3FXUA

Crystal structure of tsar in complex with its effector p-toluenesulfonate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
source organism Comamonas testosteroni
molecule tags Transcription regulator
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA03
1JEVA 5H8SA 4RB3C 3M1EA 2VOOA 3PUXE 1T6SA 5HS9A 1B3FA 1R9QA 2PBIA 3KP5A 2HTSA 3G73A 2V93A 1IRGA 1VTNC 3J81Z 4ELQA 2O1MA 3QSLA 1NH7A 3K4UA 2FMLA 1J1NA 4ZEDA 2BV6A 1DSNA 1Z9CA 4JBZA 5D4SA 3HSEA 2DYXA 2M8EA 1IEJA 4HA8A 3RYPA 3E5UA 2BJJX 5ICFA 3SESA 5H6RA 3EN3A 2HS5A 1IIWA 1R00A 2HDCA 3TODA 2PT2A 4CDGA 2Q2AA 5AA4B 1J9IA 4PETA 1FQDA 3FJMA 3GWZA 3R0AA 2CZLA 1ELJA 3VLVA 4QSCA 2RKHA 1B1HA 3F8MA 3IWZA 3PQJA 1U5TA 2RNJA 4R6HA 3IJXB 1R5HA 3O29A 2O3FA 1ZG1A 3V83A 3MPKA 2QS2A 1IUYA 3PU5A 3OMBA 2JRTA 5D5XB 1MDMB 4L0ZB 1US5A 2RCBA 1LFIA 2VBXA 4EQQA 4GWOA 1H76A 3TTKA 3PD9A 3VFJA 2PMUA 2I0BA 4WKMA 2ESNA 2XXXA 2O7UA 1R22A 4IRIA 1IXRC 3KP3A 2VOZA 2CW0F 5ILUA 4ZYHA 4QFPA 5H8FB 4ESXA 4MTDA 1TFAA 1REPC 2XXTA 2QM3A 4Q4ZF 2QQAA 1XMKA 5BS6A 3OSRA 4IO4A 2ETHA 1B0HA 3WGHA 3QOPA 4BDQA 2O6GE 3CUOA 3K02A 4YICA 4HZFA 5CVJA 1PB7A 1KU2A 2FNAA 2X4HA 1DTZA 1B4HA 3G3HA 4OWDA 1JHHA 2RC7A 4OU0A 1RNLA 1B6HA 2WC2A 3S4UA 2IPQX 2HEUA 5L9OA 3HTUA 1MM6A 3KFWX 1OMPA 2VN2A 3O28A 2ZKZA 4A0XA 1DOTA 3T8RA 2G93A 5FHMA 5D4RA 1I6QA 3RT8A 4THIA 4Y17A 4KPTA 4R74A 3DP4A 2DQLA 3JTHA 3I71A 1RYXA 3L6GA 1P1QA 4Q8RA 2VC0A 3B6TA 4AQ4A 1MKMA 4HW0A 4ESJA 3EQLF 2RKMA 5HDNA 5E8IA 5L9SA 2QENA 4GL8A 2IA4A 2XX8A 2L02A 5HDGA 4KHZE 2P6TA 3M3LA 5ICCA 4FEBA 3K1MA 2LKPA 3RN8A 2GRVA 1MQIA 5HLGA 2EWNA 4EGZA 4LG0B 3GFMA 3GZ6A 2CGPA 2E1SA 2OA4A 3QUFA 1J59A 3R6UA 4BH9A 1HKTA 3KZZA 3W6JB 4QFNA 1TW2A 5CVIA 1DPRA 2FE3A 3QP5A 2HYFA 5HOOA 4H8JA 3RNNA 2QYOA 1WRJA 1B0LA 1S6LA 5D8LB 3UK4A 1BI3A 1Q1HA 1B3LA 4F19A 1KQ9A 2D21A 4OESA 4ONYA 4MQ9F 3N6TA 5F1QA 1S8NA 5CYVA 3RKXA 3J80K 3KE2A 2L54A 3MVYA 3TOAA 1TBXA 1L3LA 1D8JA 1C0WA 1OIBA 1RUNA 4G6QA 1P1NA 4EQ7A 2QMWA 2XAJA 4UVAA 3EETA 4Q5SF 3FVKA 4G9YA 3FF5A 1OLCA 1M5DA 2VE9A 1SD5A 1FC3A 2YSRA 1UTBB 5H8HA 3FXQA 2BGCA 4BHPA 4EJWA 1JQFA 1YO5C 5LEKA 4RGSA 1MJAA 1BLFA 4OIOF 1SQYA 2FYIA 2ZNTA 5L3CA 3TQWA 1TQPA 1OYWA 1SMTA 4LZ7A 4ZE9A 4NF5B 3KP7A 4KYSA 4YB6A 5ELVA 4BDOA 4KUMA 4DNCA 3TYHA 5JTYB 3RY3A 2NS0A 3OOPA 2C6YA 5JI6A 5ICGA 4ENKA 2F78A 3F11A 3FJGA 3JAMZ 3C18A 2E1NA 4PGHA 4IGTA 2PG4A 1B59A 1QGPA 1L0OC 3V8XB 4G2ZA 3JTGA 4GQOA 1J5YA 2P1SA 2KJBA 4GF8A 4G8MA 3CJNA 5CVUA 2JSCA 5EHSA 2UXAA 2O7IA 5AA3A 1GR2A 5I57B 3ERED 2M5WA 2VC1A 4F3SA 4P11A 4M6YA 1QZYA 3T93B 3BJAA 2EV6A 1S3JA 1M5FA 5J8CA 3HPIA 1NNKA 3HOTA 5FD5A 4RA1A 2RC9A 3U94A 4RNSA 3GVAA 4JWOA 1Y0UA 1HSTA 1XVYA 1Y3PA 5K5QA 3GO5A 3ZP5A 2YPRA 5D5VB 3DP7A 1FQEA 2DWJA 4KDPA 4HQEA 2FBIA 2ZNYA 3TCGA 1AWCA 4U1OA 3RI4A 5A5XA 3K2ZA 3G3FA 5EHMA 3DM0A 5M2VA 1FLIA 3ZN0A 1GTKA 1ON1A 1TNSA 5LEJA 2I6EA 5D6EA 5K5RA 2NRAC 4NE4A 3HTSB 1ZG3A 2W84A 2XXWA 5FTIA 3KSJA 1B5IA 3FIRA 1J75A 1SD4A 1B40A 5I58B 1FP2A 5DYHA 1UHMA 1ZMGA 1A40A 3BPXA 4F31B 4GGGA 4XSXF 1RIOH 2DBBA 4GYIA 3A09A 3WAFA 2XXVA 4NQWA 1P99A 1OVTA 5IAIA 3EYYA 1O7FA 1G6NA 2EFNA 2R7FA 1F5TA 3DPTA 2DVZA 2HXWA 1WWXA 4NF4A 3I59B 1YW9A 1DPPA 5TJJA 4G68A 1D8KA 1PBPA 1Y20A 1R1NA 3S9NC 2XXYA 1F9BA 3WTYC 1W4MA 3JW4A 1SW4A 4Q30B 1JVXA 5FLXZ 1USSA 4RB0A 3I4PA 2HQNA 1B9MA 2CG4A 3CVGA 2P6SA 4C0RA 5CC2A 2GA2A 4MGRA 3S2VA 1IXCA 5L3FA 1HW5A 2K7LA 1Y4TA 5DDGA 2H98A 5L3DA 4X1DA 4YMAA 3S9LC 1R1TA 4OTEA 2DXYA 2VHAA 4LONB 3O97A 3O2AA 2MLGA 3N26A 4ZE8A 1MXVA 5AA2D 1P4WA 5I2KB 4A5NA 1U6GA 4NF8A 1Z7ME 1LDKB 3DKWA 4I7HA 2UWMA 4GXAA 4U21A 3DP6A 1USTA 3LA2A 4N0BA 4MEYF 3HV1A 1JNFA 3GLBA 3ABTA 3U9GA 3L9FA 4BXUA 1ZBMA 1OMIA 4IRGA 2ANJA 1LJ9A 5B7DA 2Z23A 2XX9A 3VXCA 3H6TA 4HCYA 4MTEA 4BNCA 3QP6A 4EJUA 1DUXC 1U3EM 5EEGA 1I6BA 4IO6A 3FMRA 3ECRA 4IY6A 4MBPA 3BJOA 4UNOA 5TPAA 3WGGA 4KFCA 1KYZA 4O3BA 5E20A 1LAGE 2I48A 1ZLKA 1CB6A 5D8KB 2NYXA 4LK0F 1FTMA 4PZJA 1T39A 5IT3A 3TELA 2F5CA 2XXIA 2XHKA 2YX4A 2BBYA 4H5GA 2RF1A 1SW1A 3FHZA 5KDTA 1TWYA 3PPOA 2Z99A 4DQ2A 1DPUA 2VT3A 3K6UA 1FZPB 4RJZA 4GFRA 5FFXA 1XC1A 4LVQA 4M4GA 4M73A 1HW2A 2DI3A 1ZN2A 3OD7A 1I6XA 1O64A 1XB4A 3G3IA 4HLYA 3CG1A 4ESWA 3DLNA 1W7PD 2A5TA 3MCZA 2IRFG 3LAJA 1P1OA 4ELPA 1QPMA 2RDPA 1D9VA 5L9MA 3SEYA 2R6GE 4R2FA 3H3UA 2XHDA 4LZ8A 4OEUA 3DFGA 3U1OA 2BE5F 1YIOA 3IORA 4ELRA 2FU4A 1SBPA 4YB5A 4OFOA 3EPEA 2H94A 5ITPA 1WSUA 3LSFB 4JSOA 2Z33A 1Y3QA 2L3DA 3H4ZA 3BKIB 3WTUC 3SQNA 1I5ZA 2QRYA 1FQFA 1BBYA 2A68F 4PQJA 3DF8A 2PYYA 3GFLA 1RZ4A 2ADUA 4ASNA 1MRPA 2QS1A 2IP2A 4GVOA 5DUIA 2LNBA 4DXUA 1YTYA 3CFLA 1A8FA 3OO8A 3RLFE 5A2QK 4H8IA 2M8CA 4XLPF 2GFEA 3VB2A 3Q27A 2EV5A 2E7WA 2IA0A 5E1WA 3EUHA 4A2UA 5CM6A 4IHTA 2EFOA 2CMOA 3T1BA 1MPDA 3GZGA 1Y4CA 5DYMA 1YS6A 4WWCA 1IAWA 4IO2A 3BBRA 3MVZA 1OQHA 4CICA 2FF4A 2RN7A 3P7IA 1UCRA 4MFIA 4EGYA 2ZCWA 3BZ6A 3TKYA 3DP8A 2VD2A 1ZRCA 4YZZA 4LUBA 1KU7A 4PDKA 4DCXA 2A3SA 4WXHA 3K2DA 4HX4A 4ZECA 3ZSFA 2UXNA 1D9YA 3DPLC 3RGYA 2F35A 1WI9A 1R6ZA 4H0WA 2V1UA 2Y0MA 2DQVA 3PMWA 2JT1A 1B51A 4F1VA 2V79A 3GLXA 1BJAA 4WXDA 4FATA 1HSEA 1ZG5A 2IJLA 3VOEA 3C33A 1ATGA 2EK5A 1EH3A 1I69A 3V8JA 5CVRA 3VDFA 4L9JA 1AOYA 3P9KA 2XAGA 4OFLA 2HYGD 1MQHA 2XD2A 3TTLA 4KD5A 1U78A 4EM1A 2UYFA 3G3ZA 3AAFA 3KEOA 3K6VA 4GL0A 3IO4A 1A99A 3C1DA 5AIQA 3JSOA 1D3KA 2HR3A 1ZTYA 1OYYA 1P4AA 2GXBA 1YAEA 1CGPA 1QBJA 4CO8A 1II5A 2F7BA 4M1VA 4G7HF 4A6DA 1T98A 4M9XA 4P5OA 3U93A 2Y7PA 2A69F 5DT6A 2IVMA 3W15C 2PFBA 1QVSA 3Q29A 5DUKA 3H3GA 2R3SA 2ZMEB 5KVRA 2O69A 4H67A 3V89B 4TQUQ 1S7OA 3LSTA 1R36A 2OBPA 1VSOA 2MD5A 3CUQB 4CHUA 3Q28A 2X7QA 2GWRA 4H1XA 1GXQA 4GLIA 2HOEA 3Q9SA 4I09A 1BIAA 2FRHA 4GXSB 2PMSA 4RYAA 1POY1 1R1UA 1FNNA 2ZBKA 3WGIA 3FV1A 3FMQA 5CMKA 4EM2A 4LA9A 3TTMA 4FAJA 3F6VA 2XAFA 2W85A 1O3TA 1O3SA 1IQ7A 4U1ZA 4OMBA 1LVAA 2M87A 1KYWA 2KIUA 4I0AA 5TP9A 4DDDA 4XTCQ 3R61A 1YQAA 1QUIA 4XSZF 3ODBA 1BKAA 1LDJA 4IF4A 1B7HA 5IT9Z 1B2HA 4ENJA 5I2NA 3I54A 2XV4S 1JETA 1U2WA 2G7UA 2D45A 2HAVA 1PB9A 4P0GA 2P5VA 4P55A 4BLAA 4L5IA 4KIBA 3BJ6A 2XKPA 3R4KA 1MPBA 2AL5A 3K0LA 5LGNA 4BHBA 2G29A 1N04A 1MM7A 1LB2A 3FUZA 3B73A 2YX7A 3H6VA 4R9GA 5AA4A 1ZLJA 3SEXA 4ZZDA 1W5TA 2QBYB 2G7HA 2H5YA 1Y9UA 4LB6B 2UVIA 1LCTA 4I8CA 3BPVA 4GD5A 1K78B 2ONSA 2CYYA 2M30A 3J7AO 1TFDA 1IW7F 5TRDA 2O0YA 2QVOA 2B0LA 1SI1A 1OKRA 3VXBA 5KK1A 4POXA 3HYIA 1URSA 3S2WA 3HN0A 5HM4B 1LEAA 1MDMA 1FTOA 2Z22A 3VV5A 3KP4A 1N84A 3K1PA 4G8XA 4FEDA 1A8EA 2WKYA 2HZTA 3HCQA 4JSDA 5HBCA 5JHUA 2GH9A 5FTHA 4G8HA 5KZTA 2KIMA 1K6OA 3IWFA 2JPBA 2R9JA 5H8FA 4EXKA 4EV0A 4Q0CA 4YKJA 1SVXB 4HYEA 1FT9A 4GIZA 4ENMA 3GXOA 2GXGA 4M71A 4HF0A 2QLZA 3T5XA 4YIFA 3GYHX 4LB5A 3CDHA 4I0BA 1PUEE 5CMCA 4MNUA 2DWIA 1LDDA 2ABHA 2GHBA 4RB1A 4M9ZA 3U92A 3LWFA 3B02A 1I6AA 2QS3A 3OXNA 4I01A 1SW5A 1AH5A 3IB2A 2PJPA 2DK8A 2B3FA 5FFZA 4OXVA 3WG9A 2UZKA 2H99A 2ESHA 1BC8C 3MAMA 2EB7A 2ONKE 4RAYA 3BFUA 2ZXJA 4G94A 4P9FA 2ZYMA 4LQ2A 1G3SA 4I02A 1WVJA 5HLIA 4XRFA 4KIFA 2F34A 3JAMK 4R75A 3KN8A 4HS7A 4UV9A 1G3YA 3FM5A 2E7XA 3RPQA 4QSEA 4RAZA 3BROA 3F22A 4QSDA 3KN7A 1UB9A 4POWA 1YW8A 2XASA 3KLOA 3ROUA 2I4BA 1DMBA 1FSEA 3LA3A 3WTVC 1UTHA 1LBBA 5I59B 3FM3A 2KJCA 3IB0A 4O5VA 3OOAA 4IVNA 3GFJA 3LR1A 4ZH4F 4G7OF 3P9CA 2Q9TA 4LATA 1ZYRF 1PBQA 3I6VA 4EMSA 1IN4A 4I98B 1FCKA 2DSFA 2QPQA 4ZEKA 1LLSA 1SI0A 1B4AA 1ODDA 5LHIA 4F29A 1VFDA 3QXMA 1P92A 3HRMA 3FXRA 4IHSA 2G9WA 2LF8A 2P0SA 4FECA 1LFHA 1WKMA 1CF7B 4HX8A 4IO5A 1AIVA 3SETA 2FBKA 5BOXA 4PE5B 3I0TA 2PMHA 2ZNSA 5DTBA 2DVCA 1PEBA 1SAXA 1Y1MA 3PMVA 4NF5A 4IRHA 3QU6A 3MVWA 4QWQA 3P7NA 5JTYA 3LFKA 4RB2C 1JXSA 4HOBA 4OOIA 1G4DA 1K7AA 5ICTA 3F72A 3N94A 4YIIA 1LAFE 4O3MA 2F2EA 2W25A 1NNPA 3UA8A 4Q5TA 4IO7A 5CJ9A 3QU3A 2H9BA 4DIGA 3FVNA 5DV5A 2UVHA 2A6EF 5F6FA 3CUQC 4EF2A 3MP8A 5I57A 2YPNA 4BDNA 3IOUA 2HCAA 3M8UA 4X1BA 5ILSA 4A6EA 3ILUB 1QKBA 1USYH 2PI0A 2CSOA 3TFLA 5H6QA 1V4RA 2HFHA 3K00A 4ZDMA 3VE1B 1Z7UA 4RS8A 2IT0A 2Z3YA 5BPDA 1BTJA 1P2FA 4UA8A 5CMBA 3VLUA 2O03A 4OQOA 5IKBA 2OZUA 1LBCA 2ISZA 3KOSA 3GBBA 1Z7NE 5AONA 4K2EA 1B4ZA 3F23A 3G7WA 3S9EA 1JE8A 4PP0A 2ISYA 4IXAA 1NL5A 2NOOA 3FATA 4R9FA 1LAHE 3GW2A 3ZN1A 3BWGA 2GHAA 2FOKA 4BDLA 4IY5A 2NUVA 4UUVA 4YFKF 3ZS6A 4GO1A 4R2BA 4F3GA 1ZGJA 4F3PA 1YS7A 1VFEA 5I58A 3QK6A 3E6BA 5DCMB 1T0FA 4U22A 1B7ZA 1F4KA 3H06B 1A54A 2DXRA 1IXHA 1NNFA 4F22A 3PUYE 4OFJA 3PUWE 1DPEA 3BOQA 4UHTA 1FBUA 4N9IA 4ZYDA 4ZZLA 4U4SA 1H45A 2Q8KA 3MZHA 3GZ5A 3I59A 1BM9A 1K79A 1HXDA 2HGCA 3UGWA 1XDUA 4HX7A 3IRQA 3MAJA 1KWHA 2VP1A 4NF6B 1A55A 3USDA 1XCVA 3MP1A 5J8FA 3MFKA 1Z6TA 2OWSA 2ACJA 1OPCA 2DTRA 4YFXF 3C7JA 3R60A 2HQRA 1O3QA 2PVUA 3N6UA 4JB7A 1ANFA 3EQ1A 5EEHA 4O3AA 4RGRA 3SKPA 1IRFA 2EFPA 1U8RA 5D5WB 1LB8A 2WV0A 3J80Z 1B9NA 1MXYA 4ESFA 5KCJB 2Y48A 3C36A 2ZNZA 1TT1A 5DD8A 1STZA 1ZJLA 3E6CC 5HS7A 3VVEA 2I58A 3RTFB 5A5XB 3V4GA 4MF3A 5I56B 1HW1A 2FMYA 3IR1A 5I84A 3DQVC 2OCUA 2K4BA 1T2KA 4KMUX 4GXOA 4MQVA 1KQ0A 2GZWA 4FHTA 2O1LA 3V5AA 2D1VA 4YKKA 2I49A 2L01A 5I2KA 4WX9A 4R73A 5AA2B 1XD7A 4KICA 3T96B 4RXLA 4FJPA 2P5LC 1S7YA 4EQBA 2LDUA 1XCBA 1JVYA 5D5UB 2FEZA 4L9TA 1OYIA 1H0MA 3GXAA 2Y7RA 2M1BA 3HRTA 1BP5A 1MD0A 2X0LA 4JXIA 1QUJA 3FVOA 2O68A 2ZYKA 5K2XA 1GV8A 1ZGAA 2QSXA 1QO0D 4GCVA 4IO3A 4EF1A 2HQ0A 4KMFA 1F1ZA 1QZZA 1USYE 1BI0A 5DEXB 4ZS9A 3QYTA 2NNNA 1FWZA 1MY1A 4N13A 3PPQA 4ZYGA 3WU0A 1NFTA 2X7PA 4XLNF 2VT2A 4G6DA 3TAJA 3U1DA 2CWEA 3M3KA 1MGTA 3PUZE 3L6HA 4WK8F 5BWJA 2I3VA 4H5FA 2H6CA 3E13X 2ALUA 4YFNF 4OHNA 3R6SA 1YFHA 3TCFA 3T9XB 2O61A 2XKOA 2GIVA 4C1UA 3KBRA 4NWCA 1W7PB 4PCQA 1XVXA 2PBWA 1EH8A 4ELOA 3MP6A 5LRSA 3PPNA 1LEBA 4PFWA 3G3GA 2L4AA 3KFMA 1BI2A 3BFTA 3MQ9A 3Q5FA 1NMUA 3SEUA 5H8QA 2FBHA 4HDVA 3C9HA 3MWMA 3CR9A 1QQIA 4MHGA 5K5OA 1X3UA 2O6AA 3FGSA 5ERIA 4CZZA 2VBWA 1MY3A 1A04A 2I4CA 4BYYA 1PB8A 4UACA 1ZREA 1SFEA 4JDFA 3FASA 1P4XA 1I1GA 3BY6A 3EYIA 4GYGA 1AL3A 3EHUA 4PFYA 3TO9A 3UORA 1FPQA 1ZHFA 2FXAA 1N3XA 2OQRA 3I5UA 2H27A 1JGSA 3LC8A 1NHAA 4H6DA 4OZ9A 1MXUA 3MEXA 2ZYNA 3O3KA 4JQFA 4P0IA 4OINF 3V8KA 3KEQA 1MQGA 3IK6B 4XKPA 4EQ9A 1EH7A 1LGBC 3HRSA 4YAHX 1XGNA 2MH2A 1JEUA 3IOWA 3VODA 3MWBA 2OWTA 2A07F 1YYVA 3TGNA 4ZEIA 3ZKKA 3EHTA 1FTLA 4EXLA 2K02A 3DELB 4MLVA 3HHGA 4M72A 3TCHA 3IOVA 4OYVA 2X26A 4IB2A 4OVJA 2F6GA 3MPLA 5HVQC 3QUJA 2DWAA 2Q88A 3ML6A 1F9NA 2QQBA 4HLXA 3ILTB 3CRBA 4LP2B 3PFIA 4OIPF 2LSOA 1ZRFA 1IN5A 1QW0A 1M5EA 3H3ZA 4FIMA 3GFIA 4O6JA 2HAUA 4B8XA 2RC4A 1N7XA 4LZ5A 2V84A 3HRUA 4JK1X 3RJPA 2Y84A 2DE4A 1IZ1A 2F36A 3K6WA 2P4WA 4CGZA 3N5LA 4OIQF 3KN3A 3E5QA 3F21A 3HUGA 1P1WA 3H7MA 1J2XA 5E17F 3QPHA 5IT9K 4OMZA 4L17A 4AB5A 3MQ0A 3MVXA 3ZMTA 1WODA 2XXHA 1Z6RA 3LAPA 1S50A 3P9IA 2O8XA 3H92A 1IN8A 2XROA 1KA8A 4EVIA 3Q25A 4WXJA 2GQQA 3SFZA 4WCGA 4HTGA 2HWVA 5FD6A 4WF2A 6PAXA 2YR2A 3GF2A 1P6RA 1FTKA 2NNYA 4I62A 2ZMEA 4OETA 1KU3A 3KGCA 1B5JA 5CVVA 4O3CA 1ON2A 3TTRA 5DEQA 2V25A 2V1DA 5TU0A 3J81K 2W57A 3D5LA 2THIA 2XUBA 4U23A 1W5SA 5CBSA 4WEDA 2O51A 3PQKA 4S04A 4KYEA 1IUDA 2YU3A 4ISUA 5BPIA 4U0WA 2DWHA 2OK2A 2IA1A 4E0XA 1MY0A 1B1BA 2JZYA 2PLYA 2COMA 4ZZAA 4HV5A 1B1XA 4AVPA 3MZYA 3QAHA 4HW8A 1IN7A 5ITOA 3E3VA 4P96A 2H25A 5FGMA 3WAEA 3E5XA 4I2OA 2ELHA 1BOAA 2WWYA 3HSTA 4E0WA 3TQNA 3G3JA 1BN5A 5A2QZ 2RQPA 4LLLA 2XXUA 3C35A 3UP9A 2REJA 4XKRA 4U0VA 5CI5A 1SD7A 1VE4A 4LGWA 1PP8F 1PDNC 1KQ8A 1T38A 1RYOA 4ESBA 2DE3A 1EV7A 3IRRA 1SYHA 2MA3A 4H65A 3D0SA 2K4JA 1BIYA 4QFOA 1VR5A 2F97A 2OBGA 1MJBA 4PGGA 1BC7C 3AXFA 3HIFA 1B58A 4KN4X 3JZJA 1NH8A 2HTJA 3TKDA 2ZMBA 5H8NB 2UVJA 3VVFA 3SXYA 4XXUA 3TTNA 2BYVE 3SZTA 1K78A 3MC2A 3PGFA 3KP6A 1HKSA 3FZVA 2MBFA 1B5HA 3QIMA 4EUOA 1O57A 2OZZA 2NVUB 2GAUA 4JWYA 4KA4A 4ZEBA 3TMGA 2DS9A 1GXPA 3D4CA 3IL2A 1NKXA 4F39A 2H09A 4KR5A 3O2PE 4DZ1A 3WTWC 4PFUA 1GVJA 2IA2A 3T9HB 1H3DA 2YLNA 2OAZA 4G4PA 4Q48A 1YLFA 1XHYA 3KZYA 1QUKA 4G77A 2LAOA 3IKVA 5DD4A 1R1VA 3H03A 4OENA 1EZ9A 2EV0A 3VLWA 5CBRA 2F5DA 2XXRA 3RPWA 4NTLA 1LB9A 1HQCA 3ZMSA 2HZLA 3TDJA 3LSLA 4IPAA 1G3WA 5I2NB 5K1YA 3IL1B 3K69A 4M9SA 1XGOA 3ZPLA 3WE3A 4UV8A 3QAXA 4LFUA 3LQQA 2PN6A 4MEXF 1B46A 4YU0A 2FSWA 4OERA 5CLSA 1LAXA 2HKXA 3K6XA 1XS5A 4KT5C 5JFRA 3JV9A 3R7XA 4L18B 4FORA 3SERA 3T66A 4PFTA 2YJPA 3MUQA 2W24A 3F8NA 1XGSA 1E2XA 3KJTA 1PC3A 1YCJA 3KG2A 3M3FA 4AB6A 2E1CA 3EF7A 3CFZA 4CYDA 1SMYF 3CG3A 5E8GA 1WDNA 2QUFA 5CMMA 3U2RA 2W7YA 3V8LA 4KI0E 3U8QA 4I9DA 3WODF 3OENA 3KOTA 2DT5A 1NNTA 1AMFA 3NRVA 1H9TA 3OEMA 3LA7A 4TV7A 5F1RA 5D6FA 1IXGA 2QS4A 4RPNA 2KKOA 1U5TB 2Z5UA 5EYFA 2QWWA 5LHGA 5HLHA 1YW7A 2HFBA 1JW5A 4DE8A 3C3WA 1FBSA 1D5VA 1MJ9A 1GGGA 1ZKBA 2XX7A 1H43A 2XXPA 3OEKA 4Q47A 1ZIUA 5I59A 3ONMA 2GA1A 3BP8A 1AOVA 3K1NA 1IXIA 3O6IA 3IO6A 1GVCA 2XAHA 2STWA 4WEPA 4QHQA 1BI1A 2OU2A 4NEDA 2V3QA 1MPCA 1QKAA 5DCFA 3IKTA 4LG0A 4AIHA 4LQ5A 1EZOA 2OQGA 1WQ2A 4EJVA 2LF7A 3O6HA 3W9VA 2QL3A 1FQBA 1M5CA 4C1TA 3TO6A 2OZ6A 3R26A 3ISPA 3FJ7A 3ZQ7A 1CF7A 2J5PA 1B3GA 1OQGA 2D5WA 3IAZA 4K3FA 3F3XA 3CFXA 2EFQA 1LCFA 4HAMA 1S29A 3KLNA 4FE8A 1Y3NA 2O84X 4AIJA 3B6WA 4FX0A 2OLBA 4GRKA 3V7RA 3FMSA 1QNTA 3RKYA 3ZMUA 4ENNA 2PT1A 3PD8A 4S05A 4EJOA 2D2WA 3OV8A 5AE4A 1UTBA 1O7LA 3COAC 3M9AA 3PPPA 1SFXA 2JPCA 2RC8A 5J1DA 2KLFA 1FSHA 4LLNA 4N9HA 4L0YB 1I1SA 2VOPA 3KZGA 4TLMB 1CE2A 4ZEFA 2F5XA 3WTTC 5JK4A 3OSQA 3FV2A 4F1YA 2DLLA 2VE8A 4YKPA 1N0TA 5H20A 1XGMA 5FHOA 5JEIA 4KYWA 3TUSA 3JYRA 1UTHB 1J7KA 1JW1A 3HHFA 1MDQA 2XRNA 2D1HA 2A6HF 2NAZA 1TTYA 3RPUA 1SFUA 2CQKA 4L9NA 3SZPA 4H0EA 1Z91A 2DAOA 1B3HA 2Q89A 2PQ8A 1IF1A 2Q2CA 4LK1F 2DP8A 3MZ9A 3L7WA 1MQJA 2Y7WA 4OEVA 4NHJA 3H6WA 3THIA 2DW4A 5FHNA 4UXNA 4EM0B 4F2QA 5LGTA 1EH6A 1EZPA 3PPRA 1FQCA 4U0YA 5FLXK 4HF1A 2UVGA 3TPAA 3TO7A 2DE2A 1B9JA 3PMXA 5ICQA 3I58A 3IJOB 1POTA 1QJMA 5DCMA 4N07A 4F18A 1P1UA 1ZU0A 1UFMA 2RVCA 4X48A 4F2OA 1FBQA 1B7UA 2Y75A 2JTVA 3OO6A 3V7CA 1MDP1 4BHCA 3KEIA 5HPQA 4NWDA 2EJRA 5L8DA 5H8HB 3F8CA 1MY2A 4P9UA 4IJAA 4RY1A 3E97A 4Z7EA 4BDMA 1ZH5A 1DDNA 1Y1ZA 2DPUA 1Q35A 2Y7KA 3FD3A 3W9WA 1IN6A 4EDPA 1XN7A 3O66A 4NF6A 3QPTA 2DOJA 2HZKA 2OJTA 3ULQB 1URDA 4R8HA 2ZJ2A 1RUOA 2V1XA 2PEXA 3UN6A 3REOA 3OO7A 5DVFA 1R23A 2M45A 1GHCA 1ZAOA 4BAYA 3N4MA 3DXJF 5ED4A 3CO7C 2XAQA 3HO7A 5KCJA 4Z2YA 1DTGA 3IB1A 2VONA 1HSJA 2QJEA 2ZXTA 3E6MA 3H6UA 1SDXA 1PP7U 3NEUA 5I56A 5HS8A 4RK2A 1MH4A 3F6OA 4ECFA 3M8FA 3R0JA 3NQOA 3B7DA 4KN7X 3A3CA 2FQ3A 3O9PA 4IGRA 4Y13A 1UQWA 1RI7A 1R5GA 4A0YA 4OMYA 5AA2A 2HKOA 2R71A 1TLHB 4F3BA 1IITA 3D4GA 2VXZA 3BDDA 2RGVA 2DFIA 1FP1D 1XSVA 2Q0OA 2AL4A 1MS7A 3E4RA 1J0RA 4G7ZF 4QRZA 2ZNUA 3MZ1A 4D0PA 2V3TA 2XXQA 3DV8A 4RGUA 1SD3A 3A3UA 4QF9A 4U4XA 4RGXA 3FX3A 3K9TA 1LFGA 2CFXA 2IEEA 1T0KA 2P5KA 1TXFA 1ZLQA 4NB5A 2ZO4A 2F7CA 3CI8A 4KIGA 3IC7A 5DEXA 1R9LA 4KCDA 2XIGA 1S9TA 1FW0A 1O63A 4DXBA 5LHHA 1D4NA 4YB7A 4FX4A 1PDAA 3CTAA 5F7VA 2UXXA 1TQIA 3ZMVA 2Q2EA 1KU9A 2BEOA 5BQTA 3GX4X 2NXOA 3EHSA 2B65A 4L5JA 2RINA 4R1HA 4OIRF 4HDUA 2HEOA 2FNCA 1MXWA 1XSXA 2A5YB 2DQRA 2MH9A 4U2RA 4XIGQ 3HSRA 2J5OA 1MQDA 4NF4B 1U5TC 1W7PA 4G68B 2RCAA 4ETSA 1SW2A 1Z05A 3TEPA 3T9VA 1HKQA 3RDIA 5E1XA 5LBQA 3JSPA 1H44A 3ELKA 4ON0A 3I5OA 5LLQA 1YPNA 1TNTA 2ZFWA 3SDFA 2Z9OA 2MC3A 3LUYA 3T9UA 2Q8JA 5JR3A 3N97A 5DVIA 1ULYA 3M8EA 1FOKA 1Q1KA 1XT8A 3GEZA 1HSLA 2F5EA 3ZMDA 1TW3A 1LQ1A 5AIPA 1KGSA 4G8NA 2FA5A 4R6YA 1DP7P 2I0CA 4KNYA 1MXZA 2K86A 1H9GA 3K0VA 3I64A 1O7TA 4LLGF 1N7WA 3RUMA 1O3RA 4EJTA 4KFQA 5K2YA 1LSTA 5LRRA 2E0SA 2EA4A 2VBZA 1FQAA 3C34A 4NF8B 2L4MA 3M7GA 4U7DA 2ZYOA 1JHFA 3CSGA 3Q26A 3W6KB 4M6XA 1XOCA 4L9VA 4R79A 5L3GA 4FT8A 2F5FA 4ZZEA 1B52A 4RPOA 5ICEA 2FNPA 4LJZF 4QFKA 3SEVA 3F8FA 4Z0IA 2H6BA 2DPDA 1EU8A 4YKIA 5TPAB 3ZMZA 3PUVE 5LGUA 2R7DA 1R7JA 2F7AA 3O6BB 3KETA 3WU1B 2RV8A 2VODA 1FYLA 3E6DA 1B05A 5L3EA 3GUDA 1BIBA 4M74A 3SHFA 4CXFA 1B3EA 2KRFA 5KDTB 1TQMA 2DO7A 5FB2A 3T8TA 1Z1DA 2QZ8A 2P7VB 3L09A 3FWEA 4WXCA 5JVTA 1UIUA 2P8TA 5H8QB 1G3TA 3T0YA 3LQRA 4KYDA 3L2CA 1FYKA 4MH5A 2AS5F 2A5TB 1N3WA 3I3VA 4JBAA 3O6GA 5BMZA 3C32A 2V9VA 1M5BA 4QFLA 2P7CB 4LMYA 1I27A 5B70A 4HBLA 3RKWA 2H4IA 2Y7IA 3RIRA 2D3IA 2V3UA 3FVGA 4HQMA 1N76A 3MZBA 3MW0A 4YG2F 3HOSA 4F1UA 5DVJA 1OR7A 1FX7A 3WTZA 2DU9A 3RT6B 3T22A 2XVCA 3V7SA 3KCCA 2VD3A 2EA2A 2K27A 1XDSA 3LBSA 3U72A 1FY7A 4AIKA 5FO5A 1MZBA 4UVBA 1A7LA 4AWXB 2STTA 3DEUA 4B09A 3KSXA 3Q9VA 3G3KA 1L5TA 2AXLA 1UIVA 2F8DA 1ONVA 2Z8DA 4X9TA 3HHHA 3IOTA 4XKQA 4U88A 3IX1A 4HV6A 2QQ9A 3CIJA 1ZRDA 4BDRA 1MY4A 2ONRA 2MLKA 1YTVA 2V6CA 1SYIA 3ECHA 3TOBA 4AD9A 4R6KA 2B3BA 4KCCA 4A5MA 2XD3A 3RYRA 2TDXA 4F7ZA 3VVDA 3EDPA 3CUQA 1XSDA 3LSXA 2PX1A 5BUUA 3MBPA 2Z8FA 1V3FA 4A0ZA 4QLCU 3ECOA 4U7BA 3TZAA 3OO9A 1D3YA 3I53A 1QULA 4DCYA 3CLOA 4BQAA 2I3WA 2VBYA 2OD5A 5HDKA 2A61A 4R72A 1US4A 3L00A 3PV0E 3IHUA 2IW5A 2CO5A 3SEWA 2UYEA 4NMYA 2F6PA 3VEPA 3RTRA 1RKMA 4HF2A 1OVBA 2VGQA 3TQLA 3RQTA 5E1ZB 2FA7A 1B32A 1UHWA 3WE2A 3RTWB 4N6PA 2AYSA 1B6AA 2KIFA 4ZYEA 4HCWA 1E17A 5F64A 4TLLB 4A12A 5H8NA 3ZKLA 4MLQA 3S9MC 4DLDA 2A5SA 1IXSB 4TOZA 3K01A 2P2AA 1R58A 4RK9A 4UVCA 1MXXA 3ABUA 2REGA 1YG2A 4XKNA 1XMAA 5ISUA 2XGXA 1MH3A 3HSFA 1OLAA 3LSWA 3KP2A 2AIXA 2DK5A 4JWXA 3WTXC 4YMBA 1FTJA 4XBFA 5E18F 4I1DA 4ND9A 3VFZA 4G68C 2QBYA 1MG1A 5L3BA 4LD5A 3OELA 3KJ7A 3TDZC 2Z8EA 3WTSC 4E70A 3E9XA 3TDUC 3B6QA 5AA1A 3QRFF 3MJNA 5LOMA 3GBAA 1FYMA 3CO6C 4Y15A 4KQPA 2NWJA 5ILVA 1S7AA 3F8BA 4DXCA 1URGA 3FXUA 1ZARA 5CRYA 3UIFA 3E3KA 2EFWA 4GOTA 2WTEA 1SD6A 3C31A 3C4MA 5J6XA 1JW4A 5TP9B 2QMXA 3CSBA 1LNWA 1HBXG
chains in the Genus database with same CATH superfamily
2QA4I 1JEVA 5H8SA 4F3QA 1K61A 5M3FJ 1LBXA 4RB3C 3M1EA 3QPSA 2VOOA 3PUXE 1T6SA 4A3BJ 5HS9A 1INPA 1B3FA 2PBIA 1R9QA 3KP5A 2HTSA 2F4OB 3G73A 3ABKH 2V93A 1IRGA 1VTNC 3J81Z 2RQQA 4ELQA 2O1MA 2M0MA 4CZCA 3QSLA 1NH7A 3K4UA 3BR5A 2FMLA 1J1NA 3ZQCA 3RCOA 1NV5A 4ZEDA 2BV6A 2VQGA 3SEZA 1DSNA 4XICA 1Z9CA 1AHDP 4JBZA 5D4SA 2B63J 3HSEA 2DYXA 4OVRA 2M8EA 2QKLB 1IEJA 2UUZA 4HA8A 3RYPA 4UUSB 3E5UA 1SVOA 2O7OA 1V54H 2WA0A 1IG7A 5ICFA 2BJJX 2F3DA 5H6RA 3EN3A 3SESA 2HS5A 1IIWA 1R00A 5IP6A 3JREA 2HDCA 3TODA 2PT2A 1VF9A 4CDGA 2Q2AA 5AA4B 1K83J 2Z2SB 3EUAA 1J9IA 4PETA 1FQDA 2DFFA 2NS7A 3FJMA 3CP2A 2ZB9A 3GWZA 3R0AA 2CZLA 1ELJA 4AM3A 3VLVA 3HL2A 4QSCA 2RKHA 3VPRA 1B1HA 3F8MA 3IWZA 3PQJA 1U5TA 1GV2A 3UORA 4P47A 1IMFA 3BTJA 1MBKA 4MMPA 1MBEA 2RNJA 4R6HA 3IJXB 1R5HA 3KPHA 2O3FA 1ZG1A 3O29A 3V83A 3MPKA 3GTOJ 2QS2A 1BR2A 1IUYA 3PU5A 3OMBA 2JRTA 3HBLA 5I7IA 2VJIA 3M07A 1X3ZB 2KQZA 5D5XB 2MKZA 4YEJA 4IZZA 1MDMB 3DCFA 4L0ZB 1US5A 2RCBA 1LFIA 2VBXA 2L9VA 4EQQA 5JLWA 4GWOA 1H76A 2V9PA 3TTKA 2IBDA 3PD9A 3VFJA 5LFAA 2BY3A 3A0BC 2PMUA 2I0BA 4PGPA 4WKMA 3H3VK 2ESNA 3AG2H 2XXXA 2O7UA 1R22A 4IRIA 1JKRC 1IXRC 3KP3A 2ZFUA 4XLEA 2LOOA 4BE0A 2CW0F 2VOZA 2LY1A 5ILUA 1E0EA 3OL3A 4ZYHA 4QFPA 5H8FB 4FE4A 3HOUJ 2JMWA 3PNYA 2FHYA 4D5CA 4MTDA 1REPC 3H9GA 1TFAA 2XXTA 4ESXA 2DOFA 1I50J 2QM3A 4Q4ZF 2QQAA 1XMKA 5BS6A 3OSRA 2VPOA 2ETHA 1B0HA 4IO4A 4RA2A 3WGHA 2X48A 3QOPA 2QSHX 4BDQA 2F5VA 2R7QA 4IEJA 2O6GE 3CUOA 5JVGF 3K02A 4YICA 4HZFA 4HEA2 5CVJA 1KU2A 2FNAA 1PB7A 2X4HA 1YXIA 1VQ5I 1DTZA 1B4HA 1KZHA 2K9NA 4PJ0C 3G3HA 3HGYA 4OWDA 1BW5A 1JHHA 1HLVA 2RC7A 4OU0A 1RNLA 4A3KJ 4IKFA 3M4OJ 2B9SA 1B6HA 2WC2A 3HEFA 3S4UA 2IPQX 3BT9A 2HEUA 5L9OA 3HTUA 1MM6A 5ESYA 3KFWX 3OYMA 2VN2A 1OMPA 2LY2A 2ZKZA 4A0XA 3T8RA 1DOTA 2G93A 3O28A 5FRNA 5FHMA 2XPVA 5D4RA 1I6QA 3RT8A 3BIHA 4THIA 4Y17A 4B1RA 4KPTA 4R74A 4DZJA 2DQLA 3JTHA 3DP4A 3I71A 1RYXA 5FKNA 5GPCA 1P1QA 3L6GA 4Q8RA 2E19A 4BU2A 1JT0A 2VC0A 2XAUA 3B6TA 4B43A 2E2JJ 1RDYA 3EUHC 4O7MA 4AQ4A 2CW8A 1MKMA 4HW0A 2L7ZA 3EQLF 4ESJA 1ZGWA 2RKMA 4A3MJ 2W4SA 5E8IA 4ZJZA 2QENA 5HDNA 3PSFA 2IA4A 2L02A 5HDGA 2XX8A 4GL8A 4KHZE 2XGEA 2P6TA 2XWVA 5ICCA 1JKQC 4Y4RA 3M3LA 4JP0A 4FEBA 3K1MA 2LKPA 3RN8A 5LDZA 2JJ7A 2GRVA 1FOWA 5HLGA 2EWNA 4EGZA 4LG0B 3GFMA 3GZ6A 1YJWI 2CGPA 1SVLA 4PK4A 1NUWA 1Y0NA 4A3IJ 1EYIA 2E1SA 2OA4A 3QUFA 2DMTA 1M1EB 1WHUA 4BH9A 1J59A 1HKTA 4JX4A 3KZZA 3W6JB 1TWHJ 3BQZA 4E6KG 1U0JA 1TW2A 2VLAA 4E7HA 4QFNA 5CVIA 1DPRA 3B8BA 2FE3A 1JUSA 3QP5A 2HYFA 2X85A 5HOOA 4H8JA 3RNNA 1R4MB 2QYOA 2ZC2A 3QOEA 3H1CA 1WRJA 3OIOA 5C3EJ 2KR0A 1B0LA 1S6LA 2CS3A 3CC4I 5D8LB 2XF7A 1BI3A 3UK4A 1Q1HA 2IGOA 3VWBA 3KEYA 1B3LA 4F19A 1KQ9A 2ELKA 4ZYAA 2D21A 1R6RA 4OESA 4MQ9F 2PCRA 1WPKA 3N6TA 2P81A 1S8NA 5CYVA 3PJRA 1D1BA 5F1QA 3RKXA 3J80K 3KE2A 4AU7A 2L54A 3MVYA 3TOAA 4C30A 3S3OA 1TBXA 1L3LA 1D8JA 4A3EJ 1C0WA 2W7NA 1RUNA 4G6QA 1OIBA 1P1NA 2B4MA 4EQ7A 2QMWA 2XAJA 4UVAA 3EETA 4Q5SF 3FVKA 4G9YA 5J16A 3FF5A 1OLCA 1LKXA 1M5DA 2VE9A 1SD5A 1FC3A 2YSRA 1UTBB 5H8HA 3O8GA 3FXQA 2IS6A 2BGCA 4BHPA 2MGQA 1EA3A 4EJWA 4RAGA 1JQFA 1YO5C 4ANJA 4CH7A 5LEKA 1DGWY 4RGSA 3LV0A 1MJAA 3OL4A 1BLFA 4OIOF 1SQYA 4FISA 2FYIA 2ZNTA 1JT6A 2M0CA 5L3CA 1TQPA 1IMDA 1OYWA 3TQWA 1SMTA 4LZ7A 4ZE9A 4NF5B 3KP7A 4KYSA 4YB6A 1T33A 5ELVA 4KUMA 4DNCA 4BDOA 3TYHA 2GOXB 5JTYB 2CMPA 2XWKA 2DCEA 2NS0A 3RY3A 4YELA 5B66C 3OOPA 4RBOA 5JI6A 2C6YA 4N17A 3G1LA 5ICGA 3LSHA 4ENKA 3SDBA 2F78A 3JAMZ 3F11A 3C18A 3FJGA 2E1NA 4PGHA 3TEDA 2PG4A 4IGTA 1B59A 1QGPA 3KYLA 1K9ZA 3RQIA 1L0OC 3V8XB 4G2ZA 2F4MB 3JTGA 4GQOA 1J5YA 2P1SA 2KJBA 4UB8C 4G8MA 3CJNA 4GF8A 5CVUA 2JSCA 5EHSA 2UXAA 2O7IA 5AA3A 2Q74A 1GR2A 5I57B 3ERED 2M5WA 2VC1A 4F3SA 4BEHA 4IQJA 4P11A 4M6YA 2XB0X 1QZYA 4XM3A 2V7FA 4C2MJ 3BJAA 3T93B 2WX9A 3LSRA 2R0QC 2EV6A 1S3JA 1M5FA 1HF0A 5J8CA 3HPIA 5EG0B 2EZKA 1NNKA 3HOTA 1S72I 1FPDA 5FD5A 4RA1A 2RC9A 3U94A 4RNSA 2LVSA 2TRTA 3GVAA 4JWOA 1IGNA 1Y0UA 1QA6A 1HSTA 4BXXJ 1LBYA 3K4BA 1XVYA 3RZOJ 1Y3PA 5K5QA 3GO5A 2CV2A 3ZP5A 4NAPA 1XMXA 2HI3A 2YPRA 5HNFA 3DP7A 5D5VB 4QSHA 1NG6A 1VQ4I 4KDPA 9ANTA 4HQEA 1FPIA 2DWJA 2FBIA 2ZNYA 1SC7A 1AWCA 4CSWA 4PE3A 4U1OA 3TCGA 3PO2J 2E1MC 3BG5A 1FEXA 3H35A 4JX6A 3RI4A 3NWTA 5A5XA 3K2ZA 3G3FA 5EHMA 3DM0A 5M2VA 1FLIA 1NTCA 3ZN0A 1HOMA 1GTKA 1ON1A 1TNSA 5LEJA 2I6EA 1LUJB 1Y39A 5D6EA 5K5RA 2NRAC 4NE4A 3GTMJ 3HTSB 1ZG3A 2W84A 2XXWA 5M5YJ 3OS0A 2BXZA 3KSJA 5GP9A 1B5IA 3FIRA 5FTIA 1J75A 1SD4A 1LE8A 1B40A 4I40A 5I58B 4FASD 2GM4A 1FP2A 5DYHA 1UHMA 1ZMGA 1A40A 3BPXA 4F31B 4N8GA 4GGGA 4XSXF 3JRAA 1RIOH 2DBBA 2KIQA 4DIQA 4GYIA 2QGUA 3H9JA 4A3FJ 2XXVA 4BXFA 3K70C 1DK4A 4NQWA 3A09A 3WAFA 1P99A 3CMAI 1OVTA 5IAIA 3EYYA 1O7FA 3LSMA 1G6NA 2EFNA 4CA0A 2R7FA 1F5TA 2JUCA 3DPTA 2DVZA 2HXWA 1WWXA 1TL8A 4NF4A 3I59B 1YW9A 2HZDA 5TJJA 1DPPA 4G68A 1D8KA 4W1UA 3VYUB 3CMYA 1PBPA 1R1NA 1Y20A 3S9NC 5C4JJ 2BZTA 2XXYA 3E79A 2GIZA 1F9BA 3WTYC 1EJ9A 2OX3A 3T0JA 1W4MA 3JW4A 1SW4A 4Q30B 2CZHA 3VYTB 1FTTA 1JVXA 3EUKL 4OANA 5FLXZ 1USSA 1MMNA 4RB0A 3I4PA 3GTKJ 4B3AA 2OUMA 2HQNA 1B9MA 2CG4A 3CVGA 2P6SA 4C0RA 2DOAA 4JVDA 5CC2A 2GA2A 4MGRA 3S2VA 1IXCA 5L3FA 5FROA 1IO2A 1HW5A 4OVQA 2K7LA 1OLTA 1Y4TA 2CJJA 5DDGA 1D9QA 2H98A 5L3DA 4X1DA 4YMAA 1MSFC 2O5RA 3S9LC 1R1TA 2P3NA 4OTEA 2DXYA 2VHAA 4LONB 3O97A 2LH9A 4JOMA 5F1JA 3O2AA 3OYDA 1N77A 4MNPA 3BC8A 2MLGA 4NC7A 3N26A 1SEUA 4ZE8A 3IH3A 1MXVA 5T3JA 3FISA 5LTCA 1YHQI 5AA2D 4II3A 1P4WA 1AWBA 1NK3P 2HU9A 5I2KB 5EF6A 4A5NA 1U6GA 3S8PA 4NF8A 1NUXA 1Z7ME 1LDKB 3DKWA 4I7HA 4II2A 2UWMA 4GXAA 4U21A 3PIPF 1G8XA 1USTA 3LA2A 4N0BA 3BIGA 3DP6A 4MEYF 3HV1A 3AL0B 1JNFA 3GLBA 5FKLA 3ABTA 3U9GA 3L1PA 3L9FA 4BXUA 1ZBMA 1OMIA 4IRGA 2R5YB 1LJ9A 3MVPA 2ANJA 2Z23A 5B7DA 2XX9A 3VXCA 1YYZA 5J3LA 3H6TA 4MTEA 4BNCA 4HCYA 3QP6A 4EJUA 3OYEA 2Q2EB 2HDWA 1DUXC 1U3EM 4I3EA 5EEGA 3DBRB 2FOWA 3DWLE 1I6BA 4IO6A 3FMRA 3ECRA 4IY6A 4MBPA 3BJOA 3OYJA 2DMPA 3WGGA 4UNOA 4KFCA 5TPAA 1KYZA 2D5VA 4O3BA 5E20A 1LAGE 2I48A 1ZLKA 5F0FA 4FBPA 3CCVI 1CB6A 3KYCB 2NYXA 4LK0F 5D8KB 1FTMA 4PZJA 1T39A 5IT3A 1YRNA 3VSKA 2F5CA 2XXIA 3TELA 2XHKA 2YX4A 2BBYA 4H5GA 3S93A 2RF1A 1ETOA 1SW1A 3GYYA 3FHZA 5KDTA 1TWYA 3PM1A 3PPOA 2Z99A 4DQ2A 1DPUA 4XKVA 4PCDA 2VT3A 3CF2A 2DMQA 3K6UA 1FZPB 4RJZA 4GFRA 1WJAA 1A31A 2YU9J 5FFXA 1XC1A 4LVQA 4M4GA 4M73A 1HW2A 2DI3A 1ZN2A 3FIWA 3PNTA 1I6XA 2IGKA 1O64A 1XB4A 3OD7A 4XEQA 3G3IA 4XQFA 4HLYA 3CG1A 3DLNA 1W7PD 5IOZA 4ESWA 2A5TA 3MCZA 2Q8MA 1TWAJ 5F0HA 1MMDA 2IRFG 1MBFA 3LAJA 2ZXHA 1P1OA 1FBEA 1QPMA 4ELPA 2RDPA 4E7KA 1D9VA 5L9MA 1G0HA 3SEYA 2R6GE 3RPLA 4R2FA 1NV4A 3H3UA 3CCLI 2XHDA 3WHBA 4LZ8A 4OEUA 2L7KA 3DFGA 1FJ6A 1S9HA 3U1OA 2BE5F 1YIOA 1X1CA 3IORA 1W36D 1ENHA 1MNDA 4ELRA 2FU4A 1W1WE 2LLKA 1SBPA 4YB5A 4OFOA 3AFHA 1A6QA 5DM7F 3EPEA 1X1AA 2H94A 1WSUA 3LSFB 5ITPA 4JSOA 2VQHA 3L2RA 4MIMA 2Z33A 4AS5A 3OYKA 2KISA 3JRDA 1Y3QA 2L3DA 5EYGA 1AKHA 1NV1A 3H4ZA 3S2HJ 2ME6A 3BKIB 2EINH 4JX5A 3A02A 3VDXA 3WTUC 3SQNA 1X1BA 2HDDA 1I5ZA 2LC2A 3QPLA 1G2HA 1FQFA 1BBYA 1IRZA 2A68F 2QRYA 4PQJA 3DF8A 1X4PA 1Z77A 4D7NA 3IUOA 2R92J 2PYYA 2NS8A 3GFLA 3JRHA 3H5RA 1RZ4A 2ADUA 4ASNA 3GMEA 3AKZA 1ZR4A 5FRMA 1MRPA 5ET6A 2XDVA 5IZ3B 2E35A 2QS1A 1N25A 3FBIB 4PJJA 3H5AA 2IP2A 3PUFA 4GVOA 4E7JA 3SEQA 5DUIA 2LNBA 5E79C 4DXUA 1YTYA 3CFLA 1RR8C 1A8FA 3OO8A 1JUPA 4JVIA 5A2QK 4H8IA 2M8CA 1MBJA 3RLFE 4XLPF 2GFEA 4AIDA 5B3SH 3H0DA 3VB2A 1B72B 3Q27A 3JRFA 1XC5A 2EV5A 2E7WA 3HDDA 3H5NA 2IA0A 2X6XA 5E1WA 2XPUA 3K4KA 2MSYA 3EUHA 4A2UA 4DGWB 4IHTA 2EFOA 2CMOA 4MEVA 5CM6A 3T1BA 1MPDA 3GZGA 1Y4CA 5DYMA 1YS6A 4WWCA 1IAWA 4IO2A 3BBRA 3MVZA 1OQHA 2AQFA 3MSTA 4CICA 2FF4A 2RN7A 3P7IA 4EATA 1UCRA 5IM2A 4E7SA 4MFIA 4EGYA 4BJ5C 2ZCWA 3BZ6A 4PJNA 3TKYA 3DP8A 2VD2A 2LFBA 1ZRCA 4YZZA 4LUBA 1KU7A 4PDKA 4DCXA 2A3SA 2BW3B 4WXHA 4HX4A 5J40A 3K2DA 2UXNA 1D9YA 3ZSFA 4ZECA 2DA6A 3DPLC 1ETWA 2F35A 3RGYA 1WI9A 3ZGKA 1R6ZA 4H0WA 5J1YA 2V1UA 2F4IA 4BY7J 2CEXA 2Y0MA 4AYBA 2DQVA 2JT1A 1B51A 3PMWA 2VT5A 4F1VA 2V79A 4F93B 3GLXA 1U8BA 1BJAA 4WXDA 4ONYA 4FATA 1HSEA 1TWGJ 2VJ5A 1ZG5A 2IJLA 4BL0B 3VOEA 3PFYA 4I6ZA 2K40A 3C33A 1ATGA 4CYCB 2EK5A 1GDTA 4XORA 3RSNA 3LSPA 1EH3A 1Z21A 2ZJQF 3V8JA 5CVRA 4IHVA 1I69A 4L9JA 1AOYA 3VDFA 3P9KA 1Y1WJ 2XAGA 2M4GA 1F36A 4OFLA 2LBFB 2HYGD 2R7UA 5KCMA 1MQHA 2XD2A 1U78A 4KD5A 4EM1A 4XIGQ 4GWWA 4BQQA 1NI9A 2UYFA 1WI3A 4KISA 2EZIA 3G3ZA 4F91B 3AAFA 3KEOA 1YOVB 3O8HA 1A35A 3FXKA 1B8IB 3K6VA 4C2TA 3I55I 4GL0A 3BG3A 1Y6IA 3IO4A 2CUFA 1BJZA 3HUGB 1A99A 3C1DA 5AIQA 3JSOA 2KPMA 1D3KA 2HR3A 1ZTYA 1OYYA 4FE7A 5IYBJ 5IY5H 1P4AA 3DLLF 3OS2A 2GXBA 1YAEA 2EILH 1CGPA 1QBJA 3L2WA 1FOXA 4CO8A 1II5A 4GFBA 2F7BA 4M1VA 3QMFA 4G7HF 4A6DA 1T98A 2JSPA 2WB1A 5EQ8A 4M9XA 4XRSG 4P5OA 3U93A 1ETKA 1NV3A 4MFDA 2Y7PA 2A69F 2KFDA 5DT6A 2IVMA 3W15C 2PFBA 1VNDA 3D1NI 2R5ZA 1QVSA 1ERDA 3Q29A 1BL0A 5DUKA 5DTDA 3H3GA 2R3SA 4JYKA 2ZMEB 5KVRA 5IOYA 2L9NA 2O69A 4H67A 4PJLA 3V89B 2JRMA 1ACIA 4TQUQ 4P1WA 3DKYA 1S7OA 3LSTA 4ZTFA 4PDDA 1R36A 2OBPA 2CQNA 1APLC 1VSOA 2MD5A 3CUQB 4CHUA 4RAFA 3Q28A 5EQAA 2GLOA 2GWRA 2X7QA 2E71A 4H1XA 1GXQA 4A69C 3OYBA 2R8TA 4GLIA 2HOEA 3Q9SA 4I09A 1BIAA 2FRHA 4GXSB 2PMSA 4RYAA 1POY1 5F08A 1R1UA 1FBFA 4OVPA 1FNNA 2HOSA 3PNVA 2ZBKA 3WGIA 4ZC3A 3FV1A 3S16J 3ASNH 3M8JA 3FMQA 5CMKA 4XLAA 4EM2A 4LA9A 3MN2A 4PFBA 1ETQA 3TTMA 4FAJA 3F6VA 2XAFA 2W85A 2WYKA 4DI4B 1Z0XA 3BR2A 2F6CA 1O3SA 1O3TA 4D7MA 1IQ7A 1OCPA 3A01A 2WY8Q 3Q0UA 5DS9A 4U1ZA 4OMBA 1LVAA 2M87A 2HYJA 4DBRA 1KYWA 2KIUA 4I0AA 3EKIA 5TP9A 4DDDA 4XN0A 4XTCQ 3K4JA 3R61A 1YQAA 2PJRA 1QUIA 4ZDPA 2JWTA 4DJAA 4XSZF 3ODBA 3OR2C 1BKAA 1LDJA 4IF4A 1B7HA 5IT9Z 5IYDJ 1B2HA 3CCJI 4ENJA 5I2NA 3I54A 2XV4S 1JETA 1U2WA 2G7UA 1RKWA 2D45A 2HAVA 1PB9A 4P0GA 4NN3A 4CCOA 2P5VA 2PMZN 4P55A 5J47A 4BLAA 1FBHA 4XFEA 4L5IA 4KIBA 4XRMA 3BJ6A 2XKPA 3R4KA 1MPBA 2AL5A 4FQGA 3K0LA 4UUSA 4PFRA 5LGNA 4BHBA 1X2MA 5KAFC 2JA5J 4LITA 2G29A 1N04A 4UUTA 1MM7A 1LB2A 3FUZA 3B73A 2W00A 2YX7A 3H6VA 1H89C 4R9GA 1ZLJA 3G1OA 5AA4A 3SEXA 3CD6I 4ZZDA 1JTYA 4LIUA 1W5TA 2QBYB 2G7HA 2M7BA 2H5YA 4FTHA 3LSJA 2DDAA 2NOJB 1Y9UA 4MHFA 4LB6B 2UVIA 1LCTA 4I8CA 3BPVA 5B5EC 5C44J 3M3YJ 4GD5A 5F24A 1K78B 2ONSA 1BR4A 2CYYA 2M34A 5F27A 4DBQA 2E5NA 2M30A 4PFPA 3J7AO 1TFDA 4X1EA 1IW7F 5TRDA 2O0YA 2WV1A 4N15A 2QVOA 2B0LA 1SI1A 1OKRA 1JTXA 3VXBA 5KK1A 1OCRH 4POXA 3CC2I 3HYIA 1QPIA 3S2WA 1URSA 3HN0A 1LEAA 1MDMA 5HM4B 1FTOA 2AO9A 3S1NJ 2Z22A 2NVQJ 3VV5A 1TT5B 3KP4A 1N84A 3K1PA 4G8XA 4FEDA 2LD5A 4HPQA 1A8EA 1TC3C 2WKYA 2HZTA 3HCQA 4JSDA 1VQOI 3L2VA 3HG9A 4A93J 3IV5A 1POGA 5HBCA 5JHUA 2GH9A 5FTHA 4G8HA 4L5EA 1S5LC 2VIXA 3K4MA 5KZTA 2KIMA 1K6OA 1P7JA 3IWFA 2JPBA 3HZJA 1VI0A 2R9JA 4EXKA 3DU5A 5H8FA 4EV0A 4Q0CA 5FJ8J 4YKJA 5IZZA 1SVXB 2JVHA 2RREA 1NV7A 4BKXA 4AYBN 4HYEA 1FT9A 2E34A 1MNEA 4GIZA 4ENMA 3GXOA 2GXGA 2JK3A 4GWYA 4M71A 4HF0A 2QLZA 3T5XA 4YIFA 3GYHX 2ICWG 4LB5A 3CDHA 2W48A 4I0BA 1BOBA 1PUEE 5CMCA 4MNUA 3PUBA 3GTLJ 2VKDA 2DWIA 1LDDA 2ABHA 1HCRA 2GHBA 1Z7LA 4PF8A 3NARA 4RB1A 1FBDA 3LSIA 4M9ZA 1GT0C 3U92A 4IR8A 3LWFA 1NG7A 3B02A 3HOZJ 4LN5A 1I6AA 2QS3A 2VPLA 3OXNA 4I01A 1SW5A 2E60A 3LFUA 5EZHA 4IHYA 1IV6A 1AH5A 3PTYA 3IB2A 2PJPA 3A0HC 2YS9A 2DK8A 2X6WA 3HGGA 1WJBA 4IOCF 2B3FA 1JP4A 5FFZA 2B7EA 3WG9A 2UZKA 4OXVA 2H99A 2ESHA 1BC8C 5EEAA 2EB7A 3MAMA 2ONKE 4RAYA 2LREA 4HG2A 2ZXJA 4G94A 2WB1N 4P9FA 2ZYMA 2W1OA 1NV2A 4RLQA 3KC1A 4LQ2A 3K4NA 1MIJA 1G3SA 4I02A 1WVJA 5HLIA 4XRFA 4KIFA 5KHDA 3JAMK 2F34A 4R75A 5F04A 3KN8A 4HS7A 3ZCOA 2L0KA 4UV9A 4XLFA 1G3YA 3FM5A 2E7XA 2DODA 2XB5A 2HXRA 3RPQA 4QSEA 2B4LA 4RAZA 3BROA 3F22A 4QSDA 4B47A 3KN7A 1UB9A 3GTGJ 2BY1A 1YW8A 2XASA 4POWA 3W6VA 2CQ7A 1ETYA 1WJFA 1EYKA 4X04A 3KLOA 3ROUA 2I4BA 1KA0A 2XXKA 4M3EA 1DMBA 1FSEA 3LA3A 4XN3A 3WTVC 1UTHA 1LBBA 1GLNA 5I59B 3FM3A 4P1LA 2KJCA 3IB0A 4O5VA 3OOAA 3BCAA 1A5JA 4IVNA 4M6VA 3GFJA 3LR1A 4ZH4F 2DFEA 2X51A 4G7OF 3P9CA 2Q9TA 4LATA 1ZYRF 1TZLA 3Q0VA 4EMSA 1IN4A 4I98B 1EF4A 3G2BA 1FCKA 1PBQA 2DSFA 1LLSA 2QPQA 4DYCA 1SI0A 1B4AA 1VDWA 2M4KA 1ODDA 2DJIA 5LHIA 2KDOA 4HE2A 4F29A 2DYSH 2PFZA 1VFDA 3QXMA 1P92A 2K5CA 3HRMA 3FXRA 3OY9A 4IHSA 2G9WA 2LF8A 2HQAA 2P0SA 4FECA 2Y9YA 1LFHA 1WKMA 1OFCX 2NVXJ 4PBQA 1CF7B 4HX8A 1VQMI 4IO5A 3M1CA 1AIVA 2E5ZA 3SETA 5EYRA 2FBKA 5BOXA 4PE5B 3I0TA 2PMHA 2ZNSA 2R7XA 5DTBA 2DVCA 1FBGA 1PUFB 1PEBA 3PL8A 1SAXA 1Y1MA 3PMVA 1LBZA 4NF5A 2DOEA 4IRHA 3QU6A 1WCMJ 2IS1A 4PAIA 3MVWA 1RETA 4QWQA 3P7NA 5JTYA 3LFKA 4RB2C 4QXDA 1JXSA 4HOBA 4OOIA 2BOLA 1K7AA 1G4DA 5ICTA 3F72A 3N94A 4O7IA 2R4GA 4XNFA 4YIIA 4YRVA 1LAFE 3CJQB 4O3MA 2F2EA 2L5QA 2ZMEC 2LG4A 2W25A 1NNPA 5DM6F 5HODA 3BR6A 4H45A 3UA8A 4Q5TA 4IO7A 5CJ9A 3QU3A 2H9BA 4DIGA 3FVNA 1DQUA 5DV5A 2V9KA 3OIQA 2UVHA 5CQGA 2A6EF 3MD2A 5F6FA 3CUQC 4EF2A 3MP8A 5I57A 4V2FA 2A5WA 4P56A 4RM2A 2YPNA 4A3GJ 4BDNA 3IOUA 2HCAA 2HOTA 3M8UA 2KZGA 4X1BA 4M3FA 3HC7A 5ILSA 2L9RA 4A6EA 5EG0A 3ILUB 1QKBA 1USYH 1BW6A 3IAS2 2PI0A 2CSOA 5EJCA 3TFLA 5H6QA 1V4RA 2HFHA 3K00A 1T08B 4ZDMA 3VE1B 1Z7UA 4RS8A 2IT0A 2Z3YA 5BPDA 1BTJA 1P2FA 4J00A 4UA8A 5CMBA 3VLUA 1FJLA 1WJ5A 2O03A 4OQOA 5IKBA 2DT6A 2OZUA 1LBCA 3S14J 2ISZA 3KOSA 3GBBA 1Z7NE 1HDPA 5AONA 4K2EA 4F52A 1B4ZA 3F23A 3G7WA 2VPNA 3S9EA 2MW8A 4QPOA 1IMEA 1JE8A 4NF0A 4PP0A 2ISYA 3HXLA 4IXAA 1NL5A 1NUZA 2QKMB 3HJEA 3ASOH 4N8YA 2NOOA 3FATA 3W3CA 4R9FA 3DU6A 3GW2A 3ZN1A 3BWGA 4PJMA 3VYSB 2FOKA 1LAHE 2GHAA 3PIOF 4BDLA 4IY5A 1P9QC 2CQQA 4UUVA 2NUVA 4E4HA 3OIPA 4YFKF 5C4XJ 2FBPA 3ZS6A 2LMDA 3S1QJ 1XTAA 4GO1A 4R2BA 1T0KA 4F3GA 3CCMI 2P3VA 1ZGJA 2EIMH 2X1EA 3FXBA 4F3PA 4V2GA 3A03A 1YS7A 2ZJPF 1VFEA 5I58A 1UHSA 1OQYA 5M3MJ 3I56I 2CUEA 3E6BA 3PSIA 1T0FA 5DCMB 3QK6A 2Y5LA 4U22A 1B7ZA 1F4KA 2A05A 3H06B 4Y3OA 1A54A 2DXRA 1T95A 1Z3XA 3P5JA 1IXHA 4PTKA 2R7TA 1NNFA 3LUZA 2ID3A 1PYVA 4MO7A 3PUYE 4F22A 3I9V2 3GTPJ 1XS9A 3ZQFA 3PUWE 4NC6A 4OFJA 1WJCA 3ZQIA 2R7RA 1DPEA 3BOQA 4IQ4A 1FBUA 4N9IA 4UHTA 4ZYDA 2H8RA 4ZZLA 4XLCA 4BGDA 4U4SA 1H45A 2NOGA 2Q8KA 3MZHA 3GZ5A 2FQ4A 3GTQJ 3I59A 1BM9A 1K79A 3S15J 1ETVA 1HXDA 2HVSA 2HGCA 2BJIA 3UGWA 1XDUA 4HX7A 3IRQA 3MAJA 1KWHA 2VP1A 4NF6B 1A55A 3USDA 1XCVA 3MP1A 5J8FA 3MFKA 1Z6TA 2OWSA 2ACJA 1OPCA 2DTRA 4ZDOA 4YFXF 2KRCA 3C7JA 5J4VA 2DA5A 2BVLA 3BTLA 2HQRA 3R60A 1O3QA 2PVUA 3N6UA 1YX3A 2I8DA 3QYEA 4JB7A 1ANFA 3EQ1A 1MBGA 5EEHA 4O3AA 4RGRA 4BBSJ 3SKPA 1IRFA 1JKPC 2EFPA 1U8RA 5D5WB 1LB8A 2WV0A 5ET7A 4Y7NJ 2ZXIA 2KL4A 3J80Z 1B9NA 2H8WA 4IOAF 1FPFA 2E2HJ 1MXYA 4ESFA 5KCJB 2CH0A 2Y48A 2ZNZA 3C36A 1TT1A 3D5RC 5DD8A 1STZA 1ZJLA 3E6CC 5HS7A 4HNTA 3VVEA 2I58A 1Y8QB 3RTFB 3OYFA 5A5XB 3WU2C 1N78A 3V4GA 5I3SA 4MF3A 4JVCA 5I56B 1HW1A 2FMYA 4N91A 3IR1A 1MW7A 3DLAA 5I84A 3BR0A 2KP6A 3DQVC 2OCUA 4OVSA 2K4BA 1T2KA 4KMUX 2GQ1A 4RDUA 4GXOA 4MQVA 4IO9F 1KQ0A 5GAGJ 1D1CA 2GZWA 4FHTA 3OS1A 2D1VA 2O1LA 4YKKA 3V5AA 2I49A 2ECCA 2L01A 5I2KA 5K7HA 4WX9A 4R73A 5AA2B 1XD7A 4KICA 3T96B 3QQAA 2FJ1A 2KQRA 3FKJA 5IPAA 4FJPA 4RXLA 3G71I 2P5LC 2BHZA 1S7YA 1BA5A 4EQBA 1PJRA 3CCUI 4MIJA 2LDUA 1XCBA 1JVYA 1DU6A 5D5UB 2FEZA 4L9TA 1BR1A 1OYIA 1H0MA 1X2NA 2Y7RA 3GXAA 2EH3A 3Q3SA 2M1BA 3HRTA 1BP5A 1EYJA 1MD0A 2X0LA 3DTEA 4JXIA 3FKIJ 1QUJA 3FVOA 2O68A 4PUSA 4P8BA 2ZYKA 3SZGA 4O8MA 5K2XA 1GV8A 1ZGAA 2CUJA 2QSXA 1QO0D 3C2GA 4GCVA 3TBIA 2Y69H 3W2AA 4X0GA 2IXSA 4IO3A 4EF1A 2MABA 3BQYA 2HQ0A 4KMFA 3B6CA 3GZNB 1F1ZA 1QZZA 1USYE 1BI0A 5DEXB 4ZS9A 3QYTA 2NNNA 1FWZA 1MY1A 4N13A 3PPQA 4ZYGA 3WU0A 1NFTA 2X7PA 4XLNF 2VT2A 4LG3A 2CW7A 1SFKA 4G6DA 1R49A 2BY0A 2HPMA 3TAJA 2VQCA 3U1DA 2CWEA 3C2BA 3M3KA 3EPZA 2OCEA 1MGTA 3LMMA 3PUZE 3L6HA 2E36A 4WK8F 5BWJA 2I3VA 4H5FA 5H2FC 1DGRM 3TW7A 2H6CA 3E13X 2ALUA 4YFNF 4OHNA 3R6SA 1YFHA 3TCFA 3T9XB 2O61A 2XKOA 2EIJH 2GIVA 4C1UA 2M8GX 4AC0A 4B4CA 3KBRA 4CCJA 4NWCA 1W7PB 1RR7A 3VSLA 2EZHA 4PAKA 1WJEA 4PCQA 1XVXA 2PBWA 1EH8A 4ELOA 1FTAA 3MP6A 4B48A 5LRSA 3PPNA 1I39A 3KX2A 1LEBA 3G3GA 4PFWA 2L4AA 2ZJRF 3CCRI 2CV1A 4E7ZA 3B50A 3KFMA 2TCTA 3HM5A 3S32A 1BI2A 4DYQA 3BFTA 1DU0A 3MQ9A 3Q5FA 1NMUA 4AUXA 3SEUA 5H8QA 2FBHA 4HDVA 1FOYA 3C9HA 3MWMA 3LSGA 4S0HB 1FPGA 3CR9A 1QQIA 4MHGA 5K5OA 1X3UA 4MNCA 2O6AA 3FGSA 1I6HJ 3ZR8X 4I99C 4FCYA 3BG9A 5ERIA 4CZZA 5ET5A 2VBWA 1MY3A 1A04A 4F92B 4D1QA 4BYYA 2I4CA 1PB8A 4UACA 1V5GA 1ZREA 1SFEA 1ZK8A 3BCBA 4IHXA 1P4XA 3FASA 4JDFA 4NG7A 1I1GA 4N4OB 3BY6A 3WHCA 4GYGA 4KITB 1PVEA 3EYIA 3TO9A 1AL3A 1FPQA 4HNVA 3EHUA 1WGXA 1ZHFA 2FXAA 2X1CA 3OMYA 2OQRA 3FXMA 3I5UA 1N3XA 2H27A 4BS9A 1JGSA 5M5WJ 1IC8A 3LC8A 1NHAA 4H6DA 4OZ9A 1YX5A 1MXUA 3MEXA 2R7SA 1Z67A 2XF5A 4NUBA 2MFZA 4GDFA 1VQ6I 3O3KA 3L2QA 3MKWB 4JQFA 2ZYNA 4DOZA 4P0IA 2OJED 4OINF 1WVRA 3V8KA 2QQ8A 3KEQA 1MQGA 3IK6B 3KIOA 4XKPA 1EH7A 4EQ9A 4PSXA 1LGBC 3HRSA 4YAHX 1XGNA 2MH2A 4MLOA 1JEUA 3IOWA 3VODA 3MWBA 2OWTA 2A07F 1YYVA 3TW6A 5I5PA 3TGNA 1YIJI 4ZEIA 3EHTA 3ZKKA 2WEFA 1FTLA 3OWTA 2V6EA 4EXLA 4BQOA 1WH5A 2K02A 3DELB 3D5SC 4MLVA 1CNQA 4BJTA 2AXTC 4QPQA 4C2UA 3HHGA 4M72A 3TCHA 2BW3A 2M7AA 3IOVA 4OYVA 2Z1DA 4BY1J 2X26A 4IB2A 4OVJA 4IL6C 1MNMC 2F6GA 4UY8I 5HVQC 3MPLA 3QUJA 2DWAA 4HNUA 3UP9A 2Q88A 1R4NB 1SPIA 3ML6A 2PFYA 1F9NA 2QQBA 2OCCH 4HLXA 3ILTB 1WZ2A 3CRBA 4LP2B 3PFIA 4OIPF 2LSOA 3C2HA 1ZRFA 4NX1A 2K3FA 1IN5A 3WG7H 1QW0A 1M5EA 1JGGA 3E7LA 3H3ZA 4FIMA 4RLFA 4UB6C 3GFIA 3S1MJ 2DMUA 3CJTB 2OTJI 4O6JA 2HAUA 2VKEA 4B8XA 2RC4A 3KZIC 2LBFA 1N7XA 1NV6A 4LZ5A 2V84A 3HRUA 4JK1X 3RJPA 2Y84A 2DE4A 1IZ1A 4M3GA 2F36A 3K6WA 2P4WA 4CGZA 3N5LA 1B8IA 4OIQF 4XMYA 3KN3A 4XOPA 3E5QA 3F21A 1ZKGA 1I3AA 3HKZA 3F0CA 3HUGA 1IMCA 1P1WA 3H7MA 1J2XA 5E17F 3QPHA 5IT9K 4OMZA 4L17A 3TMOA 4AB5A 3MQ0A 3MVXA 3ZMTA 1WODA 2XXHA 2DA3A 1Z6RA 3LAPA 1G0IA 1S50A 3P9IA 2JA6J 3OYAA 2O8XA 3CMEI 3H92A 3HOYJ 1IN8A 2XROA 1KA8A 2GOMA 1LBWA 2KRHA 3ERMA 4EVIA 3Q25A 4WXJA 2GQQA 3IH4A 3SFZA 4WCGA 4HTGA 2HWVA 3A4CA 5FD6A 4WF2A 2FIXA 6PAXA 2YR2A 3FXLA 3GF2A 1P6RA 1FTKA 4PAFA 2NNYA 4I62A 2ZMEA 5GTHC 4OETA 1KU3A 3KGCA 1B5JA 3GBGA 3CP8A 5CVVA 4MFEA 4O3CA 1ON2A 3TTRA 3IH2A 3DTIA 5DEQA 2V25A 2V1DA 5TU0A 3J81K 2W57A 3D5LA 2THIA 2XUBA 4U23A 1W5SA 5CBSA 4WEDA 2O51A 3NOHA 4HXVA 3PQKA 2XF6A 4S04A 4KYEA 1N75A 1IUDA 2YU3A 2DTZA 1YJNI 3I3LA 4ISUA 2IS4A 5BPIA 4J01A 4U0WA 2DWHA 2OK2A 2IA1A 3S1RJ 4E0XA 1MY0A 1B1BA 2JZYA 2PLYA 2COMA 5IGAA 2LKXA 2LK2A 4ZZAA 4HV5A 1B1XA 3MYUA 4AVPA 3MZYA 2Y2ZA 5GAEJ 3BFUA 3QAHA 4HW8A 1X3WB 3ZQLA 2WADA 3AG1H 1IN7A 3G6EI 3JRGA 2EQRA 3DEEA 2JUGA 3E3VA 3SYTA 5ITOA 4P96A 3PO3J 4PF6A 4P9KA 2H25A 5FGMA 3JRIA 4NDLA 3WAEA 3E5XA 3FXJA 4I2OA 3KBZA 1DBZA 2ELHA 1BOAA 2WWYA 1MQIA 3HSTA 1OJLA 4E0WA 3BZKA 3TQNA 3G3JA 3BZCA 1BN5A 1W5CC 4CCKA 2RQPA 2X9DA 5A2QZ 5IP9J 4LLLA 1JKOC 2XXUA 3C35A 2REJA 4XKRA 1EKEA 4U0VA 4N6DA 4GWUA 1SD7A 1VE4A 5CI5A 2RAEA 2QVVA 4LGWA 4I76A 1PP8F 1PDNC 2P0WA 3K2AA 3JR9A 1T38A 5HNHA 1KQ8A 1LBVA 1RYOA 2ZZVA 4ESBA 2EIKH 1GV5A 2DE3A 4NGUA 3U65A 1FIPA 1BK4A 1EV7A 3IRRA 2K3PA 2YUSA 2ZSIB 3IAM2 3DPUA 1VZ0A 2Y30A 3OOUA 1SYHA 2MA3A 2ZSHB 4NC8A 4H65A 3D0SA 2K4JA 1BIYA 2JA8J 2MG4A 4QFOA 4BACA 1VR5A 2F97A 2OBGA 3HOXJ 1MJBA 4GBVA 4U87A 4LIVA 2ZXWH 4PGGA 1BC7C 3RYDA 3AXFA 3MKLA 3HIFA 1B58A 4G12A 1Y56A 4KN4X 3JZJA 1NH8A 2HTJA 3AL0C 3IP4B 2ZMBA 3TKDA 5H8NB 2UVJA 1UMQA 3SXYA 3VVFA 4XXUA 3TTNA 2BYVE 3UNGC 2DDBA 3W2VA 1XX5A 3SZTA 1R9TJ 1K78A 1QGXA 3MC2A 3PGFA 3KP6A 1HKSA 3FZVA 2MBFA 3ZXSA 1B5HA 2COBA 1K6YA 3QIMA 1O57A 2OZZA 4EUOA 4ABZA 2IAIA 2NVUB 2IGNA 2GAUA 1FBPA 3DBHB 3QYBA 1XPXA 4JWYA 4KA4A 4ZEBA 3TMGA 2DS9A 2HXOA 4CUGA 1GXPA 3D4CA 3IL2A 2KDZA 4P3LA 2DYRH 3RQ4A 1NKXA 3LL7A 4GX3A 2A6TA 2H09A 3O2PE 4KR5A 3WTWC 4PFUA 5K7ZA 4DZ1A 4F39A 3A01B 1GVJA 5JHFA 2IA2A 3T9HB 1H3DA 2YLNA 3E1SA 4DI3D 2OAZA 4G4PA 4Q48A 1D0XA 1YLFA 1XHYA 4XF5A 3KZYA 1QUKA 4G77A 2LAOA 3IKVA 5DD4A 1MBHA 1R1VA 2DA1A 2QF7A 4EEFG 1EZ9A 3H03A 4OENA 2EV0A 3D1RA 3VLWA 4XOTA 5CBRA 1ETXA 1RC9A 2F5DA 2XXRA 4B44A 2QCOA 1TWFJ 2F48A 4NTLA 3RPWA 1LB9A 1W36C 1HQCA 3ZMSA 2HZLA 3TDJA 3LSLA 2IEKA 1G3WA 4IPAA 2OF7A 3TP3A 5K1YA 5CKTA 1YITI 3K69A 3IL1B 5IZ1A 4M9SA 1XGOA 4PFIA 4GWZA 3ZPLA 3ZQHA 2BXYA 3WE3A 1DP3A 1XI6A 4NHBA 2DA2A 2L2OA 4UV8A 2CRGA 3QAXA 4C9YA 1K9YA 3ZOBA 4LFUA 3LQQA 2R7VA 2PN6A 3AG4H 5EGOB 4HRIA 2LP0A 4MEXF 1B46A 4YU0A 1Y8RB 2FSWA 4MJOA 2EZLA 1UJ8A 5HLTA 4OERA 5CLSA 5M5XJ 1X1PA 2Z16A 1LAXA 2HKXA 1FPKA 3K6XA 2BHYA 1XS5A 4KT5C 5JFRA 3JV9A 3R7XA 4LOCA 4L18B 4FORA 3SERA 3T66A 4PFTA 3LSKA 2VPRA 3UKGA 4BDYA 2YJPA 4J19A 3MUQA 2W24A 3F8NA 1XGSA 2QVUA 1MSEC 3HKZN 4GBWA 1E2XA 3KJTA 1PC3A 2E1OA 2K9MA 1YCJA 4GX6A 3KG2A 4I3YA 3M3FA 4CCLA 1D5YA 4PDHA 4DW6A 4AB6A 2KHMA 2E1CA 1X1DA 3EF7A 3CFZA 4CYDA 4BE1A 1SMYF 3CG3A 5E8GA 1WDNA 4MX6A 2QUFA 1VQLI 4G61A 5CMMA 3U2RA 2W7YA 3V8LA 4KI0E 3U8QA 3K70D 3WODF 3OENA 4I9DA 3KOTA 2DT5A 1NNTA 2O8KA 5J1RA 1AMFA 1QRYA 3NRVA 1NV0A 4QBAA 4HSTA 2CQXA 1FPEA 2X6OA 2ME0A 1H9TA 3CESA 3OEMA 3LA7A 4M3BA 4TV7A 4Y52J 5F1RA 5D6FA 1IXGA 2QS4A 2ZZXA 2KKOA 4RPNA 4XKBA 1U5TB 2Z5UA 5FLVA 2QWWA 5LHGA 5HLHA 4XK4A 5EYFA 1YW7A 4OAYA 2HFBA 5KAIC 3RKQA 1JW5A 3MKZA 4DE8A 3C3WA 1FBSA 1D5VA 4XR6A 1MJ9A 1GGGA 1ZKBA 2XX7A 1H43A 2XXPA 1RRJA 3OEKA 4Q47A 4XKCA 1FMVA 1ZIUA 5I59A 3ONMA 2GA1A 3BP8A 1AOVA 3K1NA 1IXIA 3O6IA 5EDNA 3IO6A 1GVCA 1OCZH 2XAHA 2STWA 4WEPA 4QHQA 1BI1A 1RKTA 1UELB 2OU2A 1SFOJ 2V3QA 1MPCA 4NEDA 1QKAA 5DCFA 3IKTA 3K7AJ 4LG0A 1UAAA 4AIHA 1FMWA 4LQ5A 1EZOA 1AA7A 2OQGA 1WQ2A 2XSJC 4EJVA 2LF7A 3A2KA 3O6HA 1X58A 2M9HA 3QWLA 2QL3A 1FQEA 3W9VA 1GUUA 2QVRA 1FQBA 1M5CA 4C1TA 3TO6A 1SVMA 5E3LA 2OZ6A 2ID6A 3R26A 3ISPA 3FJ7A 3ZQ7A 1CF7A 2J5PA 1B3GA 1OQGA 2D5WA 4RM3A 3IAZA 2V1NA 4K3FA 1IUFA 3F3XA 3CCSI 2EFQA 5B1AH 3CFXA 1OR7C 4RMNA 2VL8A 4C3IJ 4HAMA 1LCFA 2Y5KA 1S29A 3KLNA 3KYDB 1PUFA 1ZR2A 4FE8A 1Y3NA 2L5VA 2O84X 4AIJA 5L9SA 3OYCA 1R71A 3B6WA 3OYGA 3IFCA 4FX0A 2OLBA 4GRKA 1UG0A 3V7RA 3FMSA 1QNTA 3HOVJ 2K9LA 3RKYA 2KT0A 4QIWN 3H9QA 3ZMUA 4ENNA 1K4SA 2PT1A 3PD8A 2OPTA 4EJOA 4S05A 2D2WA 5J1UA 3OV8A 1KZ8A 2JJKA 1Q1VA 5AE4A 1UTBA 1O7LA 3K4CA 3COAC 1UG2A 3M9AA 1SFXA 2JPCA 2RC8A 2CUZA 3PPPA 2KLFA 4PFYA 5J1DA 3CCQI 1LEVA 1FSHA 4LLNA 4N9HA 2G0EA 4L0YB 4NQ8A 1S7EA 1I1SA 2KZVA 2VOPA 1Y1VJ 3KZGA 4TLMB 1KONA 1CE2A 4ZEFA 2F5XA 3WTTC 5JK4A 2Y0SA 3OSQA 4GX4A 3FV2A 4F1YA 2DLLA 2VE8A 5EQ9A 2HPIA 3ESWB 5H20A 1XGMA 2O9LA 1N0TA 4YKPA 5FHOA 3J7YJ 4KYWA 5JEIA 3TUSA 4OA4A 3JYRA 2DMNA 3OYHA 1UTHB 1J7KA 1JW1A 3J7ZI 1MDQA 2QFLA 3HHFA 1SAUA 2XRNA 4E7IA 1AU7A 2D1HA 1HC8A 2A6HF 2NAZA 3K4LA 1TTYA 4NNJA 3RPUA 1SFUA 2CQKA 4HSRA 4L9NA 3SZPA 4H0EA 1Z91A 2DAOA 1ZELA 3V42A 1B3HA 5GTIC 1FPJA 1K4TA 2Q89A 3TL4X 2PQ8A 1IF1A 2Q2CA 4LK1F 2DP8A 3MZ9A 3L7WA 1MQJA 5F0CA 2Y7WA 4OEVA 4NHJA 3H6WA 3THIA 2DW4A 5FHNA 1ITYA 2OV7A 4UXNA 3W2WA 4BJ6C 4EM0B 4F2QA 5LGTA 3TP0A 1EH6A 2X6YA 3VYRB 4KT6A 1EZPA 4PGNA 3PPRA 3NWSA 1FQCA 4U0YA 5FLXK 4HF1A 2UVGA 1KA1A 3TPAA 1OCTC 3TO7A 1TT0A 2N8GA 2DE2A 1VQ7I 1B9JA 3PMXA 5ICQA 3I58A 3IJOB 1POTA 1QJMA 3ABMH 5DCMA 4N07A 3U1KA 4F18A 2KLOA 2WAQA 1P1UA 1ZU0A 1UFMA 2RVCA 4BQNA 4X48A 5IP7J 4F2OA 2DA4A 1FBQA 5CPRB 3OYNA 1B7UA 2Y75A 2JTVA 3OO6A 3V7CA 1MDP1 4BHCA 3CHGA 3MZ8A 3KEIA 5HPQA 4NWDA 2EJRA 5L8DA 3LNQA 5H8HB 2XRLA 3F8CA 1MY2A 4P9UA 5BNGA 2M2EA 1ZQ3P 4IJAA 2KMUA 1RDXA 4RY1A 3E97A 2DN0A 2HXIA 1MMAA 4BDZA 4Z7EA 2VASA 1ZH5A 1DDNA 1Y1ZA 5J4YA 2DPUA 4BDMA 1Q35A 2Y7KA 3FD3A 3W9WA 2XSDC 1IN6A 2Q1ZB 5GPAA 1XN7A 1LFUP 3O66A 4EDPA 4NF6A 1QVUA 3QPTA 3BR1A 2CV0A 2CZKA 2DOJA 2HZKA 2OJTA 3ULQB 2CEYA 2XC7A 2VKVA 4R8HA