2QMWA

The crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGTINIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQFDYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFDQNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAITTDIKKVIAILETLDFKVEMIGAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prephenate dehydratase
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 71
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmwA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA02
1ZBMA 4FE8A 2I4CA 5B7DA 1LK7A 4XKQA 5FHMA 1FQFA 3OFHA 4HCYA 5IT4A 1YTVA 4ZEFA 2P1SA 1JVYA 4R2BA 4F3PA 3LSWA 1VSOA 3U7JA 4X1DA 3IJXB 3MZBA 3TZAA 4IY6A 4LUBA 3G7WA 4C1UA 3E4RA 3DC2A 1PEBA 2HEUA 3FVKA 4ZEIA 3SERA 3TTLA 1FCKA 2BJJX 4NMLA 1WDNA 1B7ZA 1Y1MA 2F7BA 4R6HA 2GH9A 4G68A 4KD5A 2LAOA 2P0SA 2ONSA 4EQ9A 3HHGA 2XX9A 3PUXE 2XXPA 1Y9UA 4POXA 3SEVA 1NNFA 5L9MA 1EZOA 3HSTA 4JWXA 1LFGA 3FZVA 5EYFA 3C33A 3H6VA 4LVQA 4YAHX 4IO2A 1UIVA 3G3KA 2R71A 2HFBA 1UJ6A 1QJMA 3ZS6A 2DE3A 2AYSA 3KEIA 1B52A 1MQJA 1B3GA 1DPPA 4KYDA 3DDNA 3BBRA 2PT1A 1U8SA 1NFTA 1NL5A 3PPPA 3TTKA 4AB6A 4ND9A 3AB2B 4IGRA 2VP1A 1MM7A 3B7DA 4ZEBA 2A5TA 1GTKA 3M8UA 2O6AA 2DOJA 2RKMA 1QUKA 2Y7PA 5KDTA 1TFAA 4PETA 3E9XA 3MP6A 4F1UA 5JEIA 1NNPA 1OQGA 2QJEA 3A3CA 2F6PA 4IO4A 3Q25A 3K6WA 2HXWA 5TP9A 2OCUA 3C35A 3OEMA 3ZKKA 2F35A 2XXIA 3H03A 2QSXA 3MQ9A 2NYIA 4XKNA 4ELOA 3E13X 3K6VA 5AA4B 1SW2A 1UJ4A 3H06B 1MH4A 4JDFA 4ELRA 4FEDA 1JEVA 2XXTA 3SDFA 1MDQA 1H3DA 2J0WA 1JW4A 2PVUA 4IO3A 1S50A 4XIGQ 2DSFA 2ZNTA 4ELQA 3LSLA 1B3FA 4GIZA 4H8IA 2Z8DA 4ISUA 2IEEA 3G3FA 2NXOA 5LOMA 2H99A 4QFPA 4UACA 3W7BA 3PMVA 4JBZA 3ECRA 4O3BA 3DLNA 2O1LA 5CM6A 1Y1ZA 2OWTA 4TOZA 1PB8A 3Q27A 4BLAA 3TCFA 4NF8A 3FV1A 3G3IA 3OFFA 1CE2A 3AXFA 3TQWA 4G68C 3V5AA 1M5DA 1HSJA 4OERA 1L5TA 4FIMA 5CBSA 4GOTA 4WXJA 1GGGA 3FVOA 1OIBA 1Z7NE 3GXAA 4RXLA 2YPNA 4G68B 1MXUA 3EF7A 3T9VA 2XD3A 4P0IA 4KCDA 4PQJA 2Z8EA 2JOQA 2OK2A 3T93B 4XKRA 4G2ZA 1KWHA 2DT9A 4RK9A 1B4ZA 1Q35A 2D21A 4K3FA 3HV1A 1TFDA 5AA2D 3ILUB 4F22A 2PBWA 4U21A 4DXUA 2I3VA 4G8HA 1B51A 3MPLA 3WAEA 3C34A 5CRYA 1M0SA 3N94A 5T41A 3MVWA 2PT2A 4LATA 1P1OA 3H4ZA 1WODA 1YBAA 4F3SA 1SYIA 2A5TB 4H5FA 1H45A 1ZIUA 5K2XA 4H5GA 2UXAA 4MBPA 3V8XB 3MAMA 5KDTB 2V25A 3QUFA 1SQYA 3CSGA 3QUJA 2HQ0A 1SW5A 2DWHA 4QSCA 4AB5A 4GXAA 4NF5A 3RLFE 4R74A 3VVEA 1I6BA 3ZSFA 1JEUA 3KSXA 1LAXA 3IBWA 4HTGA 1DSNA 5TP9B 3Q26A 3H6WA 4U4SA 3G3JA 3H6TA 3VVDA 4XTCQ 1UJ5A 2Y7IA 3UORA 4E0WA 4WEDA 4Q8RA 3T9UA 3PUYE 1S7YA 1R9LA 1N7XA 2FA7A 4OEUA 3S9MC 5EHMA 1T0KA 1GVCA 4XXUA 3TTMA 5HPQA 1MM6A 5ICQA 1N84A 5IT0A 1MPDA 4H67A 4L17A 2NOOA 4Q0CA 4PFUA 1LFHA 4OQOA 3KJ7A 1AL3A 3ODBA 2Q9TA 3IX1A 4OVJA 5I84A 1F9BA 5ITOA 5DT6A 1Y4CA 2DQVA 3S4UA 4YB6A 3JV9A 1MY3A 4LQ5A 4G77A 1YGYA 2H5YA 3DELB 4NF8B 3M3KA 4OWDA 1D4NA 3HO7A 2UVGA 4QFNA 2FGCA 1B1HA 4POWA 3T9HB 2G93A 4F19A 3OD7A 1GR2A 1M5EA 3DP4A 4M8LA 3U72A 1R6ZA 3WAFA 5TPAA 1B58A 4O3CA 1MXZA 4OFLA 1LLSA 4IO5A 2RINA 2F1FA 3VDFA 2B65A 2ZMBA 1US4A 5KCJA 2O1MA 1XTZA 1MQIA 3IOVA 3IO4A 3O6HA 3TELA 3TDJA 1XVYA 2UYEA 3TUSA 5JTYA 4YMBA 2XHDA 2XXWA 4HW8A 4RA1A 2UVIA 3CFZA 4NMYA 4R75A 4ZEDA 3TFLA 3KFMA 1RKMA 5EHSA 2VHAA 4OENA 2I6EA 3LSXA 1MXXA 3FV2A 1R9QA 3CG1A 4OESA 3O97A 1MQGA 4ECFA 3IORA 1N04A 5F1QA 2I9SA 1BKAA 1SBPA 2H25A 4NF5B 2Y7WA 3MZ9A 3MBPA 3W15C 4TQUQ 1B32A 1NNTA 2PA3A 5H8QB 5H8FA 3CSBA 3JYRA 4G8NA 2D5WA 1B5HA 2FNCA 1AOVA 1QUIA 2XXQA 3QAXA 4H65A 3VLWA 2OBGA 2Q2CA 2Z23A 3KN7A 3IAZA 1QVSA 4EF1A 2Y84A 3PPOA 1URSA 1ZMGA 2DYXA 4F3GA 4H1XA 1NNKA 1FTOA 4EQ7A 5AA3A 4FEBA 5L8DA 2QSWA 2P9EA 4DCYA 2REGA 1LBBA 4X48A 1N3WA 1B46A 1SD3A 3VLUA 1D9YA 4LP2B 1PSDA 4BDOA 3G3GA 4AQ4A 3OFEA 1WVJA 3MVZA 1FQAA 3W9VA 3K1PA 4THIA 4F3BA 4GVOA 4O3AA 2Y7KA 1LKZA 1PB7A 1B7HA 2XXYA 4OMBA 1LGBC 5AA2A 3R6UA 5JJBA 4DIGA 4EQBA 4QFOA 2HCAA 4U1ZA 3TUZC 1VE4A 2QRRA 2E0SA 1TT1A 4I8CA 1B0LA 3FD3A 4F1VA 3ENQA 2P9CA 4BDMA 4LZ8A 2XXRA 2F7AA 3OO9A 2CDQA 3UK4A 1B0HA 2H9ZA 4ONYA 3QXMA 3Q28A 3OO8A 3P96A 1N3XA 1FQCA 4QSEA 4DXCA 3RT6B 3RTWB 4YZZA 4I62A 3ZKLA 1SC6A 2R6GE 5KCJB 3OSQA 5JK4A 1NH7A 5JTYB 4HS7A 3IXQA 4NF4A 4YB5A 4GL0A 2RC7A 3K1NA 1IITA 3TTRA 3C36A 2O84X 2F8DA 4DXBA 3KSJA 2Q8JA 1FQDA 2W7YA 3AB4B 3UGWA 4NTLA 3OXNA 5FTHA 1B6HA 1UTBA 3OOAA 2RF1A 3TYHA 5IAIA 5FHNA 2H4IA 1IXIA 1EZ9A 3K01A 2XXHA 1XOCA 4U22A 4EDPA 2XXXA 4NF6A 1SW1A 1EH3A 3OELA 1I69A 4MLQA 1UTHA 5I56A 2DVCA 5H8FB 4GLIA 4TLLB 3VFJA 4UA8A 3CI8A 2HZKA 1Y7PA 2Z8FA 1ANFA 5K2YA 3UIFA 3IB2A 4OFJA 1VR5A 4HCWA 4LQ2A 1QKAA 2QMWA 1IXHA 2PYYA 2QS3A 2NWJA 1PB9A 3PV0E 4FORA 4KYSA 4U4XA 2O69A 1RYXA 2DWAA 3O6IA 1IXCA 3RT8A 2ALUA 4TLMB 2ZYMA 5DEXA 1UIUA 4Z0IA 4JXIA 1Y3QA 4GD5A 1OVBA 4YU0A 2Q89A 1N7WA 4R6KA 5BUUA 1USYH 1XS5A 4FATA 2DWIA 3PMWA 3ONMA 4EXLA 2I58A 4H0WA 3N0VA 3Q29A 4XKPA 5TU0A 3K6XA 2QRYA 3RQTA 4QFKA 4R9FA 4NWDA 4IY5A 3EN3A 4KCCA 3FGSA 3K1MA 5AA2B 3L6GA 5CBRA 5A5XA 1QUJA 3CFLA 3SESA 2XX7A 4IGTA 1SI1A 5AE4A 3TUJC 3N5LA 3BKIB 3CRBA 3TQLA 1AIVA 2O7UA 1S9TA 1MPBA 4EUOA 5J1DA 4OEVA 3I5OA 1DPEA 2F5XA 4G8MA 2F6GA 4ESWA 3IOTA 1LCFA 3O9PA 2O7IA 1UQWA 3MC2A 1B7UA 3VVFA 1B05A 2V84A 5I2KA 4F18A 3H6UA 3U93A 2I3WA 1O64A 3VV5A 4KPTA 4GRKA 1B5JA 2OZZA 3TTNA 3SKPA 1R1NA 4NF4B 3W9WA 3OO6A 1SI0A 2NVUB 3SEYA 2LVWA 4WKMA 4KFQA 3OBIA 3DP6A 3CFXA 1HSEA 1MH3A 3C4MA 3M3FA 1OVTA 3HCQA 1UTBB 1POY1 4PE5B 1M5CA 1MQHA 3GBAA 4NWCA 2ZYOA 1B3HA 5KZTA 5DVJA 2REJA 1SYHA 2UVHA 4NF6B 2A5SA 1USYE 4RJZA 1H43A 1P99A 3CG3A 4ELPA 4PFYA 4EF2A 4GQOA 1UTHB 4ZE9A 4RYAA 5I56B 5F7VA 1QULA 2QMXA 3TKDA 4OFOA 1AMFA 2F36A 1MY2A 4GF8A 3CIJA 3EPEA 3THIA 4FECA 4LZ5A 2QL3A 4PFWA 4LONB 1QW0A 1DTZA 2Q88A 3TCHA 2UYFA 3N6UA 2GHBA 3G3HA 2B3BA 3PUZE 2DWJA 4WEPA 3FVNA 2D3IA 3O2AA 1LAGE 3QYTA 4MLVA 3S9EA 1POTA 4KHZE 3S9NC 4MF3A 4Q5TA 3UN6A 2PX1A 3CR9A 2F97A 2HZLA 4ESXA 4DZ1A 3KWMA 5I2NA 2XXUA 4QHQA 3MP8A 1HSLA 5A5XB 3T9XB 3MTJA 2GFEA 4P0GA 2O68A 1OQHA 1O7TA 3PD8A 5I57A 3DP8A 1MXYA 2VGQA 1B40A 4U2RA 1Y3PA 3IOWA 4R2FA 4JWYA 5FIIA 4JSDA 5I2KB 2HAVA 4ZEKA 4IO7A 3SEWA 1IQ7A 3OENA 3I6VA 3V83A 3DM0A 1LK5A 3OO7A 2Y7RA 4RPNA 4YMAA 1BLFA 2ESNA 3MUQA 3U8QA 1TXFA 4M4GA 2PC6A 1PC3A 1NKXA 2QPQA 3KN8A 5AA1A 3T22A 1ELJA 4OETA 4GFRA 2X7PA 3SETA 1DOTA 1AH5A 3U92A 3FXRA 3K00A 1XHYA 2X26A 2ZNUA 2DTJA 4PFTA 4ZZEA 3IR1A 2R9JA 3VXBA 4BDNA 4EXKA 4U23A 2OJTA 1IEJA 4PWUA 1ATGA 3B6QA 3VE1B 1Z7ME 4R73A 3TPAA 4OHNA 3K0VA 3VXCA 5DYHA 1IZ1A 2RCAA 3EHTA 3KG2A 5IS2A 2I4BA 4N6PA 3RGYA 3ENVA 3HHEA 4ZZAA 2J0XA 3HHFA 3S2VA 4N07A 3K2DA 3MJNA 3FASA 3RNNA 4QSDA 1H76A 4IO6A 2F78A 1URGA 3K5PA 2X7QA 3EHSA 3V89B 3PPRA 1OLCA 3RY3A 1A54A 3E3KA 4ZECA 2DS9A 4GO5X 4RK2A 4YKKA 3ILTB 1A8EA 1EU8A 2ZYNA 2V93A 1NMUA 1JW5A 2XX8A 1ZKBA 4BDRA 3EHUA 4X9TA 3U94A 3N26A 1Y4TA 4GMKA 1N76A 1I6QA 5H8HA 1P1NA 3IO6A 3JZJA 5DVIA 3OEKA 3GZGA 1O8BA 1GV8A 3RN8A 2QS1A 5ITPA 5TPAB 4R72A 3VLVA 1BTJA 4OZ9A 4RPOA 4QFLA 4RNSA 1JNFA 2OLBA 5I2NB 1LSTA 3BFTA 1LAFE 2VD2A 3PMXA 2DP8A 1MG1A 2B3FA 1OLAA 4YICA 5CMBA 3FJGA 1B1XA 3KJTA 4KR5A 1URDA 2I0BA 1JETA 5I57B 3O28A 4PP0A 3KZGA 1PBPA 3FIRA 4F1YA 1MPCA 2WKYA 2HAUA 1JQFA 1MXVA 4Z7EA 4YKJA 3RUMA 1I6AA 2F8MA 3C9HA 1FQBA 3L7OA 3B6TA 1LB9A 2NUVA 2RC8A 4GL8A 2AL5A 2RQKA 3M3LA 4DLDA 1YPNA 3MWBA 4KI0E 3FXQA 1MY4A 2YLNA 3SEXA 1A7LA 3FVGA 3LUYA 3P7IA 5B70A 2YJPA 4JSOA 4NE4A 4C1TA 5FTIA 2UVJA 2THIA 5M2VA 3USDA 3MZ1A 3PUVE 3IL1B 3UW1A 4DDDA 4G4PA 1A99A 2DE2A 5FHOA 2QS2A 5H8NA 1MS7A 2XXVA 5ICTA 4C0RA 1YAEA 4MFIA 2QS4A 1N0TA 4BDLA 3I3VA 4FAJA 3DHXA 3OMBA 1IXGA 3QIMA 1FTJA 2RCBA 3GLBA 3KGCA 3H7MA 3F11A 3B6WA 3EQ1A 2IA4A 5DTBA 2M8CA 1LBCA 3MPKA 5BWJA 3FUZA 1MDP1 3K02A 3C32A 4I9DA 3MAHA 3C31A 4GXSB 3IJOB 1FTLA 3TEPA 2RE1A 2Q2AA 2V3QA 2F7CA 1DTGA 5I58A 3PPNA 1KS2A 3ENWA 1II5A 4H6DA 1US5A 1O63A 2H98A 1TWYA 2ONKE 3KN3A 3HPIA 3MW0A 4GO7X 2I49A 5I59A 1ZTYA 3PGFA 3LC8A 3R7XA 2DE4A 3LOUA 5H8SA 1BP5A 3TODA 3IK6B 1LB8A 1IUDA 1JW1A 1SDXA 4ZE8A 4X84A 1LFIA 2ZNSA 3FJ7A 3DHWC 3OFGA 3NRBA 4F31B 1P1WA 2AL4A 1FQEA 1VFDA 5H8HB 3R26A 4Q30B 3BFUA 3PU5A 2ABHA 5CMKA 2G29A 4U1OA 2GRVA 2O51A 1LCTA 3MVXA 3L6HA 4E0XA 3S9LC 1B9JA 2F34A 3UP9A 5HM4B 2ZYKA 3FJMA 2P2AA 4OTEA 3PD9A 2I48A 4QF9A 3LBSA 3O1LA 1Y20A 4H8JA 2DXRA 1Y3NA 1PDAA 3D4GA 1A8FA 4ZS9A 4YKIA 1SVXB 1P1UA 1M5FA 1FTKA 2CZLA 1NH8A 5CC2A 4LZ7A 2DXYA 5H8QA 1P1QA 1A40A 3AAWB 1XC1A 3A3UA 1XT8A 1A55A 4ZDMA 3KBRA 1B3EA 5L9OA 2RC9A 4X1BA 3FATA 3O29A 1VFEA 4YKPA 4DCXA 5CI5A 1J1NA 1OMPA 1MRPA 3S1TA 4RY1A 1ZPVA 1IIWA 3O66A 2KO1A 3H3GA 4IB2A 4NEDA 4QRZA 1ZLQA 5H8NB 3FXUA 5CMCA 3RPWA 2MDAA 4R9GA 5DVFA 3D4CA 1FW0A 3IB1A 3PPQA 3SEUA 1QKBA 3QK6A 1D9VA 2LQJA 1FTMA 4F2OA 1YCJA 3TUIC 1RYOA 3CEDA 4OXVA 4DE8A 4FJPA 4F2QA 3GBBA 5DEXB 3LR1A 3N6TA 3T96B 3LSFB 4I1DA 2PMSA 2V3UA 1JVXA 2Z22A 1PBQA 5L9SA 4KQPA 1MQDA 3MVYA 5I58B 2ONRA 3T66A 2JHEA 2XD2A 4F29A 4YB7A 4BDQA 1MY1A 4MH5A 3PUWE 3U1OA 3QSLA 3HN0A 5ISUA 2VD3A 5I59B 1BIYA 2CMOA 2P9GA 5HBCA 2ZHOA 3OSRA 3TAJA 2VOZA 3KOSA 1XVXA 3K4UA 3CVGA 4M1VA 1H44A 3O6GA 4LA9A 5CMMA 1LAHE 2RQMA 1Q1KA 2I0CA 3TMGA 1B2HA 2E1SA 1ZU0A 1SW4A 2AIXA 5ELVA 1CB6A 4F39A 2ZXTA 5IKBA 3K6UA 3RTFB 1B5IA 3IOUA 2H9BA 3KOTA 4GWOA 5AA4A 3A09A 2FYIA 4JB7A 3TCGA 2KLFA 4R6YA 3MP1A 1M5BA 4KYEA 1D3KA 1MXWA 1MY0A 1RWUA 1ZJLA 1DMBA 3IB0A 4P11A 4IO1A 1EZPA 2OWSA 4OYVA 2DVZA 1B4HA 2GHAA 2V3TA 4N13A 2ANJA 4JWOA 3UA8A 1B3LA
chains in the Genus database with same CATH superfamily
1ZBMA 3U1MA 4FE8A 1LK7A 3CC2S 4LF8J 4J9MA 2BZ2A 1TK5A 1PKUA 3OFHA 1HIYA 4NF0A 2B51A 2W9CA 2XO7A 2O01C 5IT4A 2AKWB 4ZVOB 2CQBA 1KWMA 3LSWA 1VSOA 4WFZA 3IJXB 1S12A 2G2OA 4IY6A 3PYDA 2UXCJ 1KHWA 2MPUA 3DC2A 4ZEIA 2RILA 3EM1A 3TAMA 4JBCA 2LXIA 1UWBB 3DDIA 3MHYA 3IBCB 4K0KJ 1KKHA 1WDNA 4RNFA 1Y1MA 2F7BA 2BW7A 1N5SA 5D0HA 2YKAA 2PFZA 1T9TA 1VS3A 2G13A 4KHPJ 5AXKA 1WI8A 3HHGA 2WVDA 1NM2A 3UWTA 1Y10A 2DEIA 2CQ2A 3R9LA 1KNZA 4GWSA 4PQUA 1Y9UA 2KT5A 4J7CA 4M5DA 3QSYB 1FESA 1WG5A 1NSPA 1U1OA 5EYFA 3VAIA 1TR0A 4U7UD 2GQCA 2ZFHA 3V6KA 1QJMA 2AYSA 4C8KA 4C11A 4M5HA 4IQXA 1RHRB 4URSA 3W3SA 3KEIA 1B3GA 1DPPA 5CZVA 3SQOP 3WIVA 4CLFA 3MOZA 1NL5A 5KFVA 2QLFB 4AB6A 1RCXB 3M8YA 4OFZA 3AB2B 3BO2A 1L3VA 1QAYA 1WSRA 4ZEBA 2A5TA 3W66A 5D4OA 2RRAA 1RISA 2W4PA 1NEEA 4P6QA 2GVZA 4J9NA 5H9EK 2W2PP 4OZNA 4G3IA 3N6NA 2AX1A 3VAHA 3MUVP 1Q82T 1VJWA 2Y1RI 3GZ7A 4C7QA 4PYDA 1OQGA 3P6YC 3Q25A 4N4UA 2YNFB 3J7AN 2CJXB 3C35A 2F35A 3Q23A 2XXIA 2DISA 2NYIA 4LRDA 4XKNA 5GAGI 1U0HA 1IM4A 3E13X 3MEGA 1RKIA 3RTVA 1M5SA 4USTA 1UJ4A 1G0IA 3R5CA 4FEDA 2RVJA 5C24B 4XFEA 4NOHA 4DU7A 5I42B 1B99A 3SDFA 1U2CA 4DPXA 2A2CA 2E9ZA 3GILA 3AH6A 1XNRJ 2QLJB 4N56A 2HQDA 3V6JA 1U2RA 3QRQA 1VHIA 2P8IA 4IFYA 2H1YA 2LEBA 2QTWA 4QFPA 3TUPA 3D4JA 4KY3A 3RB3A 4JBZA 1RT3B 5EQAA 2RAQA 4AS5A 3PIPQ 4RW7B 3HHKA 4ZPVR 3GP9A 3OFFA 4C9DA 3EVMA 4AL5A 4U7UK 2E1MC 4QW9A 3HHDA 3BN7A 2JC1A 1TMJA 2YWKA 3Q86A 3WC0A 3W5YA 1L5TA 4FIMA 4WE1A 2CYYA 1OIAA 1GGGA 2GHWA 3SMZA 3FVOA 1SJQA 1Z7NE 2JFDA 4NEYA 4ZLPA 4DR6F 4RXLA 3KOAA 1MXUA 2IHR1 1WC0A 4GWZA 3QLHA 1A7GE 3LP2A 3B4MA 4OX6A 1UP1A 3T93B 3PACA 2X1AA 4PAKA 1BK4A 1B4ZA 2Y0SD 4K3FA 1HARA 4IOCQ 1R8HA 1RT7B 4F22A 3MEDB 1YJRA 2Y5LA 4ZJQA 3AD8C 1N5VA 2FUG9 4P7VA 2MKKA 2C2MB 4FS1A 2VH7A 4FBTA 5LSOA 4K2JA 3CDUA 2XZWA 4K4UA 2I3VA 4G8HA 3V6HA 1JLFB 2W4CA 4LATA 2EK6A 4ZP7A 2L48A 3HSGA 3ITHB 3H25A 1YBAA 5CAAA 5U47A 4H5FA 2Q66A 1LV5A 1J5OB 1H45A 3RPLB 2B4LA 5KG1A 3HZEA 3BDEA 4LF4F 5DQIA 1A9NB 5J1EB 3FQKA 2UXAA 4MBPA 3MAMA 3UCGA 4DX5A 5KDTB 4UUXA 3QUFA 3IWLA 4ZVTB 2V4JB 4W90B 2ZZXA 3QUJA 3OLAA 2HQ0A 1E6YB 2KZZA 2DWHA 4AB5A 1S10A 2MJNA 2V8VA 2P6SA 3CSKA 4R74A 1H38A 2AMCB 2EG1A 3KSXA 1LAXA 2MKHA 4HTGA 1TVRB 3DLKB 1DSNA 4U4SA 1UJ5A 3PTWA 2XMVA 5JVHQ 4B9SA 1HPZA 4ZPTR 5F8JA 3K8WA 4Q8RA 5AT1B 4ZPAA 4DQRA 2MYFA 2IM0A 5CABA 5H9FK 5A8RA 5GADU 3MR2A 1N5YA 5CA5A 3NCRA 3H4BA 3ISPA 4IO9Q 1RB0A 2GC8A 1R89A 3W64A 3TTMA 2ADCA 4DXLA 1FK9A 3PR5B 1VQ8S 2FZCB 3HHNB 3FCHA 5HPQA 5ICQA 5IT0A 2QC3A 3HVWA 2ZITA 1IXKA 4Q0CA 4ED8A 3LWLA 1JLBA 4LN5A 5KG3A 5KFZA 4OX9J 3M8QB 1FX2A 1LFHA 3KJ7A 3MPDA 2IA6A 3ODBA 2J76E 2Q9TA 5I84A 4LBHA 1FPKA 5D15A 5ITOA 1XJWB 4NCGA 1NUWA 4AUKA 1Y4CA 2X3GA 4RUHA 2ZM6J 2YPYA 4OVTA 3KLFA 2GX8A 4ED2A 1EYIA 2XWVA 5RUBA 1UKUA 4YB6A 5EYGA 3DXSX 3WIUA 4GBVA 4NG7A 3DELB 3OR1A 3M3KA 2MGZA 1HBNB 1D4NA 2B7BB 2Q8MA 2IY5B 4P74A 2PFFB 5LMUJ 4TQRA 3E78A 3KLIB 4ED0A 2CPIA 4M1KA 4DUYF 3RRKA 4DUTA 3FJ2A 3C15B 4POWA 3PFEA 3IA0A 4F19A 5EX0A 4A8FA 1F9HA 3AOBA 1N88A 4RW8A 3CXCR 1M5EA 1H7WA 3HHLC 1FWLA 4CO2A 2M88A 4P9KA 4X8RA 1FVQA 3WAFA 5BYRA 2JEJA 1B58A 4O3RA 1RT4A 3M8ZA 1KBRA 4OFLA 3R5AA 2K7KA 4IO5A 4URQU 3VDFA 2DVIA 4NZ0A 5KCJA 1S1UB 1LWCB 1UVNA 1FBCA 3KHLA 4YB1P 2FHMA 3JTNA 2KVIA 5JTYA 1ZOTA 2HWHA 2DY1A 2C3MA 4FKXA 2COLA 4LF8F 2A1BA 1JX4A 3BO4A 5BJRA 1RAGB 2UVIA 1GMUA 3DNCA 1ZA1B 4R75A 4ZEDA 2MKSA 1H74A 2V94A 2I6EA 2CPZA 2VG7B 5E41A 1S5ZA 4PG8A 1R9QA 4ETZA 4OZJA 1SV5A 4IG3B 1PC5A 3FZBA 4A8MP 2UXCF 4HACA 3PKYA 4FXWA 2WHOA 3IORA 4QZVB 2IAJA 3QGHA 1SBPA 2H25A 2ZHBA 4K0KF 2DB1A 2Y7WA 4NAPA 1OPZA 1U25A 1X4HA 3V2UC 1EAYC 4TQUQ 1NI9A 4KHPF 1NNTA 1NPRA 4TYBA 2PA3A 1D9AA 1FBEA 2QE5A 1D09B 1JLGA 1DCUA 4PAFA 3CCSS 3JYRA 4G8NA 5K14A 2VDHA 4Y2KA 2FNCA 1L3KA 3NKYA 2ALZA 4JI6J 1QUIA 2WYPA 5HQ8A 5L9NA 3LH2S 1BE4A 2UUBJ 4ZPCA 4XIUA 1HNXF 4ENOA 1RWOB 4ZIWA 4WFAQ 1K8AT 1QVSA 3ZTSA 3MSTA 2R8IA 2DYXA 3AA9A 4F3GA 3TVYA 3LGMA 2F4VJ 1RHKB 2L5VA 4FEBA 2REGA 5F9NA 3OL8A 2ABYA 2Q6CA 1SD3A 4H4OB 4Y65A 3VLUA 3CD5A 1PSDA 1WWHA 4ECWA 4BDOA 3G3GA 3KLHA 3OFEA 1QE1A 4FPIA 1WOOA 1NO8A 3K1PA 2HNYA 1UZDA 5CH7B 4OL8A 1B7HA 4K50A 4PE3A 3HFUA 2MJUA 1UW9A 4KGMA 5JJBA 4DIGA 2XA5A 1TT1A 1NV2A 4I8CA 3FD3A 1EP4A 2L3MA 2XXRA 4KB7A 3OO9A 4TQSA 4MIWA 3OL9A 3MYUA 3SCJE 4JB8B 2DGQA 4DV4J 2YWEA 1HL6A 1XMQF 4PZVA 3H0PA 4WYWA 1SC6A 2XQCA 3NNCA 2X3DA 2UUTA 1XNRF 4NLVA 3T0JA 3EZOA 1VQPS 4K4SA 1NH7A 4WKRA 3BSAA 3IXQA 4LVOP 5F8NA 5DDOC 3VF0B 3MMBB 4CT9A 2RC7A 2MQNA 2H54B 4CIOA 4TY8A 2ZE2B 2RJZA 2Z2MA 1TKZA 2IVYA 2VG5A 4DXBA 2YWHA 3HD2A 1HI0P 1FQDA 3UGWA 3DOLB 5F24A 5FTHA 1DLOB 1RSCA 3PDNA 1UWAA 4DPTA 1FE0A 3DN9A 4O3SA 5IAIA 2ZH7A 3C2PA 7AT1B 1YWXA 4Y2MA 1EZ9A 2CDRB 3D6HB 4EDPA 2Z30B 4LSZB 3PX0A 1KQFB 4PR6A 5D4NA 5K8NA 2E7VA 5J1NA 1I69A 1S57A 4KFBA 2DHHA 4N17A 3DOKB 1RYSA 3ZFVA 2BYCA 2CQ3A 3DRRA 2V0NA 2KT3A 2Z8FA 4HXVA 4OA4A 4CH0S 1X7VA 1X4CA 1SH0A 2EFPA 3V81B 5D3GA 3IB2A 4J9OA 1TAUA 1RU2A 1IMCA 3QNWB 2HHSA 2DR5A 1PB9A 1CJTB 3MF5A 5L46A 4KYSA 4FS2A 1RADB 5HMWA 1PBUA 3W8PA 2P5VA 2O69A 5KT6A 2VQEJ 1RYXA 3NBPA 1IXCA 2WBRA 4V19X 4OJ1A 1UIUA 4JXIA 3IS9B 3MM9A 4K4WA 4GD5A 1KSPA 4YU0A 4ZA1A 4KPYA 1BWVA 2ALYB 3CDBA 2DWIA 3PMWA 4NLTA 4ILMA 3ONMA 2YKMB 2M52A 4PCDA 1KDNA 2IIHA 2LA6A 1LXJA 2E66A 4H0WA 3CVKA 3Q29A 4NL5A 2Z4PA 3RQTA 3I9V9 1X4AA 4CLLA 4QFKA 3T5KA 4KCCA 2DK2A 3SIPB 5EX3A 3L6GA 3KK2B 2GVDB 5CBRA 2UVWA 5A5XA 3HVTB 1BUXA 1C0UB 1H0HB 4AT1B 5AE4A 1S1WA 3TQLA 2JNJA 2X51A 2ZUGA 3E8OA 1ZPWX 2XSJB 2OPRA 5M2PA 3DRSB 2IBKA 4EUOA 4OEVA 1WHWA 4X2BA 1DPEA 2F9DA 2F5XA 2NUUG 3O9PA 3ZTRA 1UQWA 1SUQB 1B7UA 2V84A 4I6AA 4EFAC 5KT2A 2XLIA 3IN5A 2I3WA 3C16A 1HBMB 3OV7A 3EGZA 2VBXA 1FJ9A 2BEFA 2OZZA 3C14A 4ZLJA 2R3VA 1JK9B 1WDDA 2IJFA 3TTNA 1SB6A 2OTJS 4DR2J 2MMYA 1YJ9S 2KJWA 3G96A 1KHVA 2LVWA 5KFNA 4E0DA 2DNHA 3OBIA 2F7VA 2KTQA 3DGPA 4RBUA 3CFXA 2ZJRQ 2B6AB 3NS5A 2ZM6F 3CB4A 4P1LA 3M3FA 2CADA 1OVTA 1OSCA 3WC2A 1WG1A 4DSKA 1UTBB 1POY1 2MSTA 4K4XA 5ETMA 1B7YB 1RTHA 3KYLA 1VQNS 5LMUF 1B3HA 5KZTA 4IRCA 2J9EA 2VOOA 2UVHA 3NOHA 3CJQA 1USYE 4RJZA 4ECVA 1JLQA 1Y3JA 1UFWA 3CG3A 4EF2A 2VPOA 4RYAA 2OELA 3KMQA 5F7VA 1UTAA 3FBBA 1RUSA 1AFIA 1MY2A 2VU5A 4FECA 4ZVPB 1PC4A 3AODA 4ECZA 2F3DA 4N15A 4LZ5A 4YP3A 3RR7A 1TV6B 2VBYA 1FEEA 2V9KA 4OVRA 5D78A 4NZ7A 2Q88A 1HQ2A 2IBOA 3ZZYA 2CZ4A 2GNKA 3G3HA 2B3BA 3PUZE 2Q43A 3BGFA 3S8SA 1VQOS 2YNHA 1GMWA 2NYHA 3ROJA 1FD8A 1S4EA 4LSLA 5LXYA 2OH2A 2FD2A 3AA8A 1U1QA 4DR4J 1INPA 2XZDB 2OP5A 1SL0A 4KC5A 2Z57B 3S9NC 4Q5TA 3RW6A 1VOMA 4M5LA 2YQ3A 2FPHX 2PX1A 3CR9A 1AB8A 3D6FB 3M8RA 5KFMA 4CLZA 1U48A 1FERA 3L9ZA 4ESXA 4CTAA 2V2KA 1FRXA 3KWMA 4PEOA 2RKIA 3MP8A 1HSLA 3R97A 4F4WA 5KTQA 2NQPA 3QATA 2QL9B 2LEAA 3FCWA 2XY6A 1O7TA 3FBEA 3BO3A 5I57A 5DZ6A 2BDPA 3R7SB 2FVPA 2MY7A 4QR0A 3POTB 1QVFR 4Z2XA 1FPFA 1MXYA 2VGQA 3GPAA 5JXSA 2HHHJ 1OYDA 4JI6F 2D1CA 2CJBA 3NWGA 1DTQA 5HJXA 3IOWA 1G7CB 5CYQA 5LSRA 2UUBF 4TLRA 4QXDA 4IO7A 3SEWA 1EKRA 2CPJA 1HI8A 1IQ7A 3B82A 2NPFA 4N81A 3OENA 1T9YA 1R27B 2ZBPA 4DI3D 1P6TA 2E9RX 3CHGA 2Y7RA 2GJFA 3SSRA 4JV0A 3O44A 3MPWA 2VB6A 1TXFA 4M4GA 2F4VF 5LM7E 2PC6A 1NKXA 2QPQA 5IM0B 3KN8A 4XEQA 3T22A 4FF3A 5E3PA 3R5GA 4MKAA 1FWKA 5K8MA 2AEMA 3U92A 3FXRA 1NJWA 3K00A 2ILZA 3M1VB 4DV1J 2QT7A 3UR3C 1YJTA 3E3XA 3QZ7A 2YX1A 5ADZA 2CNKB 3BQ0A 2VC0A 4KV8A 3KLGB 3MFHA 2WZ1A 2FHKA 2MZSA 1QAXA 4QBAA 2V6AA 1YITS 4I7FB 3VE1B 4MHFA 3C3LA 1TKDA 2CRLA 4R73A 2YNGA 1AA1B 5DYHA 4CQ1A 2F4FA 1EHWA 2AJ4A 1C2PA 4N6PA 2BW2A 4ICLB 5HLFA 4ANEA 2FIEA 3HHEA 3RGYA 1C4AA 2XMTA 2YKNB 4P2SA 3HHFA 3QSIA 2ZUAA 4Q44A 4DV4F 4N07A 1R31A 3RNNA 3BREA 2B5JA 3QIPB 1Q7LB 1URGA 1IN0A 3K5PA 3CC7S 1KFDA 3MAAB 5LMNF 4O4RA 5L1LA 1FX4A 3ENAA 2CQ1A 4NLQA 3PPRA 3L4BC 3SYZA 3E3KA 4ZECA 4GO5X 4I68A 4RK2A 2VZ9A 3KC0A 1NMUA 1Q8BA 4WFNQ 4OZLA 1RAJA 3TJ8A 3EX7B 3KLVA 1RJJA 2YNIA 1BWEA 1NSAA 4X9TA 4LRCA 3QGGA 1U1PA 2RSQA 4PFBA 1N34J 5HI7A 1FHTA 5FDLA 1K1SA 2BACA 2MY8A 3OR2B 1HQEA 4A8QA 4DEZA 1WC4A 3IO6A 3JZJA 4OV6A 5DVIA 3RN8A 3BSNA 3VLVA 4A8WA 1FRLA 1BTJA 4FKYA 2RF2B 1QUPA 2ZD1A 4PAAA 4QFLA 4RNSA 4RPOA 3ZC4A 1LAFE 2VPWB 4PPZA 2DP8A 1MG1A 2B3FA 4WYLA 3RAQA 3EUNA 4YICA 5CMBA 4I2QA 3J81Y 2C2KB 3DRYA 3KZGA 3VGVA 4DX6A 5B0BA 2WONA 2WKYA 4FVMA 2UZAA 4P8BA 4YKJA 3RUMA 2KHCA 4OVPA 5I7IA 1I6AA 2DHSA 3DLEB 3AHPA 3NL0A 2LQ8A 1CQNA 2RC8A 2AL5A 1TL3A 3M3LA 4RNNA 2XULA 1MY4A 2VQEF 5A6PA 1A7LA 2EKYA 2Q1LA 1BQNB 2MXYA 4MAGA 3VALA 2YJPA 4OLPA 1KOHA 4NE4A 2D9OA 1QGXA 5FTIA 1B64A 5M2VA 2DYAA 1U09A 3MZ1A 1HR0J 4KGKA 3PUVE 1G0HA 3PW4A 3M30A 2BJDA 3O6QA 1N5QA 3SCKE 2L08A 3EXYA 3ZZ0A 1MS7A 4E98A 3R6LB 3KBZA 1S1XA 2VQFJ 2GMJA 1RHQB 4NRTA 1JLAA 1N0TA 4DBQA 5DZ7A 3FGVA 4JP8A 4A8SA 3DHXA 3QIMA 4O4GB 2B43A 4ZKAA 3KGCA 2HRTA 2ZH9A 3F11A 2G1HA 1SC3B 2M8CA 5HBMA 5GADI 2OEJA 5BWJA 1RU1A 2K1RA 4B3OB 4JV1A 2EW9A 4DSIA 1S1VB 3ISND 4I9DA 3C31A 2YWGA 2VV5A 3BZQA 1Q8LA 2FVRA 2RE1A 3T1AA 4HH0A 2F7CA 4J9KA 4NA1A 1LW2B 3M8PA 1KS2A 4EWTA 1OWXA 2C42A 2B4PA 3A8KA 4H6DA 1TWYA 4X4SA 3PYEA 5ETKA 3GIKA 3HPIA 3TVZA 4OYZA 4QPXA 1G6BA 3MW0A 4GO7X 4DR2F 3LC8A 4KTQA 5J2QA 3IK6B 4FYDA 4P1EA 3ETMA 2XMJA 1SL2A 3GG1A 4X84A 1X9WA 2HHVA 1QAIA 2ZNSA 3DYAB 3DHWC 2ZH5A 3EMTA 2I2YA 2HVZA 1OO0B 2FTRA 4LBIA 2WEFA 3AY0A 2OO4A 3ILIA 3T1HJ 3MM7B 1VFDA 2N4CA 1HI1A 2FQQB 2FHYA 1WD6A 1KOOA 3X1LB 3D1HA 5HK4A 2OTLS 2ZBCA 2G29A 2HXRA 2AYEA 1PILA 1H72C 2FGOA 2O51A 1LCTA 2IMOA 4CH1A 2OMLA 2NR0A 3SDEB 4N91A 3M4XA 2D74B 1N52B 3V4MA 2OUGA 3PD9A 5J2NB 2I48A 3LBSA 4H8JA 1HKAA 4NI2B 4KJIA 1YJVA 1AYEA 1IBMJ 4DWIA 3DRPA 1SVXB 2CPEA 4WXWA 4AL6A 4CT8A 1FTKA 3MPUB 4LF1A 1XWLA 5CC2A 3QWPA 4LIWA 2DXYA 5DM6Q 1CLFA 5DQGA 3AXKA 2IA0A 2CJAA 4NLUA 1A40A 2DIVA 3MM6A 5KFKA 3H2VE 3ZZRA 3H40A 4PBHA 3EPGA 4UOFA 1A55A 2KXFA 5GMEA 4YFUA 3G9CA 1B3EA 3GFYA 2RC9A 1FXLA 4K5RA 1VFEA 2BE2B 4YKPA 4DCXA 4DR4F 3G6ES 1DJ0A 3LAKA 4P56A 3EDQB 1PYTA 4QWBA 4HH1A 5ETLA 3DKDA 1UWBA 2MZTA 2CZVC 4JI3J 4IB2A 1ZLQA 5H8NB 4CI0B 2JX2A 5EHHA 3RPWA 3CUNA 3W5ZA 4N8GA 4CM2A 3PPQA 5ETPA 1NAQA 4LFCJ 5IOLA 3QK6A 3W61A 2LQJA 1CEZA 2AYGA 1Y00A 3T6BA 3TUIC 2QLWA 3NCPA 1RYOA 5FD1A 4FJPA 4DU8A 5ITHA 2VUGA 1MMNA 1GAOA 4GC7A 5DEXB 3PFOA 1YLXA 4FYVB 5DRKA 2XEXA 2FHJA 4NLYA 3W2VB 2D3UA 4Y2AA 1RT1B 4XDCA 2JHEA 1RAHB 2GHPA 2HRYA 1SPBP 4KT0C 3V4IA 1W7WA 1YRTA 2HPGA 4MH5A 3PUWE 3U1OA 5CYJA 5B09A 2CQHA 2VD3A 3KLEB 1M5PC 4L6V3 2I0XA 5HBCA 2ZHOA 3OSRA 1I3OB 3ZZZA 1VR6A 3HLUA 3L09A 4LREA 2XMKA 6AT1B 2WSCC 5E7OB 1NUEA 3O6GA 1UW4A 5CMMA 1LAHE 1FJ7A 3U1NA 4ED7A 1Q1KA 2UVVA 4OIXA 2YNFA 1VLOA 3B78A 3PJXA 1SW4A 5CYMB 2VJUA 4ID8A 1CB6A 4CO3A 3J80Y 3GJRB 3VVTA 4A8XA 2MLZA 2CPFA 4JB7A 4B9NA 5I42A 1WELA 1FKAF 1RWUA 4UTGA 2V63A 1N56A 4OI2A 4DHVA 1EZPA 3L95X 2KXNB 2GHAA 5LDZA 4N13A 2ANJA 4QIGA 5B7DA 4KO0B 4F4AA 4F2RA 4XKQA 3HZGA 2J7UA 4QYZK 5FHMA 4ZN3A 2DCLA 1RT3A 3TZZA 2XG8A 3M32A 3E79A 1TL1B 2PD1A 3QJJA 3GMGA 3O8WA 3VGSA 3U7JA 4RW7A 1WJ9A 2HGLA 3OJSA 4GWWA 5E5NA 2OJ3A 5GAHU 2W2QP 3HVAA 1N34F 2ZC4A 5KFGA 2V2VA 1ZM3A 3PKMA 1S0MA 4PFIA 3FVKA 3PYFA 2FY8A 3A3PB 1B7FA 1AZSB 2DXFA 2XS7A 4MK9A 4USUA 3BKFA 4KD5A 3KJVB 4MFBB 4UQTA 4O94A 2ONSA 1YBTA 2QVRA 4A47A 2DPJA 2K3IA 1Y3KA 3PUXE 2XXPA 2WBMA 5L9MA 1S4FA 1L3SA 1X8DA 1WEYA 1EZOA 1LFGA 4AXJA 2KXHA 1AWBA 3MEDA 1UIVA 3AOCA 3G3KA 1D9QA 4NRUA 2HFBA 2DE3A 1B52A 3KHRA 1RABB 4KYDA 1DBZA 3GIMA 1JLFA 2WAQD 4PRFA 3AT1B 3DLLQ 3ITHA 1RAOA 2W8KA 5HQMA 1GTKA 1J5OA 3RPLA 3GIIA 2O6AA 2QL7B 2AQ4A 1CS4B 2RKMA 5J1EA 2Y7PA 5KDTA 1RP5A 3HD1A 4PETA 1NDPA 2V4JA 3DGVA 1HR0F 1OQ3A 3FEZA 3DXBA 2KFNA 1NNPA 3R3TA 1E6YA 5J2PB 1GK8A 4FNIA 5AE2A 2ZNYA 1JB0C 4AFFA 5IWAJ 1TVRA 3DLKA 3GLJA 2F6PA 3UN3A 1HBOA 2N7CA 3EYZA 3CC4S 3ET6B 2VQFF 5D77A 2KRRA 2XMMA 2DNLA 2OCUA 2WYKA 1WOPA 5KFDA 3ZKKA 2ZWOA 1FA0A 3G87A 1QSLA 3HSZA 4ZCKA 3R1LA 2Y0BB 2B8PA 2JVRA 3H06B 2OD4A 3FCVA 4ELRA 2KVQE 1JEVA 1T05B 1MDQA 1H3DA 4DV2J 2J0WA 2PVUA 4IO3A 4XIGQ 2DSFA 4ELQA 3R1HA 5B7WA 2G0CA 3LSLA 1M5HA 4H8IA 2Z8DA 3MUMP 3ONQA 4ISUA 1HFEL 1WF0A 3M8QA 3CJ8A 5LOMA 2M5YA 2H99A 5EWEA 4UACA 3PMVA 2WVBA 4F04B 2NZCA 1VBXA 4O3BA 4AQYJ 4TXSA 1SJ3P 2XO6A 4JI7J 2WOMB 2O1LA 1PB8A 3ISNC 4PYAA 3W2WB 2VPZB 4DLGA 4R8UB 4B9UA 1FRKA 4DV6F 3G3IA 1TK0A 1HBNA 1S99A 2GW8A 3AXFA 4F3QA 4USHA 4G68C 5KT7A 2F8EX 3TQWA 4CH7A 1HW8A 3T1HF 3KLIA 1M5DA 3IRXB 1Y5NB 1HSJA 1Y0HA 1SIWB 3C15A 2ZZWA 5JVGQ 1IJFB 1QUVA 1NJYA 1DBDA 1U47A 5IFMA 4USVA 2C3UA 4B3SJ 3VZHA 4KCDA 3BH7B 4YR2A 1F9EB 1SJRA 2JOQA 2JJ4D 3UNGC 1KWHA 3EICA 2DT9A 3MPVA 4RK9A 1S1UA 2D21A 5IGAA 2POKA 3NG8A 1W25A 4G1IA 5AA2D 2VKZG 1IBMF 5C7PA 3ILUB 2PBWA 2GMHA 5IC6B 2PMHA 1RTIB 4AYBD 2KHDA 2ZOMA 4U21A 1FRMA 2QFJA 1D1UA 3WAEA 3FBCA 3C46A 1SXLA 1TELA 2ZHAA 3MVWA 1TP7A 2OKQA 2I5JB 1P1OA 2VG7A 1SYIA 1VQYA 2CNLB 4ZP9A 1ZIUA 1YRXA 1K9YA 1YVFA 2PCRA 4FVCA 1WSVA 2D9PA 3MM5B 4IOAQ 1BXNA 3B54A 2VODA 4TU7A 3VQTA 4TYAA 1RI7A 4QSCA 3Q8UA 2WBDA 4GXAA 1XR7A 4JI3F 5GAEI 3ZSFA 1JEUA 4OJGA 2M8HA 4NXNJ 3IBWA 5IT9U 2HIYA 3OSPA 3G3JA 3H6TA 4XTCQ 2Y7IA 4LFCF 1FSAA 3UORA 4DL4A 1R8CA 1X4EA 3VTIA 2HRUA 4LR9A 3G6YA 3MGJA 2QA4S 3PUYE 4NLSA 1V3RA 2XCAA 4OEUA 2JWNA 4XPEA 5EHMA 1VIXA 3EZ5A 1GVCA 1APSA 3QJPA 3DU6A 2AGQA 1FXRA 5F8IA 2ZNZA 1J5EF 1HHTP 1MM6A 1PJ5A 2HQFA 2WRMA 2VFUA 4H67A 4L17A 5KFTA 2QZ8A 1WTFA 1RGVA 3A12A 1RTJA 4FPRA 4PUOB 2WK4A 1S1TB 4RNMA 1F5BA 4TLQA 3BEGB 3O5TB 3I4HX 3CO0P 2I38A 2ZH6A 3S4UA 4I4BA 3MCMA 1C1BB 1KN6A 4DQPA 2VF3A 1YKWA 1HYSB 3KHGA 4NF8B 2DD8S 4EMDA 4OWDA 3CIZA 4OYWA 3HO7A 1XERA 4Y28C 2JL9A 4QFNA 2RH3A 3KK3B 4XF5A 2FGCA 2C1EB 3W62A 1IKWB 2UUWA 2LU2A 2DR9A 1YRUA 2CJ9A 1ZYQA 4EBEA 1T02A 3HF5A 3L7PA 4H46A 1V6HA 1FDNA 3DP4A 2DGWA 4M8LA 2B3TB 3GR1A 2OSRA 1N33J 2DPIA 4JV5J 2HAIA 5E3AA 3R2CJ 2RINA 4FXVA 3CCMS 1EYJA 1US4A 3CJ0A 2XY5A 1VC0A 3QYYA 1XTZA 3G86A 3MXHP 3HHLB 5I3SA 4AS4A 4ZP8A 3A3NB 5LXRA 2VPNA 4EGLA 1FTAA 2E1PA 2XXWA 3MMBA 3SSQA 1R43A 1KVKA 3MCOA 3WBZA 2F9JA 4IH6A 2ZE2A 2R7SA 1RHUB 4DCJB 3TFLA 4BBYA 1HNVB 2CG8A 4OYOA 2VHAA 3KUGA 3D1RA 4DDFA 4ZVUB 3BR9A 3DOLA 2HK3A 4QBUA 2C28A 1DLOA 3BKTA 1HHSA 4OESA 4U8YA 3CCRS 1MQGA 4F50A 1VQLS 5KFYA 5F1QA 3CCVS 3MZ9A 3N5BA 1RHJB 5C42B 3MBPA 4QWCA 2W8LA 2XXKA 1U1LA 3GJTB 3DM2B 5MLCV 2UP1A 1B32A 2MKIA 3NS6A 1RBAA 1FJEB 1S6QB 3DOKA 5H8QB 3CSBA 4RW6B 4DV3J 5D4LA 2ZH3A 3OPKA 3QT8A 1AOVA 3LQVA 4ZVFA 4LMZA 1S9GA 1KA1A 2DNOA 2XXQA 1YIJS 3QAXA 1YZ7A 2OBGA 2Z23A 3KN7A 2Y84A 1URSA 4DV0J 4DR7J 3F0NA 2CAJA 4H1XA 3LWMA 1NNKA 5D0GA 1YYZA 4DJBA 4O0IA 2OSQA 4IDKA 3IS9A 4X48A 1B46A 4J5OA 2VFTA 1CG2A 1Q0NA 4AQ4A 3MVZA 2B4VA 2YKMA 3MMCB 3CDWA 3OW2R 4UOHA 4GVOA 1ITPA 1GFWB 2EFOA 1PB7A 5EWGA 2XXYA 1VCTA 4OMBA 3I0SB 3IFEA 4HLBA 2QL5B 3KK2A 2XYGB 3R6UA 2ZZMA 4Y00A 4EQBA 3M2UB 4QFOA 3HVTA 4U1ZA 5IWAF 1VE4A 2QRRA 2YH0A 3KDNA 1C0UA 4J9UE 3B6BA 3I6PA 2RDIA 2PMZD 3PRDA 4MJOA 4HL9A 4LZ8A 3DRSA 1U7LA 1S6UA 1D8YA 2CDQA 1WHYA 1DRZA 3UFCX 3OL7A 4BS2A 4YR0A 3CD0A 3HDSA 3MTKA 3CJ4A 3KG1A 1B0HA 4ZPBA 1SUQA 3R7NB 1VMBA 3R5BA 1HNZJ 2DXDA 4QSEA 2X7IA 4B17A 3RTWB 3H5XA 1LBYA 4A4JA 2J0QD 3JTPA 5KT3A 3BIHA 2R6GE 4BWJA 4CO0A 3LP0B 4WIQA 3LPEA 2GQ1A 4C4WA 1XBWA 1ROFA 3TR5A 5JK4A 1JJHA 4HS7A 5F8HA 1MN7A 4OHWA 2CJKA 5D6GA 4CNZA 1GX6A 2RHQB 1JLEB 3ILOA 2KKHA 2IM3A 4ITSA 4OZ1A 1IITA 3C36A 4NYZA 4JI7F 2B6AA 4RKUC 1JLCB 1MROA 4DG1B 3IG1B 1NUZA 3BB5A 4PCQA 4NTLA 3NNAA 1UTBA 2RF1A 1NV7A 3GU0A 4TNOA 2W9AA 4MK8A 3KG4A 4V19J 1IXIA 2QMUB 5K9FA 2XXHA 2E1RA 2EVZA 3HFVA 2QEXS 4HKQA 3D0HE 3OVSA 4BC9A 2B7CB 1VQSA 1RDYA 1TAQA 4MLQA 4Q7AA 4B3SF 2DVCA 5H8FB 3M6VA 5ETRA 4UOGA 4IG0B 2HZKA 4NN3A 1Y7PA 3V5RA 1ANFA 2PEHA 2GGPB 2VG6B 1NK8A 1FXDA 1VR5A 4WIIA 2F63A 1J2VA 3H42A 3U27A 3U1LA 3MEKA 2NWJA 2FY1A 3LALA 3PV0E 4FORA 2XYHB 2HS4A 3JQMA 3C6TB 2W2OP 4N7TA 2LU1A 5T7LB 2ALUA 2IDEA 2DJWA 4YQWA 3CJ5A 4WU3A 2ZYMA 1S77D 5FLXU 2FZKB 4HE1A 2ZVSA 4LRBA 2Q89A 1UA1A 4R6KA 2AWZA 1USYH 3MECB 1XS5A 4EXLA 2DNKA 2HIQA 2RQ4A 5F0WA 2Y9HA 3HSDA 4PQUB 5TU0A 4ED3A 1GQEA 3BGOP 1ZAXA 4R9FA 4C8LA 1FBFA 4R25A 4IY5A 3T1YJ 5K8OA 2AJ0A 3RU0A 4NX9A 3ZO7A 1QUJA 4NXNF 2QVVA 3T5HA 3NP5A 1H98A 3TQ1A 2G0IA 4C11B 2XX7A 4IGTA 1FVSA 4OHVA 3MDFA 3POTA 4HEA9 2H5JB 5J1DA 2HHTA 4C0OC 3I5OA 3TW0A 4X65J 4ESWA 3MC2A 4UQGA 1IMFA 2MLXA 3I32A 1IR2A 1YJUA 4F18A 4DFJA 5HP1A 2MKCA 3VV5A 3TYTA 2RDDA 4RBTA 2HBRB 3Q83A 4L72B 4M5MA 3AD9C 1F3FA 1KVJA 2HHWA 2ZDOA 5IM0A 1KQKA 5LSLA 3OO6A 2Y8WA 2HQGA 2NVUB 1G1XA 1X9MA 4WKMA 4MX6A 1IQZA 3M1VA 4ZPDA 1P9YA 2BR0A 4FF4A 2PFYA 1K1QA 3KLGA 2HS0A 3R2DJ 2FC9A 4Q45A 1BHNA 1ZA2B 3LV0A 2Q79A 2ZYOA 2V68A 5DVJA 1ZTTA 4H4KC 1F9FA 3P3DA 2IRYA 4TU9A 3FBPA 4NF6B 2A5SA 1YQHA 2WB4A 1FT8A 4LF4J 4YS2A 4PTKA 3CD6S 2R2TA 4S0MA 5DGBA 2B9WA 2RMLA 4ICLA 4GQOA 1UTHB 2YKNA 4Z7YA 1S0VA 4LBPA 1KTVA 3ILJA 4DF4A 3N5FA 4CRJA 2QMXA 2M3DA 4ZVRB 2R2UA 1N33F 4QIVA 5KFJA 4JV5F 5KFWA 1K73T 4DV5F 4OZ0A 4D3GA 1B3TA 3CJTA 3QIPA 4DL5A 1CPZA 3A29A 3MAAA 2K2PA 5ETNA 1WF2A 1UEVA 4YEAA 3TCHA 2UYFA 3UDVA 2JEGA 2MSSA 1K47A 3D1QA 1NJZA 3G2XA 4YR3A 2W24A 1IKXB 2J7WA 3O2AA 3QYTA 1LWXA 1T11A 3CO9A 5GAHI 3OR2A 2V8DA 1TQLA 4B02A 3CD7A 5IXUA 1F5AA 1OYEA 4ED1A 2HGMA 4DZ1A 2RF2A 3CDAA 3I82A 1CJVB 1X60A 4B3TJ 3H59A 1P9QC 3CCQS 1AUSL 2GFEA 4OYAA 1JWWA 4ELUA 3VGUA 3M8WA 2H51B 4MNPA 3QJLA 3DP8A 1S6OA 3SSSA 4DV3F 1B40A 3KJNB 4U2RA 4WU2A 3RW7A 3DLEA 3PYGA 5FIIA 4UY8T 3QZ8A 3S6EA 1VQ4S 5I2KB 5ET7A 4QIWD 2HAVA 2QX0A 2XI2A 4UY85 5B0FA 3HI9A 3RB6A 3BIGA 3W9IA 2NREA 3V83A 4MK7A 3DM0A 1LK5A 1UAWA 4DR7F 4ZVHA 3F44A 1NK0A 2Y5KA 1BLFA 4YMAA 3U8QA 2FLLA 4F36A 1PC3A 3FKBA 1BQNA 1N0VC 1ZS6A 2JZ5A 4AD6A 4PWDB 4OETA 4GFRA 4P3LA 1DOTA 1AH5A 4QYRA 4QJVA 1NV4A 5B0AA 1HPZB 2V2QA 3NGUA 2X1FA 2X26A 2DTJA 4PFTA 4J9VA 3BKUA 4JOUA 4ZOSA 1I94J 1SC1B 2MKJA 4U8VA 5A8RB 1YXIA 3PW2A 4M5KA 4EXKA 4U23A 2OJTA 2E5IA 4MYTA 1ATGA 1NDCA 1F6TA 1ZM9A 1RDZA 4ECTA 4ES3A 4O4GA 1X4GA 1FK9B 2EFQA 2OFHX 3TPAA 1REVB 1NKEA 3EHTA 4I67A 4X4NA 1RAAB 2XI3A 1NHVA 1Q9DA 5EN1A 2W7PA 3HSJA 1JLBB 3P49B 4PXCA 1S1VA 3ENVA 1H7XA 3F56A 1X4FA 3S2VA 2A6MA 1HNZF 6FD1A 3K2DA 5ESYA 2N3LA 3TI0A 4QSDA 3OQ2A 4IO6A 2C2OB 3G6XA 4DS5A 1LW2A 3Q8YA 1VBZA 2X7QA 2IFXA 1JXEA 5BR8J 3BPSP 2PN6A 3OR1B 1OLCA 4NLOA 3CNQP 1A54A 4PXEA 4OVSA 4YKKA 3US5A 2V93A 4B9MA 2F40A 4I40A 1FRJA 1U24A 2Y1LB 2A18A 5D0RA 2XX8A 5FBPA 4N77A 4BDRA 3EHUA 3DYAA 1XI6A 2NPIA 3U94A 3R6GB 1HNXJ 2W7OA 1DURA 1Y4TA 4GMKA 3MM7A 1KFSA 4MEVA 1P1NA 1NJIT 2V9WA 3OEKA 2ZDPA 4DR5F 3N01A 1GX5A 4O3QA 3GWCA 2R8HA 3H90A 1UEKA 2DHAA 3SDEA 2E5GA 2MLYA 4KR5A 4R5PB 2ASJA 2WCXA 3VZIA 5J2NA 3KXDA 4OJHA 1VDHA 4PP0A 4NI2A 4ECXA 3FRZA 4BWMA 1X0FA 2E29A 1MXVA 3RB0A 2ADBA 4DFPA 1Q78A 4P71A 1VBKA 4LQ3A 3GYGA 1BQXA 1FQBA 3GJQB 3L7OA 1NPPA 5I5PA 1LB9A 3PO4A 5A2QU 4P47A 5C5JA 1NRKA 4HACB 1GEHA 1YPNA 5KFCA 4TVAB 4KI0E 2IAJB 3A3OB 2LECA 2DR8A 4O7MA 4Y0FA 4DR1J 3PV8A 2EFNA 4AXIA 1XMQJ 2X1GA 2IJRA 1KLNA 1RWVB 4H4KA 1JLGB 5T3JA 3EPIA 4ZCIA 2G1DA 8AT1B 4DQSA 2FJVA 1MWQA 5GMKa 4DDDA 4E2FB 1UCNA 2O67A 5KT4A 5DQHA 2WB1D 2QG9B 5H8NA 1JXVA 2XXVA 2OPPB 4WFYA 3T1YF 4MCOA 1YAEA 1OMSA 4H54A 2QS4A 3OUYB 2KT2A 4BDLA 3I3VA 3ADAC 3D1OA 1SIZA 1IQTA 4FAJA 4QU7A 3OMBA 1IXGA 2RCBA 3MCSA 2BBEA 2P6TA 4K4YA 4KYZA 2IA4A 1LBCA 3M6XA 5MAOA 4X65F 3FUZA 1SPIA 1MDP1 1EQ0A 3SCIE 3MAHA 1P1TA 3W2VA 5I3UB 1WEXA 1FTLA 3TEPA 2XWKA 2Q2AA 2VDIA 1DTGA 4JVDA 4HE0A 3UI3A 3PPNA 4U6PA 3ENWA 1OY6A 1US5A 1X4DA 3ETOA 3KN3A 3KLEA 3C6UB 2BXJA 4K7QA 2DE4A 1IKYB 1NU4A 1FF2A 3W5XA 3TODA 1IUDA 2CIMA 4W92B 1EP4B 2QFLA 1YSJA 3I0RB 2HHMA 3M9OB 3OFGA 4K4VA 4X64J 3O2IA 1REGX 5G0RB 3R26A 4Q30B 3BFUA 5CYMA 1VC6A 1VI7A 2E9TA 4LT6A 5CMKA 1G2EA 3EE3A 4U1OA 2Z0GA 5LOQA 1CJKB 2GRVA 2OGUA 3M8SA 4E0XA 1B9JA 2M9KA 5HM4B 4HI2A 2R8KA 3FJMA 2PT0A 2GMLA 2DNMA 2FJDB 4M5GA 3WHIA 3DDKA 4QF9A 3O1LA 1Y20A 2DXRA 4WTOB 1YJWS 4KSEB 5A0YB 3IGNA 3CGIA 3TX0A 5IZ3B 3C66A 3I96A 1P1UA 1NHUA 1W2BR 4DZ6A 4F2SA 2CZLA 4KO0A 2OX3A 2VPYB 2EC0A 1U6FA 3QAEA 3QT7A 1P1QA 2JH3A 2IDLA 2IC3B 1XC1A 1TL1A 4USIA 2KZMA 4ZDMA 3GFXA 4O7IA 3KBRA 1GNKA 2BJEA 1VLYA 2AD9A 2W01A 4X1BA 3FATA 3O29A 3JAMY 3DLJA 4ZHRB 4KFBB 1J1NA 1C0TB 4ECYA 4ELVA 3EJMA 2MTLA 4RY1A 1AZSA 3NGDA 3B8BA 1IIWA 3K59A 2KO1A 3H3GA 5ETSA 3IR5B 2IMWP 1YZ0A 3MAQA 2ASDA 3J7ZT 3MD1A 2HBYB 5B0EA 5DDRC 2AEJA 5D3GB 5CMCA 3KJVA 4MFBA 1R8BA 4B3TF 2KI2A 3J7Z5 5DVFA 1FW0A 3IB1A 2U2FA 2UV8G 3NLCA 1QKBA 4F2OA 1EZZB 1MMLA 2VA2A 1ZM4A 2LEPA 3NBPB 4N8YA 1H6KX 4DUZF 3NMRA 4OX7A 3IBFB 1DARA 3KK1B 3GBBA 4I6WA 3LR1A 3N6TA 3QRPA 2YKQA 4JI4J 1NB7A 1KTQA 1T0TV 2PI5A 1CBKA 4LRAA 1SBRA 4RBVA 5C2GA 2QA4G 3GYXB 2VA3A 4F29A 1TKTA 2OPSB 4ERDA 1MY1A 3BV8A 2QIFA 3QSLA 1FCAA 1CS4A 5I59B 2F3JA 1BIYA 2CMOA 3KDOA 2W1BA 2CNNB 1QAJA 4LJMA 1QDUB 3KOSA 4RW9B 3CCLS 3CVGA 4M1VA 1S1WB 2HVIA 3E01B 1I94F 3G71S 5B0GA 1I6JA 1IBLJ 2AJ2A 1WC5A 1IMAA 2ROEA 3FSYA 2I0CA 1YZ6A 1Q86T 3ET6A 2E1SA 3RB4A 2BOAA 1IKVB 4LF7J 5M2UA 3LP1B 4NMXA 2R9LA 3CWJA 1B5IA 3NGRA 3PNIA 3C14B 4DL6A 2J9DA 4Y2CA 1MW7A 1Y4ZB 2KLFA 3TCGA 5L1IA 5HROB 1YBUA 1T05A 2DNNA 2YKOA 1D3KA 5B0DA 1MXWA 2FB0A 1MY0A 1XR5A 4YUDA 4ZCLA 3IB0A 2C3YA 4DQQA 5KAKA 4YMEA 3OVAA 2YWWA 1SQFA 2XZTB 2DVZA 1B4HA 4JWOA 3A1YG 2GQ2A 3D3CJ 4ED4A 2Y3YA 1B3LA 3UA8A 3FEYB 4ZJOA 1ACMB 2I4CA 4MMOA 3EXCX 1VQ7S 3I9ZA 1NLKL 5BR8F 2HK2A 5A8KB 2VC1A 2DRDA 1ZZFA 3R7BB 1R0AB 2WOMA 4MJKA 1NK9A 1YTVA 4ZEFA 1JVYA 3WZ0A 1NNDA 3TOQA 4R2BA 3IC1A 4QR1A 3RRGA 3W2WA 4WP3A 4X1DA 2UUCJ 1S76D 3JSMB 4C6AA 4R8UA 4C3MA 3TZAA 1JLQB 2WBBA 1KP6A 3EWGA 1UVKA 2DEJA 1RCOB 1O5JA 1M5OC 4C8OA 2F5GA 3IRXA 4EBDA 4OI1A 3SERA 2OPQB 2CQ0A 4DL0C 2BJJX 4NMLA 4R6HA 2GH9A 2GCFA 5THWA 3EGVA 1MMDA 2LAOA 3D3BJ 1WKKA 2EKNA 1SH2A 4POXA 2KYZA 2V67A 1D9FA 3SEVA 2HNDB 1NNFA 2DNGA 1D9DA 4JWXA 2YNHB 3JXOA 3FZVA 3SV3A 4WBFA 1XR6A 2WVCA 4DN0A 1UZHA 5L1JA 4IO2A 1K9MT 3EDRB 2R71A 3P5BP 4ATNA 3IR6B 2ZBIA 3Q8VA 2ROGA 1SJ4P 1MQJA 1T7PA 3HKZD 3DDNA 3MFIA 1U8SA 2KYXA 4G6VB 3GG0A 1RWWB 3FEXB 4EO8A 2JEFA 4IGRA 4DF8A 3GFHA 4N5SA 1MM7A 3B7DA 5EQ8A 4IFVA 4DR1F 4NYPA 1B0TA 3NEKA 2OEKA 2K8GA 3MM5A 4ECUA 4PF6A 1RT6A 2LMIA 3K17A 2L9WA 3MP6A 4F1UA 3IRWP 4EEYA 5LMNJ 5JEIA 2FVZA 4IKAA 2YTCA 4CLUA 2R7VA 2HVEA 2DO0A 2QJEA 3A3CA 1DTQB 3GTYX 1YDLA 4IO4A 1N6QB 5CYQB 2AGOA 2AHOB 4A8KA 4U96A 3OEMA 1X4BA 3P4UB 3H03A 3MQ9A 5HANA 2XWYA 5IC4B 1SKRA 2NSBA 1UVIA 5AA4B 1MH4A 3HPOA 5I3PA 4HYKA 5M2RA 1HBUB 1JW4A 2F8HA 1S50A 5D8HB 2ZNTA 1M5KC 1HWIA 1S97A 4KV8B 2IEEA 3G3FA 4HE2A 4J9SA 5JMNA 2G0JA 4PUOA 3W7BA 1S48A 1N0UA 2HQ3A 3NAHA 3T9NA 2AF6A 3ECRA 4ZMMA 3DLNA 2ROPA 1Y1ZA 4HTIA 1C1BA 3Q27A 2VASA 2YNGB 3SZ2A 3A13A 3H4DA 1FPLA 1EETB 3TCFA 5J2MB 1HYSA 4NF8A 3TAPA 3FV1A 4WP8A 3TZXA 4PF8A 4X64F 1N4LA 4NLGA 2VFSA 1B0VA 2XBPA 3KK3A 3NWRA 2EXUA 5CBSA 4GOTA 2NS1B 4WXJA 4D3HA 3GXAA 2B5JB 3EVWA 3RZAA 3SXLA 4G68B 2O5DA 3UO0A 3D2WA 1M1GA 4KGZB 2C22A 3T9VA 2XD3A 4P0IA 2Z8EA 3H2UB 5KFLA 2OK2A 3ZXWA 2LQBA 4WKYA 2DGUA 4ZK7M 5EQ9A 1X5TA 1Q35A 5KFPA 1TFDA 1Q5YA 3HHLA 5HO4A 1C1CB 1TL7A 4B3RJ 2MEWA 3KHHA 3PRBA 1URRA 3THVA 4DXUA 2V5HG 4KGVB 3G82B 3MPLA 4OYIA 1M0SA 3UNYA 4DSJA 3N94A 5T41A 2C2NA 2KH9A 4WZQA 2PT2A 2QLBB 1IWAA 1VJQA 1IR1A 3H4ZA 1WODA 4F3SA 3TP2A 5EUHA 2JJKA 2MZ1A 1CJUA 5LTCA 5DJBA 4NLPA 2ACMA 4H5GA 2NXNA 4I2QB 4F25A 3N6LA 3VQSA 1U4BA 1SW5A 1HA1A 4IYQA 1UA0A 3JYTB 3FNNA 1Y5LB 3PEHA 5AE1A 4N47A 1WI6A 3QWUA 5C42A 3KTQA 1FJCA 3VVEA 3DM2A 1XN9A 4UW2A 1S6QA 5TP9B 3Q26A 1RT2A 3HULA 3TARA 3H6WA 3T3FA 3VVDA 4GVLA 2M0GB 4E0WA 1U45A 4WEDA 1CNQA 3H5SA 4RUBA 4RW6A 4HTJA 1R9LA 2XCPA 3FMBA 1N7XA 3K5OA 3P45B 3J81j 2EWHA 3S9MC 4XPCA 1MU2A 4QOTA 3M05A 3UVJA 3GQCA 2OWZA 2PE8A 4GKJF 3NS7B 2YXLA 1Q8IA 3HMJG 2MQ8A 1UL3A 4JI4F 2NUHA 4UF4A 4OVQA 5GVQA 1N84A 4LQ9A 1MPDA 2VPXB 2LLZA 1TK8A 4B9LA 1RKJA 4PFUA 4IRKA 4OQOA 2IM2A 1AL3A 2L9NA 2FZGB 1FJ6A 3IX1A 4OVJA 1J27A 1F9BA 1MSWD 1IBCB 4M63A 5DT6A 3MMCA 4FYXB 2HGNA 3ULHA 4LVNP 2HHUA 2JLEA 2FJXA 3I0SA 4G77A 5HBMB 4MNIA 3NXZA 2AJ1A 2PEBA 3WX8A 4X62F 1UMJA 3ISZA 1IBLF 4PAIA 3H20A 1P8GA 2SXLA 1RWNB 3FRYA 2UVGA 3DOMB 1BQMB 3HFZB 4HT7A 3S7RA 4PDHA 3BGLA 3TEGA 1B1HA 2H48B 4DPOA 1DFDA 4LF7F 3D66A 3T9HB 3K5NA 3I5CA 3OD7A 2DGOA 1GR2A 1ZH5A 4EYIB 2MZQA 4F26A 2XMWA 3WQPA 3U72A 2CZKA 1R6ZA 1QJHA 4G65A 5KFSA 3IWNC 3CF5Q 1FDBA 3CMQA 4G61A 1TZ0A 2XM3A 4W4MA 5TPAA 1I51B 1MXZA 5T14A 4KE5A 2BJIA 3GIRA 1LLSA 2MHEA 2Z2ZA 4YHHJ 1U6ZA 2O1MA 2HZAA 3RR8A 3LP0A 3MZIA 2D3ZA 1MQIA 3IOVA 3IO4A 3RBDA 5GAEU 1XVYA 1JP4A 5DS7A 4YMBA 4ANDA 1OS5A 4RA1A 1RT5B 4WWSA 1JLEA 3CCES 2I1RA 2ATCB 1ZZNA 4M95A 3CFZA 4CLSA 3KFMA 5EHSA 1EARA 2KL8A 4OENA 3KFWX 3H98A 4ANCA 4DG1A 5A8WB 1MXXA 2Y1JA 3IG1A 2UUCF 3FV2A 5ETOA 3C19A 4JV2A 3MD3A 3TO8A 4ES1A 2CXEA 4Y34A 3CCWA 3NOGA 2M4MA 2ATLA 1FDAA 3JTOA 2R7TA 1PYOB 1HNIB 1P1LA 4Q8EA 3B50A 3QO9B 3TX8A 3RUBL 4NF5B 1FFWB 3BJYA 3W15C 2BE9B 3OSNA 1QTMA 5HJYA 2ZWPA 4J37A 5L8RC 5H8FA 3IFAA 4K5SA 4GRSA 4KH0B 4NA3A 5H9FJ 3MM6B 4IG0A 1B5HA 2XWXA 3AD7C 1MWZA 2V2ZA 2GGPA 2VG6A 1S59A 4FBPA 1S7HA 4OYPA 2RT3A 5LT5A 3MCNA 2GS8A 1RDRA 3VLWA 2R42A 1MNEA 2Q2CA 3IAZA 2VONA 1VRUB 1CSJA 1A6LA 1O6XA 1F3VA 3H7HB 3TZYA 3C6TA 2RD5C 4L3NA 4CCHA 1H73A 1FTOA 3LA0A 5T7LA 1HMVA 4USWA 3MOJB 3B4DA 2DHGA 2QSWA 2P9EA 2DBBA 1LBBA 3BS9A 4X4OA 4WZMA 1D9YA 3QFWA 3MECA 3J7YI 4I3EA 3LGHA 4OX8A 4ILRA 3W9VA 3UE2A 4THIA 2Y7KA 2XY7A 3QT6A 1LGBC 5IZHA 2EBEA 2BQUA 5L39A 1Z2ZA 3I56S 2HCAA 3G8QA 1K0VA 2BM1A 4YDXA 5E3QA 2UXBJ 3ENQA 1GMWD 4L73A 4BDMA 2LDYA 2C2DA 3K7RA 2R8GA 1AW0A 3SQGB 2BANA 4FXDA 1WEZA 2QVUA 1FD2A 3LANA 2WVFA 3V4IB 1UVMA 2XB2D 4JVIA 3OO8A 1N3XA 4DXCA 4YZZA 2ZZVA 3ZKLA 2IPOB 3FBFA 5SUHA 3OSQA 2HFOA 4E8UA 5DLGA 1VRQC 1IWGA 1T94A 4GX6A 3HT0A 5AE3A 5KFOA 4YB5A 1H2VZ 5C25B 4OZ2A 2OAUA 1F5CA 3PXGa 3ZNJ1 2J6UA 3KG0A 4FBUA 2F8DA 2ZBRA 1LW0B 1FKOB 2KG1A 2J7KA 3Q0AA 4J9PA 3AB4B 1NZ8A 1B6HA 3EKIA 4BHQA 1T9UA 4B08A 3TYHA 2FJAB 1DQ8A 5CHCB 5FHNA 1S79A 2HLUA 3R5DA 5AXNA 4U22A 4CNYA 1XC9A 3UN2A 4NF6A 3BBBA 5IV3A 3F41A 1AXQA 4LSNB 4PQAA 4L3KA 5HVGA 3HT3A 1UTHA 3VAJA 5J16A 1I5OB 3NGSA 3M32B 3VFJA 2DGSA 4UA8A 5LL6d 3CI8A 3LTOA 3RBEA 1FPJA 3OTEA 3MM8B 3DRXA 5DG8A 2ZH4A 1QKAA 4OI3A 4B3RF 3RJMB 3L3CA 2QS3A 4NCBA 2VT5A 5BYSA 4U4XA 4O44B 3M9MB 2DWAA 3O6IA 1IKXA 1S49A 4M5IA 3RAMA 3W9HA 4JI0F 3DLHA 2B4UA 4FP9A 3GCWP 2ZKTA 1P27B 1T3NA 4GWUA 5H1SV 5BYQA 5IQQA 2BJ3A 1N7WA 4DPYA 3TQEA 5HATA 1XNQJ 4RWWA 4Q0BB 1TU0B 3K6XA 3SCLE 2RS2A 1CJVA 4NWDA 1MN9A 3EN3A 5D0EA 4NYOA 5E2QA 3K1MA 3IGVA 4XO0A 5AA2B 2YX7A 4NX1A 1N32J 2UU9J 3CFLA 3SESA 1OQ6A 3KNGA 5F8GA 1SI1A 3N5LA 2NLWA 3CRBA 2FVQA 1AIVA 1S9TA 1MPBA 2HQCA 1U1NA 2E1CA 4LF9J 3DI6B 4DV6J 3MEEB 5ET8A 5EQ7A 4G8MA 2F6GA 1WF1A 2O7IA 4HR2A 3TANA 3VVFA 1B05A 3UD5A 5I2KA 3CTRA 2B9EA 3FSIA 3U93A 1O64A 2G2ZA 4GRKA 4F0MA 1PJ6A 3PW5A 6FDRA 4IOBA 4ER8A 1PGZA 2ZH1A 5L1KA 3PM9A 1SKUB 3SKPA 1FEHA 3BF4A 4NF4B 3W9WA 4PWDA 1HBOB 1SI0A 4O8MA 1JKHB 3SEYA 4DI4B 2R7XA 4N41A 4NLDA 1K0TA 2W7AA 3ZZOA 1Z1ZA 1HSEA 4J90A 3VVUA 4GWXA 1MH3A 4PG7A 3C4MA 5KG5A 5L38A 2IYGA 4HI1A 1Q95G 9ATCB 2H65B 4CM0A 1RWKB 5AJ3J 4P9SA 4CO5A 3HCQA 2PO4A 5ET5A 2CZHA 4C8ZA 1WC1A 4L74A 1AROP 3JSRA 1M1HA 3CCJS 1REVA 4RPFA 3LW5C 1SYHA 3IO1A 2YKPA 3HJVA 8ATCB 4RNOA 3OHAA 1RDXA 3CMAS 2CJYB 4RW4B 1NCLA 4ELPA 2DO4A 1SVDA 2RHSB 4ETXA 2CEXA 5I56B 2ZOFA 3HCXA 3TKDA 4OFOA 2F36A 2ZBQA 3JSBA 4GF8A 4MMPA 4N76A 3VWSA 1X9SA 3AJ2A 4QPTA 4YHHF 4CLPA 4U95A 3BGRB 3TRGA 3JS9A 2QL3A 2HYIB 1RTZA 2HFUA 1E6VB 4EUVA 1ZETA 1L3TA 3DMJB 3OTDA 2JC0A 1VRTB 2EEYA 2R7UA 1VDWA 4LONB 4H45A 4KHRA 4CYUB 2VL1A 1DTZA 1S9EB 3W8GA 1U1RA 2J9CA 2GHBA 2XC9A 2DWJA 4WEPA 2D3IA 1Z4UA 1LAGE 4MLVA 3V6DB 3VR1A 3JQJA 3NGTA 3RG6A 1RTDB 1EIYB 4DFMA 3DLBA 3UN6A 2LQ5A 8RUCA 1J5EJ 3Q8SB 1HWKA 4YOEA 4MKYA 4JUZA 3R5JB 5DG7A 1WHVA 1JJ4A 5F8LA 4QWDA 5EYHA 2XXUA 2K7JA 1KZ8A 1IM6A 1NDKA 3T9XB 1LEVA 3MTJA 2GQQA 2J5AA 4P2FA 2O68A 3VAFA 4R5PA 3PD8A 5KOWA 4LF2A 4B9VA 4PDDA 3LUZA 2VJVA 3GV7B 2HHQA 3MMAB 1CC8A 3M9NB 4QU6A 1X5SA 4O23A 2WX9A 4R2FA 3MR6A 4JSDA 2GHVC 4CO1A 1RE1B 1TUWA 1UVLA 1WKLA 2IJNA 3A8EA 2CNOB 3I6VA 4XDDA 3OO7A 4RPNA 3EVOA 4ZVQB 1VYAA 3T19A 4I64A 2HVHA 2YWFA 2K06A 1FBPA 1LQ9A 5C24A 4ECRA 1FPBA 1SKWA 1PJ7A 5AA1A 3GIJA 2X7PA 3SETA 4J9LA 2DGXA 2ZZTA 3NY0A 3GJSB 4DV7J 4ZIVA 1VK3A 3IAM9 3RBZA 2KDOA 2BUNA 3AFGA 3IR1A 2R9JA 4LF5J 1ZBTA 2OPPA 2LP4A 3VXBA 4DQIA 2AU0A 1IEJA 4WFBQ 4PWUA 3OUYA 4BDPA 5HSPA 2DGVA 1HWUA 3M2VB 3AJ1A 1CULB 4OHNA 3K0VA 2YH1A 1RLCL 1NSQA 3L7UA 1IZ1A 2UXBF 2RCAA 2DNPA 3J81U 4QQBA 4CLKA 3LO3A 5K8PA 5HAOA 2I4BA 4URGA 1YI2S 1HQUB 1RTJB 5KFEA 2BKNA 4ZZAA 5B08A 1HD1A 1FBDA 2J0XA 1NUXA 5I3UA 3VAGA 3MJNA 3FASA 1H76A 3ZTPA 1V9OA 4ZCMA 2EFVA 1VK8A 4O3NA 2BA9A 3THTA 2KM8B 3EHSA 1FKPB 3NCQA 3C6UA 2JFKA 2DS9A 1IKYA 1F2HA 3U65A 3QIDA 2H5EA 1SI9A 3ILTB 1EU8A 2ZYNA 4ZITA 3BBFA 3I0RA 2OIHA 1LOUA 2R7QA 1RT7A 1NHKL 4WXOA 2G9OA 4OANA 1VIOA 4NXMJ 2FHJD 3M2RB 2GA7A 2V8GA 3AOAA 5G0RA 1I6QA 1V5IB 4NQ8A 1GV8A 4P73A 2QS1A 5ITPA 5E3CA 2WSFC 4ZLLA 4R72A 5KOXA 3CT9A 2AEFA 3G4SS 4OZ9A 3G8SA 3N6MA 4NWBA 1CJKA 3TVKA 5I2NB 1Q81T 3EZUA 3BFTA 4H4MB 2AZ1A 2VD2A 3PMXA 4P7TA 2ZZNA 3D5MA 3IMQJ 4KKOB 2CWKA 3KJTA 1HWJA 3BYRA 1JETA 4C3KA 1KD1T 2FLOA 5A0YA 1FTRA 1LEOA 4F1YA 2V34A 2CQ4A 2RU3A 1MPCA 5ETQA 2HAUA 2L9DA 5IZ3A 2PDAA 2AIRB 3H5YA 3GONA 2E1AA 1WNEA 1S72S 2EI5A 4JI5J 1G4CA 2PGCA 2F8MA 4DN9A 2P3NA 1R6YA 2V50A 1BMQB 1IBKJ 3B6TA 2NUVA 4GWYA 4QW8A 2WTFA 1Q8KA 3QGPA 1F2GA 4GL8A 2A6OA 2IC3A 1W2IA 4DLDA 2WSEC 2JRSA 1FBGA 4DSLA 3MWBA 5KT5A 1LWFB 1S6PB 3FVGA 1VHFA 3LUYA 4JYAJ 5EDWA 4R0EA 2I8EA 2W2NP 5AXLA 1TKXB 3GSIA 4JSOA 2B56A 4ZHRA 4YN3B 1C0TA 2UVJA 1NZAA 4I69A 4DZDA 4LRFA 1XNQF 3IL1B 3QPIA 4TKTA 4GC6A 1ELOA 4QWAA 2FJBB 3CDEA 1S9GB 5ICTA 2BKPA 3ZTOA 4MFIA 2MQMA 2JLGA 4X4QA 1N32F 2UU9F 1UEUA 2GJ2A 4MKVA 1WTBA 1LXNA 3H7MA 1JNZB 2J8SA 3B6WA 5K5MA 1NV1A 2CUYA 1JXLA 3KK1A 4LF9F 4NLRA 4IDKB 1U8WA 4EYHB 2VFRA 2FDNA 3IM9A 5KFRA 5HMZA 4EZ6A 2AJQA 5B0CA 4GXSB 3GYYA 3GFZA 3BGUA 2HMIB 3IJOB 1YG0A 2J9DE 3IAS9 1NK6A 3BSCA 2MHNA 4G1QB 2YX4A 2OPSA 3OHBA 1O63A 2H98A 1IMBA 2ONKE 2I49A 5I59A 1ZTYA 3GYNA 3R7XA 1ZAVA 5SZTA 1BP5A 4OI6A 2X1BA 2B4MA 3KUEA 3P8BB 1LB8A 4RW9A 4ZE8A 1LWCA 3GV5B 4U7CA 4EU0A 3E01A 2IM1A 2PFDA 2D3OR 2EC2A 3THPA 4ZVEA 1WACA 2AL4A 1N54B 5AJ3F 5H8HB 3PU5A 4G1PA 1IKVA 1SL1A 4HHUA 3TNVA 3LP1A 2HQIA 1KVIA 4JI1J 2D3O1 3MVXA 3S9LC 2XMUA 2F34A 3UP9A 2NXJA 5KFUA 5HROA 4IG3A 2ZYKA 5K20B 4M94A 2P2AA 4OX9F 3M7VA 4PXDA 5LJ3Y 2JSXA 1PDAA 2HKEA 1A8FA 4ZS9A 1NPKA 1VQMS 3CJKB 2F65A 4XTTA 4YKIA 2AV5A 3I5AA 1MROB 3OTBA 3TWZA 1M5FA 2KB2A 2EK1A 2BRKA 3PRVA 1H2TZ 4LZ7A 4F7VA 5A8KA 1FO1A 3FQLA 4U67Q 1LBZA 1R0AA 3A3UA 1XT8A 4PG5A 5ETTA 2XLKA 3JSMA 2M2BA 3Q8PB 5L9OA 4I3YA 4KPCA 4RUCA 4ELTA 1HNWJ 2K3KA 3BR8A 1OMPA 3K5MA 1YTYA 4EBCA 1MRPA 4GX3A 3S1TA 4ZDNA 4MNCA 2OPQA 5KFAA 4X4TA 3FC9A 3O66A 3RYLA 4NEDA 2EFGA 4QRZA 2V8PA 2R2RA 3PG9A 3FXUA 2BMBA 4H4OA 3J80U 4R9GA 3D4CA 2ERRA 4O0NA 1IMEA 1K44A 4GVBB 3JQKA 2PIIA 1FTMA 2H5IB 1FRPA 1QTNB 1KLMB 2HNDA 2VKRA 1CVJA 4K4ZA 4OXVA 2AJFE 4OV1A 5KFQA 3TEHB 4FF1A 3TA1A 3T96B 1T03B 1VFJA 4I1DA 2PMSA 4RZRA 2Z22A 1PBQA 5L9SA 3M6WA 1MQDA 2AP6A 3TAQA 4ID5B 3MVYA 1MWYA 5I58B 1BD6A 2C2RA 2XD2A 3G8TA 4YB7A 4BDQA 1RAEB 3CJ3A 7FD1A 4CDIA 5ISUA 2GJIA 1PIEA 2KU7A 1EQMA 3PHTA 4LR7A 3TAJA 4DV5J 1DQ9A 2VOZA 2YPZA 4YY3J 1LBXA 2RU9A 4DV7F 3PO5A 5J1PA 1H44A 4LA9A 4LF5F 2DNQA 2RS8A 1N6QA 3TMGA 2MQQA 1FPIA 2HHPA 1PAUB 4PC9A 5HP1B 3FFIB 2B4OA 5ELVA 3D0GE 1IR0A 5IKBA 3MI7X 3GSDA 3IOUA 2ZEJA 2B9XA 3KOTA 4GWOA 5AA4A 2AYMA 1U6BA 1F0XA 2HURA 3MP1A 1XQIA 4K8RA 4KYEA 1JQGA 1HBUA 1ZJLA 1DTTB 1DMBA 4UZBA 1WKJA 1XK8A 1B4SA 2B0GA 2W9BB 1RWPB 2RUSA 1KQGB 2ASLA 4MIJA 1U02A 4PKDB 1RWXB 4IH5A 3Q8QB 2R7OA 4FNHA 2AT1B 3BBCA 1KA0A 2VBZA 2ZC3A 2DGTA 3GB0A 2IVMA 1FQFA 4HCYA 2Y1IA 3PR4A 2HZCA