3FXUA

Crystal structure of tsar in complex with its effector p-toluenesulfonate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
molecule keywords LysR type regulator of tsaMBCD
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA03
4U88A 1MPBA 5LHHA 3Q26A 4DQ2A 3KN7A 3OOAA 1W5SA 3FJMA 4ZZDA 1A40A 4GFRA 2I3WA 4QFKA 3RKXA 3BWGA 3QP6A 4XRFA 3FUZA 2Y7RA 2IA0A 1MKMA 1P4AA 1IN4A 2ZMEB 1MH4A 4I02A 4UA8A 5LLQA 4KCDA 5LRRA 4ESFA 4R2BA 5I58B 2UYEA 4EQQA 1ZAOA 2DTRA 3D0SA 3F23A 3QUFA 1IW7F 5H6QA 1REPC 1MY4A 3F21A 1TXFA 1PB9A 1SW4A 3LWFA 4N07A 1MDP1 4LZ5A 1XGNA 4FE8A 3B73A 4EJOA 4OFOA 4HBLA 1ZRFA 4KPTA 4EGZA 4R74A 1MY2A 3MVZA 3VVEA 4FT8A 1USYE 1SW5A 1H44A 3TTRA 2CGPA 2EFPA 2CG4A 4EQBA 2DAOA 5AIPA 1B46A 4KFQA 1BC7C 5J1DA 4GOTA 2NNNA 2KRFA 3VODA 1K78A 1HW5A 4ZE8A 4HF2A 3GUDA 5AE4A 3SDFA 4IRHA 3F8BA 3ZMZA 3N5LA 4GVOA 1ZG5A 1O57A 1UHMA 5L8DA 1BI2A 4NF4A 1ZG3A 4XKRA 1NH7A 4KI0E 3BDDA 4PFUA 3DEUA 1FOKA 2XX7A 4IGTA 1QUJA 4FEDA 3ZP5A 3OOPA 3F6OA 3H6WA 3GBBA 1QQIA 3TDUC 3V89B 1OYWA 3CIJA 4GF8A 4LLGF 2OAZA 3RYRA 2DI3A 1IQ7A 2FEZA 3WGGA 2ISZA 1B5JA 6PAXA 4XTCQ 2PFBA 2HCAA 1RUOA 4KICA 1BIAA 3EPEA 1B7ZA 4ZH4F 4DE8A 5DVIA 2VOPA 1MY0A 3CTAA 2OA4A 1T2KA 2NXOA 3Q28A 4EJVA 4O3CA 4HF0A 3SEWA 1I69A 1J5YA 1VSOA 2ZYOA 5AA4A 4KMUX 2GFEA 5F1RA 5FGMA 1YTVA 1URSA 2DK8A 4R8HA 3F6VA 3KCCA 1XCVA 4OERA 1LFHA 2R7DA 2Z8FA 3D4GA 4EXKA 3P9CA 2Y7WA 4FAJA 5D6EA 3H3ZA 2EV6A 5FHMA 2H5YA 4ZZLA 2VE9A 4N0BA 1HSEA 1SW2A 4MLQA 5IT9Z 3A3UA 4L0YB 3C33A 3OD7A 4MTDA 4Q30B 1B9NA 1DOTA 3V5AA 2DQLA 3V7SA 1MDMB 1QW0A 4G2ZA 2FMYA 4GYIA 4RJZA 4C1TA 4FX4A 5JTYA 4YIFA 3Q29A 1XT8A 3ECOA 4Y17A 3QK6A 3U8QA 1WI9A 4R9GA 1S7AA 4MGRA 1UIVA 5BOXA 4I1DA 4LZ8A 1MGTA 2XXIA 2AS5F 2L54A 2Z33A 2XXXA 3K6UA 3EQLF 3FATA 3RNNA 3KLNA 4LUBA 3WAEA 5DD8A 2DPDA 1BIBA 2HAUA 2F5EA 1PP8F 2EK5A 2FA5A 3CFXA 2Y7IA 3OSRA 4F1YA 2Z8DA 4KFCA 3L6HA 2VBWA 3C36A 4JWOA 3Q27A 3I71A 1JE8A 5H8NA 4EJTA 4P9UA 4HAMA 3KEQA 3T8TA 1M5FA 5D4RA 5ICQA 3REOA 1GXPA 5LHGA 4M9SA 5LGTA 3ZMTA 4OHNA 1B2HA 4I0BA 5H6RA 3O66A 3IORA 4IPAA 4RK9A 3IL1B 1XDSA 4M9ZA 1GHCA 4R1HA 4RK2A 3HSEA 1FBQA 4LFUA 4U21A 5JR3A 4HZFA 4EMSA 1U5TC 4O5VA 1YG2A 1UTHA 2L4AA 4Q47A 2DQRA 3TOBA 1B6AA 3G3KA 1IIWA 1SFEA 3RYPA 4IB2A 5ERIA 4KN7X 2PI0A 4XLNF 1OMPA 3THIA 1Q1HA 4A0XA 2VP1A 2IP2A 5FB2A 1A54A 2QL3A 1U5TB 3GXOA 3QAHA 4G68B 1ULYA 3M3FA 5AA1A 3LA2A 2WTEA 1P99A 1B3GA 1PB8A 2A5TB 4DXBA 1OKRA 1Y4TA 2PN6A 3RTRA 1S3JA 1DPPA 3BOQA 3HOSA 2QBYB 3ROUA 2V1XA 3Q9SA 4OU0A 1Z7NE 3TTNA 3T66A 3R61A 4QFOA 3K1MA 5K1YA 4OZ9A 1B3FA 4P0GA 2HTJA 1LGBC 2DE3A 4YMBA 3F22A 3BJAA 5E1XA 2HDCA 1OQGA 1NNKA 2YX4A 2NWJA 3PUXE 3EETA 1ZJLA 4X1BA 4RY1A 2VGQA 2QRYA 5HVQC 1G3WA 4CXFA 1TW3A 4NF6A 2V6CA 4A0ZA 2HEOA 1D5VA 2Z9OA 2PX1A 4DZ1A 1Y9UA 2EWNA 3RPWA 1UFMA 1F9NA 2P0SA 1R6ZA 2F6GA 5B7DA 3VVFA 1UHWA 1AIVA 4ZEBA 1PUEE 3DF8A 2Y48A 1NNPA 4JWXA 4LONB 1QJMA 3QPTA 2A5YB 5DUKA 1NMUA 2Z99A 5H8QB 1Z6RA 3JTHA 2WWYA 1N3XA 3H3UA 2FF4A 3OMBA 3ECHA 4HV6A 2DWJA 2QENA 2XHKA 2Z8EA 4NWDA 2XD3A 3MP1A 3K9TA 5E8IA 1FCKA 1FWZA 3U9GA 2XXYA 4GRKA 1YIOA 2ANJA 4QF9A 2ZYMA 1G3YA 3F8CA 2A6HF 2GWRA 4ZEDA 4U4SA 1F1ZA 5DEQA 1VTNC 2DVCA 4L9TA 5H20A 2J5PA 1BP5A 5LEJA 4ZEIA 4BYYA 2V9VA 4CHUA 4I62A 4H0EA 1RYOA 4JBZA 4ONYA 4PQJA 5IAIA 5A2QK 3L09A 1YS7A 4R6HA 2DS9A 1MS7A 3FMRA 1ZREA 1UTBB 2MLGA 2D5WA 3MC2A 4GWOA 1T98A 5IT9K 3KJTA 1T39A 3SEXA 4YKKA 1PEBA 3CUOA 4GCVA 3DP4A 3K01A 4L9NA 1YW8A 1IXGA 1EZOA 3GO5A 4JQFA 2ZNTA 3BROA 1IN5A 4KNYA 4OETA 5K2XA 2DE2A 4BH9A 1L3LA 1IUDA 3UIFA 2R9JA 1KA8A 3E3VA 2GZWA 2RC9A 1B52A 1VFEA 5I59B 5L3CA 3PGFA 2GH9A 1NH8A 5F7VA 3QPHA 5AA2D 1XSDA 3U94A 3MVYA 3HHGA 4C1UA 3K0VA 2STWA 4YG2F 4HA8A 3U1OA 3WG9A 2EJRA 2FSWA 3BPVA 3FJGA 1VR5A 3QIMA 3H7MA 3KFWX 3E97A 3HSFA 1B4ZA 5H8HB 3PPOA 1H9TA 1J2XA 4U0VA 1AL3A 4CYDA 1WODA 3DELB 3GZ5A 2HZLA 3TEPA 4ZEKA 5FHNA 4UNOA 2UVGA 1FNNA 1BI3A 2A69F 2ZFWA 3GFJA 2VE8A 1LB2A 3G7WA 1B1XA 1ZTYA 3P7NA 2P6TA 3IOWA 2UVIA 1LCFA 3PPRA 3TQWA 1FQEA 3WODF 3I6VA 4HW8A 1TQIA 2O61A 3JSPA 3WTTC 2FU4A 4OVJA 4F3SA 3M1EA 3O6IA 3MZBA 4F19A 1X3UA 1CF7A 3HO7A 3E4RA 1CGPA 1LBCA 1N76A 1YAEA 1Y20A 1KQ0A 4YFKF 2K7LA 1YYVA 5HLIA 4IRIA 3TMGA 3IR1A 3KE2A 1D8KA 3S2VA 3H06B 3KGCA 3N94A 4OESA 2XXUA 5BMZA 3EYIA 1S6LA 1B6HA 4ZZAA 2P5LC 2FNCA 4Y13A 4Q48A 4ESXA 2FRHA 4YIIA 2FXAA 5EHSA 4U7BA 4DNCA 3FMSA 4B8XA 2QS4A 4QSEA 2LF8A 2M8EA 1LB8A 2ZCWA 5DEXB 3U93A 4EM0B 2Y7KA 5D6FA 1SD5A 4A0YA 2OWSA 2NOOA 3L00A 1UTHB 2F78A 1DMBA 2LAOA 1WSUA 1FBUA 1D9VA 1LCTA 4NF6B 5TP9B 4NF8A 4M73A 5FD6A 4EM2A 2CYYA 2ABHA 1Y1ZA 5HDGA 4G94A 1Y3QA 2BE5F 2PVUA 4Q4ZF 1F4KA 3K02A 2NS0A 3UA8A 2J5OA 1Z05A 4BDNA 1SYHA 2O69A 1T6SA 1B3EA 3K2ZA 2UWMA 1T0FA 4F29A 4QFLA 5H8NB 4JB7A 3PUWE 2D1VA 4RAZA 5ILVA 1LAGE 1IN7A 2M8CA 1SVXB 1XOCA 4P9FA 1B0LA 1CB6A 3GXAA 1TBXA 2HFHA 4LATA 2HQ0A 3TDJA 1RI7A 1R1NA 4JSDA 1I5ZA 4KR5A 3H6TA 3K1NA 3TTKA 5FTHA 3ZN0A 2ZKZA 3HTSB 4I2OA 4AB5A 3PFIA 1P6RA 1J9IA 1TNSA 3MZHA 3R6SA 2ZMBA 3MAMA 4JXIA 1MG1A 1O3RA 4HLYA 2QS3A 2OCUA 4HX8A 3E5QA 3MUQA 3OO9A 4ESBA 5IKBA 1SMYF 4AD9A 3KP3A 2LNBA 4R79A 1B05A 2OJTA 3EHUA 2F35A 3G3GA 4M6YA 5EYFA 2V93A 2VN2A 4NMYA 1BKAA 4H0WA 1ZBMA 1LDDA 4BLAA 2KKOA 1NKXA 1LAXA 3O2PE 1FTJA 2VD3A 5D8KB 2CFXA 4OIPF 4L17A 2PQ8A 2K4JA 3KOSA 3MW0A 2H6BA 3V8JA 2X0LA 4XIGQ 3V7CA 4P5OA 5DD4A 3W6KB 3SEVA 5I2KB 3TKDA 4MFIA 4PETA 3C31A 2PT1A 4MNUA 4WEDA 2MH2A 1MQHA 1DPEA 4YKIA 2O8XA 3B6TA 3QOPA 2JZYA 5CLSA 3VVDA 5JTYB 3AAFA 1R36A 2I6EA 2BYVE 3HHFA 2Q2AA 1MXWA 1B9MA 1YPNA 2ONKE 2RV8A 3FVGA 1US4A 4LD5A 4GO1A 4WF2A 4IJAA 4Q8RA 2DQVA 3N4MA 2B3BA 4RA1A 4AIKA 1B7UA 4ZZEA 1N04A 4YMAA 1VFDA 1K6OA 1ZIUA 3L9FA 2XIGA 2MLKA 4A2UA 5CVIA 5JK4A 1K78B 4OMYA 1TFDA 3HHHA 3E9XA 1JEVA 3O6BB 2I3VA 3O97A 1B32A 1ZGJA 1YW9A 3C3WA 1DPUA 2EA4A 2GRVA 3QU3A 4DCYA 1MY3A 5AA2B 2RCAA 2JPBA 4ND9A 5E1ZB 2XXWA 2O51A 3FV1A 1MPCA 1BN5A 1MQIA 3RKYA 4F3GA 4KYSA 1WKMA 4DXCA 1I27A 2P1SA 2F97A 2OK2A 2JTVA 1SFXA 2WC2A 5KZTA 1DPRA 2XXPA 2UXNA 4H8IA 1W4MA 1ZKBA 2HOEA 4G8XA 5D4SA 5DYHA 2VODA 4RGXA 4FHTA 3RI4A 3GBAA 3N6TA 1O7LA 2PBIA 1ZU0A 2JSCA 1IN8A 3PMXA 4K3FA 4GXSB 1ZHFA 2V3TA 2XVCA 2HZTA 1O3SA 4E0WA 2FOKA 4A5NA 2HEUA 5H8HA 4F2QA 3P9KA 4F31B 2E1SA 4BQAA 4F39A 2ZYKA 1KU3A 5LHIA 3J80Z 3MPLA 1ELJA 1MJBA 5F6FA 2EB7A 2Q8KA 1FP1D 5BUUA 1IRFA 2M30A 1NL5A 3ZKLA 1O3TA 1O64A 3MZYA 1WQ2A 1D3YA 1IZ1A 5KK1A 4EGYA 3LSXA 4NEDA 2DOJA 2HTSA 1GVJA 1O63A 3IRQA 5KCJB 3OO8A 1FQBA 3B6QA 2FYIA 4LK1F 1SBPA 3WAFA 5E8GA 1IAWA 4KYEA 3K1PA 3KJ7A 2OLBA 2FBKA 5ITPA 2GA1A 1PC3A 4EM1A 3IB1A 5E1WA 1ZGAA 2DYXA 5HDKA 5H8SA 2QWWA 5ITOA 2E1NA 5H8FB 2CSOA 2XAQA 3N97A 2HQRA 3TCFA 4P0IA 3RQTA 1MM7A 4QWQA 2E1CA 2MD5A 2HZKA 4RGRA 4AB6A 4L18B 1ZLJA 2FBHA 3ABTA 5KDTA 1S50A 1P1UA 1SI0A 2NVUB 3MP6A 4NF4B 5FTIA 2QMXA 4UACA 1IUYA 3OSQA 4EQ7A 2VXZA 4KDPA 5D5WB 4BHPA 3SHFA 1B1BA 3C18A 3QXMA 5DCMA 2ZO4A 4HF1A 1FTMA 1B0HA 3HUGA 4F22A 2IA1A 5JEIA 2IRFG 4QRZA 2L01A 2QJEA 1LB9A 1J75A 5FD5A 2M45A 2ADUA 4U22A 1EH6A 3CUQA 3N6UA 2CWEA 4I01A 2H25A 2VC1A 3T9HB 3SZPA 4DLDA 3PD9A 1A04A 3H92A 2FBIA 1W7PA 1B5IA 2ONRA 2V3UA 4ENNA 5ICCA 3FXQA 5BPIA 3VXCA 3H6VA 2O7UA 3PMVA 1MXXA 2ESNA 3VLVA 3HSRA 4Z2YA 4IGRA 4NTLA 5TPAB 4OIRF 2W85A 2G29A 5M2VA 3ELKA 3C9HA 1R23A 3BJ6A 3IOUA 4MH5A 3SFZA 1I6AA 5L3EA 2H94A 1JGSA 5ED4A 1KQ8A 3CVGA 1NFTA 3MP8A 3UK4A 2WKYA 1KWHA 3RTWB 3TFLA 4O3MA 2KIFA 3TTMA 3WE2A 2D1HA 2PBWA 2REGA 3O6HA 1ZRCA 3O2AA 2XHDA 1HSTA 3O9PA 5ILUA 3H3GA 2A3SA 3MEXA 3U92A 3VDFA 3LR1A 1N7XA 4IO6A 3DFGA 5L9OA 4MF3A 3PMWA 5DCMB 3HRMA 4I0AA 1V3FA 2O03A 3V7RA 2IEEA 4F1UA 3ZN1A 2QQBA 1FSHA 2NNYA 4POXA 1BLFA 2G7HA 3WE3A 3ZPLA 2HYGD 3V83A 1WRJA 3LSWA 2OZUA 4HOBA 4GLIA 1FY7A 1E2XA 2F5DA 3TELA 1JEUA 4QLCU 5L3GA 4HQMA 1FZPB 1ZH5A 4LG0B 3UORA 2FNAA 3C1DA 1H76A 3S4UA 3PPNA 4BAYA 3BJOA 3G3ZA 2F34A 1BBYA 1U6GA 3FASA 1SAXA 4I9DA 1SD4A 3W9WA 3KLOA 4G6QA 4FORA 1PDAA 3HSTA 1MJAA 4EJWA 3NQOA 1A8EA 1U8RA 5CMCA 3UGWA 5L3FA 4GIZA 4XKNA 5FFXA 3QYTA 5F1QA 2NYXA 2AIXA 1Q35A 3HOTA 4OMBA 2HXWA 4YZZA 4UXNA 4U2RA 4EUOA 4B09A 2IPQX 4HS7A 4XSXF 4AQ4A 5JI6A 2FA7A 1H3DA 5EHMA 3MCZA 2QS2A 1JW4A 3S2WA 3S9EA 3P7IA 1ON1A 1MQDA 3TCHA 4ZS9A 5ICGA 3G3JA 3IJXB 3KZYA 4I09A 5DUIA 5I56B 4G9YA 4LQ2A 3E5XA 3ULQB 4EXLA 2KLFA 1US5A 4OINF 3ZMVA 5HS7A 2I58A 3DM0A 4BDLA 3ZSFA 2X4HA 2P7CB 2LKPA 3IRRA 1MPDA 4IY6A 5D5UB 3LBSA 1SFUA 3KETA 3EN3A 3SEYA 2P7VB 4QSDA 4AIHA 1FYMA 3KSXA 3R7XA 4YKPA 2A5SA 4CO8A 3TCGA 3IO6A 4NWCA 3CR9A 4S04A 3ZS6A 2R71A 5AIQA 1DTZA 1OYIA 1A99A 4S05A 2F7AA 4HV5A 1ZG1A 3RPUA 4YAHX 3A3CA 1K79A 1NHAA 5JHUA 1FQFA 1J0RA 2XKOA 5IT3A 5ICEA 3EF7A 3JYRA 3T0YA 4ZE9A 1KU2A 3QP5A 1RNLA 2CW0F 2XKPA 2EFWA 1FP2A 1P1QA 4UHTA 5CC2A 3J81Z 3OENA 4ESJA 2KIMA 3F11A 2XV4S 3RLFE 3GLXA 3PPPA 2XAGA 3T5XA 5CMMA 4RPOA 1ZARA 1QUIA 3P9IA 5I56A 3PV0E 3C35A 3KSJA 2IA4A 1UIUA 1KQ9A 2UXXA 3GFLA 4ON0A 5E17F 4F18A 1G3TA 2X7PA 5I2KA 2Y0MA 2JT1A 3OXNA 4PFWA 2XXQA 1Z1DA 4TOZA 3PUVE 3BKIB 1LQ1A 3W9VA 2H6CA 2ZXJA 3LAJA 1DTGA 3FVKA 3E3KA 4RB2C 2P4WA 4C0RA 2XAJA 1AOYA 4G8HA 1FQAA 3T96B 4I98B 5DDGA 1KU7A 1OLAA 4LP2B 4YFXF 1URDA 3GZ6A 4OYVA 3TGNA 1YO5C 1Y0UA 3ML6A 1IRGA 1BC8C 2K27A 4H65A 1R1TA 1P1OA 4UUVA 2RC4A 2JPCA 3HPIA 2OWTA 1SYIA 4TQUQ 4YB7A 2HGCA 4LG0A 3N26A 2H09A 2DWAA 2Y7PA 2RKMA 3HRSA 5CVRA 4RPNA 1XMKA 3RIRA 3O3KA 2HWVA 3M3LA 3R26A 3FIRA 2OZ6A 4UV9A 1FC3A 4ETSA 1YCJA 2I4CA 5CVUA 2EFOA 2QM3A 5I84A 3FGSA 2G7UA 1PDNC 5I57A 4IXAA 2YPRA 2D3IA 3K6WA 1LVAA 2P5KA 4HX7A 3S9LC 3OO7A 1OLCA 1YW7A 1YS6A 3GYHX 5CVVA 4RGUA 3VXBA 4OIOF 4KT5C 2HKOA 3SKPA 3Q5FA 5DVJA 1XMAA 2RNJA 4ZYDA 1SD3A 3MZ1A 1JQFA 4R75A 4KIGA 1N3WA 5FHOA 3I4PA 3FXRA 3IHUA 2IVMA 2F5XA 1OQHA 2RKHA 4NHJA 1ATGA 2PT2A 3F72A 1URGA 4IO4A 4FX0A 5TPAA 4KMFA 3ILTB 1P4WA 3G3IA 4WXDA 1Y3NA 1IXSB 3E6MA 1BOAA 3CUQC 5BS6A 2O6AA 1OIBA 4IO7A 2KJBA 1RKMA 2A6EF 4UVAA 2M1BA 3E6DA 1JVYA 3GVAA 3LC8A 5DEXA 3RY3A 5I2NA 4BXUA 3NRVA 3I0TA 3T9XB 2W7YA 3PUYE 1ZYRF 3FM3A 2DFIA 1RUNA 2YSRA 3CRBA 4FATA 1JXSA 1FT9A 3F8MA 2D45A 3CUQB 1AWCA 2UVHA 1RYXA 2XXVA 1O3QA 3S9NC 3QU6A 5KVRA 2UZKA 4R73A 4JWYA 3FZVA 5TU0A 3GZGA 2IW5A 1XGSA 4L9VA 4ASNA 3IB2A 4HCYA 4X48A 5A5XA 4THIA 2BEOA 1LFIA 1BM9A 1TQPA 2FMLA 3K0LA 3V4GA 1MXYA 4ISUA 1B51A 2W84A 2O1LA 3ZMSA 4LGWA 1KGSA 3LSLA 1ONVA 4OOIA 3T22A 2EFQA 5H8FA 2GXGA 2RDPA 5JFRA 3C34A 3D4CA 4G6DA 2DW4A 3EYYA 2V1DA 4DXUA 3H4ZA 1JHHA 3ZKKA 3M3KA 2DWHA 1Z7UA 1J59A 4Q5TA 2COMA 1MZBA 1S7YA 2ZYNA 2VBZA 3IX1A 4WEPA 5KCJA 3TQLA 2A61A 3TO7A 3BFUA 3I53A 3CSGA 5CM6A 1FW0A 1U78A 4G7OF 2QPQA 1Y1MA 5E18F 5ELVA 2A68F 3I3VA 1P4XA 1IXCA 2KIUA 4IHTA 3IAZA 2QSXA 1C0WA 4H1XA 4POWA 1B58A 1OVBA 2G93A 4UVCA 4JDFA 4U1ZA 1P1WA 5D5XB 5J8FA 2BBYA 2E7XA 5TJJA 4MTEA 1MQGA 5DTBA 2QLZA 4R6KA 4OXVA 4G8NA 1DSNA 3BY6A 3PU5A 3U2RA 4K2EA 3EHTA 2UVJA 1LAFE 3VEPA 4PZJA 4KCCA 3GEZA 1FTKA 4L5JA 1D3KA 3VE1B 4H8JA 1QBJA 4CICA 2F5FA 4IRGA 5CVJA 5LEKA 3QUJA 1POTA 1FQDA 4RAYA 1MXUA 3EQ1A 4OFJA 4ESWA 1WWXA 5FFZA 2PJPA 1KYWA 4MQVA 5F64A 3TO6A 2XRNA 2HQNA 3R4KA 1NNTA 4R72A 2RC8A 4KHZE 2O1MA 4XXUA 5CMBA 1XVYA 2AYSA 1QKAA 1MQJA 3RDIA 1FYLA 3LUYA 1LDKB 1S8NA 1QUKA 2DP8A 3A09A 3MFKA 2Y84A 1V4RA 2PG4A 2D21A 3HYIA 4X1DA 4R6YA 2OZZA 2QMWA 3GFMA 1F5TA 2VT2A 4RXLA 1U3EM 4YFNF 5EEGA 4M1VA 1OYYA 2DSFA 4ZDMA 3ZMUA 1TNTA 1DDNA 1MXZA 1I6BA 4JBAA 2DVZA 3JAMZ 3I5OA 1H0MA 2X7QA 4ZECA 1QPMA 4LJZF 2FNPA 4M9XA 2DPUA 1B3LA 3PQJA 4HDVA 3GFIA 3IOTA 5CI5A 3FV2A 4Q5SF 3SERA 1K7AA 2M87A 2AL4A 1XS5A 4OFLA 4KQPA 4P11A 1PB7A 4O6JA 3ILUB 1JHFA 3PQKA 2F36A 2E7WA 2LDUA 3DPLC 1FYKA 1JNFA 3SEUA 4MEYF 3KFMA 1MH3A 2LF7A 4JSOA 1FTOA 4L5IA 4MQ9F 3LQRA 4RS8A 5AA2A 4MBPA 1XVXA 1BTJA 4U1OA 2X26A 2RF1A 3WTYC 1G6NA 2L02A 1W5TA 4Z0IA 1SW1A 2Q0OA 4LK0F 3BZ6A 3LA3A 5HM4B 5HS9A 4LVQA 3TQNA 2V84A 5CRYA 2A5TA 1EH7A 3FWEA 2ZXTA 1T0KA 5E20A 4WWCA 2B65A 4G68A 2B0LA 4YU0A 5AONA 3UN6A 5TP9A 1H45A 3R0AA 3MQ9A 5A2QZ 3FVNA 5HPQA 4PE5B 3MZ9A 2VT3A 5FO5A 4QSCA 1XHYA 4NF5A 2QVOA 2VONA 3VOEA 4F7ZA 1OR7A 2BV6A 5DT6A 1AOVA 1FSEA 3GF2A 1O7FA 2YLNA 3CFZA 1M5BA 1A55A 1G4DA 2NRAC 2HFBA 4I8CA 2C6YA 3ERED 3KEOA 1LJ9A 2YU3A 2QUFA 3OEMA 3HRTA 4LA9A 2XX8A 2EV5A 1M5CA 1SDXA 3K6XA 1L5TA 2FE3A 1GGGA 1B40A 2HAVA 3GLBA 3T8RA 3WU1B 3SQNA 5K5OA 4G68C 2HS5A 3WGHA 4OENA 2F8DA 3RJPA 1IN6A 2VC0A 2XASA 1CF7B 3CSBA 3EDPA 1OPCA 2E0SA 2O0YA 2GHBA 2RGVA 3G3HA 1JETA 1XSVA 3E5UA 1XGMA 3F3XA 4ELPA 2DBBA 3R0JA 3O6GA 2YJPA 3SETA 3TUSA 2QS1A 2XUBA 1J7KA 4R9FA 1I6XA 4FEBA 3DXJF 1E17A 2CMOA 2L3DA 3B6WA 3L6GA 3IKVA 4NF5B 5FLXK 1B9JA 1B4AA 4GD5A 3K69A 4QFNA 4RGSA 4U0YA 4ELQA 3U1DA 3WGIA 2HYFA 1MDMA 3ODBA 3TZAA 1USYH 3CG3A 1Z6TA 3B7DA 2F7BA 2V25A 5EEHA 2REJA 4A5MA 2ACJA 2PLYA 3S9MC 1SD7A 2K4BA 4H5GA 1XB4A 3CO6C 3QAXA 2OQRA 3WU0A 1LLSA 2Y75A 1WVJA 4OEUA 3RKWA 1LNWA 2OQGA 1XSXA 2ZNZA 2Q9TA 1O7TA 1IXIA 3C32A 3SZTA 3J81K 4G4PA 3ZMDA 3SXYA 3ISPA 5DV5A 5I59A 2DU9A 4OEVA 2CZLA 3KZZA 5ISUA 2QQ9A 3V8XB 4A6DA 2GXBA 3DPTA 1MDQA 1HKTA 4BDMA 2RINA 1BI0A 1B7HA 4ENJA 3DP8A 4PP0A 2GIVA 3J80K 1BJAA 2PEXA 4YB6A 1HKQA 2PMUA 5CJ9A 4A12A 4NF8B 4LB5A 4PGGA 1GVCA 2UYFA 4BDQA 4GL8A 3TYHA 4KN4X 1IXRC 2DO7A 3W15C 3QRFF 2G9WA 2STTA 2BGCA 1WDNA 4F3BA 1XD7A 3M8UA 2ISYA 2GA2A 3I58A 2XAFA 1TW2A 1TQMA 1FPQA 4HTGA 4WK8F 1QVSA 4MHGA 2DT5A 3I54A 3FX3A 4PDKA 4WXJA 4KIBA 3TAJA 5FLXZ 1USSA 2EFNA 2H98A 1QULA 5ILSA 3FHZA 3KP7A 4LLNA 3G73A 1HKSA 3Q9VA 4HDUA 4N13A 4G7HF 4WKMA 1GXQA 3RUMA 4GYGA 3KN3A 4LB6B 1EU8A 3TO9A 3W6JB 1KYZA 3PD8A 1RZ4A 4BHBA 2RCBA 3CFLA 2V1UA 3MWMA 1BI1A 1MD0A 4IF4A 3WTUC 5H8QA 1B59A 1R00A 1P1NA 2QYOA 3MPKA 4NE4A 3T1BA 3WTZA 2F7CA 3HCQA 4P96A 5K2YA 1U2WA 5I2NB 1QNTA 4HX4A 5BWJA 4QFPA 4AIJA 4R2FA 4ENMA 2XX9A 3KZGA 1HW2A 1R9LA 1W7PD 1GV8A 1T38A 4FJPA 4EF1A 4MLVA 4EDPA 3BBRA 1II5A 2W57A 3COAC 4N6PA 4U7DA 3DLNA 2P6SA 1QZZA 1TFAA 5LRSA 2ESHA 3IKTA 3L2CA 2Z5UA 1B3HA 3AXFA 2Q2EA 1IEJA 2I48A 3TOAA 1UQWA 2GQQA 5DYMA 2O6GE 4GL0A 4WXHA 1QGPA 4XLPF 1DUXC 1RIOH 3M8EA 3RGYA 3EUHA 2VHAA 1F9BA 5K5QA 3DP7A 3GX4X 1MY1A 3KBRA 3U72A 3CLOA 4O3AA 4NQWA 3F8FA 3M9AA 4UV8A 1R1VA 2XXTA 1EZ9A 3JZJA 3K00A 1IF1A 4YKJA 5BQTA 2W24A 2ALUA 3FM5A 3OO6A 1LEAA 4ZEFA 5CYVA 1B5HA 4GQOA 2ZNSA 3B02A 5J6XA 5K5RA 2ZBKA 1LSTA 2Z3YA 3HIFA 3BP8A 3H6UA 3FD3A 2I0CA 4G7ZF 2YPNA 3MBPA 1IXHA 4YB5A 4Z7EA 4ZYGA 4F2OA 2GHAA 1XDUA 4WXCA 3PPQA 2PYYA 4LLLA 4BNCA 5TRDA 2EV0A 1SI1A 2ZNYA 4HCWA 3TPAA 5B70A 1UCRA 1FBSA 4GGGA 3T9VA 1UTBA 2Q88A 3MAJA 1VE4A 4WX9A 5HDNA 1NNFA 1MJ9A 4DDDA 2D2WA 2HKXA 5HBCA 4DCXA 2A07F 3LAPA 1Z9CA 2MC3A 3FVOA 1LDJA 2NUVA 3TDZC 2O68A 3KG2A 3NEUA 1TWYA 4F1VA 3EHSA 2P5VA 2MA3A 1A7LA 3JV9A 5LOMA 2B3FA 3JAMK 2DE4A 1S29A 1ZLQA 2RC7A 3G3FA 3DP6A 2RN7A 4M74A 3FXUA 4IY5A 5CBRA 1N0TA 4Y15A 1HBXG 4IVNA 4RB3C 3OEKA 3RN8A 3LA7A 1U5TA 1I1GA 4TLMB 3WTWC 2H27A 2JRTA 2DXYA 5AA3A 4HW0A 4IO2A 3IO4A 2R7FA 1I6QA 3R6UA 4EVIA 1ZLKA 4ELOA 2NAZA 3IOVA 4P55A 2FQ3A 2IT0A 2M5WA 3DKWA 4LZ7A 2R6GE 2XXRA 3HN0A 1XC1A 4BHCA 1R5HA 1R7JA 3E6CC 4XSZF 2O7IA 3TODA 3K6VA 4LQ5A 2VOOA 1M5EA 3KEIA 1B1HA 3VFJA 4M72A 1SD6A 5L3BA 1R22A 3IL2A 3DQVC 4U0WA 3KP6A 2DWIA 4KYDA 1Y3PA 3VV5A 3T93B 2QBYA 3ONMA 4F3PA 4YICA 4G77A 1S7OA 4FIMA 2L4MA 3IK6B 3H03A 2CO5A 4L0ZB 3WTVC 3CJNA 1HSJA 3VFZA 2MBFA 3E13X 1Q1KA 2W25A 1CE2A 3MVWA 3OV8A 1TT1A 2DLLA 3DV8A 1JW1A 4XBFA 3BFTA 3SESA 1ANFA 3V8LA 3JW4A 1R58A 4A6EA 4EV0A 5HOOA 1GR2A 1QZYA 1SMTA 4L9JA 5L3DA 3JTGA 3IC7A 3O29A 4CDGA 3IWZA 1D4NA 2P2AA 4Q0CA 1J1NA 1Z91A 4LMYA 1FLIA 1MRPA 2Z23A 4M71A 4PFYA 3I5UA 4AVPA 2V3QA 2Q2CA 1L0OC 3IJOB 1HQCA 4DIGA 1KU9A 3GWZA 4M6XA 4RB0A 4XKPA 3FJ7A 1AH5A 2UXAA 4G8MA 2RVCA 5HLGA 1D9YA 3KP5A 5HLHA 2BJJX 1ZRDA 3ZQ7A 3V8KA 1TLHB 5J8CA 1OMIA 4ZYHA 2LSOA 3FMQA 4M4GA 3I59A 2XXHA 3ABUA 4TV7A 3LFKA 4I7HA 4NB5A 3HTUA 2RQPA 2TDXA 5DVFA 3I59B 4HYEA 2F6PA 4EF2A 2YR2A 4X9TA 4AWXB 2DK5A 2VBYA 4ELRA 1Y4CA 2OU2A 1EZPA 2AL5A 2Q89A 1R5GA 4EJUA 4CZZA 4XKQA 5D5VB 1HSLA 2HR3A 4BDRA 3KOTA 4IO3A 1PP7U 1OVTA 3RT6B 2ONSA 5BPDA 3K2DA 2F5CA 4UVBA 1EV7A 1SQYA 3L7WA 4TLLB 2O84X 2O3FA 2DXRA 3BPXA 2K86A 3HRUA 2VOZA 3C4MA 1HW1A 3I64A 3T9UA 2IA2A 1XCBA 1N7WA 5CBSA 2ETHA 1EH3A 3RTFB 2P8TA 3UP9A 1LFGA 3LSTA 1H9GA 2WV0A 3R60A 1GTKA 4H67A 4KIFA 3KP4A 5AA4B 4D0PA 4OIQF 4EQ9A 1MM6A 3IB0A 3KP2A 4RNSA 3O28A 3Q25A 4PGHA 3HV1A 2AXLA 4OTEA 2PMHA 3MQ0A 2OBPA 2XGXA 1YFHA 2EA2A 1A8FA 2Z22A 4E70A 4PCQA 3D5LA 4CGZA 2PMSA 4GXOA 3IWFA 4O3BA 4ZYEA 1ZN2A 2KJCA 1YQAA 5LGUA 4IO5A 4E0XA 1D8JA 5I58A 1YLFA 2VD2A 1FX7A 3PUZE 3M7GA 4HLXA 4BDOA 1FQCA 1Z7ME 2I0BA 2ZMEA 3J7AO 3ECRA 1ODDA 1G3SA 2QQAA 1XGOA 2ELHA 1W7PB 4JK1X 3MVXA 1ON2A 2XAHA 3VLUA 5CMKA 1POY1 4N9IA 5A5XB 3LSFB 1M5DA 1PBPA 1JVXA 4WCGA 2K02A 2CQKA 4FECA 2MH9A 3RPQA 2H4IA 2V79A 4OMZA 5HS8A 4H5FA 1P2FA 1PBQA 3M8FA 5ICFA 2ZNUA 4GXAA 1ZMGA 1LEBA 1H43A 3QSLA 5DCFA 1LAHE 2OBGA 1HXDA 3VLWA 2Q8JA 4N9HA 3CI8A 2YX7A 4KUMA 5ICTA 4HQEA 1FTLA 1QO0D 1JW5A 2QZ8A 5KDTB 2F2EA 2I49A 1TTYA 5D8LB 3CG1A 2GAUA 1R9QA 1USTA 1STZA 1MXVA 1EH8A 4U23A 1I1SA 1N84A 1B4HA 3JSOA 3K4UA 3E6BA 3WTSC 2THIA 4PFTA 4KD5A 1LBBA 3WTXC 3GW2A 1YTYA 3RT8A 1AMFA 2ZJ2A 4KA4A 3MJNA 4OWDA 4U4XA 2I4BA 4OQOA 3CO7C 2XD2A 2VBXA 3MWBA 4RYAA 4IHSA 1UB9A 3TTLA 4ECFA 2IJLA 4ENKA 4KYWA 3USDA 4MEXF 1IITA 3CDHA 2XROA 4RB1A 3TKYA 2H99A 2OD5A 1DP7P 1S9TA 3FF5A 1XN7A 3VB2A 2R3SA 1QKBA 3F8NA 3OELA 1BIYA 3C7JA 3KN8A 4QHQA 5I57B 5LBQA 5L9MA 1R1UA 2H9BA 5L9SA 1P92A 5JVTA 5LGNA 4H6DA 3LQQA
chains in the Genus database with same CATH superfamily
4U88A 1O64A 1MPBA 2MGQA 3A1YA 5LHHA 4MNIA 3Q26A 5HODA 4DQ2A 3KN7A 3HOXJ 3OOAA 1W5SA 3FJMA 4ZZDA 5KNLA 4B4CA 1A40A 4GFRA 2I3WA 3QOEA 2VJJA 5DS9A 4QFKA 3RKXA 3CCEI 3BWGA 3QP6A 4IZZA 4XRFA 3FUZA 2Y7RA 1OCPA 3MN2A 2IA0A 3FBNB 2JRMA 1MKMA 2QEXI 1P4AA 1IN4A 2ZMEB 1MH4A 3ESWB 4I02A 4UA8A 1Y8QB 5LLQA 4RBOA 5LRRA 2HPMA 4KCDA 4ESFA 2VKHA 4R2BA 5I58B 2UYEA 4RAFA 1ZAOA 2DTRA 3D0SA 4EQQA 3F23A 1IW7F 5H6QA 1LBYA 3QUFA 1Y8RB 1REPC 3F21A 1MY4A 1TXFA 1SFOJ 1PB9A 1SW4A 3AG2H 5B5EC 1LEVA 3LWFA 3BIHA 3GTJJ 1ETXA 4N07A 1MDP1 4LZ5A 1XGNA 2NS8A 3QMFA 4DOZA 3B73A 4EJOA 4FE8A 4OFOA 4HBLA 1ZRFA 3CDLA 4KPTA 4EGZA 4R74A 2VIXA 1FPGA 1MY2A 2R7TA 2H8RA 3MVZA 2IS6A 4N8GA 3AL0B 3VVEA 3NWTA 4FT8A 3B50A 1USYE 5FRMA 1SW5A 1H44A 3TTRA 2RAEA 2CGPA 2EFPA 2JJ7A 5LFAA 5J1RA 2CG4A 1WH5A 5FROA 1FOYA 2DAOA 5AIPA 2BJIA 4EQBA 2LY2A 1B46A 4KFQA 1BC7C 5J1DA 4GOTA 2NNNA 2KRFA 3VODA 2ID3A 4IO2A 1X3WB 1K78A 3LSHA 1HW5A 4ZE8A 4HF2A 3ROJA 3DKXA 1F36A 3GUDA 5JLWA 3VWBA 5AE4A 3SDFA 4IRHA 2M0MA 3F8BA 5EJCA 3ZMZA 3N5LA 1ZG5A 4GVOA 1O57A 4OVSA 1UHMA 5L8DA 1BI2A 2XAUA 1ZG3A 2Y0SN 4NF4A 2R8TA 4XKRA 4PTKA 2Y5LA 1NH7A 4KI0E 2FIXA 3BDDA 4PFUA 4N17A 3GCMA 3DEUA 3IV5A 1FOKA 2XX7A 4IGTA 1QUJA 4FEDA 3ZP5A 2NOJB 2W4SA 1W36C 3OOPA 3CESA 3F6OA 3H6WA 3GBBA 1QQIA 1MSFC 3TDUC 3V89B 4IHWA 1OYWA 3QPLA 3CIJA 4GF8A 4LLGF 2OAZA 4PJNA 3RYRA 2DI3A 1GLNA 2FEZA 2XB5A 3WGGA 2LVSA 2ISZA 1IQ7A 1A36A 1B5JA 6PAXA 4UB6C 4XTCQ 2PFBA 2HCAA 1RUOA 1K6YA 4KICA 1BIAA 3EPEA 3RQ4A 4A3JJ 1G59A 1EYJA 1B7ZA 4ZH4F 4DE8A 1XI6A 2VOPA 1MY0A 5HLTA 3CTAA 3CCSI 5DVIA 2XDVA 2QCOA 2OA4A 4NDLA 4XN0A 1T2KA 1AWBA 4UUSB 4EJVA 2NXOA 3Q28A 4O3CA 4HF0A 4PDHA 4M3FA 3SEWA 1I69A 1J5YA 1VSOA 2ZYOA 5AA4A 4KMUX 2GFEA 2F6CA 5F1RA 2GIZA 1ZGWA 1T33A 2Y2ZA 5FGMA 1YTVA 1URSA 4P8BA 3L2RA 2DK8A 4R8HA 3TEDA 2HNHA 3F6VA 3KCCA 1ZR4A 4OERA 1DK4A 2R7DA 2Z8FA 1LFHA 3D4GA 2EPFA 2CW8A 1FPLA 4EXKA 3GBGA 4QXDA 4H6DA 1NK2P 3RKQA 4C9YA 2L2OA 3P9CA 2Y7WA 1JUSA 4FAJA 5D6EA 2P81A 3H3ZA 2EV6A 4OWRB 5FHMA 2H5YA 4ZZLA 2VE9A 4N0BA 1HSEA 1SW2A 1VF9A 4MLQA 5IT9Z 3A3UA 4L0YB 3S17J 3C33A 3OD7A 4MTDA 5GTIC 1A5JA 2ICWG 4Q30B 4BQQA 1B9NA 1FMVA 1DOTA 4ITVA 2DQLA 3V7SA 1MDMB 4NX1A 3U65A 3V5AA 3WHCA 1HDDC 1QW0A 4OVTA 4G2ZA 2FMYA 4GYIA 2JA6J 4RJZA 1ETYA 3KPHA 3S1MJ 4RAGA 2UUZA 4C1TA 4FX4A 1FSAA 5JTYA 4YIFA 3OIOA 3Q29A 4NF0A 2WBBA 1XT8A 3ECOA 4Y17A 3CJRB 3QK6A 3U8QA 4B3XA 1WI9A 3EUKL 2TRTA 5GPCA 1JKQC 4R9GA 1S7AA 3VYSB 4MGRA 1FMWA 4AYBA 1UIVA 4XM3A 3P5JA 5BOXA 4I1DA 4LZ8A 1MGTA 1P7JA 2XXIA 2AS5F 2L54A 1UG0A 2Z33A 4GFBA 2XXXA 1LFBA 3EQLF 1H8AC 1EJ9A 3KLNA 3FATA 4DBRA 3K6UA 4LUBA 4PC9A 4OANA 5DD8A 2DPDA 3WAEA 1BIBA 1K9YA 2ZC2A 2HAUA 3BQZA 2X6WA 4P3LA 2F5EA 1PP8F 4NN3A 1QZEA 5EQ8A 2CQNA 2EK5A 2FA5A 2Y7IA 3CFXA 5GAEJ 3OSRA 3FBPA 2Z8DA 3PTYA 4KFCA 3T0JA 4F1YA 3L6HA 2AO9A 2VBWA 3OYCA 2R4GA 3C36A 4JWOA 3Q27A 1ZKGA 3I71A 1JE8A 5H8NA 4D7MA 4EJTA 4P9UA 3KYLA 2BY1A 2DDKA 4HAMA 3KEQA 3T8TA 1M5FA 5D4RA 5ICQA 3REOA 1GXPA 5LHGA 4M9SA 1R6RA 5LGTA 4M3EA 2K9LA 3RYDA 3ZMTA 5IP7J 4OHNA 1ETWA 4I0BA 5H6RA 1B2HA 3O66A 3IORA 4N15A 4IPAA 4RK9A 5J40A 3IL1B 3PL8A 1XDSA 2IGNA 4M9ZA 1GHCA 3CJTB 2BHZA 4R1HA 3S16J 3OS0A 3ZCOA 4OA4A 4RK2A 3HSEA 4QPOA 1FBQA 3FXMA 3OR1C 4LFUA 4QTRA 4U21A 5JR3A 2R5YA 2MKZA 4HZFA 4EMSA 2PJRA 1U5TC 4O5VA 1YG2A 1UTHA 2L4AA 4Q47A 4F92B 2ECBA 2HXOA 2DQRA 1KONA 3TOBA 1B6AA 3G3KA 1IIWA 1SFEA 3S1NJ 4PE3A 3RYPA 4IB2A 4X8RA 5ERIA 4KN7X 2PI0A 2LR8A 4XLNF 2M9HA 1OMPA 1Q1HA 4A0XA 1MBHA 1G0IA 3THIA 3GTLJ 4MCOA 2VP1A 2IP2A 5FB2A 4IHYA 1A54A 4RA2A 2HPIA 3G1LA 2QL3A 1U5TB 3GXOA 2L7KA 3QAHA 1ULYA 1Y39A 3M3FA 4G68B 3LA2A 2WTEA 5AA1A 1P99A 1B3GA 1PB8A 2A5TB 1I39A 4DXBA 1OKRA 4LOCA 1Y4TA 2PN6A 4BXFA 3RTRA 1S3JA 1XX5A 1WVRA 3BOQA 3HOSA 3ROUA 3S1RJ 2V1XA 3Q9SA 4OU0A 4CYCB 2QBYB 2E1MB 1FBHA 1Z7NE 2QVRA 3TTNA 2JVHA 3T66A 3R61A 2ME6A 1G8XA 4QFOA 3K1MA 5EGOA 2M8GX 3FV1A 5K1YA 4OZ9A 1B3FA 4P0GA 3FKIJ 2HTJA 1LGBC 2CZHA 3K4BA 3S9LC 2DE3A 2WAQA 2IGKA 2CUEA 4YMBA 3F22A 4MAGA 4QIWN 3BJAA 2DJNA 3S32A 5E1XA 5E3OA 1X1BA 2D5VA 1J09A 2HDCA 2JA5J 2W1OA 3G6EI 1OQGA 4N81A 5IOZA 2BHYA 2YX4A 3DTEA 1NNKA 3EETA 3PUXE 4GWUA 2NWJA 4FTHA 1ZJLA 4X1BA 4RY1A 2VGQA 2KQRA 3A02A 5HVQC 1TL8A 1G3WA 3QYFA 1TW3A 1UZCA 4LITA 4CXFA 4NF6A 4XRSG 2V6CA 4A0ZA 4HPQA 2HEOA 2Z9OA 1D5VA 2PX1A 1Y9UA 4PF6A 2EWNA 3HG9A 3RPWA 4DZ1A 1UFMA 3LMMA 1FBEA 1F9NA 2E60A 1R6ZA 2F6GA 2P0SA 5B7DA 4II2A 2E34A 5CPRB 1MNEA 3VVFA 1UHWA 2K9SA 5EF6A 1AIVA 1S9HA 2JUGA 4ZEBA 3DF8A 1PUEE 2Y48A 5EEAA 3CP8A 1NNPA 4JWXA 4M6VA 4LONB 4Z6YA 1FPEA 3QPTA 1QJMA 2A5YB 2F5VA 5DUKA 2LRDA 3MD2A 1NMUA 2Z99A 5H8QB 1Z6RA 3JTHA 2WWYA 2OTJI 1N3XA 4DW6A 3OYAA 3H3UA 2FF4A 4BL0B 1EYIA 3OMBA 3ECHA 4HV6A 2DWJA 3NAUA 3HDDA 2QENA 2XHKA 4Y7NJ 2Z8EA 1VFCA 2XD3A 4NWDA 1W1WE 2PMZA 3K9TA 5E8IA 3IFAA 3S15J 1FCKA 3MP1A 1FWZA 1LBVA 3U9GA 2XXYA 3BR3A 2M2EA 1XPXA 3S93A 2HDDA 1YIOA 4GRKA 2ANJA 4QF9A 3LSRA 2KDOA 1G3YA 3F8CA 3A0HC 2ZYMA 2A6HF 2GWRA 4ZEDA 4U4SA 1F1ZA 5DEQA 1A6IA 1VTNC 2DVCA 1JTXA 4L9TA 3BIGA 5H20A 4H4KC 2J5PA 2Z2SB 1BP5A 5LEJA 1NTCA 3ZRGA 2V9VA 4BYYA 4CHUA 4I62A 4ZEIA 4H0EA 1RYOA 1LE8A 1JP4A 5EQ7A 4JBZA 2X1DA 4ONYA 4PQJA 5A2QK 3L09A 3ZQLA 5IAIA 3CLQA 1YS7A 3NOHA 4R6HA 1SPIA 2Q1ZB 2DS9A 2Q2EB 1MS7A 3FMRA 1X58A 1ZREA 2MLGA 1UTBB 2D5WA 3MC2A 1T98A 1IRXA 5IT9K 3GTKJ 1T39A 3KJTA 4GWOA 3SEXA 2E36A 4YKKA 1PEBA 3CUOA 4GCVA 3DP4A 3K01A 4L9NA 2QFLA 1YW8A 1MMAA 2IEKA 1IXGA 5IZ3B 1EZOA 3GO5A 4JQFA 2X51A 3FXJA 4DYRA 2ZNTA 3BROA 1VQ5I 1IN5A 3OYGA 4KNYA 4OETA 5K2XA 2DE2A 4BH9A 1L3LA 1IUDA 3HOZJ 3UIFA 2R9JA 4RM2A 4DYQA 1KA8A 3E3VA 2GZWA 2X48A 5GAHJ 2RC9A 4MX6A 5HNHA 1B52A 4Y3OA 4NNJA 1VFEA 5I59B 5L3CA 3PGFA 2XWKA 2GH9A 5J4YA 1NH8A 4A3BJ 5F7VA 3QPHA 5AA2D 1XSDA 3U94A 1RKTA 4C3JJ 3MVYA 3HHGA 4C1UA 1G2HA 3K0VA 2NVYJ 2ME0A 2STWA 4YG2F 4HA8A 3U1OA 3WG9A 4D5FA 1TP4A 2EJRA 2FSWA 3BPVA 3FJGA 1VR5A 3QIMA 3H7MA 2VQCA 3KFWX 3E97A 2JWTA 3HSFA 1B4ZA 4NEDA 3PPOA 5H8HB 1H9TA 1J2XA 4U0VA 1AL3A 4CYDA 1WODA 3DELB 3LSPA 3GZ5A 3ZR8X 2HZLA 2ZJRF 3TEPA 4F93B 4ZEKA 5FHNA 4UNOA 2UVGA 2HVQA 3DWLE 1FNNA 2ZFWA 1BI3A 2A69F 1WJCA 3GFJA 1VNDA 2XF5A 2VE8A 1LB2A 3G7WA 3RQIA 4C3HJ 1B1XA 1ZTYA 3P7NA 2P6TA 3IOWA 2UVIA 1LCFA 2V9KA 3PPRA 3TQWA 1FQEA 2CQXA 2NVQJ 1VQ6I 3WODF 3I6VA 3IAS2 2AXTC 4HW8A 3A0BC 5HNFA 1TQIA 2O61A 3SEZA 2M4KA 3JSPA 3WTTC 2FU4A 3OYMA 2KR0A 4OVJA 4F3SA 3M1EA 1FTZA 3O6IA 3MZBA 1YHQI 3CMAI 1X3UA 1CF7A 4F19A 3HO7A 1ORKA 3E4RA 1CGPA 1LBCA 1N76A 2DA7A 4QPQA 1YAEA 2VQLA 4F55A 1Y20A 1KQ0A 5DTDA 4YFKF 3LQQA 2K7LA 1YYVA 3G1OA 1NK3P 5HLIA 4IRIA 3LSXA 2I5UA 2FVZA 3PIPF 3IR1A 3TMGA 3KE2A 1D8KA 3S2VA 4HSTA 3PNVA 3H06B 2PFYA 3KGCA 3MZ8A 3N94A 4OESA 2XXUA 2DODA 5BMZA 3EYIA 3RZOJ 1E3PA 1S6LA 1B6HA 2VKDA 4ZZAA 2P5LC 3EUAA 2FNCA 4Y13A 1D5YA 1B8IB 3W6VA 4Q48A 4ESXA 4MIMA 2HU9A 3KC0A 2FRHA 4YIIA 2FXAA 3SDGA 5EHSA 2Q8MA 5GTHC 1LBXA 2G0EA 4U7BA 3B6AA 1DQUA 3BC8A 3FMSA 4B8XA 4DNCA 2LF8A 2M8EA 2VJIA 1Q1VA 2O9LA 1LB8A 2ZCWA 3LV0A 4QSEA 5DEXB 3U93A 1K4TA 4EM0B 2Y7KA 1NV5A 3BQYA 5D6FA 5JLXA 4O94A 1SD5A 4A0YA 2OWSA 1I3QJ 4PAKA 4S0HB 2NOOA 3L00A 1UTHB 2F78A 3VSKA 1DMBA 2B63J 1DPPA 2LAOA 1FBUA 1WSUA 1D9VA 1LCTA 4NF6B 5TP9B 1A31A 2R5YB 4NF8A 4M73A 2O5RA 5FD6A 2QKMB 2CYYA 2MC4A 4EM2A 2QRYA 4A3IJ 2ABHA 4XMYA 1Y1ZA 1B72A 1PYVA 5HDGA 4G94A 3WG7H 3ZQFA 2VPRA 1Y3QA 2BE5F 2PVUA 4Q4ZF 1F4KA 4YIRX 3ABKH 2NS0A 3K02A 3UA8A 2J5OA 4XEQA 1Z05A 1LE8B 4BDNA 1SYHA 2O69A 1T6SA 1B3EA 3K2ZA 3G2BA 2UWMA 1T0FA 3K4JA 4F29A 4F91B 4QFLA 4II3A 5H8NB 4JB7A 1MNMC 3PUWE 1S7EA 3GLLA 2OUMA 2D1VA 2HHMA 4RAZA 5ILVA 1LAGE 1IN7A 2M8CA 1SVXB 1XOCA 4P9FA 4AM3A 5F08A 1B0LA 4FETA 1CB6A 3GXAA 1TBXA 1YX3A 2HFHA 2HQ0A 2LBFA 4LATA 3TDJA 1RI7A 2WA0A 2KMUA 1I5ZA 1JUPA 3DCFA 4CCJA 1R1NA 4JSDA 3FXLA 4PFOA 3GTMJ 4KR5A 3H6TA 1D0YA 3K1NA 3TTKA 1MMDA 5FTHA 3V42A 3ZN0A 2DT6A 2ZKZA 3HTSB 4I2OA 4AB5A 1IO2A 3PFIA 2CW7A 1P6RA 4A3EJ 1J9IA 3K4NA 1TNSA 3MZHA 3R6SA 2ZMBA 3MSTA 3MAMA 4JXIA 1QVUA 1MG1A 2XXKA 2JMWA 3DPUA 4NGUA 1O3RA 2LG4A 4HLYA 4E7ZA 2OCUA 2QS3A 4HX8A 3E5QA 3MUQA 3OO9A 4ESBA 5JHFA 5IKBA 1SMYF 3IFCA 2E19A 2UV1A 3DBRB 2NVXJ 1DU0A 4AD9A 3KP3A 2LNBA 4R79A 1VQ9I 1B05A 2OJTA 3ZOBA 3BTLA 3EHUA 2F35A 3G3GA 4M6YA 5KAIC 2V93A 4N91A 5EYFA 1R9TJ 2VN2A 4NMYA 1IMAA 3Q0UA 1BKAA 2ZJPF 1ZBMA 1LDDA 5K7HA 2KKOA 4H0WA 2GXAA 4BLAA 1NKXA 1LAXA 2F3BA 5GAGJ 3O2PE 1MBEA 2NOGA 1EF4A 1FTJA 2VD3A 5D8KB 2CFXA 2GBYA 5LDZA 4OIPF 4L17A 2PQ8A 2K4JA 4OVQA 3KOSA 3QQAA 4FBPA 3MW0A 2VI6A 2H6BA 3V8JA 4GWZA 2X0LA 3HEFA 2R7SA 4XIGQ 3V7CA 2KZGA 2WYKA 4RMNA 4P5OA 5DD4A 3W6KB 1IMBA 5I2KB 3SEVA 3TKDA 3LSKA 4MFIA 4M3BA 4PETA 3C31A 2PT1A 4MNUA 2TCTA 4O7MA 1HC8A 4WEDA 2MH2A 5GADJ 5C44J 1EKEA 1MQHA 3F0CA 4ZDOA 1DPEA 4YKIA 2O8XA 3B6TA 2K9QA 2HDWA 3QOPA 2JZYA 5CLSA 3VVDA 1IMCA 5JTYB 3AAFA 1R36A 2ZJQF 4U87A 2BYVE 2I6EA 4J00A 2Q2AA 1MXWA 3HHFA 1B9MA 1YPNA 1JGGA 2RV8A 2ONKE 3OSGA 3FVGA 1US4A 1T95A 2IGOA 4LD5A 4GO1A 4WF2A 1N75A 4IJAA 2R7QA 4LG3A 4Q8RA 2DQVA 3N4MA 2B3BA 2IBDA 2EBIA 4AIKA 4RA1A 5ET7A 1B7UA 4ZZEA 1N04A 1KZ8A 2NXNB 2X1CA 4YMAA 1VFDA 1LBZA 1K6OA 1ZIUA 3L9FA 2XIGA 4A2UA 1WFXA 5CVIA 3UR3C 3BZCA 5JK4A 4HEA2 1K78B 4OMYA 3HHHA 4X0GA 1DCUA 1TFDA 1JEVA 2WX9A 3E9XA 1WH7A 3O6BB 2I3VA 1YYZA 2F4MB 2X6OA 4PBHA 3O97A 4MO7A 1B32A 1ZGJA 1YW9A 1CQTA 3C3WA 3OYIA 1DPUA 1GUUA 2EA4A 1WJ5A 2GRVA 2WYPA 4RLFA 3QU3A 4MLOA 4J19A 1MY3A 4DCYA 3LFUA 3TP3A 2RNGA 5IZZA 5AA2B 1QHHD 2RCAA 3DLAA 1NI9A 2JPBA 2MW8A 5E3MA 4ND9A 2A5WA 5E1ZB 3GTPJ 1U9OA 4XONA 3A2KA 1MPCA 2O51A 2VPNA 2XXWA 1BN5A 2XGEA 1MQIA 3HC7A 3RKYA 4F3GA 4KYSA 1WKMA 1P7IA 3N05A 4DXCA 1I27A 3MKLA 2P1SA 2F97A 2OK2A 2JTVA 1SFXA 2WC2A 5KZTA 1DPRA 2JA2A 1JI8A 2XXPA 2UXNA 5M3MJ 3FK7A 3O8HA 4H8IA 3VDXA 3GMEA 1W4MA 2R5ZB 2HOEA 4G8XA 1ZKBA 5FKMA 3RPLB 3E1SA 5D4SA 3X2QH 5F0HA 2VODA 2DDBA 1T0FC 4GRIA 4RGXA 4RLQA 4H45A 5DYHA 2B9SA 2OPTA 4FHTA 2P0WA 3RI4A 3GBAA 1O7LA 2PBIA 1ZU0A 3N6TA 2JSCA 1IN8A 3PMXA 3LOCA 2XGDA 4GXSB 4K3FA 2AQFA 1ZHFA 3D5SC 2V3TA 2XVCA 2HZTA 1O3SA 4E0WA 2FOKA 4HE2A 1JTYA 2L7ZA 4A5NA 2HEUA 5H8HA 4F2QA 3P9KA 3PFYA 2EZIA 4DI4B 4F31B 1NV6A 4PSXA 2E1SA 1TWGJ 2ZMEC 4XLEA 4BQAA 4XOTA 2ZYKA 4F39A 2LP0A 1KU3A 2QKLB 5LHIA 4AS5A 1NG7A 3I4NJ 3J80Z 3MPLA 1ELJA 1MJBA 5F6FA 2EB7A 4XKCA 1FP1D 3LSIA 2Q8KA 1IRFA 2M30A 3HOVJ 1NL5A 2CS3A 4M3GA 3MZYA 1WQ2A 1D3YA 1IZ1A 5KK1A 3OS1A 4EGYA 1O3TA 5KAFC 3CC7I 1IMEA 1YZ0A 1X19A 2HTSA 3ABLH 2DOJA 1BR4A 1GVJA 1X1DA 4JVDA 1O63A 4RM3A 3IRQA 5KCJB 3OO8A 1FBPA 1FQBA 3B6QA 4I6ZA 2FYIA 4LK1F 3I3LA 1SBPA 3WAFA 5E8GA 1IAWA 4KYEA 3K1PA 3KJ7A 2EIMH 2OLBA 5IZ3A 2FBKA 3VYUB 5ITPA 2GA1A 1YITI 4EM1A 1PC3A 5E1WA 3IB1A 3FISA 4N4NB 1ZGAA 2DYXA 5HDKA 5H8SA 2K3FA 1X3ZB 2QWWA 4KITB 4X04A 4MIJA 1ENHA 5ITOA 2E1NA 3F9KA 5DM6F 5H8FB 2CSOA 2XAQA 3N97A 2HQRA 3TCFA 4P0IA 3RQTA 4RDUA 1MM7A 4QWQA 2E1CA 4HNTA 1QPIA 4PFRA 2MD5A 2HI3A 1GV2A 2HZKA 4RGRA 3HBLA 4AB6A 1D1AA 1ZLJA 2FBHA 4L18B 3ABTA 3K6GA 5IOYA 5FRNA 1HDPA 1P1UA 1S50A 2DXIA 2NVUB 1SI0A 5KDTA 3MP6A 4NF4B 4XKVA 5FTIA 3ZQQA 2QMXA 4UACA 1IUYA 3OSQA 4EQ7A 3DLLF 3ASOH 1VQMI 2DA1A 2VXZA 4KDPA 3CCJI 5D5WB 4BHPA 3E78A 3SHFA 5F24A 1QGXA 1BL0A 3C18A 1B1BA 2EIJH 5DCMA 4D9JA 1LKXA 4HRIA 2ZB9A 2ZO4A 3PSIA 1PUFA 3QXMA 2QF7A 4V19K 4HF1A 2HXIA 1FTMA 1B0HA 4IX7A 3HUGA 4F22A 2IA1A 5JEIA 2IRFG 2F3DA 4QRZA 4YRVA 2L01A 2QJEA 2XF6A 2QS4A 1LB9A 3PSFA 3CCRI 1J75A 4O7IA 5FD5A 2M45A 2ADUA 4U22A 5ET8A 1EH6A 5I59A 3CUQA 1FBDA 3N6UA 3QYEA 2CWEA 1OCTC 4I01A 2H25A 2VC1A 4G12A 3T9HB 3SZPA 4DLDA 1YRNA 3PD9A 1A04A 4MEVA 2VASA 3H92A 2CV2A 2FBIA 4B43A 4HNUA 1RDZA 1O4XA 1W7PA 1B5IA 2ONRA 2V3UA 1ZK8A 4ENNA 5ICCA 3FXQA 3AG1H 2LK2A 4CZCA 5BPIA 4W97A 3VXCA 3H6VA 4V2FA 2O7UA 2OWZA 2CUJA 1MXXA 3PMVA 4Z7EA 2ESNA 3M3YJ 4CCLA 3VLVA 2E2JJ 3HSRA 1Z0XA 4Z2YA 4O8MA 3JRFA 4C2UA 2JJKA 1NG6A 4IGRA 4NTLA 5GP9A 5TPAB 4OIRF 2W85A 1QHGA 2G29A 5ET5A 3ELKA 2DN0A 2W48A 1MBKA 1R23A 3BJ6A 3C9HA 3IOUA 3SFZA 1I6AA 4MH5A 5L3EA 2H94A 1JGSA 5ED4A 1KQ8A 3CVGA 3GTQJ 1NFTA 3MP8A 3UK4A 2WKYA 1KWHA 1IV8A 2VQHA 1NUXA 1Y0NA 4HE1A 3RTWB 3TFLA 2ZFUA 1D1BA 4O3MA 1RDYA 2KIFA 5EGOB 1FPJA 3WE2A 2KDZA 2D1HA 3TTMA 2PBWA 2REGA 3O6HA 4A3FJ 1ZRCA 3O2AA 2XHDA 1HSTA 2HVSA 2L0KA 4CYCA 3MKYB 4A3CJ 3O9PA 1UELB 5ILUA 2A3SA 4IOCF 3H3GA 2LLKA 3MEXA 2IS4A 3JRHA 3U92A 3VDFA 3LR1A 3S3OA 1N7XA 4IO6A 3DFGA 4D5CA 5L9OA 4MF3A 3PMWA 5DCMB 2COBA 3A01A 3HRMA 4I0AA 1V3FA 2I8DA 2O03A 4NC8A 3KYCB 3V7RA 1KZHA 4C2MJ 5J4VA 2IEEA 2H1LA 3B6CA 3ZN1A 3PIOF 1LFPA 4F1UA 2JVGA 2QQBA 2RQQA 1FSHA 2NNYA 4POXA 3IH3A 2CJJA 3OYFA 2G7HA 1BLFA 1FOWA 3G71I 3WE3A 3ZPLA 3H3VK 2HYGD 4ZDLA 3V83A 1MMNA 2IAIA 4LIVA 2WEFA 1WRJA 3LSWA 2OZUA 4HOBA 4GLIA 1FY7A 1FTAA 1E2XA 2F5DA 2CQQA 3TELA 2DMPA 1JEUA 4QLCU 5L3GA 4HQMA 3L2WA 1FZPB 1ZH5A 3BT9A 3CF5F 4LG0B 1D1CA 2VUMJ 3UORA 2FNAA 3C1DA 1H76A 3S4UA 3PPNA 4ZECA 4BAYA 3BJOA 2KHMA 4UB8C 2BW3A 3G3ZA 2KLOA 2F34A 1FIPA 2FX0A 4N4OB 4B48A 1BBYA 4D1QA 3HOWJ 1U6GA 3FASA 1W5CC 1Z67A 1SAXA 1H89C 2Y31A 2ELJA 3L2QA 4PFIA 2L9NA 1SD4A 4I9DA 4EEFG 3W9WA 2L9RA 2EZHA 2OV7A 1KA0A 3KLOA 4G6QA 4FORA 1PDAA 1GT0C 3HSTA 1MJAA 3LUZA 4EJWA 2B4LA 3NQOA 1A8EA 1U8RA 5CMCA 4CCNA 2BY2A 5L3FA 4ANJA 2P3VA 4GIZA 4XKNA 3UGWA 2WBMA 3EUHC 5FFXA 2NYXA 4BE2A 1Q35A 2AIXA 2IS1A 3HOTA 3QYTA 4OMBA 2K9MA 1OLCA 2HXWA 4YZZA 2HXRA 4UXNA 4U2RA 2VB6A 4EUOA 4B09A 2IPQX 1OFCX 5DM7F 3CJQB 1YXIA 1Y56A 3G4SI 4XSXF 4HS7A 1APLC 4AQ4A 5JI6A 3OS2A 2FA7A 1U0JA 1H3DA 1NV7A 5EHMA 3MCZA 3CQZJ 1NV2A 2QS2A 2ZXHA 1JW4A 2DFHA 3S2WA 3S9EA 3S3NA 3P7IA 1ON1A 3OIPA 1MQDA 3TCHA 4ZS9A 4JVIA 2ZXWH 5ICGA 1VQ4I 3G3JA 2K40A 3FBIB 3IJXB 3H9QA 3SFIA 2YUSA 2LKXA 3KZYA 4I09A 5DUIA 2HOAA 1WZ2A 4G9YA 5I56B 4LQ2A 3E5XA 3ULQB 2M7AA 2K85A 2KLFA 4EXLA 1US5A 4XR6A 3TL4X 4OINF 1PVEA 3ZMVA 5HS7A 2PX9A 2I58A 3DM0A 4BDLA 3ZSFA 4P56A 2X4HA 2P7CB 2AQEA 2LKPA 5M5WJ 1E3OC 4A3DJ 3IRRA 1MPDA 4MFDA 5D5UB 3LBSA 4GWXA 4IY6A 3IUOA 3CP2A 4V2GA 1SFUA 3KETA 3EN3A 4BKXA 4XIDA 3SEYA 1IDYA 3CMEI 1ZTRA 2P7VB 3K10A 5J3LA 5FLVA 4QSDA 3BLYA 2L7FP 4AIHA 1T8IA 1FYMA 5M5XJ 3E79A 3KSXA 3R7XA 4YKPA 1NUWA 1GVDA 2A5SA 4CO8A 4BXXJ 3TCGA 1VQNI 4XRSA 3IO6A 1T56A 4NWCA 3CR9A 4S04A 2PFZA 4PK4A 3ZS6A 2R71A 5AIQA 1ETVA 1DTZA 1OYIA 1A99A 4P1EA 4S05A 1V54H 2XRLA 4HV5A 2F7AA 1ZG1A 4BQNA 3RPUA 1IG7A 1FJ9A 4YAHX 3A3CA 3HKZA 1K79A 2GOMA 3B8BA 1NHAA 5JHUA 4I3YA 5IZ1A 4P1LA 2XPUA 4I76A 1FQFA 4XNFA 1R4NB 1LBWA 2XWOA 4XICA 1J0RA 2XKOA 5IT3A 5ICEA 4G6TB 3EF7A 3JYRA 3JRBA 4ABZA 1SAUA 2AHQA 3T0YA 4ZE9A 4QBAA 1KU2A 1RNLA 2CW0F 2MABA 2XKPA 3QP5A 2EFWA 1FP2A 1P1QA 4UHTA 5FKKA 5CC2A 3J81Z 3OENA 4BDYA 2CFOA 2QVVA 1X4PA 1BJZA 1LUJB 2KIMA 4PUSA 3MKZA 4ESJA 3F11A 2CRGA 2XV4S 3GLXA 3PUBA 1OCRH 3PPPA 3RLFE 2XAGA 3T5XA 4P9KA 5CMMA 3RPUD 4RPOA 2X9DA 4B1RA 1ZARA 5J1YA 3P9IA 1QUIA 5I56A 3LNQA 3PV0E 5EYHA 4GX6A 3O8GA 2MFZA 3C35A 1QRYA 2IA4A 3KSJA 4A3KJ 1UIUA 3CCMI 1KQ9A 2UXXA 3GFLA 4Y33A 4ON0A 5E17F 4F18A 2O8KA 1G3TA 2X7PA 4P1WA 5I2KA 2Y0MA 2Y5KA 2JT1A 3OXNA 4PFWA 1NV1A 1Z1DA 2XXQA 2W82A 3PUVE 4TOZA 3RSNA 4BY1J 3BKIB 3HGYA 2YU9J 4UABA 2LFBA 1LQ1A 3W9VA 4AUXA 4AIDA 2H6CA 2ZXJA 3LAJA 1DTGA 2VKVA 3FVKA 3L1PA 3E3KA 4RB2C 2P4WA 4C0RA 2XAJA 2BVLA 1AOYA 3U21A 4XKWA 2VJ5A 4G8HA 1FQAA 3T96B 4I98B 5DDGA 1KU7A 1OLAA 5ISUA 3E0JB 4BU2A 4X1EA 4LP2B 1UHSA 4YFXF 2DJIA 4N6KA 5I5PA 2JA7J 1URDA 3GZ6A 4OYVA 3TGNA 1YO5C 3OR2C 1Y0UA 3ML6A 4W1UA 1IRGA 3KC1A 5J47A 3KEYA 1BC8C 2K27A 4H65A 1R1TA 5IP9J 3NWSA 1P1OA 4UUVA 2RC4A 2JPCA 4Y52J 3HPIA 2OWTA 1SYIA 3UNGC 4TQUQ 4YB7A 1Z3XA 2HGCA 4LG0A 4JOMA 3N26A 1MBFA 2H09A 2DWAA 2Y7PA 2RKMA 5LD2C 2XA5A 3HRSA 5CVRA 3Q3SA 1XMKA 4RPNA 3RIRA 3OYDA 3O3KA 2HWVA 4A3GJ 4BS9A 3D1NI 3M3LA 3R26A 1YI2I 5EYRA 3FIRA 2OZ6A 4UV9A 1FC3A 4ETSA 1YCJA 2I4CA 1RPWA 2LOOA 5CVUA 3SZGA 2EFOA 2QM3A 5I84A 2OCCH 3FGSA 2LBFB 2G7UA 1PDNC 4PJMA 5I57A 4IXAA 1IMFA 2YPRA 2D3IA 3K6WA 1LVAA 1POGA 2P5KA 4HX7A 3A01B 3OO7A 4CA0A 1MW7A 1YW7A 1YS6A 1GV5A 3BG3A 3H0GJ 2CUFA 5CVVA 3VYTB 3GYHX 3CCLI 1WJDA 2MD0A 1TZLA 3ZXSA 4RGUA 2X6YA 3VXBA 4OIOF 4KT5C 2VT5A 2HKOA 4NQWB 3FIWA 3SKPA 2X85A 3Q5FA 5DVJA 1XMAA 2RNJA 4ZYDA 3S14J 4C2TA 1SD3A 3MZ1A 1MNDA 3VYRB 4OAZA 2VKEA 2GM4A 1JQFA 4BE1A 4KIGA 5B3SH 1N3WA 4R75A 3I4PA 1WGXA 1I3AA 5FHOA 3FXRA 3IHUA 5FKNA 2IVMA 2ZSHB 1OQHA 2F5XA 4PBQA 2RKHA 4NHJA 1ATGA 2PT2A 3F72A 1URGA 1VQ8I 2V4JC 4IO4A 3DU6A 4FX0A 2BW3B 1TWAJ 4KMFA 3ILTB 5TPAA 2LYCA 4GX3A 1V55H 1P4WA 3H5NA 3G3IA 1DU6A 2OCEA 2HQ5A 4WXDA 3AG4H 1IXSB 3E6MA 4C30A 1Y3NA 1BOAA 3CUQC 5BS6A 2O6AA 1OIBA 4IO7A 2Y30A 5EQAA 2KJBA 1RKMA 2A6EF 4UVAA 2M1BA 3E6DA 2R92J 3GVAA 2QSGX 1JVYA 4JX4A 3C2HA 3BG9A 3LC8A 1TWCJ 5DEXA 3RY3A 5I2NA 1TT0A 4BXUA 3BTIA 3NRVA 3I0TA 3T9XB 2W7YA 3PUYE 4GBWA 1ZYRF 4MFEA 5T3JA 3FM3A 2DFIA 2JK3A 1FJLA 1RUNA 2YSRA 3CRBA 4FATA 1HCRA 1JXSA 5FJ8J 1FT9A 3F8MA 3PUFA 2D45A 3CUQB 1AWCA 3AFHA 4JVCA 2UVHA 1RYXA 2XXVA 4UUTA 1O3QA 1VI0A 2QA4I 3S9NC 3KIOA 3QU6A 5KVRA 5IYBJ 2UZKA 1XG1A 4R73A 2M3AA 1T08B 3QODA 4JWYA 3FZVA 2LY9A 5TU0A 3GZGA 3DTIA 2IW5A 1XGSA 1D0XA 4L9VA 2DDAA 4ASNA 3IB2A 2QGUA 4HCYA 4X48A 4THIA 1IMDA 5A5XA 2BEOA 1LFIA 1BM9A 1TQPA 1EA3A 2FMLA 3K0LA 2N8GA 3V4GA 1MXYA 4HE0A 4ISUA 1V5EA 1MIJA 5E3LA 1B51A 2W84A 2O1LA 3HOUJ 3ZMSA 2CV1A 4LGWA 1KGSA 3LSLA 1ONVA 2E2HJ 3RPLA 1Z77A 2VL8A 4OOIA 3T22A 1HA8A 2EFQA 2K9NA 4AU7A 5H8FA 2GXGA 2RDPA 5JFRA 3C34A 3D4CA 2BZTA 4I99C 3JRAA 1RRJA 4E6KG 4G6DA 1FTTA 2DW4A 3EYYA 2V1DA 3MMYB 5F04A 4DXUA 3H4ZA 2XWVA 1JHHA 1OCZH 3ZKKA 1SC7A 3M3KA 2DWHA 1Z7UA 4PJ0C 1J59A 1XMXA 3OIQA 1FPDA 4Q5TA 2COMA 1MZBA 2KIQA 1S7YA 2ZYNA 3DBHB 2VBZA 1YJWI 3HPHA 2P3NA 3IX1A 2Y69H 4WEPA 5KCJA 3TQLA 2A61A 3TO7A 3BFUA 3I53A 3CSGA 3MYUA 1RDXA 5CM6A 1CNQA 3HUGB 5E79C 1U78A 1FW0A 3CMYA 4G7OF 2QPQA 5H2FC 1Y1MA 3W2WA 5E18F 5ELVA 1AA7A 2A68F 3H35A 3I3VA 1P4XA 1IXCA 2KIUA 4IHTA 1OCCH 3IAZA 2QSXA 1FIAA 1C0WA 1MBJA 4H1XA 4POWA 1B58A 3Q0VA 1OVBA 1MMSA 3OYNA 4AYBN 5TISC 1FRPA 4UVCA 2G93A 1WCMJ 4JDFA 2LC2A 1P1WA 4PGPA 4U1ZA 5D5XB 5J8FA 2BBYA 2E7XA 5TJJA 4MTEA 1A6QA 1MQGA 5DTBA 1X2NA 2QLZA 4R6KA 1X1PA 4G8NA 1DSNA 4OXVA 2FUG2 3FXOA 2DT7B 3BY6A 1FBFA 3PU5A 4NG7A 4PDDA 3U2RA 5EYGA 2MSYA 4K2EA 3H0DA 3EHTA 2UVJA 1AU7A 1LAFE 1BA5A 3OY9A 3VEPA 4HNVA 2ZZXA 4PZJA 4KCCA 1JJ6C 3GEZA 1FTKA 4L5JA 3FK6A 1D3KA 2R7ZJ 3VE1B 1AKHB 4H8JA 3NARA 1QBJA 4CICA 3DEEA 3BG6A 2F5FA 5M5YJ 4IRGA 3WHBA 5CVJA 5LEKA 3QUJA 1JKOC 1ACIA 1POTA 5IYDJ 1FQDA 4RAYA 4KT6A 1MXUA 3EQ1A 4OFJA 4ESWA 4CCMA 1WWXA 5FFZA 2PJPA 1OISA 1KYWA 2LMDA 4MQVA 5F64A 2XRNA 2HQNA 3R4KA 3TO6A 1NNTA 4R72A 2RC8A 4KHZE 2O1MA 4XXUA 2CQ7A 5CMBA 1XVYA 2AYSA 1QKAA 1MQJA 3RDIA 1FYLA 3LUYA 4NHBA 1LDKB 1S8NA 5IGAA 2VLAA 2F4OB 3OYLA 4ZJZA 1PJRA 4E4HA 1HLVA 4FASD 3TP0A 1QUKA 2DP8A 1AHDP 1K9ZA 3A09A 3MFKA 4OVPA 2Z16A 2Y84A 3IH4A 1V4RA 5BNGA 4B47A 2PG4A 2D21A 3HL2A 3HYIA 4B44A 4X1DA 3H9JA 1SVOA 2OZZA 2QMWA 4R6YA 4XN3A 2H1KA 3OSFA 3GFMA 1F5TA 4IO9F 2WB1N 4BBSJ 1IDZA 2VT2A 3K4KA 4RXLA 1U3EM 1HOMA 4YFNF 5EEGA 4M1VA 1OYYA 2DSFA 4ZDMA 1JKPC 3ZMUA 1G0HA 1TNTA 2V9PA 1DDNA 1MXZA 1FPBA 1I6BA 4JBAA 2DVZA 5I7IA 1W36D 3JAMZ 1TWFJ 3AKZA 1H0MA 3I5OA 4DJAA 2L7MP 2HVRA 4KISA 5C4JJ 3W2VA 2R5ZA 2X7QA 1BR2A 2RREA 3S3MA 2VPLA 1A35A 1QPMA 4LJZF 2FNPA 4M9XA 2DPUA 1B3LA 3PQJA 4HDVA 3GFIA 5M3FJ 3IOTA 1VDWA 2FJ1A 3OYBA 5CI5A 3FV2A 3PNTA 4Q5SF 1X2MA 3SERA 3DBLB 1K7AA 2M87A 1D9QA 1LVKA 2AL4A 1XS5A 4OFLA 4KQPA 2OC6A 1RR7A 4A93J 4P11A 3J7ZI 1PB7A 4O6JA 2DOEA 3ILUB 1JHFA 3PQKA 4AC0A 2F36A 3D1RA 2E7WA 2LDUA 3DPLC 3HM5A 1FYKA 1JNFA 3SEUA 4MEYF 3AG3H 3KFMA 2DA2A 1MH3A 1UJ8A 2LF7A 4JSOA 3ZQHA 3H36A 5DW8A 1FTOA 4L5IA 4MQ9F 3LQRA 4RS8A 5AA2A 4MBPA 1XVXA 1R49A 1BTJA 4U1OA 2X26A 2LY1A 2RF1A 2DOFA 3PM1A 3QWLA 4C3IJ 1G6NA 3WTYC 2L02A 2R7UA 4BEHA 3RNNA 1QVTA 1W5TA 4Z0IA 1SW1A 2Q0OA 4LK0F 3BR2A 3BZ6A 1BR1A 4NC7A 3LA3A 5HM4B 2DTZA 2LH9A 1E0EA 5HS9A 4LVQA 3TQNA 2V84A 5CRYA 2A5TA 1EH7A 2NS7A 3FWEA 2E71A 5GPAA 2ZXTA 1T0KA 5E20A 3PO3J 4WWCA 2B65A 4G68A 2XGCA 2B0LA 4YU0A 5AONA 4IQJA 3UN6A 5TP9A 4XLFA 1E3HA 1H45A 3R0AA 1TC3C 3MQ9A 5A2QZ 4PJJA 3FVNA 5HPQA 3KBZA 3HGGA 3I55I 1ITYA 2KRCA 3JRDA 4PE5B 3MZ9A 2KISA 2VT3A 5FO5A 2KPMA 4QSCA 1XHYA 4NF5A 2QVOA 2VONA 3CZ6A 3VOEA 1NV0A 2F48A 3ZQIA 1OR7A 2BV6A 4F7ZA 5DT6A 1AOVA 1FSEA 3GF2A 4XL9A 1O7FA 5M2VA 4XLCA 2YLNA 3CFZA 2PJRB 2DA4A 1M5BA 4MNCA 1A55A 2K5CA 4I40A 1G4DA 2NRAC 4MNPA 2HFBA 5J16A 4I8CA 3A4CA 2W00A 2C6YA 3ERED 4IHXA 3KEOA 1LJ9A 2DFEA 2QUFA 2YU3A 4X6AJ 3OEMA 3HRTA 2CEXA 4LA9A 4GBVA 5I3SA 2XX8A 1K83J 2EV5A 2KRHA 1JJ8C 1M5CA 1SDXA 3K6XA 1X1CA 2XWIA 1L5TA 2FE3A 1GGGA 3I4MJ 1B40A 4EATA 2HAVA 5J1UA 3GLBA 2QSHX 4BEHB 3T8RA 3WU1B 3SQNA 2FQ4A 4DGWB 1OQYA 5K5OA 4G68C 2HS5A 4DZJA 3WGHA 4PAIA 4OENA 2QQ8A 1VQPI 4ZTJA 2F8DA 3RJPA 4PGNA 1IN6A 3RT8A 3QYBA 2VC0A 2XASA 1CF7B 3CSBA 3EDPA 1OPCA 2E0SA 2O0YA 5A5LA 2GHBA 2RGVA 2WV1A 3G3HA 1RR8C 1JETA 1XSVA 1R5ID 3E5UA 1XGMA 3F3XA 1FPFA 1OR7C 4ELPA 2DBBA 1IC8A 4D7NA 2DMUA 3R0JA 3O6GA 2YJPA 3CCVI 1RESA 3ZGKA 3SETA 2OF7A 2JUCA 1B72B 3TUSA 2IGMA 2QS1A 2XUBA 1J7KA 4R9FA 1I6XA 1X4OA 4FEBA 3DXJF 2V26A 4KXPA 1E17A 2CMOA 4LN5A 3ZKLA 3CDIA 2A05A 3BR0A 2L3DA 3B6WA 1AKHA 1EYKA 3OL3A 3M4OJ 3L6GA 4N6DA 3IKVA 1BW5A 4DYCA 3VSLA 2MYSA 2KL4A 4NF5B 5FLXK 3BTCA 1B9JA 1B4AA 4GD5A 1MBGA 3K69A 3HKZN 5F1JA 4BE0A 4QFNA 4RGSA 4U0YA 3BG5A 3U1DA 4ELQA 1YOVB 3IP4B 1LPQA 5EDNA 3WGIA 2HYFA 3FKJA 1MDMA 2GLOA 3ODBA 3TZAA 3HJEA 2KP6A 1USYH 3CG3A 2CZKA 1Z6TA 3B7DA 2F7BA 2V25A 1SFKA 5EEHA 2REJA 1HF0A 4A5MA 1NV3A 2ACJA 2VQGA 2PLYA 1SD7A 2K4BA 2ZZVA 3PJRA 1I50J 1XB4A 3CO6C 3ASNH 2OQRA 3WU0A 1LLSA 2Y75A 1WVJA 3QAXA 4OEUA 3RKWA 4G61A 1LNWA 2OQGA 1XSXA 2ZNZA 2CZIA 4H46A 4NBQA 2X6XA 2Q9TA 1O7TA 3JRCA 1IXIA 1NUYA 2HYJA 3C32A 3RZDJ 3SZTA 3C2BA 2VJ4A 2BOLA 4DBQA 3C2GA 3SXYA 3ISPA 5DV5A 3ZMDA 2DU9A 2R7WA 1FBGA 3KZZA 2CZLA 2QQ9A 3Q0WA 4OEVA 3V8XB 4A6DA 2GXBA 2ZSIB 3DPTA 2R0QC 1MDQA 3CMMA 3KX2A 1HKTA 3CF2A 4BDMA 1WPKA 1V5GA 4BJ5C 1IGNA 1BI0A 1B7HA 4ENJA 5K7ZA 2RINA 3DP8A 4PP0A 3M8JA 5IY5H 2GIVA 3J80K 1BJAA 1ZELA 3BTJA 2PEXA 4YB6A 3JREA 1HKQA 5EQ9A 1JUMA 2PMUA 5CJ9A 4A12A 4NF8B 4PGGA 4LB5A 1GVCA 2UYFA 4BDQA 2IXSA 4GL8A 3TYHA 4KN4X 1IXRC 2DO7A 3W15C 3QRFF 2G9WA 2STTA 2BGCA 1VQLI 4QSHA 1WDNA 4F3BA 1XD7A 3M8UA 3SEQA 2ISYA 4FE4A 2GA2A 4FQGA 3I58A 2XAFA 5E3NA 4BUPA 3TW6A 1TW2A 1RKWA 1TQMA 1FPQA 4HTGA 2PMZN 1NV4A 4WK8F 1QVSA 4MHGA 1R71A 2DT5A 3I54A 3FX3A 4XKBA 1YIJI 3CCUI 4PDKA 2JN6A 4WXJA 2DYRH 2E5ZA 2L9SA 4KIBA 1B8IA 1OCOH 2Y9YA 5FLXZ 1USSA 4IKFA 2EFNA 4YELA 2H98A 3TAJA 1V5FA 1QULA 3ERMA 2EQRA 3KP7A 5ILSA 3FHZA 4LLNA 3G73A 1HKSA 2ZXIA 3Q9VA 4HDUA 4G7HF 4N13A 5FKOA 4PFBA 4WKMA 1GXQA 4GWYA 2E35A 3RUMA 4GYGA 4BGDA 3KN3A 4LB6B 1EU8A 3TO9A 1KA1A 3W6JB 3FXBA 4XK4A 1KYZA 3BCAA 3PD8A 1RZ4A 1WJFA 4BHBA 2RCBA 3CFLA 2V1UA 3MWMA 1BI1A 1MD0A 4IF4A 3WTUC 4N8YA 1B59A 1R00A 5H8QA 4AS4A 1P1NA 2QYOA 3MPKA 1DGWY 5F0FA 1R4MB 4CH7A 4NE4A 1VQ7I 1YX5A 3T1BA 3K4LA 3WTZA 2F7CA 3HCQA 2EZLA 3DU5A 1RETA 2WY7Q 4P96A 5K2YA 3FXKA 1U2WA 2BY3A 1QNTA 3BR6A 3GTOJ 4P47A 2Y0SA 5I2NB 4HX4A 4NUBA 4ZC3A 5BWJA 4QFPA 4AIJA 4R2FA 4ENMA 2XX9A 3KZGA 1HW2A 1R9LA 1W7PD 1GV8A 2EINH 1T38A 4FJPA 4EF1A 4MLVA 2EZKA 4EDPA 2CU7A 3BBRA 1SEUA 2W57A 3COAC 1BK4A 1II5A 4N6PA 1JKRC 4U7DA 4M3DA 3DLNA 2P6SA 1QZZA 1NUZA 5LRSA 2ESHA 3IKTA 3H5AA 3L2CA 1NH3A 1INPA 2Z5UA 1WHUA 4F3QA 1B3HA 3AXFA 2Q2EA 1IEJA 1DGRM 4JX6A 2I48A 1K4SA 1WJAA 3TOAA 1UQWA 2GQQA 5DYMA 2O6GE 4GL0A 4WXHA 2DOAA 4NQ8A 3S9MC 1QGPA 4XLPF