3FXUA

Crystal structure of tsar in complex with its effector p-toluenesulfonate
Total Genus 90
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
296
structure length
296
Chain Sequence
b'MLKLQTLQALICIEEVGSLRAAAQLLHLSQPALSAAIQQLEDELKAPLLVRTKRGVSLTSFGQAFMKHARLIVTESRRAQEEIGQLRGRWEGHITFAASPAIALAALPLALASFAREFPDVTVNVRDGMYPAVSPQLRDGTLDFALTAAHKHDIDTDLEAQPLYVSDVVIVGQRQHPMANATRLAELQECRWAFSSAPRGPGAIIRNAFARYGLPEPKLGLVCESFLALPGVVAHSDLLTTMPRTLYERNAFKDQLCSIPLQDALPNPTIYVLRRHDLPVTPAAAGLIRWIQHHAL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LysR type regulator of tsaMBCD
molecule tags Transcription regulator
source organism Comamonas testosteroni
publication title Structural studies on the full-length LysR-type regulator TsaR from Comamonas testosteroni T-2 reveal a novel open conformation of the tetrameric LTTR fold
pubmed doi rcsb
total genus 90
structure length 296
sequence length 296
chains with identical sequence B
ec nomenclature
pdb deposition date 2009-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00126 HTH_1 Bacterial regulatory helix-turn-helix protein, lysR family
A PF03466 LysR_substrate LysR substrate binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3fxuA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3fxuA03
1H43A 3VDFA 1B5HA 3B6WA 4ZECA 2BJJX 3T96B 2IJLA 2VOPA 4I8CA 4MH5A 1G3TA 3TTRA 4M1VA 4PE5B 2ZFWA 4TOZA 3WGGA 1XT8A 4IO2A 4G94A 4OENA 2I4BA 3IOUA 1A7LA 2EV5A 4O6JA 3DQVC 2VP1A 3PUYE 2H09A 4G8XA 2WKYA 4LZ5A 5FGMA 1MXXA 2FU4A 3F8NA 2NXOA 2Z23A 3PPNA 4BNCA 1A8FA 4L9NA 1H9TA 1R5GA 2ZO4A 5ERIA 1OLAA 4LA9A 5HPQA 1I5ZA 3VFJA 5CVVA 3TOBA 3KN8A 3C7JA 4RB2C 3QPTA 4OIRF 2FF4A 4FORA 3OSRA 2LDUA 4EQBA 2ZBKA 1Z9CA 2YX7A 4WEPA 3T9XB 4AVPA 4RPNA 2BBYA 5I2KA 4NWDA 5F6FA 4KR5A 3BJAA 1JEVA 3C35A 3K6UA 3KOSA 1BI0A 4ZEIA 2KIMA 5L3DA 3UGWA 3RPWA 1S29A 4EJVA 4S04A 2Z5UA 1R5HA 2ZXJA 1WWXA 5HS9A 3FXQA 4P11A 4QRZA 4LLLA 3FASA 2DO7A 1B6AA 4EF2A 1SFXA 2PG4A 5D4RA 1BIBA 3EHUA 1UHWA 1QO0D 2VE8A 4QLCU 4HDUA 4KA4A 2ZNTA 1AH5A 2P8TA 4XKPA 2JZYA 3GXOA 4EGZA 1I1SA 4RK9A 1SI0A 2QBYA 2EWNA 4U0YA 3BJOA 3J80K 4DXCA 1B3GA 4MTDA 1ON1A 2R7FA 4OESA 3I5OA 3IL1B 4R2FA 1AIVA 5E8IA 3R61A 2RKMA 2FRHA 4THIA 4YMAA 1XCVA 4B09A 1Y3QA 3F11A 3VB2A 5IKBA 1R23A 1BIAA 2F5DA 1YTVA 3F6VA 1NNPA 5A2QZ 2B0LA 2FA5A 2XX9A 2EV6A 3TMGA 4ZEKA 2G29A 4AB5A 3NQOA 1ON2A 3WG9A 3VLVA 2O3FA 1B7UA 3MC2A 4GL0A 3RI4A 4HQMA 3USDA 2CQKA 3CO7C 1RNLA 3ZN1A 2DU9A 1FY7A 3ECHA 1B1BA 2PEXA 1B3HA 5AA2D 2DE4A 1P2FA 3FVGA 1GVCA 3K2ZA 3MPLA 1N7WA 3LSFB 5DTBA 5KVRA 3O3KA 1DOTA 3DLNA 1SD7A 1OPCA 5KK1A 3MWMA 2V6CA 5E17F 4WEDA 4NF4B 4KHZE 3C36A 4RGRA 5CMKA 3EUHA 5CVJA 4EQ7A 1I6QA 1W4MA 2QS3A 3GLBA 4R73A 3K9TA 2W25A 1RZ4A 3U2RA 2XX8A 1R36A 2I58A 1O3QA 3KJTA 1FTLA 3P9CA 2VD3A 2F35A 3CR9A 4JDFA 1YLFA 5A2QK 1POTA 2NOOA 1WRJA 4KMUX 1JNFA 2V1UA 2UXXA 3O2PE 2UXAA 4AIKA 3KP7A 3K69A 3GVAA 2V1DA 1RUOA 4IY5A 3TDJA 2OU2A 4DDDA 1BLFA 4ELPA 5DD4A 4KIFA 5TRDA 5J8CA 3KEIA 4N6PA 4NF8B 3GZ5A 3RQTA 5JFRA 4XSXF 2XXYA 5DVFA 3WTWC 1OYYA 3IOWA 3ILUB 1LB9A 1MY3A 1Y1ZA 4U21A 1P4WA 1P1WA 4N07A 2WV0A 5CBRA 1MXZA 5AA1A 5ITOA 1LCTA 2MLKA 2P1SA 4YKIA 3FVNA 4EM0B 3IWZA 5HS8A 2I0BA 3F3XA 1P6RA 1HQCA 5JVTA 1B32A 3MQ9A 4R6YA 3MP6A 5KCJA 2JPCA 4G68A 4IPAA 3F23A 2G9WA 3T9UA 3HIFA 2VE9A 1ZG3A 4G2ZA 1F1ZA 2H27A 2O69A 1FQDA 2ZCWA 1OMPA 3EHTA 1FBUA 2RV8A 1REPC 3WU0A 2B3BA 2H4IA 3BKIB 4NF6A 1CF7A 3JSPA 3G7WA 3WTUC 1TQMA 1DPEA 5JTYA 3QXMA 3IB1A 4JWXA 3A3CA 4OETA 4OMBA 1LBBA 2NYXA 4LGWA 2ZXTA 1HW1A 2UVIA 3KP2A 4CZZA 3G3GA 2TDXA 1B46A 1FTKA 1Y4TA 3F8CA 1VR5A 3MAMA 1R58A 4ZEFA 2OK2A 3IL2A 1LDJA 1L0OC 3QU6A 3M3LA 1BI2A 4U23A 1S3JA 2EFNA 2KJBA 2H9BA 5EHMA 2CFXA 1MG1A 1FT9A 3I59A 3TCGA 2JRTA 5EYFA 1IW7F 2V25A 2PBIA 2Q8JA 1SW2A 2Q2EA 1HSEA 3OOAA 5L3BA 5JTYB 2RVCA 3WE2A 4ELQA 1IRFA 4I0BA 3HHHA 1JVXA 2AL4A 1E2XA 2Z99A 5CYVA 1Y20A 5AIPA 5AIQA 3EYYA 4ZYEA 1SI1A 3E5UA 3G3KA 3FF5A 3I0TA 5I2NB 1JW4A 1P99A 2A69F 2JT1A 2A07F 4PGGA 4IO6A 1T6SA 3K0LA 4G77A 1MH3A 4LG0B 3UORA 1BIYA 1P1UA 4B8XA 2PBWA 2DE3A 3KP3A 3E4RA 2F2EA 2E1CA 5HDNA 3OO7A 5DEXB 1II5A 2XV4S 3PPRA 1QUJA 5F7VA 3H6TA 1FCKA 3O28A 3SHFA 3QSLA 1MQIA 3DV8A 3KSXA 1TW3A 2ACJA 1B05A 1FQEA 3DP4A 5FHOA 5DUIA 1P1QA 4ZH4F 2DPUA 1CB6A 1HSLA 5FO5A 3L9FA 2D1VA 1QBJA 2P6SA 1A04A 2HAUA 2XXWA 4EF1A 5JK4A 4G9YA 3FX3A 3EQ1A 3IO6A 3HRSA 2ZNSA 3PQKA 3ABTA 1FZPB 1RUNA 2Q9TA 2VODA 1N7XA 3MVYA 1UCRA 4GL8A 2STTA 4ZZAA 2YU3A 3IKTA 3I64A 1R9LA 1L3LA 3P9IA 4G8NA 1MXUA 3CLOA 3NRVA 1GTKA 3SQNA 1LFHA 1UTBA 3TPAA 1URSA 4ENMA 1MH4A 4MFIA 4RB1A 3I5UA 3SEVA 2ETHA 2V3UA 1O3TA 1RKMA 4F18A 4BDLA 2I48A 4XRFA 2CSOA 3G3JA 1HKQA 2ONSA 4HS7A 4MEXF 1UQWA 1MQHA 1LFIA 3LR1A 1A40A 3TDZC 4JWOA 3HYIA 2FMLA 1GXQA 3QOPA 2ANJA 2XRNA 4LQ5A 3SEXA 3ZQ7A 1B1HA 2R71A 2OBGA 4KCCA 3RPQA 4OXVA 1B4ZA 4IO5A 5D8LB 4RNSA 1U78A 2DSFA 3ZMSA 1YS7A 2PMUA 1B5JA 1Q1KA 4OYVA 4F1VA 3HRUA 2V3TA 4KDPA 5DV5A 2Q0OA 1URGA 3QPHA 2F5XA 1LSTA 4I98B 3V5AA 1XGOA 2QL3A 4OU0A 3DP6A 2VXZA 4KT5C 4R9GA 2IEEA 3DPTA 4G7OF 2FA7A 3TDUC 3QP6A 2EK5A 1FLIA 3FATA 4DXBA 3BP8A 1IN7A 2BEOA 4HTGA 2MH9A 1ZBMA 2M5WA 5H8FA 3LAJA 4L17A 3I71A 5H6RA 5F1RA 5L9OA 1RYOA 5A5XB 1SD6A 1FYLA 1R1TA 1JVYA 4WKMA 3C18A 3I59B 3BPXA 4WXDA 3OOPA 4YAHX 1B4HA 1U6GA 1DTZA 1SW4A 4H8JA 2DLLA 2B65A 3TTLA 2AIXA 1LGBC 2RQPA 3LWFA 4A0XA 5JEIA 1G3SA 4C1TA 1W7PA 4JBZA 2V79A 2VONA 3CI8A 1UHMA 4NE4A 3CFLA 2NNYA 4HX7A 3VXBA 4M72A 2F8DA 5ILUA 4ISUA 3GUDA 3IB2A 2O68A 1XS5A 5B7DA 3DP8A 1F9BA 3JTGA 1MS7A 3G3ZA 3G3HA 1JHHA 4TLLB 1R1UA 4YKJA 2F7CA 2CZLA 2XAFA 2GZWA 1NMUA 3HSEA 4X9TA 2UVGA 1LEAA 4U0VA 4A5MA 1VFEA 3IOVA 2B3FA 3H3GA 1USYH 5DT6A 4Q30B 5J8FA 2XXPA 5DVIA 3PPPA 3JZJA 1B9MA 1FQBA 2P7VB 2FNCA 2RC8A 4KYWA 1SVXB 1MGTA 4KICA 4EM1A 3I4PA 2RCBA 4GYIA 5EHSA 1FOKA 1N76A 2H5YA 4WXJA 2ESHA 1BOAA 3W9VA 5CC2A 2P7CB 3LA3A 3VE1B 1SMTA 1B2HA 2K02A 4ECFA 3GEZA 2Z3YA 1KGSA 2E1NA 4A0YA 3JAMK 3TTKA 3VFZA 1KA8A 3QAHA 2XXQA 4PFWA 4OINF 3OMBA 4XKQA 2HR3A 2DT5A 1IAWA 1R6ZA 2A61A 2HAVA 2K4BA 5BOXA 2A5SA 2A6EF 4DXUA 3Q27A 4KPTA 4XBFA 4OVJA 2GFEA 1B1XA 2DK5A 3V8LA 3K2DA 4O3CA 2VN2A 3E6DA 4H6DA 4YB5A 1QUKA 3O29A 4WCGA 4IRGA 5FLXZ 4F3BA 1MXYA 1EH3A 1POY1 1H0MA 2VT3A 3H06B 2UYFA 4YFKF 5LHGA 4L9TA 4K3FA 4HCWA 4U4SA 4POWA 3KBRA 1F9NA 4LLNA 4LK1F 3G3IA 3KZZA 2H25A 2E7WA 1FWZA 5LEKA 3E5QA 2WTEA 1BI1A 4KI0E 4U4XA 3PMXA 3E3KA 3DF8A 1YO5C 1N04A 4OTEA 4HF2A 1IXCA 3VVFA 4JB7A 3VVEA 3REOA 2DWAA 1EV7A 4ZZLA 3VLUA 4P0GA 4F2QA 1FYMA 1Z6RA 5DYMA 3IJOB 2UVHA 5AA4B 2FOKA 3I58A 4IVNA 3RTRA 3T22A 4IRHA 3LSTA 4EM2A 4U1OA 3L2CA 2AXLA 2QMXA 3V89B 1TWYA 1B4AA 1ULYA 3TELA 3MZ1A 4EQ9A 1MKMA 1R1NA 4M9ZA 4KNYA 4ZE8A 1KYZA 1FC3A 1VTNC 4O3BA 5DVJA 1XCBA 4ESWA 1H44A 2A3SA 2H94A 2FMYA 1BP5A 3WODF 1GR2A 3N26A 4FHTA 4KFCA 1EU8A 3WAEA 2IA2A 3K6VA 1MD0A 2IA4A 3M9AA 3OELA 3ZMVA 1J7KA 2UVJA 1FSEA 2DQLA 1ZMGA 2HXWA 2OCUA 3HRMA 3R26A 3KSJA 3LBSA 2ONRA 3QAXA 5TU0A 3FWEA 2VOZA 4FECA 4ON0A 1UTHB 4XXUA 5E1XA 2A6HF 2CWEA 2RNJA 3CO6C 3C4MA 4F39A 5K1YA 1DMBA 4HX8A 1LNWA 1SYIA 1B7HA 1JEUA 4YG2F 1Z1DA 2KKOA 2WWYA 5I58B 3ISPA 4FE8A 2D5WA 1AMFA 1MY0A 2HKOA 2LF8A 1MY2A 3G3FA 1N3XA 4Q0CA 3S9MC 4UVCA 3T9HB 1WDNA 3VVDA 2RDPA 4O3AA 4OFJA 3UK4A 2F36A 4X1DA 5BPDA 2H98A 3WE3A 2HZKA 2H6CA 3TUSA 1TFAA 3MFKA 1B3EA 1OQGA 4RXLA 2Z9OA 1B59A 4F3PA 3F8MA 2DQRA 3IR1A 5CMCA 3KN7A 2VC1A 1J1NA 3Q26A 4O3MA 4WF2A 1KQ0A 3U8QA 2K86A 3DEUA 3BROA 3F6OA 1DUXC 4FEBA 4LVQA 4PFTA 2E7XA 4M9XA 4BDNA 5IT9Z 3MP8A 3HOSA 4UA8A 3LAPA 1USSA 2Y7WA 3KEOA 4A5NA 2XXIA 4KYSA 2P5VA 4FJPA 3FMSA 1Z05A 3FVOA 3MAJA 3IK6B 1G3WA 3ERED 5ICEA 1B7ZA 3CFZA 3GF2A 3Q9VA 5CVIA 1U2WA 3O2AA 2IA0A 1Z91A 3QK6A 4I1DA 5CM6A 3B73A 3HRTA 4R1HA 4ZS9A 3GFJA 3TCHA 4ZYHA 3LSLA 4IO7A 3CSBA 1K6OA 2UWMA 2I49A 2X26A 3K00A 4FIMA 4LZ7A 3B02A 1MDQA 3ZMUA 4H0WA 2MH2A 1O7TA 4GRKA 1MQDA 3FHZA 2MBFA 3O97A 4CICA 4LK0F 4ZEBA 5LHIA 3EPEA 1B3LA 4L9JA 2ZYOA 1S50A 4RAYA 1ZARA 2LF7A 4P96A 3CFXA 4YMBA 1UFMA 4GQOA 1ZGJA 3OEMA 5I56A 4G8MA 1TQPA 1VFDA 2QS4A 2FYIA 2EA2A 1A99A 5AA2A 3MZHA 1USYE 1GVJA 4A6EA 4YIFA 1LFGA 2VC0A 4PDKA 4U7DA 1F5TA 4CHUA 4KCDA 4L0ZB 4NB5A 2EB7A 5FFXA 3EETA 1EH6A 3CUQA 1IIWA 1JE8A 4IRIA 3FM3A 4F7ZA 1B6HA 3SDFA 4R74A 1GXPA 1Y3NA 1EZPA 2EFQA 2KIUA 1WVJA 4EQQA 3H03A 3J80Z 5CVRA 3PPQA 5BQTA 4ELOA 3NEUA 1Z7NE 3W9WA 4CO8A 5F1QA 5K2XA 2EFWA 2YX4A 1KYWA 4EJWA 4MF3A 3C1DA 4EV0A 4TLMB 2M8EA 1WI9A 2FNAA 5ILSA 5FHMA 2F7AA 3JW4A 2MD5A 1E17A 3SESA 3RIRA 3R6SA 5ICGA 3TO9A 2R9JA 3MVWA 2O8XA 4QSCA 2DWIA 4RGSA 3E9XA 2IVMA 2NVUB 1W7PD 3CUOA 1MM6A 5D5WB 3RYPA 3CG3A 2ADUA 3KCCA 1W5SA 1TFDA 3TO6A 3RLFE 2G7UA 4OIOF 2LKPA 1QGPA 3TQWA 3IRQA 1BM9A 4H65A 1KQ9A 4NF5A 2HDCA 4OMYA 1BBYA 3LA2A 2HZTA 4MEYF 2I3VA 2V84A 2GAUA 2XXTA 3HSRA 4P0IA 3FIRA 5DEXA 3H3ZA 3DPLC 2Z8FA 1OYWA 5CRYA 3T8RA 4NHJA 2XAGA 5EEGA 1XOCA 2QWWA 4ZZEA 3OXNA 3QUFA 4Z7EA 4NF8A 3TQLA 2J5PA 1IN4A 4EJOA 1UTBB 2HS5A 4RY1A 1ZG5A 4GVOA 4AQ4A 2VT2A 2P6TA 1PUEE 4KMFA 1H9GA 4WXCA 3IWFA 4XTCQ 4UXNA 4BDQA 4I01A 2XHKA 3PUWE 5J1DA 2PX1A 3M1EA 1SD4A 1Y0UA 4Q8RA 3MQ0A 2UZKA 3T1BA 4PFUA 5CMBA 4JXIA 4YZZA 1ZRCA 5L3GA 1TTYA 2PJPA 2ESNA 4F31B 2A5TA 5L3EA 4UUVA 2L54A 3UA8A 3RKYA 3OO9A 1D9VA 1N0TA 3ZP5A 1U5TA 2EFOA 2X4HA 4DNCA 4Q48A 2PT2A 4I02A 2GH9A 1MPDA 3HTSB 4KQPA 3L6HA 1F4KA 1DDNA 1IQ7A 5DDGA 2H99A 4GXOA 3N6TA 5BUUA 2YSRA 5HLIA 1WSUA 2Q8KA 1BC8C 1ZG1A 3TO7A 4E0XA 3RTFB 4HAMA 2YPRA 4L5JA 3GZ6A 3V8JA 5AA2B 1LB2A 2O51A 3BFUA 2HQNA 2F7BA 5ILVA 2X7PA 1GHCA 1SD3A 1S8NA 3T93B 4HV5A 3V7RA 3V4GA 2A68F 4YIIA 4CDGA 4UNOA 1NNTA 1V3FA 1Y4CA 2Y7PA 1MQGA 3MP1A 3L09A 2ZNYA 5LGTA 1R1VA 3KZYA 1B3FA 1XGNA 3Q29A 3BDDA 1KU2A 1J2XA 4L5IA 1ZREA 1NKXA 1ZU0A 4G8HA 1AWCA 4U88A 4IHSA 3P7NA 1S7YA 4TV7A 3KE2A 1D8KA 1XN7A 3ROUA 1XGMA 5TPAA 1FTJA 1OQHA 2OQRA 2STWA 1D8JA 4OZ9A 1NFTA 3GBAA 4G68C 4DIGA 2MLGA 1U5TC 1EZ9A 1A8EA 4H5GA 1PB8A 1LAGE 1IITA 2CMOA 4G7HF 5DUKA 2ONKE 2KLFA 2BGCA 2FEZA 2LSOA 2XIGA 2NRAC 3RDIA 1X3UA 1RYXA 2LNBA 3S4UA 2GQQA 2EA4A 3C3WA 4AB6A 1ELJA 5CJ9A 3BPVA 3M8FA 2XXHA 2P5KA 3FVKA 2ZYNA 3C32A 2YPNA 2PYYA 5HLGA 5FLXK 2QJEA 2XX7A 3IJXB 5TP9A 3WGIA 5L9SA 1Q1HA 5E18F 4WX9A 2XAHA 1IN6A 3I6VA 2HTSA 2RKHA 2Z33A 1TLHB 5DCMA 3ODBA 3RGYA 2XGXA 3OO8A 2ZNUA 1SFUA 2X7QA 1TXFA 3J7AO 3T8TA 2L4MA 4ENJA 3S9LC 3PQJA 2VBWA 1IXRC 4BLAA 2GIVA 1BI3A 2M87A 3KEQA 2Y0MA 1VSOA 2LAOA 2HGCA 1FBSA 1HSJA 2L01A 5LRRA 4NF5B 1BTJA 4MHGA 4R2BA 2W84A 2IRFG 4RGUA 3OSQA 3W6JB 3C34A 5ICQA 3LSWA 2Y84A 3HV1A 4HW8A 3E13X 2PFBA 1ZAOA 4HX4A 4OFLA 2W7YA 1XB4A 3Q9SA 4N9HA 2XAJA 4WXHA 3HHGA 3C33A 1MDMB 3ZKKA 3L7WA 5H8NA 3DP7A 3KLNA 3TOAA 4F19A 4MQVA 1M5CA 2GRVA 3Q25A 4HCYA 4QFOA 2F97A 1S7AA 4U22A 5B70A 1I6XA 1HKTA 4NWCA 2OLBA 3ZSFA 2XXXA 1T98A 4PP0A 3WU1B 4R6KA 4P9UA 3H3UA 5JI6A 2VBYA 4GCVA 4HLYA 3IX1A 4LG0A 3T5XA 3SEYA 5BWJA 2HYFA 1LLSA 3SETA 1ZLKA 3JTHA 3KGCA 5H8QB 3FD3A 1OLCA 3FGSA 2ZYKA 5FTIA 1HW5A 4OQOA 1TNTA 5E1WA 3S9EA 4S05A 2GXGA 3K0VA 4NF4A 5H8FB 4EMSA 1KWHA 4N0BA 1FP2A 1HXDA 3QYTA 1Z7ME 4H5FA 2EV0A 2XD3A 3O6IA 4IGTA 3WTZA 3VLWA 4XSZF 1FW0A 3H92A 3BY6A 3L6GA 3F72A 1NH7A 3U9GA 4QSDA 3ONMA 2O84X 4BDMA 3EDPA 3MZ9A 4EUOA 2HYGD 4KUMA 3ILTB 4GOTA 1W7PB 2XROA 2OD5A 4HW0A 4PZJA 1TT1A 5AA4A 1LVAA 1J5YA 4HOBA 5IT9K 1D3YA 4GO1A 1RI7A 1J75A 1OVBA 4X1BA 1MQJA 2P5LC 1RIOH 3F8BA 3M3FA 4FEDA 1FSHA 4U0WA 2IP2A 4HBLA 5LRSA 5ITPA 2I6EA 5HS7A 3FM5A 5L3CA 4ETSA 1MPCA 2OZUA 5HM4B 1PBPA 1QZZA 4YKPA 1YTYA 4BYYA 3AXFA 4QFPA 1FTOA 2RC4A 3GWZA 1KU7A 4PGHA 2QBYB 2ABHA 3PD9A 3EYIA 1XDSA 1IZ1A 5J6XA 5FD6A 3WAFA 4EXLA 2AS5F 1XVXA 4BHCA 5KDTA 3ZN0A 2QS2A 3SZPA 2ZJ2A 3N6UA 3F21A 3H6VA 4M6XA 5CMMA 3QRFF 5KZTA 1HBXG 3O6HA 1AL3A 1QULA 5LLQA 4ASNA 5K5RA 3N5LA 3PD8A 4BDRA 5FD5A 1XMAA 3RUMA 3UP9A 2F6PA 2K27A 3ML6A 3TZAA 2FQ3A 2KRFA 4LMYA 4F29A 4AD9A 2NWJA 3FMRA 4JWYA 2H6BA 2M30A 2QYOA 4C0RA 3MW0A 3KETA 3DELB 4Q5SF 1JXSA 3QIMA 2DOJA 5E8GA 1N84A 2CO5A 1O7LA 4LP2B 2P4WA 4RGXA 1XDUA 4YKKA 3B7DA 4YICA 1R00A 2Q2AA 4UACA 2G7HA 1S7OA 4PFYA 2OZZA 4RB3C 2Y7RA 1J0RA 2JTVA 3IHUA 3BFTA 4IGRA 3IKVA 1O3RA 5BMZA 1FQFA 2Z22A 1O63A 1LCFA 5H8HB 4FT8A 4I7HA 2P2AA 3K4UA 4MLQA 2DFIA 3DM0A 2R3SA 3K1PA 1U8RA 3LA7A 3LFKA 3KZGA 3HTUA 2E1SA 3N97A 2DVZA 3MZYA 5H20A 5IAIA 2MC3A 4RS8A 3HOTA 2PMSA 1ZLJA 3S2VA 1LJ9A 2V1XA 2QPQA 2FBIA 2QUFA 4AIJA 5LBQA 3EF7A 4F22A 4L9VA 4QSEA 1DPRA 4BHBA 6PAXA 1K7AA 1QJMA 3BBRA 2I3WA 3HUGA 3D4GA 2BYVE 4LB6B 1MDMA 3TKDA 4F3SA 3CUQB 3LQQA 4U7BA 2QS1A 3KFWX 5LHHA 4HA8A 4AIHA 3ZMDA 1FTMA 3MVXA 1YW9A 3IRRA 1XHYA 2F5CA 2V93A 3ABUA 2L02A 1BJAA 1MY4A 3DKWA 1QVSA 3FV2A 3BOQA 2DYXA 3W6KB 2O61A 4QFLA 2HQ0A 4L18B 4BH9A 2Z8DA 2XKOA 3LUYA 1R9QA 2THIA 3FJGA 4HDVA 3ECOA 1ANFA 1SW1A 4ESJA 3JAMZ 1T39A 4OOIA 2O6AA 2DP8A 1P4XA 4I9DA 1B5IA 4GYGA 3W15C 2Q2CA 2QQ9A 2GHAA 4MLVA 4M6YA 4Y13A 1KU3A 1LDKB 2JPBA 1PB9A 3VODA 2PLYA 2PI0A 1P1OA 3OV8A 1PC3A 1NNKA 1XVYA 5KCJB 1XD7A 3V8KA 3F8FA 4KN4X 1KU9A 3D4CA 3I53A 2W24A 4IXAA 4IB2A 2HCAA 1O57A 4EVIA 5D6FA 3OO6A 4LD5A 4Q5TA 4HF0A 1ZH5A 2CG4A 5E20A 5HLHA 4H8IA 2R7DA 2CGPA 4Y15A 4NMYA 2F5FA 4NEDA 2O6GE 2HOEA 3JSOA 1ODDA 4OMZA 2G93A 5DEQA 3TAJA 5BPIA 4OIQF 1STZA 1SYHA 3FJMA 2IPQX 4LQ2A 2RCAA 4QF9A 3PMWA 3RNNA 2HTJA 5D5VB 3ULQB 4C1UA 2RN7A 4HLXA 1Y3PA 3WTVC 4GFRA 1M5FA 3SZTA 1ZN2A 2DS9A 2NUVA 1P1NA 1EH7A 2ZNZA 3KLOA 2Q88A 4M71A 5ICFA 2REGA 4I62A 2IA1A 1OR7A 2IW5A 5DD8A 3F22A 2VD2A 5TJJA 4N13A 2J5OA 1HW2A 2M1BA 4OEVA 2HFBA 1IXHA 1SFEA 4JBAA 1G6NA 2F5EA 3MUQA 4PETA 4CYDA 4NQWA 4KIGA 1FQAA 3WTSC 3O66A 2O7UA 1ONVA 1ZJLA 3U1OA 1US4A 5HOOA 2P0SA 3ZMZA 5FB2A 3J81Z 3PFIA 3MCZA 3H7MA 1JW1A 5I2KB 3PUXE 4P5OA 3FMQA 3K1MA 2A5TB 5DCFA 3WTXC 4LLGF 5AONA 1B58A 3VV5A 5CVUA 1U5TB 2D2WA 1YPNA 3TODA 5D5XB 3TKYA 4Q47A 1AOYA 2XUBA 5H8HA 1YW7A 2QVOA 5AE4A 2QZ8A 2OA4A 2W57A 3PGFA 3S9NC 3RT6B 3V7CA 3U94A 4LONB 5H8NB 5D6EA 4YU0A 1XC1A 4MBPA 1I69A 1IUYA 1PBQA 1D5VA 1G4DA 1H76A 1W5TA 3HHFA 2DVCA 4D0PA 2RF1A 1SDXA 4G68B 4ONYA 5IT3A 2OAZA 4ENNA 3IC7A 4ESFA 1YYVA 2OQGA 1HSTA 1MPBA 3A09A 2DK8A 4P55A 5I56B 1O64A 5LGNA 2BV6A 3TEPA 1LBCA 3HSTA 3M8UA 1IN8A 1FNNA 3B6TA 4NF6B 1PEBA 1K79A 3SERA 2DI3A 2HFHA 4HF1A 2PMHA 3VEPA 1MXWA 2GWRA 3CG1A 2K4JA 2QLZA 5CLSA 4G7ZF 1N3WA 1YW8A 2KJCA 3CVGA 3VXCA 2DE2A 4HYEA 3BZ6A 2D3IA 1S9TA 3E6CC 3R4KA 3SXYA 4GLIA 3R0AA 4RB0A 2RC7A 1JGSA 3ZS6A 4UV9A 2RC9A 3N4MA 3FV1A 2O0YA 4M9SA 5D4SA 3LC8A 4YFNF 2I4CA 3GBBA 5FFZA 1PP7U 1QUIA 4LFUA 2VHAA 3HN0A 2ISZA 2DWHA 1PDNC 2HWVA 2FBHA 1Z7UA 3HPIA 1CF7B 3TTNA 3MJNA 3UN6A 2XXRA 4OEUA 4H0EA 4EJUA 1MY1A 3PV0E 3GFIA 1TQIA 1LQ1A 1P92A 3H6WA 1K78A 1T2KA 1OIBA 1SBPA 3QP5A 4ZDMA 3PUZE 5JR3A 1FYKA 3T9VA 3IO4A 2ALUA 3MWBA 2OWSA 1DPPA 1USTA 2DTRA 3ZMTA 1T0FA 3T0YA 5F64A 1R7JA 4I0AA 4GD5A 3S2WA 3CDHA 1I6BA 3GW2A 1YS6A 1MZBA 4R8HA 3KP6A 3U93A 2X0LA 1NNFA 3K01A 3WGHA 1B9NA 1J59A 1OVTA 4WWCA 2XHDA 3HCQA 1A55A 2PVUA 1FX7A 4F3GA 1UIUA 2FBKA 2HQRA 3C9HA 4HZFA 4CXFA 5ED4A 4OFOA 1MJBA 1OMIA 1TBXA 3L00A 4G6QA 2O7IA 3P7IA 2XKPA 4EJTA 1IEJA 4FAJA 1B52A 5H8QA 5K5OA 3KOTA 2QRYA 5CI5A 2XASA 1LEBA 5BS6A 4OHNA 1XMKA 3H6UA 4QWQA 3PUVE 2M8CA 1D4NA 2DW4A 4RYAA 1DSNA 4EXKA 3CUQC 2OZ6A 3K1NA 4KN7X 3DXJF 1YFHA 2E0SA 3KN3A 4IO4A 1FPQA 4MQ9F 3R0JA 5DYHA 2GXBA 2XVCA 3CSGA 2PT1A 1UIVA 2Y75A 2GHBA 2VOOA 4UHTA 3E6MA 1FP1D 3C31A 5CBSA 2YJPA 4Z2YA 1B40A 4P9FA 4NTLA 3GFMA 1QKAA 2Y7IA 5I84A 1C0WA 4WK8F 4DLDA 3GYHX 3U1DA 1LB8A 4UVBA 4EGYA 1ZRDA 1LDDA 2HEUA 5M2VA 1EH8A 1ZGAA 1HKSA 1B0LA 3GLXA 1LAFE 2DQVA 2FNPA 1B9JA 4N9IA 3H4ZA 4KYDA 3RKWA 3HSFA 4E0WA 3HO7A 2F34A 4IJAA 3A3UA 3TTMA 1IN5A 5I59B 4JK1X 3KP4A 1ZKBA 1IXSB 2CYYA 2V3QA 4ENKA 2A5YB 3VOEA 4Z0IA 1B51A 4RK2A 3LQRA 4JSOA 4BQAA 1LAHE 4GF8A 4DZ1A 2C6YA 2OJTA 5I59A 3MBPA 3OD7A 4GGGA 4PQJA 1OKRA 1MRPA 3PMVA 2GA2A 3KP5A 1ZYRF 1QPMA 4IO3A 2EJRA 4M4GA 1MM7A 1Y1MA 4IHTA 2DAOA 2D45A 3CJNA 3R7XA 2F78A 1IF1A 4I2OA 1QNTA 1JW5A 4QHQA 4A12A 2D21A 2I0CA 4A0ZA 1FQCA 2ZMEB 3GO5A 1M5DA 4E70A 3E3VA 1JETA 2XD2A 1XSXA 3N94A 3E5XA 5TP9B 4OERA 1B0HA 2L3DA 2QM3A 4KD5A 1AOVA 1DTGA 3DFGA 2FSWA 4YB7A 2FXAA 3KG2A 5JHUA 4BAYA 3ELKA 2QQAA 4HV6A 4GXSB 1G3YA 4ZYDA 3RYRA 3CTAA 4IF4A 4MGRA 4XLPF 4UV8A 4R9FA 3AAFA 4O5VA 1US5A 1ZTYA 3TYHA 2GA1A 1I6AA 1XGSA 1NHAA 2F6GA 4L0YB 2WC2A 1KQ8A 3ECRA 3QU3A 4FX0A 1LAXA 5FHNA 1TNSA 1ZRFA 3K6XA 3TGNA 4GWOA 5H6QA 2HEOA 2OBPA 1BC7C 4H1XA 4A6DA 3CRBA 1QW0A 2CW0F 3E97A 1UTHA 4U2RA 3B6QA 2EFPA 1BKAA 2QMWA 5I57A 1IXIA 1YCJA 4BHPA 4F1YA 3WTYC 3IOTA 4IY6A 4M74A 3TFLA 1DPUA 4OWDA 4U1ZA 3JV9A 1YQAA 3WTTC 1IRGA 1WKMA 4LZ8A 1BN5A 3RT8A 3TCFA 2OWTA 1MXVA 1YAEA 2DPDA 2K7LA 1EZOA 2ELHA 3JYRA 1ZIUA 2QSXA 4ESBA 3SKPA 1A54A 1PDAA 5DCMB 4A2UA 1K78B 2R6GE 1OYIA 2O1LA 1S6LA 1Q35A 4H67A 1URDA 3K6WA 4EDPA 4GIZA 1O7FA 1FBQA 3SFZA 3OENA 4FATA 4HQEA 4ZZDA 2YR2A 4ELRA 4LATA 3ZPLA 3D5LA 3FXUA 4I09A 4KIBA 2M45A 4BXUA 2ZMBA 4DCYA 4PCQA 2VGQA 3EHSA 2HKXA 4MTEA 1T0KA 4RPOA 4M73A 2PQ8A 3IAZA 3UIFA 2COMA 2O1MA 4R79A 1MJAA 1PP8F 2AYSA 2XAQA 4RA1A 4ESXA 4R72A 2XXVA 4F1UA 5L9MA 3PPOA 4R75A 5D5UB 4DCXA 1H3DA 5EEHA 4YB6A 5D8KB 2ZMEA 4RAZA 2RINA 5K5QA 1ATGA 1SAXA 2IT0A 1H45A 1QKBA 4CGZA 3V83A 2QENA 2NNNA 2YLNA 5L8DA 3CIJA 4R6HA 3U72A 1D9YA 1Y9UA 2Z8EA 3GZGA 5LOMA 3TQNA 2DBBA 5ICTA 3IB0A 4ZYGA 1MJ9A 1VE4A 5ICCA 5AA3A 5KDTB 4GXAA 1P4AA 4LB5A 2AL5A 3P9KA 4XIGQ 2DXRA 5E1ZB 5TPAB 1U3EM 1O3SA 2FE3A 3THIA 1WODA 3PU5A 4RJZA 5HDKA 4MNUA 2HZLA 4OIPF 3O6BB 1SQYA 3O6GA 3M3KA 1SD5A 2NS0A 2O03A 2RGVA 1QZYA 1UB9A 5H8SA 4YFXF 1D3KA 1NL5A 2VBXA 4ZE9A 3J81K 1M5BA 3EN3A 1J9IA 4ND9A 4BDOA 2DWJA 4F2OA 4Q4ZF 3FXRA 2UYEA 4TQUQ 5HBCA 3RY3A 3ZKLA 1XSDA 3V7SA 1GGGA 3GXAA 2BE5F 2Q89A 1DP7P 3QUJA 5I58A 5K2YA 1JQFA 3I3VA 3KJ7A 5FTHA 1L5TA 2XXUA 1Z6TA 2JSCA 4QFNA 4POXA 3RJPA 3MVZA 4DE8A 3V8XB 1SW5A 3R6UA 2QQBA 3MEXA 3M7GA 1YIOA 2Y48A 1PB7A 1V4RA 3RPUA 2Y7KA 4DQ2A 3OEKA 1ZLQA 3GX4X 4AWXB 4JSDA 4KFQA 4ZEDA 4G6DA 2VBZA 5LEJA 3K02A 1YG2A 2PN6A 4UVAA 2NAZA 3MPKA 3SEWA 5A5XA 2ISYA 1I1GA 1QQIA 2L4AA 3GFLA 3U92A 1R22A 3FJ7A 1XSVA 1GV8A 2MA3A 1IXGA 4X48A 1ZHFA 3FZVA 2V9VA 5I57B 5ELVA 5I2NA 3RKXA 3COAC 3T66A 2D1HA 1I27A 1SMYF 3E6BA 4FX4A 3RN8A 2KIFA 4Y17A 3RTWB 1CGPA 5LGUA 3Q5FA 4JQFA 2DXYA 3LSXA 4G4PA 4KYEA 3D0SA 4K2EA 2REJA 2ZYMA 5HVQC 4XLNF 3FUZA 2W85A 4XKNA 4XKRA 5ISUA 5HDGA 1IUDA 3M8EA 3G73A 1TW2A 3I54A 4LJZF 3R60A 2ZKZA 3BJ6A 1M5EA 1CE2A 2UXNA 1NH8A 3IORA 3BWGA 4QFKA 3MZBA 3SEUA 3EQLF 3KFMA 4LUBA 1MDP1 1T38A 1WQ2A 3Q28A 1JHFA 5L3FA 3O9PA
chains in the Genus database with same CATH superfamily
1U8BA 1H43A 3VDFA 1B5HA 3B6WA 4ZECA 2BJJX 1FPKA 2IJLA 4V2FA 2I5UA 3T96B 2VOPA 2VKHA 4I8CA 4MH5A 3BZKA 1G3TA 3KC1A 4GX6A 3TTRA 4M1VA 4PE5B 2ZFWA 1IMFA 4TOZA 3OR2C 3DLAA 3H5RA 3WGGA 1CQTA 1XT8A 2R7UA 4IO2A 4G94A 4OENA 2I4BA 3IOUA 2LP0A 3BR5A 1A7LA 2EV5A 4O6JA 3DQVC 3VWBA 2VP1A 2H09A 3PUYE 2GOMA 3NWTA 4G8XA 2R7OA 2WKYA 4LZ5A 5FGMA 1MXXA 2FU4A 2RQQA 2X1DA 3F8NA 2NXOA 2Z23A 2OV7A 3PPNA 4BNCA 1A8FA 4L9NA 2KR0A 3MKYB 1H9TA 4UUSA 3I56I 1AHDP 1N25A 1R5GA 2ZO4A 2GM4A 5ERIA 1OLAA 4LA9A 2IGOA 5HPQA 3CZ6A 1I5ZA 3S14J 5CVVA 3VFJA 3TOBA 3KN8A 3C7JA 4RB2C 3QPTA 4OIRF 2FF4A 2LTPA 2DXIA 4FORA 3OSRA 3PUBA 2LDUA 4EQBA 1WCMJ 2ZBKA 1SVOA 1Z9CA 2K85A 2YX7A 5CKTA 1LE8B 1NUYA 2XWOA 4WEPA 4AVPA 4RPNA 1T08B 4A3BJ 3T9XB 3CCVI 2BBYA 5I2KA 2DA5A 4NWDA 2VL8A 1P7IA 5F6FA 2LKXA 3KYLA 4KR5A 3BJAA 1JEVA 2KHMA 3H5AA 3C35A 3K6UA 3KOSA 1BI0A 4N6KA 2WYKA 3H35A 4ZEIA 3JRDA 2DDBA 2KIMA 4JYKA 5L3DA 3UGWA 2CQXA 1LE8A 3RPWA 1S29A 4EJVA 4S04A 2Z5UA 1R5HA 2ZXJA 4PCDA 1WWXA 5HS9A 3FXQA 4P11A 4QRZA 4LLLA 2DFFA 2XF6A 4BJ5C 1YIJI 3FASA 2DO7A 2ZSIB 1B6AA 3FBPA 4NAPA 1SFXA 3K4NA 4EF2A 1QVUA 2BY0A 2PG4A 5D4RA 1BIBA 3EHUA 1KA1A 1UHWA 4X1EA 1QO0D 2VE8A 4QLCU 4HDUA 4KA4A 1IO2A 2ZNTA 1AH5A 4FASD 2P8TA 4GFBA 5ET8A 4XKPA 2LBFB 1Z3XA 2JZYA 3GXOA 2EINH 3HJEA 4EGZA 1I1SA 2IGMA 2VD2A 4NGUA 4RK9A 1SI0A 2QBYA 2EWNA 4U0YA 3BJOA 3J80K 4DXCA 1B3GA 2CW7A 4MTDA 1E0EA 1ON1A 2R7FA 4AUXA 2KQZA 4OESA 3HZJA 3I5OA 3IL1B 4R2FA 5JVGF 1AIVA 5E8IA 3R61A 2RKMA 2FRHA 4THIA 1FPDA 4FETA 1BR2A 4YMAA 2M0CA 4FISA 1XCVA 3OSFA 2EZLA 2CZIA 2BOLA 4B09A 5J4VA 1Y3QA 2NUVA 3F11A 1E3PA 1R23A 5IKBA 3CDLA 1RDZA 1BIAA 2F5DA 1YTVA 3F6VA 2BHZA 4BE2A 1FBPA 1NNPA 5A2QZ 2B0LA 1X2NA 2FA5A 2XX9A 2EV6A 3TMGA 2WY8Q 4ZEKA 2G29A 4AB5A 3NQOA 1ON2A 3WG9A 2R7XA 3VLVA 3CCMI 4BJ6C 1X1PA 2HYJA 2O3FA 1B7UA 3MC2A 4GL0A 3RI4A 4HQMA 3GTOJ 3USDA 2CQKA 2IEKA 4ABZA 1RNLA 3ZN1A 5FJ8J 3CO7C 2DU9A 1IMEA 1LBWA 1FY7A 3ECHA 1B1BA 2PEXA 1FJLA 1B3HA 5AA2D 2DE4A 3GCMA 1VQ7I 1P2FA 3FVGA 1GVCA 1ETOA 1D9QA 4GWUA 3K2ZA 3MPLA 1N7WA 2V1NA 3LSFB 5DTBA 5KVRA 5KHDA 5F27A 4YIRX 3A1YA 3O3KA 1DOTA 3DLNA 1SD7A 1OPCA 5KK1A 3MWMA 2V6CA 5E17F 4WEDA 2L7ZA 4NF4B 4KHZE 2CEXA 3C36A 3BG7A 4AYBN 3W2AA 4XOTA 4RGRA 5CMKA 3H1CA 3EUHA 3HOVJ 5CVJA 2HXIA 4EQ7A 1I6QA 1W4MA 2QEXI 2A6TA 4BY1J 2QS3A 3S1QJ 3GLBA 1NV5A 4R73A 3K9TA 2W25A 3OMYA 1RZ4A 1XTAA 3U2RA 3JRGA 2XX8A 1R36A 2JA2A 2I58A 2KFDA 3FXLA 1X1BA 1B8IA 1O3QA 3KJTA 2M7AA 5CPRB 1FTLA 2HI3A 3P9CA 2VD3A 2X85A 2F35A 1HF0A 3CR9A 1YLFA 5A2QK 4JDFA 1POTA 2NOOA 5TISC 4A3JJ 2QVRA 1WRJA 4RMNA 2ZZVA 5LTCA 2VJIA 4KMUX 2LR8A 1JNFA 3H0DA 2V1UA 5FKOA 2B4MA 2UXXA 3CCRI 4GX4A 2V4CA 5FKKA 3O2PE 4IHWA 2UXAA 3AG3H 3B6CA 3KP7A 4AIKA 5IM2A 1D0ZA 3K69A 3GVAA 2V1DA 4PJ0C 2UV1A 2R5ZB 1JKPC 1A5JA 2CRGA 1RUOA 1WVRA 1ETYA 4IY5A 2OU2A 3TDJA 4DDDA 2KIQA 1BLFA 4ELPA 4AIDA 5DD4A 2DJNA 4KIFA 3Q0UA 5TRDA 2XF7A 1TWGJ 1VQ4I 5J8CA 3KEIA 4N6PA 3BR1A 3GZ5A 4NF8B 3RQTA 1JKRC 1V55H 2L9RA 4OAZA 5JFRA 3JREA 3G1OA 4XSXF 3GTKJ 3GTPJ 2XXYA 4G61A 5DVFA 3WTWC 1OYYA 3IOWA 3ILUB 1V54H 1LB9A 1MY3A 4DGWB 4IOAF 1Y1ZA 1P4WA 1P1WA 4U21A 2M2EA 4UB6C 2WAQN 4N07A 2WV0A 5CBRA 3QWLA 1MXZA 3H0GJ 3I4MJ 5ITOA 4E7JA 1LCTA 2MLKA 3G1MA 5AA1A 4A3GJ 4G12A 3ESWB 2P1SA 4YKIA 3FVNA 4KITB 4EM0B 1VI0A 2R7QA 3IWZA 1U0JA 3W2WA 4ZTJA 2CZHA 2X6WA 5HS8A 2KRCA 2I0BA 3F3XA 1P6RA 1HQCA 3OIPA 5JVTA 1B32A 3MQ9A 3MP6A 3FKJA 4R6YA 5KCJA 1BL0A 2JPCA 1A6IA 2GOXB 4G68A 4IPAA 3F23A 2G9WA 2ECCA 3T9UA 3IV5A 3HIFA 2VE9A 1ZG3A 3QMFA 4G2ZA 2WY7Q 1F1ZA 2NS7A 1ETWA 2H27A 3CCQI 2O69A 1DP3A 4NUBA 5IZ3B 1FQDA 2ZCWA 3OIQA 3OIOA 1OMPA 3EHTA 1FBUA 3MKWB 1BJZA 4UABA 2RV8A 1REPC 2CJJA 3WU0A 4FTHA 3KBZA 2B3BA 2H4IA 3BKIB 3HOZJ 1CF7A 4NF6A 3JSPA 3G7WA 3VYTB 3WTUC 1TQMA 3BTLA 4HNUA 1DPEA 5JTYA 2OJED 3QXMA 3IB1A 4PGPA 1IUFA 3GTJJ 4JWXA 3A3CA 1P9QC 2F5VA 1D0XA 1OCTC 4OETA 4OMBA 1LBBA 2NYXA 4LGWA 3EUHC 1JJ6C 4A3LJ 2ZXTA 1HW1A 2UVIA 3MKZA 3KP2A 4CZZA 5JLWA 3G3GA 2TDXA 1B46A 1FTKA 3TL4X 1Y4TA 3F8CA 1B72A 1VR5A 3MAMA 2VQGA 1R58A 4ZEFA 3IFAA 2ZFUA 4S0HB 5E3OA 2OK2A 3IL2A 1LDJA 1L0OC 2V4JC 3QU6A 1BI2A 4DJAA 3CC2I 3M3LA 4U23A 4M3FA 4PJNA 1S3JA 2EFNA 2KJBA 2H9BA 4V2GA 2CFXA 1MG1A 1FT9A 5EHMA 3I59A 3TCGA 2JRTA 5EYFA 1IW7F 2V25A 2HDWA 2PBIA 2Q8JA 2B63J 4V19K 5J47A 5CQEA 1SW2A 2Q2EA 1HSEA 1Y1WJ 1X4OA 5L3BA 3OOAA 5IZ1A 5JTYB 2RVCA 1EYJA 3WE2A 3W6VA 4ELQA 1IRFA 4I0BA 4KYDA 2OTLI 3HHHA 1N78A 1JVXA 2AL4A 2XPUA 1E2XA 2Z99A 3VYUB 5I7IA 5CYVA 3FISA 1Y20A 2B7EA 5AIPA 5EG0B 2VPOA 3K10A 5IYCJ 5AIQA 3CJRB 3ZQQA 3EYYA 3G6EI 3BTJA 2VQCA 4ZYEA 4IEJA 1ETKA 1SI1A 4XRMA 3E5UA 3G3KA 3FF5A 3I0TA 5I2NB 1JW4A 1P99A 2A69F 2JT1A 2A07F 4PGGA 4IO6A 1T6SA 1TL8A 3RYDA 3RCOA 3K0LA 4G77A 1MH3A 4LG0B 1RDXA 3JRBA 2QGUA 3UORA 1BIYA 1P1UA 2HQAA 4B8XA 2ELJA 2DE3A 3KP3A 2PBWA 3E4RA 2BXZA 4ONYA 2F2EA 4IR8A 4HCYA 5HDNA 2E1CA 2DDKA 3OO7A 3QYBA 1NV7A 5K7HA 5DEXB 1II5A 2XV4S 3PPRA 1QUJA 1FPBA 3K2AA 4MO7A 2PCRA 1FJ9A 3H6TA 1FCKA 3O28A 3PNYA 5F7VA 3SHFA 3QSLA 1MQIA 4XLHA 3DV8A 4E7IA 4MNCA 3KSXA 1TW3A 2ACJA 1B05A 1FQEA 3DP4A 5FHOA 3HPGA 5DUIA 1P1QA 3RKQA 4B4CA 4ZH4F 3VDXA 2DPUA 1YX3A 2KDZA 1CB6A 1HSLA 5FO5A 3L9FA 1AKHA 2D1VA 1QBJA 2P6SA 1A04A 2WBDA 1FBCA 2HAUA 2XXWA 4EF1A 5JK4A 4P8BA 4G9YA 3PL8A 4BE0A 3FX3A 3EQ1A 3IO6A 3HRSA 2COBA 3JRHA 2ZNSA 1S5LC 5DM7F 4HE2A 1POGA 1WPKA 4CZCA 3PQKA 3ABTA 3VPRA 1FZPB 1RUNA 1HCRA 2Q9TA 2ZJQF 2VODA 1N7XA 3MVYA 1UCRA 4GL8A 2STTA 1Z21A 2YU3A 3IKTA 3I64A 4ZZAA 5J1RA 1R9LA 1L3LA 3P9IA 4G8NA 1MXUA 4X04A 3CLOA 3NRVA 1GTKA 3SQNA 1LFHA 1UTBA 3S1MJ 3TPAA 3GMEA 1RPWA 4ENMA 1URSA 1MH4A 4MFIA 4RB1A 3I5UA 5FKLA 4AS5A 3SEVA 2ETHA 2V3UA 2DMUA 4OAYA 3A01B 1O3TA 1RKMA 4BDLA 4F18A 2I48A 4XRFA 4AVZA 2CSOA 3G3JA 1HKQA 5GPAA 1WH5A 3SFIA 2MYSA 2ONSA 4HS7A 1X3WB 3D1NI 2CH0A 4MEXF 3OS2A 1UQWA 1MQHA 1LFIA 3LR1A 1A40A 3TDZC 2QF7A 3L1PA 4JWOA 3HYIA 5HLTA 1K9ZA 2FMLA 1GXQA 2F4OB 3QOPA 1Q9DA 2ANJA 1ZKGA 3TEDA 3DTKA 4FBPA 2XRNA 1OISA 4LQ5A 3SYTA 3SEXA 3GTMJ 3ZQ7A 4W97A 1B1HA 2KLOA 4XR6A 4RLQA 2R71A 2LMDA 2OBGA 4KCCA 1NUZA 3RPQA 4OXVA 1B4ZA 4IO5A 1OJLA 2VB6A 5D8LB 1U78A 4RNSA 2DSFA 3ZMSA 1YS7A 2PMUA 1B5JA 1Q1KA 2Y5LA 1LVKA 3HRUA 4HEA2 4B44A 4OYVA 4F1VA 1LBXA 2V3TA 4KDPA 5DV5A 2Q0OA 1URGA 3QPHA 2F5XA 1LSTA 3W3CA 2OC6A 1QRYA 4I98B 1W0TA 4OVRA 3V5AA 1XGOA 2QL3A 1WJEA 3IAM2 4OU0A 3DP6A 2VXZA 4KT5C 1CNQA 4R9GA 4IHYA 2IEEA 3DPTA 4G7OF 2FA7A 2XGCA 3TDUC 2Y0SN 3QP6A 4F92B 2EK5A 2LVSA 1FLIA 3FATA 3LNQA 2HVQA 3BP8A 1IN7A 2CV1A 4DXBA 2BEOA 1XI6A 4HTGA 2MH9A 1ZBMA 3ZOBA 3Q3SA 2M5WA 2RF1A 4PJMA 3D1RA 5H8FA 5M5WJ 2OF7A 3LAJA 4L17A 1JUSA 3I71A 1TWHJ 5H6RA 5F1RA 5L9OA 1RYOA 1JKOC 3S2HJ 1SD6A 5A5XB 1GLNA 1FYLA 1R1TA 2KT0A 1JVYA 4JX5A 4WKMA 1I3AA 3C18A 3HGGA 3BPXA 3I59B 2JA6J 4WXDA 4XLEA 3OOPA 1H89C 1YZ0A 2E71A 2FD5A 2EZIA 4YAHX 5H2FC 1B4HA 1MMNA 4PFBA 1U6GA 5BNGA 1MW7A 1DTZA 1SW4A 4H8JA 4QBAA 2DLLA 2B65A 3RSNA 3TTLA 2AIXA 1LGBC 2RQPA 2ELKA 3LWFA 1D5YA 4A0XA 2MG4A 5JEIA 1G3SA 4PSWA 1W7PA 2YU9J 4C1TA 4JBZA 2V79A 2ID6A 4CUGA 1UHMA 4I76A 2VONA 3CI8A 4NE4A 3CFLA 2NNYA 4HX7A 2CV0A 2W1OA 3VXBA 2K40A 4M72A 1G2HA 2F8DA 1IV8A 5ILUA 4ISUA 3GUDA 3IB2A 2O68A 1XS5A 5B7DA 3DP8A 1IMBA 1F9BA 3JTGA 2DOAA 1MS7A 3G3ZA 4E6KG 3G3HA 1JHHA 4TLLB 3BTCA 4DI3D 1R1UA 2AHQA 4BACA 4YKJA 2F7CA 2X6YA 2CZLA 4HXVA 2XAFA 2GZWA 4AU7A 1NMUA 4O8MA 3HSEA 4X9TA 2UVGA 1UMQA 1W36D 1ZQ3P 1LEAA 4U0VA 2FJ1A 4A5MA 5B66C 1VFEA 2QKLB 1OFCX 5J4YA 2WBBA 3IOVA 2W00A 2B3FA 3H3GA 1H88C 1USYH 2WA0A 5DT6A 3CP8A 5EEAA 4Q30B 5J8FA 2XXPA 1RESA 5DVIA 2MW8A 2V26A 4RAGA 3BG3A 3S3OA 4BXXJ 3PPPA 3JZJA 1K4SA 3W2VA 1B9MA 3GTLJ 1VQKI 2P7VB 1FQBA 2EIKH 2FNCA 5EYGA 2RC8A 4KYWA 4XKWA 1SVXB 1MGTA 4KICA 4EM1A 3I4PA 3WG7H 2RCBA 4GYIA 3CHGA 3OYNA 5EHSA 1FOKA 1N76A 1RDYA 2H5YA 4WXJA 2ESHA 1BOAA 2FX0A 2L7FP 3W9VA 5CC2A 2IS4A 2P7CB 3LA3A 3VE1B 1SMTA 3BLYA 5F04A 1B2HA 2K02A 4ECFA 3GEZA 2Z3YA 2Z16A 1KGSA 2E1NA 4A0YA 3JAMK 3TTKA 5GAHJ 1ENHA 3ZCOA 3IFCA 3VFZA 4HNVA 2F4MB 1KA8A 4H4KC 4BUPA 2GLOA 3G71I 3BT9A 3HOXJ 3ABMH 3CDIA 3QAHA 3SEZA 1ZR2A 2XXQA 1VZ0A 1HC8A 4PFWA 4OINF 5LFAA 3OMBA 3A2KA 4XKQA 3KX2A 1UG0A 1LBZA 2HR3A 2X48A 3DCFA 2KQRA 2DT5A 3O9PA 3JRAA 1IAWA 2I8DA 1EJ9A 1R6ZA 2A61A 2PX9A 2K4BA 4BJTA 2HAVA 5BOXA 2A5SA 3HEFA 4XQFA 2A6EF 4DXUA 3Q27A 4KPTA 3OS1A 4JP0A 4XBFA 4OVJA 2GFEA 1B1XA 2MFZA 2DK5A 3V8LA 3K2DA 4O3CA 2VN2A 4CH7A 2FIXA 3E6DA 2XB0X 4H6DA 2W4SA 4YB5A 1QUKA 4D5FA 2R5YA 3O29A 5EZHA 4WCGA 3C2BA 4IRGA 5FLXZ 1Y39A 1EH3A 1MXYA 4F3BA 2MD0A 1H0MA 2VT3A 1POY1 2PFYA 3H06B 2UYFA 4E7SA 4YFKF 2P0WA 4L9TA 5LHGA 4K3FA 3HG9A 4HCWA 4U4SA 4POWA 3KBRA 1F9NA 4LLNA 1S9HA 4LK1F 3G3IA 4N6DA 3KZZA 2H25A 2E7WA 1FWZA 5LEKA 3E5QA 2WTEA 1BI1A 4KI0E 1Z77A 4U4XA 1MBGA 3PMXA 3E3KA 3DF8A 1YO5C 1N04A 4OTEA 3FXBA 4HF2A 1IXCA 4DI4B 1UZCA 3BG9A 3UNGC 3VVFA 4JB7A 1NG7A 1I50J 1R49A 3VVEA 3REOA 4Y3OA 1EV7A 4ZZLA 2DWAA 4P0GA 3VLUA 4BEHA 4F2QA 2DA6A 2A05A 1FYMA 1Z6RA 5DYMA 3IJOB 2UVHA 5AA4B 2FOKA 3I58A 5J16A 4IVNA 3LSPA 3RTRA 3T22A 4IRHA 3LSTA 4EM2A 4U1OA 3L2CA 2AXLA 4GWSA 2QMXA 3V89B 1TWYA 1B4AA 1ULYA 3CCSI 4N15A 3OYEA 3MZ1A 3TELA 1MKMA 4EQ9A 1R1NA 4O94A 2L2OA 3DLLF 4IX7A 3QYFA 1T33A 4PBQA 4M9ZA 4KNYA 4ZE8A 1KYZA 1FC3A 1VTNC 2DA1A 4DYCA 4O3BA 2PJRB 1XCBA 5DVJA 4ESWA 1H44A 2A3SA 2H94A 2FMYA 1BP5A 3WODF 4ZC3A 3U1KA 4XIDA 3RZDJ 2BY2A 1A31A 1GR2A 4FHTA 4KFCA 1EU8A 4XLCA 2JA7J 3N26A 2IA2A 3WAEA 3K6VA 1MD0A 2IA4A 3M9AA 3OELA 1ZELA 2WBMA 3ZQFA 3F0CA 4BQOA 3ZMVA 1J7KA 2UVJA 1FSEA 2DQLA 3CJQB 2OCCH 3HGYA 1ZMGA 3HRMA 2HXWA 2OCUA 2E2HJ 3R26A 3KSJA 3LBSA 2ONRA 3QAXA 4L5EA 5IZ3A 5TU0A 3FWEA 1IV6A 2VOZA 4FECA 4ON0A 1UTHB 4XXUA 3S8PA 2DODA 1R9TJ 5E1XA 2R7TA 2R7SA 2A6HF 2CWEA 2ICWG 2RNJA 3CO6C 1FEXA 3C4MA 5K1YA 1DMBA 4NC7A 2YUSA 5I3SA 5EQAA 3IH4A 4HX8A 2WV1A 3LOCA 1LNWA 1BR1A 1X4PA 1SYIA 1B7HA 1MBEA 1OR7C 1JEUA 1P7JA 1Z1DA 4YG2F 2HDDA 4CYCA 1DGWY 2B9SA 2KKOA 1YJWI 2WWYA 5I58B 1NUWA 5EQ7A 4HNTA 3ISPA 4FE8A 2D5WA 1AMFA 2M3AA 2HKOA 1MY0A 2LF8A 1MY2A 3G3FA 1N3XA 4Q0CA 1J09A 2ME0A 3S9MC 4CCOA 4UVCA 4X6AJ 3T9HB 1WDNA 1APLC 3VVDA 2RDPA 4O3AA 1ORKA 3OL3A 1IMDA 4OFJA 3UK4A 2F36A 1NG6A 4X1DA 5BPDA 2H98A 3WE3A 1YRNA 2HZKA 2H6CA 2K5CA 1TFAA 3MFKA 1B3EA 1OQGA 3HOYJ 2Z9OA 1KZHA 4RXLA 1B59A 4PAKA 1Q1VA 4F3PA 2E5NA 2DQRA 3F8MA 3IR1A 5CMCA 4U87A 5FBPA 3KN7A 2VC1A 1J1NA 4NBQA 3Q26A 4O3MA 4WF2A 1KQ0A 3U8QA 2K86A 3DEUA 3BROA 3F6OA 1DUXC 4FEBA 3UKGA 4LVQA 4MCOA 2E7XA 4PFTA 2DFEA 3RQ4A 4M9XA 4RLFA 5IT9Z 2FVZA 3HOSA 3MP8A 4UA8A 3K4BA 2E1OA 3OL4A 4OWRB 1USSA 3LAPA 3QODA 3OYGA 2IGKA 1I39A 2Z1DA 2Y7WA 3KEOA 4F93B 3DBRB 4A5NA 2XXIA 4KYSA 2P5VA 4C3IJ 4XOPA 3FMSA 1Z05A 4C2MJ 1I6HJ 3FVOA 4FJPA 4QXDA 3H5NA 3MAJA 1ITYA 4M3DA 1AWBA 1G3WA 3IK6B 3ERED 4QPQA 4CCLA 1IRZA 5ICEA 1B7ZA 1TT0A 3SEQA 3HOWJ 3CFZA 3GF2A 3Q9VA 5EQ9A 3VSKA 3AL0C 5CVIA 1U2WA 4P1EA 2DA4A 3O2AA 1ZTRA 1AA7A 5ET6A 2IA0A 2W48A 3CLQA 1Z91A 1YJ9I 3QK6A 4I1DA 4DW6A 4UUSB 4MNPA 3B73A 5CM6A 3FKIJ 1OCZH 3HRTA 4R1HA 2GXAA 4BS9A 4E4HA 5FRNA 2LK2A 2E34A 1NTCA 2XF5A 4ZS9A 3GFJA 2L7KA 3TCHA 4ZYHA 2NVXJ 3LSLA 4IO7A 2KPMA 3CSBA 2EZKA 1D0YA 4LIVA 1K6OA 1FOXA 4OVTA 1VFCA 2UWMA 2I49A 2X26A 3K00A 4FIMA 3B02A 4LZ7A 1MDQA 3ZMUA 3ABLH 4H0WA 2MH2A 2PJRA 1O7TA 4GRKA 3GLLA 4C3HJ 4M3GA 3FHZA 1MQDA 4OVSA 4PAFA 2MBFA 3O97A 4CICA 4LK0F 4ZEBA 5LHIA 1NK2P 1B3LA 4L9JA 2ZYOA 2QSFX 1S50A 3EPEA 4RAYA 2LC2A 1ZARA 2LLKA 2MGQA 4PF6A 2CUZA 2LF7A 3ERMA 4P96A 1FJ6A 3CFXA 1Y6IA 2KL4A 1UFMA 4BGDA 4YMBA 4GQOA 1ZGJA 3OEMA 1IDYA 3ASOH 5E3MA 5I56A 4G8MA 1TQPA 1VFDA 5B70A 3JRIA 2FYIA 2QS4A 1T56A 1WJCA 2EA2A 2MSYA 3E0JB 3K4JA 3SDBA 1A99A 2OX3A 5AA2A 3MZHA 1USYE 1KONA 1EF4A 1GVJA 3PSFA 4A6EA 4YIFA 2WB1A 4C2TA 1LFGA 2VC0A 4PDKA 4U7DA 1F5TA 4CHUA 2M0MA 4L0ZB 1KA0A 4KCDA 1VQLI 3ONQA 4NB5A 2EB7A 2JUGA 2JVHA 5FFXA 3EETA 4MIMA 1EH6A 3CUQA 1IIWA 2ZZXA 4XFEA 1JE8A 4IRIA 3FM3A 4F7ZA 1B6HA 3L2WA 3SDFA 1YE9A 3KYCB 3CMAI 2OUMA 1XX5A 1GXPA 4NX1A 4R74A 3EPZA 1Y3NA 1EZPA 2EFQA 2KIUA 1WVJA 4EQQA 2QFLA 3H03A 3J80Z 5CVRA 3PPQA 4MHFA 5BQTA 3BIGA 4MJOA 4ELOA 2O5RA 3NEUA 2LD5A 1Z7NE 4N81A 3W9WA 1RKTA 4NC8A 4CO8A 4OANA 2EPFA 5F1QA 5K2XA 2EFWA 1K4TA 1MNMC 3BR0A 4P3LA 4BDZA 2YX4A 4II3A 2KP6A 1KYWA 4EJWA 2ZSHB 4MF3A 5CQGA 3C1DA 1B72B 4EV0A 4TLMB 2M8EA 1WI9A 2FNAA 5ILSA 5FHMA 2F7AA 3JW4A 2VJJA 4BXFA 2MD5A 1E17A 3SESA 5T3JA 3RIRA 3R6SA 5ICGA 3TO9A 1FRPA 2R9JA 3MVWA 1V5FA 2O8XA 1T0FC 1JUMA 4RGSA 2DWIA 4P1LA 4QSCA 3E9XA 2IVMA 2NVUB 1W7PD 3CUOA 1MM6A 2OCEA 3CP2A 5D5WB 3RYPA 3CG3A 5DW8A 5FROA 2ADUA 1OCCH 3KCCA 1W5SA 2NS8A 1FTAA 1TFDA 2WYPA 3TO6A 4IO4A 3RLFE 4EEFG 1TT5B 4NC6A 3JCUC 2G7UA 4UUTA 2M34A 4OIOF 2LKPA 1QGPA 3TQWA 4PK4A 3IRQA 1BM9A 4H65A 2WB1N 1KQ9A 4NF5A 2D5VA 2HDCA 4OMYA 5IY5H 3K7AJ 1BBYA 3LA2A 2HZTA 4MEYF 2L5QA 2OTJI 2I3VA 2V84A 1VQ9I 2GAUA 4E7HA 1JTXA 2XXTA 4NN3A 2QSHX 3HSRA 2CQ7A 4P0IA 3L2VA 3FIRA 5DEXA 2IAIA 4C9YA 2CZKA 3H3ZA 2NXNB 3DPLC 2Z8FA 3M8JA 1OYWA 4GWZA 5CRYA 3T8RA 4NHJA 2X6OA 2IXSA 2XAGA 4HE0A 5EEGA 1XOCA 2QWWA 4GRIA 4C2UA 4ZZEA 1GV5A 3OXNA 1RR8C 3QUFA 4Z7EA 3AFHA 1QVTA 3MMYB 4NF8A 2KRHA 1A36A 2J5PA 3TQLA 1IN4A 2IGNA 4EJOA 1UTBB 2DN0A 2HS5A 4RY1A 2Y9YA 1LUJB 1ZG5A 4GVOA 1OCRH 2VT2A 4AQ4A 2P6TA 1PUEE 4KMFA 1H9GA 1NV0A 3ROJA 4WXCA 2DFHA 2H8RA 3IWFA 4F39A 3I4NJ 4XTCQ 3FBNB 1RETA 2BZTA 4UXNA 5J3LA 4BDQA 4I01A 2OWZA 2VIXA 2XHKA 3PUWE 5C3EJ 3HXLA 1R5ID 1R71A 4GWWA 2CQQA 5J1DA 2PX1A 3M1EA 1SD4A 1Y0UA 2Q1ZB 3MQ0A 4J19A 1MMAA 3U65A 3JR9A 1FBGA 4Q8RA 2XPWA 2UZKA 3T1BA 4PFUA 5B3SH 4JXIA 5CMBA 1OLTA 3CF5F 4YZZA 2JUCA 2M9HA 4XEQA 1R4MB 2X51A 1ZRCA 5L3GA 1TTYA 1Z3YA 2ESNA 2PJPA 4F31B 3S1RJ 3SDGA 5L3EA 2A5TA 4UUVA 4HSRA 2L54A 4ZJZA 3UA8A 3RKYA 1JP4A 3OO9A 1XG1A 4XONA 4YRVA 1D9VA 1I3QJ 3DEEA 4PUSA 1N0TA 3ZP5A 1U5TA 5EJCA 2EFOA 2X4HA 1D1CA 3IH3A 4DNCA 4Q48A 2PT2A 4I02A 2R5ZA 4DYQA 1VNDA 2CS3A 4QIWN 2GH9A 1MPDA 5DM6F 4ZYAA 3HTSB 2HU9A 1FTZA 2L5VA 3TP3A 3L6HA 1DBZA 4KQPA 1F4KA 1DDNA 1IQ7A 3PNVA 2EH3A 1WJDA 3HUGB 4RA2A 5DDGA 3E79A 5GTIC 2H99A 4NQWB 4GXOA 3N6TA 5BUUA 2YSRA 5HLIA 1VQ5I 1WSUA 2W7NA 2P81A 2Q8KA 1BC8C 1ZG1A 4XKCA 3TO7A 2WAFA 3Q0WA 1HA8A 3RTFB 4E0XA 1FTTA 1R4NB 4HAMA 2YPRA 4L5JA 3GZ6A 3V8JA 5AA2B 1LB2A 2O51A 1MBFA 3BFUA 2HQNA 2F7BA 5ILVA 2X7PA 3DKYA 3DBHB 1GHCA 4HRIA 1SD3A 1S8NA 3T93B 4HV5A 3V7RA 3V4GA 2A68F 2JK3A 4YIIA 2HQ5A 4CDGA 4UNOA 1NNTA 1V3FA 1Y4CA 2Y7PA 3DTIA 4E7LA 2XRLA 4QSHA 1MQGA 3MP1A 3L09A 2ZNYA 1YOVB 1R1VA 5LGTA 1SVLA 2LRDA 3KZYA 1B3FA 4IHVA 1XGNA 3Q29A 4PFRA 2DA3A 3BDDA 3S3MA 1KU2A 4ZDLA 1J2XA 3B50A 4L5IA 1JTYA 4OVPA 4W1UA 1ZREA 2VLAA 1NKXA 3KPHA 1ZU0A 3C2GA 4G8HA 5K7FA 1JGGA 4U88A 1AWCA 3H9GA 4XRSG 4IHSA 3P7NA 4CA0A 1AU7A 1S7YA 4TV7A 3KE2A 1D8KA 1XN7A 3ROUA 4GDFA 1XGMA 5KAIC 2E1MC 5TPAA 1FTJA 1OQHA 2OQRA 4DZPA 2STWA 1BW6A 1D8JA 4OZ9A 1NFTA 3GBAA 4G68C 4DIGA 2Y5KA 4DZJA 2MLGA 1U5TC 1EZ9A 5M5YJ 1A8EA 3LSKA 3WHBA 1PB8A 1LAGE 4D7NA 2CFOA 1IITA 1FPIA 4H5GA 4F91B 4G7HF 3G1LA 2VQLA 5DUKA 2CMOA 2ONKE 4XNFA 1ETVA 1MBJA 2BGCA 1OCPA 2XGEA 4FQGA 5FKNA 2KLFA 2L9SA 2FEZA 2LSOA 2XIGA 1VQMI 2NRAC 3RDIA 1X3UA 4LOCA 1RYXA 2LNBA 3ZQGA 3S4UA 9ANTA 2GQQA 3QQAA 2EA4A 3C3WA 4AB6A 1ELJA 5CJ9A 5EF6A 3BPVA 3M8FA 1GT0C 1HDDC 2XXHA 2P5KA 3FVKA 4B47A 2ZYNA 3C32A 2YPNA 2MC4A 2JSPA 2PYYA 5HLGA 3CCJI 5FLXK 2BY1A 2QJEA 2NOJB 2E19A 3CCLI 2XX7A 5TP9A 3WGIA 1JUPA 2Y2ZA 5C4JJ 1NI9A 1Q1HA 5L9SA 4BBSJ 3MSTA 4N8GA 3LSIA 5E18F 4IQ4A 4WX9A 2XAHA 4I99C 1IN6A 3UR3C 3I6VA 2HTSA 2RKHA 2IS2A 3HKZN 1TLHB 2DJIA 5DCMA 1OCOH 2JRMA 2Z33A 1WJ5A 2XGXA 3ODBA 2ZNUA 3OO8A 1SFUA 2X7QA 4ITVA 3RGYA 1TXFA 1WJFA 3J7AO 3T8TA 1IG7A 2L4MA 1H8AC 4XICA 4ENJA 3S9LC 3PQJA 1LPQA 2VBWA 1G59A 3TP0A 1IXRC 1W36C 1FMVA 4XF5A 2GIVA 4BLAA 1BI3A 4LN5A 2M87A 3CESA 3KEQA 2Y0MA 3FDYA 1VSOA 1MSEC 2HGCA 2LAOA 1FBSA 1HSJA 2L01A 4FCYA 3CQZJ 5LRRA 3CF2A 1BA5A 4NF5B 2CUFA 4MHGA 1BTJA 2F4IA 2OPTA 2W84A 4R2BA 2VJ4A 2IRFG 4RGUA 3K6GA 1FBHA 1WJBA 3W6JB 3OSQA 3C34A 5ICQA 3LSWA 2Y84A 3HV1A 4HW8A 3K4KA 1F36A 3L2RA 2PFBA 4II2A 1ZAOA 4HX4A 3E13X 4OFLA 2W7YA 2EBIA 1XB4A 3Q9SA 4N9HA 2XAJA 2CQNA 4WXHA 1JT0A 1KZ8A 3HHGA 3HL2A 3C33A 1MDMB 3ZKKA 3L7WA 4LIUA 4IHXA 1FMWA 5H8NA 3DP7A 3O8HA 3KLNA 3TOAA 5GPCA 2R7VA 5TGTA 3OYIA 5J1UA 4F19A 4BBRJ 4MQVA 3HKZA 1M5CA 2KZGA 2GRVA 2ID3A 3Q25A 2EIJH 2N8GA 2VJ5A 2ZJPF 1S7AA 2NVQJ 2F97A 1I6XA 1HKTA 4NWCA 4QFOA 4U22A 3VSLA 2OLBA 3ZSFA 2XXXA 3MKLA 3QYEA 1T98A 4PP0A 3WU1B 4R6KA 4P9UA 1FIPA 3H3UA 5JI6A 4QPOA 4XKVA 2VBYA 4GCVA 4HLYA 2M7BA 1QPIA 3IX1A 4LG0A 3LUZA 3T5XA 3AKZA 3SEYA 5BWJA 2HYFA 1LLSA 3SETA 1ZLKA 3JTHA 5IYDJ 3KGCA 5H8QB 3FD3A 1OLCA 1QZEA 1S7EA 2L9NA 3FGSA 2ZYKA 2EILH 5FTIA 1HW5A 2A5WA 4OQOA 1TNTA 5E1WA 3S9EA 4S05A 2GXGA 3MVPA 3K0VA 4NF4A 5H8FB 4EMSA 1XC5A 2FQ4A 1KWHA 4N0BA 2VPNA 2HPGA 1FP2A 1Y0NA 1HXDA 3QYTA 1Z7ME 4H5FA 2EV0A 2XD3A 3O6IA 2DYRH 1SC7A 4IGTA 3WTZA 3VLWA 4XSZF 1FW0A 3H92A 3BY6A 3M1CA 3F72A 1G0HA 3L6GA 1NH7A 2ECBA 3U9GA 3LSRA 5EQ8A 4QSDA 3S16J 3ONMA 2H8WA 3TMOA 2F6CA 2O84X 2PFZA 2DA7A 4BKXA 2P3VA 4BDMA 4XM3A 3EDPA 3MZ9A 1G8XA 3NWSA 2HYGD 5ET7A 4EUOA 4KUMA 3ILTB 4GOTA 1W7PB 2XROA 2OD5A 4HW0A 4PZJA 1TT1A 5AA4A 1LVAA 1J5YA 4HOBA 2JQ7A 1QA6A 1D3YA 4Z6YA 4GO1A 2NVTJ 2O9LA 5IT9K 1PJRA 1RI7A 1J75A 1OVBA 4MLOA 2FHYA 4N13A 1IMAA 1MQJA 4X1BA 4G4PA 2P5LC 1RIOH 3F8BA 3M3FA 4FEDA 3I9V2 1FSHA 4PTKA 4D7MA 4U0WA 2IP2A 2RNGA 4HBLA 4GX3A 5LRSA 2LY2A 5ITPA 2I6EA 5HS7A 3FM5A 3BR3A 1UAAA 2DYSH 5L3CA 4ETSA 1HLVA 4DOZA 1MPCA 2OZUA 4F52A 1VQOI 5HM4B 1PBPA 1QZZA 4YKPA 2WAQA 1YTYA 2E35A 4BYYA 3AXFA 1FTOA 4QFPA 2DMNA 2RC4A 4CYCB 1YHQI 1FBEA 1FPJA 3GWZA 3PM1A 1VF9A 3K70C 4PGHA 1KU7A 4N8YA 2QBYB 2ABHA 3PD9A 3EYIA 1XDSA 4DBQA 3K70D 1IZ1A 3CMMA 5J6XA 4OVQA 5FD6A 3WAFA 4EXLA 1K83J 2Y9ZA 2AS5F 3ZQLA 1XVXA 4BHCA 5KDTA 5KNLA 3LFUA 3ZN0A 1SFOJ 3SZPA 4P1WA 3CC4I 2ZJ2A 2QS2A 3N6UA 3CMYA 4FE7A 3F21A 2QVVA 3H6VA 2ZJRF 4M6XA 4X0GA 2Y30A 5CMMA 3GTQJ 1BW5A 3ZGKA 3QRFF 5KZTA 1HBXG 3O6HA 4A3FJ 1AL3A 1QULA 5LLQA 2R4GA 4ASNA 3EUAA 5K5RA 3N5LA 3PD8A 5FD5A 3KZIC 1XMAA 3RUMA 4BDRA 3UP9A 2JVGA 2K27A 2F6PA 3ML6A 3WU2C 2FQ3A 3S1NJ 3J7YJ 2KRFA 3TZAA 4LMYA 1K61A 1YXIA 5FRMA 4F29A 4AD9A 2NWJA 5F24A 3FMRA 2CUEA 4JWYA 4H45A 2H6BA 3A29A 2M30A 2QYOA 3PUFA 3O8GA 2XSDC 3MW0A 4C0RA 2BY3A 1IC8A 3KETA 2CUJA 2DDAA 3DELB 4Q5SF 1JXSA 3QIMA 2DOJA 5E8GA 1N84A 1E3HA 2CO5A 1O7LA 1WGXA 4LP2B 3T0JA 2P4WA 2EQRA 4NNJA 4RGXA 1XDUA 4BU2A 4YKKA 3B7DA 1WHUA 1MMSA 4YICA 5F08A 1K9YA 1R00A 2Q2AA 5EG0A 4UACA 2F48A 2G7HA 1S7OA 3E7LA 2OZZA 4PFYA 4RB3C 2Y7RA 3HPHA 1J0RA 5EYRA 2JTVA 3IHUA 4PDDA 3BFTA 5C4XJ 4UB8C 4IGRA 3IKVA 1O3RA 4O7IA 5BMZA 4Y33A 3PIPF 1FQFA 2Z22A 5IYBJ 1LCFA 1O63A 5H8HB 4FT8A 4I7HA 4YELA 1HDPA 2P2AA 3K4UA 4MLQA 2BW3A 2DFIA 3DM0A 2R3SA 3K1PA 1U8RA 4PAIA 3LA7A 1N75A 2F3DA 3LFKA 2VPRA 1EYKA 3KZGA 3HTUA 2E1SA 3N97A 3A01A 2DVZA 3MZYA 5H20A 2R93J 3S3NA 4HE1A 5IAIA 2MC3A 3SJMA 4RS8A 3HOTA 2HHMA 1ZLJA 2PMSA 3S2VA 1LJ9A 2V1XA 4G6TB 2QPQA 1MMGA 2FBIA 2Y31A 2QUFA 4AIJA 5LBQA 2CMPA 1FOYA 3OYCA 4GWXA 3EF7A 1ZK8A 4F22A 4L9VA 2LY9A 2XB5A 4QSEA 1DPRA 4BHBA 6PAXA 1LEVA 2H1KA 3HDDA 4LITA 1K7AA 1X1AA 1QJMA 2I3WA 3BBRA 3HUGA 3FXOA 3D4GA 2BYVE 4XMYA 4LB6B 4BDNA 1MDMA 3TKDA 4F3SA 3OYBA 3CUQB 2AXTC 3FXKA 3LQQA 4U7BA 3RZOJ 1EKEA 2QS1A 3KFWX 5LHHA 4PDHA 4HA8A 1U9NA 3ZMDA 4AIHA 1FTMA 1YYZA 2XWIA 3MVXA 4GBVA 1YW9A 1Y1VJ 4MX6A 3IRRA 2LKSA 1XHYA 2F5CA 2V93A 2EZHA 3ABUA 2L02A 3BR2A 4NHBA 2H1LA 1BJAA 1MY4A 1IMCA 3DKWA 3NAUA 3OSGA 1QVSA 3FV2A 5DTDA 3BOQA 2DYXA 3W6KB 2O61A 3DBLB 4PE3A 4QFLA 2HQ0A 3LSMA 2CU7A 4BH9A 4J01A 4L18B 2Z8DA 2M4KA 3V42A 3I55I 2XKOA 1M1EB 1R9QA 2THIA 3FJGA 3LUYA 4HDVA 3ECOA 3BIHA 3DU5A 1ANFA 1SW1A 4ESJA 3JAMZ 1T39A 4OOIA 1TWAJ 2DP8A 2O6AA 1P4XA 4I9DA 4XRSA 2JA5J 2HPMA 1B5IA 3CCYA 4GYGA 4DYRA 2V6EA 4J00A 3W15C 2Q2CA 1Z0XA 2BXYA 3OYMA 2QQ9A 5EGOB 2GHAA 2WADA 4MLVA 1IRXA 4M6YA 3EUKL 4Y13A 1KU3A 1UG2A 5ESYA 1LDKB 2JPBA 1PB9A 3VODA 2PLYA 2IBDA 2ZXWH 2V9PA 2PI0A 1P1OA 3OV8A 1PC3A 1NNKA 1XVYA 3J7ZI 4MFDA 1YX5A 5KCJB 1XD7A 1BR4A 3F8FA 3V8KA 2XAUA 3K4MA 4KN4X 1W0UA 1KU9A 3D4CA 3OYDA 3I53A 2W24A 2XDVA 2XGDA 4IXAA 1VQ6I 2JA8J 2X9DA 4IB2A 2M8GX 2HCAA 2DOFA 2AQFA 1O57A 4EVIA 5D6FA 3OO6A 4LD5A 4Q5TA 3DWLE 4IOCF 4HF0A 3CD6I 3B8BA 1ZH5A 2CG4A 5E20A 1DK4A 5HLHA 4H8IA 2E2IJ 3PSIA 2R7DA 4PJLA 2CGPA 4Y15A 3S93A 1SPIA 4M6VA 4NMYA 2F5FA 5IP9J 4NEDA 2O6GE 1X58A 2HOEA 2TRTA 3KEYA 3RPLA 3JSOA 1SFKA 5E3LA 2WEFA 1ODDA 2Y69H 4OMZA 2G93A 5DEQA 3TAJA 2LYCA 2YS9A 2DTZA 5BPIA 2QSGX 1MBHA 3CCEI 1STZA 4Y7NJ 4OIQF 1WJAA 1SYHA 3FJMA 2IPQX 2X6XA 2ZZWA 2R7RA 2KDOA 3L2UA 4LQ2A 2RCAA 5ET5A 3K4LA 1Z67A 3FXJA 4QF9A 3PMWA 2E60A 3RNNA 2HTJA 5D5VB 3ULQB 1PUFA 2ZXIA 4C1UA 5IP6A 2RN7A 2HNHA 4HLXA 2GIZA 2ME6A 4ANJA 3WTVC 3G4SI 4A3CJ 1Y3PA 4GFRA 2LBFA 3SZTA 1ZN2A 1M5FA 2DS9A 1P1NA 2JWTA 1EH7A 1T95A 1GDTA 4MIJA 1D1AA 3PFYA 2ZNZA 3KLOA 4N4OB 4M71A 5ICFA 2Q88A 1TP4A 2REGA 4A3DJ 4P9KA 4I62A 2IA1A 1OR7A 1Y8QB 1RKWA 2IW5A 5DD8A 3F22A 5TJJA 3FBIB 2J5OA 2KMUA 1YJNI 1HW2A 4A93J 1BK4A 2F3BA 4D5CA 2M1BA 5M5XJ 3J7AY 4OEVA 4XLAA 3TBIA 2HFBA 5EZGA 1IXHA 1SFEA 2DT6A 4JBAA 3OOUA 3N05A 3QPLA 1G6NA 2B4LA 2XPVA 2F5EA 4QTRA 3MUQA 2L7MP 4CYDA 4PETA 2HXOA 4NQWA 2V7FA 3H9JA 5HNHA 4KIGA 3D5RC 3ZXSA 1FQAA 3WTSC 2XC7A 2O7UA 3O66A 1ONVA 1ZJLA 3U1OA 4PFPA 3PTYA 1US4A 5HOOA 2P0SA 3ZMZA 5FB2A 3J81Z 2G0EA 3MCZA 3PFIA 3H7MA 1JJ8C 2LG4A 1JW1A 3MYUA 5I2KB 1X3ZB 3PUXE 4P5OA 3FMQA 1XPXA 3K1MA 1UELB 2A5TB 3HC7A 5DCFA 2I10A 3WTXC 4XN0A 2BVLA 4LLGF 5AONA 1B58A 3ABKH 3VV5A 5CVUA 1U5TB 2CEYA 4N4NB 2D2WA 3B6AA 3OYKA 1YPNA 3TODA 3VYRB 4I3EA 5GP9A 5D5XB 3TKYA 3ASNH 4JX4A 5IGAA 3G2BA 4Q47A 1AOYA 2XUBA 4IO9F 5B1AH 5H8HA 1YW7A 1Y56A 3FIWA 2QVOA 1MBKA 4E0WA 2QZ8A 2OA4A 2W57A 5AE4A 3PGFA 4LG3A 3S9NC 3RT6B 4JOMA 3V7CA 3U94A 4LONB 5H8NB 5D6EA 4YU0A 1XC1A 2E5ZA 2R0QC 1MNDA 1F43A 3VYSB 4MBPA 3LV0A 2TCTA 1V5EA 2RREA 4B1RA 1I69A 3EKIA 1IUYA 1DCUA 1SANA 3IUOA 1D5VA 1PBQA 2K3FA 5DS9A 4AS4A 1G4DA 1HOMA 1H76A 3KYDB 1W5TA 3HHFA 4B3AA 2GBYA 5J1YA 1GVDA 3IP4B 4HPQA 4D0PA 3PO3J 1NK3P 5IT3A 1SDXA 2DVCA 2OAZA 4G68B 4ENNA 3IC7A 4ESFA 2HVSA 1ZR4A 2R5YB 1YYVA 2OQGA 1HSTA 3OS0A 2DCEA 2DK8A 1MPBA 4P55A 2XXKA 1TWCJ 3A09A 5I56B 1X2MA 1O64A 3P5JA 5LGNA 2BV6A 3TEPA 1LBCA 3HSTA 3S32A 1IN8A 1FNNA 3B6TA 3M8UA 4NF6B 2DMQA 1PEBA 2MABA 2V9KA 1K79A 1MSFC 3SERA 2DI3A 1FOWA 2HFHA 4HF1A 3GZNB 3GTGJ 2NOGA 2PMHA 3VEPA 1MXWA 1WH7A 2GWRA 1G0IA 3KC0A 3QPSA 3CG1A 2K4JA 2QLZA 5CLSA 4G7ZF 2JN6A 4ZTFA 1YW8A 2KJCA 1N3WA 3CVGA 4JVCA 3VXCA 1MNEA 2DE2A 4HYEA 3BZ6A 2D3IA 1S9TA 3RPLB 2K9NA 1NV3A 2DOEA 3E6CC 3R4KA 3SXYA 4GLIA 3R0AA 3OY9A 4RB0A 2RC7A 1JGSA 3ZS6A 4UV9A 2RC9A 3N4MA 3FV1A 2O0YA 4M9SA 2IS6A 2Y0SA 4KT6A 5D4SA 3LC8A 4YFNF 3SZGA 2I4CA 3GBBA 5A5LA 1T8IA 5FFZA 4PBHA 1PP7U 1QUIA 4LFUA 2VHAA 1QHHD 3HN0A 2ISZA 2DWHA 1UHSA 1PDNC 2HWVA 3RPUD 1JT6A 2FBHA 2VASA 1Z7UA 3HPIA 3JRFA 4B48A 1CF7B 3Q0VA 3MJNA 4NG7A 3TTNA 3UN6A 2XXRA 4OEUA 4H0EA 2K9QA 4EJUA 1MY1A 1DQUA 3PV0E 4M3EA 2X1CA 4F3QA 2O7OA 2ZXHA 1MMDA 3CJTB 2ZMEC 3GFIA 3CCUI 1V5GA 1XS9A 1TQIA 1LQ1A 1P92A 3H6WA 1ETXA 4MEVA 1K78A 1T2KA 1OIBA 1SBPA 3QP5A 2MKZA 3CMEI 3PUZE 4ZDMA 5JR3A 1FYKA 3T9VA 3IO4A 3D5SC 2ALUA 3MWBA 4KXPA 1YITI 2OWSA 1DPPA 1USTA 2DTRA 3ZMTA 1T0FA 4BL0B 3T0YA 2JMWA 5F64A 1R7JA 1FPFA 1LFBA 2VPLA 2UUZA 4I0AA 3ZRGA 3S2WA 3CDHA 4B3XA 4GD5A 1I6BA 1X1DA 1YS6A 3GW2A 1MZBA 4R8HA 3KP6A 3U93A 4HSTA 5HNFA 5GAGJ 2X0LA 1NNFA 3M07A 3WGHA 1B9NA 1J59A 1OVTA 2JJKA 3K01A