3FXUA

Crystal structure of tsar in complex with its effector p-toluenesulfonate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA03
5DCFA 1B5HA 3FWEA 4N07A 3ELKA 4ZYEA 3BOQA 2IA0A 2JRTA 3ZMSA 4DQ2A 3BDDA 4QFNA 2Z8EA 1UTHA 3WTTC 2V25A 5CMCA 1HKTA 3NRVA 3PU5A 5I57B 3RPUA 4U2RA 3GFJA 4M74A 1NNPA 3B73A 1P1NA 2RN7A 3GLBA 2KIUA 1OMPA 1RUNA 4XLNF 4OMYA 2NS0A 2GHAA 3W9VA 4Z0IA 4U7DA 3EYYA 3WTSC 1FQCA 3VXBA 4HA8A 2PVUA 4LLGF 5CVJA 2O1MA 3ULQB 3LAPA 2HKOA 4O3CA 1U5TB 2D45A 1REPC 1XCBA 5HDNA 2DWJA 2XKOA 2VODA 3WTUC 4LZ7A 2UXNA 3CFZA 4G7ZF 1YIOA 2Z23A 5DCMA 4ZEFA 2REJA 1O3SA 1SVXB 2OCUA 3JZJA 2Z33A 4M9SA 4POXA 1Y3QA 4UHTA 2EWNA 1BKAA 2HYFA 2JSCA 3M7GA 4HQEA 3N4MA 2HCAA 2XX7A 3IRRA 4KFQA 2LSOA 3ECHA 3LA7A 4PETA 3TTRA 3E97A 2H98A 2JT1A 4BHCA 2QQBA 2QUFA 2Y7PA 1YFHA 5FTIA 2P4WA 1HKQA 1UFMA 3I59A 3K2ZA 1NNFA 3UA8A 1TTYA 4HF0A 2A6HF 3VFJA 2K4JA 3VFZA 4YG2F 4S05A 2EFNA 3VB2A 1LEAA 4H0EA 3KZZA 3G7WA 3DPLC 3OO7A 3TO6A 4CICA 2Y7KA 4OIOF 5DCMB 1B1HA 4O6JA 1N7XA 2EV6A 3LR1A 5H8HB 1PP7U 2O84X 1FLIA 3OENA 1OYIA 1LFHA 4NE4A 5CMBA 2PN6A 4K2EA 3O6HA 3WU1B 1IAWA 3H06B 2F5CA 3F23A 5BUUA 4HCWA 1GR2A 3JSPA 3V5AA 5E20A 3K6UA 1T38A 3H6TA 2XX9A 4LG0B 4OIQF 4BDLA 3M8UA 2P6SA 2CQKA 2VBZA 5F1QA 2HFHA 5AA1A 3DLNA 2ISZA 2VT3A 3RKXA 4R1HA 5EEGA 5J8FA 1R6ZA 1Y4CA 2QBYB 1ZG5A 3C1DA 2UVIA 4ELQA 3U2RA 3PMWA 4KDPA 1OPCA 5JK4A 3EHUA 4M9ZA 4U4XA 2W25A 3HRSA 3QXMA 1XCVA 2THIA 3VLUA 4RAZA 2BJJX 5EEHA 5D6EA 3FJGA 1IEJA 1K78A 3O3KA 2CMOA 4LA9A 4F3PA 4EJUA 1G3WA 2FNCA 4L9NA 2OBGA 3HSFA 1B9JA 1L3LA 2NWJA 2Q8KA 2H9BA 4HF1A 4FECA 4G6QA 4RJZA 2XKPA 4O3BA 3T8RA 2O3FA 4KN4X 3IHUA 2DSFA 4IY5A 4A5MA 3QU3A 1UTHB 1J7KA 1RI7A 4P0GA 1USTA 4M71A 1FBQA 5CVIA 4G2ZA 4GO1A 2CFXA 1ZAOA 4RPNA 1F9BA 3TCGA 1SD5A 3H7MA 4E0WA 2R6GE 4HCYA 1FX7A 3LSLA 5I2KB 5BWJA 4AIJA 2UWMA 1OIBA 5ITOA 1KU9A 1LEBA 4BDRA 3F21A 1FYMA 4Q30B 2CZLA 4GCVA 2DWAA 3K0LA 2W84A 2IP2A 5E1ZB 4U0YA 4QSEA 4WXHA 2ZMBA 1JW5A 2D5WA 5IT3A 2ZYMA 3K6WA 3SEVA 2PMHA 4EQ7A 2G93A 2A5SA 2ZBKA 3P9CA 3K69A 4RAYA 4N6PA 1IZ1A 2I0BA 3Q9VA 3QYTA 1B3EA 1CB6A 4BLAA 5A5XB 2VC1A 1IXRC 3CG3A 4HTGA 2ZMEA 2DE3A 2F78A 2CGPA 1Y3PA 1SD4A 2V84A 2I4BA 4YFNF 1A55A 4RB1A 1M5BA 1QVSA 2F6GA 3TZAA 5ICEA 2LDUA 3FM3A 3IOWA 1B3LA 1ZRFA 2VT2A 4PGGA 3PMXA 4CYDA 1KYZA 2Y7IA 3WE2A 3MEXA 2LF7A 3FD3A 1SD3A 2W85A 1B32A 1UIVA 4A0ZA 5AA4A 3KLOA 2COMA 1MH4A 3U72A 4Q47A 4OINF 2AYSA 1Z9CA 5TP9A 4FATA 1IXCA 1LAFE 2H99A 4KUMA 1W5SA 4I9DA 3C35A 2QLZA 3DP6A 4FEBA 3SXYA 5ITPA 2PLYA 4EJTA 2MLGA 4JQFA 1B6HA 2XXPA 5DD4A 4U1ZA 3TKYA 2GA2A 4NWDA 2QZ8A 1SYIA 2E7WA 3HIFA 1TQIA 4RB0A 4KFCA 4IPAA 1P99A 1JEUA 3T9XB 3LA3A 2L54A 1O7TA 3KETA 1Y1MA 3JV9A 1YW8A 4RK2A 5HLIA 3G3HA 5D5VB 1MY4A 3ODBA 2QMXA 3A3UA 2FA5A 2X7QA 2Q8JA 3V7SA 2DPUA 3K6VA 3HOTA 2FF4A 3C34A 3FXQA 5F64A 3K0VA 4OWDA 4XKPA 3FZVA 5ED4A 2K4BA 5A5XA 4U88A 2WWYA 3I6VA 1QNTA 4ZZEA 1A04A 4M73A 4QHQA 5I2NA 1TNSA 1FQDA 1YTYA 4GL8A 4QLCU 4U23A 2VOPA 2X0LA 1W7PA 3LSXA 3OSQA 1FC3A 3J80Z 3QK6A 4R2BA 3JTGA 1ZKBA 3U1OA 3R0JA 2W7YA 3RTWB 5FLXZ 4GVOA 2OQRA 3W9WA 3TO9A 4A12A 1YAEA 4YIIA 4HOBA 1FQAA 5HM4B 4PZJA 3WTWC 4IO7A 3K01A 4LUBA 4OEVA 1IUYA 2I49A 5I2NB 5LGUA 4KIFA 3I4PA 5B7DA 3E5XA 3HPIA 3FVKA 3L9FA 4CGZA 2CG4A 1EU8A 3OOPA 4RYAA 3ZMUA 3JTHA 4ESWA 2DOJA 2V1XA 4KI0E 4FHTA 1R5GA 1HXDA 1JETA 2PX1A 4GRKA 4HW0A 3COAC 2A3SA 4POWA 3UK4A 4RPOA 5JVTA 1ZGAA 3ZQ7A 5L3DA 2P7CB 1B1XA 4YKIA 1BIAA 5FFXA 1YS7A 4HX7A 1SDXA 2QMWA 2ZMEB 2F6PA 1OKRA 1FP2A 4F7ZA 1FTOA 4L17A 3MUQA 2M8EA 4Y17A 4Q48A 3KJTA 2VBWA 1JQFA 3KJ7A 2IPQX 3H4ZA 1JGSA 1CF7A 1PBQA 4ELPA 4ON0A 3MC2A 2M45A 1M5DA 1KQ9A 1FYKA 1BTJA 3QUFA 1GXQA 5AE4A 5BQTA 2Q0OA 5E1XA 2PI0A 1H43A 3KZYA 1O3RA 1QZZA 3G3IA 3F22A 2DS9A 5CRYA 4ESJA 1I69A 3KG2A 3K02A 1GVCA 3RKYA 5I2KA 1QW0A 3Q29A 2ZXJA 4WEDA 1OMIA 3V8KA 5I57A 5H20A 1E2XA 3F6VA 3WE3A 2QBYA 5L9SA 2D21A 5CMMA 2F2EA 2HXWA 3LAJA 3K1PA 1PB7A 3PUWE 3QAXA 2K7LA 4IB2A 3MVZA 4GLIA 4H5GA 1Z7NE 3Q28A 2M8CA 4BH9A 1B4AA 3LSWA 4MBPA 4U0VA 1XB4A 1DP7P 1FQFA 4F1UA 2P5KA 1QZYA 2E7XA 1SW2A 4F39A 5ERIA 1XC1A 3WG9A 4JDFA 4OTEA 3DM0A 2RC9A 3VOEA 3S4UA 3GX4X 2UXAA 4BHPA 1B46A 2H4IA 3SEYA 3ZKKA 2QVOA 4KPTA 1ZLJA 4NTLA 2VGQA 1W7PB 1MPDA 5AA4B 3HRTA 3SKPA 3OO8A 2EJRA 3LWFA 4OEUA 3G73A 2V3QA 2B0LA 4IXAA 2PBIA 3IK6B 4F3SA 1OVTA 4FT8A 1I6XA 1RNLA 3R4KA 3B7DA 1G3YA 5LGTA 4PE5B 4JBZA 2ACJA 3GZGA 5E1WA 3S2VA 2PG4A 2HGCA 3R7XA 3U1DA 2RC8A 1LAHE 1HKSA 4ASNA 1H9TA 2XD3A 4BNCA 2L4AA 2ISYA 1MM6A 1HBXG 3H3UA 3KP6A 1ANFA 2A68F 2ZXTA 3HHGA 2EFWA 5D5UB 1LFGA 2J5OA 1SFEA 3E3VA 3W6KB 1H44A 3M9AA 1KWHA 4A2UA 3OEKA 1ZRCA 4HAMA 5L3GA 5I59B 2FNPA 1UB9A 1IXHA 1FTMA 4EF2A 2HKXA 2KJBA 1M5FA 1QUKA 2MA3A 3O6GA 5F7VA 4L9TA 3U94A 2YR2A 1D3KA 3D5LA 1EH8A 2HYGD 1B4ZA 2OLBA 5JTYA 4UXNA 5TPAB 1CE2A 1U2WA 3USDA 5HS8A 2RINA 4JSDA 3GXAA 1MY0A 3BFUA 4EQQA 4MEXF 4NF8B 2EV0A 3BY6A 4H6DA 3ZMZA 3EPEA 4EDPA 1WVJA 3H6WA 5I84A 3QU6A 4XRFA 2FBIA 5ILUA 3KOSA 3L6GA 3PUXE 3DEUA 1LAGE 4RGUA 3MCZA 3IR1A 1R1UA 4M6XA 4AIHA 4D0PA 2W57A 1HQCA 3SHFA 3CUOA 3MZYA 5LHGA 4ENMA 1MZBA 2NAZA 3H3GA 4ZEDA 4RK9A 2O8XA 3PPQA 2XROA 1NL5A 5HLGA 3MP1A 1N3WA 4R6YA 5K2XA 4HLYA 3F8FA 1B7UA 1XS5A 1AMFA 4P9FA 3WGIA 3HCQA 3LA2A 4DCXA 1NH8A 2HQNA 4G4PA 3IL2A 4F1VA 4E0XA 1F1ZA 1DPRA 1UHMA 1U8RA 1USYH 4EM0B 1QQIA 4O5VA 3PPNA 3T1BA 5B70A 2DE2A 2IRFG 3K6XA 5FHNA 3SZPA 1B3GA 3KE2A 1OYYA 1MPBA 2FQ3A 3GO5A 2DTRA 1SQYA 1B2HA 3P9IA 3J7AO 2XXXA 1URSA 1US4A 1KA8A 4BDMA 5ILSA 4YB6A 5CBRA 1XDSA 5ICCA 1ELJA 3IAZA 2B65A 4U4SA 4RA1A 4I98B 2ALUA 1SW1A 3R26A 3N6UA 3TUSA 1WSUA 2DT5A 1RUOA 3K2DA 3C4MA 1ON2A 1QKAA 4RNSA 1M5EA 3KP5A 5LHHA 4LB6B 3T22A 1TWYA 4QFLA 3EN3A 2OAZA 3I58A 2ESHA 5CC2A 1P1QA 3AXFA 3CO7C 1QUJA 2DBBA 2H5YA 1LBBA 4N9HA 5IT9Z 2M30A 2ZCWA 2CWEA 3BZ6A 1ZREA 4EM2A 1A8FA 3PUZE 1ZBMA 1KU3A 1GXPA 3F8CA 1NMUA 1EZ9A 3TOBA 2QWWA 2O1LA 1J1NA 1UIUA 4M9XA 4MEYF 4QF9A 3PQKA 1MPCA 2YX7A 1R9QA 2QRYA 3OOAA 4R6HA 1QUIA 1PDNC 5JFRA 3RI4A 3OSRA 1O7LA 2NOOA 2YPNA 3U8QA 1BLFA 2Y84A 1MDMA 3I53A 4QSDA 2STTA 2HZKA 4YB5A 1J5YA 2XIGA 1YYVA 4LK0F 4IJAA 4FIMA 1R1TA 3PPRA 3FGSA 3G3FA 4ZECA 2V3UA 2GWRA 2PBWA 3U92A 4BDOA 2DVZA 3EQLF 1B5JA 3TDJA 3EHTA 1VR5A 1IN5A 4B09A 1I6BA 3L00A 2G7HA 1ZLKA 2E1CA 4F3BA 2AL5A 5HS9A 3VLWA 3MJNA 1LLSA 1URGA 2HTSA 2HQRA 1DTGA 4IRHA 4ZE8A 2OZ6A 1MXZA 3VE1B 3S9NC 2V6CA 1PDAA 2AXLA 2O6AA 2FNAA 4Q5SF 4LLNA 4KNYA 1ATGA 1FCKA 3CR9A 3T8TA 2FA7A 2ZJ2A 2F8DA 3ECRA 5BPIA 2I6EA 1OYWA 3RJPA 2OK2A 1TQPA 1B3FA 4UUVA 3E13X 2QQ9A 2HEOA 2XAQA 4HYEA 3M8EA 2CW0F 2MBFA 3J81Z 1P1UA 4P0IA 4OXVA 1FSHA 4IO2A 4TLLB 2BBYA 3T93B 3O2PE 2DW4A 3MPLA 4CHUA 4DXUA 1P2FA 1PEBA 4OFOA 3HRUA 3M1EA 4EV0A 4MQ9F 5DVFA 2XAGA 1B1BA 3CTAA 3G3ZA 3TO7A 2UVJA 3SEWA 3D0SA 6PAXA 2PT1A 2ZNTA 2O7UA 3TFLA 1B59A 4R73A 1Z6RA 3OV8A 2XASA 2QYOA 2RKHA 3HTUA 4EXLA 2VD3A 2F7CA 3FXUA 3NQOA 3DKWA 3P7NA 5KDTB 3WGGA 1AOVA 1VTNC 4OETA 3TCFA 1XMAA 3R61A 1QGPA 2Y7RA 4U1OA 1O3QA 4KCCA 1Q1HA 5IT9K 2UYFA 4HZFA 3ZPLA 1W7PD 4KYDA 4PQJA 3VVFA 5I58A 1KQ0A 3WTZA 3SETA 1EV7A 4NMYA 3HSEA 5ICTA 4OMZA 1N76A 5BMZA 1PUEE 4X9TA 3MWBA 2XXQA 4RS8A 1AH5A 3B6QA 2NUVA 4U21A 5FHOA 2NYXA 3TDZC 1TW3A 2LKPA 4AB5A 4C1TA 1FQBA 4MQVA 2R71A 2O7IA 2K86A 2HTJA 2P2AA 1US5A 4JK1X 4LJZF 4ELRA 1G6NA 2WTEA 1S50A 3FVNA 2OD5A 2D3IA 1OLCA 4G8NA 3TTNA 3FIRA 2L4MA 1OVBA 3I0TA 1LAXA 2CO5A 5JHUA 3G3JA 3T9HB 4IO4A 1U3EM 4P11A 4L9VA 1SAXA 1R7JA 4UV9A 1RZ4A 3I59B 5AIQA 2I48A 1W4MA 4PFTA 3BWGA 2GFEA 5DVIA 3IL1B 4TV7A 2F35A 5CLSA 3O6BB 3QOPA 1S3JA 2PMUA 1WQ2A 5TJJA 4IGRA 3N94A 1LQ1A 4EVIA 1XGMA 3FATA 1Y9UA 1G3TA 1XN7A 2FBHA 1S29A 3S9EA 4OIPF 1G4DA 1B51A 5AA2A 2ZKZA 1BJAA 3W6JB 3K1MA 3GYHX 4OESA 2DQLA 1IUDA 4BHBA 1BOAA 3DP8A 4HBLA 4LK1F 2XXWA 5E17F 5FTHA 4MGRA 4PDKA 1MQJA 4A0YA 3MP6A 1MJ9A 1JVXA 5DVJA 1B0HA 2REGA 2DQVA 4GWOA 3ABTA 4NF4A 4UNOA 1QPMA 1STZA 3DP4A 4YIFA 4R6KA 1IW7F 1S7OA 4DNCA 2CYYA 2DXYA 3FVGA 2B3FA 5I56A 2DXRA 3A09A 1DPUA 1UQWA 1CGPA 1LB8A 3ZMVA 2PQ8A 5HOOA 1ZTYA 5CVVA 5DV5A 4KYWA 5LRSA 4NF5B 3T9VA 3CLOA 3QUJA 3JAMK 3KEIA 4JWOA 1SI0A 3S9MC 2MH2A 3V7CA 2XD2A 4WWCA 2OWSA 1FTJA 3TMGA 3IRQA 4M1VA 1S9TA 3GLXA 5DEXB 3BPXA 1RYXA 2G7UA 1XVYA 4G8HA 1I6AA 1BBYA 4G7HF 2DE4A 1JEVA 4PFWA 3U9GA 4KCDA 5JR3A 1DMBA 1MD0A 4F2OA 1SI1A 3PD9A 4R8HA 3EETA 1D4NA 3IB2A 4FE8A 4G6DA 5DTBA 1LJ9A 4G68A 4WK8F 1FSEA 1ODDA 2AS5F 1SW5A 1YLFA 5M2VA 2Z3YA 1WDNA 5DUIA 1YS6A 5H6RA 4YICA 3M3LA 2L02A 3E6MA 1TFDA 1S7YA 3GXOA 4WEPA 4ZH4F 2GHBA 1IF1A 1XD7A 5F6FA 5AA3A 2ABHA 3LSFB 4KR5A 3QIMA 4PCQA 2XXIA 4OERA 4ZS9A 1S8NA 5E8IA 3E5UA 1U6GA 2ANJA 3TTLA 3SFZA 2I4CA 3ABUA 4WXDA 4GF8A 4KN7X 2NNYA 1R5HA 2H09A 2QS3A 3O2AA 3R6UA 1KYWA 2F34A 3IC7A 3TTMA 5D8LB 3RT8A 1X3UA 3FVOA 5L3CA 3TQNA 5I59A 2ETHA 2GZWA 2ZNZA 4UA8A 5JI6A 4P96A 1SYHA 3F6OA 3TOAA 4GOTA 3HO7A 4IHTA 1ONVA 2DK5A 1ZGJA 2PT2A 2ZYNA 3E4RA 4AQ4A 5AA2D 2DP8A 4IO3A 2LNBA 2RC4A 5ICGA 1H9GA 3T5XA 5LGNA 3I3VA 4YKKA 4S04A 5HVQC 1G3SA 1JE8A 3HRMA 4A5NA 5CI5A 2Q2CA 2QS1A 5LLQA 1YG2A 4JSOA 4F31B 1JW1A 3FF5A 3MAMA 3GF2A 1NFTA 4EF1A 3S9LC 4ZZAA 2R7DA 2FMYA 2M5WA 4GL0A 5D5XB 5KVRA 4UV8A 4RB2C 1D5VA 3KSJA 3P7IA 4OMBA 5JTYB 1B4HA 2OZUA 2HOEA 4ESBA 1FY7A 3PGFA 1L5TA 2QQAA 2OWTA 2XAHA 1BC8C 2F7BA 3VXCA 4KT5C 5CVRA 3MVYA 1JHHA 2DQRA 1XVXA 4X1BA 4UVAA 4ZEKA 2QPQA 4L5IA 4GD5A 1P4XA 4R72A 2EA2A 3CUQC 3MZ9A 2GA1A 3GW2A 2YJPA 4FJPA 5FO5A 3FUZA 4KIGA 2V79A 2ZYOA 3TAJA 2Q2EA 1BI3A 2DYXA 5D5WB 2X7PA 3ILTB 5L9MA 4HW8A 3QAHA 2ZFWA 3ZS6A 3MWMA 2ONRA 4F18A 1WODA 3F3XA 2DK8A 1YO5C 2H6CA 2V93A 4MLVA 3H3ZA 2FYIA 2Y75A 1Z1DA 4OVJA 5EYFA 4YMBA 5K2YA 3T9UA 3RYRA 1XSDA 1SMTA 3I54A 2RV8A 5L3FA 5LHIA 2C6YA 4ELOA 3D4CA 2RC7A 5I58B 1MXYA 1B9NA 2ZYKA 3HSTA 1LDJA 4BDNA 4JWXA 2GAUA 4I02A 1N04A 3OO9A 1J0RA 1FT9A 1K79A 5DUKA 4LB5A 3VDFA 3MVXA 2KRFA 3RTFB 2A5TA 2DVCA 3MP8A 4JBAA 3N97A 1BN5A 3R0AA 4H0WA 1S7AA 4LGWA 1ULYA 3K9TA 3IO4A 2HEUA 3RTRA 3GVAA 3TTKA 3F72A 1B5IA 4IY6A 2XAJA 1YCJA 1O3TA 3J80K 1FOKA 1BIYA 2Y7WA 1NHAA 4XLPF 4E70A 3LBSA 4H8IA 3VV5A 1MXXA 4TOZA 5BOXA 1R9LA 2Q89A 3L2CA 2BEOA 2UXXA 1Y4TA 1FPQA 1ZH5A 4ESFA 3T96B 1ZU0A 4O3MA 4AWXB 4GFRA 1MG1A 2WKYA 2FE3A 4FAJA 2H6BA 1MRPA 1MXWA 3O66A 4WX9A 3O97A 4ECFA 3IB1A 2RDPA 3N6TA 2BGCA 1POY1 1A54A 2A6EF 3RGYA 4ETSA 5EHMA 2GXGA 1SW4A 3TDUC 4H65A 3A3CA 2YLNA 5H8QB 4R9GA 4YKJA 4DXCA 2EFOA 2QJEA 1LVAA 1QKBA 2K27A 3LSTA 5FB2A 2STWA 2OQGA 4F3GA 4N0BA 5LOMA 1P4WA 2XUBA 1MY2A 4XKRA 1H45A 4YFKF 1II5A 2K02A 3IJXB 1CF7B 5LEKA 5ISUA 2QM3A 2XV4S 2ZO4A 3IWFA 4LLLA 2NXOA 2D1VA 4MTDA 1QULA 5E8GA 5TP9B 1I5ZA 2R7FA 2HS5A 2F5DA 2F36A 3IOTA 4ZYDA 2ZNUA 2XXVA 1USYE 4OIRF 4ENKA 3TEPA 1FP1D 4EQ9A 2UZKA 3HUGA 1KQ8A 1P4AA 2XXRA 3RDIA 2HDCA 1LFIA 1J59A 3MZHA 2F5FA 4IO6A 1XHYA 3OD7A 4BAYA 4AVPA 3B02A 4M72A 1F4KA 1MQGA 1MJBA 3C7JA 3SEXA 3D4GA 2H25A 1R36A 2E1NA 1ZN2A 4QWQA 4G77A 1FNNA 3E6DA 5I56B 2UYEA 3VODA 3KP4A 5FHMA 4I0BA 5H8HA 1IRGA 4HX8A 2QSXA 2OBPA 1AWCA 2FXAA 2IA2A 4RY1A 3OELA 2GIVA 2NVUB 2J5PA 2E0SA 3GFMA 3CI8A 3B6WA 1GHCA 4LMYA 2D2WA 5CJ9A 1ZYRF 1DOTA 2P8TA 2ZNSA 2A5YB 2QENA 1A8EA 3RNNA 1B7ZA 4THIA 3E9XA 4N9IA 2Z8FA 1P92A 4P55A 3FM5A 1A40A 1OLAA 3W15C 5F1RA 3F8NA 3CIJA 3FJ7A 4NF8A 4L0ZB 1R23A 3LQRA 2AL4A 4PP0A 3SZTA 3V8XB 3KFMA 1T0FA 3RN8A 3TODA 3F8MA 4F19A 4FORA 3NEUA 3DQVC 3IOUA 1HSLA 5FD5A 1T6SA 2FU4A 4NB5A 4LG0A 4DE8A 3E5QA 3KN7A 1URDA 2E1SA 4Q8RA 3GWZA 4GYGA 1PB8A 3MBPA 1IRFA 2DAOA 3F11A 4H67A 1XGNA 2RCAA 3V89B 4X1DA 2AIXA 4OU0A 1NNKA 3DELB 4CZZA 1F9NA 2A61A 4KA4A 2Z9OA 2XXHA 3L6HA 2XXUA 5DDGA 4QFKA 1MXVA 1Z91A 3K4UA 4U0WA 1HSTA 4GIZA 3BJAA 1H76A 3JAMZ 1FTLA 3MVWA 1N0TA 1H0MA 4EXKA 3SDFA 2O51A 2BV6A 4KMFA 4I09A 2VD2A 3PD8A 4KD5A 1MM7A 3C31A 4OFLA 2EV5A 5AA2B 2KIMA 3WTVC 4F2QA 4EMSA 2P6TA 3B6TA 1XOCA 1RIOH 3RT6B 5DEQA 1YQAA 1PC3A 3SQNA 2XGXA 3QP6A 1NH7A 4RGRA 1AL3A 4LZ5A 5HPQA 2IW5A 4OOIA 3BFTA 1TXFA 1FTKA 3CRBA 4EJOA 1BP5A 4BXUA 3MAJA 4WF2A 1E17A 4L5JA 1R58A 4ZEIA 3IKVA 3Q25A 2Q88A 3UP9A 2HAVA 3MPKA 1ZIUA 4L0YB 2Y0MA 1B58A 3C33A 4LQ2A 1EZOA 3CFXA 1Z05A 2F5XA 1MH3A 1HW1A 2Z8DA 3QPHA 1Q35A 4G8MA 4ZE9A 1WI9A 2I3VA 3UORA 2VOOA 4I0AA 1IN4A 2QL3A 3CVGA 3Q27A 2FEZA 1XSVA 3ZN0A 3EDPA 5CMKA 4ZEBA 4ONYA 3JSOA 4HLXA 4KMUX 2EK5A 2Z99A 1AOYA 1IN7A 1B40A 4I62A 4M4GA 1RYOA 4BYYA 4GQOA 2ADUA 4MHGA 4Y15A 1B9MA 4XSXF 1H3DA 4L9JA 4TLMB 2DU9A 3O29A 2GXBA 2O69A 2G9WA 4IF4A 4GYIA 4KYEA 3FJMA 5TPAA 1SD7A 3V4GA 4EJWA 2FOKA 4IRGA 1A99A 1J2XA 2JZYA 3PFIA 2X4HA 5AONA 4QRZA 4I1DA 1R1VA 1ZHFA 3M3FA 3FMQA 4DZ1A 1FW0A 1BI1A 4TQUQ 3PMVA 1JXSA 4XTCQ 4LZ8A 5K1YA 1U78A 3KEQA 2OA4A 3EQ1A 1YW9A 2W24A 1PP8F 1HSJA 1IITA 2JPBA 4GXSB 3FV1A 2VBXA 1LGBC 1B0LA 2H27A 2XHDA 2QS2A 5L3EA 4ZYGA 4F29A 4MFIA 2JTVA 4NHJA 4HX4A 1MS7A 2O68A 3DXJF 1MXUA 1Z7ME 3H6UA 5HLHA 2RF1A 5FGMA 3O6IA 3KEOA 1TQMA 2VE8A 3PPPA 2I3WA 2IA4A 1BM9A 5HDGA 5H8NB 3R60A 3ML6A 3HYIA 3H92A 1LCTA 3KOTA 4LP2B 2JPCA 3LFKA 3ZSFA 2RQPA 1SBPA 5A2QK 4IHSA 5KCJB 5LBQA 5CBSA 3KN8A 4U7BA 2KKOA 3KP7A 3CUQA 3L7WA 1F5TA 4ZZLA 2MLKA 4I8CA 1QO0D 1U5TA 3AAFA 1SD6A 2HFBA 5J8CA 1IXGA 2HZLA 5EHSA 1B52A 5L3BA 4NF4B 4KICA 3P9KA 2FRHA 4LATA 4HS7A 2DPDA 2VC0A 3VEPA 3GBAA 2M1BA 4G7OF 4XKQA 5ICFA 1Y0UA 2PFBA 5CYVA 3OEMA 4NEDA 4C0RA 1OQHA 3GEZA 1LB9A 5BS6A 4R75A 4XSZF 3FASA 5KDTA 2LAOA 1FQEA 2FBKA 5DYMA 4MTEA 3FV2A 2IEEA 5L8DA 2ELHA 2RVCA 3PQJA 2VE9A 1N3XA 3ZP5A 1I6QA 1O63A 2O03A 4KIBA 3WTXC 3ONMA 2P0SA 4NQWA 3L09A 2HQ0A 1O57A 4LD5A 2KJCA 1VFEA 3IO6A 2BYVE 2LF8A 3TQWA 1UTBB 4M6YA 4I2OA 3PV0E 2P5LC 5H8FA 3MZBA 4Z7EA 4U22A 5H6QA 3M3KA 1TBXA 1B7HA 1FWZA 2QS4A 1GV8A 1QJMA 1ZG1A 4RB3C 4AD9A 2VN2A 2IA1A 4QFPA 4YMAA 3WAEA 4Z2YA 2UVHA 5BPDA 2XRNA 4OQOA 2EA4A 1QBJA 3BP8A 2A5TB 4OZ9A 1TT1A 1XDUA 3E3KA 3TCHA 5H8FB 4I01A 1FYLA 3KFWX 4I7HA 3TYHA 2Y48A 3IX1A 3KLNA 3IJOB 4LONB 1V4RA 2I58A 5FLXK 4P9UA 4ISUA 5DEXA 1ON1A 1MGTA 4Q4ZF 4A6DA 3HOSA 2O0YA 4YKPA 4GGGA 4A6EA 2WC2A 4IVNA 3RLFE 2H94A 3QRFF 2R3SA 2O6GE 4GXAA 1VSOA 3RKWA 2HAUA 5K5OA 1POTA 1B6AA 1P1WA 3H6VA 3HTSB 1Y20A 3V8JA 4HDUA 4KQPA 3SESA 3S2WA 4PGHA 1V3FA 4YFXF 3DF8A 3N26A 2X26A 2OJTA 3I64A 1EH3A 3VVDA 1DSNA 3O9PA 1EZPA 4H8JA 2GH9A 1JW4A 1MDMB 4CO8A 2L3DA 2GQQA 1TNTA 1K78B 4WXJA 2DLLA 4ND9A 1ZMGA 4QSCA 2IVMA 3LC8A 5HBCA 1BI0A 1OQGA 5FD6A 3Q9SA 2ONSA 4O3AA 1UCRA 3WGHA 2FMLA 5H8NA 2CSOA 3QPTA 3QP5A 3HN0A 4DXBA 1VE4A 1D3YA 3WTYC 5IAIA 5FFZA 3JW4A 2VONA 4NF5A 1DTZA 3WODF 3K00A 3CJNA 5D4SA 3DV8A 2RNJA 3FXRA 4DCYA 1D8JA 2TDXA 3IKTA 3ILUB 1K7AA 3CG1A 5J1DA 1A7LA 3HV1A 1YTVA 1ZG3A 5D6FA 4AIKA 1J75A 2YSRA 4XIGQ 2RGVA 4DIGA 3IB0A 3LUYA 5JEIA 3LQQA 3EF7A 4YZZA 1D9YA 2Q9TA 3CSBA 4PFYA 1D8KA 3GBBA 2RCBA 3RIRA 1LBCA 3DP7A 4EJVA 3BBRA 3C18A 4ZDMA 2UVGA 1WWXA 4R9FA 4NF6A 2MC3A 3BJ6A 1Z7UA 4G94A 4OYVA 4Q0CA 3GFLA 1NKXA 2I0CA 3PUVE 1W5TA 3U93A 3UN6A 2XVCA 4JWYA 5KK1A 1JVYA 1YPNA 3DPTA 4HDVA 3TELA 4IRIA 5TU0A 2PYYA 2A07F 5H8QA 4LVQA 4XKNA 3TKDA 3KZGA 4C1UA 3KP3A 3I5OA 3EHSA 3WAFA 1DPEA 1K6OA 1IQ7A 3BJOA 2HWVA 2G29A 1IXSB 3T0YA 2BE5F 4XBFA 1FBSA 4OENA 1L0OC 3FMSA 5K5RA 2OU2A 1EH7A 3MW0A 2EFPA 4H5FA 1IN8A 4HF2A 1FBUA 4IGTA 1R00A 3BPVA 1MQHA 3MQ0A 3KCCA 5DD8A 1HW5A 1B3HA 2NNNA 1TLHB 3T66A 1Y3NA 2PEXA 4F22A 1XGOA 3KGCA 4ZZDA 1EH6A 2VOZA 3JYRA 3CO6C 4AB6A 1GTKA 2KIFA 4WKMA 1IN6A 3WU0A 1Q1KA 3FX3A 3VLVA 3HHFA 4MF3A 1TW2A 1MDP1 3REOA 4DDDA 2P5VA 1N7WA 4ESXA 1J9IA 3GZ6A 5ILVA 3C32A 3QSLA 1BI2A 2ESNA 2IJLA 5L9OA 2VHAA 3CUQB 3E6CC 1UHWA 1XT8A 3G3KA 3GFIA 3Q5FA 4JXIA 4R2FA 3THIA 4MLQA 1KU7A 3G3GA 3ZMTA 3PPOA 3UIFA 2KLFA 1O7FA 2EB7A 1XMKA 3RQTA 3RY3A 2V1DA 2PMSA 1AIVA 5LRRA 4EGYA 1U5TC 4MNUA 2R9JA 3BKIB 3KBRA 1P6RA 4Q5TA 4XXUA 2A69F 5CVUA 1XSXA 4IO5A 1SFXA 5D4RA 3UGWA 2WV0A 4WCGA 4G68C 4X48A 2FSWA 1FZPB 1I1SA 1LB2A 1RKMA 5E18F 2ONKE 3SEUA 3Q26A 3TGNA 3TPAA 1LDKB 4YB7A 3C36A 2XX8A 2XXTA 3GZ5A 1T39A 3IOVA 5H8SA 5KZTA 1Y1ZA 2HR3A 1USSA 1M5CA 2MH9A 4OHNA 4OFJA 2EFQA 3TQLA 4ENJA 1JNFA 3HSRA 1LSTA 1MKMA 3ECOA 3V83A 2RKMA 1DDNA 1KU2A 4GXOA 2M87A 1WKMA 4P5OA 1D9VA 4H1XA 3IORA 1MJAA 4QFOA 5IKBA 3EUHA 2DO7A 5DT6A 1GVJA 4G68B 5CM6A 1ZARA 4EGZA 4R79A 1O64A 2IT0A 2DWIA 1OR7A 5TRDA 4UVBA 1DPPA 4FX4A 1XGSA 1I1GA 2V1UA 1VFDA 3ZN1A 1TFAA 2V9VA 2P7VB 1HSEA 1S6LA 3C9HA 2YX4A 4BQAA 4L18B 3V7RA 4JB7A 2V3TA 3O28A 3J81K 3ZKLA 3FHZA 1GGGA 2DWHA 1MDQA 1ZLQA 2ZNYA 1IXIA 1BC7C 1LDDA 4BDQA 3H03A 2DI3A 1BIBA 1PB9A 4MH5A 2HZTA 3MQ9A 4DLDA 3OXNA 3ZMDA 4Y13A 5J6XA 2F97A 2Z22A 1I27A 1ZRDA 2VXZA 3OMBA 1IIWA 1JHFA 5K5QA 3OO6A 4RGSA 3IWZA 4NF6B 2P1SA 4ZYHA 5A2QZ 3R6SA 2O61A 2Q2AA 1ZJLA 4FEDA 3ROUA 1SFUA 4R74A 2DFIA 4FX0A 2B3BA 4CDGA 5D8KB 1R22A 2F7AA 2MD5A 4HV5A 4HQMA 3ISPA 4UVCA 3EYIA 3KP2A 4G9YA 1MQIA 3DFGA 4PFUA 4WXCA 1T2KA 4YAHX 2OZZA 3KN3A 1MY3A 4YU0A 3MZ1A 3RUMA 4RGXA 3E6BA 3HHHA 4B8XA 3N5LA 3I71A 2YPRA 4NWCA 4EM1A 4EQBA 1N84A 1KGSA 4HV6A 3V8LA 3CDHA 1MQDA 5KCJA 3ERED 3BROA 1SMYF 2YU3A 5AIPA 1B05A 1C0WA 5LEJA 3RPWA 2NRAC 4K3FA 5DYHA 5HS7A 3GUDA 3VVEA 2PJPA 3PUYE 1LNWA 3F8BA 2XAFA 1NNTA 1P1OA 4ENNA 4RXLA 3C3WA 2Z5UA 3CFLA 4KYSA 1Z6TA 3RPQA 4KHZE 1LCFA 2GRVA 1WRJA 1T98A 4F1YA 4CXFA 3SERA 1T0KA 3I5UA 3M8FA 1DUXC 2XHKA 4N13A 1HW2A 3MFKA 4LFUA 1YW7A 2F5EA 3RYPA 4LQ5A 3FMRA 5ELVA 2VP1A 1PBPA 4UACA 4EUOA 4A0XA 3KSXA 5HDKA 5ICQA 2L01A 2D1HA 1MY1A 4G8XA 1UTBA 2XXYA 3K1NA 1R1NA 3CSGA 2VBYA
chains in the Genus database with same CATH superfamily
5DCFA 1B5HA 5JLWA 1MBEA 3FWEA 4N07A 5C4JJ 4DYRA 3ELKA 2ZB9A 4ZYEA 4BS9A 3BOQA 1UJ8A 2IA0A 2JRTA 3ZMSA 2E36A 2F4MB 4DQ2A 1SC7A 2XWVA 3BDDA 4A3FJ 4XF5A 1FTAA 4QFNA 4GBWA 2Z8EA 1UTHA 3WTTC 4E7SA 2V25A 5CMCA 1R49A 3NRVA 1HKTA 3PU5A 5I57B 3RPUA 4U2RA 3GFJA 4M74A 1NNPA 3B73A 2Z1DA 2RN7A 2UUZA 2KIUA 4XM3A 1OMPA 1P1NA 3GLBA 1RUNA 4XLNF 5GPCA 4OMYA 2NS0A 2GHAA 3BTIA 3W9VA 4Z0IA 1LFUP 4U7DA 3EYYA 3WTSC 1FQCA 3VXBA 4HA8A 2PVUA 4LLGF 5CVJA 2O1MA 3ULQB 3PSIA 2HKOA 3LAPA 4O3CA 1U5TB 2D45A 2QF7A 1OCTC 1XCBA 4MO7A 5HDNA 1REPC 2DWJA 2XKOA 1Y39A 1W0UA 2HI3A 2PJRA 2QSFX 4XNFA 2R7RA 2VODA 3WTUC 4LZ7A 2UXNA 3CFZA 4G7ZF 1Z3YA 1T95A 2Y31A 2L7KA 4N4OB 1EYJA 1YIOA 2XSJC 2Z23A 5DCMA 4ZEFA 3PFYA 1LBXA 2REJA 1O3SA 1SVXB 4W1UA 2OCUA 4O7IA 3JZJA 2Z33A 4M9SA 4POXA 2EZKA 4UHTA 4D5CA 1Y3QA 2EWNA 1BKAA 2HYFA 3ABKH 2VQGA 2JSCA 3M7GA 4HQEA 5B5EC 3N4MA 2X6OA 2HCAA 3W3CA 2XX7A 4DZPA 3IRRA 4KFQA 2LSOA 3ECHA 4O8MA 1EYKA 4E6KG 3LA7A 2LP0A 2CEYA 4PETA 3TTRA 2UV1A 3E97A 2H98A 2JT1A 1BOBA 2QQBA 4BHCA 2QUFA 2Y7PA 2VKDA 1YFHA 2H8WA 2P4WA 5FTIA 1HKQA 1UFMA 3I59A 3K2ZA 1NNFA 3UA8A 1TWCJ 3KX2A 1TTYA 4HF0A 2E34A 2A6HF 1S7EA 1IDZA 3VFJA 2K4JA 3VFZA 4YG2F 4S05A 2EFNA 3VB2A 1LEAA 4H0EA 4BE1A 2EINH 3KZZA 4XKBA 3G7WA 3DPLC 3OO7A 3TO6A 4CICA 2Y7KA 4OIOF 2IGNA 5DCMB 1FIPA 1B1HA 3BIHA 1A36A 3DU6A 4O6JA 1N7XA 4FISA 2EV6A 5CMBA 3LR1A 5H8HB 1PP7U 1A5JA 2O84X 1FLIA 1P9QC 3OENA 4AM3A 4XORA 1OYIA 3OR1C 4G12A 1LFHA 3M1CA 4NE4A 2PN6A 4K2EA 3O6HA 3WU1B 2B9SA 1IAWA 2WYKA 3H06B 3WHCA 4QXDA 2F5CA 2CS3A 3F23A 5BUUA 2K9SA 4HCWA 1GR2A 4E7HA 3JSPA 3BTLA 3V5AA 2KZGA 2L7FP 5E20A 3K6UA 1T38A 3H6TA 2XX9A 1TWHJ 4LG3A 4F3BA 1LBWA 3SEZA 2EQRA 5EG0A 2HHMA 4LG0B 4OIQF 1FJLA 1V5EA 1IMEA 4BDLA 3M8UA 2P6SA 2CQKA 1OQYA 1WJCA 3MN2A 2VBZA 5F1QA 4V19K 2HFHA 5AA1A 3ZQLA 4S0HB 3DLNA 2WAFA 2ISZA 2VT3A 3RKXA 4R1HA 5EEGA 5J8FA 1R6ZA 1Y4CA 4XLCA 1ZG5A 2QBYB 5HNHA 1D0YA 3C1DA 2UVIA 2CW7A 3LSHA 4ELQA 3U2RA 3PMWA 1ETOA 3AG3H 4KDPA 1Y8RB 1OPCA 5C44J 5JK4A 4X8RA 2EZHA 1JJ6C 3EHUA 5EEAA 4M9ZA 2BVMA 4U4XA 2W25A 3A0BC 3HRSA 3QXMA 2JSPA 1XCVA 2THIA 3VLUA 4RAZA 3S1MJ 2BJJX 3TW7A 4C9YA 3QWLA 3BIGA 5EEHA 2P81A 5D6EA 3IAS2 4B44A 3FJGA 4DYCA 2OTLI 1IEJA 2LRDA 1K78A 1MBKA 1YE9A 1OFCX 2HXOA 3O3KA 2CMOA 4LA9A 4F3PA 4EJUA 1G3WA 2FNCA 3CJRB 4L9NA 2OBGA 4LIVA 3F0CA 2DMPA 3HSFA 1B9JA 1L3LA 1FPJA 2NWJA 5LDZA 2XWIA 2Q8KA 2H9BA 4HF1A 4FECA 4G6QA 4RJZA 2XKPA 4O3BA 3T8RA 3CP2A 1MMSA 2O3FA 4KN4X 3E1SA 3IHUA 2DSFA 4IY5A 3GTGJ 2E60A 4A5MA 1GT0C 2QA4I 3G1MA 3QU3A 3KPHA 2R7WA 1UTHB 2CV1A 4QBAA 1J7KA 1RI7A 1VDWA 4P0GA 1USTA 4M71A 1FBQA 5CVIA 4G2ZA 1RESA 2CFXA 1ZAOA 2V9PA 4GO1A 4JX6A 1DGWY 4UB6C 1I3QJ 1LPQA 1SD5A 3MD2A 5IOYA 1DP3A 3H7MA 2KLOA 4XQFA 2L7ZA 4E0WA 2JVHA 2NOGA 3FDYA 2R6GE 1V54H 4HCYA 4LIUA 4BJ6C 1FX7A 3LSLA 3DEWA 4D1QA 5I2KB 1QRYA 3JRGA 5BWJA 4AIJA 2UWMA 1OIBA 2KHMA 1IGNA 4O7MA 1SVMA 1P7IA 1QHHD 1KU9A 2FVZA 5ITOA 3OIQA 1LEBA 4BDRA 3F21A 2XXKA 1FYMA 4Q30B 2CZLA 4GWUA 2X1CA 4GCVA 3S14J 2OV7A 3K0LA 2W84A 2IP2A 2NVYJ 5E1ZB 4U0YA 4J00A 4QSEA 4WXHA 2ZMBA 1JW5A 2D5WA 5IT3A 1X3ZB 2ME0A 2ZYMA 3K6WA 4E7JA 3SEVA 2HPIA 2PMHA 4EQ7A 2L0KA 2A5SA 2G93A 4N8GA 2XWOA 2ZBKA 3P9CA 3K69A 4RAYA 5KAFC 4N6PA 1IZ1A 2I0BA 4IHVA 3Q9VA 3QYTA 3BTJA 1B3EA 1H88C 1CNQA 2Y0SA 1CB6A 4BLAA 3QYEA 3B50A 4GWWA 5A5XB 2VC1A 1IXRC 4M3DA 3CG3A 4HTGA 2ZMEA 4B48A 2DTZA 2ZXHA 5EGOB 2DE3A 2F78A 3IP4B 2CGPA 1Y3PA 3OYNA 1SD4A 2V84A 2I4BA 2IS6A 2XDVA 2FIXA 2W1OA 4F3QA 4YFNF 1ETYA 5IP6A 3H5AA 4RB1A 1A55A 1M5BA 1QVSA 5ICEA 2LDUA 1NUWA 2F6GA 3TZAA 3FM3A 4RM3A 3IOWA 1B3LA 3BR0A 4E7KA 1ZRFA 4NG7A 2VT2A 4PGGA 3RZDJ 4ABZA 3PMXA 4CYDA 1FOWA 4OVTA 1X1AA 1KYZA 2KQZA 4PDHA 1FPBA 3WE2A 2Y7IA 3MEXA 4BDZA 2LFBA 3BG9A 2LF7A 2P3VA 3FD3A 2KIQA 1SD3A 2W85A 3CC4I 1B32A 3TP0A 1UIVA 3PIPF 4A0ZA 1INPA 3TP3A 3ESWB 4G61A 3KYLA 5AA4A 5I5PA 3KLOA 4JX5A 3JCUC 3JRDA 4NAPA 2PFYA 1MH4A 2COMA 3U72A 4Q47A 4OINF 2AYSA 1Z9CA 2LK2A 1MBHA 1WJEA 5TP9A 4FATA 1B72A 1IXCA 1LAFE 3MMYB 3VSLA 2H99A 1G8XA 4KUMA 2W48A 4B3XA 3VDXA 4PTKA 1W5SA 3CDLA 3DTKA 3C35A 4I9DA 5M5WJ 2QLZA 2VT5A 1EA3A 1FRPA 3DP6A 3SXYA 4FEBA 4MNCA 5ITPA 2RQQA 2PLYA 2HU9A 4MFDA 1D9QA 4EJTA 3RKQA 4P1EA 1VQOI 1NUZA 2MLGA 2LR8A 4JQFA 1B6HA 4PCDA 2XXPA 5DD4A 3TCGA 4U1ZA 3TKYA 2GA2A 3H5NA 4NWDA 3K4JA 2XA5A 2QZ8A 1SYIA 4GBVA 2E7WA 3HIFA 2R5YB 3S2DJ 1TQIA 4RB0A 4PE3A 4KFCA 3I3LA 4IPAA 4XLEA 1JEUA 1P99A 3LA3A 2EZLA 5M3FJ 2L54A 3T9XB 1O7TA 3KETA 1Y1MA 3JV9A 1WI3A 1YW8A 1T8IA 4RK2A 2EH3A 5HLIA 5D5VB 2Z16A 3JREA 1MY4A 2QMXA 3G3HA 3A3UA 2FA5A 3ODBA 3CCEI 5IZ1A 2JUCA 2X7QA 2JJ7A 1KZHA 2Q8JA 3V7SA 2DPUA 4GX4A 3K6VA 3HOTA 2FF4A 5K7HA 1XPXA 3JRIA 2EBIA 3PL8A 3FXQA 1TT0A 5F64A 5C4XJ 3C34A 3K0VA 4OWDA 4XKPA 3FZVA 4M3EA 5ED4A 2IXSA 2K4BA 3OIPA 5A5XA 4U88A 2WWYA 3I6VA 4BJTA 3HOZJ 1QNTA 2WX9A 4ZZEA 1A04A 3OYIA 2X1DA 4M73A 4V2GA 4B43A 4QHQA 1TNSA 5I2NA 4II2A 1FQDA 4BQOA 1YTYA 4GL8A 4PDDA 1ZKGA 4QLCU 4U23A 2OCCH 2X0LA 1W7PA 2VOPA 3LSXA 3OSQA 1FC3A 3J80Z 2I5UA 3QK6A 4R2BA 3JTGA 1ZKBA 4RMNA 1S9HA 3U1OA 1MNDA 3R0JA 1WFXA 3HZJA 2W7YA 3RTWB 2VPOA 4G77A 5EQAA 5FLXZ 4GVOA 1BJZA 1UG2A 3G2BA 2OQRA 3W9WA 3TO9A 4A12A 1YAEA 4YIIA 4HOBA 1FQAA 1AA7A 4PZJA 5HM4B 1A6QA 2Y69H 3WTWC 4IO7A 3K01A 3WAFA 4LUBA 4OEVA 4DOZA 1IUYA 2N8GA 2I49A 5I2NB 2W82A 5LGUA 4KIFA 3CMAI 3I4PA 5B7DA 3E5XA 3HPIA 3FVKA 3L9FA 4CGZA 2CG4A 3GLLA 1EU8A 2Q8MA 3OOPA 4RYAA 1Y56A 3ZMUA 5E3MA 3JTHA 4ESWA 2XPVA 1LFPA 2DOJA 1X2NA 2V1XA 3JRBA 4KI0E 2NVQJ 4YRVA 4FHTA 1R5GA 1HXDA 1JETA 2PX1A 4GRKA 4HW0A 3COAC 2A3SA 3FKJA 1FTTA 2COBA 4AYBA 2E2HJ 4POWA 3RPLA 3UK4A 4RPOA 4BY7J 5JVTA 1ZGAA 3FXLA 3ZQ7A 5L3DA 3KZIC 2P7CB 1RRJA 1B1XA 4PFIA 1DCUA 4YKIA 2WAQA 1SANA 1BIAA 3ZGKA 4RDUA 2PMZN 5FFXA 1YS7A 1K4TA 1Y6IA 4HX7A 1SDXA 2ZMEB 2QMWA 2F6PA 1OKRA 3L2WA 2R7QA 3CCRI 1FP2A 4F7ZA 1FTOA 4L17A 3MUQA 2CZHA 2M8EA 4Y17A 4Q48A 3TMOA 2AO9A 1Q9DA 3KJTA 2VBWA 4M3BA 2KRCA 2IPQX 1JQFA 3H4ZA 5IP7J 3KJ7A 1JGSA 1QZEA 3OOUA 4QPQA 1CF7A 1PBQA 4ELPA 5LTCA 3L2RA 4ON0A 2DWAA 3MC2A 2M45A 1M5DA 1KQ9A 1VQKI 1FYKA 1BTJA 3H36A 1GXQA 3QUFA 5AE4A 5BQTA 2Q0OA 3LSJA 5ET5A 5E1XA 2PI0A 1H43A 3KZYA 1O3RA 1QZZA 5K7ZA 3G3IA 3A03A 3PO2J 4U87A 3F22A 2DS9A 5CRYA 4ESJA 1I69A 2DMQA 2OX3A 1R6RA 3KG2A 3K02A 1GVCA 2VASA 3RKYA 4XRSA 2BXYA 5I2KA 1QW0A 3Q29A 2ZXJA 4WEDA 1OMIA 3V8KA 5I57A 1G0HA 5H20A 5EZGA 4MJOA 2E35A 1E2XA 2B4LA 3F6VA 3WE3A 3OL3A 2QBYA 5L9SA 2D21A 5E3OA 4GFBA 5IYCJ 1VQLI 2F2EA 5CMMA 2HXWA 4O94A 4XLAA 3LAJA 2V9KA 3K1PA 2JA5J 1PB7A 3GTQJ 3M3YJ 3IFCA 3PUWE 3L2VA 4I99C 2K7LA 2DJNA 3QAXA 4IB2A 3MVZA 4KJZA 1YXIA 4GLIA 4H5GA 1Z7NE 4FBPA 3Q28A 2M8CA 4BH9A 1B4AA 3LSWA 1LBVA 4MBPA 1YHQI 4U0VA 1R4MB 1XB4A 3OYCA 1DP7P 1FQFA 4F1UA 2P5KA 3CLQA 1SPIA 2DXIA 1QZYA 2E7XA 1SW2A 4F39A 5ERIA 5E3LA 1XC1A 3JR9A 3LFUA 3HJEA 3WG9A 4JDFA 3K2AA 2WAQN 2X1EA 4OTEA 3DM0A 5EDNA 2RC9A 1W36C 3VOEA 4AYBN 3S4UA 3BG3A 3GX4X 1TC3C 2UXAA 4BHPA 1B46A 2H4IA 3SEYA 4RBOA 3ZKKA 5EYRA 2QVOA 4KPTA 1LVKA 2R93J 1ZLJA 4NTLA 2MABA 2VGQA 2K3PA 4H4KC 1TP4A 1W7PB 1RPWA 2JN6A 3CCUI 1MPDA 5AA4B 2M8GX 3HRTA 3SKPA 3KC1A 3OO8A 2EJRA 3VYTB 4UUSA 1K6YA 3S1QJ 2X51A 1TT5B 3LWFA 5ET7A 4OEUA 3G73A 2V3QA 2B0LA 3F9KA 2PBIA 4IXAA 3IK6B 5DM6F 4F3SA 1OVTA 4FT8A 2GIZA 1I6XA 1RNLA 3R4KA 3E7LA 3B7DA 2XC7A 1G3YA 5LGTA 2X6WA 4PE5B 4JBZA 2R7OA 2ACJA 3GZGA 5E1WA 4D5FA 3S2VA 2PG4A 2HGCA 3R7XA 3HC7A 3U1DA 2RC8A 2IBDA 1LAHE 1HKSA 4ASNA 1H9TA 2XD3A 4BNCA 1SFKA 4IO9F 2L4AA 2CW8A 2ISYA 1MM6A 3KP6A 3H3UA 1HBXG 1ANFA 2A68F 1JUPA 3BQZA 3FISA 4HPQA 3HHGA 2EFWA 2ZXTA 5D5UB 1LFGA 2J5OA 2ELKA 4I6ZA 4IX7A 1SFEA 3E3VA 1NV5A 3W6KB 2QVUA 2R7VA 3FBIB 1E3PA 1H44A 3TEDA 3M9AA 1KWHA 3A2KA 3NARA 4A2UA 3OEKA 4A3IJ 1ZRCA 4HAMA 4AU7A 5L3GA 5I59B 2FNPA 1UB9A 1IXHA 1FTMA 3LSRA 4EF2A 2HKXA 3U1KA 3OYDA 2KJBA 1M5FA 1RKTA 1QUKA 2MA3A 3O6GA 5F7VA 4L9TA 3U94A 2YR2A 4P8BA 1D3KA 4PJ0C 3D5LA 1EH8A 2HYGD 4ANJA 3OS1A 1B4ZA 3NWTA 3IAM2 2OLBA 3C2HA 4UXNA 5JTYA 4A3JJ 3S1RJ 4XKCA 5TPAB 1CE2A 1U2WA 1BA5A 5HS8A 3USDA 2RINA 4JSDA 2F4OB 3HL2A 3GXAA 4DI4B 1MY0A 3PSFA 3BFUA 4EQQA 4MEXF 4NF8B 2EV0A 3BY6A 4H6DA 2M9HA 3K4BA 4XMYA 3ZMZA 1F36A 3EPEA 1WVJA 4EDPA 3H6WA 5I84A 1D0ZA 3QU6A 4XRFA 2E1MB 2FBIA 5ILUA 5IY5H 3KOSA 3L6GA 3PUXE 2IGMA 3DEUA 1LAGE 4RGUA 3MCZA 2XAUA 3IR1A 5M3MJ 2KDOA 1R1UA 4M6XA 2RAEA 4AIHA 4D0PA 2W57A 2QSGX 1HQCA 3SHFA 3CUOA 1WJ5A 3MZYA 5LHGA 1MZBA 4ENMA 2NAZA 5EQ9A 3H3GA 4ZEDA 5EQ7A 4RK9A 2O8XA 3M4OJ 3PPQA 1RETA 2XROA 1NL5A 1X1DA 5ESYA 4FTHA 1FPLA 5HLGA 3MP1A 3A0HC 2F3BA 1WH5A 1M1EB 3BG7A 1N3WA 4R6YA 2ZMEC 4HLYA 2CV2A 5K2XA 3F8FA 1B7UA 2X6XA 1XS5A 3NOHA 4E7IA 1A6IA 4A3DJ 1AMFA 1W36D 4P9FA 4DIQA 3WGIA 2QKMB 3LA2A 2Q2EB 3D1NI 3HCQA 4DCXA 1NH8A 2HQNA 3NWSA 5IYDJ 4G4PA 3IL2A 4F1VA 1FIAA 4E0XA 2I8DA 1F1ZA 1DPRA 1UHMA 1U8RA 1USYH 5FJ8J 4EM0B 3GTMJ 1QQIA 4O5VA 3PPNA 3H3VK 4I3YA 3T1BA 5B70A 2PMZA 3PM1A 3OYAA 2IRFG 2DE2A 4PAKA 3K6XA 2V1NA 2VQLA 3SZPA 5FHNA 3HB9A 1B3GA 3KE2A 1OYYA 4C2UA 1GLNA 2FQ3A 2JA2A 2DTRA 3GO5A 2WADA 3ZQHA 1B2HA 2VPRA 1SQYA 3P9IA 2QVVA 1YJNI 3J7AO 4BBSJ 2XXXA 2XGEA 1URSA 4H46A 1POGA 1US4A 1KA8A 4XN3A 4BDMA 5ILSA 4Q5TA 4YB6A 5CBRA 1XDSA 3HUGB 1BK4A 5ICCA 1ELJA 3IAZA 2GLOA 2B65A 4RA1A 4I98B 1R71A 2GM4A 4U4SA 2ALUA 2XB0X 1SW1A 3R26A 1KA0A 4BE0A 3N6UA 3BR3A 1BW5A 4CYCA 1YJWI 1FBHA 3FK6A 2PJRB 3TUSA 3AG2H 1WSUA 1YX5A 2DT5A 2LBFA 2ZSHB 1RUOA 1TWAJ 3C4MA 1ON2A 1QKAA 3K2DA 4RNSA 1M5EA 3KP5A 3H9GA 5LHHA 4LB6B 3T22A 1TWYA 2F3DA 4QFLA 3EN3A 1PUFB 2OAZA 1X4OA 2ESHA 3I58A 2F6CA 5K7FA 1P1QA 2Y5KA 3CO7C 4P1WA 3AG1H 1QUJA 3AXFA 4UABA 3HGGA 2DBBA 2H5YA 1LBBA 1FMWA 3N05A 1X4PA 4N9HA 2M30A 5IT9Z 2R5ZB 1UHSA 2ZCWA 2CWEA 3BZ6A 1LBZA 1ZREA 3H9QA 1T08B 4EM2A 1A8FA 3PUZE 3TBIA 3GTJJ 1KU3A 1ZBMA 4OA4A 1GXPA 3MKYB 3F8CA 1NMUA 1EZ9A 3TOBA 2QWWA 2ECCA 2O1LA 3GTPJ 2CUZA 2KT0A 1J1NA 1UIUA 4MNPA 2EPFA 4M9XA 4MEYF 3K4MA 3PQKA 4QF9A 2IGKA 1MPCA 2YX7A 1R9QA 1PYVA 4YELA 2BW3A 2QRYA 3OOAA 5CQGA 1QUIA 4I3EA 4KITB 2XPUA 3S3OA 1PDNC 4R6HA 5JFRA 1MPBA 3RI4A 3U21A 5J3LA 3OSRA 4N8YA 3EUAA 1O7LA 1GDTA 4IKFA 3HKZN 2NOOA 3H5RA 2YPNA 3FHNA 3U8QA 1BLFA 2Y84A 5EF6A 3I53A 1MDMA 4QSDA 3DEEA 2STTA 4ITVA 3BZKA 4F93B 2HZKA 4YB5A 3LSIA 4QPOA 1J5YA 5KAIC 1HDPA 1LKXA 2XIGA 1YYVA 2E5ZA 4LK0F 1RDXA 4IJAA 4FIMA 1R1TA 4EEFG 4N91A 3PPRA 3FGSA 3G3FA 4ZECA 2V3UA 2GWRA 5CPRB 2PBWA 4IOCF 4PC9A 3U92A 4BDOA 2DVZA 2BHZA 3EQLF 1B5JA 3TDJA 2Y5LA 2B4MA 3EHTA 4BEHB 4RA2A 1HDDC 1VR5A 4F91B 4C3HJ 2AXTC 1IN5A 5JLXA 4B09A 5GTHC 3L00A 1I6BA 2G7HA 1ZLKA 2E1CA 2KL4A 4A3BJ 4A3CJ 1F9BA 2AL5A 2ZZWA 3DBLB 4XKWA 5HS9A 3FXBA 3VLWA 2O7OA 3MJNA 1LLSA 1URGA 2HTSA 2HQRA 1DTGA 4PAFA 4IRHA 4ZE8A 2OZ6A 4MIMA 3CCYA 2DJIA 2WY8Q 2V6CA 4DBRA 1MXZA 1PDAA 2AXLA 1IG7A 3VE1B 2O6AA 2FNAA 4Q5SF 2VQCA 4KNYA 4LLNA 1ATGA 1YJ9I 1FCKA 3CR9A 3T8TA 2FA7A 1XG1A 2ZJ2A 2F8DA 3ECRA 2HQAA 5BPIA 2I6EA 1OYWA 1LE8B 3HOVJ 3RJPA 2OK2A 1TQPA 1B3FA 4UUVA 4PGPA 4C3IJ 3E13X 2QQ9A 2XAQA 2HEOA 4HYEA 1OLTA 2NS7A 3M8EA 2CW0F 2MBFA 3J81Z 1P1UA 3PTYA 4P0IA 1FSAA 4OXVA 4FE4A 2IGOA 1FSHA 4IO2A 5IZZA 4TLLB 2BBYA 3T93B 3O2PE 2DW4A 4PAIA 3MPLA 2E1OA 2FQ4A 4CHUA 4DXUA 3E79A 1P2FA 1PEBA 2X85A 1VQ7I 4OFOA 3HRUA 3LOCA 2YUSA 2VKVA 3M1EA 3QYBA 4EV0A 4MQ9F 2V7FA 3FXJA 1ETQA 5B3SH 3S1NJ 2XAGA 5DVFA 1B1BA 2M4KA 3CTAA 3G3ZA 1X3WB 2GOMA 3TO7A 1I50J 2UVJA 3SEWA 1SEUA 3D0SA 1WJDA 6PAXA 4HEA2 2PT1A 2VPLA 4J01A 2O7UA 2ZNTA 1LUJB 1B59A 3OIOA 3CCSI 2FIEA 4R73A 3TFLA 1Z6RA 3OV8A 2NVTJ 1UZCA 1KA1A 2XASA 3G4SI 2QYOA 2RKHA 3H0GJ 3S2HJ 3OYMA 1T33A 3HTUA 1F43A 3IFAA 4EXLA 2JA7J 2EZIA 3ZQGA 2VD3A 2F7CA 3FXUA 3NQOA 1NH3A 2DMTA 3DKWA 3CJQB 2HPMA 4ZDOA 3P7NA 5GAEJ 3WGGA 5KDTB 1AOVA 1VTNC 4OETA 3TCFA 1XC5A 4FE7A 1XMAA 3R61A 2DDKA 5BNGA 1QGPA 3IH2A 1S5LC 4M3GA 2Y7RA 4U1OA 1O3QA 4KCCA 1Q1HA 5IT9K 2R8TA 4HZFA 3ZPLA 1W7PD 2UYFA 2L5VA 4KYDA 4PQJA 3VVFA 5I58A 1KQ0A 2LYCA 3WTZA 4CCKA 3SETA 1NK2P 1EV7A 4NMYA 3HSEA 5B1BH 5ICTA 4OMZA 1N76A 1Z21A 5BMZA 1PUEE 1HC8A 4X9TA 1MSEC 1RDYA 3MWBA 2F5VA 2WYPA 2XXQA 2YS9A 4OWRB 4RS8A 4GWYA 1AH5A 3B6QA 2NUVA 4U21A 5FHOA 5FBPA 5DM7F 2PFZA 4XRSG 1IUFA 2NYXA 3TDZC 2HYJA 1TW3A 2DDBA 2LKPA 4DW6A 3RYDA 4AB5A 4C1TA 3GTKJ 2WBMA 1FQBA 3A29A 4MQVA 5FLMJ 5J1RA 2R71A 2O7IA 2K86A 2HTJA 3D5RC 2P2AA 1US5A 1E3HA 4JK1X 4LJZF 4ELRA 3PJRA 1RC9A 5FKMA 1G6NA 2WTEA 1S50A 2WBBA 3FVNA 2OD5A 2D3IA 1OLCA 4NN3A 4G8NA 1MSFC 3TTNA 3FIRA 2L4MA 1OVBA 4OVQA 3I0TA 2FX0A 2CO5A 5JHUA 1LAXA 3G3JA 2M7BA 2V4CA 4IO4A 1U3EM 3T9HB 4P11A 4L9VA 1SAXA 1R7JA 4UV9A 1RZ4A 1OCCH 1R5ID 4MLOA 3I59B 5AIQA 5EQ8A 2I48A 1ZTRA 3RPLB 1W4MA 4PFTA 3BWGA 3LMMA 2V26A 2DT7B 1XX5A 2GFEA 5DVIA 3IL1B 4TV7A 5F24A 5DW8A 2F35A 5CLSA 3O6BB 3QOPA 2LOOA 4ZEKA 1S3JA 2PMUA 3HXLA 1WQ2A 5TJJA 4IGRA 3N94A 1LQ1A 4EVIA 1XGMA 3FATA 1Y9UA 1G3TA 2KQRA 1AU7A 2CQXA 2HOTA 1XN7A 2FBHA 3NAUA 1VF9A 1S29A 4KXPA 4PF6A 1NUYA 3AG4H 3S9EA 5EJCA 4OIPF 1G4DA 3BG6A 3S32A 1B51A 4E7ZA 2ZKZA 1BJAA 4Y3OA 5AA2A 3W6JB 3K1MA 3GYHX 1JKQC 2LMDA 5JVGF 2DQLA 4OESA 2ZSIB 1IUDA 2I10A 4Y4RA 3W2VA 1JKRC 4BHBA 1BOAA 1IV6A 4P1LA 3DP8A 2VKEA 2MKZA 4DGWB 4HBLA 4LK1F 2XXWA 5E17F 4J19A 1HOMA 2HDWA 4MGRA 4PDKA 1MQJA 5FTHA 4A0YA 3MP6A 1MJ9A 1JVXA 5DVJA 4ZYAA 1B0HA 2REGA 2DQVA 4GWOA 3ABTA 4NF4A 4UNOA 1QPMA 3BZCA 3DLAA 4JVCA 3BLYA 3CCLI 1STZA 3DP4A 4YIFA 2K9LA 3ERMA 4R6KA 1IW7F 1S7OA 4DNCA 2CYYA 2DXYA 3FVGA 2B3FA 1KZ8A 5I56A 2DXRA 3A09A 3H6UA 1DPUA 4PGNA 3WU2C 1UQWA 2ZZXA 2GOXB 2K85A 1CGPA 3DCFA 1LB8A 3O8HA 3ZMVA 2PQ8A 1JTYA 5HOOA 1ZTYA 1N25A 5CVVA 5DV5A 4KYWA 5LRSA 1WHUA 4NF5B 5H2FC 3CLOA 3QUJA 3T9VA 4A3LJ 2KDZA 1A31A 3JAMK 4X6AJ 2ZJRF 3KEIA 4JWOA 1SI0A 1OJLA 2DODA 2MH2A 3V7CA 2XD2A 3S9MC 4WWCA 2OWSA 1FTJA 3TMGA 3IRQA 3JRHA 4M1VA 1S9TA 1ETKA 3GLXA 1QPIA 3V42A 4PFBA 5DEXB 3BPXA 3WG7H 1RYXA 2G7UA 2Z2SB 4RLFA 1XVYA 5I7IA 4G8HA 1I6AA 1BBYA 2DA6A 4G7HF 3QQAA 1OCZH 2DE4A 4E7LA 1FPFA 4FETA 4BY1J 1JEVA 4PFWA 3U9GA 1LEVA 2ECBA 4KCDA 4RAGA 3MSTA 5JR3A 1DMBA 2DMNA 1MD0A 1NV2A 5HODA 1X58A 1SI1A 3PD9A 4F2OA 3KYDB 4R8HA 2XF7A 3EETA 1D4NA 3IB2A 4FE8A 4X04A 3ZCOA 4G6DA 3QMFA 5DTBA 4QSHA 1OISA 3B6CA 1LJ9A 1QGXA 4WK8F 1IC8A 4G68A 4CCLA 1FSEA 2AQEA 3K4KA 1ODDA 2AS5F 1SW5A 1YLFA 2ZJPF 5M2VA 2Z3YA 3BTCA 3A1YA 1WDNA 5DUIA 1YS6A 1RKWA 5H6RA 4YICA 4UY8I 3M3LA 2Y9ZA 1I6HJ 2L02A 3E6MA 1TFDA 2DDAA 1S7YA 3GXOA 1K9YA 4WEPA 2QQ8A 2EIJH 4ZH4F 3VYSB 2GHBA 2BY3A 3L2UA 2HDDA 2A5WA 1IF1A 1XD7A 5F6FA 5AA3A 2ABHA 3LSFB 5IYBJ 4KR5A 3QIMA 4PCQA 4XOTA 1VQPI 2XXIA 4OERA 4ZS9A 3K70D 1JKPC 1S8NA 5E8IA 2DA2A 3E5UA 3VYUB 1U6GA 4BJ5C 3ABLH 2O8KA 2ANJA 4N15A 3TTLA 3SFZA 2I4CA 3ABUA 4WXDA 4GF8A 4KN7X 2NNYA 1NV1A 1R5HA 2H09A 2QS3A 3HDDA 3MKWB 1KYWA 3O2AA 2KZVA 3R6UA 2F34A 3IC7A 2R7ZJ 3TTMA 5D8LB 5C3EJ 3S93A 3RT8A 1X3UA 3S8PA 3FVOA 5L3CA 3TQNA 4NBQA 5I59A 2ETHA 2GZWA 2ZNZA 4LITA 4UA8A 5JI6A 4P96A 1SYHA 3F6OA 3IV5A 3TOAA 4EATA 3SDBA 4GOTA 3HO7A 4PFRA 4IHTA 1ONVA 1T0FC 2DK5A 1ZGJA 4RM2A 2PT2A 1UELB 3D1RA 2R0QC 4GRIA 3SYTA 1QHGA 3BCAA 4A3MJ 2QVRA 2ZYNA 3E4RA 4AQ4A 5AA2D 2LKSA 2VI6A 2DP8A 1HF0A 4IO3A 3K6GA 3OWTA 4XFEA 3CESA 2LNBA 2RC4A 5ICGA 2X6YA 1H9GA 2ME6A 3T5XA 5J40A 5LGNA 3I3VA 2M4GA 1OCRH 3B8BA 4YKKA 4S04A 5HVQC 1G3SA 3HG9A 1JE8A 1NG7A 3HRMA 3VWBA 2L9NA 4C30A 4A5NA 5CI5A 2L5QA 3CZ6A 2Q2CA 2QS1A 3V83A 4ZDLA 1YG2A 5LLQA 4JSOA 4F31B 1JW1A 1MMDA 3FF5A 5TISC 3GF2A 1NFTA 3MAMA 3ZQQA 1ORKA 4EF1A 3S9LC 4ZZAA 2R7DA 2FMYA 2M5WA 4HRIA 2CEXA 4GL0A 5D5XB 5KVRA 4UV8A 4RB2C 1D5VA 3KSJA 3P7IA 4OMBA 5JTYB 1B4HA 2BVLA 2HOEA 2OZUA 4ESBA 4F92B 1FY7A 1PVEA 4BKXA 4PBHA 3ASNH 3PNTA 1WCMJ 4GDFA 3PGFA 1L5TA 2QQAA 4Y52J 2XAHA 3I9V2 3ZQIA 1HLVA 1BC8C 2F7BA 4KT5C 5CVRA 2OWTA 3BG5A 3VXCA 2LG4A 3MVYA 1JHHA 1GVDA 2DQRA 1WZ2A 1XVXA 4X1BA 4UVAA 3HKZA 4UUTA 1O4XA 2QPQA 4L5IA 1H8AC 1FPIA 1P4XA 4GD5A 2PX9A 4R72A 2EA2A 4NHBA 3CUQC 3MZ9A 1X19A 1Z3XA 2GA1A 2BHYA 3GW2A 2B63J 2YJPA 4FJPA 5FO5A 3FUZA 3DLLF 4KIGA 2V79A 1ITYA 2ZYOA 4N17A 3TAJA 2Q2EA 2WEFA 1BI3A 2JWTA 3BR2A 1V55H 1K83J 1JUSA 2DYXA 5D5WB 2HPGA 2QFLA 2X7PA 3ILTB 3QAHA 1DBZA 3K7AJ 2ZFWA 5L9MA 4HW8A 3DTEA 3ZS6A 4XLFA 3MWMA 2ONRA 4F18A 1WODA 1B8IA 3F3XA 2DK8A 1YRNA 1YO5C 2H6CA 2V93A 4MLVA 3H3ZA 4B1RA 2FYIA 2LH9A 2Y75A 1Z1DA 1MNMC 4OVJA 4ZJZA 5EYFA 4UB8C 2E1MC 3OYBA 5K2YA 3T9UA 3LV0A 4YMBA 3RYRA 1XSDA 2R7SA 1SMTA 3I54A 2RV8A 5L3FA 1W0TA 2JUGA 5LHIA 2M2EA 3FXMA 1VQ4I 2C6YA 4ELOA 1RR7A 1D0XA 3AFHA 2RC7A 3D4CA 5I58B 4P9KA 1MXYA 5F0FA 1B9NA 2ZYKA 3HSTA 1LDJA 4IEJA 5TGTA 4JWXA 2V6EA 4BDNA 2GAUA 4I02A 3CC7I 4H45A 1N04A 5DTDA 3OO9A 3H9JA 1J0RA 1FT9A 1K79A 5DUKA 3I55I 4LB5A 3VDFA 2CZIA 3MVXA 3CMYA 2KRFA 4QIWN 2A5TA 3RTFB 2DVCA 3MP8A 4JBAA 2JK3A 3N97A 1BN5A 1N78A 3R0AA 2L9RA 2D5VA 1S7AA 4LGWA 1FTZA 4H0WA 1Q1VA 1ULYA 3K9TA 1FEXA 3IO4A 5I3SA 2HEUA 3S17J 3RTRA 4IOAF 4PUSA 3GVAA 3I56I 3TTKA 3F72A 1B5IA 3QPLA 4IY6A 1NTCA 2XAJA 1YCJA 3LSKA 4ZC3A 3J80K 1O3TA 1FOKA 3J7AY 5IM2A 4DJAA 1BIYA 2Y7WA 1IMBA 1NHAA 2CJJA 3HPGA 4E70A 2BXZA 4XLPF 4C2TA 5FRMA 1FOXA 3LBSA 5HNFA 2VLAA 4H8IA 3VV5A 1TWGJ 1ETVA 2DA4A 2DA1A 5F27A 1MXXA 4TOZA 2AQFA 1WPKA 5BOXA 1R9LA 2Q89A 3C2GA 3UNGC 2DFFA 3L2CA 2BEOA 2UXXA 1Y4TA 1FPQA 2LY2A 3K1NA 1N77A 4FCYA 1WGXA 1ZH5A 4ESFA 3T96B 1ZU0A 4O3MA 4AWXB 4GFRA 2K9MA 3MKLA 3VYRB 1MG1A 2WKYA 2FE3A 4FAJA 2QEXI 2OWZA 2H6BA 1MRPA 1MXWA 4BXFA 5LD2C 3O66A 1WJAA 4WX9A 3O97A 4ECFA 3IB1A 2RDPA 3X2QH 3RZOJ 2BGCA 1D1CA 2ELJA 3TL4X 1VQMI 1POY1 1ETXA 4XL9A 2A6EF 1A54A 3QYFA 3RGYA 4CCJA 2DFHA 4ETSA 5EHMA 2GXGA 1SW4A 3TDUC 4H65A 4P3LA 4IHYA 3A3CA 2YLNA 4PF8A 2CQNA 4R9GA 5H8QB 1AWBA 4YKJA 1AKHA 1FBFA 1ERDA 2EFOA 4DXCA 2QJEA 4XOPA 1LVAA 5E79C 2K27A 3LSTA 1QKBA 4I76A 5FB2A 4IHXA 2MFZA 2OQGA 4AIDA 3DTIA 2STWA 4F3GA 4N0BA 2LY9A 5LOMA 1P4WA 2XUBA 4XONA 1MY2A 5FKOA 4XKRA 1H45A 4YFKF 4XKVA 3SZGA 2K02A 1YX3A 3K4LA 3S3NA 1IMAA 1II5A 1YZ0A 1CF7B 3IJXB 1X2MA 4HNTA 3ABMH 5LEKA 4OAZA 5ISUA 2QM3A 3LNQA 3OSFA 2KP6A 2XV4S 2ZO4A 3IWFA 4LLLA 4Y7NJ 2D1VA 4MTDA 2NXOA 1QULA 5E8GA 5TP9B 1FBGA 1I5ZA 4MCOA 3FIWA 2R7FA 2HS5A 2DOFA 1FPDA 1Z67A 2F5DA 2F36A 4OVPA 3JRAA 4ZYDA 3IOTA 2ZNUA 2XXVA 1T56A 2FOWA 3DBRB 2TCTA 5J1YA 2WBDA 1USYE 2CUEA 4OIRF 4ENKA 1FP1D 4EQ9A 3TEPA 2UZKA 4NQ8A 1A35A 3HUGA 1KQ8A 1P4AA 2XXRA 2ZFUA 2RREA 1VZ0A 1VI0A 3RDIA 2HDCA 3EUHC 1IMCA 1LFIA 1J59A 5CQEA 3MZHA 2F5FA 4N4NB 4IO6A 1XHYA 3OD7A 3OYHA 4PJNA 2W7NA 2XGDA 4BAYA 4AVPA 5J4VA 3E0JB 3B02A 5GAHJ 4V2FA 3GBGA 3OR2C 4M72A 1F4KA 1MQGA 2WB1A 1MJBA 3C7JA 3SEXA 3D4GA 2H25A 1FPEA 1R36A 2E1NA 1ZN2A 4HSTA 4QWQA 2K5CA 5EZHA 1W5CC 2XWKA 4NNJA 1PUFA 1FNNA 3E6DA 5I56B 2R7XA 3VODA 3KP4A 2UYEA 5FHMA 3W2AA 4I0BA 5H8HA 1IRGA 3BR6A 3N6TA 4HX8A 1JKOC 2OBPA 1AWCA 2QSXA 2FXAA 2IA2A 4RY1A 3OELA 2GIVA 4RLQA 2NVUB 2J5PA 5CKTA 2E0SA 1JT0A 3GFMA 1FPGA 3CI8A 3B6WA 1GHCA 3TPAA 2R4GA 4LMYA 1J09A 2D2WA 5CJ9A 1ZYRF 4MEVA 1DOTA 2P8TA 2ZNSA 4MHFA 2A5YB 2QENA 2DA5A 5GADJ 1A8EA 3RNNA 3GTOJ 2NOJB 1B7ZA 4THIA 2K40A 1MBFA 4N9IA 1JJ8C 1NV7A 3E9XA 2Z8FA 1P92A 4PJMA 4P55A 3FM5A 1A40A 1OLAA 5B1AH 3W15C 5F1RA 3F8NA 3CIJA 3FJ7A 1HCRA 4NF8A 4L0ZB 5JHFA 1R23A 3SJMA 3FXOA 3LQRA 1ZGWA 1LE8A 3B6AA 3QOEA 2WAEA 2AL4A 4PP0A 3SZTA 3V8XB 3KFMA 1Y1VJ 1T0FA 3RN8A 3TODA 3F8MA 2BOLA 1VQ6I 4F19A 3HOYJ 4FORA 3OYGA 3NEUA 3RCOA 3DQVC 3IOUA 1HSLA 1XS9A 2CQ7A 2ID6A 2KRHA 2QGUA 5FD5A 1T6SA 2FU4A 4NB5A 4LG0A 5IPAA 4GX3A 3OS2A 3E5QA 2JVGA 1IRXA 3LSGA 4DE8A 3KN7A 1URDA 2E1SA 4Q8RA 3GWZA 3H1CA 4GYGA 4XN0A 1PB8A 1IRFA 3MBPA 3FBNB 2DAOA 3F11A 4MIJA 5IZ3B 4H67A 2VJJA 4KISA 1XGNA 5A5LA 5GAGJ 2RCAA 3V89B 4XRMA 3K70C 2AIXA 2EILH 4OU0A 4X1DA 1NNKA 3KC0A 2LBFB 3DELB 3ZRGA 4CZZA 1F9NA 2A61A 3L2QA 1IMFA 1W1WE 4KA4A 5GP9A 2Z9OA 2XXHA 2XF6A 2FHYA 1WJBA 3LSPA 4XLHA 2XXUA 5DDGA 3L6HA 1JP4A 3E78A 4QFKA 2O5RA 1MXVA 4BEHA 1YI2I 1Z91A 2VQHA 1G59A 1B72B 3K4UA 1QVTA 1HSTA 4U0WA 3BJAA 4CZCA 2VB6A 1H76A 3JAMZ 1FTLA 4GIZA 3MVWA 4X1EA 1N0TA 1H0MA 2XF5A 4EXKA 5F0HA 3SDFA 2IS4A 3A02A 2O51A 2BV6A 4MFEA 4AVZA 1E3OC 1TZLA 4KMFA 4I09A 1VQNI 2VD2A 3PD8A 4KD5A 1NUXA 3H0DA 1MM7A 2BW3B 4KT6A 3C31A 4OFLA 2EV5A 5AA2B 2KIMA 5KHDA 3WTVC 1BR1A 1U0JA 4F2QA 4EMSA 2P6TA 3B6TA 1XOCA 1RIOH 1ZR2A 3RT6B 1EYIA 5DEQA 3CCJI 1XTAA 4HNVA 1YQAA 1PC3A 2MD0A 2WA0A 4NDLA 3SQNA 1PJRA 2JJKA 2XGXA 3MKZA 3QP6A 3HFUA 1NH7A 4RGRA 3IH4A 2Q74A 1AL3A 1D1AA 3JRFA 4IZZA 3OMYA 4LZ5A 2IW5A 5HPQA 4OOIA 3BFTA 1TXFA 4NC8A 4GX6A 4ZTFA 1FTKA 3CRBA 5ET8A 3CMMA 4EJOA 3DPUA 4YIRX 4BXUA 1BP5A 5J47A 3MAJA 1SAUA 3BR1A 2VKHA 2VXDA 3LL7A 4NX1A 4WF2A 1E17A 1X1CA 4MNIA 4L5JA 1R58A 3UKGA 1ZK8A 1EF4A 2DYRH 2NS8A 3KEYA 4FASD 1MBJA 3MYUA 2Y30A 3G1OA 4ZEIA 4CUGA 3IKVA 5B66C 2R5ZA 2H1KA 3Q25A 1LFBA 2Q88A 3RQ4A 3UP9A 2HAVA 3MPKA 1ZIUA 4L0YB 4MAGA 3DWLE 2Y0MA 1B58A 2YU9J 3C33A 4LQ2A 2E5NA 4IHWA 5J4YA 1EZOA 2XPWA 1R4NB 4PSXA 3CFXA 1Z05A 2F5XA 5DS9A 1MH3A 1E0EA 1HW1A 2IS2A 2FBPA 3QPHA 1Q35A 2Z8DA 4G8MA 4P47A 1WI9A 2I3VA 3UORA 4ZE9A 2VOOA 4I0AA 1IN4A 2QL3A 3CVGA 3Q27A 2FEZA 1XSVA 2P3NA 3ZN0A 3EDPA 5CMKA 4ZEBA 4ONYA 2PCRA 4JYKA 4HLXA 4KMUX 3JSOA 2EK5A 2Z99A 1AOYA 3A4CA 2EIMH 1IN7A 5FROA 2M34A 1B40A 2FUG2 4I62A 4M4GA 4IL6C 1RYOA 1JTXA 2K3FA 4BYYA 4GQOA 2ADUA 4MHGA 5GTIC 1V5GA 4Y15A 1B9MA 4XSXF 2JQ7A 1H3DA 4L9JA 4TLMB 2CRGA 2DU9A 3O29A 1QU3A 5EG0B 1YITI 4D7NA 2GXBA 2O69A 2G9WA 4IF4A 3T0JA 2CUFA 4GYIA 4KYEA 3FJMA 1WVRA 2L7MP 1DU6A 1X1BA 5TPAA 5F0CA 1SD7A 5J1UA 2GH9A 3V4GA 2VJ5A 4EJWA 2FOKA 4IRGA 4F52A 4BBRJ 1J2XA 2JZYA 3PFIA 2Y2ZA 2X4HA 5AONA 3CJTB 2MSYA 1A99A 1YYZA 4QRZA 4I1DA 1R1VA 2LD5A 3PUFA 1ZHFA 2E19A 1FPKA 3M3FA 3FMQA 1DGRM 3S16J 1ETWA 1I39A 4DZ1A 3W6VA 1FW0A 1BI1A 4NC6A 4TQUQ 1VQ9I 2LLKA 3PMVA 1JXSA 4XTCQ 1JT6A 3BT9A 4NUBA 1N75A 4LZ8A 5K1YA 3QODA 3KEQA 1U78A 2OA4A 3EQ1A 1YW9A 2W24A 1PP8F 4HSRA 1HSJA 1IITA 2JPBA 1K9ZA 2L9SA 4GXSB 4MMPA 3FV1A 4A3EJ 2VBXA 1LGBC 4C3JJ 1B0LA 4X0GA 2H27A 1NG6A 2XHDA 2QS2A 1D5YA 4ZYGA 5L3EA 4F29A 1SFOJ 4MFIA 2JTVA 4HX4A 1UAAA 4NHJA 1MS7A 2O68A 3ASOH 3DXJF 3HOXJ 1MXUA 5HLHA 1Z7ME 5FGMA 2RF1A 3KEOA 3EKIA 3M07A 1TQMA 3O6IA 2VE8A 4CCMA 3PPPA 1IV8A 1NI9A 1FBDA 2I3WA 2IA4A 1BM9A 5HDGA 2WY7Q 5H8NB 1ENHA 3R60A 3S15J 3HOWJ 3DU5A 3BC8A 3ML6A 3HYIA 3H92A 1LCTA 3KOTA 4LP2B 2JPCA 3LFKA 4NF0A 1EJ9A 4B47A 1OCOH 3ZSFA 2RQPA 1SBPA 5A2QK 4DYQA 4IHSA 5KCJB 5LBQA 3GTLJ 3KN8A 5CBSA 1G0IA 4U7BA 4JOMA 4DZJA 2KKOA 3O8GA 1BR4A 3KP7A 2LY1A 1U9OA 3CUQA 1FBCA 3FK7A 2M0MA 3L7WA 1F5TA 1U9NA 5HLTA 1B8IB 2ZJQF 4A3GJ 4ZZLA 2FD5A 2MLKA 4I8CA 1QO0D 1U5TA 3AAFA 1SD6A 2HFBA 5J8CA 1JGGA 3SDGA 1IXGA 2HZLA 5EHSA 1B52A 5L3BA 5LFAA 3I4NJ 4NF4B 4KICA 3GMEA 4LN5A 3P9KA 2FRHA 4AUXA 4LATA 4HS7A 2H1LA 2VC0A 5FKLA 2DPDA 3VEPA 3KIOA 3K10A 3GBAA 2M1BA 4G7OF 4XKQA 1OR7C 1Y0UA 2PFBA 5CYVA 5ICFA 3OEMA 4NEDA 4C0RA 1WJFA 1OQHA 3G6EI 3GEZA 1LB9A 5BS6A 4R75A 4XSZF 3FASA 3C2BA 5KDTA 2LC2A 9ANTA 2LAOA 1FQEA 2FBKA 4YEJA 5DYMA 4MTEA 3FV2A 4MX6A 2IEEA 5L8DA 2KMUA 4D7MA 2ELHA 2RVCA 3PQJA 4LOCA 2VE9A 2LKXA 2DT6A 3AKZA 3ZQCA 1N3XA 1X1PA 3ZP5A 3M8JA 1I6QA 1O63A 2O03A 3DBHB 2F4IA 4KIBA 3WTXC 2P0SA 3ONMA 3UR3C 4NQWA 3L09A 3OSGA 2HQ0A 2V4JC 1O57A 4LD5A 1Z0XA 2KJCA 1FJ9A 1K4SA 1VFEA 3IO6A 2BYVE 2LF8A 1ZELA 3TQWA 2L9VA 1UTBB 3VPRA 4M6YA 4I2OA 3HPHA 3PV0E 2P5LC 5H8FA 1NV4A 3MZBA 4Z7EA 4U22A 5H6QA 1DU0A 5EYHA 2DOEA 3M3KA 2O9LA 1TBXA 1B7HA 1FWZA 2WB1N 1IDYA 3SEQA 2QS4A 4IR8A 1GV8A 1QJMA 1ZG1A 4N4UA 4RB3C 4AD9A 2VN2A 2IA1A 3S9NC 3IUOA 4QFPA 4YMAA 3WAEA 1ACIA 4Z2YA 2Y9YA 2UVHA 5BPDA 2XRNA 4OQOA 2EA4A 3CQZJ 2HOSA 2QKLB 1QBJA 3BP8A 3SFIA 5J16A 3RSNA