2QMWA

The crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGTINIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQFDYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFDQNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAITTDIKKVIAILETLDFKVEMIGAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
molecule keywords Prephenate dehydratase
total genus 71
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmwA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA02
1LK5A 3ENWA 4JWYA 1P1UA 2H99A 3WAEA 2HFBA 2DT9A 2P9EA 4ECFA 3H06B 1MQHA 3TUJC 1MXYA 5JJBA 1CB6A 2UVJA 2XX7A 3U8QA 3IB1A 3O2AA 5I57B 2V93A 4XTCQ 3ZKKA 4PE5B 5I57A 2XXRA 3MVXA 1LFHA 3ZSFA 4NF5A 4TOZA 3U1OA 4DCYA 2I0BA 1IZ1A 1DTGA 3VV5A 3TTLA 1ZIUA 5I58B 1B40A 4Q30B 1A8FA 3RN8A 5I58A 3Q27A 3MW0A 1B51A 5M2VA 1JW4A 5CMCA 5TP9A 5CMKA 2NOOA 3EQ1A 5FHNA 2O7UA 3FV2A 1Q35A 4ZE9A 4DCXA 3P96A 4GF8A 5LOMA 1MXZA 2V3TA 3KFMA 2A5TA 1URDA 1Y20A 3TZAA 2CMOA 3MTJA 2X7PA 3ILTB 4ZS9A 4ZEKA 1B05A 4GO5X 2YPNA 2O84X 4IO2A 2PX1A 1MY4A 2F97A 1VSOA 2O6AA 2VGQA 4NEDA 2KLFA 4XKQA 5H8QB 2F1FA 1AMFA 2P1SA 4POWA 4F39A 4R74A 2FGCA 1QKBA 4R2BA 4LZ7A 3K01A 4H8JA 3DM0A 5JTYB 4U1OA 5FHOA 4I9DA 3H4ZA 3H7MA 3IB0A 3K6WA 3Q26A 3VXCA 2F7CA 1Y4CA 3FXUA 4IO4A 2HZLA 2DQVA 2O69A 4F19A 3QYTA 1DPEA 1Y3NA 4OFJA 2M8CA 4RPNA 3T93B 4R72A 4H8IA 1II5A 1N3WA 2NUVA 3G3FA 2I4BA 3KSXA 3FIRA 1OMPA 1B4ZA 2OWTA 2FYIA 1EU8A 2Y7KA 5AA3A 4N13A 1CE2A 4EDPA 5DTBA 4GL0A 3KBRA 1URSA 4KI0E 4G68B 2ZHOA 4GWOA 3Q25A 3QXMA 2O68A 4IO1A 2AL4A 4XKRA 4MFIA 1JW1A 1XTZA 5CBRA 2ALUA 3VFJA 3W9WA 1A99A 3AB4B 4NF5B 1MY3A 3I3VA 4ZEFA 2F35A 1US5A 4P0GA 1ZJLA 2DWJA 1IXGA 5B7DA 4GQOA 1D9YA 3V5AA 1BIYA 1H3DA 3E3KA 4NF6A 2DSFA 4R6KA 1TWYA 4I62A 1LKZA 3MZ9A 1A7LA 5KZTA 2PC6A 1ZBMA 4Z7EA 5CI5A 4OHNA 3RT6B 3TMGA 4WEDA 2A5TB 3H6UA 5KCJB 2P9GA 2DS9A 1N7WA 2H5YA 1SW1A 5HPQA 1IIWA 2QS2A 2XXVA 3IXQA 4TLLB 4F2QA 3UGWA 5IAIA 2Z22A 4FORA 4YB7A 4I1DA 3HSTA 2XXIA 1TT1A 1LLSA 1SD3A 1P99A 4X1DA 2R6GE 3SETA 3TTMA 3PPOA 2UYFA 2AL5A 2P9CA 2ONRA 1YPNA 3CI8A 4GD5A 3BFTA 4ESXA 5AA2D 3LSLA 1NNTA 1LFIA 1OVBA 1QKAA 2DE2A 3KG2A 4WKMA 1O63A 1YAEA 1PBPA 1FTKA 2B3FA 1T0KA 1UJ4A 1M5DA 1ZKBA 3OFFA 3HO7A 4G77A 4XKPA 3FVNA 3EHSA 4FJPA 4ZZAA 3OMBA 2V84A 3O1LA 1OVTA 4DE8A 2Z8FA 5CC2A 2H98A 3UN6A 1LCFA 4QFKA 1SI1A 4KR5A 3WAFA 1N04A 2REGA 4OVJA 4OZ9A 3GXAA 3K6VA 1JVXA 3VVDA 4YB5A 3FVGA 4IY6A 3K5PA 5CRYA 3PD8A 3T22A 3DP6A 3OELA 1B0HA 3KGCA 4EF2A 3VLWA 2FA7A 3DC2A 3TCHA 4ISUA 1A40A 3BBRA 4F31B 1EZ9A 1OQHA 3TELA 4LONB 2Y7PA 1B3FA 1SQYA 1XT8A 3GZGA 3THIA 2UVHA 2XXXA 1TFDA 3TQWA 3DHXA 1BTJA 2HAVA 1N76A 3ENQA 3CG1A 4DXCA 5IT0A 1HSLA 1M5FA 1LAHE 1QJMA 3OO7A 3KSJA 4U22A 3UORA 2AIXA 3C32A 4QSEA 1MH4A 1VR5A 2ZYNA 2VD3A 4F3BA 4LP2B 2G93A 4QSCA 3KJ7A 1MDQA 4F3SA 3C9HA 2XXUA 4ND9A 4R6YA 5FHMA 1UTHB 3KN7A 4AB5A 2CZLA 5AA2B 2QSWA 2PA3A 1YTVA 2QMXA 1I6AA 3HV1A 4F1VA 1MPBA 4F22A 4YICA 2CDQA 1S9TA 4YB6A 2IA4A 5I2KB 3RTFB 3KJTA 1FQEA 1IEJA 3VLVA 4QRZA 4Q5TA 4BDLA 4YMBA 4PFYA 2I49A 1URGA 3K1PA 3OENA 4R2FA 1LBBA 4HW8A 5L9OA 2ONSA 3FGSA 1B5IA 3MQ9A 2DVZA 1QUJA 3BFUA 2QSXA 1US4A 1R6ZA 4G8NA 3SDFA 2ZNSA 1FTLA 3O28A 2XXTA 1TFAA 3CFXA 3O66A 3M3LA 3QK6A 3EPEA 2XXHA 3R6UA 4ESWA 3K1NA 1NMUA 2BJJX 3FXRA 4HCWA 4IGTA 2D3IA 1B3LA 2ESNA 4L17A 2IEEA 4YZZA 2I6EA 3K1MA 3IBWA 2I3WA 3LC8A 3C33A 2QS1A 1B7UA 1LSTA 4G4PA 2YJPA 3K6UA 3I5OA 3EHUA 4N07A 1GR2A 2DYXA 2OBGA 3C34A 2Z23A 1KWHA 2DP8A 4WEPA 3ZS6A 3BKIB 4LA9A 3KOSA 3KOTA 4K3FA 2H4IA 5FIIA 5TPAB 3Q29A 3QSLA 1MS7A 5TPAA 3I6VA 4NTLA 2QRYA 2ZMBA 5ISUA 2I9SA 5DT6A 2DWHA 2O1LA 3UW1A 2P0SA 1B1HA 3TEPA 3MWBA 4H0WA 2RCAA 1B6HA 1PC3A 4QFOA 4ZEBA 1B46A 4THIA 4FECA 2V25A 4H5GA 1M5BA 2GH9A 3N26A 4OEUA 3OSQA 4UA8A 1LAGE 2Z8DA 5DVJA 4YKIA 1VFEA 4ZEDA 3E4RA 4OEVA 3AB2B 4PWUA 1D9VA 3IJXB 3OFGA 1FW0A 2I3VA 3OSRA 1JVYA 2ANJA 4RK2A 3T9HB 3FATA 4JB7A 4OETA 5J1DA 1B5HA 3Q28A 3PPQA 1A8EA 2RQKA 3OO9A 3CSGA 2DVCA 4H5FA 1MM7A 4MLQA 1LB8A 5EHSA 1FQCA 2UVGA 5TU0A 2O7IA 4EF1A 2XHDA 3K0VA 3IK6B 1N7XA 3MUQA 2V3UA 2RC7A 4F2OA 1AH5A 3FUZA 2ABHA 2XX8A 3T9VA 1ANFA 1IXHA 4GL8A 1UIVA 1YBAA 1MG1A 3S9NC 4E0XA 1VFDA 1UQWA 1RKMA 3TCFA 3T9XB 3PV0E 4XKNA 1B2HA 1MM6A 1Q1KA 3MAMA 3VLUA 2UVIA 1I6BA 4KYSA 1B52A 1UIUA 3O6GA 3IOTA 3QUFA 2ZYOA 1MQDA 2RKMA 4R6HA 3OOAA 1FTOA 4ELQA 5K2YA 4EUOA 1BKAA 4X1BA 4H65A 1U8SA 4ZE8A 1BP5A 1IITA 3K6XA 2YLNA 4QFNA 1FQDA 3VVEA 1R9LA 4ZEIA 3EN3A 4GXAA 4QFPA 2JOQA 4LATA 4EQ9A 4YKPA 3USDA 2Q88A 4IO5A 1B3HA 4PQJA 3A3CA 3CIJA 5JEIA 3GLBA 2THIA 4FAJA 3L6HA 3FJ7A 4M4GA 4H67A 4IY5A 3U92A 1VE4A 1Y3QA 1LCTA 3U94A 2DTJA 4F29A 1SBPA 1P1OA 1MPCA 4U1ZA 4QFLA 1GTKA 1FQFA 1MQJA 3SEYA 3TPAA 3O97A 3UK4A 3KN8A 2DXRA 1P1WA 4NF4B 1RWUA 1MQIA 1EH3A 1ZMGA 1H45A 5DVFA 1UTHA 4GRKA 4MBPA 3PPPA 2Y7IA 5I56B 4TLMB 3SEXA 5I2NB 4RPOA 1UTBA 3B7DA 4NF8B 3TKDA 3IX1A 5F1QA 4F1YA 3C35A 3IO6A 2VHAA 2F34A 5AE4A 4OQOA 2VD2A 2F78A 1Z7ME 3TAJA 2NWJA 5BUUA 2Q89A 4JSDA 4F18A 5KDTB 1UJ5A 3CRBA 2GRVA 1J1NA 2H9BA 4EQ7A 1Z7NE 3IAZA 4F1UA 3TFLA 4BDRA 2HQ0A 3HHFA 5K2XA 2OJTA 3B6QA 2HEUA 1FQAA 3TQLA 3S9EA 3TTRA 1PB9A 4DIGA 3D4GA 4BDOA 3PMXA 1F9BA 1FTJA 1PEBA 3M8UA 3T66A 2Q2AA 1Y7PA 5I2KA 2J0WA 3TUZC 3D4CA 4LQ5A 1Y3PA 4U4SA 5HBCA 3B6WA 1NNFA 2GHBA 3PUVE 1DMBA 4WXJA 1NH8A 3MPKA 2QMWA 3CR9A 2FNCA 4JSOA 4NMLA 3H6TA 3IO4A 3N6TA 2QJEA 4GOTA 4F3GA 1MY1A 2GHAA 2QRRA 3C4MA 4HCYA 4PFWA 5H8HA 1KS2A 1AOVA 1NNPA 4PP0A 4G2ZA 1R9QA 5ICTA 2XXPA 4GXSB 4ZDMA 2F6PA 4Z0IA 4KHZE 1POY1 4AB6A 3SEUA 2PT2A 1LFGA 2NVUB 3TCGA 3W15C 4OFLA 5H8FA 2DWIA 2XXWA 3DP4A 4YAHX 1SW2A 1L5TA 3FVKA 4LZ8A 3S4UA 2HXWA 4DLDA 1MXUA 3V89B 1P1NA 1N84A 4QF9A 1ELJA 3MBPA 1FTMA 1SYIA 4U2RA 4AQ4A 5I2NA 3LSWA 2JHEA 3CFZA 1RYXA 2GFEA 4NF8A 5F7VA 2O51A 4BDNA 3QIMA 4RNSA 1B4HA 5AA4B 5CM6A 3K2DA 1QW0A 4GIZA 4GFRA 3OBIA 3AAWB 2I48A 4QHQA 3H6WA 2ZXTA 4MH5A 5JTYA 4KPTA 3OO8A 2REJA 5EYFA 1ZPVA 2UXAA 4H6DA 5CMMA 2ZYMA 1POTA 1SW5A 2XXQA 1B7ZA 3K4UA 1SI0A 2OCUA 4GO7X 1N0TA 3RLFE 2Q2CA 4F3PA 3T9UA 4FEBA 1IXIA 2D5WA 4RY1A 4FE8A 3PPNA 5ITPA 4ELPA 4JXIA 3H03A 1XVYA 3ILUB 1QUKA 1XHYA 3W7BA 2PYYA 3G3IA 4G8HA 4YU0A 4KD5A 3U72A 5H8NB 1GV8A 3PUWE 4JDFA 3FVOA 1RYOA 5AA2A 3K02A 3UP9A 2PBWA 4KYDA 4C0RA 4JBZA 3V8XB 2OZZA 3AXFA 4O3CA 3RT8A 2ZNTA 1M5CA 3IOUA 1WDNA 4FIMA 4IO3A 4KQPA 4R9FA 4O3BA 1MDP1 4HTGA 3EHTA 3C36A 3G3GA 3TDJA 3G7WA 1WVJA 3LSFB 2F36A 2P2AA 4DDDA 4NF6B 1P1QA 3SEVA 3VDFA 5AA1A 2F7BA 3PUYE 3KN3A 2I0CA 1PDAA 3LR1A 2Y7WA 2UYEA 4XIGQ 1ZLQA 2F8MA 4KFQA 2PVUA 2X7QA 3F11A 5FTIA 5H8QA 2Q8JA 1XC1A 2F5XA 1HSJA 4NWCA 1MPDA 5EHMA 3RTWB 2E0SA 4FEDA 4PFTA 1H44A 3TYHA 2RC9A 5IS2A 5IT4A 3GBBA 3K00A 3MP8A 1USYH 4YMAA 2DXYA 3JYRA 3JZJA 1DPPA 2RINA 1H76A 1SDXA 2XD3A 2Y7RA 5H8FB 4NF4A 2RC8A 3GBAA 1SC6A 4U21A 3VE1B 3MZBA 1LB9A 3P7IA 1D3KA 3A09A 3LBSA 3TTNA 5I56A 2RQMA 1NNKA 3RY3A 5H8SA 3R7XA 3FJMA 3PPRA 4X9TA 3IB2A 3A3UA 1I69A 3G3KA 1YCJA 4FATA 4P0IA 4O3AA 1LAFE 1EZOA 5A5XB 4M8LA 4KCDA 5A5XA 1MY0A 5ICQA 3ODBA 3FD3A 1UTBB 5CMBA 1A54A 1XOCA 4GMKA 5DEXB 4OWDA 3FV1A 3SERA 3FZVA 2B3BA 3U93A 5AA4A 4OMBA 3OXNA 4OFOA 3PU5A 3N0VA 2MDAA 3RUMA 4X48A 1QULA 4R73A 1R1NA 4G8MA 5KDTA 2QPQA 2I58A 3TUIC 4GLIA 2VP1A 3RNNA 3O6HA 3PMVA 3ONMA 5L9MA 1JEUA 5L8DA 1QVSA 2V3QA 3OO6A 4JWOA 4LQ2A 2HAUA 1EZPA 3SESA 2F8DA 4EXKA 4LZ5A 2PMSA 5CBSA 1JEVA 4RJZA 4LUBA 1NH7A 4ZZEA 4OYVA 3LSXA 2RE1A 3TUSA 1SW4A 1OIBA 1JETA 3SKPA 1LK7A 4C1TA 2XXYA 4Q0CA 3RPWA 5JK4A 5TP9B 2LVWA 2O1MA 2OK2A 4E0WA 1S7YA 2NYIA 3RGYA 3MPLA 3ENVA 1BLFA 3TTKA 3ECRA 2G29A 4RXLA 4U23A 3PGFA 3MP1A 1MXWA 3HN0A 1OLCA 2VOZA 3HHEA 3MVZA 1M0SA 2WKYA 3DLNA 1GVCA 1B0LA 1JNFA 4DXUA 3IOWA 1IXCA 1NL5A 3B6TA 1WODA 3OEKA 2ZNUA 3DHWC 4P11A 4Q8RA 4MLVA 2I4CA 1MRPA 5I59A 4YKJA 1M5EA 1QUIA 4I8CA 4RYAA 4KYEA 3IL1B 1D4NA 3SEWA 3CG3A 2HZKA 3MC2A 3FXQA 2QL3A 2HCAA 2RCBA 4JWXA 3MVYA 4QSDA 3FASA 3MP6A 1ZTYA 1SVXB 3E9XA 3S1TA 2D21A 2QS3A 1DTZA 3IR1A 1B32A 4OESA 1A55A 3IJOB 3EF7A 3G3HA 1NKXA 2NXOA 1JQFA 2ONKE 3N5LA 5B70A 3DP8A 3MZ1A 3CEDA 2AYSA 2F6GA 5HM4B 3G3JA 1IUDA 1GGGA 2RF1A 3LUYA 3S9MC 4H1XA 3PUXE 3OFEA 1Y9UA 2W7YA 3KWMA 1S50A 3PUZE 3S2VA 2KO1A 3HHGA 5FTHA 5L9SA 1YGYA 1SYHA 3KEIA 5ELVA 4PETA 4RA1A 1TXFA 4R75A 1LGBC 4BLAA 1N3XA 1Y4TA 3KZGA 5T41A 1LBCA 1DOTA 2H25A 4U4XA 3PMWA 3N94A 4XXUA 3HCQA 4ELRA 3IOVA 3C31A 4BDQA 1MH3A 3OD7A 1ZU0A 1O64A 5H8NA 2Q9TA 2LAOA 3QAXA 3MAHA 1MXVA 1USYE 1MXXA 1PB8A 4OERA 2LQJA 3LOUA 4EQBA 1B58A 1O8BA 5DEXA 3R26A 3T96B 4NMYA 4OENA 4ONYA 1H43A 3UA8A 2J0XA 3L7OA 4IGRA 4OTEA 3QUJA 2QS4A 3H6VA 5I84A 3O6IA 1Y1ZA 4DXBA 2PT1A 3CSBA 4N6PA 1B1XA 1XS5A 4POXA 1JW5A 5DYHA 3V83A 1NFTA 3U7JA 4X84A 2DWAA 3DELB 2XX9A 1PB7A 1B9JA 3TODA 4BDMA 1Y1MA 3MJNA 5BWJA 4UACA 1MQGA 5DVIA 3VVFA 1PBQA 5KCJA 5ITOA 4IO6A 2ZYKA 1AL3A 2E1SA 3M3FA 1OQGA 2X26A 4EXLA 3N6UA 3L6GA 5H8HB 4GVOA 2A5SA 1OLAA 2OLBA 4C1UA 4OXVA 3OFHA 3O29A 4G68C 4ZECA 4HS7A 2R9JA 3E13X 3HPIA 5IKBA 2F7AA 3UIFA 4M1VA 4LVQA 3DDNA 3NRBA 3S9LC 4KCCA 3FJGA 4NWDA 3RQTA 4YKKA 2R71A 2B65A 1B7HA 3MVWA 3CVGA 1DSNA 1B5JA 3CFLA 3O9PA 1HSEA 1MY2A 2DE3A 1LAXA 1B3GA 2DOJA 1PSDA 2H9ZA 1AIVA 2Y84A 1FQBA 1B3EA 4PFUA 4DZ1A 3OEMA 4IB2A 5I59B 3IORA 4R9GA 3PD9A 4ELOA 3JV9A 1I6QA 3H3GA 4MF3A 4G68A 3M3KA 1FCKA 3VXBA 2DE4A 4NE4A 1XVXA 3W9VA 1O7TA 1ATGA 4IO7A 2OWSA 2Z8EA 1UJ6A 4RK9A 3ZKLA 4TQUQ 2XD2A 1IQ7A
chains in the Genus database with same CATH superfamily
3TZWA 4PKDB 3UFCX 3HX9A 1R0AA 2N7YA 2G13A 3V81A 4QBUA 4JWYA 5GAHU 1NZ8A 1P1UA 1UVJA 3A8KA 4P10A 4X4NA 1CULA 3Q8PB 1UWBA 5J2PA 1X5OA 4ECFA 1NEEA 3H4BA 1JQGA 4AD6A 1Y5NB 2KRRA 3TUJC 1NK5A 3Q89A 4LRAA 3TAPA 1Q53A 4ED3A 2OPQB 5I57B 1KA0A 3AXKA 3ZKKA 1FRKA 4I6YA 4IDKB 3ROJA 5G0RB 1TKTA 3ZSFA 3QFHA 1N32J 4DCYA 1KWMA 3ULHA 2ZHBA 2P3VA 3L95X 1ZIUA 3TTLA 3CC4S 4XPEA 2CZVC 4UY8T 2J9EA 5F9NA 1A8FA 5LMNJ 1RJJA 1LBWA 1T9UA 4M5KA 5M2VA 1JW4A 4GX4A 3MZIA 3DXBA 3EQ1A 3SDEB 5FHNA 4EYHB 3RR8A 1TAQA 4ZLNA 3QMQA 2IY5B 1B0VA 4MCOA 1TELA 4CQ1A 3HKZD 4TVAB 1EP4B 5HMWA 5A8WB 2XS5A 3KFMA 1RT6A 4S0MA 2R2TA 4ZCMA 1X9WA 1WOOA 3HLUA 4FF1A 2CMOA 3TZAA 2RF2B 3W8GA 4ZS9A 3DOMB 1S5ZA 4NHBA 3ZTOA 3W61A 1HNIB 4O23A 1FE4A 2PX1A 2F97A 2VGQA 2F8EX 5H8QB 2F1FA 3JTPA 4LF8F 2KKHA 1DRZA 3BSAA 1AMFA 2P1SA 4A8WA 2JLFA 4HI2A 1IMDA 3JAMY 4F39A 1QKBA 2ZVSA 2HHMA 4R2BA 1FK9A 1NK6A 1Q8IA 2DO4A 3UDLA 4LZ7A 1IBLF 4X4RA 1T11A 4DS5A 4X4PA 2F7CA 4NX9A 3VXCA 1I1GA 3NGSA 3JSMA 3SFGA 4WZQA 3ILLA 4O0NA 1L3UA 2PE8A 2CZHA 4R5PB 3PJXA 4DQPA 4DWIA 1NV5A 3AA9A 4F2RA 4OFJA 2YH0A 1EETB 2M8CA 4MK7A 4RPNA 4R72A 1EARA 3G3FA 3VAKA 2HHHJ 2FY1A 5ADZA 2MLYA 1RHKB 2DPIA 3FIRA 3NS6A 4Y2IA 1OMPA 2VKRA 5B0EA 4NYPA 1FD8A 3MPWA 5AA3A 4N13A 2W7OA 4EDPA 3KBRA 4KI0E 2FC9A 1REGX 4GWOA 2LFVA 1NHVA 3PO5A 3QXMA 1TL7A 5L39A 2LECA 4UOGA 4RWWA 3AOBA 4PPDA 5GMEA 4NASA 3LW5C 4MFIA 4DBQA 3DLJA 1JW1A 2F9JA 3BGUA 2ALUA 3W9WA 3HHLD 2G2ZA 2QX0A 4NF5B 1MY3A 5E3CA 5HO4A 1ZYQA 4F3MA 1US5A 5HQ8A 3L3CA 2Y1LB 2W8KA 4MMOA 2LYVA 4JUZA 1D9YA 4GQOA 1NB2A 1PJ6A 3DYAB 1IR1A 1T9XA 4K2XA 3KC0A 4DEZA 1LBXA 2DSFA 1S1WA 3SCIE 3MEDA 1TWYA 3K89A 4QR1A 4UOFA 1KQFB 5KZTA 2DGTA 4B3MJ 2OPQA 2VPWB 3TMGA 2I2YA 2FIXA 2A5TB 5KCJB 1OQ6A 2XXVA 4N81A 4PXBA 1IKXA 4TLLB 4F2QA 1TKXA 1NK9A 3AY0A 1U2RA 4DR1J 3I5BA 2FDNA 1FJ7A 1LLSA 3GYGA 1TAUA 3W2VB 5BR8J 4PE3A 3TI0A 1TTHB 1HA1A 3PPOA 4I6WA 1KD1T 4IOBA 1S99A 4OHWA 3H5XA 2UYFA 2MLXA 2P9CA 1YPNA 3HFUA 1CBKA 2XLJA 2NUUG 4N8OA 1YZ6A 1Y5IB 2KHCA 3H2LA 5L1LA 2HXRA 3QSYB 4O0IA 4UUXA 4WF9Q 1UZHA 4F50A 2SXLA 3CO0P 1SJ3P 1S1TB 4DUYF 4DL7A 2V4RA 3RB4A 1HNIA 3GFZA 2IJFA 3BQ0A 3OFFA 3HO7A 4G77A 1B7YB 1JJ4A 4ED5A 4FJPA 4LR9A 3OSNA 5ET7A 3SQGA 2UU9F 1JB0C 1F6TA 3O1LA 1RT3B 4CT9A 1OVTA 1AYEA 3VAMA 1VC6A 1GXLA 4DE8A 5DG7A 4UUWA 3MMAB 5LMNF 2Z8FA 4WIQA 4B3RF 4WFAQ 1YI2S 3JQJA 4N8YA 3UCGA 1SI1A 4KR5A 2M3DA 3I31A 3ZTPA 4OVJA 4TQSA 2BA9A 4F02A 3GXAA 1RK8A 2D1CA 5CRYA 1WSRA 3GIJA 2BJ3A 3QWPA 3T22A 2FJXA 3POTB 3OELA 5T7LB 1B0HA 4EF2A 3VLWA 1YJUA 2FA7A 1OYDA 1IMEA 4O3SA 2V2ZA 3VV2B 3TCHA 4EWTA 3BBCA 4BDPA 3ITHB 3PACA 5F8HA 4FYDA 1A40A 4J9UE 1DLOA 4OANA 1Z2LA 5KFSA 1NV0A 4U67Q 3C8YA 2V4CA 1F5BA 1B3FA 3KUGA 1H6KX 4QZVB 3DU6A 2X1AA 3PJ9A 2AZ3A 1OIAA 4X65J 3TQWA 2OSRA 3DHXA 1SCJB 1BTJA 1ZM9A 3KHHA 5LXRA 2HAVA 3QGPA 2XLIA 2VPZB 2DRBA 1HSLA 3OO7A 1RWXB 1KQSR 4DV1J 4KGKA 4NYOA 2JJ4D 4RW7A 3M8QB 3TANA 2Y8YA 4QSEA 2VD3A 4F3BA 4LP2B 3MGJA 2N3OA 4KY3A 4ES3A 1MDQA 3AD7C 4X66J 3GILA 3LH2S 3IFCA 5FBPA 5FHMA 1M1GA 1GAOA 2OHDA 2BX6A 5AE2A 1UTHB 2J8SA 3LP1A 4AB5A 4I64A 5L46A 3H98A 4P47A 4KGXB 3DGVA 4X8RA 3D9BA 2NREA 4UY85 5G0RA 4HHHA 1R31A 3R7NB 4YICA 1S9TA 4YB6A 4NQ8A 2KG1A 4YUDA 4Y2KA 4OX9J 2VG6B 4DL2A 5DLGA 3EM1A 3RTFB 2IJNA 2MHEA 5F0WA 2B9YA 2HVIA 4A8OA 1FPJA 3V6KA 3EWGA 4DCOB 1HYSB 3PEJA 3VAJA 3QYYA 5E0OA 4Q5TA 1KR4A 2OPRB 3VGVA 4PFYA 3BH6B 2YKNA 1URGA 2D3O1 3OENA 3KLEA 1NRKA 2OMLA 3TOQA 1QAXA 3MMBA 2ONSA 2ZHAA 2R7QA 1FWLA 2M4MA 2F40A 3I96A 4OJ1A 1WELA 3K57A 2ZNYA 2QSXA 2JZ5A 4B9LA 2IVYA 1RKIA 3O28A 4G6VB 4N91A 1T3NA 4ESWA 3K1NA 2BJJX 5D4NA 4HCWA 1DQ8A 2DEJA 4QCLA 1OY6A 2FC8A 4L17A 1NKBA 2DNGA 2QL5B 2G9OA 2NPIA 2NXEA 2JVOA 3M9NB 1P9YA 4CLFA 1IBCB 1R8BA 4C3LA 4DR4J 3ZTQA 3LC8A 2QS1A 1B7UA 4G4PA 3D68A 2JLGA 4XF5A 4URGA 2FHMA 3TEGA 4K4WA 1IM4A 3C6TA 3DOLA 5GADI 1GR2A 3K58A 2DYXA 3DRSB 1NSKL 1LFWA 4Z37A 1T05B 1FKOA 4YY3F 3EXCX 1KWHA 1APSA 2KI2A 4YR3A 2YNGB 1VQOS 2DGOA 3QSLA 2XYPB 1MS7A 1WHYA 4ICLA 2QRYA 2PD1A 1RA6A 3FJ2A 3D4JA 2I9SA 3K8WA 5E2QA 2C2OB 2P0SA 4GBVA 3IWLA 3NL0A 3M8ZA 4LBIA 2APOA 3CCJS 4X64F 5HK4A 4THIA 2V63A 3LAKA 2FVCA 2AJ2A 4C11A 3KBZA 4DV0J 4HE0A 1VQSA 1WF1A 4AQYJ 2ZWOA 2AV5A 2VPOA 3R5JB 4OVSA 1PGZA 3NNAA 2OD6A 4UA8A 1NLKL 3EGWB 2IM2A 1MU2A 4ZEDA 3DRRB 1Q4RA 1XI6A 3CCZA 3B8BA 3BO4A 1SV5B 3PM9A 2I3VA 4Y00A 2ANJA 1JNRB 5B0AA 5I7IA 3FATA 4PG4A 1KN6A 1OO0B 3FEYB 3Q28A 1R27B 4X66F 3OO9A 1ULRA 1FPGA 1YITS 3CSGA 4H5FA 3BM7A 1LB8A 2JEJA 2F3DA 3DLHA 5TU0A 1HWJA 2CQ1A 2O7IA 2DISA 4EF1A 3PIPQ 2XHDA 4M95A 2WOMA 2EC0A 1TKXB 2QZ8A 2V3UA 2L41A 4F2OA 2F4FA 1MWZA 5KT7A 1IXHA 1I5OB 3OVBA 2FQQB 4DSFA 1YBAA 4YEAA 2KYXA 3DN9A 3S9NC 1M5KC 2JSXA 4DPTA 4PUOA 1X8DA 5DW8A 3IC1A 2LEBA 2V8DA 4F2SA 4N6KA 1QVFR 4XKNA 1B2HA 3UE2A 5KG0A 3B54A 2QYGA 3EGNA 4PEOA 1N0VC 4QIVA 1FPIA 1RWKB 2KT3A 3QUFA 4F36A 4ZDNA 4RW4B 3VCDA 1N5SA 3OOAA 1RWVB 4WZMA 4X1BA 4L73A 1U8SA 4LMZA 3PYDA 1QE1B 2YLNA 4QFNA 2FLLA 1R8AA 4CNYA 3P8BB 2PMZD 5A0YB 2OEJA 4DV2J 3EN3A 2WB1D 2ZM6F 1HQEA 4EQ9A 1PG5B 1YRXA 3U1LA 1PYTA 4CCHA 1T94A 4K4ZA 2GNKA 1KFDA 2XWYA 4NLUA 1FRPA 4ZK7M 4GWSA 5HROA 3CIJA 2HQDA 1FBEA 3BF4A 4E0DA 4EGLA 4CO1A 2PI4A 2Z57B 2GAHC 2WSCC 2I38A 4N15A 2W9CB 3E01B 4M4GA 3T1YF 4C8ZA 5ITHA 4IY5A 2KYZA 1UVMA 1IQZA 4CZCA 1UVIA 3KMQA 2DTJA 3SCKE 2XM3A 2W2NP 3CO9A 1W2IA 1S57A 1MQJA 2O01C 4E2FB 4WK1A 1RTDA 4ECSA 3THPA 5HP1A 1P1WA 4NF4B 1RWUA 2G2YA 2GAGC 5HQMA 1RDRA 2XS7A 4LF5J 4DS4A 1OY9A 2B4PA 4X4TA 2M7SA 3B7DA 5H9FK 1JLFB 2BJDA 4W90B 2BM1A 4RW7B 2B5JA 1REVB 5KT3A 3F44A 1Q79A 2VD2A 4J5OA 4WXOA 2QVVA 4V19X 2K7JA 3G96A 2NWJA 2Q89A 4JSDA 4F18A 5KDTB 2GRVA 3NS5A 1J1NA 1KTVA 1JXEA 3C14B 3HSGA 2XMUA 4LSLA 1TL3A 5K2XA 3B6QA 2HEUA 3TQLA 4QOTA 3FFIA 2Y5LA 2VC1A 1U47A 3QBCA 2HHUA 1SUQA 4OJHA 3PMXA 2BJ9A 1IUJA 2R7UA 4N6DA 2J0WA 1VQYA 3G8SA 3D4CA 3M9OB 4OVRA 4DJBA 3PUVE 4BLGA 4ANCA 3QT5A 2PDAA 3TR5A 4ZPVR 2CZ9A 4A8YA 4NMLA 4BBYA 1G0IA 3N6TA 4NA1A 4UABA 2RKIB 2QJEA 1DJ0A 2PI5A 3QZ7A 2KTQA 2MKZA 2GHAA 2QRRA 3C4MA 4HCYA 2BRLA 5H8HA 3FBBA 5RUBA 3FBEA 3ZNJ1 1S49A 1VQ7S 2UUCF 2ZZNA 2DHSA 3I0SB 5D6GA 1LWFB 4HACB 1U1OA 2CJYB 2XXPA 4B9NA 1PCAA 1IN0A 4KC5A 4ZDMA 1YXIA 4U95A 4MKAA 5KFEA 3VVUA 3SSQA 2O1PA 4JI5J 2QFIA 1JJ2R 2XYGB 1JXLA 5IT9Y 3H5UA 1X60A 2DWIA 2XXWA 3DP4A 4N41A 4YAHX 1SL1A 3KTQA 2AMCB 1WSVA 2M8HA 3PEHA 3FVKA 3V2UC 2ZWPA 4QF9A 1E6VB 3MBPA 1FTMA 1SYIA 4M63A 1N6QB 4ITSA 4P52A 4DN9A 4H4MA 4AQ4A 4RBUA 1RAOA 4AL7A 3GP9A 2O51A 5IV3A 4I67A 2H4WB 5CM6A 1HL6A 2ZH5A 1HQ2A 1QW0A 1ZS6A 4HDHA 2V2KA 4DV5F 3OBIA 1F2GA 4BC7A 2GVZB 2ZKUA 1F3FA 1WC0A 1QUPA 5DDPC 3IN5A 2ZXTA 3EMTA 4KE5A 4O7MA 3KUHA 4FKXA 1S1UA 3O6QA 4AXIA 4JV0A 2P3NA 2YQ3A 5AXNA 3NGTA 2DH9A 3PDNA 4WKYA 1LBYA 2ZYMA 1TV6A 1FDAA 4QYZJ 1SI0A 3PW0A 1R0AB 1N48A 2DNNA 3CSKA 4QIFA 1N0TA 3RLFE 4HH1A 1UWAA 2GO9A 1X5PA 3EYZA 5KT4A 2D5WA 1HPZA 2I0XA 2IYIA 3GU0A 4RY1A 2YQ0A 4EZ9A 2E29A 1LOUA 2YX4A 5KFDA 4I68A 4RU9A 5HAOA 4JVCA 2I6WA 4YR2A 4N47A 1QAIA 3H42A 4Q2MA 4J37A 1GV8A 5T3JA 3PUWE 3FVOA 3BO3A 1RYOA 1T95A 4Y34A 4O44B 4P2MA 1SVDA 5K14A 2OH2A 3MM8A 3TUPA 3NGKA 3UP9A 3MSTA 2WVBA 3JB9k 4C0RA 2HBZB 2HPUA 3KNGA 4LF8J 4LF5F 1HARA 1V3SA 2D69A 1TQLA 3RT8A 4DU7A 1WDNA 5SZTA 4KQPA 4P8BA 5A6WA 2CQHA 4M1KA 2J7WA 4O3BA 3EHTA 2F9DA 3G3GA 2WONB 3TDJA 4ENOA 1IWGA 1EZZB 4NF6B 3BR9A 3HCXA 4KO0B 1D09B 1PDAA 4YN3B 2G0JA 3GLJA 1LEVA 3BSOA 3HZEA 3KHGA 2XZWA 4DUZJ 2F8MA 4KFQA 2HVZA 3OL8A 3T9NA 5FTIA 3TVYA 2OELA 4AL6A 4ED6A 2YKPA 3SFUA 5H8QA 1VMBA 4B3OB 4CM0A 2F5XA 1VK3A 3IR7B 4I7FB 4B3SJ 4QQBA 5JXSA 1FRLA 3KXDA 2E0SA 3RTWB 1X5TA 4PFTA 1H44A 3TYHA 2RC9A 5IS2A 2AEMA 3CMES 3H4DA 4ECXA 1YSJA 1HD1A 5H8FB 2RC8A 2YWHA 3GBAA 3IG1A 4U21A 3VE1B 3OT9A 3MZBA 1LB9A 1O0PA 1SQFA 2CQ0A 1Z4UA 2RVJA 3FXBA 3CW2C 3TTNA 5I56A 1NNKA 5BJRA 4IO9Q 3RY3A 2YPZA 1UFKA 4OL8A 3GWCA 3G3KA 3OL7A 4FYYB 5DJBA 4PAKA 4C0HA 2I5JB 4FATA 3TAMB 1S48A 3TA1A 4ZHRA 5KFCA 1EZOA 1FJ6A 9RUBA 2F8HA 4M8LA 1FRMA 4JV2A 1SXLA 4KCDA 2PIIA 5J1EA 2ZZXA 4FBPA 4OZLA 2GQCA 4P73A 3TARA 4OI0A 1UTBB 1XOCA 4FYXB 1TL7B 2FVZA 3OR2A 3HD1A 2BANB 3RZAA 2OAUA 1TFWA 2V4JA 5F8GA 1FVQA 2B3BA 2AD9A 3TAQA 3ONQA 3N0VA 4F0KA 1CJKA 3MM9B 4IR9A 1KOOA 5AXLA 2HFVA 1QULA 4X48A 3MM6A 4DPWA 4G8MA 5KDTA 1QAYA 4UOCA 2J6SA 2IA6A 1HPZB 3ISND 1SC1B 3OVSA 3DI6B 3MEGA 1RT7B 5F24A 4USIA 5EQAA 4WFYA 4C8YA 1SBRA 4NZ6A 3ONMA 1H7WA 2HQIA 1QVSA 2C2EA 2V3QA 2XEXA 5D77A 3W64A 4LQ2A 1EJ7L 5D3GB 4KAIA 3L7UA 2ZNZA 5EN1A 4EXKA 1TZ0A 4LZ5A 4DPUA 1QUVA 1JEVA 2VG7A 4ZZEA 4M5MA 3LSXA 2WBDA 4NLGA 4IR1A 1SB6A 3ZNUA 1ZAXA 3SKPA 1LK7A 2FLOA 1RLCL 3UO0A 1V9OA 5TP9B 2O1MA 1D9FA 4E0WA 2NYIA 2DNMA 4O3NA 4JV5F 2UVVA 4OX8A 2EVZA 4DV7F 3ECRA 3Q0AA 4RX6A 4IOCQ 2G29A 3I0SA 3VZIA 2Z2MA 1JMTA 1MXWA 3OUYA 3D6MB 2WEFA 3MUMP 2VOZA 2LDIA 3HHEA 3A8IA 5GAEI 4LREA 3UR3C 4P1EA 5I42A 4V19J 3D3BJ 1IXCA 3V6DB 1WODA 3TW0A 1UL3A 2ZNUA 1HKAA 1TUWA 4KGMA 2MKIA 2MZSA 1S9FA 3HVWA 3G6ES 4MMPA 1FCAA 3AJ1A 1NKEA 4N77A 5I59A 2L9NA 1M5EA 1QUIA 2ZKTA 2AQ4A 3CG3A 3NKYA 4M5NA 2CZ4A 4PFBA 5EYGA 5CZVA 2LMIA 5DDQC 2UVRA 1H7XA 2RF2A 1JLEB 5CXTA 2RCBA 3FC9A 1C0UA 4JWXA 4QSDA 1ZTYA 2XNRA 2EFPA 2DR6A 3OJUA 2KFNA 1B32A 1A55A 4WE1B 3RRGA 2AKWB 1NKXA 1IKVA 3H7HB 5J1NA 2ONKE 1KKHA 2CPZA 2KVIA 5KFQA 4HHJA 2KM8C 2DRDA 2PEBA 1NV7A 2AYSA 3Q8UA 4RNOA 1N34J 3MD1A 3PUXE 2W2QP 4ZVRB 1Y9UA 1GMVA 3S2VA 2KO1A 3DFEA 4J9QA 2ZE2A 3T0JA 5L9SA 4P6QA 1RYRA 3JSMB 4LIWA 3KEIA 3TZZA 5ELVA 1EQ0A 1TK5A 4IG3A 3KZGA 2OGUA 4KKOB 3QO9B 2V4JB 4DMZA 4ILLA 1NB7A 2VPXB 4DFJA 3U65A 3C31A 1V3ZA 1D3WA 1S79A 2CQ3A 1MH3A 4MTPA 1QAJA 3KNAA 1O64A 3IM8A 3DRXA 4NA2A 3MAHA 1MXVA 1DHMA 1G3OA 3MI7X 2Z2ZA 1BE4A 4USKA 2R7RA 3TX8A 3LOUA 1B58A 3JQMA 4R0EA 5HANA 3NAIA 1RADB 3WIVA 3Q22A 2V67A 3J7ZT 3T96B 3W2WA 2E5LJ 1FTRA 3D1OA 3DLBA 3ADAC 2MJNA 2J0XA 4LJMA 1S4FA 4IGRA 5IOLA 1KFSA 1BD6A 5C5JA 3EJMA 2DB1A 2JFKA 5KG6A 4OZ5A 1X31C 2WVFA 4FF4A 2PT1A 3UI3A 2CWXA 2GO8A 3T3FA 2LA6A 4OZJA 1WG1A 2L9WA 2MY7A 2DWAA 3LQVA 3MAAB 1S1WB 3PW7A 2XX9A 1X4EA 3MM7B 1PB7A 2K7KA 4F4XA 5F8JA 1WC6A 2DJWA 4M5JA 2GJIA 1VRUA 4QWAA 4NXMJ 2LEPA 3BBFA 3VVFA 1PBQA 5KCJA 5ITOA 2EKYA 1PYSB 5KT2A 1JLQB 5FDLB 4QW8A 3MUTP 2X26A 4EXLA 1ZM2A 3L6GA 3R7SB 1OLAA 4O4GB 1CNQA 1BXNA 3VZHA 4H46A 4CLPA 3DRPA 1X4FA 5F41A 3PR5B 1HNVA 5K20B 4HH0A 5KTQA 2UU9J 4Y0FA 2AGQA 2VIHA 5CD4A 1C4CA 2FIUA 3VGSA 4OA4A 4ZECA 5IZ3B 1FD2A 1S0NA 3V6DA 2B0GA 4NLTA 1IBKF 5I5PA 2HFZA 1WACA 8AT1B 3T5JA 1FPEA 4TYAA 3NRBA 1ELOA 3FJGA 3RQTA 1S1VA 3N6NA 1RABB 2R71A 9ATCB 1T02A 2B65A 2Y1IA 1BQNB 2E1AA 4MKBA 1RWPB 5KG7A 1C0UB 1K47A 1HSEA 1MNEA 4V1Ak 1LWCA 2PSZA 3CJSA 3FMBA 4CRJA 2MKYA 4ZVGA 2H9ZA 4AS5A 1AIVA 2Y84A 3OTBA 1U4BA 2CPJA 1HBNB 3M2RB 4NYZA 2QTWA 2H65B 1F9EB 3IORA 1CC8A 1RTHA 3HHLC 4ELOA 1VQ8S 5E3RA 2N3LA 1ZTTA 3UWTA 3ZO7A 2FHOB 2MJUA 4ZCIA 5HLFB 1NUWA 1FCKA 3OVAA 4DR5J 3GJTB 3U02A 3KK2B 1ATGA 4JI1F 4IO7A 4ANDA 2ZH2A 3DRRA 5K8OA 4TXSA 4GVBA 3CCES 4H54A 4D3GA 1CC7A 2HFSA 1U24A 3R1LA 3IM9A 2H99A 4MHFA 4P74A 3PFOA 4MK8A 2J9DA 4GWZA 3MR3A 2W4DA 2KRBA 4K4XA 1QLNA 2LXFA 2KXFA 4L72B 2B6AB 1MQHA 4NEZA 1FO1A 4K7QA 2GVDB 2DGSA 5JJBA 1IVZA 2FJWA 2JFDA 4XAKA 3IB1A 2IJRA 1HFEL 4IDKA 2V93A 2WYPA 5B0GA 2WOMB 3QAUA 3MVXA 3M2UA 1LFHA 5BYQA 2RDIA 2RQ4A 4FN5A 5T14A 2I0BA 5J1PA 4NCGB 3VV5A 2LU1A 5I58B 2IRUA 5J2MA 4OZNA 2OUGA 3HFZB 4K2JA 2MKJA 3JXOA 5D0EA 1B51A 2ZUGA 4YB1P 5CMCA 1UZDA 2XNQA 4P75A 5TP9A 2Q6CA 3G86A 2PO4A 3FV2A 1Q35A 4ER8A 4ZE9A 2QV6A 3P96A 4GF8A 4X62J 2BKNA 1MXZA 2V3TA 1SL0A 1CJTB 1VBZA 3DLEB 2X1GA 1FE0A 3M8WA 1RAIB 2X7PA 1B0PA 2VJVA 5CAAA 1B05A 1S72S 1FX4A 1O6XA 3TNVA 3OV7A 3VQSA 2DR8A 2XQCA 3HVRA 5E3AA 3P6YC 2BYCA 1HQEB 3SCLE 2FBPA 1BWVA 2YX1A 2IFXA 4POWA 4R74A 2BJ8A 4MKVA 1KBRA 2BVZA 2NXCA 1WUUA 3DM0A 1IR0A 5FHOA 2CQ4A 4C9DA 3HVAA 4I9DA 1XJWB 5EWFA 4KFBB 3OR1B 1EKSA 2BM0A 4A46A 3K6WA 1Y4CA 3FXUA 1KZ8A 1AWBA 3GQCA 3MXHP 2ABYA 2HZLA 2WVDA 3POTA 3PTYA 2DD8S 3MEKA 3MUVP 1DPEA 2ASDA 3GYNA 1HQUA 4OHXA 2BJIA 2HBYB 3HI9A 1UEKA 2HGLA 3V81B 3KLVA 4NCAA 3M9MB 1J5EF 1JLGB 2HURA 4HI1A 1NJWA 2I4BA 2YNFA 2OPPB 3RBZA 4IH7A 1FJCA 4DX7A 3CJKB 1HMVA 2A0FB 1M5OC 1YYZA 2HHVA 2EFVA 1NK4A 4HEA9 3CDAA 1DZ5A 2V94A 2O68A 1KDNA 4USVA 2XS2A 1J5OB 1XR7A 3MFHA 1CEZA 2Z8QA 3N5BA 3EE3A 1XTZA 5A6PA 4QPTA 3J7AN 1S6QA 2C3PA 1HBUA 3ZZYA 1IXGA 5B7DA 3V5AA 2V5HG 3NCRA 4LSLB 1H3DA 3DDIA 3E3KA 4NLYA 1VRTB 1VOMA 1FXLA 4R6KA 2QG9B 3MZ9A 2J7KA 3GG0A 1FFSB 3L09A 1QSLA 4X2BA 4KXPA 2PC6A 1ZBMA 3QGHA 4DV4J 2XWKA 2QE5A 3RT6B 2MZQA 3NOHA 2DS9A 1N7WA 1SC4B 4K8RA 1ACMB 1SW1A 5HPQA 3IXQA 2ZOGA 2R4FA 1VS3A 2BE9B 2BE7D 4A8QA 5AT1B 3IS9A 2XY7A 1P99A 3QIPA 4X1DA 4X64J 2VV5A 1XN9A 1GNKA 3NMRA 3AT1B 4JI7F 2AL5A 4OLPA 1HI0P 4GD5A 4ESXA 3LSLA 1NNTA 3HT0A 1LFIA 1TKTB 4A8KA 2F5GA 3PYEA 2C2MB 4FS1A 2WBBA 3KG2A 4B3MF 4PQAA 4RW9B 4CLLA 4USHA 5GAGI 5KFBA 1O63A 2WZ1A 1PBPA 1T0KA 6FDRA 5KOXA 4KSEB 4XKPA 2JLEA 2QA2A 3EHSA 1Y10A 3IWXA 4AUKA 3W65A 1AB8A 5IQQA 1AZSA 5CC2A 5A8WA 2HHWA 2QSFA 3PJWA 5E33A 3D3CJ 2UV8A 1N5VA 1WF0A 4K0KJ 1JVXA 1H0HB 4YB5A 4OHZA 1NM2A 3K5PA 2RNEA 4LFBJ 3PD8A 2ZZTA 1VIXA 2XSJB 3RTVA 2W8LA 4MKYA 2R8JA 1RDYA 3NEKA 4NLXA 2YWFA 2R7VA 2LKZA 2ATLA 2WK4A 3PNIA 1S10A 3KJNB 3T41A 4P1LA 3AOCA 1WHXA 3MR7A 2JH3A 1SQYA 4R8UA 3GYYA 3EUNA 1G1XA 3GZGA 3KK1A 2VFRA 2M88A 1WNEA 1IBKJ 3BN7A 5DRKA 1FXRA 2UVHA 1N36F 2IRYA 3E51A 2H1YA 4WK3A 5KFMA 1N76A 2EFNA 7FD1A 1H73A 4QJVA 4ZLPA 4NXMF 1QJMA 4ELVA 4U22A 2HG4A 2H5JB 4H4OA 3C32A 2IIHA 1VR5A 1MH4A 2ZYNA 4NZ0A 4WP8A 4WFBQ 2VOOA 2G93A 4QSCA 4F3SA 2KU7A 1RHQB 3C9HA 2XXUA 1U25A 1B99A 4ND9A 3KN7A 4E8UA 1YTYA 2CZLA 3SSSA 5HBMA 2XTJP 2PA3A 1AW0A 1TR0A 5A8RA 5C42A 1I6AA 2OWZA 3CGIA 4F22A 3AOAA 4PF8A 4M5IA 4X04A 4IYQA 4OYXA 4DI6A 4P9SA 2FLNA 2XMKA 2W7PA 2DY9A 2G0CA 1U2CA 2Q66A 5HL7Q 1LWXA 4A4JA 3NOGA 3SQOP 2J6UA 3BIGA 2B56A 1RCXB 5D15A 1EX8A 3K5NA 2CNNB 3BBBA 4I3EA 3T6JA 3UNYA 2G4BA 4A8XA 1VIOA 3NBPA 4HW8A 2CNKB 1YJ7A 2BACA 3CD7A 2VBWA 1JLAB 1WTBA 4ZLJA 3BFUA 1XNRJ 1RGVA 1US4A 1VRQC 1TKZA 2A1BA 3SDFA 2ZNSA 1FTLA 2GQ1A 1TFAA 3L9ZA 3O66A 3M3LA 3D6HB 3UDVA 2IM1A 2NSCA 1XR6A 4RW9A 2HNZB 2XXHA 3R6UA 3E79A 2OKQA 1NMUA 4M5GA 3FXRA 4IGTA 2D3IA 2HQCA 2FY8A 3EGZA 1B3LA 5SUHA 3HSDA 2CQPA 1VBYA 2FZCB 2EFQA 2DIUA 4YZZA 3E78A 2AP6A 5DG8A 3GB0A 3IBWA 2DBBA 2JX2A 3WX8A 3C33A 4WYWA 4ZPCA 1LSTA 4U9RA 4EBDA 1YHQS 3IRXA 5ET5A 2BKOA 3EHUA 1AXQA 4ID5A 2OBGA 3QAEA 1IMBA 4DV3J 2VICA 3Q8SB 4WEPA 3ZS6A 1P8GA 2WRMA 3BKIB 4LA9A 4ZVEA 3KOSA 4K3FA 3MD3A 3GTYX 3JYTA 4A48A 2E5LF 2PFDA 1U48A 4I2QB 2HYIB 4NTLA 5CCMA 2ZMBA 2C3OA 5ISUA 4JYAJ 2DWHA 3US5A 2LCWA 2AU0A 2CWKA 2O1LA 1BK4A 3R2CJ 1U02A 2RCAA 1B6HA 3HDSA 3MOZA 2WYKA 2YQ1A 1RT4A 3G2XA 1MN9A 2KL8A 2F3BA 2KZMA 1M5BA 2GH9A 3HD2A 4OEUA 1IWAA 4GRSA 1NJYA 3VR1A 2XI3A 2B7CB 2V8VA 1H38A 1Y00A 4YKIA 2XMVA 1VFEA 3HULA 3PRDA 2VQEF 4WJBA 2BOPA 4PWUA 3IJXB 1WEXA 1ROFA 4OFZA 3HXMA 1DLOB 2XMAA 4RK2A 3C16B 3T9HB 1UVNA 3A8EA 5J1DA 2MHNA 3GIKA 1B5HA 3PPQA 1IMAA 1A8EA 2RQKA 4IRCA 2ZZMA 2L3MA 5CYMB 3V5RA 4P71A 1V6HA 3IA0A 1R7IA 1MM7A 2GGPB 4HLBA 2DYAA 5D4PA 4P9KA 4DL4A 2F7VA 2HQFA 1URNA 3RUBL 1GX6A 3FGVA 2DNRA 1YKWA 4DV0F 4J9LA 2RC7A 1AH5A 4DV2F 1Q95G 4CH7A 3BSCA 2ALZA 1U1NA 4GL8A 5LXYA 3T9VA 2XBPA 2UVWA 5DGBA 3QIPB 1MG1A 1D9AA 3D0GE 4E0XA 1VFDA 2LXIA 1RKMA 4PQUA 7FDRA 3T9XB 2KFYA 5HMXA 1AT1B 4C97A 4O44A 3LV0A 3MAMA 4ZP9A 5EQ7A 3PZPA 2XZDB 4QWBA 2FPHX 1B52A 4CYUA 1UIUA 4K4VA 5H9EJ 3AD8C 3O6GA 4L75A 5MAOA 2ZYOA 4M5HA 1MQDA 2ADCA 1N5YB 4R6HA 1KVIA 2VG6A 4OHYA 2AF6A 3QFWA 4G3IA 4H65A 4ZVSB 2QFLA 4ZE8A 1BP5A 4DF4A 1IITA 2JEGA 3S6EA 1JLBB 1WHWA 5H9EK 2OIHA 2JOQA 1FDBA 3EVOA 2ZBPA 1RWWB 4IO5A 4DSLA 2D3OR 4ZVHA 5C25B 3WC0A 4X4VA 2B4MA 1A6LA 4Q7AA 3VVTA 1YRUA 2Q74A 5DQIA 3FJ7A 4H67A 2B8QA 4CM2A 1JKHA 1QSYA 3U92A 1VE4A 2OTLS 4GBWA 1SBPA 1P1OA 1U1QA 1MU2B 2VPYB 1SQEA 2RUSA 4N7TA 4LF6F 3MMCA 4LVOP 3O97A 1RHMB 4PDHA 4D3HA 3QRRA 2GA7A 2YY3A 2DXRA 3BGLA 1XERA 3HFVA 4ZVOB 4FP9A 1HNXF 1D1UA 4ZPAA 3PPPA 2HWTA 2Y7IA 4TLMB 3S01A 4RPOA 4JBCA 4NF8B 1M90T 5L38A 2AEJA 2HQGA 2H48B 4B3SF 2O3DA 4PYAA 4F1YA 2HMIB 1R8HA 1Q7YT 2F34A 5AE4A 1XMOF 5KAKA 3GG1A 4RZRA 3JQKA 4ZHRB 4GX3A 3BDPA 2F78A 3TZXA 3M1VB 4HTJA 4BS2A 3IMQJ 2F63A 1X4DA 4U7UD 4C8MA 3HFKA 2JC1A 2IBOA 3CRBA 2FTRA 1U0SA 4CIOA 4DL0C 3IWNC 4OYZA 2E9ZA 3BGRB 4FDFA 1URRA 3HHFA 4JYAF 3NMAA 3OHBA 3KFWX 2RH3A 3S9EA 3TTRA 1I94F 2BDPA 4DIGA 2HRTA 2HNYA 2VC0A 2J76E 4LF2A 1RT1B 1F9BA 4P72A 3QSIA 5DG9A 5KFLA 3T66A 3TUZC 1FTAA 2HVHA 2K8GA 4MJKA 4LQ5A 4YMEA 4DX5A 1U26A 1NNFA 2GHBA 2J5AA 3QJJA 5ETQA 2R42A 1F9HA 3VAGA 2C3YA 4PBHA 4CLTA 3MM7A 4DCPB 3ZZPA 2JEFA 1AROP 2KJVA 4EBCA 4HL9A 3W60A 3IO4A 3M8PB 5LTCA 2IMOA 2GMHA 1YZ7A 3LF0A 2ZJPQ 4G1IA 1K44A 1N56A 4KV8B 3KYLA 3TA0A 1S6PB 3FCHA 5JUMA 1NUXA 4PP0A 2HNZA 1RTJB 4MIJA 3ZZTA 1LWEA 5ICTA 5LL6d 4GXSB 3QGIA 4Q43A 4ZN1A 2VFVA 2F6PA 4KHMA 4Z0IA 1VQ5S 1POY1 3SEUA 2PT2A 1LW2A 4OVPA 4JI0J 2NVUB 3AJ2A 1VCTA 2K1RB 5H8FA 1W7WA 5AXKA 1SW2A 4NG7A 1WORA 4DLDA 2V0NA 1SL2A 3HZGA 1ELJA 2CADA 4U2RA 2CG4A 3K8VA 4MH8A 2Q3PA 5I2NA 2W2PP 5B09A 2JHEA 2EXUA 5CCLA 3AA8A 3Q23A 2HIQA 5KFVA 2NR0A 4OZ2A 4MYTA 4RNSA 2BE2B 4GIZA 3MF5A 4GFRA 4P3LA 1RTHB 4OV6A 2B7BB 4DN0A 2FUG9 4EI2A 2JDJA 2I48A 1Q8BA 4QHQA 1YG0A 3B4MA 5JTYA 4KPTA 3OO8A 5E5NA 5C24A 2W4CA 4GX6A 3OLAA 4H6DA 3MEDB 2ZD1B 3LUZA 3B8HA 1SW5A 5ETOA 4UZBA 2OCUA 4Q2LA 1Y9OA 4GO7X 2Q2CA 2E66A 3R27A 4F3PA 3GFXA 1IXIA 4BHQA 3ENAA 3IRWP 4FE8A 1N52B 3TA2A 4NI2B 5ITPA 3BS9A 1XVYA 2UXDJ 2J9DE 3M6WA 3K17A 4NL5A 3ILUB 1QUKA 1D9DA 4Y2AA 3G3IA 4G8HA 4KD5A 1GK8A 1OY8A 3MM8B 4DR7J 4JDFA 4F4AA 2EC2A 1YQHA 2ASLA 3M05A 2N4CA 5AA2A 2DNPA 1M5VC 2B9XA 2E9RX 5FJ4A 2WCXA 2GQ2A 1RBOB 1M5CA 4JI6J 4R9FA 1YLXA 1MDP1 4ZP7A 3NAHA 4OYMA 4W4MA 3C36A 1RDXA 1WVJA 3LSFB 1GTEA 4RUHA 3VAFA 2I1RA 2P2AA 1RT5A 2WTFA 2DCUB 3GR1A 1NDCA 2F7BA 4XDCA 4PGNA 4JI2F 3GCXP 1OMSA 4DSKA 4ELTA 2Y7WA 4CP5A 2VODA 3ZFVA 1VJQA 3Q24A 2UYEA 1FEHA 4OLOA 4RWXA 5D0GA 1KLMA 1FFWB 1KONA 1ZLQA 3AD9C 2PVUA 1IKWA 1IKXB 3F11A 4H4MB 2HHQA 4ECTA 2EW9A 2YKMB 5A0YA 3KUEA 1XC1A 4L74A 1HSJA 4G1QA 5B0FA 2VF3A 1AA1B 3RYLA 2X1BA 5EHMA 4Q45A 4I4BA 3CJTA 3P4UB 4WWSA 3MP8A 4CLSA 5MLCV 3JZJA 2RINA 1H76A 2XD3A 3WC2A 1RAFB 4YP3A 4ZPBA 4OHVA 2B43A 3E01A 3GV8B 3DLGB 4TLQA 3A09A 2RQMA 5DLFA 4HYKA 4UQTA 5H8SA 4ES1A 3FBPA 1NO8A 2HWIA 3IB2A 1L3KA 3CPWR 1I6JA 4EO8A 1YCJA 5F0UA 2QVUA 1HR0J 1K9MT 2VQFJ 4MIBA 4OI1A 4RL1A 3D7SB 3NS7B 1LFPA 1MY0A 3ODBA 2EI5A 5F9LA 4ELUA 3OR2B 1G6BA 2QIFA 2JJKA 4HDGA 4DX6A 5I3UB 2PEHA 5DEXB 2CUYA 4OWDA 2XB2D 3SERA 2C2RA 5AA4A 4OMBA 4HE2A 3OXNA 4OFOA 2IYGA 2ROEA 1DTQA 4R73A 1R1NA 3QPIA 4RNMA 4NOHA 3C14A 2BZ2A 3CHGA 5IGAA 3EVMA 4K4TA 3O6HA 3PMVA 3P49B 1JEUA 4ECYA 1JLCA 3OO6A 3M4XA 5F8IA 1YJ9S 3T19A 3RB3A 1X0PA 4CO3A 3QT6A 3PXGa 2NUHA 3BZQA 1PO6A 2CJKA 3QWUA 2PMSA 1WC3A 2Z2LA 4DCJB 4PG7A 4WP3A 5CQGA 3KJFB 1UETA 2MQMA 2R7XA 4C1TA 2XXYA 2WSEC 3RPWA 3BR8A 2BBEA 2QC3A 2D74B 2M2BA 5KFGA 3NGDA 1S7YA 3WDOA 3W8PA 5FDLA 2YNIA 2A3JA 3ENVA 1ZTWA 3BYRA 2KZZA 4JVDA 1TVRA 2DRAA 4RXLA 1NDKA 2E44A 3LAMA 3IR5B 4U23A 2Y1RI 3C46A 2DH8A 3MP1A 4G1PA 5B7WA 2V68A 3MVZA 4MIWA 3HF5A 2WKYA 5J2NA 1HYSA 1B0LA 3CDBA 4DLEA 1JNFA 1FVSA 4DXUA 3IOWA 1NL5A 2VU5A 3B6TA 3TVZA 3OEKA 5DQHA 4Q8RA 5D4OA 2J8AA 4ICLB 4MLVA 1GMUA 2LQBA 4PAIA 3IL1B 1S9EA 2A2CA 1DAXA 3UCZP 2GIFA 3FXQA 4ECWA 2BUNA 2YWEA 1WEYA 1N6QA 4PWDA 1S59A 3QT8A 5DZ7A 4Q0BB 2ZH7A 4DV6F 3JAMU 3DLGA 4BC9A 2O67A 1DTZA 2V34A 3G3HA 3O8WA 1GMWA 4EU0A 2C2NA 2VDIA 1JQFA 3N5LA 2HQ3A 4EZ6A 3DP8A 3CEDA 5HM4B 6AT1B 1UW9A 3G3JA 5KG1A 3FMWA 1IUDA 3LUYA 2GJFA 3CD6S 2BXJA 1S1UB 2VBXA 2W7YA 2NXNA 4F0HA 3KWMA 1F2HA 3HHGA 4ZCKA 1RUSA 1KEKA 2WW4A 2ZDPA 4B17A 4KRWA 3W63A 4UQGA 1LGBC 2J9CA 1NU4A 3OHAA 4CT8A 1NHKL 4A8MP 3N4WA 4U4XA 1B70B 4DV7J 3H90A 4U8VA 3MR6A 2XI2A 2ZH4A 1KVJA 3A4TA 4BDQA 2XULA 1NPPA 1CQMA 3MECB 1GFWB 4QWDA 2FJAB 4RPFA 1ZU0A 2Q9TA 2VZ9A 3RR7A 1B3TA 2P6TA 3MR2A 4CLYA 4OERA 4PPZA 4USJC 5A8RB 1T8EA 2HGMA 4MAGA 4EQBA 3PYFA 2WW8A 5KFYA 1U6BA 3RG6A 2MQ8A 4XTTA 1H43A 4ONYA 1IMFA 1LBVA 2KB2A 1CJUB 1JNZB 4LQ9A 1P27B 3O6IA 1WC1A 5IFMA 8ATCB 1HI1A 4N6PA 4POXA 2RHQB 5I42B 4KO0A 1KHVA 4MNPA 1NFTA 5K8NA 2BW2A 3U7JA 4ED0A 3QNWB 1B9JA 1CG2A 2MZRA 4DQRA 4JI4F 3VGTA 4UACA 4KR0B 2FGOA 5HVFA 1MWYA 3BPSP 4I2PB 4IO6A 3DKDA 3NGRA 2IAJA 3CCSS 2R8IA 3GPAA 2QL9B 3AXMA 3ZZ0A 4GVOA 2A5SA 4OYWA 3N79A 5D8HB 5DM6Q 4FS2A 4I7FA 3OFHA 2HKEA 3O29A 4G68C 1Z1ZA 3JTOA 3SDEA 2R9JA 1C1CA 5KT6A 1G0HA 4OYIA 3A29A 3CMAS 4O7IA 2L5VA 1SC3B 2F7AA 2MY8A 3DOLB 1IR2A 4KCCA 1SJ1A 4NWDA 1FRXA 1T05A 1XK8A 2M5YA 3D6FB 5GMDA 1S7IA 4RW4A 2IMWP 3UNGC 4ZVPB 1B5JA 4FXWA 5KFIA 2ACMA 3M30A 5IM0B 2DE3A 2DOJA 2AEFA 2NYHA 2UUAJ 2VT5A 4KKOA 3Q8RB 3J7A1 3C66A 1M1HA 1WKKA 3OEMA 3MTKA 5EDWA 5K8MA 4X62F 1N4LA 2UUCJ 1X9MA 1FFGB 4FKYA 5KFAA 4R9GA 3PD9A 3JV9A 2KFZA 3CTRA 3F41A 4DV5J 5B08A 5M2RA 4Y65A 4NCBA 2VG5B 2GMJA 2KXNB 3DCAA 2C2DA 3ETMA 1D9QA 1UJ6A 5ET8A 4XDDA 2J6TA 3HHDA 5BYRA 3MM9A 1CJKB 1AFIA 2BW7A 1LK5A 3K59A 3G6XA 2A6OA 4TNOA 1A9NB 1ZM3A 5DS7A 4DR4F 2HVEA 3WAEA 2Z4PA 5ETVA 4EEYA 3LO3A 3R6GB 1OJ4A 4JI6F 3RPLB 3S7RA 1HBOA 1IBMJ 3SV4A 2Q6BA 3ICLA 3B82A 1MXYA 1EIYB 1WWHA 1CB6A 2UVJA 4J9VA 4DX8H 3DNCA 4XTCQ 1HHSA 4USWA 4PE5B 2FVPA 2XXRA 3HKWA 1X9SA 2DGXA 2MKHA 1BC6A 4F7VA 1IZ1A 2Y0BB 4GKJJ 4K59A 1DTGA 2RU9A 4WU3A 1B40A 4Q30B 1UEVA 3RN8A 2HW3A 1K73T 3MW0A 1ZOTA 3RGIA 2F4VJ 5CMKA 2NOOA 2FD2A 2O7UA 1RWOB 2ZFHA 3J7YU 4PXCA 3BKFA 3GFHA 5LOMA 3SYZA 5C2CA 2A5TA 2M52A 3CCWA 2ROGA 3M2VB 3SCJE 4KGZB 2DGWA 3MURP 2XWVA 3DMJA 4JV5J 2P8IA 4U6PA 1NUEA 1VLYA 2O84X 4P56A 4RBVA 1OSCA 1MY4A 4ZLLA 1VSOA 1RU2A 1C4AA 4PTKA 3W2VA 2L48A 3M2RA 1F3VA 1FJEB 2CJAA 4CLKA 4JI8F 1AUSL 3GONA 2FGCA 3FCVA 5KOWA 1MMLA 5F8NA 4RJVA 4I0WA 2XSFA 4U1OA 2LP4A 1UA0A 1OPZA 3H4ZA 3H7MA 3R7BB 1Q7LB 2HNDB 4Q0BA 1FDDA 3Q26A 2MZ1A 2EKNA 5CZXA 4IO4A 4C3MA 4X4SA 4ZITA 2HRYA 3SZPA 5A8KB 2DGUA 3VTIA 3QYTA 1Y3NA 3W9HA 4YHHJ 5KFWA 4XO0A 4Q44A 3T93B 2P6SA 1UAWA 4H8IA 4MT1A 3HSZA 4NWBA 2NUVA 1FBHA 1O5JA 3KSXA 4EFAC 5KFPA 1B4ZA 2OWTA 5ESYA 1IKYB 4N56A 4P7TA 4DU8A 1B64A 1VR6A 1CE2A 3OL9A 4CTAA 1URSA 1D8ZA 4EYIB 3I6PA 3KG0A 2ZHOA 2ALYB 2AGPA 3T1AA 5ETPA 1X4GA 2HBQB 2AL4A 3OTDA 4XKRA 3A3PB 2B5JB 2C3MA 3A12A 2G2OA 1HBNA 3VFJA 4KH1B 4F4YA 1A99A 1YK9A 3AB4B 2V8GA 5FLXU 1UFWA 2R8TA 1BUXA 2F35A 4P0GA 4NPOA 2DWJA 2GC8A 5HLFA 4LSNA 3KOAA 3THVA 4LF9F 1SPBP 1S1XB 1BHNA 4NF6A 2IPOB 2A10A 2DNHA 1TV6B 1A7LA 2OJ3A 2R8HA 1NV3A 4Z7EA 1CPZA 4OHNA 2DO0A 2H5YA 4UZCA 3FEXB 1RT2A 2ZJRQ 1VK8A 2PA8D 3UGWA 1OYEA 3PYGA 4FORA 4YB7A 3TX0A 1HNZF 3IFEA 1CULB 2ZM6J 3HSTA 4IFVA 1TT1A 5E41A 3QQCD 4ID8A 2E5GA 2XO7A 2R6GE 3SETA 3TTMA 1NZAA 3DU5A 2RU3A 2MKKA 2KQZA 1EHWA 5HJXA 4DSEA 5KFHA 3J81j 1HW9A 3BSNA 3IG1B 1CVJA 4FBUA 1QKAA 5DGAA 2B4OA 1FESA 5HSPA 4C8OA 4WKMA 1HNVB 4U8YA 4NRTA 2GHWA 3WX4A 1YAEA 1VQ4S 1UJ4A 5ETTA 4RW6A 3Q8QB 4HR2A 2ERRA 4WTOB 1YJRA 4M94A 4LFCF 4P2XA 2HIYA 3FVNA 5I4MA 3OMBA 1AZSB 1SJRA 4LFCJ 4HT5A 2ZBQA 2YH1A 3TYTA 2HBRB 2M8DB 1HHTP 2R3VA 3CJ0A 2RT3A 1NJXA 2H98A 1SH3A 3RRKA 4CO0A 4QFKA 4ID5B 1N04A 1NUYA 1L3TA 1PJ5A 4L3NA 4X4OA 4DR6J 3OXGA 2REGA 1DY3A 1GQEA 4NLPA 5IM0A 3W9JA 3PHEA 2QA4G 3K6VA 3VVDA 3K2YA 4QYZK 3FVGA 4IY6A 3T5LA 3IR6B 5L1KA 3KLIB 3JYTB 3BPDA 1KLNA 3DP6A 2EPIA 4HHUA 3U27A 3FQKA 3DGPB 1H2TZ 3EPIA 4ZJQA 4ISUA 2CPYA 3J80Y 3BBRA 2FIEA 4WBFA 2UUWA 3VGUA 3GE9A 4LONB 2AJQA 3GIIA 2ACYA 1H74A 3DRSA 2DR7A 2W9CA 2AYMA 2HZVA 1RB0A 1RDZA 2LQ5A 1ZZFA 4DXCA 2OPSA 2MGZA 4O3PA 2CQGA 1LAHE 1DARA 4DI3D 3KSJA 1LXNA 1TK0A 1RACB 3QGGA 2AIXA 2HFUA 2WAQD 3PHTA 1K0TA 3KJ7A 4FNHA 3PW2A 3A8JA 5I3PA 4C48A 4MNCA 1RBLA 3IS9B 3CJKA 4LF4F 3FZBA 1K1SA 1FBGA 2J7UA 2QSWA 2HLUA 7AT1B 2V8HA 3CWJA 3PRBA 2V9WA 1T3OA 4PAFA 5F8MA 3CC7S 4YQWA 4GWYA 2OP5A 2X3GA 3QZ8A 4CDIA 1PC4A 3RB0A 4K5SA 2LDYA 2V4QA 3EKIA 5CH7B 1RAGB 2LA4A 1FA0A 4C8KA 3CIZA 5I2KB 3RYDA 3KJTA 4URQU 2YWWA 4WKRA 1FBDA 4QPXA 4ZIWA 2FJVA 2CEYA 4YMBA 4TLRA 3RBDA 3UVJB 1XEZA 3SXLA 3MR5A 4R2FA 1M5PC 1BMQB 3FGSA 3H5SA 4IQXA 3MQ9A 3HM9A 3HJFA 4DG1A 2WBRA 1IM6A 3FSIA 1U1MA 2GX8A 1R6ZA 4G8NA 3CNQP 2DNYA 2XXTA 3QK6A 3EPEA 3HPOA 1BY9A 2ATCB 4F4ZA 2E1CA 3V6HA 5F3ZA 2VFTA 3KC1A 2ESNA 4PXDA 1WG4A 2XO6A 2I6EA 3R5CA 1WEZA 3R3TA 3X1LB 3S8SA 5EHHA 2I3WA 4OYPA 2E7XA 3W1YC 3D1RA 4PYDA 2F4VF 2ZH9A 3K6UA 3PVXA 2CNOB 4N07A 5GAEU 1BWEA 3QIDA 2H5IB 2DDKA 1R8CA 3C34A 4PWWA 1LW0B 3E8OA 2Z23A 5DDRC 2DP8A 1LXJA 3KOTA 1QVGR 5FIIA 2C2ZB 3QO9A 4JB8B 4BWJA 4G65A 1VBKA 1Y3JA 2YNFB 1REVA 1FBPA 1FF2A 5TPAA 3I6VA 4M5DB 3W3SA 4NXNJ 1HI8A 5DT6A 4RNHA 2AZ1A 1U49A 1B1HA 4IH6A 3ZTSA 3N28A 1PC3A 4DFPA 4IOAQ 2FHYA 4ZEBA 4DFKA 3TZYA 1UFLA 2NS1B 3LP1B 1NJIT 2Z0GA 3AQPA 5ET6A 4JI7J 3NWGA 3N26A 4I69A 3BGFA 4HE1A 3OSQA 2VBYA 5CABA 1VISA 2W9BB 4RU2A 5DVJA 4FF3A 3CT9A 1Y5LB 3E4RA 1JK9B 4AQYF 1AUDA 4AT1B 3OFGA 2XCAA 1FW0A 1S6OA 2UZAA 2R8KA 5HP1B 2UXBJ 1NV1A 4JB7A 2LEAA 2RS2A 2HZCA 2GGPA 2XLKA 1WC5A 1IQTA 3BGRA 1UTAA 4ATNA 5J16A 1P6TA 3CULA 3PV8A 5EHSA 1VRUB 2HK3A 3N9UC 6FD1A 1HBMB 2AYEA 2Y3YA 2MQOA 2RRBA 4AL5A 4LSZB 3NCPA 2ABHA 1EQMA 5LJ5Y 2FVQA 4B9TA 2AJ0A 3ZZUA 3W5YA 3MPUB 4OV1A 5AXMA 1MROA 1YX2A 5DO2A 2M0GB 3TCFA 3M6VA 3PV0E 2XMWA 2YKAA 1MM6A 2HHPA 3V4IB 3VLUA 1I6BA 1QSSA 4KYSA 4A8FA 2CPDA 3KKFA 1N5YA 1B4SA 3R5AA 1Q9DA 2RKMA 4C2MA 3MMJA 3KLHA 3UD4P 4EUOA 5K2YA 2D3UA 3T5KA 3BB5A 4LBHA 3K6XA 5L1IA 2YBVA 3VVEA 3NNHA 1R9LA 4LATA 2RKIA 1WF2A 3AODA 2PFYA 1P1TA 3KLEB 2W7AA 1B3HA 2PFFB 2O5DA 3BGOP 3R9LA 2HS3A 3GLBA 2WSFC 2CQBA 3RAMA 2MPUA 2OFHX 4ILMA 4B3OA 5A2QY 3PX0A 5DDOC 4AE5A 4FNIA 1IBMF 1VLOA 1MPCA 4U1ZA 3VWSA 1GTKA 3C19A 2RDDA 2YXLA 5B0CA 4A47A 3KK3B 3SEYA 3ET6A 4J91A 3TPAA 2E5HA 1UPPA 4KHPJ 4OYBA 3UK4A 2ZC3A 5EWGA 1J2VA 3KN8A 5U47A 4CH0S 4F3OA 1WC4A 4QR2A 1SJFA 2GCFA 2NSBA 1H45A 5DVFA 4PXEA 3HT3A 1UTHA 4GRKA 2UV8G 3OD2A 5I56B 1V5VA 1K9YA 1EYJA 2RRNA 4JI3F 1N88A 1OPIA 5F1QA 3CCRS 1F5AA 5AE1A 1FDNA 2M9KA 2K3IA 3C35A 5KG2A 3IO6A 4JI3J 2XHCA 1QDUB 2BOAA 1XNRF 1VHFA 4OQOA 4P2SA 3OLBA 3V6JA 1Z7ME 2E1RA 2IRXA 1NPRA 2MMYA 2QLFB 3NCQA 1UJ5A 3ZZOA 2HLTA 2H9BA 4I56A 1TUGB 4Z7CA 1Z7NE 3IAZA 4F1UA 2GJ2A 1U1LA 3TFLA 1CQNA 3KLFA 4AS4A 1LV5A 1W25A 2BANA 5E3QA 1FQAA 2XXKA 2DEIA 1PB9A 1H2UX 2HAIA 3D4GA 1CJTA 1FTJA 3M8UA 2C2KB 3I4PA 2Q2AA 5I2KA 3HP6A 4TU7A 4CO2A 4JI1J 4RW8A 2GMLA 1N8RT 1Y3PA 5HBCA 4NF0A 1DMBA 2XG8A 3P3DA 4PCDA 1S97A 1NH8A 3MPKA 3CR9A 2FNCA 1CJVB 4JSOA 3GJSB 2HVDA 4DR7F 5IWAJ 3WBZA 4AXJA 5M2PA 3UD3P 1HWUA 1S9GA 4ZIVA 2AJFE 1FK9B 4LF6J 4GOTA 1MY1A 2CPIA 5D3GA 2JRSA 4KFBA 1TL1B 4F4WA 4NE9C 1UKUA 1NNPA 1I94J 2FB0A 5J2QB 1CS4A 3EDRB 4G2ZA 1R9QA 1P1LA 1WD6A 1VQMS 1SJQA 4GKKF 3H20A 2QJ3A 4I1TA 3BQ2A 2YNGA 3VF0B 3I0RA 4PFIA 4KHZE 1S7HA 4QR0A 1LFGA 5IC4B 2B9EA 3TCGA 3TRGA 1JLGA 5IQ6A 4NMXA 2UXCF 4OFLA 2BRKA 1UCNA 2EEYA 3KJVB 5DQGA 3FSXA 3S4UA 1MXUA 2XC9A 2B51A 4J9PA 4U7CA 1P1NA 4MFBB 3EZUA 2GW8A 1N5TA 1SIZA 4ZMMA 3MCSA 2BABA 4U7UK 3LP2B 2E1MC 3CFZA 4NF8A 5F7VA 4LBPA 3QIMA 3D54A 3VAIA 1B4HA 3RBXA 3PR4A 1XNQF 2CKWA 5KFTA 1RYSA 1NPKA 3AAWB 1XMOJ 4B02A 1E6YB 2RDJA 4MH5A 3SSRA 2KN4A 4F67A 5A2QU 1K8AT 1KNZA 4ECUA 1FWKA 2QYCA 1HIYA 2REJA 5EYFA 1EYKA 4TY9A 3ILIA 5CMMA 2Q43A 2EBGA 2YPYA 1TUVA 5HATA 5D0HA 1JKHB 1YRTA 4RR5A 1T03B 3FFIB 1B7ZA 3K4UA 3HHLB 4DL6A 2FHJD 3VQTA 1IKVB 2HHXA 2CPFA 3UCUP 2I5JA 2NZCA 3PPNA 1NCLA 3VALA 3CJ8A 2CZIA 4EMDA 1FHTA 5BYSA 5J1EB 2CPEA 2PYYA 3BKUA 2DGVA 5KFOA 4DV6J 1I3OB 4ZPWR 1FJGJ 4KH0B 2N82B 2LU2A 1Q5YA 1RCOB 3RAQA 5LSOA 2DGQA 3NLCA 3M2UB 2EG1A 4AFFA 4JBZA 2OZZA 3AXFA 1QTNB 4USMA 2ZBCA 4O3CA 3UN3A 3IOUA 2MQNA 4FIMA 4IO3A 2X1FA 4MX6A 2ZZVA 1DBDA 1IMCA 1RI7A 2ASYA 1S0VA 4HTGA 4C7QA 1GMWD 3G7WA 1JJHA 5KFZA 5LJ3Y 3CDUA 4DDDA 1P1QA 5AA1A 3KN3A 4NLDA 5IWAF 2ZH8A 4B08A 2I0CA 2YNIB 3LR1A 3I9V9 4RKUC 2XMJA 5KFUA 1Q16B 5HROB 4XIGQ 3MEEB 1E6VA 4DQIA 5CA5A 3SIPB 2X7QA 3FNNA 1KQKA 4DF8A 2Q8JA 3EICA 2RD5C 1LEOA 2HPGA 1MPDA 4TN2A 4EUVA 4ZCLA 4FEDA 4OX7A 5E7OB 3D2WA 1RE1B 1D0EA 1JP4A 3K00A 1USYH 4YMAA 3QLHA 2DXYA 4NAPA 3LP0B 2R8GA 3JYRA 4IQMA 2YNHA 3IAM9 3R5DA 1M1KT 2VL1A 5HMYA 1HHQA 3FKBA 4QWCA 4LIRA 2ZBRA 1MMNA 3N5FA 3P7IA 1DQAA 1RAHB 3CB4A 4IRDA 5CYJA 1RTJA 5C2GA 1LWFA 3PW5A 4O4GA 4ANEA 2ZZWA 2V2QA 3H5YA 2QO3A 3PPRA 3V4MA 4ZS6A 1I69A 4OJGA 4DV3F 3TAMA 3EPGA 1S0MA 4P0IA 1RSCA 2JC0A 4MNIA 2H51B 4YDDB 2NQPA 3HVTB 1FKPB 3MFIA 5A5XA 2UXBF 5ICQA 5FLXY 4JI5F 4DOZA 1JLEA 5CMBA 3UN5A 4LRDA 1RHRB 4ZVTB 1U1PA 1RLDA 4GMKA 4XEQA 1XQIA 1U0HA 4OJ3A 4OZ0A 3FZVA 3U93A 3Q8YA 1FBFA 1L3SA 3PKMA 3RRHA 1Y4ZB 2DKOB 3PU5A 2MDAA 1MW7A 2KH9A 3RUMA 2JWNA 2QPQA 4B9MA 5IV4A 5ETRA 2VP1A 2RB7A 3CVKA 3KK2A 5L9MA 5L8DA 1JX4A 4KJIA 1RT1A 2BQ3A 3OXFA 5ETKA 2HAUA 3SESA 2F8DA 3LGMA 3PW4A 3Q2SC 5CBSA 1HD0A 2D41A 4B9VA 4RJZA 3PY8A 4LUBA 2OO4A 4WXWA 4TY8B 1NH7A 3C2PA 2PT0A 3J81Y 3FRZA 1SW4A 4O3OA 2LLZA 2RAQA 1OIBA 3BKTA 3KDOA 2DHHA 4PR6A 4PUOB 4Q0CA 1XMQJ 4Z7YA 1NDLA 5JK4A 1WG5A 1EYIA 1K9ZA 2LVWA 4IRKA 2FHKA 4P2FA 2JNJA 3H59A 4I2PA 2OK2A 4OI6A 2PN6A 1U45A 3MPLA 2HRUA 4NA3A 2IVMA 1CS4B 3MEEA 3MCOA 2PCRA 1SKUB 4F3QA 5L1JA 5HI7A 2CVIA 1FJGF 2CJ9A 3QJLA 1M0SA 1XC9A 3NOCA 1ICEB 1LWCB 2Z2YB 4DPYA 4UW2A 2MQPA 1SH2A 4P11A 3HK2A 4E98A 4BCAA 1QY7A 1NHUA 2BEFA 4YS2A 4OMFG 1MRPA 4X4UA 3F56A 4J9KA 4RUAA 4I8CA 4Q8EA 3QLHB 2OFGX 1D4NA 3SEWA 4MFBA 3M8RA 1GXUA 1N32F 1FNXH 3LP2A 4TU9A 4GKJF 3GV7B 3MVYA 3DXSX 3FASA 3MP6A 4YHHF 1KQGB 2AW0A 1A7GE 5D78A 2CQDA 4OESA 3IJOB 5L9XA 1YZ0A 2ZBIA 2OX3A 4R5PA 3SI8A 2CG8A 3FZ2A 1JXVA 5B70A 4XFEA 1YJTA 2AWZA 1FWPA 2F6GA 1WKJA 1N54B 3P5TL 4W98A 1U1KA 2RSQA 2RF1A 1RHJB 1FJ9A 3WZ0A 3Q86A 3DI6A 2AGOA 4LF7F 3LPEA 3OPKA 3MEGB 3PUZE 3OR1A 2UXCJ 5FTHA 4EBEA 1SYHA 3EXYA 3U1MA 4PETA 5KG3A 4LFBF 3M8SA 4RA1A 1XR5A 4ZN3A 3HHLA 1TXFA 4DZ6A 1ZM4A 1FPKA 1QTMA 4BLAA 1N3XA 4NLWA 2Q1LA 5T41A 5IM2A 1S6UA 3LANA 1RWMB 4OVTA 2WX9A 3WHIA 2KVQE 3N94A 5ETSA 1NV2A 3HCQA 4ELRA 4ZPTR 1HBOB 4LT6A 4LF9J 4PAAA 4EK2A 3M32B 1GH8A 3OD7A 3MM5A 2XWXA 2C22A 3LWMA 5HBMB 1USYE 2X51A 1RT4B 2LQJA 3B4DA 4C11B 3CCUS 3EVWA 1O8BA 3R5GA 4WP9A 1WOPA 3ELHA 4ECRA 1FERA 3H2VE 3NNCA 1EP4A 4NMYA 4GVBB 4OENA 4IG0A 4OX6A 1CJUA 5HVGA 3UA8A 4J9SA 1HNXJ 1X4AA 2DNOA 3ISZA 3QUJA 2HFOA 3H6VA 5I84A 4O3RA 1Y1ZA 4DXBA 1UMJA 3CSBA 5EYHA 1NSPA 1XS5A 5DYHA 3FBCA 3TQ1A 5THWA 2LQ8A 1S1XA 4NZ7A 4OI4A 4X84A 3DELB 2CPHA 3H8YA 1T0TV 3TODA 3AJDA 3TJ9A 3MJNA 1V5IB 5DVIA 2V2VA 1T9YA 2ZYKA 1AL3A 2RMLA 1UVLA 3GZ7A 3F73A 3M3FA 4J9OA 1OQGA 3N6UA 4NCGA 5H8HB 4NRUA 2OLBA 2XYHB 4KHRA 1SJ4P 4C1UA 3MHYA 1S1TA 2W4PA 4WE1A 4UF4A 2G1HA 5IZ3A 4PQUB 4HS7A 5IC6B 2YNHB 1H2VZ 3E13X 1MWQA 2GIRA 1ZPWX 3SV3A 3MYUA 1WDTA 5F3TA 3CE8A 1MMDA 1HMVB 3UIFA 2QLJB 3S9LC 1T9VA 2GV1A 2QA4S 3MMAA 2ASJA 4RBTA 4YKKA 1R89A 3AFGA 1B7HA 2QN6B 3CVGA 1S1VB 3W9IA 2NCKL 3CFLA 1VQKS 2CJQA 3O9PA 5ETMA 2UUBF 1LAXA 2Y8WA 1PAEX 1QE1A 1ZA1B 1IJFB 4C8LA 1PSDA 3Q8VA 5HJYA 2E1PA 3BEGB 3UR0A 3MAQA 1FQBA 1RWNB 2H5EA 1B3EA 4PFUA 4DZ1A 1VC5A 5I59B 3IGVA 1I6QA 1S9EB 3I82A 4FXVA 2VQFF 1R0CB 1MN7A 5LSLA 3BH7B 2XY6A 2W25A 3M3KA 4FYWB 4NE4A 1JWWA 1DCUA 4LRCA 4ZVFA 3UQSA 4QIGA 1TL3B 3CXCR 3I56S 2W9BA 2CEXA 2A6MA 2QT7A 4USUA 1U8WA 2R2UA 3ZKLA 2DNLA 1DTQB 4QU6A 1IQ7A 4N8GA 4CO5A 1S76D 2IM3A 2RHSB 3ENWA 4Y2MA 2DVIA 2DR9A 4NN3A 3C15B 4ZP6A 2IDLA 2W2MP 1RA7A 1RISA 2BKPA 4LSNB 2HFBA 2DT9A 3D1QA 3M8QA 2P9EA 4KIAA 1DK4A 3RB6A 1X0FA 2H54B 4IH5A 3H06B 4C4WA 2MLZA 1UWBB 3DRYA 5DZ6A 1SH0A 1KA1A 4KYZA 1F60B 5EQ8A 4R8UB 2DR5A 1JLCB 3M8PA 3ILOA 2XX7A 2HEKA 3U8QA 3O2AA 4YOEA 1MLAA 1RTIA 2CYYA 3HHNB 2DITA 2YKQA 5I57A 3MPYA 2LXUA 1S6QB 4NF5A 4TOZA 3U1OA 2MXYA 4OYAA 4DPOA 5CD4H 3B50A 1F9FA 2R2SA 2R9LA 3X3UA 3DOKB 3R6LB 5I58A 3Q27A 3LGNA 1Q8KA 1WTFA 1WJ9A 1ZAWA