3FXUA

Crystal structure of tsar in complex with its effector p-toluenesulfonate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA03
3KP7A 1B7UA 3M1EA 1PP8F 3CTAA 3DKWA 4N13A 5LEJA 1BC8C 3EUHA 4ETSA 1IIWA 4OFLA 1B3GA 2Z8EA 3K6WA 3K1PA 2QZ8A 4L17A 2JT1A 3D5LA 2F5CA 1EZPA 3LA7A 2XGXA 2ZNZA 3KFWX 1QBJA 4K3FA 2HQ0A 3N6TA 3WAFA 1J1NA 4IO2A 4G68B 3ZMUA 4F39A 3SZPA 2P7CB 4U7DA 3OD7A 1SD6A 5EEHA 3ROUA 4IXAA 1JQFA 3HHGA 3RTRA 3KSJA 3K1NA 3UN6A 1TT1A 4KYEA 2BGCA 1OQHA 2GRVA 1J5YA 1Y1ZA 4XRFA 1LB9A 4ENKA 3M9AA 2Z3YA 1DDNA 4OYVA 1IW7F 4ZDMA 3CUQA 3ECRA 3DFGA 2HXWA 2WC2A 2DXYA 2NAZA 1A99A 3V4GA 4EVIA 3UK4A 3GWZA 4EQ7A 4A6DA 1B3FA 2LF7A 4THIA 5L9OA 3RYRA 5I2KB 4GOTA 2VD2A 4I1DA 5LRSA 3QU6A 4R73A 2ALUA 2AXLA 1FY7A 1MXWA 3PUYE 4OU0A 4YKKA 3R26A 2H25A 1R9LA 3DQVC 3OOPA 2ZYOA 3ODBA 4YFXF 1R22A 4I02A 1M5EA 1LVAA 2OZUA 4KCDA 3U8QA 2OWTA 2XXWA 2W85A 4AIHA 1FQBA 2EK5A 1NNTA 4Q5SF 3K00A 2FNPA 1Z1DA 1VFDA 1YG2A 2HQNA 4MQ9F 2H98A 4E70A 1H43A 2ZXJA 2XAHA 1RNLA 2M87A 2RVCA 1D3KA 5AIQA 1KU9A 2GXGA 2OZ6A 1DUXC 2UWMA 2I49A 5LGTA 3VDFA 3LQQA 3KOSA 2IEEA 3MVZA 4NTLA 4ECFA 4ESBA 1QW0A 4ZEKA 2QENA 3H6VA 3C3WA 2GWRA 2I6EA 1SMYF 2M1BA 1MD0A 3ABTA 4P55A 1YW8A 3IB0A 1FT9A 3BPXA 3F22A 4KT5C 1LAXA 4I62A 3V7RA 4DNCA 5I59B 1OYIA 2X0LA 5DYMA 5DEXB 3BP8A 4HQMA 3B6TA 1TXFA 4GWOA 3IJXB 3OSQA 1NL5A 2AYSA 5FTHA 4N9IA 4KYDA 4YMBA 3Q28A 3CUQC 4JDFA 3FHZA 1R1VA 3FGSA 3TEPA 3ZN0A 4QF9A 2QBYB 2QS4A 5HVQC 4PDKA 3QP6A 2RKHA 1URGA 2CMOA 1B05A 4RXLA 3PUVE 2O7UA 4OINF 3E5QA 3PPNA 4N6PA 3P9KA 1BP5A 1ODDA 1O64A 3FMRA 2UVJA 1B5JA 1LFGA 3RKWA 2XXHA 1SQYA 3SDFA 2V9VA 1OIBA 3WODF 5F6FA 1PC3A 1JNFA 3L00A 1HQCA 2ZNSA 3RTWB 1S7YA 1URSA 1R9QA 3CFXA 1OR7A 4Q48A 1V4RA 4U0YA 4BHCA 1B0LA 3HOTA 3D4GA 4L9NA 3KZGA 2X7QA 4XLPF 4YICA 5D5WB 5JEIA 1HKTA 5EHMA 3VXBA 5EYFA 2HZLA 3SEXA 4IO7A 1QQIA 4PFYA 2OCUA 3MBPA 3KJTA 4OZ9A 3ILUB 1D4NA 1XCBA 2MD5A 1NNKA 2XXUA 4C1TA 4I8CA 4WXJA 4IVNA 1XMKA 1PBPA 4Q0CA 4HX7A 4EJTA 2DLLA 2D5WA 2Q0OA 3KZYA 1ZH5A 2F6GA 2GIVA 2E1NA 4OENA 3IHUA 5D4SA 3RGYA 3S9EA 1P92A 3E13X 2R3SA 2YPNA 2NVUB 1YFHA 4UVAA 2P5KA 4KD5A 4P0GA 4YKJA 3ELKA 1ULYA 3SEYA 1CB6A 4JWXA 1II5A 3KP4A 4JXIA 2G7HA 1UQWA 2DO7A 2A61A 2IA0A 1ZMGA 2VP1A 3WGHA 3FM3A 1VTNC 3M8UA 3IOVA 1B4AA 2MA3A 4LLNA 1ZG3A 2LF8A 3TQLA 2DTRA 3KP3A 1ZIUA 4KYSA 1QNTA 3BDDA 4G8HA 4FX4A 3BROA 3VLVA 5HDGA 3HRTA 2AL4A 2F5EA 4F3GA 1UB9A 3PQKA 1BM9A 4LZ8A 3K0LA 2Y7RA 1MS7A 3ZMVA 1I69A 5CVVA 1UHWA 5LHIA 4EJVA 4YIFA 1GVJA 1F1ZA 2OD5A 1OYWA 2G29A 5HS7A 3FVNA 5LGUA 1IXGA 2HKXA 5H6QA 2ACJA 2DWHA 3FJ7A 5L3GA 3TMGA 1X3UA 2JTVA 3DP7A 3IO4A 4YU0A 3KP5A 1NHAA 1LSTA 1PP7U 1BTJA 2NXOA 3UORA 2VC1A 2QSXA 1F4KA 4KI0E 2BJJX 4IRIA 4FECA 4A2UA 3EHSA 5E8GA 4NMYA 1WKMA 1ZYRF 1EH6A 1KQ0A 1ON1A 3GBAA 1I5ZA 3EHTA 1SVXB 1FQFA 3OO9A 3TELA 2I4CA 1WVJA 2XVCA 2I58A 3K6VA 5DVJA 1XGMA 1S9TA 1UCRA 1XSDA 3F8FA 4RB1A 5FD5A 3N5LA 4IO4A 2OAZA 2DQVA 1MXVA 4XSZF 2UXAA 4NF8B 1YLFA 1B3EA 4XKQA 1EZOA 2HYFA 2AS5F 2L54A 1RKMA 1BJAA 3V8JA 3DEUA 4CZZA 5I59A 2HZKA 4IRHA 3Q9SA 5H8QA 2Z9OA 4OXVA 5DUKA 4GYGA 1R6ZA 2W24A 1KU2A 4AD9A 1A8EA 2F34A 2O51A 2E7XA 2DS9A 3WTVC 5DD8A 5K5QA 4EJWA 4KR5A 1IXCA 3MEXA 1EZ9A 3P9CA 3WE3A 2ZBKA 5HS8A 3KP2A 1CF7B 1AMFA 5F1QA 2R9JA 4DQ2A 4U22A 5M2VA 1N76A 2RGVA 5I56A 2UVGA 3R4KA 5DYHA 1RZ4A 5H8FB 3FVGA 2Z99A 5KVRA 3E6CC 2RDPA 2PI0A 2HDCA 1JETA 3U72A 3IORA 3RTFB 1ZAOA 2KJBA 4GL0A 1I1SA 1ZHFA 3GEZA 5LEKA 4H0EA 5A5XA 4R74A 1S7AA 1FQCA 1IZ1A 1USTA 4G7HF 1YS7A 1DTGA 1I6QA 1Y3PA 1FLIA 1BIAA 3TYHA 3JSOA 3RDIA 1GGGA 3IL1B 1RI7A 1K79A 1B5HA 2I0BA 2XXYA 2CWEA 2Y84A 3IAZA 5E1ZB 5BMZA 3K0VA 3T9HB 1G3WA 2STWA 1ZGJA 4P5OA 1LB8A 2HTJA 1U5TA 2A68F 3PU5A 2OU2A 1QPMA 2F5XA 3QPTA 1M5DA 1N7WA 4H8IA 4EQBA 3T9UA 1J2XA 1YTVA 1FTKA 1JGSA 2KIMA 3MPLA 3RNNA 3LAPA 1USYE 1Y0UA 2Z8DA 4JQFA 2DAOA 5JHUA 4I01A 2R7FA 1OMIA 4YMAA 4A0ZA 3TKDA 4EJUA 3GLXA 3O9PA 4FJPA 1EV7A 1NMUA 1JW5A 1XGSA 2EB7A 1FOKA 4KN4X 3H3GA 4LB6B 1TQMA 1TW3A 2V6CA 1Z7ME 1G3YA 4QFOA 4XBFA 4QSEA 1TLHB 4NF5B 3T9VA 2O84X 5FB2A 4YG2F 3BKIB 4U88A 3JTGA 3MZ9A 3N94A 4NE4A 2UZKA 3QXMA 4B8XA 1BI2A 3C31A 3E6BA 1ZGAA 5IAIA 5CVIA 2ELHA 3VV5A 1P4XA 1MY3A 2VOPA 3J7AO 3PPRA 1QZZA 1QVSA 4OEUA 2VC0A 3OEKA 4POXA 1K6OA 2FBKA 2CO5A 3FXRA 3E9XA 3H06B 3LFKA 1HSEA 1NNFA 1WRJA 2ESHA 2EV0A 3CO7C 2HWVA 4NF6B 4LK1F 4MH5A 3MAMA 4F18A 4G6DA 2ZFWA 2OQGA 5ICCA 2PN6A 4KICA 1MDQA 2ANJA 4BQAA 5DEQA 5B70A 3BWGA 2KKOA 1U5TC 3G3FA 4PP0A 5D8KB 3C4MA 1H45A 2XD2A 2HS5A 4S05A 4L0YB 1MXUA 2I3WA 2ZNYA 2QMWA 4BXUA 4HOBA 3TFLA 2XHKA 3TCGA 2UXXA 4ZYHA 2NS0A 4DLDA 3CUQB 1SW2A 2Q89A 4BDLA 4A6EA 1F5TA 1FZPB 4M9ZA 3RN8A 4BYYA 3L2CA 5AA4B 1ZRDA 4EQ9A 2O03A 4XKNA 1B6HA 3KEOA 4F7ZA 1TNSA 2M45A 5I2NB 4L5JA 2CGPA 2RF1A 4R8HA 4NF8A 2DPUA 4BH9A 3MW0A 3FJMA 1LBCA 1B6AA 3LC8A 4L0ZB 2I48A 2DQLA 5IT9Z 1BI1A 4QFLA 2A07F 3AXFA 2HOEA 2Q2CA 3LWFA 2K02A 2HZTA 2VOOA 3CVGA 4Y13A 2Z8FA 1KWHA 4RA1A 2GZWA 1O3RA 4H67A 1CF7A 3IOUA 4GF8A 3EQLF 1IN6A 3ZKKA 2UYFA 4YB5A 4CICA 5D5XB 2DK8A 3TO9A 5LLQA 2PT2A 3SEWA 2Z33A 4R79A 3KZZA 3RKXA 5IT3A 2MLGA 4HV5A 4U23A 4RGUA 1R58A 2DW4A 4R2BA 1Z91A 4F3PA 4WWCA 2NUVA 1U2WA 1IF1A 1LBBA 3MC2A 3PQJA 2PYYA 2PEXA 1S3JA 1R23A 3FMQA 1XT8A 5K2YA 3HIFA 1TQIA 4P0IA 3E4RA 4ZECA 3JZJA 3CFZA 3FD3A 3K2ZA 4P11A 2CSOA 1WODA 3SETA 1UIVA 4LMYA 3GXOA 4GCVA 4NEDA 1SYIA 2MBFA 1J9IA 3GW2A 5BWJA 1IN7A 4G7ZF 3RJPA 1O3SA 3TTKA 3THIA 1B51A 4JWOA 4WCGA 5HDKA 2THIA 3WAEA 1L5TA 2OWSA 5K2XA 4L5IA 5CI5A 2MLKA 1IXHA 4QSDA 1BI3A 1B1HA 1Q1HA 4QHQA 3G3JA 4LP2B 1W7PA 5CMMA 5L9MA 1HKSA 4Q30B 1OPCA 2A6EF 3ZQ7A 3MUQA 1IN8A 4N9HA 1IXIA 3MP6A 3R0JA 2HKOA 2REJA 4YB6A 1FYMA 1TBXA 2XXPA 5EHSA 1DSNA 3QUFA 1W5TA 3KLNA 3M3FA 1MY4A 3DP4A 1OVTA 1SD5A 1ZLQA 4KPTA 1ONVA 3MZYA 3F72A 5F1RA 2HTSA 2ZNTA 1N84A 4NF5A 2AL5A 3IRQA 2GA2A 2CG4A 3IRRA 4QWQA 4OIQF 3WTZA 4RGRA 3K6XA 5ITOA 5FLXZ 3U92A 1NNPA 1LAFE 5I57A 2EJRA 2JRTA 4JBZA 4XKPA 3EETA 4BDOA 4M9XA 2V79A 4Q8RA 3RQTA 2K4JA 4MEXF 3BFTA 3DV8A 4M1VA 3ERED 4BHPA 4RAZA 1J0RA 1T39A 4HAMA 4BHBA 3HRSA 1BKAA 2XX7A 3DLNA 3WG9A 4GXAA 2QLZA 1SD3A 4TQUQ 5BPIA 3K6UA 1EH8A 3E3VA 1US5A 1B7ZA 1I6BA 4PETA 3ONMA 4GFRA 4NF6A 1LLSA 2RC8A 3IKVA 4RJZA 1WDNA 2R71A 3H03A 1LCFA 4PGHA 2NWJA 2EV6A 3F8BA 4KFCA 4AQ4A 5AIPA 1B0HA 4LZ7A 1TTYA 2OA4A 4HYEA 3VEPA 1WSUA 5TJJA 2Q8JA 1B2HA 3I59A 3F3XA 4YB7A 1QUIA 4U4SA 1SAXA 1AIVA 1ZTYA 4EF1A 2NNNA 3KE2A 4H1XA 4A12A 5D8LB 3U1DA 3LUYA 3HHFA 3A3UA 2ZYKA 2UVHA 4OMYA 1YCJA 4HCYA 1O7LA 4LG0A 1D3YA 5TP9A 3GFIA 5AA4A 3TTNA 1R00A 4XXUA 3HPIA 3GZ5A 4NWCA 3TPAA 5AA3A 5I2NA 1YW9A 3Q27A 3TCFA 4MHGA 1MPCA 4U0VA 3WU1B 4G77A 5D5VB 1OMPA 1DOTA 2YR2A 1D9VA 2D45A 2B0LA 1VSOA 2D1HA 2RNJA 1NH7A 1SD4A 1FTLA 4I09A 1MQIA 2H94A 3D4CA 4BDNA 5J8CA 2VN2A 4G8MA 4XLNF 5L3BA 2VONA 1QUKA 2W7YA 3SERA 3S9LC 2D21A 2P8TA 1TWYA 3C34A 1RYXA 1MZBA 1PDNC 1MQJA 2K4BA 3M3LA 2E1CA 2Q88A 2FRHA 5KDTA 5DVIA 2O1LA 2DE2A 2OBGA 3V83A 1G6NA 2ADUA 3S2WA 1FTMA 3GLBA 2PBWA 3E97A 1SFUA 3LSXA 1O7FA 1KYZA 1YTYA 3B6QA 2F5DA 4XKRA 1FSEA 2QQ9A 3HRUA 3U9GA 2Q2AA 3JSPA 4KHZE 1US4A 4OTEA 4TV7A 1J7KA 1HBXG 1MM7A 3TUSA 4PCQA 2O0YA 5H8QB 4E0XA 5ICFA 3PD9A 5AA1A 1ZLKA 3I71A 5K1YA 2L4MA 3GZ6A 2RC9A 1P4WA 4HA8A 4L9TA 4AB5A 1ON2A 1U8RA 1KQ9A 4UHTA 1PDAA 4R2FA 5AA2A 2FF4A 4IGRA 1FPQA 5I56B 1XN7A 3GFLA 2CQKA 4F1VA 3VVDA 1MJ9A 1B9NA 1Z05A 1PBQA 3QPHA 1FBSA 1B3LA 2NOOA 4UV9A 1MXXA 1J75A 3W9WA 1REPC 4NQWA 3CR9A 3I64A 5A5XB 2M8CA 1HSJA 2K7LA 2Q2EA 4WF2A 4H0WA 2WV0A 2FSWA 1LAHE 1JXSA 4IF4A 3FMSA 3G7WA 4GRKA 4LONB 4HS7A 3JW4A 3V89B 2Y0MA 3PGFA 3LA3A 3QOPA 4F19A 5KZTA 3BJOA 1U5TB 3G3ZA 2QMXA 4DDDA 1B9MA 3DP8A 2RC4A 1MH4A 2FYIA 3JYRA 1GVCA 4KIFA 1OLCA 3P7IA 1BOAA 1ZREA 3K01A 3SEUA 3HSTA 4MBPA 1YO5C 4ENMA 1F9BA 3Q29A 4F1YA 2FA7A 3O6HA 4FORA 4LQ5A 1W5SA 2EA4A 1IEJA 2VT3A 1LJ9A 3LBSA 3GZGA 3VOEA 3WTYC 4DZ1A 3GO5A 2OK2A 3G3HA 3C7JA 3W6JB 4M4GA 5F7VA 2O1MA 4F3SA 4GIZA 5HM4B 2V1XA 2RINA 2M5WA 3CUOA 4JK1X 3T22A 4PGGA 2O3FA 2O68A 4MFIA 4L9JA 1JVYA 2VBZA 1XVXA 3WE2A 5ILSA 5CMKA 2DWAA 3HOSA 1PEBA 2WKYA 3K1MA 3VFZA 4NHJA 3PD8A 1LDDA 3Q5FA 3TOAA 4I0BA 3U93A 3PV0E 1B58A 1P1QA 2OBPA 3GVAA 3RPUA 2ABHA 2XXVA 1R1TA 1MDMA 1XDUA 2TDXA 3DXJF 4DIGA 3E6MA 3QUJA 4KA4A 4HDVA 3G73A 2GFEA 3WTSC 1LEBA 2QS1A 4AWXB 4G6QA 3B7DA 3I4PA 2IVMA 3EHUA 1RUOA 2YLNA 3S9MC 1T38A 2EWNA 5DD4A 2RCBA 3FIRA 3I53A 1A54A 4E0WA 4YIIA 3EPEA 2C6YA 1R5GA 4LB5A 3G3KA 3IWZA 4HLXA 4ND9A 2CFXA 2NNYA 4ZE9A 1ZBMA 4DXCA 1OYYA 2XAQA 4F2OA 3VVEA 1SMTA 2XAGA 3BY6A 5HLIA 5HLGA 1B32A 1MG1A 5ED4A 2PMSA 5CM6A 2FQ3A 3I6VA 1Z6TA 4Q4ZF 1OQGA 4RY1A 1N3XA 4I98B 5FFZA 4QFPA 2DYXA 3ULQB 3UGWA 3KN8A 3EYIA 5D6EA 1T6SA 3BJAA 5ERIA 1A40A 2XX8A 3OENA 3KBRA 1UTBA 2EFOA 5BQTA 3HO7A 1IRGA 2GH9A 5BPDA 1S29A 2HEOA 3K02A 4OIOF 3O6IA 3ECOA 3F11A 2YPRA 3TTRA 3V5AA 2DVZA 3EF7A 3MWMA 3FXUA 3HSFA 1ZKBA 4JB7A 2VT2A 1XS5A 3A09A 1N04A 2QRYA 5H8NA 4R75A 2QWWA 3J80Z 3QAXA 3LSFB 2FBIA 5FGMA 1XB4A 4M72A 4QSCA 4F29A 2D3IA 3IOWA 4UA8A 3FF5A 3TGNA 1KYWA 3HHHA 1U6GA 2IA2A 3FVKA 3PMVA 5K5OA 5TPAB 3ILTB 2J5OA 4X1BA 1SFXA 1WQ2A 2XAFA 3G3IA 4UV8A 3T9XB 5TU0A 1K7AA 2OZZA 4OHNA 1VFEA 3HCQA 1IXRC 1N0TA 4D0PA 2QQBA 3M7GA 2W57A 2V3TA 2KRFA 2E1SA 3V8XB 4UVCA 1L0OC 2O8XA 4LZ5A 1YYVA 4ELQA 1CE2A 3F8NA 1DTZA 1XDSA 4L18B 5ILVA 1Z7NE 3HSEA 3FASA 5FHNA 5D5UB 2BEOA 2D1VA 3QU3A 3MVYA 3KJ7A 4HF0A 4C1UA 3LQRA 3PUZE 4G2ZA 3BFUA 1W7PB 1AWCA 5DT6A 1MQGA 4R9FA 3I0TA 4EJOA 2HQRA 4X9TA 4OEVA 1Y3NA 3K4UA 2CZLA 1XGOA 2B3BA 2XXTA 1AOVA 1JHHA 2DE3A 4I0AA 4CYDA 2F78A 3DELB 2XKPA 5FO5A 3QYTA 2DWIA 3E5XA 1MH3A 3F8CA 4G7OF 4GYIA 1LEAA 3N4MA 5LHHA 2V84A 2ONSA 4IRGA 4KMUX 5E1XA 5J6XA 2P5LC 2DOJA 5E18F 4KUMA 4OFJA 4EV0A 3PPOA 3IC7A 5I57B 1B3HA 4IO3A 2Q8KA 3PPQA 3B6WA 2VE8A 3Q26A 5H8HA 1MY2A 5JK4A 4ZZEA 1S7OA 2KIFA 5LHGA 3RT8A 1MXYA 3REOA 1PB7A 3H6WA 4LLLA 3MP1A 2EFNA 3HSRA 3IX1A 1J59A 1IN5A 2B3FA 4ZS9A 5ICGA 4M9SA 3TTLA 5JR3A 4U7BA 4IJAA 2A69F 1YS6A 2GAUA 5CMCA 1IRFA 2VBYA 2I4BA 1OVBA 3E3KA 3R6UA 2XIGA 3I59B 1Q35A 4KMFA 2IA1A 3CG1A 4KDPA 1PB8A 3RKYA 1H3DA 2K86A 4ZH4F 1T98A 2XASA 1QUJA 2RCAA 2OJTA 1B4ZA 2HR3A 3TO7A 3V7SA 2V93A 1LQ1A 5IT9K 1IAWA 2Y75A 2XKOA 1FTJA 4LG0B 5TP9B 1B5IA 4BDRA 4BDQA 2PT1A 4LLGF 4RYAA 1TW2A 5J1DA 4NWDA 3K69A 4N07A 4YKIA 4KN7X 4RPOA 4WXHA 1MQDA 3T1BA 3WTWC 1O7TA 2Y7IA 3VLUA 3AAFA 4BNCA 3TZAA 2PG4A 3BZ6A 4PQJA 3IO6A 4RS8A 3QP5A 5A2QZ 1FTOA 1USSA 4CHUA 2YX4A 2ZNUA 3TQNA 1RYOA 4JSOA 2O7IA 4WXDA 1F9NA 5I84A 2A5TA 3N6UA 1FX7A 5KCJA 2Y7KA 1PB9A 4ZYDA 1AL3A 4ISUA 4WX9A 1ZJLA 2GXBA 2E0SA 1I6XA 6PAXA 2HFBA 2Q9TA 3PMWA 3HV1A 2HFHA 2KJCA 2HEUA 4U0WA 3ZS6A 2O6AA 4HW8A 1FCKA 2XXQA 5HBCA 1UTHB 5TPAA 2RN7A 5KDTB 5H6RA 4R9GA 4IHTA 3F6OA 1B52A 1MPBA 3RPWA 3MWBA 4F2QA 4Y15A 3MP8A 2JPBA 3LSWA 4HLYA 3ZSFA 4L9VA 1A7LA 2V3UA 4HBLA 1GXPA 3DPTA 1I27A 2DE4A 3MQ9A 3KG2A 2DK5A 4DXBA 4ZYEA 3MFKA 1FW0A 1NH8A 1OLAA 1SD7A 2Y7WA 3T0YA 5L3EA 2XXXA 3IK6B 4GL8A 1MJBA 3C35A 5L3DA 4TLMB 3E6DA 1B7HA 4HX4A 3OEMA 3QRFF 4MLQA 3IKTA 1IUDA 3EYYA 4LFUA 5AA2B 1HXDA 3WTTC 3TDUC 1XVYA 4ZZDA 1O3QA 3HTUA 4ASNA 4IY6A 4AVPA 4GD5A 2YSRA 4Q47A 4CXFA 3FWEA 3F21A 4KQPA 1JW1A 2ZYNA 4G94A 1L3LA 4RNSA 1K78A 2A5YB 3HYIA 3R6SA 3TQWA 3KEQA 4FAJA 3CJNA 3HN0A 5FLXK 3F6VA 3FXQA 3MVWA 5DCFA 5LRRA 1UFMA 2R6GE 3K9TA 1MM6A 3GFMA 2FNCA 2F97A 4O5VA 3O2PE 4IO5A 5FTIA 3TTMA 5CBSA 4A0YA 2BBYA 2GQQA 4C0RA 2XD3A 5JI6A 2QS2A 3Q25A 2FBHA 4G8NA 1Z9CA 3P7NA 3CI8A 4UVBA 1D9YA 4ZE8A 4YAHX 3H92A 1DPEA 2K27A 3SEVA 4GGGA 4KCCA 2F5FA 2DBBA 1BIBA 1AOYA 1Y4TA 1W7PD 2F6PA 5I58B 2W25A 4OIPF 3M8EA 1R7JA 3DM0A 2PJPA 1WWXA 1Y1MA 2L01A 1PUEE 4RK2A 4O6JA 4QFNA 3GX4X 2H4IA 4U1OA 1MY1A 1IN4A 2XRNA 1HSLA 2EV5A 4ZZLA 5TRDA 4F3BA 1Z7UA 5J8FA 4Z0IA 2VOZA 3A3CA 3U1OA 1DPRA 1TFDA 1P99A 4FT8A 4R72A 1HSTA 4ZEFA 3S4UA 5AONA 3C1DA 4G4PA 3WGGA 1URDA 3PUXE 1FYLA 1S50A 1GXQA 3S2VA 4LVQA 1USYH 1FSHA 2QJEA 1JEUA 3EQ1A 5D6FA 4EGZA 2LSOA 5ELVA 3H4ZA 1S8NA 4K2EA 3T66A 1MDMB 4I2OA 4UXNA 2Z5UA 2X26A 4EM0B 4G8XA 4LJZF 2IP2A 1D8KA 1B4HA 1VR5A 2CW0F 1ZG1A 3OO8A 5FD6A 3L09A 3I54A 4EM1A 3SKPA 2G93A 4M6XA 4MEYF 4H8JA 3I3VA 3MQ0A 2VGQA 2Y7PA 4ESWA 2QUFA 3VLWA 3OELA 3FM5A 4ZYGA 1EH7A 2V1DA 4NB5A 4HF1A 3ZPLA 1GTKA 4WKMA 5DTBA 3VVFA 4ELOA 3QAHA 1LGBC 5FFXA 1NKXA 4F1UA 2XUBA 4OMBA 4RB3C 5FHMA 2MH2A 2E7WA 1XSXA 3ABUA 3FZVA 3PMXA 4EQQA 2F36A 2RKMA 2PMHA 4U21A 3RPQA 5L9SA 2WTEA 4KIBA 1HW1A 4ELPA 2P5VA 3WU0A 2XV4S 4Q5TA 2H9BA 1CGPA 1UTHA 3GF2A 4H5FA 4OQOA 4M73A 3ML6A 3ISPA 2FMLA 5JFRA 3ECHA 1XD7A 2XROA 2UYEA 3PFIA 2UVIA 3W6KB 1C0WA 1XCVA 4IGTA 2PQ8A 1XMAA 1E2XA 2OQRA 1UTBB 3VXCA 5HDNA 3C9HA 1LAGE 1MRPA 5E1WA 1MQHA 1B40A 5CVJA 2P2AA 2VE9A 5ICTA 1XGNA 1SBPA 1P2FA 2MH9A 5H8NB 4N0BA 1SFEA 5E20A 2DSFA 3C32A 1B1XA 2P0SA 2VODA 3L6GA 4OESA 5H20A 1STZA 1Q1KA 4YFKF 4DE8A 1P6RA 3T8RA 1MXZA 3U94A 2ONKE 2QQAA 2RV8A 2F7CA 3KETA 4XIGQ 3OSRA 1KU3A 5HOOA 1SDXA 1FQAA 3M3KA 4WEPA 5DDGA 5DCMA 2KIUA 1IQ7A 1ZG5A 1Y20A 3MPKA 2VHAA 1LNWA 3ZMTA 3LR1A 2F8DA 3RLFE 4ENNA 4JSDA 1FP1D 1T0FA 2YX7A 4LUBA 4NF4B 4FATA 1DP7P 4GQOA 4EXKA 1VE4A 2RC7A 3OMBA 5ICEA 1QKBA 1Y4CA 4UACA 3T5XA 4EDPA 3SZTA 5AA2D 4LQ2A 3QSLA 3CSBA 4PFUA 3QK6A 3B73A 4IB2A 3FX3A 1D8JA 3PPPA 1M5BA 3PUWE 1IITA 4MLVA 2DU9A 4ZEDA 5I58A 3RUMA 1ELJA 2F35A 3LA2A 1KGSA 3D0SA 4M6YA 2GHBA 4HQEA 4Z2YA 4YZZA 2IPQX 3COAC 5IKBA 2ZJ2A 5D4RA 3H7MA 3IL2A 1KA8A 3O29A 1UIUA 1TFAA 2DXRA 5FHOA 4CO8A 5JVTA 1HW2A 4KYWA 4OFOA 3C36A 1JVXA 4A5MA 3RYPA 3R7XA 4U4XA 3KCCA 2ONRA 3WTXC 4PFWA 2IA4A 2QPQA 4LGWA 5BS6A 4A5NA 3USDA 2H6BA 4G68A 3GBBA 4HV6A 3VE1B 3TDZC 1SW1A 1P4AA 3DPLC 1U3EM 1M5FA 4ZZAA 4ON0A 4AIKA 5AE4A 2P1SA 3V8KA 2M30A 3IOTA 3CLOA 5H8HB 3S9NC 5BUUA 2EA2A 2STTA 4I9DA 1RIOH 2G7UA 2YU3A 1POTA 1TQPA 3FV2A 3CFLA 3N26A 5L3FA 3FATA 2COMA 4TOZA 3H3ZA 1YQAA 3SHFA 3NRVA 3V7CA 3J81K 4KIGA 4QRZA 3WGIA 3FJGA 4KNYA 3NEUA 4OVJA 3N97A 5CLSA 3ZKLA 2IW5A 2P4WA 3HTSB 4RAYA 2XAJA 1FQDA 2IJLA 4R6YA 3T93B 4OWDA 1H9TA 1LDJA 4U2RA 2J5PA 2X7PA 4PFTA 2D2WA 5I2KA 1AH5A 3J81Z 1DMBA 1P1NA 3F23A 4ENJA 1H76A 5JTYB 1QO0D 2Z23A 3LAJA 1O57A 4BDMA 1FQEA 2EFPA 5ISUA 1TNTA 5ILUA 4EUOA 3C33A 3SESA 3HUGA 3ZMDA 3OOAA 3GYHX 4PE5B 1RUNA 2BE5F 3VB2A 2HAVA 3FV1A 1P1UA 1ZLJA 1LDKB 4S04A 2X4HA 1G3TA 3T8TA 4R1HA 3ZMZA 2JSCA 4QLCU 3W15C 2VD3A 2GHAA 3L9FA 4ESFA 3J80K 4HZFA 3MZBA 2YJPA 3SXYA 5ITPA 3JV9A 2A3SA 2F2EA 2VBXA 2O61A 1ANFA 3TODA 2PMUA 4WK8F 4G68C 3CRBA 2V1UA 3O28A 1Z6RA 2FA5A 2ISYA 2IT0A 1B59A 4OOIA 2A5TB 2FNAA 3VFJA 5KCJB 3KLOA 2O6GE 3VODA 1O63A 4ONYA 5CMBA 3CO6C 3WTUC 2AIXA 5L3CA 3KEIA 1MGTA 4PZJA 4EM2A 4IO6A 1R1NA 3KOTA 4MTDA 4U1ZA 4BAYA 5DEXA 1ZRFA 1YW7A 1BIYA 3R61A 5DV5A 3HRMA 1OKRA 3KSXA 4HCWA 2WWYA 3OO7A 4O3MA 1SI0A 2BYVE 3FUZA 2DQRA 4FIMA 2QBYA 3UIFA 1ZN2A 4YFNF 1FC3A 4RGXA 3CG3A 2IRFG 1SI1A 5B7DA 2PFBA 2H09A 2MC3A 5E8IA 4MGRA 2H27A 1FP2A 4NF4A 1XHYA 3MJNA 2EFQA 1QKAA 4LD5A 4P9FA 3FVOA 2LAOA 1BN5A 4R6KA 4F31B 2REGA 2I3VA 1UHMA 1B1BA 4X1DA 2QL3A 3TOBA 4TLLB 2PBIA 3O3KA 4OERA 4M71A 4EF2A 4WEDA 5CVUA 4ZEBA 5CC2A 4EGYA 3I5OA 4IPAA 1GR2A 1IUYA 4P9UA 2P6TA 2OLBA 3SQNA 2FE3A 5CJ9A 2KLFA 4RB0A 1MKMA 1K78B 4DCYA 3QIMA 5L8DA 3MCZA 2L02A 1H44A 2UXNA 1YPNA 4FEDA 4ELRA 1LFIA 2JZYA 2DP8A 3LSLA 5DVFA 3OXNA 3L6HA 3C18A 3P9IA 3RY3A 1BLFA 2A5SA 3M8FA 3JAMK 3ZP5A 3SFZA 2PLYA 1KQ8A 5CVRA 5E17F 1BI0A 4HF2A 1P1WA 3U2RA 1G3SA 5EEGA 1M5CA 4A0XA 1DPPA 2LKPA 4FHTA 1FBUA 2DPDA 2QS3A 3DF8A 4H5GA 3NQOA 4POWA 4FEBA 1XOCA 2V25A 3DP6A 2LNBA 4ZEIA 3JTHA 5DUIA 3JAMZ 4LATA 2ESNA 2P6SA 1GHCA 1QZYA 3OO6A 4R6HA 1S6LA 4JBAA 1U78A 4YKPA 3KN3A 1A8FA 5ICQA 2ZMEB 4F22A 3K2DA 4DCXA 2L3DA 4FX0A 3BPVA 3BOQA 2BV6A 2ZKZA 1MDP1 3IB1A 5HPQA 2FEZA 2Z22A 3H6UA 4RGSA 4EXLA 3TO6A 3GFJA 3CIJA 1W4MA 2XX9A 3MAJA 1R5HA 2Y48A 4Y17A 2FXAA 4OIRF 1NFTA 1O3TA 5BOXA 4O3BA 3H3UA 5JTYA 3ZN1A 1SW5A 2PX1A 3GUDA 3V8LA 3IWFA 2HCAA 3RI4A 1MY0A 1POY1 1A55A 2G9WA 3GXAA 1EU8A 5A2QK 2B65A 4QFKA 2DVCA 5KK1A 1N7XA 1HKQA 1Y9UA 3ZMSA 1V3FA 4MTEA 1QJMA 5K5RA 4MQVA 2PVUA 1FNNA 3RT6B 3KFMA 4OETA 1SW4A 1GV8A 3BJ6A 2F7AA 3IR1A 1LFHA 2HYGD 4CGZA 1A04A 1FYKA 4DXUA 5CBRA 2ZYMA 2VXZA 1ZU0A 4M74A 3UP9A 2NYXA 2W84A 1ATGA 4RPNA 5LOMA 1YAEA 2HAUA 3TAJA 3KP6A 3CDHA 2DT5A 1FWZA 1WI9A 4GXOA 2FOKA 3O6GA 5LBQA 3TKYA 1DPUA 2M8EA 1ZARA 4AIJA 2H5YA 5HLHA 3KGCA 3R60A 3T96B 3W9VA 1BC7C 2A6HF 2FMYA 5LGNA 3TDJA 3IJOB 4IY5A 2ETHA 1H0MA 2QM3A 1EH3A 4H6DA 2L4AA 2EFWA 2HGCA 4OMZA 2ZMBA 3O66A 1LB2A 2P7VB 4RK9A 3BBRA 4XTCQ 3UA8A 4O3CA 4Z7EA 1QGPA 1R1UA 2QVOA 3EDPA 4UUVA 2H6CA 4HX8A 5H8FA 4MNUA 3TCHA 1SYHA 4AB6A 1XC1A 2XXRA 3EN3A 2ZCWA 2H99A 1JEVA 4GXSB 1P1OA 3OV8A 4LA9A 3MVXA 1I1GA 2FU4A 4HW0A 3O2AA 5F64A 1T2KA 1IXSB 1FBQA 3KN7A 3F8MA 2F7BA 4G9YA 1Y3QA 3IB2A 4LK0F 4GO1A 1B46A 4GVOA 4BLAA 3B02A 4O3AA 1R36A 2RQPA 3CSGA 1E17A 4XSXF 1N3WA 1T0KA 1MJAA 3I58A 2XHDA 1JHFA 4HTGA 1HW5A 3MZ1A 4ESXA 3MZHA 1XSVA 3O6BB 3RIRA 4GLIA 3Q9VA 2DWJA 4FE8A 4CDGA 2DI3A 4HDUA 4ESJA 2ZXTA 4B09A 3R0AA 5DCMB 2V3QA 4RB2C 4P96A 1KU7A 1JE8A 3I5UA 4KFQA 4X48A 1H9GA 2I0CA 2XXIA 3L7WA 2R7DA 4I7HA 5CYVA 1ZRCA 2NRAC 2JPCA 3H6TA 5CRYA 2GA1A 4H65A 1JW4A 1D5VA 1I6AA 2LDUA 1B9JA 2QYOA 3E5UA 5H8SA 4JWYA 2ISZA 1MPDA 1QULA 2O69A 4UNOA 1LCTA 4IHSA 2DFIA 1G4DA 4MF3A 2VBWA 2ZO4A 2ZMEA 4EMSA 1BBYA 3LSTA 5HS9A 3G3GA 3O97A 1YIOA 2CYYA 4WXCA
chains in the Genus database with same CATH superfamily
3KP7A 3OYMA 3M1EA 3SDBA 3IV5A 1PP8F 1B7UA 1FBFA 3A01B 3CTAA 3DKWA 3QYEA 2O5RA 5LEJA 1BC8C 4DYQA 4N13A 3EUHA 4ETSA 1IIWA 4OFLA 1B3GA 2Z8EA 2M2EA 3K6WA 3TL4X 3K1PA 2JVHA 4E7JA 2OJED 2QZ8A 3CQZJ 4L17A 3ZXSA 2PFYA 1BJZA 2JT1A 3D5LA 2F5CA 1EZPA 3LA7A 2XGXA 2ZNZA 3KFWX 1QBJA 4K3FA 2HQ0A 3N6TA 5I3SA 3WAFA 1J1NA 4IO2A 3IFAA 3ZMUA 4G68B 2YUSA 4F39A 1RRJA 3SZPA 2P7CB 4U7DA 3OD7A 1SD6A 4M3FA 5EEHA 3ROUA 9ANTA 4IXAA 1JQFA 1NV7A 1NG6A 2JN6A 3I9V2 3AG1H 1FPJA 2KMUA 3HHGA 3RTRA 2FUG2 2TRTA 4H46A 5M5WJ 1VQ5I 3KSJA 3K1NA 4XEQA 3BG6A 1TT1A 4AC0A 3OYIA 3LMMA 4IHWA 1FEXA 2BGCA 4KYEA 2MW8A 1BR2A 3FBIB 1QHGA 1OQHA 3OYNA 2VI6A 2L2OA 2GRVA 5C44J 1J5YA 1Y1ZA 4XRFA 1X1BA 1LB9A 5ET8A 4ENKA 3DLAA 2Z3YA 3M9AA 1DDNA 4OYVA 4UABA 4GWSA 3MSTA 5EQAA 1IW7F 4MEVA 4ZDMA 3CUQA 3ECRA 1M1EB 2FD5A 3DFGA 3HFUA 2MABA 2WC2A 2HXWA 5M3FJ 4CA0A 1X58A 3HJEA 1ORKA 2DXYA 2NAZA 1A99A 4BDNA 2Q1ZB 3V4GA 1X19A 4XRSG 4EVIA 1VQNI 3UK4A 3GWZA 4EQ7A 4A6DA 1FPFA 1B3FA 2LF7A 4THIA 1O4XA 1FOWA 5L9OA 3RYRA 2V7FA 5I2KB 2K9MA 4GOTA 1WH7A 4MNCA 1VQMI 2VD2A 4I1DA 4OANA 5LRSA 4MNPA 4PAIA 2K40A 2ZFUA 3QU6A 4R73A 2ALUA 3UNGC 3I4MJ 1TT0A 2AXLA 1FY7A 2NS7A 1MXWA 4OU0A 2R92J 3PUYE 4YKKA 3R26A 2H25A 1R9LA 5F0HA 3DQVC 3OOPA 4CCKA 2ZYOA 3ODBA 1FOXA 1LFPA 4YFXF 1R22A 4RBOA 4I02A 2ZMEC 1M5EA 1LVAA 3DTEA 2L5VA 2OZUA 4KCDA 3U8QA 2OWTA 2XXWA 2W85A 3CCEI 4AIHA 1YJ9I 1FQBA 2EK5A 1NNTA 2IEKA 4Q5SF 3K00A 2FNPA 1Z1DA 1VFDA 2K85A 3EUHC 4I6ZA 2F3DA 1YG2A 1RKWA 2HQNA 4MQ9F 4J19A 2H98A 4EXKA 4E70A 4X1EA 2BXZA 3HOXJ 2ZXJA 1H43A 5B66C 2XAHA 1RNLA 4N4UA 1Z3XA 3ZGKA 2M87A 2RVCA 4NBQA 1D3KA 5AIQA 1KU9A 4E7LA 4GWZA 2GXGA 2OZ6A 1DUXC 2B7EA 2UWMA 2I49A 1H89C 4BBSJ 5LGTA 3VDFA 3LQQA 4XQFA 5KHDA 2CUEA 2VXDA 3DBHB 3KOSA 1OISA 2IEEA 3MVZA 4ZYAA 4NTLA 4ECFA 4ESBA 3MN2A 1QW0A 4ZEKA 2QENA 4P1LA 3H6VA 3C3WA 1WPKA 2GWRA 2I6EA 1SMYF 2M1BA 1MD0A 3ABTA 4P55A 4GWUA 1YW8A 2DFEA 2MG4A 3PIOF 3IB0A 1FT9A 3BPXA 3F22A 4KT5C 1LAXA 4EATA 4I62A 4XORA 3CJRB 3V7RA 4IQ4A 1TP4A 4DNCA 1OYIA 4AIDA 1WCMJ 1K9YA 5I59B 2X0LA 3A1YA 5DYMA 5DEXB 4Z6YA 2M3AA 3BP8A 4HQMA 3B6TA 1RR7A 3BCBA 1TXFA 3IJXB 3OSQA 4GWOA 1NL5A 4BJ5C 2AYSA 5FTHA 1BK4A 4N9IA 4KYDA 4YMBA 3Q28A 3CUQC 4IL6C 4JDFA 3FHZA 1R1VA 3FGSA 3MKWB 2HYJA 3TEPA 4PJMA 3ZQFA 4A93J 3ZN0A 4QF9A 5EG0A 2QBYB 2QS4A 5HVQC 4PDKA 3QP6A 2RKHA 1URGA 2CMOA 5B3SH 1B05A 4RXLA 3PUVE 1D1CA 2O7UA 1RC9A 4OINF 3E5QA 2V6EA 3PPNA 4N6PA 4ITVA 3P9KA 1D5YA 1ODDA 4NDLA 3FMRA 1AWBA 1BP5A 1O64A 2UVJA 5J1RA 1B5JA 1LFGA 2M0MA 3RKWA 2XXHA 1SQYA 3SDFA 2V9VA 3NWTA 1OIBA 3WODF 5F6FA 5ET6A 1PC3A 2EPFA 2QFLA 1JNFA 1W5CC 3L00A 1HQCA 3VDXA 2ZNSA 4HEA2 3RTWB 1S7YA 1URSA 1R9QA 3CFXA 4HE0A 3VSKA 3FHNA 1OR7A 1FBPA 2XDVA 1X1DA 2M9HA 4Q48A 1V4RA 1X4OA 4U0YA 4BHCA 1B0LA 3HOTA 3D4GA 4L9NA 4ZDOA 2QF7A 3KZGA 2X7QA 4XLPF 3HDDA 5D5WB 4YICA 1A6QA 5JEIA 1HKTA 1VQ6I 5EHMA 3VXBA 5EYFA 4NX1A 2HZLA 4BQNA 3SEXA 1X4PA 4IO7A 1QQIA 4PFYA 4E4HA 3FK6A 2OCUA 3MBPA 3KJTA 3K4LA 4OZ9A 3OIPA 3ILUB 2HVRA 3G1OA 1K4TA 2CH0A 3H0DA 1D4NA 1XCBA 4HRIA 2MD5A 1NNKA 4UY8I 2XXUA 4C1TA 3OYAA 4I8CA 4B47A 4WXJA 4M3EA 4IVNA 3OS1A 1XMKA 2XPUA 4B1RA 1PBPA 4N91A 4PGPA 4Q0CA 4BL0B 4HX7A 3H0GJ 1R49A 4EJTA 2DLLA 1X1CA 2Q0OA 2D5WA 3KZYA 1ZH5A 2F6GA 1LFBA 2GIVA 2E1NA 4OENA 4MFEA 3IHUA 4FQGA 5D4SA 3RGYA 3S9EA 3CMYA 1P92A 1Z67A 3E13X 2R3SA 1TWFJ 1YYZA 2YPNA 2NVUB 4A3KJ 3OIQA 3TMOA 3PM1A 1YFHA 3OYKA 2XA5A 4UVAA 2P5KA 5C4XJ 1FRPA 2V1NA 4F52A 3X2QH 3AL0B 4KD5A 4P0GA 1TZLA 4YKJA 3ELKA 1ULYA 3SEYA 3BQYA 1CB6A 2ZZXA 4JWXA 1II5A 3KP4A 1IMAA 4JXIA 2H8WA 2G7HA 2LH9A 1UQWA 2DO7A 2A61A 2IA0A 5FKKA 3OR1C 1ZMGA 2VP1A 3LUZA 3WGHA 3FM3A 1VTNC 3M8UA 3IOVA 1B4AA 4E7IA 2MA3A 1T8IA 2ELKA 1W0TA 2XWVA 2KISA 4LLNA 1AA7A 1YIJI 2NVYJ 1ZG3A 3CDLA 2LF8A 1FMWA 1TL8A 2DTRA 3KP3A 3K70D 1ZIUA 4KYSA 1QNTA 3TQLA 3BDDA 4G8HA 4FX4A 2X1CA 3BROA 4FTHA 3VLVA 2NVXJ 3HRTA 5HDGA 2AL4A 2F5EA 1XX5A 1UB9A 3PQKA 1BM9A 4F3GA 4LZ8A 3K0LA 2Y7RA 1MS7A 1JTXA 3ZMVA 4JVIA 1WHUA 1I69A 5CVVA 1UHWA 5LHIA 1JJ6C 1OR7C 4EJVA 3ABLH 4YIFA 1GVJA 1F1ZA 2OD5A 1OYWA 2OTLI 5HS7A 2G29A 5LGUA 2MSYA 1IXGA 2HKXA 3FVNA 4GX4A 5H6QA 1YZ0A 2ACJA 2DWHA 3FJ7A 3D5SC 5L3GA 1HDDC 3TMGA 1X3UA 2JTVA 3M07A 3DP7A 2QSFX 1I39A 1Z7LA 1IUFA 2QVRA 4N4OB 3KP5A 1NHAA 1LSTA 3IO4A 1PP7U 4YU0A 1BTJA 3PL8A 2NXOA 3UORA 2VC1A 1TWGJ 2QSXA 1TWHJ 2IBDA 5GTIC 3S1RJ 4Y3OA 2X6XA 1F4KA 2F3BA 2DCEA 4KI0E 2BJJX 3O8HA 4IRIA 4FECA 3DPUA 4A2UA 2VJ5A 3EHSA 5E8GA 4NMYA 1FMVA 5EYHA 1WKMA 2L9RA 2EILH 3CCSI 1ZYRF 3S3OA 1EH6A 3WG7H 1KQ0A 1ON1A 3GBAA 1I5ZA 2CV0A 2EBIA 4XNFA 2L9VA 1FQFA 1SVXB 3EHTA 3OO9A 2DA4A 2WYPA 4QBAA 3TELA 2DMUA 1SFKA 1WVJA 2I4CA 3MUQA 1JKRC 2XVCA 2E1MB 2I58A 3K6VA 4OVSA 5DVJA 1XGMA 1S9TA 1UCRA 4O94A 1XSDA 1FJ6A 3F8FA 4GWXA 4RB1A 5FD5A 2R5ZB 3N5LA 2OAZA 4IO4A 2ZB9A 2DQVA 1MXVA 4XSZF 2MC4A 2W48A 2W4SA 1YLFA 1Y39A 1B3EA 2UXAA 3KBZA 4XKQA 3OYEA 1EZOA 2X6WA 2HYFA 2AS5F 2L54A 1RKMA 1BJAA 3V8JA 3DEUA 4CZZA 5I59A 2HZKA 4IRHA 3Q9SA 1MMDA 5H8QA 1VQ7I 2Z9OA 4OXVA 5DUKA 1YJNI 4GYGA 3HOWJ 4N81A 1R6ZA 2W24A 1KU2A 4AD9A 4A3DJ 2LY9A 2IXSA 1S7EA 2E7XA 1OQYA 1DGRM 2V26A 1A8EA 2DS9A 2O51A 3WTVC 5DD8A 5K5QA 4EEFG 4EJWA 4KR5A 1IXCA 3MEXA 1EZ9A 2V4CA 3P9CA 3WE3A 2IS4A 2ZBKA 5HS8A 3KP2A 4NHBA 2Y69H 3K4NA 3V42A 1CF7B 1AMFA 5F1QA 3M4OJ 4DQ2A 2R9JA 4U22A 5M2VA 1N76A 2RGVA 5I56A 3E79A 2EIMH 2UVGA 3K4MA 4FE7A 4MLOA 3R4KA 5DYHA 1RZ4A 5H8FB 3FVGA 2Z99A 5KVRA 3E6CC 2RDPA 4BXXJ 2ME0A 4GX6A 2PI0A 2HDCA 1JETA 2WBDA 3EPZA 3IORA 3U72A 3RTFB 1ZAOA 2KJBA 5IP7J 4GL0A 1I1SA 1ZHFA 3GEZA 4NC6A 4OVTA 2OPTA 3H35A 5LEKA 4H0EA 1A31A 5A5XA 4R74A 2CFOA 3DLLF 3JRGA 2BOLA 4BE0A 1S7AA 5DM7F 3O8GA 1FQCA 2E5ZA 3SZGA 3OYCA 1IZ1A 1USTA 4G7HF 1YS7A 1DTGA 1I6QA 1Y3PA 1YXIA 1FLIA 1BIAA 4IOAF 4FBPA 3TYHA 3JSOA 3G4SI 3RDIA 2R7UA 1GGGA 3IL1B 1RI7A 1K79A 1B5HA 2I0BA 2XXYA 2CWEA 2Y84A 1WJFA 5E1ZB 3TW6A 5BMZA 2K9LA 3IAZA 2PFZA 1G3WA 3K0VA 3T9HB 2STWA 1ZGJA 4P5OA 1LB8A 2HTJA 1U5TA 2A68F 1GUUA 1FPBA 3W2AA 5CQGA 3PU5A 2OU2A 3IH2A 2LTPA 1QPMA 4MJOA 4UUTA 2F5XA 3QPTA 1M5DA 1N7WA 4H8IA 4EQBA 3T9UA 3I4NJ 1J2XA 1GDTA 5C4JJ 5KNLA 1YTVA 3ZKLA 4PBQA 3LSMA 1WFXA 1FTKA 1JGSA 3OYHA 2KIMA 3MPLA 3RNNA 3LAPA 1USYE 1Y0UA 2Z8DA 4JQFA 2DAOA 4I01A 5JHUA 1RKTA 2R7FA 3GTLJ 1OMIA 4YMAA 4A0ZA 4IEJA 4RMNA 4O7IA 4EJUA 3GLXA 4PGNA 3TKDA 2EZIA 2RAEA 3J7YJ 3O9PA 3VYSB 4FJPA 1EV7A 1DP3A 1NMUA 2XB0X 1XGSA 2EB7A 1JW5A 1FOKA 4KN4X 1QZEA 4LB6B 3H3GA 1YOVB 1TQMA 1TW3A 2V6CA 3S3MA 4C2UA 1Z7ME 1G3YA 2DOFA 4QFOA 4XBFA 4QSEA 1TLHB 4HXVA 4NF5B 3T9VA 2JVGA 5FB2A 2ZJQF 2O84X 4YG2F 3BKIB 4U88A 3JTGA 3F9KA 1I6HJ 1YRNA 3MZ9A 4HSRA 3N94A 4NE4A 2UZKA 3QXMA 4DZJA 5EQ9A 5B5EC 4B8XA 2K5CA 1MSFC 1BI2A 1E3PA 1FBHA 1QA6A 3C31A 1MW7A 1ETYA 3QYBA 3E6BA 1ZGAA 5IAIA 2QKLB 3G1LA 1X3WB 2IGKA 5CVIA 1ETWA 2ELHA 3VV5A 1P4XA 1MY3A 1JT6A 3Q0VA 3J7AO 2VOPA 1EYKA 3PPRA 1QZZA 1V5EA 1QVSA 1IC8A 4OEUA 2VC0A 2W00A 3OEKA 4POXA 3IAM2 2FBKA 2V9PA 1K6OA 2CO5A 4A3LJ 3FXRA 3E9XA 3H06B 2E1OA 3LFKA 1HSEA 1NNFA 1WRJA 2BY0A 3VYRB 3ZQGA 2ESHA 2CZHA 2EV0A 3CO7C 1FPLA 2HWVA 1D0XA 1WJBA 4NF6B 3IAS2 4LK1F 4MH5A 3MAMA 4F18A 2CRGA 4G6DA 2ZFWA 2OQGA 5ICCA 2PN6A 1MBFA 4KICA 1MDQA 1IMCA 2ANJA 4BQAA 2QGUA 3Q0WA 5DEQA 3EKIA 3QWLA 5B70A 3BWGA 2KKOA 1U5TC 3G3FA 4PP0A 5D8KB 2R7RA 2R5YB 3C4MA 1H45A 2M34A 2BVLA 2XD2A 2HS5A 4S05A 4L0YB 4IHXA 3CD6I 1MXUA 2I3WA 2ZNYA 2QMWA 1D0ZA 4HOBA 4BXUA 1I3AA 3GTOJ 3TFLA 1LBZA 2XHKA 5IM2A 3TCGA 2UXXA 4AUXA 1GV5A 3ABMH 4ZYHA 2HXIA 2NS0A 2KHMA 2XPVA 3GYYA 2L5QA 3CUQB 4DLDA 4PE3A 1SW2A 2Q89A 4XK4A 4A3JJ 1W0UA 4BDLA 4A6EA 2E19A 1F5TA 1FZPB 5LDZA 3HGYA 3V83A 3DKYA 4M9ZA 3F0CA 4N8GA 3RN8A 4BYYA 4CH7A 3L2CA 1YE9A 1ZRDA 3L2RA 4EQ9A 2O03A 5AA4B 4XKNA 4A3IJ 1B8IB 1B6HA 4NGUA 3KEOA 4F7ZA 1TNSA 2M45A 2R5ZA 5I2NB 5M3MJ 4L5JA 3K10A 2CGPA 4R8HA 2RF1A 4NF8A 2XAUA 1RPWA 5GAGJ 2DPUA 2DMTA 4BH9A 3MW0A 3FJMA 3QMFA 1LBCA 1B6AA 2FJ1A 3LC8A 4L0ZB 4HNVA 1N78A 1U9NA 1UJ8A 1SPIA 2I48A 5GPAA 4ZDLA 2DQLA 5IT9Z 1BI1A 1Z21A 5FKLA 2OF7A 4MNIA 4QFLA 3AG3H 2A07F 3J7ZI 3AXFA 2HOEA 2Q2CA 3LWFA 2K02A 2HZTA 4ABZA 2VOOA 3CVGA 3K7AJ 4PSWA 4Y13A 1KWHA 2Z8FA 3DCFA 2GZWA 5GAHJ 5IOYA 1O3RA 4H67A 4RA1A 4II3A 1CF7A 3IOUA 2DFHA 2ECCA 4GF8A 3EQLF 1IN6A 3ZKKA 2DN0A 3KPHA 2UYFA 4YB5A 4CICA 5D5XB 4QPQA 2DK8A 3TO9A 1NTCA 5LLQA 1AKHB 2PT2A 3SEWA 2Z33A 3NAUA 4R79A 3KZZA 3RKXA 3CJTB 5DTDA 5IT3A 3HOVJ 1NUZA 1FIPA 5HLTA 2MLGA 1V5GA 4HV5A 1MNMC 2LLKA 4U23A 4RGUA 3RZDJ 2P81A 1R58A 2X9DA 2DW4A 4R2BA 1Z91A 1G0IA 4F3PA 2JJ7A 4WWCA 3B50A 2NUVA 1U2WA 1IF1A 1LBBA 3MC2A 3E78A 3PQJA 2PYYA 1K83J 2PEXA 1S3JA 1R23A 3FMQA 2HVSA 2OCEA 2FHYA 2WAQN 1XT8A 5K2YA 2UV1A 3HIFA 3FXOA 5JVGF 5FKOA 3S17J 1TQIA 4P0IA 3E4RA 4ZECA 4A3MJ 1QRYA 3JZJA 2F34A 3CFZA 4XRMA 2FQ4A 2GM4A 3FD3A 4N8YA 3VPRA 3K2ZA 1RDYA 1MNDA 2CSOA 2VIXA 1WODA 4P11A 1ZQ3P 1QGXA 3ROJA 1UIVA 3SETA 3NOHA 4LMYA 1N77A 1FPDA 3GXOA 4GCVA 2DA5A 4NEDA 1SYIA 2WAEA 2MBFA 1J9IA 3GW2A 4M3BA 2LKSA 5BWJA 1IN7A 4GRIA 4XIDA 3RJPA 4G7ZF 5K7ZA 3A0HC 4BBRJ 2CW8A 3K2AA 4QIWN 1O3SA 3THIA 1B51A 4JWOA 1X3ZB 3TTKA 5HDKA 4H4KC 4WCGA 4FE4A 2THIA 1T56A 3FISA 4QXDA 1L5TA 3WAEA 2OWSA 3LSRA 5K2XA 1T08B 4L5IA 5CI5A 2MLKA 1IXHA 4QSDA 1BI3A 1XG1A 1B1HA 3AG4H 1Q1HA 4NAPA 3C2HA 3G3JA 4QHQA 4LP2B 1W7PA 5CMMA 5L9MA 1HKSA 4Q30B 1OPCA 2A6EF 3FKJA 3ZQ7A 1IN8A 3OL3A 2CQQA 4N9HA 3R0JA 2HKOA 1IXIA 4C2TA 2REJA 3MP6A 4YB6A 1FYMA 1TBXA 2XXPA 4P8BA 2YS9A 4HSTA 4AVZA 5EHSA 2Z2SB 1DSNA 2BY3A 3QUFA 4P1EA 1W5TA 3KLNA 2GXAA 3FXMA 3M3FA 4RAGA 1MY4A 3DP4A 1OVTA 1SD5A 1ZLQA 2ZSIB 4KPTA 4GX3A 1ONVA 2K3FA 2Q2EB 3MZYA 4NF8B 3S2DJ 1INPA 3F72A 1R71A 5F1RA 2HTSA 2LBFA 2E60A 1N84A 2AL5A 2ZNTA 1NK3P 4NF5A 3IRQA 2GA2A 1Z77A 2CG4A 1OCCH 4QWQA 3IRRA 2DMNA 3WTZA 4RGRA 4OIQF 2QVVA 3K6XA 5ITOA 4M3GA 2ICWG 5FLXZ 3CF5F 2OWZA 3KC1A 3U92A 2B4LA 1NNPA 1LAFE 5I57A 2EJRA 5FKMA 2JRTA 4PBHA 4JBZA 2HPGA 4XKPA 1IG7A 4OVPA 3EETA 2HPMA 4G6TB 1DQUA 4M9XA 4BDOA 2V79A 3PJRA 4Q8RA 4ZJZA 3RQTA 2K4JA 4W1UA 4MEXF 3BFTA 3S1QJ 3DV8A 4M1VA 3ERED 4BHPA 4RAZA 2MYSA 1J0RA 3AG2H 4HAMA 4BHBA 3HRSA 5IPAA 1T39A 1BKAA 2VPOA 2XX7A 3WG9A 5GADJ 3BG9A 3DLNA 4GXAA 2QLZA 3UN6A 1SD3A 1DCUA 4TQUQ 5BPIA 4XKCA 5EYRA 4KITB 3K6UA 1EH8A 3E3VA 1US5A 1B7ZA 1I6BA 2R0QC 4A3FJ 2LOOA 3ONMA 4GFRA 4PETA 4D7NA 1EYIA 1YHQI 1LLSA 2RC8A 3IKVA 4NF6A 4N17A 2P0WA 4PSXA 3RCOA 4RJZA 3JRFA 4C2MJ 3PO2J 1WDNA 2R71A 1BOBA 1LCFA 4PGHA 5FJ8J 3H03A 1VI0A 1B72B 3OR2C 3GTMJ 2NWJA 2EV6A 3F8BA 4M6VA 4KFCA 2AQFA 4AQ4A 5AIPA 5IOZA 2KRCA 3T0JA 3H9QA 4CCOA 1B0HA 4LZ7A 1TTYA 1RDXA 2OA4A 4HYEA 3VEPA 4NF0A 1WSUA 5TJJA 2Q8JA 1B2HA 2R5YA 1KA0A 4O7MA 4ANJA 2JJKA 2XWOA 3I59A 3F3XA 1SVLA 4YB7A 1JJ8C 1QUIA 2VQGA 4U4SA 1NI9A 1SAXA 1AIVA 1SEUA 1ZTYA 2IS6A 3K4KA 4BGDA 2NNNA 3KE2A 4Y52J 4A12A 2WX9A 4H1XA 4EF1A 3FXKA 5D8LB 3U1DA 2WEFA 3LUYA 2L9SA 5CPRB 2DYSH 3A3UA 3HHFA 2ZYKA 2UVHA 1MSEC 4OMYA 1YCJA 3CJQB 4HCYA 1O7LA 4LG0A 1D3YA 2JA8J 3GFIA 5TP9A 5AA4A 3TTNA 1R00A 4Y33A 4F93B 3HPIA 1B8IA 3GZ5A 4XXUA 5FBPA 3CC2I 4NWCA 2IAIA 3TPAA 5AA3A 2O7OA 5I2NA 1YW9A 3NARA 4F29A 1G0HA 3Q27A 3TCFA 3IH4A 3CCQI 4MHGA 2F48A 1EYJA 2OCCH 1MPCA 4U0VA 2XSJC 4F55A 3WU1B 4G77A 2DMPA 3FBNB 4PDDA 5D5VB 1OMPA 1DOTA 2YR2A 1D9VA 4MX6A 2D45A 2B0LA 2DDAA 1VSOA 1IDYA 2D1HA 2RNJA 1NH7A 1SD4A 2K9SA 1FTLA 4I09A 1MQIA 1V55H 2H94A 4MMPA 3D4CA 1LVKA 2M8GX 2ZSHB 1MMAA 3DTIA 1LEVA 1R5ID 2VN2A 5J8CA 4XLNF 5L3BA 4G8MA 2VONA 5E3LA 5J1UA 2L7FP 1QUKA 2W7YA 3SERA 3S9LC 2D21A 2P8TA 1TWYA 3C34A 2WY8Q 1MBGA 5BNGA 1NV4A 1RYXA 1MZBA 1PDNC 5E79C 1AKHA 1MQJA 2K4BA 2B4MA 3M3LA 4RM2A 2E1CA 3DWLE 2Q88A 3FDYA 3JRAA 2L7ZA 2FRHA 1TC3C 5KDTA 4P56A 2FVZA 5DVIA 2O1LA 2B63J 1IMDA 2DE2A 4A3EJ 2VKVA 4BE1A 1XC5A 1LBWA 2OBGA 4PFRA 1G6NA 2ADUA 3S2WA 3CC7I 1FTMA 3FBPA 2PBWA 3E97A 3GLBA 1SFUA 3LSXA 5EYGA 1O7FA 3ZRGA 1VQLI 1KYZA 4YRVA 1YTYA 3M8JA 3B6QA 2F5DA 4XKRA 1FSEA 1PYVA 2QQ9A 3HRUA 4MCOA 4DJAA 2EQRA 1E3HA 3U9GA 3JSPA 1FBGA 2Q2AA 4FISA 4KHZE 4DI4B 3ZOBA 1US4A 1V5FA 4OTEA 1FTAA 1ZK8A 4TV7A 1J7KA 1HBXG 1MM7A 2MKZA 3TUSA 4PCQA 2O0YA 5I5PA 3FIWA 5H8QB 4HG2A 4A3CJ 5ICFA 4E0XA 3OIOA 3PD9A 2VUMJ 5AA1A 1ZLKA 3HOZJ 3I71A 5K1YA 2L4MA 4F3QA 3GZ6A 2RC9A 2IGNA 1P4WA 4HA8A 4IX7A 1K4SA 2NOJB 4L9TA 4AB5A 1ON2A 4BEHA 1U8RA 1KQ9A 4UHTA 1PDAA 4R2FA 5AA2A 2FF4A 2CQXA 4IGRA 1FPQA 4V19K 2KLOA 1XN7A 2F6CA 4BXFA 5I56B 1U8BA 3GFLA 2VLAA 3I55I 1VNDA 2CQKA 4F1VA 2DA3A 3EUAA 3OS2A 1MJ9A 4DIQA 3VVDA 1B9NA 1Z05A 4NC7A 2MFZA 4XLHA 2HPIA 4Y4RA 1PBQA 3QPHA 1FBSA 1B3LA 2DT6A 2NOOA 3TP0A 4UV9A 1MXXA 4X04A 1J75A 3W9WA 1MBEA 4XM3A 1REPC 4NQWA 3CR9A 3I64A 2AQEA 2M7BA 3JRHA 2M8CA 5A5XB 4V2GA 1IV8A 4BQQA 1HSJA 2K7LA 2Q2EA 4WF2A 5FLMJ 1MMNA 1FBCA 4H0WA 2WV0A 2FSWA 2DJNA 1LAHE 5ET7A 3A4CA 2R7XA 1JXSA 3W2WA 4IF4A 3FMSA 3OYJA 3G7WA 5LTCA 4GRKA 3S2HJ 4LONB 4HS7A 1G8XA 3JW4A 5F0FA 3V89B 2Y0MA 2XGCA 3PGFA 5EJCA 2W82A 3LA3A 3QOPA 4F19A 5KZTA 2DTZA 3BJOA 1U5TB 1WJDA 3BR1A 3G3ZA 1HA8A 2QMXA 4DDDA 1B9MA 3DP8A 2RC4A 1MH4A 2FYIA 3JYRA 1GVCA 4KIFA 3LL7A 1OLCA 2L7KA 3P7IA 3L2UA 1BOAA 2XRLA 1ZREA 3K01A 3SEUA 2NVTJ 3HSTA 4MBPA 1YO5C 4ENMA 1F9BA 3Q29A 5EDNA 3U1KA 3BG3A 5GTHC 3KYLA 1IMEA 4F1YA 2FA7A 3O6HA 4FORA 4LQ5A 2KPMA 1W5SA 1AU7A 2EA4A 3ZQQA 1IEJA 2VT3A 3PTYA 1LJ9A 3BZCA 4JX6A 5I7IA 3BIHA 1NUYA 3LBSA 1VDWA 3GZGA 3VOEA 3WTYC 4DZ1A 1IO2A 3GO5A 3LSPA 3OYGA 2OK2A 2AO9A 3C7JA 3G3HA 3H3VK 3W6JB 4M4GA 3QPLA 4XN3A 5F7VA 1B72A 2IS2A 2O1MA 4F3SA 4IHYA 4GIZA 5HM4B 4H45A 2V1XA 2RINA 1BW5A 2M5WA 3CUOA 4JK1X 2CZIA 1GV2A 3T22A 4PGGA 1D9QA 1MMSA 2O3FA 3H1CA 1Y1WJ 2O68A 4MFIA 4L9JA 1JVYA 2ME6A 1YJWI 2VBZA 1DK4A 1XVXA 1IRXA 3WE2A 4BS9A 3J7AY 5ILSA 5CMKA 2DWAA 3HOSA 1PEBA 2WKYA 4BACA 3K1MA 1YRNB 1IMFA 2ZXIA 3DEEA 1KZHA 3VFZA 4NHJA 1BW6A 1ENHA 3PD8A 3HOYJ 2F4OB 2CEYA 2IGMA 2KQZA 1LDDA 3Q5FA 4LIVA 3TOAA 4I0BA 1BA5A 3U93A 3PV0E 1B58A 1P1QA 2OBPA 3GVAA 3RPUA 2ABHA 2XXVA 1R1TA 3FXLA 3CZ6A 1MDMA 2QEXI 1K9ZA 1XDUA 2TDXA 3DXJF 4DIGA 3E6MA 2RREA 3DKXA 2DT7B 3QUJA 1SVOA 4KA4A 1FBDA 2DMQA 2DJIA 4HDVA 3G73A 1S72I 1RR8C 2GFEA 3S93A 3WTSC 1LEBA 2QS1A 2KRHA 4AWXB 4G6QA 3B7DA 3I4PA 2IVMA 3MMYB 3SYTA 1RUOA 4V2FA 3EHUA 5F24A 4CCLA 2YLNA 3S9MC 1T38A 2JWTA 2EWNA 5IYCJ 1YITI 2GIZA 4RLQA 5DD4A 4E6KG 2RCBA 1T0FC 4D5FA 2ZJPF 3FIRA 4YEJA 3I53A 1A54A 4DBRA 1FSAA 4E0WA 4XFEA 4YIIA 4A3GJ 1JKQC 2HQ5A 2WADA 3PUBA 1R5GA 4L5EA 3JRIA 1S5LC 2C6YA 4LB5A 3EPEA 3IWZA 4HLXA 3G3KA 4ND9A 2CFXA 2NNYA 2NS8A 3KZIC 4ZE9A 1ZBMA 4DXCA 1OYYA 2XAQA 4F2OA 3S8PA 3VVEA 1SMTA 2XAGA 3HM5A 1V54H 3BY6A 5HLIA 5HLGA 3L2VA 4RA2A 1MIJA 1B32A 1MG1A 3RPLA 5ED4A 2PMSA 2FIEA 5CM6A 4IOCF 2FQ3A 3I6VA 1Z6TA 4Q4ZF 1LBYA 4CSWA 2AXTC 4B3XA 1OQGA 4RY1A 3CHGA 1N3XA 1NUWA 4I98B 5FFZA 4QFPA 3T96B 3W3CA 2DYXA 3SJMA 3ULQB 3UGWA 3KN8A 2R7WA 3EYIA 5D6EA 1T6SA 3BJAA 5ERIA 1A40A 2XX8A 2HHMA 2YU9J 3OENA 3KBRA 1UTBA 5E3MA 2EFOA 2PMZA 2GOMA 5BQTA 3JCUC 3HPGA 2VPLA 1IRGA 2GH9A 5BPDA 1S29A 2HEOA 2XF7A 3TEDA 1IJWC 3ECOA 4OIOF 3GTGJ 2P3VA 3G1MA 3F11A 1NV0A 2YPRA 3TTRA 3V5AA 2DVZA 3EF7A 3MWMA 2K3PA 3FXUA 2HOAA 3HSFA 4XLFA 2X48A 1ZKBA 2DFFA 4JB7A 5DS9A 2VT2A 3UR3C 2JRMA 3K6GA 1XS5A 4G61A 3A09A 3HZJA 3SEZA 1N04A 2QRYA 5H8NA 4AS5A 3JREA 4R75A 2QWWA 3J80Z 4UUSB 2OC6A 2E36A 3QAXA 4P1WA 3LSFB 2FBIA 5FGMA 1XB4A 3CLQA 4M72A 5FKNA 4P9KA 4PF8A 2CQ7A 1VZ0A 2QSGX 2D3IA 3IOWA 3MD2A 1ZR4A 4UA8A 3FF5A 3A2KA 3TGNA 4XICA 1KYWA 3HHHA 4NC8A 2W7NA 1U6GA 2KQRA 2IA2A 4CZCA 3FVKA 3PMVA 1OLTA 5K5OA 5TPAB 3ILTB 1VQPI 3WHBA 2LK2A 2J5OA 4X1BA 1SFXA 1WQ2A 2XAFA 4J00A 3G3IA 4UV8A 3T9XB 3DEWA 1UAAA 1K7AA 5TU0A 4PK4A 4HNUA 3EUKL 2OZZA 4OHNA 2B9SA 1VFEA 2E35A 3HCQA 1HOMA 5IGAA 3QOEA 1FOYA 1XI6A 1IXRC 1N0TA 4D0PA 4D1QA 5EZHA 2QQBA 1R4MB 3M7GA 1GLNA 2R7QA 2W57A 3OSGA 2V3TA 1UG2A 2KRFA 5C3EJ 2E1SA 3V8XB 4P3LA 2XC7A 4UVCA 4GWWA 5B1BH 1L0OC 2O8XA 4LZ5A 1YYVA 4ELQA 1CE2A 1UELB 3F8NA 5GPCA 1DTZA 2BZTA 1XDSA 1KZ8A 4L18B 5ILVA 1Z7NE 3HSEA 3FASA 4RAFA 5HNHA 2WAQA 4I40A 5FHNA 3BR0A 5D5UB 2BEOA 1OJLA 3GZNB 2D1VA 5FLVA 2KDZA 1KONA 3QU3A 3MVYA 4BUPA 4HF0A 3HC7A 3KJ7A 4C1UA 3LQRA 3PUZE 5IYDJ 4G2ZA 3BFUA 1W7PB 1AWCA 2HVQA 2RQQA 3WHCA 3D1NI 3CCLI 2NVQJ 1MQGA 4R9FA 5DT6A 3VYUB 4G12A 1OCPA 1PUFB 3A03A 3I0TA 4EJOA 2HQRA 4X9TA 4OEVA 1Y3NA 3K4UA 2CZLA 1XGOA 2B3BA 3W6VA 4LIUA 4CYCA 2XXTA 1JHHA 1AOVA 2DE3A 4I0AA 4CYDA 2F78A 4LOCA 2XKPA 5FO5A 3DELB 3QYTA 4HE2A 2NOGA 2DWIA 3E5XA 1MH3A 3PIPF 3F8CA 4G7OF 2LBFB 3CESA 4GYIA 1HCRA 1LEAA 4E7HA 3N4MA 5LHHA 2V84A 5ET5A 2ONSA 4IRGA 4KMUX 5E1XA 5J6XA 2P5LC 2DOJA 5E18F 2Y5LA 4KUMA 4OFJA 3LSKA 4EV0A 4DYRA 3PPOA 2KT0A 3IC7A 3G71I 4NG7A 5I57B 1B3HA 4IO3A 2Q8KA 1U0JA 3B6WA 1F36A 3PPQA 3L1PA 2VE8A 4JYKA 5KAFC 3LOCA 3Q26A 5H8HA 1MY2A 5JK4A 4ZZEA 1S7OA 2BXYA 1ITYA 3ZQHA 2KIFA 4C3HJ 4RM3A 5LHGA 3RT8A 3KIOA 3VYTB 1MXYA 3REOA 1PB7A 3H6WA 2GOXB 4LLLA 3MP1A 1P9QC 2EFNA 3HSRA 3IX1A 1J59A 1IN5A 2B3FA 4ZS9A 2DOAA 1D1AA 4M9SA 5ICGA 3H5NA 4PFIA 3HB9A 1ETVA 4BDZA 3TTLA 5FROA 5J4YA 5JR3A 4U7BA 2F4IA 4NN3A 4IJAA 2A69F 1YS6A 1RDZA 2GAUA 3GTKJ 2N8GA 1WH5A 5CMCA 1IRFA 3I3LA 3LV0A 4X48A 1NV2A 3LNQA 2VBYA 2I4BA 1OVBA 3E3KA 3R6UA 4D7MA 2XIGA 3I59B 1Q35A 4F91B 1QVUA 4KMFA 2IA1A 1ETKA 3CG1A 5EZGA 5K7HA 4KDPA 1PB8A 2IS1A 3B6CA 4XMYA 3RKYA 1H3DA 3BR3A 2K86A 2PMZN 4ZH4F 1H88C 5IYBJ 1T98A 2XASA 1QUJA 2RCAA 2OJTA 1B4ZA 2HR3A 3TO7A 2KP6A 3V7SA 2LC2A 2R7VA 2V93A 1LQ1A 4B43A 5IP9J 2Y75A 2XKOA 1IAWA 4LG0B 5IT9K 1B5IA 1FTJA 5TP9B 4BDRA 4BDQA 2PT1A 4LLGF 4RYAA 1LUJB 1TW2A 1D0YA 5J1DA 2VL8A 4DYCA 4J01A 4NWDA 3K69A 3O6IA 4N07A 4YKIA 4KN7X 3CF2A 4WXHA 1MQDA 4RPOA 2VQCA 3T1BA 3WTWC 1O7TA 2Y7IA 1JTYA 3AAFA 4BNCA 3TZAA 3VLUA 2HOSA 2PG4A 3BZ6A 4PQJA 2BW3A 1M5CA 3IO6A 4RS8A 3QP5A 5A2QZ 4XF5A 2ZJRF 1USSA 4CHUA 1FTOA 2YX4A 4KT6A 4HPQA 2FBPA 2ZXWH 2JUGA 2ZNUA 3TQNA 2TCTA 1RYOA 4JSOA 2JK3A 5HNFA 4XR6A 2ZC2A 1ETOA 1LE8B 2O7IA 4WXDA 1F9NA 1P7JA 5I84A 2A5TA 4ZTJA 2R7TA 1FX7A 3N6UA 2ECBA 5KCJA 3DTKA 3OOUA 1PB9A 2Y7KA 4ZYDA 1AL3A 3GCMA 4UUSA 4ISUA 2HQAA 4WX9A 2CW7A 4JOMA 4JX4A 1ZJLA 2GXBA 2LG4A 3LFUA 2HU9A 2E0SA 1RESA 1I6XA 6PAXA 1T95A 2HFBA 2Q9TA 3PMWA 3HV1A 2HFHA 3QYFA 2HNHA 2KJCA 2HEUA 4U0WA 3ZS6A 1VQ4I 2O6AA 4HW8A 2Y30A 5K7FA 1FCKA 2XXQA 5HBCA 1UTHB 4CUGA 2RN7A 5TPAA 5H6RA 4B44A 5KDTB 4PTKA 3U21A 4QSCA 4R9GA 4IHTA 3F6OA 1NK2P 3PO3J 4BE2A 1B52A 1MPBA 3RPWA 3MWBA 4PFBA 4F2QA 4Y15A 3MP8A 5HODA 2JPBA 3LSWA 4HLYA 3ZSFA 4L9VA 1A7LA 2V3UA 4HBLA 1GXPA 3DPTA 1HDPA 1I27A 2DE4A 3KG2A 2DK5A 3MQ9A 4ZYEA 3MFKA 4DXBA 4DI3D 1FW0A 1NH8A 1OLAA 1SD7A 1G59A 2Y7WA 2CUFA 4I99C 3T0YA 5L3EA 2XXXA 3IK6B 4GL8A 1MJBA 1W36C 2L0KA 3C35A 3FKIJ 5L3DA 5F1JA 4TLMB 3E6DA 3D1RA 1B7HA 2DDBA 1YX3A 2M7AA 2A5WA 4HX4A 3OEMA 5CKTA 3QRFF 3IKTA 4MLQA 1A5JA 4P47A 3DU5A 4BEHB 1IUDA 2Q8MA 3GTJJ 3EYYA 2Z16A 4LFUA 5AA2B 3CP2A 2DYRH 1HXDA 3WTTC 3TDUC 2X1DA 1XVYA 4ZZDA 1Z0XA 1O3QA 3HTUA 2ELJA 4BQOA 3B8BA 4ASNA 3OYLA 4IY6A 1OCRH 4AVPA 5LFAA 2YSRA 4Q47A 4CXFA 4GD5A 3FWEA 3F21A 4KQPA 1JW1A 2ZYNA 4G94A 1L3LA 4RNSA 2LFBA 1R4NB 2XB5A 3BLYA 1K78A 2A5YB 3HYIA 3R6SA 4I3EA 3KEQA 3TQWA 1TWCJ 3CJNA 4B48A 1PUFA 4FAJA 3M1CA 3HN0A 5FLXK 4XOTA 3F6VA 3FXQA 3MVWA 2R4GA 4NQWB 5DCFA 5LRRA 1UFMA 5E3NA 2R6GE 1FPGA 3K9TA 4GFBA 1MM6A 3GFMA 3KYDB 2FNCA 2R8TA 1ACIA 2F97A 3HPHA 4O5VA 1X1AA 2KIQA 3HBLA 3O2PE 2Y2ZA 4IO5A 5FTIA 3TTMA 5CBSA 4A0YA 4M3DA 4QTRA 2BBYA 2GQQA 4C0RA 2XD3A 1OCTC 5JI6A 2QS2A 4N15A 3MVPA 4N4NB 3Q25A 2FBHA 4G8NA 3GTPJ 1Z9CA 3P7NA 5IZZA 4LG3A 1EF4A 3CI8A 3A02A 4UVBA 1D9YA 4ZE8A 1VFCA 1MMGA 1WVRA 2E2IJ 3H92A 1DPEA 1IRZA 4IR8A 4YAHX 2K27A 3SEVA 4GGGA 4KCCA 2K9QA 2F5FA 2DBBA 1BIBA 1AOYA 5EQ8A 1Y4TA 1W7PD 1ERDA 2KFDA 2F6PA 1ZKGA 5I58B 3JRBA 3KYCB 2W25A 3CCYA 3M8EA 4OIPF 1R7JA 2HOTA 2LKXA 3DM0A 2PJPA 1WWXA 1Y1MA 2L01A 2CUZA 1PUEE 4RK2A 4O6JA 4QFNA 3GX4X 4BJTA 2H4IA 3BTJA 1MY1A 1QVTA 4U1OA 1IN4A 1SC7A 2XRNA 5FRMA 1OCZH 1DBZA 1HSLA 4BDYA 2EV5A 2R7OA 4ZZLA 3SDGA 5TRDA 4F3BA 1Z7UA 4D5CA 5J8FA 4QPOA 4Z0IA 4NNJA 1ETQA 1NH3A 2VOZA 1LBXA 3A3CA 3CP8A 3U1OA 1DPRA 3OYDA 1P99A 1TFDA 2QCOA 4FT8A 2QSHX 4B4CA 2ZXHA 4R72A 1HSTA 4XLCA 4GBWA 5AONA 4ZEFA 3C1DA 3S4UA 1JKOC 4G4PA 3WGGA 1URDA 3M3YJ 3ESWB 3PUXE 2WAFA 1FYLA 3HO7A 1S50A 1GXQA 3S2VA 3K4JA 4II2A 1K6YA 1ZR2A 4PAKA 4LVQA 5J47A 3VWBA 1USYH 3BTLA 1FSHA 2QJEA 1JEUA 3BT9A 3EQ1A 2M4KA 5D6FA 4EGZA 2LSOA 3BTCA 5ELVA 3H4ZA 2DDKA 1S8NA 4K2EA 4F92B 1NV1A 3UKGA 3CDIA 3T66A 1MDMB 4I2OA 4UXNA 2Z5UA 2X26A 4EM0B 4OAYA 1UG0A 4G8XA 4LJZF 4W97A 2IP2A 1D8KA 1B4HA 1VR5A 2CEXA 4BU2A 2CW0F 2E5NA 1ZG1A 4MFDA 3OO8A 4RLFA 5FD6A 3L09A 4KJZA 3I54A 2XF5A 3QQAA 4EM1A 1ZTRA 3SKPA 2G93A 4M6XA 4MEYF 2K9NA 4H8JA 3I3VA 3BR5A 3MQ0A 2MD0A 5IZ3A 2VGQA 3WU2C 2Y7PA 4ESWA 1ZELA 2QUFA 1SANA 1JT0A 3OELA 3VLWA 3FM5A 4ZYGA 1EH7A 2V1DA 4NB5A 4HF1A 3ZPLA 1GTKA 1LE8A 4WKMA 5DTBA 3VVFA 1JP4A 4ELOA 3QAHA 5CQEA 1EKEA 1LKXA 1LGBC 5FFXA 1NKXA 4F1UA 2XUBA 2KZGA 2Y0SN 4OMBA 3DBLB 3RQ4A 4RB3C 5FHMA 2MH2A 2E7WA 1XSXA 3ABUA 3FZVA 3K4CA 1JI8A 3PMXA 4EQQA 2F36A 2RKMA 2G0EA 2PMHA 1E0EA 4U21A 3RPQA 5L9SA 2WTEA 1NG7A 3NWSA 1HW1A 4KIBA 4ELPA 2PJRB 2P5VA 3WU0A 2CMPA 2XV4S 1H8AC 4Q5TA 2L9NA 2H9BA 1JKPC 1CGPA 1UTHA 2FOWA 3RPLB 4NQ8A 1JUPA 3HUGB 4PJJA 3GF2A 4H5FA 4OQOA 4M73A 3ML6A 3ISPA 2FMLA 4PAFA 2X85A 5JFRA 3ECHA 3RKQA 1XD7A 5J40A 2XROA 2UYEA 3PFIA 2UVIA 4C30A 3W6KB 2EH3A 1C0WA 1XCVA 4IGTA 2ID3A 2JA6J 1VQ9I 2PQ8A 2IGOA 1MNEA 5LD2C 1FPKA 1XMAA 4B3AA 1G2HA 1E2XA 2OQRA 1UTBB 2CV2A 3VXCA 5HDNA 3C9HA 5GP9A 1LAGE 1MRPA 5E1WA 1MQHA 1B40A 5CVJA 2WBBA 2WB1A 2P2AA 4MIJA 2VE9A 2EZKA 1PJRA 5ICTA 1XGNA 2BHYA 1SBPA 1P2FA 2MH9A 3IUOA 3PNYA 5F0CA 5H8NB 2I8DA 2BY2A 4E7KA 4N0BA 4LITA 1EA3A 2BVMA 5EGOB 1SFEA 5E20A 2DSFA 4BKXA 3C32A 4PC9A 3PFYA 2NXNB 2E2JJ 1B1XA 3OYFA 2P0SA 2VODA 3L6GA 4X0GA 1JUMA 4OESA 5H20A 1STZA 1Q1KA 4YFKF 4PJ0C 4DE8A 1P6RA 3T8RA 1X2MA 2XPWA 3CCVI 4D9JA 1MXZA 2ONKE 3U94A 5F08A 1QHHD 2QQAA 2RV8A 3AFHA 2X6YA 4PJNA 2VJIA 2F7CA 3KETA 1AHDP 4XIGQ 3OSRA 1KU3A 2ZZWA 5HOOA 1SDXA 4DOZA 1LFUP 1FQAA 3M3KA 4WEPA 1MBHA 5DDGA 3RSNA 5DCMA 5JHFA 2KIUA 2XF6A 1ZG5A 1IQ7A 1Y20A 3MPKA 2VHAA 1LNWA 1WGXA 3ZMTA 2Y31A 1Q9DA 3LR1A 2F8DA 3BG7A 1Z3YA 3RLFE 4ENNA 2E34A 3FK7A 5A5LA 2QQ8A 4PUSA 4JSDA 1FP1D 1T0FA 2HDWA 2YX7A 4LUBA 4NF4B 1FIAA 3ASOH 1DP7P 4FATA 2CJJA 1OCOH 4GQOA 4OVQA 5JLXA 1VE4A 2RC7A 3S15J 1ETXA 5ICEA 1XS9A 1QKBA 1WI3A 4XN0A 3OMBA 1Y4CA 4UACA 2BY1A 3T5XA 2R7SA 3SZTA 3A29A 4LQ2A 4EDPA 5AA2D 2CQNA 2I10A 3QSLA 4I3YA 3CSBA 3ZR8X 4PFUA 3TP3A 3RYDA 3QK6A 3MZ8A 3B73A 3H5AA 4IB2A 3FX3A 1D8JA 3ZCOA 4XL9A 3BR2A 3PPPA 1M5BA 2CU7A 3PUWE 1BR1A 1IITA 4MLVA 2DU9A 4ZEDA 1R6RA 5I58A 2ZZVA 3RUMA 4PFPA 1S9HA 4CCMA 1ELJA 2F35A 3LA2A 1KGSA 2CV1A 3D0SA 4M6YA 1FJLA 1QPIA 2Y5KA 2GHBA 1WJAA 4HQEA 4FETA 2KZVA 4Z2YA 4YZZA 2IPQX 3COAC 5IKBA 4PDHA 2ZJ2A 3GMEA 5D4RA 3H7MA 3IL2A 1KA8A 3O29A 1UIUA 1TFAA 2WBMA 3A01A 2DXRA 5FHOA 4CO8A 5JVTA 3PSFA 4CYCB 1HW2A 1RETA 4KYWA 3JRCA 1XPXA 4OFOA 3C36A 4JVCA 5KAIC 2DA7A 2HZDA 4A5MA 3RYPA 4BJ6C 1IV6A 1JVXA 3R7XA 4U4XA 1WJCA 3KCCA 2ONRA 3WTXC 4BY1J 3H5RA 4PFWA 2IA4A 2QPQA 4XKBA 4LGWA 2F5VA 2X6OA 4QSHA 3RZOJ 5BS6A 4A5NA 3L2QA 2H6BA 4G68A 3USDA 4X6AJ 2VJJA 3GBBA 4HV6A 3OS0A 3VE1B 4OA4A 3TDZC 1SW1A 1P4AA 3DPLC 3HG9A 1U3EM 1M5FA 4ZZAA 5JLWA 3H9JA 4ON0A 2R7ZJ 2GQ1A 4AIKA 5AE4A 2P1SA 3V8KA 2M30A 3IOTA 3CLOA 2WV1A 4HNTA 5H8HB 2EA2A 5BUUA 3S9NC 3ZQIA 2STTA 2X51A 4I9DA 1RIOH 2G7UA 2YU3A 3SEQA 1POTA 1TQPA 2DODA 3FV2A 3CFLA 3N26A 5L3FA 3FATA 2HXOA 2COMA 4TOZA 3H3ZA 1YQAA 3SHFA 2DA2A