2QMWA

The crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
b'MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGTINIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQFDYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFDQNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAITTDIKKVIAILETLDFKVEMIGAFN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prephenate dehydratase
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 71
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmwA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA02
1USYE 3T9UA 1Q35A 1OVBA 4F1YA 1B3HA 3MZBA 3QAXA 2P9CA 2OK2A 3FXUA 1A8FA 4DXCA 2ZYMA 3CVGA 4OTEA 2R71A 4F31B 4ZDMA 3LBSA 1M0SA 5JEIA 3VLVA 2DE4A 3TQLA 4F3BA 4H5FA 2DVZA 3ZS6A 1QUJA 3CFXA 4G8NA 3VXCA 2V3UA 1IEJA 3PUVE 2AYSA 4AB5A 3GLBA 4NF8B 1AH5A 1AIVA 4E0WA 1EZ9A 3DP8A 3G7WA 2PYYA 4EQ7A 3EN3A 4ZE8A 1DTZA 3TTMA 1MM6A 2PT2A 2DE3A 1PEBA 1QKBA 3IK6B 2HXWA 1GV8A 3KGCA 2ABHA 3VVEA 4YKKA 2I58A 5CI5A 5CMCA 1MXXA 5IAIA 3MQ9A 1PBPA 2DXYA 1YBAA 1FQCA 3IORA 3PU5A 4TQUQ 3CRBA 1TFAA 4EQ9A 2WKYA 2ZNUA 4GMKA 5L9OA 4ZEFA 3G3FA 2O7UA 2X7PA 4F1UA 4ZZAA 4OYVA 1N7WA 1SYHA 4LZ8A 1LCTA 4EF2A 4PFWA 5CRYA 1FW0A 1DMBA 3DLNA 4X84A 3MAHA 4YU0A 3S1TA 4F2OA 5CM6A 3JYRA 2DWHA 3ENQA 5I2NA 1LBCA 2QS2A 5IT0A 3C4MA 4M4GA 3LSXA 4R6YA 2O1MA 4F29A 2I49A 1L5TA 1BLFA 4ELOA 4GRKA 2HQ0A 1WVJA 4N07A 3O28A 4QFPA 3TUIC 4MF3A 4DDDA 3MBPA 4GO7X 3UA8A 4RNSA 2VD2A 3H4ZA 2RKMA 4YICA 2Z22A 5I57B 3ILTB 1IXIA 2Q2CA 5DT6A 2H4IA 1S9TA 3O29A 3PMVA 4GOTA 5CC2A 3MVZA 3K4UA 2RE1A 4DLDA 4GL8A 1SDXA 2W7YA 4FE8A 1SW2A 4X48A 2E0SA 4ND9A 4LONB 2D21A 2F6PA 4WKMA 2XX7A 5I2KA 5TP9A 1NH7A 4ELQA 4PFYA 3K6VA 1MY3A 4Z0IA 2OCUA 4EUOA 3KOSA 2ZHOA 4TLMB 2QS3A 3LC8A 1B1XA 2XXHA 4JBZA 1XHYA 3C32A 5EHSA 5BUUA 4YMAA 3MWBA 3K1MA 1TXFA 3PV0E 4G8HA 3OFEA 5IS2A 3TUJC 2VGQA 1PSDA 4FIMA 3P96A 3GXAA 1B1HA 1WDNA 3IJXB 3H6VA 4KD5A 3HCQA 1AOVA 2I4BA 4PFUA 2REJA 4Q8RA 3L7OA 3IAZA 4NEDA 3OMBA 4OFLA 3KN3A 4YKIA 4I62A 3N0VA 4OXVA 2O1LA 4EXKA 4O3BA 2M8CA 3BKIB 1LK7A 2HAUA 3B6TA 5AE4A 4ESXA 4HCWA 3TQWA 4OENA 3S9LC 5CMKA 2FGCA 4F2QA 3DELB 3A3CA 4OERA 2VOZA 1OLCA 2NUVA 2XD2A 2X7QA 1KS2A 1O7TA 2GRVA 2XX8A 3QYTA 4F19A 4KHZE 2O7IA 2I48A 3M3FA 2QRYA 4RYAA 4THIA 1M5DA 3E13X 4GF8A 5AA1A 1LGBC 4BDRA 3IO4A 1RWUA 1FTOA 3B6QA 1URDA 4KPTA 3ZKKA 3MAMA 1IUDA 1OLAA 4H8IA 1P99A 2DYXA 4F3PA 3IJOB 3KN8A 3M8UA 1YGYA 3GBBA 1B7UA 4HTGA 3QUFA 2OJTA 3LR1A 4NF5A 3THIA 1Y3PA 4YB5A 3DC2A 4ZEBA 1B51A 1QUKA 4BDMA 3K1PA 3KSXA 3N5LA 4ZEDA 3U7JA 4OMBA 1B40A 4TLLB 1MPCA 4PP0A 5A5XA 1ZTYA 4NMLA 4PQJA 4Q0CA 4ESWA 3T96B 1DOTA 4R2FA 3V89B 5K2XA 4MBPA 2FA7A 1XS5A 3FJGA 3TUZC 5I58A 4H1XA 4MFIA 2OBGA 3EHUA 1IZ1A 2UVGA 1URGA 3RLFE 1UJ6A 1MXZA 3K6XA 3Q28A 3C36A 3KWMA 3OEMA 5ITOA 2DTJA 4OZ9A 2H99A 1N04A 3FATA 3IOUA 3Q27A 3FUZA 1POTA 2O69A 4ZEKA 4FEDA 4F3GA 3H06B 3KN7A 3U94A 1B3EA 2P0SA 5T41A 4EXLA 2DP8A 1PC3A 1ATGA 3MVYA 1ZBMA 2RQKA 4YMBA 5ICQA 4XKQA 3SDFA 2QL3A 5IT4A 4LZ5A 3SESA 1JW5A 1Y20A 1N3WA 4HCYA 1MXYA 4DXUA 5CBRA 4XIGQ 1P1UA 3B6WA 3TPAA 3OFHA 3QUJA 3QSLA 2F36A 4QFLA 2F7AA 1B58A 3EF7A 1GVCA 5J1DA 1M5FA 5H8FB 1NNPA 1FQBA 5AA2B 1SI0A 4LA9A 2F34A 4GVOA 4OWDA 1Q1KA 3ENWA 3IX1A 4C0RA 2GHBA 1POY1 3T9HB 5ICTA 4OQOA 3FGSA 1IIWA 5I56B 2F1FA 1Y3NA 3PUXE 4C1TA 2H98A 2ZYKA 4MLVA 2R6GE 2X26A 1N3XA 3NRBA 2PBWA 3FXRA 3ODBA 1A54A 3DP6A 4R2BA 4U4SA 3TTRA 3SEYA 5AA4A 3BBRA 2PA3A 2ONRA 2QSXA 1IXGA 3U93A 1R9QA 2Q89A 3FZVA 2RCAA 1H45A 5HBCA 4KYSA 3TYHA 4RY1A 3Q26A 1XOCA 4F39A 4O3AA 5DYHA 3S9MC 2OWSA 2DT9A 3TZAA 2XXRA 3V8XB 3K5PA 4FORA 4HS7A 1D9VA 4C1UA 3BFUA 3Q25A 2A5TB 1VR5A 4X1DA 4OHNA 3KEIA 1BTJA 5FHNA 4PETA 3PPPA 5FTIA 3QXMA 3OFFA 3T9VA 1XT8A 3SEUA 3TCHA 3S4UA 2V25A 1JQFA 1HSEA 2P2AA 4PFTA 1BIYA 4XXUA 3WAFA 1NNTA 3OFGA 1MQIA 5DVIA 4IY6A 3L6GA 4IGRA 3H6TA 2XXTA 1I6BA 1NL5A 3FJ7A 2NYIA 2UYEA 4ELPA 1AMFA 2AIXA 1A7LA 4ZEIA 4QRZA 1B4ZA 1MH3A 4RPNA 1B3LA 4LVQA 4AB6A 2LAOA 2Y84A 5JJBA 3K2DA 4IO2A 3VVDA 2ONSA 2XXYA 1CB6A 5CMMA 5I56A 4NF4B 3CFZA 3U1OA 5JTYB 2Q9TA 3DP4A 1US4A 1GGGA 3SERA 1VFDA 3MTJA 4KFQA 2XXUA 2RINA 1PB7A 5BWJA 5KDTB 1IXHA 1XVYA 5DVJA 1H76A 5ISUA 3O6GA 3PPOA 2P9EA 1VE4A 1UJ5A 4OVJA 2QMXA 4X9TA 1P1OA 1LAFE 2MDAA 1ZPVA 2Z23A 1KWHA 3M3KA 2GH9A 4QHQA 4TOZA 2UVIA 4IO7A 2H25A 3C33A 3VE1B 1B5JA 3RUMA 2PX1A 4QF9A 3H6WA 3V5AA 5FTHA 4NF8A 3BFTA 4RA1A 3TUSA 3TCGA 2DSFA 2RF1A 2XXIA 1XVXA 5FHOA 5I59B 2Y7PA 4ISUA 3CSGA 1LAHE 3OSQA 1A8EA 4F18A 2ESNA 4GD5A 3EHSA 3RT6B 3TTKA 1JNFA 2F97A 5EHMA 2PC6A 3E3KA 3V83A 3FV2A 1B7ZA 3CR9A 3DM0A 3CEDA 1NNFA 1D9YA 2PVUA 2Y7WA 3PD9A 3G3JA 4R9FA 3CIJA 2PMSA 4OEVA 4DIGA 4IO5A 3TEPA 1DTGA 1BP5A 1I6AA 3RY3A 1P1WA 3HN0A 1DSNA 1OVTA 1URSA 3HO7A 1LB9A 4F3SA 1Z7ME 1QKAA 3OENA 1MXVA 5JTYA 3S2VA 3VV5A 2QJEA 1JW4A 2UYFA 3OOAA 3IB0A 4R73A 3G3GA 4RPOA 5KDTA 4P11A 3O9PA 2QPQA 2Z8FA 3AB4B 1PDAA 1B3FA 4WXJA 1N7XA 2YLNA 3F11A 2UVHA 4O3CA 2HCAA 4U1ZA 4ZECA 2XXQA 4FECA 2DS9A 2REGA 4QFOA 1UTBB 1WODA 3E4RA 2ZNTA 1SQYA 1A40A 2H9BA 3VVFA 4JXIA 4JWXA 3MP6A 3AXFA 3EHTA 3EPEA 3GZGA 4ZZEA 1MXWA 1N0TA 3G3KA 3PUYE 5I57A 2HZKA 3DDNA 3TCFA 4IO3A 2G29A 2I3WA 5H8HB 1QJMA 3TTNA 4LQ2A 2D5WA 4H5GA 5LOMA 1I6QA 3PMWA 3USDA 1B0LA 4ZS9A 1JEVA 3FD3A 3RTFB 1TT1A 1J1NA 3RGYA 4JWOA 3MVWA 5DEXB 2HEUA 2Z8EA 1ZJLA 5KCJB 4RK9A 3T66A 4IO6A 1QW0A 4ECFA 3L6HA 1MY1A 3VXBA 3ENVA 4QFKA 1QUIA 3IOWA 3PUZE 2NXOA 1QVSA 3OSRA 1Y3QA 1OIBA 2P9GA 2QSWA 4OEUA 4H6DA 4AQ4A 3MVXA 1LFGA 3LSLA 4KCCA 1R9LA 3R6UA 2ZYNA 4IB2A 1Y1MA 2QS1A 3A09A 3JZJA 1MDQA 1EH3A 4I8CA 3KOTA 1UIVA 1LK5A 2D3IA 5F1QA 1U8SA 2YJPA 3MJNA 3QK6A 3U92A 3T93B 4BLAA 2R9JA 1N84A 4G68B 4G4PA 1AL3A 2ANJA 2CMOA 1ZIUA 4F22A 4EDPA 4I9DA 1D3KA 2GHAA 3K00A 1XTZA 2F5XA 3LSWA 1DPEA 2O51A 4NMYA 4U4XA 4ZE9A 1BKAA 1R1NA 4R75A 3MC2A 3CSBA 3SEWA 2F7CA 1FQEA 3UW1A 3O2AA 3E9XA 4XKPA 1TFDA 1S50A 3VDFA 2GFEA 1P1NA 1H43A 1EZPA 4OFJA 3OBIA 4POXA 1GTKA 3UIFA 3PMXA 1SC6A 4LQ5A 1FTMA 1Y4TA 3OO7A 3FIRA 1LSTA 3MZ9A 5L8DA 4KYEA 1UJ4A 4DE8A 5FHMA 2ZNSA 2XXVA 2E1SA 3RTWB 3ONMA 2B65A 4FATA 3C34A 3OD7A 1B46A 3OO9A 4U1OA 3IXQA 3I3VA 1T0KA 2HAVA 3LOUA 3DHXA 1ELJA 1XC1A 1MXUA 2XXWA 3FV1A 3PPRA 2DOJA 1FQDA 4GLIA 2J0XA 5FIIA 1NKXA 1USYH 4N6PA 4P0IA 3H7MA 4IGTA 1MDP1 3FXQA 3K02A 4HW8A 3TDJA 2JHEA 2LQJA 3KJTA 4XKRA 4NE4A 3TELA 4YB7A 3EQ1A 2ALUA 1UTHB 1B0HA 1N76A 4DCXA 3DHWC 2QS4A 4GWOA 4RJZA 1MY0A 4R74A 4G68A 1A55A 1YTVA 3P7IA 3O6IA 3IB1A 4L17A 3RPWA 2OLBA 1NMUA 2G93A 2THIA 4FJPA 2Q88A 1CE2A 1FTLA 5I2NB 2IA4A 3VLWA 2F8DA 4XTCQ 1MPDA 2FYIA 4PWUA 2DWIA 3KG2A 2O84X 3PGFA 4FAJA 3RN8A 2HZLA 4MH5A 3W15C 4JB7A 4EF1A 3N6TA 4P0GA 1JEUA 4KR5A 4KCDA 5K2YA 3SEVA 1Y7PA 1FQFA 2XXPA 2VD3A 4LP2B 3IOTA 1B5HA 2I0BA 3A3UA 4IO4A 2BJJX 1VFEA 1O8BA 1Z7NE 2RC9A 4KQPA 3ZSFA 4X1BA 1LAXA 4QSDA 1O63A 3K0VA 1HSLA 5H8FA 2PT1A 1NNKA 5CMBA 3CFLA 5AA2A 3HPIA 1MS7A 5IKBA 1MY4A 2F78A 1SI1A 2I6EA 5I2KB 5TP9B 4UACA 4BDQA 2O68A 4BDOA 2DQVA 3UGWA 3T22A 2OWTA 4LZ7A 4U23A 1HSJA 2O6AA 4N13A 3I5OA 2RC7A 5CBSA 5H8QB 3MP8A 3G3HA 3PPNA 1MY2A 4YB6A 4BDNA 1UTHA 5L9MA 3MUQA 4NF6B 3H6UA 2Y7IA 4DCYA 3HSTA 3D4CA 1B9JA 2DXRA 3KBRA 2DWAA 4DZ1A 5DTBA 5TPAB 3CG3A 2F8MA 4R9GA 1I69A 1RYXA 4GQOA 1H44A 3TODA 3AB2B 1JVYA 3AAWB 4IY5A 1B5IA 4IO1A 2LVWA 1SW4A 2F6GA 4PE5B 1SVXB 1MH4A 1NFTA 1SW5A 2F7BA 3IR1A 3C31A 3ZKLA 5B70A 4JSOA 4GFRA 4JWYA 3K1NA 3K6UA 1YCJA 4Z7EA 1M5BA 3LUYA 1D4NA 2DE2A 3UP9A 1YPNA 1MRPA 1SBPA 4OFOA 5L9SA 4KI0E 2A5TA 3UK4A 1PB8A 3MW0A 2CZLA 4G68C 1MPBA 2ONKE 2Y7KA 3ILUB 3CG1A 3S9NC 1JVXA 3IB2A 1IITA 3FVNA 3VLUA 1UIUA 4JDFA 4ONYA 1GR2A 2B3BA 5ITPA 3H3GA 5F7VA 1M5EA 1NH8A 4YKPA 1Y1ZA 4LATA 3C35A 3TKDA 2ZXTA 4NTLA 4I1DA 4R6KA 1LCFA 2H9ZA 2V3TA 2IEEA 2YPNA 1JETA 1II5A 4U2RA 1SD3A 4H65A 1OQGA 3CI8A 3M3LA 4GXSB 4RK2A 1MG1A 2CDQA 3KFMA 1VSOA 4NF4A 3SEXA 3K01A 4DXBA 4QFNA 5H8QA 1EZOA 4NF5B 3S9EA 1YAEA 2AL5A 2NOOA 4MLQA 1UQWA 5H8NB 4F1VA 4NF6A 4WEDA 3O1LA 2V3QA 5A5XB 2FNCA 3RT8A 2UXAA 1O64A 5TPAA 2VHAA 1ZMGA 3T9XB 3KJ7A 4GL0A 1FCKA 2QMWA 3IOVA 3HHGA 1SYIA 1B3GA 1FQAA 1Y4CA 1ANFA 1EU8A 5I58B 1IQ7A 1MQHA 1A99A 1ZLQA 1TWYA 4YZZA 3H03A 3W9WA 4R6HA 4H0WA 4E0XA 3IBWA 3O66A 1RKMA 2JOQA 4G77A 3FVOA 1OQHA 1PB9A 3LSFB 1JW1A 5I59A 1SW1A 2RC8A 3PD8A 3TMGA 1DPPA 1S7YA 3R26A 2VP1A 3MPLA 4Q5TA 4YAHX 3K6WA 4QSCA 3N6UA 1H3DA 3HHFA 2A5SA 2P1SA 1OMPA 2V84A 3KZGA 1LLSA 3O97A 3G3IA 3OO6A 3W7BA 3RQTA 2I4CA 1MQGA 1B4HA 4H8JA 4U21A 2QRRA 2Q2AA 4GO5X 3JV9A 5HPQA 1P1QA 2DVCA 1B05A 5AA2D 1FTJA 1B7HA 3SETA 5I84A 3N94A 4GIZA 4KYDA 4LUBA 3FVGA 2NVUB 2XXXA 3KSJA 3O6HA 5TU0A 4FEBA 3PUWE 4BDLA 3TTLA 2AL4A 2I0CA 3TAJA 2XD3A 1B6HA 1LBBA 3RNNA 5DVFA 2Y7RA 2RQMA 1MQJA 5H8NA 5ELVA 1M5CA 3OEKA 2ZYOA 2H5YA 1LKZA 1Y9UA 4NWCA 1ZKBA 4ELRA 4M8LA 1MQDA 4G8MA 5M2VA 3U8QA 4WEPA 2Z8DA 3C9HA 5AA4B 1R6ZA 2XX9A 3HHEA 2ZMBA 1UTBA 5H8SA 3U72A 3VFJA 2I9SA 1FTKA 2RCBA 3UORA 3TFLA 2V93A 5HM4B 4UA8A 3I6VA 2KO1A 5H8HA 2I3VA 4OETA 3R7XA 3QIMA 3MP1A 3ECRA 4NWDA 4Q30B 1F9BA 1MM7A 1LFHA 5DEXA 3N26A 1LB8A 3B7DA 4EQBA 1QULA 2J0WA 1ZU0A 5KCJA 4JSDA 1IXCA 1LAGE 3Q29A 3D4GA 5EYFA 3FVKA 2DWJA 2NWJA 4QSEA 3FJMA 2Q8JA 3OO8A 1US5A 1LFIA 5JK4A 3OELA 5B7DA 4XKNA 4M1VA 2KLFA 2F35A 2XHDA 3WAEA 4R72A 3HV1A 3GBAA 3UN6A 4OESA 4YKJA 4H67A 1PBQA 3MZ1A 2OZZA 4U22A 3MPKA 4RXLA 3FASA 4GXAA 5AA3A 4K3FA 2UVJA 1RYOA 4POWA 3SKPA 2HFBA 1B32A 3OXNA 3IL1B 3W9VA 3PPQA 3IO6A 4G2ZA 5KZTA 2B3FA 1B2HA 1B52A
chains in the Genus database with same CATH superfamily
3T1YJ 5LT5A 2XA5A 1VJWA 1DJ0A 1Q35A 4F1YA 3O44A 3VV2B 1A8FA 5DG9A 1WEYA 3CVGA 4OI4A 4F31B 4ZDMA 2VC0A 2WBMA 5DGAA 2JDJA 5JEIA 3QATA 3TQLA 4H5FA 3HO1A 2DVZA 2GVZB 2KT3A 4G8NA 1FNXH 3VXCA 3L9ZA 2UUCJ 4PGPA 1NK6A 1WC0A 3QAEA 1UTAA 1LWEB 4RR5A 2R4FA 4OYWA 3DLGA 3PW2A 1UVNA 4CNYA 3EN3A 4ZE8A 3FSYA 4FNIA 4QIWD 2IVYA 3LPEA 4ICLA 3IC1A 1GV8A 1U1MA 1GMUA 1R0AB 3N6MA 1JLGA 2DD8S 3PHTA 3CNQP 3RBEA 1UCNA 2RH3A 1X4CA 3EJMA 2XNRA 4C11A 5L39A 4K5RA 4LMZA 2I58A 2PFDA 2WZ1A 4KPCA 2CPDA 3BB5A 4CLFA 3C14B 2FVQA 4PAKA 3BPDA 3VZIA 2XY6A 2HVIA 2VFSA 2AX0A 3GIRA 1Q7LB 3UDLA 2OHDA 3BO3A 2AEMA 2WKYA 2FB0A 4WFYA 5L9OA 3KFWX 2VQEJ 3ZZYA 2X7PA 3W5ZA 4F1UA 2FC8A 3IS9B 5HLFA 4ED8A 3D6HB 3D6MB 4U95A 5B09A 5J2QB 2BQRA 4RU2A 5A8WB 1LCTA 2AU0A 4IOAQ 2PGCA 2BV3A 5KFWA 1ZBTA 3IA0A 1X4GA 4NL5A 2OD6A 1UWAA 5L8RC 3IWLA 3MAHA 4DR2F 4IH5A 4YU0A 2DHXA 1SKUB 2DCLA 3ENQA 5I2NA 4R0JA 2HLUA 3M9MB 1VK8A 1L5TA 4ELOA 1J5OB 2HQ0A 1SPIA 4QBAA 2E7WA 3CJKB 2DGQA 5GMKa 3KHHA 2ADBA 2ZE2B 3V81A 3C15B 5M2PA 4TY8B 3TUIC 4MF3A 4LF4F 3EXCX 3MBPA 4GO7X 3UA8A 1HNVB 1VR6A 2D69A 3P5BP 5KTQA 3C8YA 2RKMA 4DR7F 2Z22A 2N3LA 4DFJA 2YKMB 3CO0P 3ILTB 2Q2CA 2BR0A 4J9UE 2KQZA 3FEZA 2FHMA 4NXNF 2V6AA 4B9TA 3BO4A 3T6BA 2B7BB 2KL8A 3D28A 4B9LA 2ZZNA 2H3EB 1DAXA 4GOTA 3W5XA 1JQGA 2YY3A 1XBWA 5EQ8A 5CYQB 4MNCA 3GMGA 2KR0A 2H48B 4GL8A 4F67A 3KNAA 4FE8A 2HBRB 3CC7S 4ND9A 2F6PA 2CQBA 5KFEA 3OUYB 1HR0F 4N77A 2XX7A 3GTYX 3H40A 2X7IA 2N3OA 5IZZA 4JI4F 4RW7B 1PC4A 2C2RA 4WFXA 4DR3J 2MSTA 3K6VA 1MY3A 5ITHA 2L48A 2AYGA 1HNWJ 4BWJA 2DNQA 2LU1A 3GJRB 4PKDB 5A2QY 2YQ0A 4P47A 2OWZA 1X5PA 4N8OA 2XXHA 2H5IB 3VAKA 3LA0A 4MH8A 4CH7A 1VFJA 2CG4A 4HTIA 4CLTA 3C32A 5EHSA 3WBZA 3MPVA 3CD6S 1NHUA 4N6DA 2DXFA 3OXLA 3OR1B 3MEKA 4HEA9 3OFEA 4IOCQ 3UE2A 2VGQA 3GE9A 1JIHA 2M7SA 5D6GA 4DPUA 4OV1A 4KD5A 1S6PA 4NYOA 1AOVA 4TU8A 2ZZWA 1QD1A 3M8WA 3ICLA 4ID5B 1T9XA 4Q8RA 3L7OA 4MFBB 4NEDA 5SZTA 2RS2A 2DGVA 4OFLA 1J27A 4OZJA 2XS7A 2KZMA 2O1LA 4ALZA 4MJOA 1IXKA 5E0OA 5DLGA 1M5OC 1APSA 4OENA 2DVIA 1OSCA 2Z57B 4WU2A 5CMKA 2HHSA 4HE1A 2MY7A 3PJXA 5LOQA 2VKRA 4FBPA 3KHGA 4FYWB 2NPIA 2MKKA 1FEHA 5BYSA 4W92B 2VOZA 2HNYB 1OLCA 2O5DA 2HKEA 2M88A 4PG4A 3CHGA 5I5PA 1V5VA 2GRVA 3T5HA 3UI3A 3QGGA 4IO9Q 4DI6A 1F0XA 1N33J 1RAJA 3CWJA 4F19A 4KHZE 1F6TA 4KH0B 1B3TA 4ZPBA 5IT9Y 3CCJS 2WVFA 4J9QA 4I2QA 1BQMA 3A4TA 4MMPA 3E13X 1WG4A 1FI4A 2CJAA 2IVFB 3EZ5A 3PX0A 1DARA 5I42A 3D1RA 1FTOA 1JWWA 4KC5A 2B5JA 4H8IA 2ZNYA 3TAQA 1P99A 1S5ZA 2RRNA 3HSGA 2ASDA 4DQQA 1U1LA 2QC3A 1JJCB 4N41A 1YGYA 2ATCB 2ZM6J 1B7UA 3QUFA 1E6VB 1QVFR 4DPTA 1Y3PA 3DC2A 5H1SV 4DSEA 4BDMA 4C6AA 3KSXA 5LM7E 4GRSA 3TAMB 5HVHA 2OPRB 4OMBA 4TLLB 3HHLB 3ZC4A 1MPCA 2OTJS 4PQJA 4MHFA 2FY8A 4CM2A 1DOTA 5F8HA 3PY8A 4NA3A 3HHNB 2CDRB 1DURA 2HNZA 1K9ZA 5LSLA 1XS5A 2H4WB 3CJ0A 2GHVC 2HVEA 1IZ1A 4P2FA 1O5JA 4FXWA 3RLFE 5HQLA 2DITA 3V6HA 3K8WA 4TNOA 4AL7A 1U45A 1OY6A 2I8EA 4JI3F 4WK3A 2XEXA 3ZTRA 1HMVB 3QRQA 4OZ9A 4FVCA 4CZCA 2BQUA 3FATA 3IOUA 3Q27A 2C2DA 2GHPA 1POTA 2O69A 1U1PA 2HHMA 4HDHA 2QLBB 4A8QA 4PQUA 1FJ7A 4JOUA 1V3RA 3N5BA 5T41A 5LJ3Y 5E3CA 5IQ6A 1ZBMA 2RQKA 1I5OB 5ICQA 4PXCA 3N6NA 3AOAA 3SDFA 1DFDA 5A2QU 2JLFA 4K4UA 2HIYA 1BWEA 1HNXJ 2DH8A 2F36A 1SL1A 1HI1A 4WFBQ 3RRHA 1F3FA 1S1VB 5A0YA 1M5FA 1S7HA 4C3LA 2AJ1A 4G1QB 1KVKA 1KQKA 4ZVFA 3HT0A 5AA2B 3CMES 1QVGR 5GAEU 2D3UA 3VAFA 5KAKA 3AXKA 4ED0A 1BLUA 1PG5B 4GWYA 2NLWA 3IX1A 2HGLA 5HN0A 1F3VA 4C1TA 2P5VA 3DN9A 2MZSA 1UEKA 1MROA 3SIPB 5DW8A 3NRBA 4L3NA 2PBWA 4PG6A 4WF9Q 2XI2A 1A54A 3ODBA 3DP6A 5KFNA 2OH2A 1TK8A 1NDCA 2R7XA 2G0JA 3AD9C 1T3NA 1DTQA 4DL2A 2RDIA 3JYTA 2PA3A 2JEGA 3BBRA 1F2HA 4IRDA 1RAFB 3R7NB 2QSXA 5IT9U 1R9QA 4DV5F 3TRGA 3MXHP 4ECUA 2RCAA 4I3EA 3M2VA 4WE1A 4RY1A 1HNIA 2ADCA 1XJWB 1XOCA 4F39A 2W7OA 5DYHA 3S9MC 2OWSA 2DIVA 2ZKTA 2DT9A 4EYIB 4DR1J 4A8WA 1ZA2B 3IBCB 1GMVA 3V8XB 3CD7A 1X0PA 4NA1A 2WYPA 3HKWA 4OHNA 1BTJA 4BHQA 2V2QA 4NEZA 5B0FA 3CCES 3K8VA 1S9EA 3FCWA 4Y2KA 2F3BA 2AIRB 4LFCF 4RKUC 3OTOJ 3BQ0A 2B4PA 3NCPA 3X1LB 1FPLA 4OVPA 1HSEA 4ILLA 4PFTA 4X4NA 4FYXB 1NNTA 5FDLB 1KQGB 4Y2IA 3MDFA 1K9YA 3AA8A 4OYOA 1WC6A 5DVIA 2QZ8A 3AQPA 2C28A 3UVJB 3PR4A 3VAMA 4IGRA 2LECA 1TP7A 1WUUA 3H6TA 2XXTA 1NL5A 3T19A 5GMDA 5EWGA 2VA3A 2AIXA 4O8MA 5D15A 2MQOA 1B3LA 4DBQA 4HHUA 4OZ2A 5J2PB 4B9MA 5JJBA 3DCAA 4IO2A 3CJRA 1MWQA 2ONSA 5GAEI 3FFIB 3KG4A 1XNRJ 2J76E 3D0IE 2XXYA 3NEKA 3D6TB 4RZRA 3MEDB 3CIMA 1Q82T 1FX4A 4IRCA 3OW2R 2Q9TA 4N7TA 3I9ZA 1US4A 2XO7A 1D8YA 1VFDA 3MTJA 1IMFA 2Y8WA 1L3VA 4UOCA 4BC7A 4DL4A 4RNOA 1IXHA 5KDTB 5DVJA 5T7LB 4HHHA 1I94J 3SDEA 2IBKA 4KYZA 1UJ5A 3ZO7A 3GJQB 2QMXA 3I9V9 1GX5A 4Q8FA 1YJNS 2CJXB 2VT5A 1FBCA 4FF2A 3LPYA 2UVIA 4B9NA 4YY3J 1TL7B 1KNZA 3N9UC 2PX1A 1EIYB 4KHRA 4PQAA 2J9CA 5FTHA 4OLOA 1ZETA 2JLEA 3GG1A 4Q45A 2PMWA 2GX8A 4RW8B 3TUSA 2RD5C 2DSFA 3HHLC 3BKFA 1U09A 2HHQA 1IR0A 5FHOA 3A8EA 5I59B 4JI8J 3AD7C 2AGQA 3AFGA 2XCAA 2VBZA 1KHWA 3K59A 1LBXA 4KFBA 1Z2ZA 4DLEA 1FKPA 2M2BA 2BANA 5DQHA 2MLXA 4CLZA 1PYTA 2VICA 3RT6B 1QE1A 2MKZA 2LFVA 2F97A 1MWZA 2QA2A 2ASLA 1LBYA 3A12A 3GYXB 1D9YA 4DR4F 5F3ZA 5EYGA 1D3WA 2HWIA 1XMQF 2RUGA 4Q2LA 1EHWA 2KI2A 1NV1A 3NWRA 2GFFA 3QT7A 2LKZA 4OEVA 1JLCA 1Q8BA 1TKXB 5KT2A 1BP5A 5K5MA 3FBFA 1ZS6A 4HI2A 4O44A 1DSNA 2YNIA 2F9DA 3EE3A 2GA7A 3HO7A 1QKAA 4K50A 1MXVA 5JTYA 5HMWA 2DBBA 4CLUA 3S2VA 5DG8A 1KOHA 1T11A 1S1XB 2WW8A 3NAIA 3LUZA 4QZVB 1R89A 1R7IA 3I96A 2MSSA 1SIZA 3OOAA 3IB0A 3DRSA 3G3GA 3M2UB 3EX7B 5HVGA 2U1AA 6FDRA 3O9PA 4ECYA 2Z8FA 1PDAA 3SFUA 3HLUA 1EYJA 3CJ4A 3CO9A 2BJ8A 4NAPA 4ZECA 2DS9A 5DS7A 5HVFA 1LWCA 4E98A 3RB4A 3MFIA 3E4RA 4A8KA 1VLYA 4FXDA 1LW0A 3V6KA 1A40A 3QLHA 1ROFA 3G86A 3HJVA 3W66A 3AXFA 2KRBA 3G3KA 3PEJA 2AWZA 5I57A 2HZKA 3DU6A 5I3UA 2QVRA 6FD1A 1B7YB 3LO3A 1K0TA 3NY0A 1FRXA 4IRKA 2E1PA 2R7TA 3B8BA 5H8HB 1RU1A 2EG1A 1QJMA 4LQ2A 4H5GA 5LOMA 3WX4A 1NHVA 4PWWA 3AXMA 3PMWA 2R7SA 1B0LA 4OJGA 4C8MA 5K8MA 3J7A1 4ED6A 1JEVA 3RTFB 2BW7A 2PSZA 4ZS6A 5DEXB 4ZHRB 3G87A 4CTAA 5E5NA 3GPAA 1ZJLA 2FD2A 3T66A 2QMUB 4MJKA 1M90T 2XZTB 3ENVA 4F3OA 2LA4A 5G0RB 3OXFA 5KFJA 1QUIA 3PUZE 2KFYA 4XF5A 4DFKA 3OSRA 3L95X 3H5UA 2LMIA 1LQ9A 1DBDA 3BN4A 4QYZJ 2WVBA 3S01A 1MU2B 2QSWA 4TQSA 1VGYA 4FBTA 4JI6F 2BE2A 1HQEB 3HVTB 1HQUB 1R9LA 2VH7A 3FQLA 1AFIA 1Y1MA 3A09A 3JZJA 3OV7A 4WKYA 3QFHA 3C6TA 2QFJA 4I8CA 1IMAA 3IGVA 3NGSA 2D3IA 5F1QA 1U8SA 1FRPA 3KJVA 2XHWA 3P4UB 5DM6Q 3QK6A 2V67A 3U92A 4BLAA 1PJ6A 2H4YB 3GIIA 4PGNA 1K8AT 5B0AA 5LSOA 4FF3A 2Q6BA 1AL3A 1SH0A 2ANJA 3F0NA 1ZIUA 5F0UA 3R5DA 1V6HA 2GHAA 2M8HA 3VAJA 2F5XA 3IP0A 2O51A 4U4XA 4ZE9A 3H59A 1S1UA 2HGNA 3MC2A 4FYDA 4H4KA 2OELA 1NUYA 3SEWA 1FQEA 4OZNA 2D3OR 4TVAB 3DRPA 4TLRA 1PJ7A 3DOLA 4LF4J 2F40A 1IM6A 3NGKA 4NLOA 1NV5A 7FDRA 3KJFB 3LAMA 2K2PA 3K0JA 4OFJA 1LNQA 1XMOJ 4GVBA 4X66J 2MKSA 2G0CA 4LQ5A 2E66A 3MR5A 1FTMA 1Q8IA 1RAIB 1ZAXA 1I6JA 1S0VA 3SSQA 4MKYA 1RJJA 2CPJA 1WKKA 1KZ8A 2V94A 2Z2ZA 1NU4A 4LQ9A 3KLVA 1NK7A 4DV3J 2KFNA 3BGRB 3I4HX 3RTWB 1H98A 3OD7A 4XPCA 5E7OB 1U25A 4U1OA 3W2WA 5IOLA 3PW7A 1CPZA 1XC1A 3MCSA 3UD4P 2B8QA 4RW9A 4NLTA 2NZ4A 2ZHBA 2FJVA 4PFRA 1J2VA 1TMJA 3MEEA 4IG0A 4P0IA 2H5EA 3H7MA 3C6UA 4I6YA 4DR6F 3FDSA 3TDJA 2JHEA 2LQJA 3KJTA 4A8FA 3B82A 5HBMA 2E5LF 1AWBA 2ALUA 2A6MA 1LBWA 1VYAA 2HRUA 1UTHB 1LWFB 2AW0A 1N76A 4QOTA 3DHWC 2UU9J 5CYMB 3OJUA 2QS4A 4LF8J 4RO0A 3MM7B 4G68A 1A55A 1F60B 3FC9A 1T8EA 1N36F 4L17A 1VISA 3TI0A 5HATA 3RPWA 4CDIA 3W9HA 5KFXA 3CCUS 4C3KA 1S7IA 5ET8A 3EM1A 1Y3JA 4GX6A 4F4XA 2FYIA 1EP4A 2SXLA 3KJQB 2Q1LA 2PDAA 1UEVA 3OVAA 4PG8A 4P1EA 1CNQA 2HEKA 3W8PA 1T9UA 4ZPVR 3W5YA 3WZ0A 4KR5A 5K2YA 4IFVB 2VPOA 3PFOA 2KHDA 4LP2B 4NI2B 3IOTA 3P3DA 3GU0A 3A3UA 2BJJX 4JI5F 4L75A 4LQ3A 2HWHA 4ZMMA 1NK8A 3NKYA 2YWEA 4C9DA 1Z7NE 2AP6A 1HBNB 4M5IA 1PC5A 2KXHA 1WC3A 2GZOA 3VR1A 2MKHA 2GQCA 4X1BA 1GH8A 1HNZJ 1QTNB 1F5BA 2VG5A 1QSLA 5L46A 1FPBA 4O3RA 3FBBA 3FBPA 4DV0F 2F78A 2CPFA 3ELHA 4FNHA 2I6EA 4X4UA 3HM9A 4NXMF 5TP9B 5KG5A 5L1JA 1TKZB 1HD1A 4USVA 3CSKA 2CG8A 3ZZUA 1VDHA 2ZVIA 4X04A 5CBSA 2D3O1 2IHR1 3MP8A 5BR8J 1ZH5A 1HHQA 3PPNA 4MAGA 1FFWB 2LP4A 3HDSA 4PZVA 1MY2A 2W2PP 2MKIA 3RAXA 3BQ2A 2P6TA 2DXRA 3RRGA 2DWAA 4CI0B 5DTBA 3U27A 1LW2B 2HBZB 1BE4A 1SPBP 1I69A 1Q9DA 1HA1A 2JH3A 4NLPA 3AB2B 1GMWA 3DGPA 1TZ0A 2E1AA 5K14A 1YRUA 4IO1A 4O4GA 3LWLA 3PO5A 4H54A 1SW4A 2YPYA 2IMOA 4PE5B 3LGHA 2U2FA 4P74A 2C3UA 3RU0A 4JI1J 4YR0A 4LJMA 1MH4A 3AODA 5B0GA 4LBIA 1REVA 1NB2A 1SW5A 2IYGA 2CQCA 3ISZA 2F7BA 3C31A 2E9TA 1S1WA 3ZKLA 5E33A 4GFRA 4JWYA 4P1LA 3SXLA 2MQQA 1YCJA 8RUCA 1N88A 3LUYA 4CLYA 2XM3A 1FVQA 1YJWS 1D4NA 2RKIA 3TQEA 1B99A 1L5UA 1BWVA 1S1TB 3OL6A 3T0JA 3MW0A 3LAKA 1MPBA 3OT9A 2HQCA 3S9NC 1JVXA 3IB2A 2WONA 2PT0A 2V68A 3VLUA 1VRTA 3I82A 1R8AA 1UIUA 1U0HA 2VL1A 1FJCA 3TQ1A 3CDEA 4YKPA 3MI7X 2W7PA 3TVYA 2CQHA 1TL3A 3C35A 2XG8A 3QGPA 2QFLA 2A18A 5KOWA 2Z0GA 1SUQB 2ZBQA 5LSRA 1IBMF 2H9ZA 3G8TA 3R7BB 1ICEB 3CJ8A 1JETA 4U2RA 4F3QA 3PXGa 1OQGA 2NUHA 3FMWA 1IVZA 2OIHA 5CQGA 3KFMA 3IM8A 4NF4A 2FGOA 3K01A 1S97A 2VDHA 2DGUA 1EZOA 4NF5B 5GAHU 4CP5A 4K7QA 2IDEA 2R7QA 4MLQA 2OP5A 3HHLD 4NF6A 4WEDA 4UZCA 3LGNA 2UXAA 1S10A 1TKDA 3OD2A 4HKQA 4AS4A 5ESYA 1HYSB 3LGMA 3HHGA 1FQAA 1Y4CA 4Z2XA 2DNNA 2E5HA 2V34A 5IM0A 1D9DA 3IG1B 1ZLQA 4F26A 1Q78A 3H8YA 2WRMA 4BLGA 3NCQA 2EXUA 2HHUA 1HBUB 4AL6A 5RUBA 4H0WA 1FKOB 3G4SS 3O66A 4X62F 4R0EA 2YBVA 3Q8VA 4C4WA 2OSQA 2P8IA 1M1GA 3PD8A 1P27B 4RBVA 1U8WA 1RUSA 2QV6A 1DPPA 1N34F 3MPYA 3IN5A 2VP1A 1CBKA 4WTOB 2Q74A 1H3DA 3HHFA 3L4BC 3O97A 2V2VA 2HHHJ 1JJ2R 1Z4UA 3W7BA 3RQTA 1UA1A 5IZ3A 2QRRA 4WCEQ 2DHAA 4LFBF 2DIUA 5AA2D 3EGNA 2AGOA 3C16B 3BS9A 4AL5A 1NV2A 3ZFVA 1B7HA 2Y1JA 2CQIA 4JI2J 3V6DB 2V63A 3N94A 2XGQA 4LUBA 2V4JA 2YNFB 2D3ZA 3FBCA 3EDQB 4E8UA 2OMOA 4LRDA 1DCUA 5TU0A 3T5LA 3PUWE 1WEZA 4DV6F 1N8RT 2BACA 4D3HA 2AL4A 2I0CA 1RABB 1HBOA 2I0XA 1XIQA 2XD3A 1B6HA 1LBBA 4CYUB 3RNNA 2Y7RA 2RQMA 1TK5A 5H8NA 4CO0A 1M5CA 1CEZA 3NOHA 2CNKB 3MPWA 5AT1B 1NJYA 1JLBA 4OZ0A 1Y9UA 4NWCA 2WW4A 1UA0A 5EUHA 3UN3A 4MIJA 5HSPA 3I0SA 5T14A 3C9HA 2F4VF 1T0TV 4HHJA 6AT1B 1U49A 1NV3A 3HHEA 4QWDA 4P7TA 2HNDA 1Q81T 4JI7J 3PV8A 3A8KA 4CNZA 2RCBA 1KFSA 3Q8UA 2RDJA 1R6YA 2UXCF 5D0HA 3MM8B 1CS4A 2CYYA 2EFOA 2XTJP 3M8PB 4UOHA 3PIOQ 2LYVA 1L3SA 4OETA 2IY5B 4DV7J 1IMEA 4J9LA 1F9BA 2GMJA 2R42A 4USJC 3ETMA 3EICA 3B7DA 2FHKA 2GO8A 4ZITA 5C42B 5EYFA 4C11B 2NWJA 2K3KA 1TKTB 1VQ6S 1V5IB 1SCJB 2QLWA 4TQRA 3TYTA 2AHOB 3OELA 3PW5A 1IBKF 5G4DA 3LWMA 3I5AA 1VBYA 1JJ4A 2L3MA 3WAEA 2XI3A 1CJUB 1N56A 2F3DA 2K1RA 3TZWA 2JFDA 4L73A 3QO9B 3MOZA 4FKYA 3Q89A 4KHPF 4WP8A 1FJGJ 4FS1A 3PZPA 1RYOA 3OXNA 2K7KA 2D1CA 1B52A 4PXDA 1FO1A 4QXDA 2HWTA 4URSA 1GXTA 1USYE 1RACB 3QZ8A 1YDLA 5HJXA 5ETKA 1OVBA 4Q8EA 3EPIA 4EK2A 3QRPA 3FXUA 4X64F 4DXCA 4F02A 2ZYMA 4OTEA 3T41A 2R71A 2MKJA 3NP5A 1M0SA 5F9NA 2J7UA 1S49A 3JQJA 3JTOA 4DX5A 2DE4A 4DUTA 2DK2A 3GV7B 3WIUA 2C3YA 3MECB 5EYHA 2V3UA 3PUVE 1TL1A 5CH7B 4AB5A 3M30B 4NF8B 4Y2MA 4M5GA 2UVVA 1RTHB 4Q5VA 2E44A 2NXCA 3G7WA 2PYYA 4I0WA 3BN7A 1VQOS 1FTRA 3TTMA 1DTZA 3MOJB 4I68A 3BGLA 5KFIA 1NV6A 1MM6A 2RU9A 4GKJJ 1R8PA 1CJVB 3H20A 4UY85 3AOBA 1PEBA 3RUBL 1QKBA 2IRUA 1A7GE 3HT3A 4D3GA 1FDNA 1FEEA 3LTOA 2J9EA 3TZZA 4ANEA 3ONQA 3KYLA 3WHIA 1JJHA 3NL0A 3VVEA 2KVQE 3FGVA 1U24A 4K0KF 3RTVA 3CCQS 1MXXA 3DLHA 2G4BA 1VRUA 1PBPA 1YBAA 3IORA 3PU5A 1QTMA 1ZM3A 4QPTA 5ET6A 4C8KA 1TFAA 4EQ9A 2FLNA 2ZNUA 4C7QA 1VQ9S 1FRKA 1O0PA 3EVMA 4ED1A 1D09B 2DNRA 2Z4PA 3P8BB 5KG1A 2HHPA 3CJ2A 4PFWA 5BYRA 1S6PB 1DMBA 2OFGX 3CCVS 5JVHQ 2QA4S 2GIRA 4LF6F 1FBGA 4QCLA 2XWKA 4XPEA 1NB7A 1KTQA 3MMJA 4M4GA 4R6YA 7FD1A 2I49A 4NLXA 3PG9A 4I3YA 2R7VA 1RCOB 2VU5A 3FQKA 2NXEA 1WVJA 1RHRB 1TAQA 5CABA 5DQGA 1WSVA 2JEFA 4RW4A 3LALA 2QO3A 4Y6IA 3BGFA 3R5GA 3CGIA 3PYEA 2IC3A 1NPKA 3W61A 4CH0S 1N5QA 4I2PA 3UPFA 4WFAQ 3W62A 1FPFA 3QIPA 5DT6A 4PF8A 3IWXA 3ISPA 4OVQA 2H4IA 1S9TA 2V4QA 3D0GE 2CEYA 1IJEB 3C3LA 2BYCA 3MVZA 5HP1A 4A8MP 3PR5B 3MUVP 4DLDA 2UXDJ 3M8QA 1BQMB 3HFKA 2X1FA 4GKKF 1Q8KA 4X48A 2E0SA 3TJ8A 4U7UK 1OMSA 1L3TA 1D1UA 1VQLS 2EFGA 4F25A 3ZZ0A 4B3OA 3FEXB 3K2YA 2OPSA 2H54B 4ELQA 2CRLA 4PFYA 1Q4RA 2OCUA 1EQ0A 4J9NA 4TLMB 3OVBA 3G8QA 3RR7A 4AQYJ 1B1XA 1PYOB 4LFAJ 4JBZA 1WACA 4ES3A 1FF2A 3NMAA 3OTDA 1FERA 1NDKA 1SXLA 3K1MA 3US5A 4HXVA 2MYFA 5BJRA 1W26A 3PV0E 4G8HA 3TUJC 2JZ5A 5KT4A 4FIMA 1B1HA 3IJXB 3H6VA 2B6AA 3THTA 1TV6B 2QN6B 3IAZA 1RDXA 3OMBA 4ZJQA 3KN3A 2XMMA 1RTJA 2PE8A 3TW0A 2AQ4A 4O3BA 2PMHA 2M8CA 5M2UA 1DK4A 1S4FA 4U96A 3RW7A 4F7VA 1F9HA 4PQUB 4HCWA 3S9LC 1GX6A 4YN3B 4EFAC 5FLXU 1AUSL 1NSAA 4F2QA 4M1KA 4PCDA 2YX4A 4DEZA 4OYZA 5KG0A 3DELB 2V8GA 4OERA 2NUVA 2XD2A 2CJ9A 1O7TA 3CJTA 1SC3B 3K57A 3R97A 1FTAA 1PYSB 1HLWA 2MPUA 3M2RA 4DV4J 2J5AA 3HP6A 2EFNA 4GWZA 2AYBA 4FXVA 3M3FA 2QRYA 3PFEA 4OIXA 3X3UA 4P3LA 3VCDA 5A0YB 2KFZA 4X8RA 5KFQA 5DLFA 2DNKA 3VAHA 1B64A 4UT4A 2FC9A 2HYIB 4DV0J 3IO4A 3MCMA 1RWUA 5GAGU 3ZKKA 4N47A 1OLAA 1FHTA 2ASYA 2IM0A 5ET5A 4X4PA 4F3PA 1TUVA 1WF0A 1TL5A 2QLJB 3GBBA 1K47A 3UQSA 4NQ8A 5LXYA 3FXBA 5DETA 2HAIA 2E1MC 3GIKA 2IAJA 3PCOB 2VFRA 1NJXA 4NMLA 2GC8A 4WU3A 4KO0A 1F2GA 1JNRB 2J7WA 4IFYA 3KK2A 1X31C 2UUTA 1JKHB 2DHHA 1RTDA 5HQMA 4P9SA 4MBPA 3EGVA 5DO2A 3RG6A 4TN2A 3IAS9 4KIAA 4NCAA 2R7RA 2CVEA 3TUZC 5ETTA 5C2CA 5I58A 3TANA 1RZMA 4H1XA 2OSRA 3AHPA 2O1PA 2UXBJ 3TEHB 2GO9A 1MXZA 4FDFA 4F4KA 2POKA 4TYAA 3KWMA 3M2VB 2CUYA 1XR5A 3ITHB 1I1GA 5HROA 2E7VA 4V19J 5LL6d 3ET6B 5EQ7A 2C42A 5D0GA 1FWKA 4ZEKA 4FEDA 3H06B 2HHTA 4HDGA 1WF1A 2XBPA 1KC8T 4EXLA 3TZXA 3SSSA 3VGUA 1N5YA 4Y00A 5KFMA 1A9NB 1TFWA 2EBEA 1FJ6A 2QL3A 3OSNA 1JW5A 2XSJA 3I87A 1S9EB 1N3WA 4HCYA 4DXUA 1S0OA 5LTCA 5CBRA 2HMIA 2WCXA 2O67A 2PI4A 3TPAA 1QAIA 2EFQA 4GWXA 3QUJA 2P3NA 2WBRA 4DPXA 4LSNA 4AXJA 4KE5A 4B3MF 2WK4A 4WYLA 1X4HA 3UO0A 1OPIA 4OI0A 1SI0A 3DLEA 1BK4A 1J5EJ 4W98A 5B0CA 1Q1KA 4RPFA 4KTQA 2CZIA 2F3JA 2GHBA 1POY1 5KFPA 3T9HB 1YJTA 4HT7A 5ICTA 4OQOA 3FGSA 1IIWA 1AZSB 4QR0A 3IWNC 1ZOTA 3K5NA 3PUXE 2H98A 1SB6A 2CKWA 3VGVA 1S6QA 4DMZA 2XZWA 4F2SA 5KG6A 2HS4A 2VKZG 1IBLF 3HX9A 2QJ3A 3M7VA 3SDEB 3I5CA 4O23A 3KK3A 3TTRA 2RHSB 2X3GA 3PTWA 2E5GA 3SV4A 4PG5A 2ONRA 3MZIA 4F4ZA 4WXOA 2V2KA 4UQTA 2J0QD 3UR3C 1GFWB 3U93A 4TY9A 2Q89A 5E3PA 3ISNC 4O7IA 4DS5A 2GNKA 2HQDA 4ECTA 3CDWA 4YHHJ 1IMDA 3CJQA 1S57A 4I40A 4OX9F 3TEGA 4IKAA 3TZAA 3A8JA 4N8GA 3GV8B 3TA2A 3K5PA 4HS7A 1D9VA 1S99A 1WHYA 2XSFA 2A5TB 3KEIA 1VQNS 1UW9A 2ZDPA 3UD3P 1OWXA 5FHNA 3OJSA 2VA2A 5FTIA 5C5JA 2GGPB 3QXMA 2WBDA 4L3KA 3T9VA 1UL3A 3DRRB 1LFWA 4YR2A 1WG5A 2EWHA 4WWSA 1KQFB 3ILJA 2P2AA 2YKOA 2QG9B 1BIYA 2DNGA 4OX7A 1IQTA 3SZPA 2GV1A 5EX0A 1D0EA 1MQIA 3L6GA 5EGYA 1Q5VA 3BJYA 1I6BA 3FJ7A 1CSJA 5C25B 4ELPA 2QEXS 4DG1A 1V3SA 1RDRA 1B4ZA 4RPNA 1NPPA 3K5LA 3MR2A 5EDWA 4LR8A 4AB6A 2LAOA 1JLCB 2Y84A 3J80Y 3M32B 4NG7A 3GFHA 2E5JA 2B7CB 2PFZA 4WXWA 4O44B 2Y0BB 4RX6A 1CB6A 1UVMA 5I56A 4QWCA 2HSEB 2BQ3A 5JTYB 1X5OA 3DP4A 3DLBA 4G1PA 1C0UB 2Y9HA 2DEIA 2DISA 5FJ4A 3POTB 4DSFA 2XXUA 3CULA 3JQMA 1RT7B 5BWJA 3BR8A 3TAPA 5KFVA 3UD5A 4ZPTR 4QYRA 1MW7A 3O6GA 2P9EA 1H7XA 1VE4A 1Q7YT 1FE0A 4IDKA 3GIJA 5DZ6A 1G2EA 2Z23A 4ZCIA 1QAYA 2GH9A 2M5YA 2Y8YA 2XWYA 4IO7A 3DDIA 1SH3A 2GVZA 3VE1B 4K2JA 2ZZXA 5A6PA 4QF9A 3FZ2A 4LF9F 4PDHA 4USHA 2UXCJ 2RJZA 3BFTA 2FVRA 1VBKA 5I3UB 4DU8A 2RF1A 3RB6A 5CZXA 2XXIA 1XVXA 1FA0A 1DHMA 2DHSA 2NR0A 2KZZA 4WFNQ 1WOPA 1AA1B 2Y7PA 2UUBJ 2V5HG 3G6XA 4R5PA 2QGFB 4CCHA 4B3RF 1EYKA 3CSGA 2DY9A 1LAHE 2FZCB 5IV4A 2R8JA 3UCGA 3IM9A 3OSQA 1A8EA 4F18A 4CTAB 1WORA 3M6XA 3EHSA 4DL6A 1A6LA 3TTKA 2DGSA 2IDLA 3QMFA 3NGTA 3E3KA 4I7FB 3FV2A 4DSIA 1YZ6A 5I3QA 1HD0A 1RKIA 3CEDA 4CO1A 2WAQD 3THVA 2KM8B 2CQ1A 2Y7WA 4A48A 4ANDA 3PD9A 5IFMA 4ECRA 3KLEB 2PMSA 2AJ4A 2KYZA 3NXZA 5KFUA 4YOEA 3SEOA 4F4YA 3FZBA 1ZTTA 5GVQA 3RY3A 3GFXA 5KFZA 3ZZRA 1P1WA 5KFHA 3IS9A 4B9SA 3RB3A 1LB9A 2R2UA 5J2QA 3V4IB 3HZEA 1MN7A 1X60A 3DNCA 2L9NA 5A8KB 2JL9A 2W24A 2HURA 1NK9A 1NI9A 4JYAJ 3E8OA 4RPOA 4DFMA 5KFLA 1VC0A 1NZAA 5HQ8A 1IKVA 4WXJA 2QLXA 3NGUA 2AZ3A 4X64J 2JEJA 4U1ZA 5B0BA 1R3NA 1YJVA 4HE0A 1S1UB 3UNGC 1J5OA 1UTBB 1WODA 1XN9A 3CJKA 2ZE2A 1P1TA 4TY8A 2ZH1A 1W7WA 4P2MA 2AF6A 3DGVA 2JC0A 1B0TA 4JWXA 4XAKA 2C1EB 3EHTA 2W7AA 1HNVA 3MM5A 3IRWP 4DV1J 3EPEA 2Z58B 4ZZEA 3CTRA 1ZTWA 4OI2A 3BYRA 1N0TA 3PUYE 2YKMA 4PAAA 3TCFA 4NX9A 4KQZA 3K5OA 1JX4A 3J80U 3TTNA 3BV8A 5D0EA 2D5WA 2ZBCA 2HS0A 2C2KB 2X3DA 4ZS9A 1PIEA 3TOQA 1C0TB 1J1NA 3WDOA 2X51A 2CZ9A 4NLSA 2CIMA 1P9QC 4ECFA 3W2WB 4TU7A 4X4TA 2N7CA 3GG0A 2WVCA 3IOWA 5C7PA 1QVSA 1BC6A 3SBMA 1OIBA 2P9GA 5J2MB 3A13A 2QL9B 4RNNA 4H6DA 4OEUA 4DI4B 4KCCA 3C6UB 3VAGA 3R6UA 3PYDA 1M5VC 4M95A 4GWUA 4PE3A 1YJUA 5BYQA 3KOTA 1LK5A 3MJNA 2CJQA 3UDVA 4HTJA 1VK3A 2R9JA 4MKAA 4NRTA 1MSWD 3OR1A 3CB4A 4G68B 2W9BB 4P52A 3TR5A 2IJNA 2OPPB 2CMOA 2CPZA 2F8EX 4F22A 2DR8A 3FK4A 1D3KA 2CZHA 5LMNJ 5EN1A 1NZ8A 4ZVHA 3LSWA 2WB4A 4LF5J 4DUZJ 4OJ1A 1W2IA 4G3IA 2J7KA 8ATCB 5CZVA 4R75A 1NPRA 1IMBA 3CSBA 2F7CA 2XMJA 3O2AA 3E9XA 2YWHA 4XKPA 3KLHA 1P6TA 1WELA 1HL6A 3SQOP 2XZDB 2YX1A 2OX3A 1LWXA 2FTRA 1GTKA 2AJ2A 1RWPB 5L1IA 1RB0A 1Y4TA 4B17A 1FPIA 3QWPA 2CQ2A 2I6WA 3M8YA 1LSTA 3R9LA 3CDBA 5EQ9A 2C22A 1ITPA 5GADU 5FHMA 1K44A 3D4JA 2ZNSA 1FWLA 4TKTA 2IVMA 3C34A 3BSAA 4O7MA 1B46A 3KHLA 3IXQA 1T0KA 4YP3A 1BQNB 2XCPA 3FV1A 3MAAB 4GLIA 3IFAA 1RLDA 1VQ8S 1ZM2A 5KT6A 1NKXA 3BPSP 3VGSA 2MB0B 4C0HA 1RA6A 3TZYA 4IGTA 2F8HA 3K02A 1E6VA 3QT8A 5F8JA 2QT7A 1AYEA 3SSRA 4B02A 2LXIA 3EQ1A 1EYIA 2J8SA 2BOPA 4ZVSB 2OPRA 4PUOA 2FZKB 3HHLA 3AJDA 1B0HA 4DCXA 3BSOA 4ZPWR 3SQGB 1MY0A 3NBPB 2GIQA 4HACB 5J1EB 4KJIA 1YTVA 3P7IA 2F4FA 4B3SF 4FN5A 2BEFA 2B9XA 2FHJD 4FVMA 3M8RA 5HO4A 2G93A 4ZLPA 5KOXA 4FJPA 3CW2C 2KM8C 2WVDA 2D9OA 3KHRA 2W2MP 3VLWA 4MIAA 5JUMA 1FFGB 1Z1ZA 1HMVA 2ZH8A 1MPDA 4XTCQ 4KGZB 3DXSX 3KG2A 3OR2B 3RN8A 2RU3A 1FDAA 2BOAA 2V0NA 4PC9A 1JLQB 4EF1A 3JSMA 4NYPA 1EETB 4P0GA 3FKBA 4CIOA 2ZJQQ 2XHCA 2H51B 5AXMA 1JEUA 4KCDA 4JUZA 2XXPA 1U6ZA 2YNGB 2H5JB 1P8GA 1VFEA 1QY7A 1O8BA 1U2FA 3PHEA 2RC9A 2G2ZA 1NKEA 1RGVA 1VJQA 2VDIA 5GADI 1TL3B 1O63A 1GTHA 3I56S 1S1VA 1SQGA 4FF4A 3M6VA 1NNKA 5AA2A 3DU5A 3HPIA 1NDLA 2Q43A 5IZ1A 1TK0A 2XYGB 5LMUF 1SI1A 3ZTOA 5I2KB 2K8GA 1U2CA 3ISND 4USKA 4N17A 2O68A 1YJ9S 2DQVA 1XK8A 1Q0NA 3T22A 3Q8PB 1KLNA 5L9XA 3SMZA 1NK4A 4LZ7A 4U23A 1H2VZ 4QIEA 2OMLA 4N13A 3I5OA 4Y2CA 3G3HA 3VHQA 4HYKA 3R6LB 5H9FK 2HFUA 2CWKA 4NF6B 1WNEA 2ZKUA 4FYYB 4DCYA 1G7CB 1VIOA 3D4CA 3HSTA 3KBRA 3RBDA 3CG3A 1NK0A 2F8MA 3DMJA 4F8RA 5D78A 1RYXA 2W9AA 3TODA 4MCOA 4X65J 4IY5A 1B5IA 3KUEA 3EDRB 2LVWA 1N54B 3L3CA 2XS5A 1IUJA 4C3MA 1NO8A 2HHWA 3G6YA 3MUMP 2H1YA 1TVRA 2ZEJA 2NZCA 3I32A 1N32F 1TFYA 3K6UA 4X4QA 1R8CA 2LEAA 2ZOMA 1FK9B 1FFSB 4Z7EA 1E6YB 2KG1A 3D7SB 1YPNA 1IKYA 4P7VA 4OFOA 5K9FA 2CZLA 4G68C 1SBRA 2IRYA 2ONKE 4IQXA 2DNPA 3CG1A 1GNKA 2UVRA 1IITA 4DX7A 4E0DA 3KLGB 3GFZA 3QFWA 1G1XA 2LCWA 4JV5F 4JDFA 4ONYA 2B3BA 4DN9A 2FJXA 2BJ9A 1RWNB 3BH7B 4PBQA 4ZCLA 4NLUA 5FDLA 1UP1A 2OTLS 4DUYF 5D8HB 2RVJA 4MT1A 3UVJA 1G0IA 5IZ3B 2ZXTA 4Y34A 4NTLA 4R6KA 4K5SA 4GC6A 1RI7A 2VV5A 3GYNA 2V3TA 3EGWB 3FBEA 5KFGA 3KTQA 4BDPA 3PRVA 5CHCB 1XEZA 4DDFA 4H65A 3T1AA 2V4JB 3FFIA 4GXSB 3NS6A 4X4VA 3MEDA 3R6GB 1VRQC 4EZ6A 4DXBA 4QFNA 5H8QA 4V19X 3THPA 2XYHB 5DRKA 3S9EA 1T3OA 3NWGA 1GT8A 4YB1P 2HFSA 2ZITA 4G1IA 4HLBA 5H8NB 2GQ1A 2B3TB 2QL7B 1H6KX 4F1VA 2JFKA 5JVGQ 2V3QA 5A5XB 8AT1B 3RT8A 2NQPA 3T1YF 3P49B 1O64A 1JLBB 5TPAA 2ABYA 2VHAA 5D3GB 1YRXA 4URQU 3T9XB 3KJ7A 1RHMB 1U1NA 4KV8B 2XY7A 3I0SB 1B3GA 2HZVA 1U02A 4QWEA 4M5JA 2LXFA 4DCJB 1BY9A 1MQHA 4O94A 1K0VA 3RYDA 2C3MA 1TWYA 4RNMA 3HFVA 3T1HF 2G9OA 5A8RA 2R2RA 2DR7A 4R6HA 4C8OA 3E01A 2UUCF 1CULB 1CS4B 4RW8A 3IBWA 2C2EA 2IM3A 1RKMA 2YQ1A 4QQBA 1X7VA 4PAIA 2R7OA 5I59A 1SW1A 4ZVQB 4KGKA 2ZFHA 2G0IA 4ZKAA 2JJKA 4OYPA 1NHKL 1RWVB 3WQPA 3R26A 1IKXB 9ATCB 1IWGA 4QSCA 1KEKA 1R43A 5CXTA 1OMPA 1FRIA 3PRDA 2JWNA 3KZGA 1LLSA 2AKWB 4WYWA 3OO6A 3MURP 2BW2A 2I4CA 3GQCA 4DX8H 2OD4A 2MQNA 2J0SD 4GO5X 3U1LA 2KXNB 4ZPDA 1RTIB 4CLLA 1P1QA 3P5TL 2VQFJ 2FLLA 2KB2A 2DR5A 3UCUP 4DPOA 1TKXA 4KYDA 1Y00A 2NVUB 1UFLA 1R6VA 2V9KA 5B7WA 4K2XA 4AE5A 2BX6A 4DI3D 5IC6B 2F5GA 2DRAA 4N4UA 1SQEA 3RBZA 1CJKB 4B3TJ 2M0GB 1MQJA 3VVTA 2ZC3A 1JXLA 1BGXT 2VG7B 2B9YA 2ZJRQ 3BSCA 4OYIA 2GAGC 1LKZA 2MQPA 2IMWP 1ZKBA 4QBUA 1G4CA 3RBXA 4G8MA 3U8QA 2KN4A 1DZ5A 1JMTA 3W9JA 5AA4B 1IR1A 3KC1A 1H2UX 3T9NA 4AD6A 5H8SA 1YG0A 2Y5LA 5C2GA 3U72A 3VFJA 2B9WA 1FTKA 3R8YA 2GS8A 2MMYA 4QR1A 3D1OA 1VLOA 1HW8A 3PKMA 1ZZNA 4B9VA 5AXKA 4H4MB 3ZXWA 2CAJA 3UORA 3TFLA 2K06A 2YWFA 2V93A 2GQ2A 2R3VA 4MK7A 4DR5J 5HM4B 4UA8A 2KO1A 4IYQA 2V8VA 1S9GA 4IR8A 4M5DB 5L9NA 5H8HA 2J8AA 3QIMA 3MR6A 2O3DA 4NWDA 5DEXA 4EQBA 3W8GA 2J0WA 2OUGA 2W8LA 1QULA 1ZPWX 1JLFA 4JSDA 4PPZA 1LAGE 2CEXA 4PXBA 5D0RA 3Q29A 3D4GA 3FVKA 2DWJA 4QSEA 4J9VA 2EI5A 2MEWA 4ED3A 3OO8A 3W3SA 3FNNA 5IV3A 1MU2A 1VRUB 4LVNP 3NG8A 4OMFG 4DR3F 4XKNA 1FRMA 4LIWA 3CDAA 1HQEA 1HQUA 5ETVA 4Q0BB 2XHDA 3GR1A 3K58A 1HNWF 3D1QA 1U7LA 4NCGB 2I5JA 3GBAA 3IAM9 3HHKA 3R2DJ 3CVKA 3UN2A 3MZ1A 2OZZA 2CPYA 3NOGA 4U22A 3FASA 1C4AA 2UVJA 3DM2B 1B32A 2PEBA 1XWLA 2VBWA 3CE8A 3IL1B 3PPQA 2DPIA 1FCAA 4G2ZA 1NAQA 4DQRA 2M70A 1KR4A 2L9DA 3T9UA 3MFHA 1B3HA 3MZBA 5HL7Q 1WC1A 3TA0A 3ILIA 1RAEB 5HMXA 3LBSA 2EFPA 1C1BB 4NA2A 5AJ3J 2GMHA 3TVZA 3MMAB 3PX4A 4F3BA 2ZZVA 4RW4B 1C1CB 3ZS6A 1RHUB 1B0VA 4IR1A 1QUJA 2C2OB 3CFXA 1DRZA 3QWUA 1IEJA 2AYSA 2IC3B 2FHOB 4YR3A 1AH5A 3DLKA 3NOCA 4I2PB 1EZ9A 5KT5A 1WDDA 3DP8A 4ZIVA 4W90B 2KT5A 3QIPB 2YH1A 1OS5A 2VUGA 1N33F 5J1PA 4K4YA 1RSCA 2ZH3A 2PT2A 4LSLB 4X4OA 2OI2A 3BGRA 2VFVA 3RB0A 2HXWA 2LA6A 5DQIA 3KGCA 2JVRA 2ABHA 4NPOA 5CD4H 1FTCA 3EZUA 2G2YA 3BO2A 2COLA 4KY3A 2B8PA 4YKKA 1MMLA 5CI5A 1VQ5S 5CMCA 3PO4A 1PKUA 2CNNB 2HPUA 3QRRA 3I6PA 2R2SA 2OPSB 3Q2SC 3MQ9A 2DXYA 2ZVSA 5IWAJ 4Z7CA 4C8ZA 2ZM6F 3CRBA 4J9KA 1SV5A 3VQSA 2CXEA 2MHEA 4FPIA 4GMKA 2M9KA 4K8RA 4ZEFA 1LWFA 2OAUA 2MZJA 3D54A 4MIBA 5CYMA 2BUNA 4OYVA 1X4FA 3M6UA 1N7WA 2IYIA 4OFZA 4LREA 4LZ8A 4EF2A 2KDOA 1CJTA 5CRYA 2Z8QA 1T95A 3DOKB 1K1QA 1FW0A 3DLNA 4GVLA 2CNLB 3H2UB 1JB0C 2Q8MA 3S1TA 2PA8D 4F2OA 3FMBA 3RJMB 1KD1T 3JYRA 2DWHA 5AXNA 1LBCA 3J7ZT 5IT0A 3C4MA 4OYMA 3LSXA 1RTJB 3KOAA 3MM9A 2EBGA 2Q3PA 2DGWA 1NJWA 4CQ1A 3DYAB 1R31A 4GX3A 5DZ7A 2RUSA 2DB1A 2LEBA 4N07A 4K4WA 1FWPA 3O28A 4QFPA 3GYGA 5KFDA 4DDDA 1IM4A 1BQXA 5F0WA 3WC0A 2VD2A 1SL0A 3UN5A 4R8UB 1RT5B 1HHTP 4IFVA 1JLAB 3R27A 4NI2A 4ELTA 2HQFA 3OLAA 4JI0J 3M2RB 1HNXF 2DNZA 5CC2A 5T3JA 4H45A 2ACMA 2GAHC 4LRFA 3K4UA 2RE1A 3MGJA 5D4NA 2R8KA 1SDXA 4RWXA 2W7YA 3K89A 3NGDA 4RUAA 2BA9A 4ED5A 4C98A 1A0OB 4EBDA 1HPZA 2Y1LB 1SKRA 2NXNA 1T03A 4LONB 2D21A 2VPXB 4KB7A 4WKMA 1RXOB 3H90A 4CO2A 1S9FA 5TP9A 1TTHB 1PILA 1WHWA 4DV2J 2BJ7A 1QUPA 4KSEB 2VPNA 2CVIA 3NLCA 2A0FB 3W1YC 2ZHOA 4Y65A 2QS3A 4A46A 3LC8A 2NSCA 2UUAJ 3KLFB 1XHYA 3MAQA 3NS7B 5BUUA 3MM6A 4YMAA 3MWBA 3DI6B 1CVJA 1TXFA 3KK2B 3EKIA 3PJWA 2VB6A 2ZBIA 1PSDA 3MMBA 3P96A 3A29A 1DQ8A 3HCQA 1S0NA 4PFUA 4N8YA 1RAOA 2REJA 3PVXA 1RHQB 2CFXA 3HF5A 1NBEB 3HD2A 1NKCA 4QU7A 4YKIA 3N0VA 3OPKA 3BKIB 5HROB 1LK7A 3SV3A 2F7VA 2HAUA 1YI2S 4ESXA 2ZH2A 4P73A 4DR1F 2DEJA 3H5YA 2RQ4A 3B54A 1PBUA 4ZP7A 3L09A 1S1TA 3I4PA 1EB0A 2F9JA 1B70B 2DXEA 2FGCA 3KMQA 1VQKS 4CM0A 1CQNA 2NYHA 3ROJA 4DCPB 2XSJB 2X7QA 4WZQA 1KS2A 4A8SA 3OTOF 2AV5A 2XX8A 3QYTA 2HMIB 4NZ0A 1WI8A 3RRKA 1YJ7A 4BC9A 1VBZA 4YQWA 2O7IA 2I48A 1JXEA 1V3ZA 1JK9B 4RYAA 4THIA 4TLQA 2YX7A 1M5DA 3KLIB 2AEJA 1UETA 1SUQA 2AGPA 4GF8A 2VZ9A 4OX6A 5IXUA 5AA1A 1LGBC 1FBHA 4WKRA 4BDRA 3GFYA 2DO4A 3B6QA 4KPTA 2VF3A 4OZ3A 1IUDA 3GCXP 3RYLA 4MKVA 1NV0A 2YVSA 2ZZMA 2DYXA 3GIMA 1T05B 2VJUA 2OJTA 4NF5A 3PYFA 1UFWA 3THIA 4YB5A 1Y5IB 4M5KA 1FRLA 3H5XA 4PFBA 3N5LA 2RB7A 1HIYA 4ZEDA 3U7JA 4ER8A 4DWIA 2BDPA 4PP0A 5I4MA 4DF8A 4MK8A 1ZTYA 1WJ9A 1I94F 4ESWA 2ZBRA 3FRYA 4LF7F 1HYSA 5K2XA 1R0BG 1GMWD 2FA7A 3FJGA 4DR2J 1LBZA 3WC2A 2JX2A 1LV5A 3RPLB 3EHUA 1QSYA 1UJ6A 3K6XA 3Q28A 4YY3F 3OEMA 1KDNA 5ETRA 4PTKA 2BM0A 2D41A 5ITOA 4DX6A 1U6BA 1XNQF 2Z2MA 2H99A 1S6UA 1FKOA 1KFDA 3FUZA 1Q16B 4F3GA 1M5KC 3D66A 4ECVA 1HFEL 2AYMA 5F24A 3KN7A 2G1DA 1PBAA 2XNQA 2P0SA 2DP8A 1ATGA 3MVYA 4JI8F 2I1RA 4F2RA 4DR7J 3AY0A 4XKQA 4H4OB 1S77D 2LDIA 4LZ5A 3SESA 1IKWA 1HWJA 1FDBA 4PPDA 4RW6A 4F4AA 1SJ4P 1MXYA 4NXNJ 3QSYB 3CPWR 2DRDA 3B6WA 2LQ9A 2E29A 3BSNA 2MLZA 2F7AA 3EF7A 1GVCA 3ETOA 3HVRA 5H8FB 1HWIA 5ETMA 1GK8A 2EKNA 5J16A 2YKQA 3M9NB 4OZLA 1HR0J 4GVOA 3B4DA 3LH2S 4NRUA 4OWDA 5EHHA 2APOA 3NNAA 1XERA 2PD1A 3JQKA 4JI4J 4C0RA 4KBIA 5IC4B 1RT2A 1M5SA 1WC5A 3B50A 5I56B 1RP5A 1Y3NA 4OI6A 4LSZB 4ZP6A 4CLKA 4CYUA 3Q22A 4MLVA 2E1RA 2R6GE 1B0PA 1HARA 3GILA 3U1MA 2HFOA 5A5LA 1FD8A 1G0HA 4R2BA 2VONA 4V1Ak 4Z37A 3SEYA 4IDKB 3E2EA 1TUWA 1K1SA 5D4OA 2ZDOA 2Z30B 3QNWB 3FZVA 3T1HJ 3G82B 1X8DA 1YQHA 3TYHA 1HKAA 1FJ9A 4G65A 3M1VB 3MM8A 3S7RA 3M8PA 4DS4A 2AYEA 2NREA 5ETSA 4FORA 4OHXA 4C1UA 2ZWOA 1U0SA 2Y1RI 3SFGA 3BFUA 3Q25A 2LQ8A 1CC8A 2ROPA 1YZ0A 1VR5A 4RNFA 4X1DA 1N5VA 3DOMB 4R5PB 3CXCR 4PETA 3PPPA 4CH1A 3KK1B 2LEPA 3EWGA 1UPPA 4WTYA 3TWZA 1XT8A 1OYEA 4Q2MA 4PCQA 2CQDA 3S4UA 5C42A 2ERRA 1OJ4A 2FJBB 3P45B 4XXUA 3NNCA 1TKTA 3GV5B 2WOMA 5CAAA 3CD5A 3OFGA 2XWIA 3VQTA 1RAHB 1KA0A 3JSRA 3ILOA 1GQEA 1AMFA 4QRZA 1MH3A 1Y11A 3C2PA 1CJUA 2HS3A 4NLVA 3VWSA 3Q83A 3K2DA 3OLBA 4K59A 3VVDA 1FDDA 1U1QA 3H0PA 3OL9A 3QO9A 2E9ZA 1NJZA 5CMMA 5EWFA 4NX1A 3CFZA 2ZUGA 3U1OA 1UWBB 3G6VA 4DN0A 3SERA 3HSJA 4KFQA 3N5FA 2UUWA 2HG4A 4OHZA 2DR9A 2CQPA 1OY9A 1XVYA 1IKVB 2YNHB 4X9TA 4J37A 1P1OA 1LAFE 1ZPVA 5KG2A 2LDYA 4PF6A 1RT3A 1REGX 1N52B 4TOZA 2LU2A 3O8WA 2RDDA 3MECA 3C33A 4OQJA 4JI3J 1VOMA 3H6WA 3MM5B 3M30A 2WYKA 4NF8A 2M8DB 1RTHA 1XMOF 2P2CB 4X66F 1N6QB 2RILA 3TCGA 1RT6B 1XMBA 2RF2B 2MZ1A 2V4RA 4O3NA 2HFZA 1U2RA 2RS8A 1V9OA 1QAJA 1CJVA 4NLGA 3FSIA 3LP0B 1LBVA 4DV3F 4ISUA 1VQMS 1AXQA 2KXFA 4DPYA 3N6LA 2F65A 2BE7D 2ACYA 4RJVA 3HVAA 1LOUA 3AH6A 2GMLA 3R5BA 3KDOA 2IFXA 2MTLA 5EHMA 2YPZA 3V83A 4OHVA 5DDRC 1M1KT 3CR9A 2PVUA 1PCAA 4GWWA 3HFZB 2VBXA 3QT5A 4U9RA 2HHXA 1DQ9A 4R9FA 4USTA 3CIJA 3IGNA 4ZP9A 3W9IA 4DIGA 2BVZA 3TEPA 2X1GA 4ECQA 3LQVA 5F9LA 1DTGA 1I6AA 4FPRA 2YWWA 2Y3YA 2Q79A 3HN0A 1OVTA 1URSA 2UU9F 1YTYA 1NNDA 2W9CA 1KQSR 4LF8F 2XWXA 3OENA 4C8YA 1X4DA 5KFCA 3MHYA 1NKBA 2M3DA 3BDPA 1S48A 1AW0A 3KC0A 4DQPA 2C2ZB 1QAXA 4R73A 2FHJA 1RT4B 2PMZD 4P11A 3AB4B 1B3FA 2YLNA 3P6YC 3F11A 4OYAA 3GWCA 2UVHA 2XXQA 4ZN1A 3PX6A 2REGA 4QFOA 4MK9A 3MMCA 4DV5J 4N8NA 3CCLS 1NSPA 2H9BA 3VVFA 5F8IA 4JXIA 3KLHB 2RRAA 2DRBA 4Y28C 1INPA 1FE4A 3RGIA 3GZGA 2JEIA 1MXWA 2VIHA 4WIQA 3DDNA 5M2RA 4C0OC 4NZ6A 4Y2AA 2FUG9 3D5MA 4IO3A 2I3WA 4QR2A 5KFOA 3CIZA 3ADAC 1ZZFA 3CCWA 1S6OA 1I6QA 2W4PA 4KRWA 2MKCA 1SKWA 2J9DE 4HH0A 4OJ3A 3FD3A 2W2OP 5DDQC 1EKSA 1S12A 1WHXA 3DFEA 3Q2TC 4JWOA 3QGHA 1QJHA 1IBCB 4LFCJ 5D4PA 1HNZF 4GX4A 4NN3A 2Z8EA 2BZ2A 2GQQA 4OI1A 4Q44A 5KCJB 4RK9A 2VG6A 3L6HA 4G61A 3ZZTA 3H98A 1AFJA 1ELOA 1YRTA 2NXOA 1X5TA 1ACMB 3SCJE 4ECWA 4HL9A 3MVXA 1LFGA 3LSLA 2L08A 2YH0A 3LP1B 1YKWA 4MYUA 1BXNA 2ZYNA 4IB2A 5BR8F 4BCAA 1EH3A 3LP2A 1UIVA 3BBFA 2W1BA 5KT7A 1FXDA 4PUOB 3M05A 3UCZP 3DKDA 1U1RA 4IG3B 3J7YU 1HBMA 1MNEA 5L1KA 1UEUA 5F8GA 3H5SA 1FD2A 2DNHA 2JNJA 1S72S 4G4PA 4U8YA 4JVDA 5B0EA 1UKUA 5J2NA 2FLOA 1TV6A 4ZVTB 5GAHI 4DL3A 3K00A 4PDDA 1ZAWA 1XTZA 2DH7A 1VBXA 1SJ1A 3JB9k 1FKAF 1DPEA 2HZAA 4JI1F 1RAGB 4YEAA 2GVDA 2OKQA 3H2VE 1RQ0A 1R1NA 4DL5A 4MYTA 2IBOA 4NEYA 3IRXA 2B56A 1H74A 3QJJA 1VMBA 1URNA 3VAIA 2CZVC 1S50A 3JSMB 3OHAA 2GHWA 2KH9A 2GFEA 1H43A 4OX8A 3HSDA 4P2XA 3UIFA 1SC6A 4PRFA 3VF0B 3DLGB 2KYXA 1YBUA 4EO6A 5KT3A 3KNGA 3MZ9A 5L8DA 2DH9A 4DE8A 4EBCA 3QT6A 4ZVRB 4ICLB 3ONMA 1C4CA 1JLGB 2ZBPA 4ILMA 3I3VA 2HAVA 3DHXA 2PN6A 1ELJA 2FJEB 2R8HA 1R8HA 1MXUA 3PPRA 4UUWA 1KN6A 4WBFA 2DOJA 1MN9A 4RNHA 4DR4J 2EG2A 1XMQJ 2J0XA 5FIIA 3FUYA 4RBTA 1USYH 4N6PA 3OTBA 2ZOFA 4MKBA 2D74B 3BR9A 5GMEA 1MDP1 2QLFB 1RK8A 4UW2A 1S76D 4O3OA 3PJ9A 4YB7A 1H73A 2HK2A 2KHCA 3C66A 5HLFB 3ZZPA 4OV6A 4RLEA 2MQMA 1OPZA 4R74A 5HMZA 3DMJB 4N76A 1JKHA 2QFIA 2EKYA 3ZTSA 3J7YI 1LEVA 3IB1A 4LN5A 3OTEA 1D8ZA 2OLBA 1AT1B 2THIA 2MQ8A 4ENOA 5AE2A 4P56A 5I2NB 4N6KA 3ITHA 2F8DA 1TVRB 2ZOGA 2GJFA 4PWUA 2DWIA 2OEJA 2CQ0A 3ET6A 2V4CA 2A3JA 2QVUA 3PGFA 4QJVA 4DOZA 2K3IA 2HZLA 1SJ3P 5F8MA 4WP9A 4HE2A 3V81B 3W15C 2A6OA 1IKYB 4I69A 3N6TA 3L7UA 1SJRA 4J5OA 1NDPA 2ALYB 2K7JA 1TELA 2AEFA 1FPEA 4XTTA 5DJBA 4M63A 4WPAA 2RAQA 2YKNA 4U67Q 1FQFA 2XO6A 2VD3A 1B5HA 2I0BA 3F56A 4WP3A 3CCSS 2YKAA 2B4OA 2HHHF 3VALA 4J9MA 3ZSFA 4UQGA 2A2DA 1NSQA 4QSDA 3K0VA 1HSLA 3I0RA 1Y0HA 1NSKL 3WX8A 3CFLA 1W25A 5FBPA 4JV0A 1MS7A 4JI2F 1WTBA 2C3OA 3FJ2A 4NASA 5HAOA 4BDQA 4BDOA 1ZA1B 3D3BJ 2CPEA 1FPGA 1U6FA 4OI3A 2OWTA 4JI6J 3G8SA 1AZSA 2AX1A 2C2NA 5HJYA 4OVTA 5H8QB 4UF4A 1MG7A 1Q79A 1YJRA 4YB6A 4PXEA 4BDNA 1JLEA 1Q53A 5L9MA 3H6UA 1HHSA 3G9CA 2ROGA 4CLWA 2Y7IA 2ZH5A 1B9JA 5TPAB 4YMEA 4LF7J 1VIXA 4PWDA 4AT1B 2O66A 3KXDA 3BIHA 1H44A 3G71S 2VFTA 1JVYA 1MLAA 2OPQA 4BWMA 1YX2A 2A1BA 1VI7A 2DNLA 2FIEA 3R1LA 4JI7F 2Z2YB 5A8RB 4MEVA 4XEQA 3CCRS 1NFTA 3E01B 4KKOA 1XNQJ 3IR1A 4YS2A 5B70A 4JSOA 1GTEA 1OY8A 5IZHA 3OL8A 2ZD1A 1M5BA 2HFNA 4USIA 5CCLA 4NCBA 2DE2A 2L41A 1MRPA 3MD1A 5C24A 5L9SA 4KI0E 2A5TA 3UK4A 4YUDA 1PB8A 4MTPA 4DV7F 2GGPA 5K8OA 5F8LA 3FEYB 3FVNA 3DRRA 2JRSA 3V2UC 3D3CJ 4A4JA 4QYZK 3TX8A 5ETOA 1GR2A 3S8SA 2HW3A 2ROEA 3H3GA 1P1LA 1NH8A 1Y1ZA 2NCKL 4LATA 4I2QB 3TKDA 2B4UA 2OEMA 4I1DA 4ELVA 5C25A 3MEGA 1VC5A 3B6BA 3O2IA 5I42B 1II5A 2YPNA 4XFEA 1SD3A 2P6SA 1U26A 3BGUA 2B5JB 3M32A 2WX9A 3CI8A 2KJVA 2BJ3A 1MG1A 1H0HB 1I51B 1VSOA 3OL7A 3SEXA 1T94A 1KLMA 1OO0B 3SCLE 4DR6J 1WF2A 1FJGF 4TU9A 2LLZA 1C0UA 2YTCA 2VFUA 2RQCA 2E5LJ 1R27B 3GONA 2JC1A 1MMDA 4DCOB 1WKLA 4N56A 2XS2A 1UQWA 3POTA 3W65A 1WG1A 1RT7A 3O1LA 5JXSA 2FNCA 3M4XA 2AJ0A 2O01C 2W2NP 2MGZA 2ZWPA 3SYZA 1RWKB 4GL0A 1FCKA 3IOVA 1X5SA 3HVWA 1SYIA 4JP8A 1N36J 2HNZB 1EU8A 3HZGA 3CDUA 5JMNA 2Y1IA 4B08A 2BKPA 1IQ7A 4DQSA 2P3VA 2F63A 3UWTA 2XMTA 3H03A 2IIHA 4OA4A 3QIDA 3DXBA 1Y3KA 1EZZB 2AD9A 4G77A 2EPIA 3FVOA 1OQHA 1YITS 1S9GB 3F73A 1PB9A 4FBUA 2VOOA 3LSFB 3Q8RB 2RC8A 3HK2A 2N7YA 4GKJF 2OGUA 1H2TZ 4C48A 2Q6CA 1S7YA 3IBFB 4YAHX 1RHKB 2A5SA 2XULA 1JLFB 4JI5J 4RWWA 2B4MA 3W2VA 1EJ7L 3G3IA 1RYSA 4I7FA 3F44A 1MQGA 3AQOA 2HVDA 4U21A 3CJ5A 2Q2AA 1DTTA 3JV9A 5HPQA 4AS5A 1SL2A 2J6TA 3HKZD 2IJFA 2NS1B 2VPWB 3PM9A 3KLEA 3SETA 3E51A 5I84A 2I5JB 2OJ3A 4GIZA 4CT9A 4NXMJ 3PYGA 7AT1B 2QIFA 5F8NA 3O6HA 4FEBA 2HRTA 3DRXA 4BDLA 3HJFA 2HPGA 3CMQA 3V4IA 3T5KA 3TAJA 1YSJA 2QYCA 1RTZA 1UVIA 1U4BA 3AT1B 5A8KA 4UUXA 3O3LA 1MROB 1SC4B 3OEKA 3EVOA 2XLJA 4KAIA 2ZYOA 3UDCA 1RWWB 3TO8A 2V8DA 4NE9C 2VBYA 3T5JA 2H5YA 4ELRA 4M8LA 1FPDA 4JB8B 1MQDA 1DTQB 2M52A 4WEPA 2Z8DA 4ZLJA 5ETQA 3JYTB 5H9EK 2FHYA 3OSPA 1XR7A 2ZMBA 1UTBA 3IMQJ 4JVCA 2I9SA 4JV1A 3HPOA 2ILZA 1S4EA 2FDNA 4WE1B 1HNIB 3EUNA 2HVZA 2EW9A 5ETLA 4XDDA 3DLKB 3OXGA 2ZHAA 4GWSA 3LF0A 1FNMA 1G3OA 4WIIA 2I3VA 4I67A 3MR3A 3R7XA 2ZH6A 4MIWA 4PEOA 5A76A 4Q30B 2YKPA 3PIPQ 1C0TA 3FVYA 3N26A 1LB8A 3RR8A 4QWAA 1ZU0A 2MHNA 2UXDF 4WZMA 4NOHA 2CQGA 3FJMA 1QM9A 4KHMA 1FT8A 2Q8JA 5J2MA 3EMTA 1NXIA 3G96A 3MSTA 5HANA 3CUNA 5JK4A 5IQQA 5B7DA 3QJPA 4M1VA 1BMQB 3BZQA 1IBMJ 4KGVB 5K8NA 1DQAA 1DLOA 4PYAA 4R72A 1FNOA 2V8HA 1SV5B 3BIGA 4EGLA 4AQYF 4OESA 3UN6A 4LFAF 4YKJA 4H67A 3ZTQA 4F3MA 1PBQA 5GAGI 2OO4A 4M5LA 3PTYA 4N91A 2W9BA 1ZM4A 3SKPA 2HFBA 1CJTB 4DZ6A 2OPPA 3W9VA 1SC1B 2RMLA 1NK5A 3HD1A 5KZTA 3KDNA 4U6PA 1FJEB 3B4MA 3QAXA 5ET7A 2P9CA 3I31A 2OK2A 2C2MB 1Q5YA 3MM9B 5HK4A 4ZLLA 1URRA 4DLGA 4ED7A 2GW8A 4ATNA 5B0DA 3D68A 4J9RA