA 3QIMA 4BUPA 4OIPF 2GQQA 1W36D 2PX9A 2Y75A 1YIOA 4P5OA 3UN6A 2XRNA 3O97A 1H89C 4KICA 1AKHB 4LN5A 2FNPA 4PE5B 1Z6TA 4GL8A 1WH5A 4JBAA 3HHHA 1UB9A 1X1BA 2DMQA 2Z5UA 4IX7A 5ERIA 2RKMA 2V93A 1ZJLA 5EEAA 2L02A 1J1NA 4HDUA 1FPBA 1MXWA 2ETHA 4WXCA 1FIPA 2L3DA 5DDGA 1ETKA 5F27A 1LBXA 3PNTA 1U5TA 1TT5B 1ZH5A 1IMCA 3GVAA 2ECCA 4CCMA 4CO8A 2P3VA 4YU0A 3SEYA 2OBGA 4BXFA 2VPOA 2Y7PA 1I6BA 3LSLA 5L9MA 1MGTA 1Z7UA 3PFIA 1BW5A 4RA1A 3GZNB 5EHMA 1FQCA 2CW8A 2HGCA 2EZHA 4HZFA 1LAFE 2BEOA 3OD7A 3L00A 4N81A 4I8CA 1R4MB 3EHTA 3K01A 1SD7A 5K5RA 1IGNA 1UTBA 1FMVA 5DCMB 2VOPA 1MM6A 2QWWA 4JVIA 1HW1A 4KT5C 4EMSA 3FV1A 1YO5C 1ZIUA 1JVXA 1JJ8C 2DQVA 3JRDA 2Q2AA 1ZBMA 3BZKA 1I1GA 2KDOA 2XXTA 4MLQA 4PFRA 2W48A 2ME6A 2XKPA 4XTCQ 4A5NA 2GIVA 1U3EM 3RYRA 2LR8A 1O3QA 2I49A 5GTIC 3E6BA 4ZDPA 4CDGA 1G2HA 1FSAA 4FQGA 4H6DA 1ZHFA 3QODA 1OR7C 2KLOA 1POY1 3MMYB 2R5ZB 5H8QB 5JTYA 3Q9VA 2PMHA 4X1DA 1DK4A 1WI9A 4A69C 1T0FC 3DKWA 3QQAA 4PZJA 3K70D 1RKMA 3V83A 1A36A 2OF7A 1XGOA 2Y7RA 1W5TA 5ICFA 3JZJA 2DT6A 3KYDB 5TPAB 3V7CA 2F3DA 5C4XJ 3S1RJ 5K7FA 2BJIA 3CCQI 1F4KA 5AA1A 5EEGA 3H3VK 1MQGA 2HI3A 1L0OC 3H1CA 4EGYA 4E4HA 2XXRA 1ZLQA 2DTRA 3MP6A 3KEYA 1CE2A 2V3UA 3IO4A 5TGTA 3BPVA 3RZDJ 2KLFA 3MVPA 4CCJA 3C18A 2HZLA 4NF0A 1GDTA 1MNMC 1NV2A 3FM3A 4IRGA 4R2FA 5T3JA 4QHQA 4CYDA 2NYXA 1BR1A 5L3BA 3KPHA 2V26A 4NQWA 3G2BA 4F1UA 4UVBA 4F1VA 1VQ8I 1JNFA 3DWLE 2O9LA 1JTYA 4L0YB 1Y3QA 3CC4I 3KEIA 4B44A 2FJ1A 3ZRGA 3QWLA 3MKZA 2QBYB 5EYRA 3R0JA 2LYCA 5IP6A 4GIZA 2DA3A 4N8YA 3ILUB 1JVYA 3WE3A 1XC1A 4E7KA 4O3BA 1A8FA 4V2GA 2Y7KA 2RKHA 2NOOA 4N6KA 4GWSA 2XAJA 4FE7A 3ZOBA 1Y1MA 3I5OA 3F8MA 3IOTA 3RN8A 3IH4A 4ENKA 2QS3A 3N05A 5I59B 1J59A 1FPQA 4G8XA 4JX4A 1JT6A 1WJCA 3BJAA 4XLEA 1OQHA 1YJ9I 1NNFA 3A3UA 5K5OA 1TLHB 4XLFA 1P4XA 3HPGA 2V25A 4OEVA 4ESXA 1SW1A 4F55A 3OEMA 4M3GA 1F1ZA 3ROJA 1V5GA 1R6ZA 4OTEA 3KP7A 3LL7A 4BBRJ 3FXQA 4PK4A 4BU2A 2HOTA 4XKRA 2ACJA 4KIGA 2I8DA 2GRVA 3MZBA 4FE8A 3DKYA 4PDHA 3IOUA 2CRGA 4ZYEA 4A3MJ 1FIAA 3RYDA 5F1JA 3S9MC 2F5XA 2GBYA 5JHFA 1OPCA 5ET6A 5GPCA 4M3FA 4PJLA 5I2NA 2R7OA 3KC1A 2E0SA 4XNFA 3TODA 3NEUA 3WU1B 2LBFA 4CA0A 2VJ4A 4GFRA 2ISYA 2VJ5A 1TXFA 2E7XA 2K86A 4MTEA 2GA2A 3K4NA 3OY9A 2A61A 2ZJPF 2PBWA 4DNCA 1HKSA 1NUWA 2XXQA 2CQKA 4NAPA 3TCHA 3IWFA 3OYBA 4U0VA 1FTJA 1TWGJ 1ZR4A 2R7TA 5IZ3B 5AIQA 2A5TB 1Q1HA 4UB6C 4KI0E 3RDIA 5E17F 2DJIA 1Y0UA 3QPSA 2M0CA 3I59B 4BQNA 2NAZA 4E6KG 2XRLA 1YXIA 2Q88A 4GRIA 2MLGA 3BCAA 3EYIA 1B5IA 2RV8A 2ZNUA 4HCWA 1TQMA 1N84A 1MNEA 3CTAA 4Z0IA 2DMPA 4EJVA 4IXAA 2F97A 1IRZA 2CV1A 5HS9A 1MMSA 5FO5A 4EXKA 4UY8I 1IMAA 2XHDA 4IO2A 2L01A 2ZJQF 4H67A 4AB6A 3TTLA 4GFBA 3H3UA 3F3XA 1BC7C 1M5EA 4L9VA 2QL3A 2H8WA 3S1QJ 4L9NA 4H5FA 3L09A 3FWEA 3LNQA 1W7PA 3A2KA 1VQNI 5EYGA 2WV1A 4MEVA 3Q5FA 1P4WA 3F9KA 1B1BA 1WCMJ 1K4TA 2L5VA 2D1HA 4IHSA 4F18A 3RQ4A 2ZMBA 3RT8A 4KA4A 1DUXC 2A5TA 1N78A 4UABA 1XVYA 2XUBA 5DVJA 5J6XA 3DBLB 4PFUA 2VQCA 1HLVA 1Z7NE 1RI7A 2DU9A 3K4KA 3ZMVA 2RGVA 2R7SA 5I84A 2KIUA 2ELHA 1MS7A 1RDZA 1XOCA 2IRFG 2PJRA 2JMWA 3OL3A 4LJZF 1EV7A 2HU9A 5J4YA 1D8KA 3OYDA 1EH6A 4DBRA 4GWZA 2GA1A 4RAZA 2JVGA 4BDRA 2LG4A 1U9NA 5IP7J 4R74A 3CCJI 3IX1A 1JXSA 2QEXI 3B6QA 3HHFA 1EKEA 4MQ9F 4JB7A 2QKMB 2Y2ZA 2X51A 2Z3YA 5LHHA 2L9SA 3CLQA 5CKTA 5ICCA 5BOXA 1TWHJ 3FD3A 3O28A 4GF8A 3CUQA 4OVTA 2DODA 4DZ1A 1YS7A 1R5HA 1T98A 4NHJA 2UXXA 1TTYA 3G71I 2M45A 2FE3A 2LY9A 4RM3A 3CCVI 1E3OC 3MZHA 4IHTA 3SJMA 1H45A 3CC7I 4IGTA 4EUOA 1YW9A 4M9SA 1I50J 3THIA 5LRRA 3GLLA 3W2WA 4BY7J 4EQQA 4RB2C 5FHOA 1Y3NA 4G9YA 3HKZN 3PSIA 4F91B 1B05A 2YUSA 4DGWB 1D0YA 3EUAA 3FBPA 1ZGAA 2G7UA 1WQ2A 4S05A 3IH3A 3WTTC 1XHYA 3ODBA 4OEUA 1Z05A 1KU7A 3C2HA 2HFBA 2ZC2A 2A3SA 5I58B 3JRBA 2XGEA 4QXDA 3TBIA 2DWHA 1Y8RB 3S4UA 2AXTC 1YOVB 4G68B 4PF6A 2DA1A 1ETWA 4GLIA 1BR2A 3VFZA 4M6XA 5FKMA 4QFPA 2E1SA 3GZ6A 4A3JJ 3WAFA 5J1UA 3HRTA 3CCMI 3G3ZA 3TP0A 2TDXA 3ECHA 2HTJA 2P4WA 3V7SA 3IHUA 3G3KA 3L2RA 4DI4B 5GAHJ 4XRSG 5KNLA 3GBAA 2DT7B 1VNDA 3X2QH 1S6LA 4HCYA 2DO7A 1T08B 3ZQCA 2FOKA 1RKWA 3PUBA 5FBPA 1Y6IA 4EJTA 3O6IA 4DBQA 1VFCA 4O3MA 4MIMA 4KN4X 5HDKA 3KC0A 1FYKA 3KP4A 1R1NA 3AFHA 2HQ0A 1X3ZB 3TAJA 1T8IA 1A04A 2CFXA 5HDNA 1DU6A 2DVZA 3ONMA 2W24A 4RM2A 2IGMA 5ITPA 3D4CA 3MYUA 4RXLA 2MC3A 1LBZA 5AA2A 3MQ0A 3CJTB 5CRYA 4OHNA 2EK5A 3H3ZA 2VPLA 4N9IA 4ZS9A 4MHFA 4BDMA 3SZTA 4M72A 3WTWC 4EF1A 2O68A 2BXZA 2AIXA 1B3FA 1RYOA 3IB0A 2DMNA 3K6UA 2VJIA 5KDTA 2QCOA 3TW6A 4R6HA 5E1ZB 4LGWA 3P9IA 1O3SA 1B52A 5GAGJ 4P3LA 2DYRH 3C1DA 3H35A 1MDP1 3T9HB 1CQTA 4O6JA 3Q25A 2DPDA 4OFJA 2LF7A 5FKNA 1MMNA 5I2KB 3GZ5A 2M5WA 4NF6B 1GHCA 1MY0A 4I1DA 3TGNA 4E7JA 2E2HJ 4HS7A 4ND9A 5CQEA 2LTPA 2AL4A 4PETA 4ESWA 4GYGA 2KZVA 3ZQ7A 4BKXA 1AH5A 2R5YB 4D1QA 3RUMA 1KA0A 4FX0A 2CS3A 1RETA 3E6DA 1MJ9A 3K2AA 2CU7A 1HSTA 2ZZVA 3C4MA 4IO5A 1NI9A 2GXBA 1VQ5I 1FW0A 3IFAA 5IT3A 3IL1B 3BG5A 2VBYA 2YU9J 3E6CC 1XT8A 1Y1ZA 5F7VA 1JI8A 1B4ZA 2X9DA 3C33A 3T9VA 4ASNA 4ZE8A 1TZLA 3BWGA 4N4NB 4QSCA 3DTIA 3KP3A 1R6RA 3H9JA 3CCEI 3TPAA 1OJLA 4F3GA 3OXNA 3JCUC 2FUG2 4BDOA 4RPNA 1JEUA 4LZ5A 2WY8Q 3RPQA 4RAFA 3U21A 4AIDA 1AKHA 3DP4A 1OMPA 4UVCA 2C6YA 3T9XB 4EF2A 1BN5A 4IY5A 3HO7A 5IT9K 4FIMA 1S9HA 4Q4ZF 3IAZA 5CPRB 1FQEA 4RGXA 2ONRA 1N3XA 4PFTA 1SFXA 3TDUC 3KIOA 3HHGA 4U23A 2QVRA 1BW6A 3CCLI 3RPLB 1FOYA 4Y7NJ 2L54A 1FLIA 4BDNA 4OIQF 5E3LA 5CVVA 1S7AA 4AWXB 1RKTA 4YFXF 1ZTRA 2VASA 4F92B 1XX5A 3S1NJ 1FPIA 1WI3A 1TNTA 1URDA 3MW0A 3VVEA 5LGUA 1NNKA 2GHBA 3MPKA 3JRFA 2WTEA 3AG3H 4Q30B 3NQOA 1LPQA 2VE9A 3U1OA 2JA5J 5J40A 1HBXG 3LFKA 3K1NA 4A5MA 2HZDA 1FQDA 1OCPA 3CFZA 1TWCJ 1S8NA 2KHMA 4KCDA 4OYVA 4AUXA 4OAYA 2E2JJ 1SD6A 1R49A 3F8FA 3MPLA 3E1SA 3W6KB 3PPPA 1NH3A 4DLDA 1VQ7I 2DWJA 1UFMA 2WYPA 4CZCA 4PAFA 1FBEA 4XKQA 3A03A 3C3WA 3ONQA 2REJA 4QFOA 4XL9A 3FBNB 1Q9DA 4FISA 3OIQA 5LGTA 1LSTA 3QXMA 2QVVA 2A5WA 1OCCH 1O3RA 3B02A 3QPHA 1GV5A 3VODA 1Z91A 2EPFA 1IUFA 2CZHA 2WAQN 2R5ZA 4PC9A 5FFXA 2I3WA 2DBBA 3IKVA 5H8QA 4I6ZA 4XEQA 3RTRA 2CMPA 1F9NA 3DBRB 3PQKA 3C35A 2IXSA 1P7JA 2DDAA 3F0CA 3FMQA 5E1XA 1DDNA 3VV5A 4N8GA 5E8GA 2I58A 3TYHA 2CQXA 4FEBA 4MBPA 3HZJA 1MXUA 4M74A 3LSWA 4Q5TA 1I27A 1IRFA 2CG4A 2RC7A 4UUSA 5LEKA 5ILSA 3SFZA 4X1BA 4GX4A 3C34A 3OYFA 2V1XA 4HX8A 4UUTA 4F52A 5IKBA 4O5VA 1A5JA 4UV9A 4U1OA 5ET5A 5FLXZ 3GTOJ 3H4ZA 2MKZA 1V5EA 2E1NA