2QMWA

The crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGTINIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQFDYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFDQNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAITTDIKKVIAILETLDFKVEMIGAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prephenate dehydratase
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
total genus 71
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmwA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA02
1LK5A 2QS4A 4TLMB 3IO4A 3UP9A 2F78A 5KZTA 4QFLA 1N04A 1LFGA 2CZLA 3QAXA 4XTCQ 2O1MA 1Y7PA 3EQ1A 3T9UA 3TELA 4EQ9A 1LCTA 4F39A 4YZZA 2JOQA 1LBBA 3CRBA 3AB4B 3OMBA 2ONRA 3VV5A 1MXWA 2V93A 1AMFA 3BKIB 4R74A 3ZKLA 1Y20A 4HCYA 1LLSA 1PB9A 3MP8A 3T9XB 3G3KA 1PC3A 4IO1A 4I1DA 2P9CA 3KN7A 1OLCA 3OSRA 1IXGA 3ZKKA 3W15C 3M3FA 2P1SA 4ZDMA 2QSXA 4OHNA 1LFIA 2ONSA 4QFKA 4GIZA 4QFPA 4KHZE 3LSXA 3PPPA 1R9QA 4RYAA 4R2FA 1B2HA 4DLDA 3MQ9A 3FD3A 4R73A 1N7WA 2RC7A 4U21A 3L7OA 2UVHA 5I56B 2THIA 3SESA 2HXWA 3K2DA 1H3DA 3S9NC 3DC2A 3FXQA 3Q29A 4KCDA 3UW1A 4NMLA 4LQ2A 2PBWA 5JK4A 4H5GA 4H67A 3OBIA 1B1HA 1OVBA 5FHOA 1HSEA 3EHSA 2G93A 1ZU0A 1PB8A 1B5JA 4KD5A 1LSTA 2WKYA 3FVNA 3FZVA 4E0XA 5L9MA 5B7DA 1SBPA 1LB9A 3O6IA 2ZYOA 4BDRA 4DXUA 4QRZA 3S9LC 3ENQA 4NEDA 1BKAA 1ZLQA 2I4BA 2AIXA 5AA2B 1MXVA 4C0RA 5AA2A 4XKRA 5I58A 1B3GA 5JTYB 4BDOA 1FQBA 5JTYA 5CBRA 1FTOA 3OEKA 3G7WA 3T96B 1HSJA 4LATA 4NMYA 3FIRA 2Q9TA 3SEXA 1LCFA 5ICTA 4N07A 4GD5A 4ELRA 1PBPA 1S50A 3RN8A 3PUXE 4F22A 2F7BA 3I6VA 5AA3A 3FV1A 3UK4A 2HFBA 4I8CA 2DE4A 1OQGA 1LGBC 3GLBA 1WODA 2O68A 3OFHA 3TUSA 1TFDA 2GHAA 5I84A 2IA4A 3GXAA 2D21A 3IORA 1NH7A 3N6TA 2ONKE 1FQFA 2UVJA 3RQTA 4GQOA 4U4SA 1B6HA 4QSDA 1BP5A 1GGGA 3THIA 5F1QA 5AA1A 4IO6A 3G3FA 4YMBA 3IBWA 3SKPA 1UTHA 1P99A 1XHYA 4PETA 4OENA 1FW0A 1XVXA 2I4CA 1L5TA 2DVZA 4ZEFA 4F18A 2P2AA 1P1OA 4JB7A 4IGTA 1UJ6A 2VD2A 4BDMA 1P1UA 1D9YA 1LKZA 4PP0A 5FHMA 1XC1A 3OO7A 2OWSA 1N3WA 2Q2CA 5IS2A 2I3WA 3H7MA 3IK6B 2QMXA 1LAXA 1MQGA 2VP1A 3MTJA 4R2BA 3KOTA 2Y7IA 3O6GA 4BLAA 3O9PA 2Y7PA 1MQHA 4XIGQ 3L6GA 1B58A 1A40A 4F29A 3FJ7A 4NTLA 3K5PA 4O3AA 3MWBA 3C4MA 4HCWA 4R9FA 4OZ9A 1UTBB 1MDQA 1NNTA 1UTBA 3V83A 3FJMA 4OFLA 3VLVA 3MAHA 2RCBA 5IAIA 4KI0E 4WKMA 3C32A 1M5BA 5CRYA 4HW8A 4FE8A 2Z22A 2Y7RA 4PWUA 5DT6A 4DCXA 3O1LA 4EQ7A 2DVCA 4ZS9A 2QL3A 3TCGA 1P1QA 4OERA 2REGA 3PPQA 2RKMA 2PVUA 1MY4A 4LZ8A 1B05A 5L9OA 2R71A 3SDFA 5I2NB 5A5XB 4X84A 5I2NA 5A5XA 1USYE 1CB6A 3EPEA 3RTWB 2B65A 3N94A 2XXUA 2UXAA 2O51A 1Y3PA 4GRKA 3IOVA 4G8NA 2PC6A 4P0IA 3CFLA 3E13X 3MVXA 2NVUB 3ZSFA 4FEDA 1JEVA 2W7YA 1Y3NA 2PX1A 1MM6A 3KG2A 4R9GA 1ZTYA 4LP2B 3OD7A 2ZNSA 2QS2A 1YAEA 1ZKBA 1JW4A 3OFGA 2H99A 2PT2A 1POTA 3RTFB 3H4ZA 1USYH 4JBZA 3O29A 2HAUA 3DLNA 1F9BA 3E3KA 1JVXA 3HPIA 3K6VA 3MC2A 3ONMA 2A5SA 2ZXTA 4R6KA 5IKBA 2DQVA 5H8HB 3AAWB 4PFUA 1US4A 3TYHA 3RT8A 2FYIA 4Q0CA 4M8LA 4IO4A 3N0VA 4IO5A 4EXLA 3KJTA 1XS5A 4UACA 3KSXA 4RK2A 4JXIA 2I0BA 4MBPA 2X26A 3C35A 3R26A 4KPTA 1T0KA 4H1XA 2XX8A 3M8UA 3KWMA 4IO2A 5M2VA 3KJ7A 1B5IA 1SVXB 4ESWA 1FCKA 4TLLB 3OO8A 2OK2A 4YU0A 3B7DA 1B40A 1M5EA 1MY1A 4IB2A 1NNPA 1US5A 3HV1A 2I3VA 1B9JA 3K6XA 2DWIA 3FVGA 3QUJA 2E1SA 2RINA 1MS7A 1JVYA 1SQYA 4ZEIA 3G3IA 3TTLA 2QMWA 3IB2A 4JWXA 2OCUA 4GF8A 3QUFA 5HM4B 3PPOA 1YBAA 2DOJA 1GV8A 4OEVA 4KQPA 1MM7A 2A5TB 1LAHE 1Y3QA 2A5TA 3NRBA 2DT9A 2LVWA 3UIFA 1FQCA 1M0SA 3MAMA 1A99A 4YKPA 3D4GA 1XTZA 5CC2A 4R6YA 1XT8A 3EHUA 4H8IA 3DHWC 2XXXA 3KN3A 3HHEA 1UJ5A 4EDPA 3TUJC 4YICA 1VR5A 4JDFA 2UYEA 3FUZA 2OLBA 5L8DA 4NE4A 3HHFA 1PEBA 2ESNA 4N6PA 3K1NA 2F8MA 2GH9A 4MLQA 5FIIA 3IOUA 5CMKA 2QS1A 4ZEKA 3SETA 1GVCA 3LBSA 3N5LA 1S7YA 3TQWA 3HSTA 2F1FA 3I3VA 4ZZEA 4AB6A 2NXOA 2XXWA 2DXRA 2NUVA 1A8FA 3C34A 3S9MC 4GFRA 5H8SA 3LR1A 4LA9A 2BJJX 2RQKA 5JJBA 3ZS6A 4EUOA 2O1LA 5I56A 2XHDA 4FEBA 3LUYA 1NFTA 3A3UA 5H8FB 1B3LA 3ILTB 3Q25A 2ZYKA 3DP6A 2XXYA 5H8FA 2OBGA 3ECRA 2JHEA 5EHSA 5I2KB 3PMVA 3CVGA 1URSA 2PYYA 1QULA 3F11A 2Z8FA 5I2KA 2ZYNA 1JW1A 3PMWA 1ANFA 2MDAA 1XOCA 2X7PA 3CSBA 4G68B 4RA1A 3RLFE 3IB0A 1A54A 1HSLA 2XXIA 3PU5A 3E9XA 3KFMA 1B7HA 5TPAB 3QYTA 4OVJA 1VE4A 1M5CA 2O69A 1IITA 5TPAA 1URGA 4IY5A 1POY1 3Q27A 4OQOA 2ABHA 1DPEA 2P9GA 3KN8A 3OO6A 4QHQA 4BDQA 5DVIA 1B52A 3KBRA 1VFDA 4XKPA 4Q8RA 4GO7X 1N84A 1WDNA 1OIBA 3JZJA 4R72A 3PV0E 2DWJA 1ELJA 3SEYA 1RYXA 2O84X 3WAFA 4C1TA 1LB8A 1N7XA 4EQBA 1B1XA 5CMCA 3B6WA 2I9SA 1MQIA 1JQFA 2HZLA 3KEIA 3N6UA 2REJA 4PFYA 3V8XB 1OVTA 5AE4A 1YGYA 2I58A 4H5FA 2LQJA 3MP6A 2VD3A 1Y9UA 4G77A 2GHBA 1MPBA 4POWA 2HEUA 1QUKA 3C9HA 3KOSA 2NOOA 5FTHA 2Z23A 1QKAA 2O6AA 4JWYA 3VDFA 1IXHA 3VLUA 1QKBA 2PT1A 4WEDA 5ITOA 3U1OA 1N76A 2HCAA 3MUQA 5K2XA 1UIVA 4LZ7A 4KCCA 3B6TA 1O63A 4NWCA 2Q2AA 1BLFA 1AH5A 3CFXA 3IJXB 3MVYA 2AL4A 4IO7A 3K4UA 4G4PA 1IZ1A 3DP8A 3RGYA 3M3KA 2GFEA 4UA8A 1SD3A 5CM6A 3C36A 2CMOA 3AB2B 1GR2A 1OLAA 2F97A 4YAHX 2HZKA 3ENVA 1SW2A 1IXCA 3CSGA 1QUIA 1I6QA 4POXA 3T66A 1YPNA 5BWJA 2V25A 2V3QA 2VHAA 3TPAA 1ZJLA 3PGFA 3PUYE 1FTLA 3U94A 5JEIA 3EHTA 1N3XA 3GZGA 4F3PA 1FTMA 3IB1A 4F3GA 3D4CA 3IX1A 1SC6A 3T9HB 1UQWA 2HAVA 4PQJA 5TP9B 1OQHA 4X48A 4N13A 1MXYA 5TP9A 4KYEA 1IQ7A 4FJPA 2F5XA 1SW1A 1A55A 5ITPA 2E0SA 3ILUB 4Q30B 3RPWA 1R9LA 4ELOA 2F35A 2F6PA 1DTZA 4GVOA 2P9EA 1BTJA 3MZ9A 2O7IA 3JYRA 4QSCA 5ISUA 3PMXA 4I62A 4QFOA 2R6GE 1PDAA 2R9JA 4LQ5A 1LBCA 4HTGA 1H45A 2DWAA 2XXVA 2H5YA 3O6HA 1B7ZA 4ONYA 3OO9A 4XKNA 3K0VA 2F6GA 3FATA 3PUWE 5CMMA 3FXRA 1MXZA 4ZZAA 3TTKA 3S4UA 3HO7A 4DZ1A 2XD2A 3MZBA 5J1DA 1AOVA 1S9TA 1H76A 2RCAA 1U8SA 1SDXA 2DWHA 4R6HA 3T9VA 1SYHA 3KSJA 4IGRA 3BFUA 3RNNA 3H6UA 4U4XA 3IOWA 5CMBA 3W9VA 5DVJA 5EHMA 1B51A 1KWHA 2KO1A 2XX7A 5H8QB 3VVFA 2B3BA 2NYIA 5H8QA 2H4IA 4U23A 3LSLA 3TEPA 3UA8A 4NF4B 4U2RA 3T22A 1R6ZA 4EXKA 4WXJA 4NF4A 3LOUA 3K02A 4LZ5A 2I0CA 4DE8A 4YB5A 1FTKA 3LSWA 4OESA 3FJGA 2RF1A 1CE2A 1EH3A 4OTEA 1DPPA 4ELQA 4YKJA 3PUZE 5H8HA 3O66A 1DOTA 1PB7A 4F1UA 1IXIA 2F8DA 2FGCA 1NMUA 5H8NB 4RY1A 4U1ZA 3VXCA 4XXUA 2OWTA 2Q88A 4G8MA 1MY0A 4ND9A 1DTGA 1SW5A 5ICQA 4O3BA 1MG1A 3K1MA 3W9WA 4ISUA 4DXCA 3QK6A 4P11A 5B70A 3A09A 3TFLA 1I69A 3DHXA 4H6DA 1MY3A 2VGQA 4I9DA 2V3UA 2F36A 3P7IA 1PSDA 1ATGA 2UVIA 1LFHA 2XX9A 1KS2A 3B6QA 4WEPA 4G8HA 3DDNA 2XXQA 3PUVE 4NF8B 3MPKA 3FXUA 3Q26A 5KCJB 3OELA 4NF8A 4F1YA 1MPCA 3OFEA 3I5OA 3FV2A 2Z8DA 1YTVA 3S2VA 5IT4A 3TKDA 3H03A 1SI0A 2F7AA 1URDA 4DDDA 2AYSA 3G3GA 3O28A 2FNCA 3MZ1A 5F7VA 1PBQA 4GOTA 4YKKA 1D9VA 1B0HA 2DYXA 2DTJA 1MQDA 3PPNA 3UORA 3RUMA 2IEEA 3MP1A 4MFIA 2RE1A 3SEVA 3USDA 4ZEBA 4X1BA 3TTMA 2PA3A 2RC8A 1Y1MA 4C1UA 4F19A 3MW0A 3CI8A 3LSFB 1MH4A 2I48A 3E4RA 3JV9A 4GO5X 2GRVA 1MXUA 5LOMA 1AIVA 3SEUA 3SERA 1Z7NE 4X1DA 3OOAA 3TTRA 1SW4A 2XXPA 3H6WA 4F31B 2PMSA 2V3TA 3L6HA 1ZBMA 2VOZA 4JWOA 1EZ9A 3H6TA 1DSNA 3CR9A 4Z7EA 2ZMBA 3VVDA 3G3JA 4GL0A 4MLVA 1B3FA 3CG1A 4OEUA 2YPNA 3QIMA 1P1NA 3RY3A 1B0LA 3BBRA 4P0GA 2V84A 1B3HA 3U8QA 1TXFA 4DXBA 1Q1KA 3OSQA 5KDTB 4NF5B 3SEWA 1VSOA 5KDTA 3OXNA 4NF5A 4RXLA 3QSLA 2F7CA 4BDLA 1JETA 3O2AA 3BFTA 2M8CA 4OWDA 4NF6B 3UGWA 4NF6A 1B7UA 1R1NA 5T41A 4QFNA 1QUJA 1UJ4A 4ECFA 4H8JA 3KGCA 4G68A 4IO3A 1RWUA 2UYFA 1OMPA 3VVEA 2YJPA 4YB6A 4F3SA 3Q28A 3MPLA 2ALUA 4FORA 1EU8A 4MF3A 1UIUA 4F2OA 3IAZA 4H65A 3T93B 3RT6B 4L17A 4KYDA 3K6WA 5HPQA 1QVSA 4PFTA 1D4NA 3HCQA 4RJZA 1MDP1 2B3FA 5I58B 5I57B 2ZYMA 2Y7WA 1H43A 5I59B 4ZE8A 5I57A 4NWDA 3ENWA 2D5WA 1O64A 5I59A 4F3BA 1JEUA 3S9EA 4JSDA 1TT1A 4QF9A 1TFAA 2OZZA 5ELVA 4G68C 1ZIUA 3GBAA 4RPOA 3FVOA 1Y4TA 2QPQA 2QS3A 1JW5A 1MY2A 3FGSA 1P1WA 2UVGA 2ZHOA 3H3GA 4RPNA 4GXAA 4XKQA 2DXYA 4RK9A 1II5A 1LAGE 5DTBA 1I6BA 3TZAA 5AA2D 3K01A 1IIWA 4AB5A 1M5DA 1YCJA 4U1OA 1UTHB 2DS9A 2HQ0A 4E0WA 2DP8A 2AL5A 4EF2A 3TCHA 2OJTA 2Q89A 4O3CA 1IUDA 4ZEDA 3VE1B 4ZECA 3TUIC 1B3EA 3DELB 2O7UA 4H0WA 4GL8A 5CI5A 4EF1A 3WAEA 3FVKA 3HHGA 1NKXA 1B4HA 3PD8A 4KR5A 3TODA 4ESXA 3TAJA 3DM0A 2ZNTA 2NWJA 4OFOA 4K3FA 1DMBA 2LAOA 3W7BA 3ODBA 1M5FA 3CEDA 1A7LA 4U22A 3IOTA 4IY6A 3U72A 2J0WA 4MH5A 4G2ZA 3R7XA 4PFWA 2KLFA 3S1TA 2Q8JA 1EZOA 2QRRA 1SI1A 2YLNA 3LC8A 1AL3A 3TMGA 2XXRA 2P0SA 4FAJA 4RNSA 3HN0A 1J1NA 3IO6A 1TWYA 2ANJA 3VFJA 1VFEA 3TQLA 1LAFE 3IR1A 3R6UA 1NNFA 1O8BA 4OMBA 2XXTA 3MVWA 3TTNA 1N0TA 2DE3A 5TU0A 1LK7A 2I6EA 4JSOA 3PD9A 3CFZA 5BUUA 3A3CA 2H9ZA 3V5AA 3TCFA 1RYOA 4BDNA 4YKIA 4GXSB 2Y84A 2H98A 4THIA 1FTJA 2QJEA 5CBSA 4R75A 4GLIA 3N26A 3DP4A 3CIJA 4PE5B 1Y4CA 2I49A 3U92A 3IL1B 3G3HA 1NH8A 4Z0IA 3MVZA 3GBBA 1FQDA 1SYIA 4DIGA 3EN3A 1B32A 2XD3A 2RQMA 4FATA 2FA7A 2XXHA 1O7TA 3U7JA 2X7QA 4M4GA 4KYSA 3O97A 4ZE9A 3K00A 3VXBA 2QSWA 4GWOA 4FECA 3TDJA 1XVYA 3OENA 2F34A 2RC9A 1ZPVA 4AQ4A 1H44A 4YB7A 4TOZA 5L9SA 2ZNUA 4OYVA 1B46A 2J0XA 1EZPA 1MXXA 1IEJA 1BIYA 5HBCA 4KFQA 2Y7KA 4F1VA 4LONB 5IT0A 1Z7ME 4FIMA 2H25A 3MBPA 4HS7A 1NL5A 2DE2A 2Z8EA 3V89B 1Y1ZA 3EF7A 4F2QA 5H8NA 1NNKA 4DCYA 4Q5TA 1RKMA 1MRPA 5EYFA 2H9BA 3AXFA 1QJMA 5DVFA 3C33A 5DEXB 1A8EA 2CDQA 2QRYA 1MH3A 4OETA 5DEXA 1I6AA 5DYHA 1GTKA 5FTIA 3TUZC 1FQAA 4GMKA 3M3LA 5AA4B 4X9TA 3K1PA 3IJOB 3OFFA 3U93A 5AA4A 5KCJA 3H6VA 3MJNA 4QSEA 3VLWA 4YMAA 1ZMGA 3UN6A 3KZGA 4LUBA 1MPDA 4ELPA 3K6UA 1FQEA 2G29A 3C31A 5K2YA 1B4ZA 3OEMA 4OXVA 4M1VA 1B5HA 3H06B 1D3KA 4LVQA 2D3IA 3QXMA 1Q35A 3P96A 1QW0A 3FASA 3CG3A 4TQUQ 1JNFA 3IXQA 4OFJA 1WVJA 3PPRA 5FHNA 1MQJA 2DSFA
chains in the Genus database with same CATH superfamily
2YKNB 2R8TA 3UP9A 5LSRA 1MSWD 1NK4A 2J76E 3R2CJ 5GADU 2YWKA 2KDOA 3JSMA 2O1MA 1Y7PA 2VDIA 2Y1JA 4NCAA 3T9UA 3KLVA 2E7XA 2ZC4A 1LCTA 3CJTA 1NV0A 3SFGA 3AB4B 2XY5A 2ZE2A 3T9NA 4W92B 4BWMA 1RDRA 3NG8A 4K7QA 1RA6A 1MXWA 2V93A 5FJ4A 4C48A 1O5JA 4ECZA 4RW7B 5BR8J 4J7CA 4TYAA 3QFHA 2AJFE 3T9XB 4DN9A 4KXPA 1U4BA 4NXMJ 3KN7A 1FWPA 3OSRA 3VAMA 2FJXA 4MNCA 3E8OA 1D8ZA 3EICA 2VU5A 2P1SA 1R8PA 3E3XA 3HF5A 4ZJLA 4X4UA 4GIZA 1FF2A 4QFPA 4OX6A 2NZ4A 3KK2A 2G1DA 2MZSA 2XI2A 1H73A 7FDRA 3LW5C 4OZJA 3UE2A 4DLDA 2IM0A 3OTEA 5EHHA 1YXIA 1N7WA 1RT2B 3T6JA 5J2NB 4U21A 4DR2F 2IVFB 4MK8A 3D6FB 4IQMA 4DV5J 1BWEA 5A5LA 1NUWA 3THPA 5ETNA 2R2UA 3OTOF 2DNOA 4K59A 2E9TA 4XF5A 4CLPA 3AA8A 7FD1A 4GWZA 1QAIA 4IDKB 2PBWA 2ROPA 2YKPA 1SJFA 1OVBA 2ZVSA 4KO0A 2NCKL 1HSEA 3EHSA 2G93A 4MKBA 4OJ1A 4USMA 3FVNA 2PIIA 3MEDA 4WFYA 3HO1A 1RWKB 2XMMA 1OYDA 3PIOQ 1YI2S 3KLEA 1HWUA 3O6IA 4BDRA 4OI6A 4C8MA 3LANA 1S59A 2AJ2A 3S9LC 2I4BA 4FN5A 1M5SA 3JTPA 3DRPA 4A8OA 1B3GA 3FJ2A 1Q7YT 2ZNZA 3OEKA 2CQDA 3VR1A 3AXKA 2MPUA 1KKHA 1ZM2A 2CJQA 4URGA 4YDXA 4MK7A 2HHPA 5IQQA 1NDPA 2MQ8A 4ELRA 4L3KA 1SJ3P 1PBPA 1SH2A 3PW4A 1KWMA 1R7IA 3OHAA 1VR6A 1X4HA 4F22A 1PYTA 4FVCA 3W61A 4ZPAA 2X3GA 4MK9A 5C25B 3SDEA 2WONA 3AXMA 2O68A 2PEHA 3OFHA 3BPDA 4XDCA 2V0NA 2O67A 3IS9B 3KJNB 4DPYA 4OZNA 3FMWA 3WBZA 4IUFA 2D21A 4LBIA 2HGLA 3IORA 3N6TA 1FQFA 4LR8A 1LBXA 4ZVGA 2MKKA 2KQZA 4FDFA 1U0SA 2BR0A 3U1MA 4J9QA 4HI1A 1T9WA 1BUXA 3THIA 3E01B 4OVTA 5AA1A 2CQ1A 2KFNA 3C3LA 4YMBA 2YX4A 1NJZA 1KOOA 1K9YA 4OYZA 1XHYA 2E9ZA 1K44A 2DR6A 2ZZTA 4OENA 1HWIA 1XVXA 4MIBA 2UUCF 1L3VA 4WK1A 2IM2A 2O3DA 4ZEFA 4J5OA 4F18A 2W9CB 3MD3A 1PAEX 1YK9A 2P2AA 1P1OA 1JLCB 4JI8J 3OL7A 3J81U 2VD2A 2M7SA 1ZA2B 4A8WA 1LKZA 1R6YA 5FHMA 2ZD1B 1URRA 2OWSA 3R7SB 1BD6A 3DI6B 2Q2CA 4K4WA 3LTOA 3H7MA 4NLUA 3B8HA 3IRWP 3OVAA 3IK6B 3BQ1A 4PAKA 4IG3B 3GCWP 2ALYB 2BDPA 2JLFA 1Q8KA 4MKAA 2BE2A 1WEXA 3RYLA 1VRUB 3KOTA 1FCAA 2Y7IA 4TU7A 2V4RA 3KMQA 4BLAA 1XMQJ 3FSIA 3O9PA 2HHXA 5KFHA 3L6GA 3VWSA 2FVZA 1YJTA 1RKIA 4KRWA 3X1LB 1KVKA 3CCVS 2LMIA 4DPXA 4N17A 2WTFA 4O3AA 1NV7A 3TANA 4QYZK 3M4XA 4DU8A 2CRLA 3T5LA 2BRKA 2AYGA 1MDQA 4WFZA 4LF9J 1UTBA 4OFLA 3VLVA 5KFUA 4KI0E 3KMSA 1M5BA 3RUBL 1WNEA 1VC0A 4HW8A 1REGX 4FE8A 2Z22A 4PWUA 4PXBA 3AQPA 2QA4G 1XERA 1FWLA 5D4LA 4ZS9A 1P1QA 2CQ3A 4DQRA 2REGA 4JI2J 1DFDA 3M6UA 1B05A 1WC4A 1O0PA 2WB1D 2R71A 1JB0C 2XNQA 1FE4A 4GWUA 1BY9A 5A5XB 2HNYB 1UMJA 1B7YB 5I2NA 1RACB 2JSXA 1CB6A 1EX8A 3RTWB 1IXKA 2B65A 3A3PB 1Y3PA 1IBMJ 3CIMA 1TP7A 1UW9A 3HSZA 4O0IA 1DRZA 5F41A 2IY5B 1NUZA 1KTVA 4OHXA 2DB1A 1NV5A 3OXLA 2YX7A 1MM6A 1WUUA 3KG2A 2MZQA 2CNOB 3BEGB 1UA1A 4DXLA 1RT1B 1ZKBA 1S4FA 3G8SA 3G82B 1SPBP 1FJ6A 3HVTA 4ZHRB 1NBEB 4ICLA 2ZKUA 3DLNA 4DV7F 1DLOB 2EK1A 1KBRA 1NAQA 1N6QA 5IZ3B 2XQCA 4ZVEA 4R6KA 2B7CB 3M8PA 1VC5A 1RI7A 2YWFA 5I3UB 5A8WB 4M8LA 3TP2A 4PAAA 1Z4UA 4IO5A 1IQZA 3MUVP 4RNOA 1NV6A 2Y9HA 2UXBF 4CM2A 5LDZA 4RX6A 4JI0J 5KFTA 4PGNA 2X26A 1S4EA 4K0KF 3C35A 1IR2A 1VQNS 1IMCA 3A4TA 3ROJA 1IWAA 1EHWA 3FEZA 2MY8A 4IFYB 1TVRB 5THWA 2Z57B 2DEIA 1UVJA 2HHTA 1RADB 3TARA 3PZPA 3OO8A 1WKKA 3M2VB 3LA0A 3B7DA 1B40A 2RDJA 3NS5A 1E6VB 1B0TA 3G6ES 2I3VA 5DETA 5DG7A 1B9JA 1OPIA 4NXNJ 3IBCB 2NSCA 1JVYA 3TJ8A 2PGCA 2E1CA 1HWKA 3SZ2A 2XZWA 5DJBA 4GF8A 2Z30B 2J6TA 2ZC3A 3NCRA 2CQBA 1X9SA 4OEVA 1URNA 3NBPB 2DD8S 1LAHE 3K8WA 3BBBA 1PJ5A 2CNNB 4M63A 2E1PA 4OVPA 1IMEA 2V68A 1HMVA 2LQ8A 2DT9A 1XMBA 1FJEB 3M6WA 2LVWA 2F9JA 1M0SA 3OVSA 5LJ5Y 1YKWA 1X9MA 5EX3A 2I8EA 4YKPA 1NMEB 4H45A 1C0UA 3F44A 5HBMB 3R7NB 5CC2A 4M5LA 3EHUA 2BW7A 4E8UA 3L9ZA 2C3YA 2FJEB 5B0DA 3HHEA 1FRHA 4EDPA 2ZH1A 3TUJC 5L1KA 2N3OA 4YICA 5HJYA 4JDFA 2PI4A 4KY3A 4MFBA 4KKOB 3D0HE 2SXLA 3FUZA 4RBVA 5HATA 2NYHA 1CC7A 1KLMA 2GH9A 4QIWD 2OEJA 1FFSB 5FIIA 4CLLA 1ACMB 5CMKA 1RWVB 4ECXA 3LGHA 4WIQA 4UABA 1SCJB 3DGPB 3C6UA 4Q44A 1U47A 3G6XA 2RH3A 5KFLA 4ZPDA 3P5BP 1WG1A 3I3VA 4AB6A 3MM8A 1SKWA 3C34A 2W2OP 4CT9A 1SH3A 2WSEC 4LA9A 3UCGA 1U45A 5DG9A 3ZS6A 4DFMA 5I56A 3QAEA 1PJ7A 2OTJS 1HYSB 5HI7A 1F1BB 2FJAB 5H8FB 2OPRB 5IM0B 4Y2KA 3VTIA 1Q9DA 1T0TV 3TQ1A 2ZH7A 1GMWD 1QULA 2RB7A 5I2KA 2WVEA 2PA8D 2HVDA 2KI2A 1JW1A 1RT3B 3CCZA 3PMWA 4ZVSB 1TK8A 4EBCA 2DHAA 4C3KA 3IB0A 1A54A 2LDYA 3K59A 5TPAB 3I82A 1C4CA 3DRRA 4OV1A 2YWHA 2BJIA 4IY5A 1POY1 4F67A 4PF6A 4LSNA 3PX4A 2HEKA 4X4VA 1XR7A 4XKPA 2A6MA 2KZMA 2ZBQA 1KZ8A 4MTPA 1MMLA 1WDNA 3V2UC 3GPAA 3PV0E 2FDNA 3SEYA 1PJ6A 1RYXA 2O84X 5HLFA 1Q78A 3RAXA 1TKZB 1B1XA 4KHRA 1FRPA 2JDJA 1MQIA 1JQFA 2HZLA 3KEIA 1SB6A 2M8HA 5F8JA 2IC3A 3KK1B 3QYYA 2IBOA 2XM3A 2ZH2A 1ZH5A 4PKDB 2B9WA 1VK3A 4NLYA 1KOHA 4G77A 4DV3F 3CCSS 2GHBA 5AXLA 1CJVB 1F9EB 3UI3A 2GFFA 3KOSA 5FTHA 2NR0A 2Z58B 4MYUA 4DR1J 1QAJA 4WZMA 3VLUA 3B6BA 4L72B 1S9EA 5ITOA 1HNWJ 2AYBA 2D9OA 1TKXA 5AJ3J 2C1EB 1NSKL 1R0AA 3GU0A 1AH5A 3MR6A 4CH1A 3W8PA 3BH7B 1BGXT 3T1BA 3H25A 3GIMA 3Q24A 2BJDA 3PW2A 3MVYA 2D3O1 3Q86A 3H2UB 4ZLJA 4PG4A 3W9HA 4F4YA 3RGYA 2XMKA 3S6EA 5CM6A 1XC9A 3C36A 3J7Z5 1SXLA 4HKQA 1EB0A 2E44A 2G1HA 2BQ3A 4ECSA 3CSGA 4PDDA 3F41A 2XWXA 3T5KA 4Q2LA 4X65F 4K4SA 1YPNA 3BKFA 2P3VA 3DKDA 3MFHA 1IUJA 1ZJLA 3PGFA 1FTLA 3U94A 1CSJA 1OSDA 3KJFB 2CNLB 2IYGA 4F3PA 3BKUA 2B8PA 3D54A 4DJBA 3EGZA 4F3GA 1W7WA 1SC6A 1EQ0A 4RNMA 2LEPA 4CI0B 5TP9B 1OQHA 4YOEA 1ZTTA 4N13A 2NPFA 4OYBA 1U1KA 3DYAB 1GXLA 2CVIA 5D0GA 5HL7Q 5ITPA 3DRYA 4OVRA 2HWIA 3ILUB 4OZ0A 4DI3D 3T41A 2F35A 2EWHA 4LVOP 2BXJA 9ATCB 4ED7A 2VICA 1FBEA 3JYRA 2WK4A 4NN3A 1VQ6S 2HVIA 1PDAA 4DV6J 4DG1A 1RHJB 3OR2A 1FBCA 3O6HA 3P5TL 1RTJB 4XKNA 2F6GA 5F9NA 2KJVA 2GQQA 3OR1B 3PUWE 5CMMA 3MF5A 1UP1A 3EKIA 4MIJA 2BVZA 3S7RA 1IBCB 4DZ1A 5H1SV 2FIEA 4HDGA 1AOVA 1O51A 5DDRC 2WHOA 5KFDA 3H2LA 4USJC 1U8SA 5KFKA 2WX9A 4N81A 4IGRA 4C0OC 4DV1J 4EGLA 3BFUA 3G8QA 2GA7A 4OX9F 4ZJOA 1SL1A 4QCLA 4O4RA 1U1PA 1S6QB 2RJZA 5DVJA 2ZM6J 1RAGB 3HVWA 2R7QA 4PBHA 4AL6A 1X9WA 3VVFA 2MGZB 5HROB 2B3BA 2VG6B 5H8QA 1TKDA 1CS4B 1O6XA 3UA8A 3RRHA 4NF4B 2R8GA 3LP0B 3K02A 4LZ5A 1IBKJ 2I0CA 5EX0A 3JQMA 1V5IB 2A18A 2FZGB 1S1WB 4HH0A 2DXDA 4DS5A 2W01A 4OESA 4AQYJ 3MCSA 1TAQA 3JQKA 1QAXA 1CE2A 5D4NA 3VZIA 1ZZFA 3MCOA 4ELQA 4MJOA 4YKJA 2NPIA 3PUZE 2C2DA 4L76A 3O66A 3HP6A 2D3UA 1JQGA 2DXEA 3CC2S 4JV1A 3KHHA 5IZHA 1FDBA 2WBBA 5DZ7A 2VC0A 1S0VA 2BMBA 1EZZB 4LF5F 5H8NB 4XXUA 2OPPA 2CA9A 2UUWA 3C16A 5EQAA 5I42B 2GIRA 4IH5A 4TY8B 4I7FA 5ICQA 1QVFR 4O3BA 1MG1A 2IM1A 4O7MA 3R7BB 4I9DA 2V3UA 2F36A 1ATGA 2KM8C 4J37A 4DLGA 2HBZB 2AYMA 3CC4S 2PMWA 1VHIA 4F1YA 2D3ZA 1X5TA 4OJGA 1S99A 3J7A1 1UW4A 1DBZA 3M8QA 5IT4A 3MEGA 4DQSA 2EEYA 4ALZA 4EK2A 1Q81T 2I5JB 2F7AA 2OX3A 2AYSA 2IMWP 2KT5A 3V4IA 1CPZA 1PBQA 3JYTB 2W2QP 1ZPWX 2E9RX 1X31C 4PC9A 1RDXA 1ZAVA 2HPGA 3BQ2A 4IG0A 2IEEA 3MP1A 4F25A 2C2RA 1I5OB 3USDA 1FPGA 2C42A 4PG7A 4PR6A 1F5BA 4F19A 2V5HG 2Q8MA 3JV9A 2H3EB 4QIFA 4JYAF 1MXUA 3ONQA 2EFGA 2MKHA 4DDFA 2WB4A 4L6V3 4Q7AA 3SERA 1WACA 2MZTA 4I2PA 1Z7NE 2EXUA 3RBDA 1CQMA 4ATNA 4L73A 4YY3F 4F2RA 4AL5A 2MJUA 4DSEA 4C8LA 1SW4A 4PWDB 2XI3A 4F31B 2X1GA 2JFKA 1M5VC 3D1HA 1EZ9A 1U1RA 1QSLA 2WVDA 4DUYF 3OLAA 3I9V9 2DH8A 2KN4A 2JEIA 2AKWB 3WQPA 1VGYA 2NS1B 2DIUA 2X51A 3GR0A 1P1NA 5A76A 3KUHA 3RY3A 3RR8A 2UVWA 2B0GA 3RAQA 1B3HA 3PRBA 1TXFA 2JFDA 3POTB 2GJFA 1S10A 1XBWA 1NXIA 5KDTB 3CJ8A 3I56S 4GC6A 1WKJA 5SUHA 4FKYA 1VSOA 2RRAA 1G3OA 5KFVA 1D09B 2GMJA 3B82A 1FXDA 1K9MT 1UFWA 3UN5A 3O2AA 4U8YA 3L09A 3V81B 2J6SA 4O3PA 4OWDA 1AT1B 2CPYA 5EYHA 4DMZA 3PKMA 4KFBA 3SQGB 1V3RA 2IIHA 5E41A 2Q66A 4DR2J 3Q8PB 4ZN3A 1QGXA 4NASA 1UJ4A 4QR0A 3FNNA 3K5MA 2C28A 5KFRA 3OTOJ 4USUA 4YB6A 4N5SA 3Q28A 1GFWB 3MEDB 3IWNC 4PTKA 3MPLA 4OLPA 4N8NA 2ALUA 2M88A 4FORA 4M5JA 4WE1B 1JIHA 1UVMA 3Q83A 4WKRA 2AMCB 4ZVOB 4H65A 2Q6CA 1TL5A 2VT5A 3RT6B 4ZVHA 4K4UA 1TL4A 4KGXB 2J6UA 1QVSA 4KQZA 4IR9A 1WTBA 4EYHB 1YJ9S 2AD9A 3DRPB 2WVCA 1MDP1 2B3FA 3GB0A 4ZE8A 4NWDA 1DY3A 2QFIA 5I59A 4LF8F 3E79A 3OSNA 1P1LA 4RR5A 3LWLA 4QF9A 1TFAA 2KH9A 3O3LA 1T9XA 2L3MA 5ELVA 1DQ8A 1NV3A 1TAUA 1WHXA 4NZ7A 3Q8RB 4I6YA 3PYFA 2N4DA 4BS2A 4RBUA 3MMBB 1JW5A 2OJ3A 1X4DA 2ZUGA 2QC3A 2NSBA 3B8BA 2FZCB 1P1WA 4F4AA 2KFYA 2UVGA 4EBDA 2DHXA 4GRSA 5ITHA 2HAIA 5ET7A 3EYZA 2ZH9A 1BQXA 2P6SA 3GYYA 4RK9A 1VLOA 2QVUA 1SL0A 2Z0GA 5B7WA 3QJPA 5AXNA 2VPYB 3BGUA 3TAQA 1F5CA 2XS5A 2W7AA 3RPLB 3TQEA 4AB5A 1LV5A 1XR6A 2VPNA 2DP8A 3FVYA 4DF4A 3SXLA 2NXUA 2L41A 2OLWA 4I6WA 2RT3A 3G71S 2VA3A 4ZEDA 4ZECA 3BSNA 1KQSR 5KOXA 4GL8A 2N7CA 8RUCA 4P74A 4DU7A 3KC0A 3IRXA 1NK7A 3DOKB 5D3GB 3AFGA 1G4CA 3HHGA 4ED6A 1UTAA 3TODA 1CBKA 4PFRA 4ESXA 3TAJA 1XNRF 4K3FA 4CM0A 4I6AA 3L7PA 4C3LA 5KFWA 2LAOA 1M5FA 1BQMB 3U72A 5A8RB 4MH5A 4G2ZA 2RU9A 2V50A 3S1TA 3LP1A 4IR1A 2XO6A 3GJQB 2QRRA 3FBEA 1SI1A 1QE1A 5HK4A 3J81j 2XXRA 4KPCA 4PDHA 4X04A 3CULA 2P0SA 4FAJA 1IR1A 3KNGA 4ZCMA 1J1NA 1TWYA 3VFJA 1FBFA 2H1YA 4QWEA 3TQLA 3KHRA 1K73T 3R6GB 2E7WA 4CP5A 1R8CA 3M8YA 3KHGA 1R43A 3KNAA 3PFOA 2YKMA 2I2YA 1LK7A 2M52A 4GVBA 5C5JA 5DGBA 3OQ2A 4JSOA 3PD9A 3A3CA 1VQ5S 1S6OA 1RYOA 1TELA 4YKIA 4OYXA 2KL8A 2H98A 1TMMA 1PKUA 1YJUA 3N26A 5EYGA 2AX0A 4B9TA 5D77A 4Z0IA 4PZVA 1SYIA 1F60B 2VKZG 4LMZA 1LOUA 3M8WA 4TLQA 1KD1T 2FA7A 4OYAA 3QMFA 2X7QA 4RBTA 4A46A 5CH7B 3BO4A 4KYSA 3O97A 4ZE9A 1U0HB 5H9FJ 3KLHA 5F8LA 3VXBA 3FMBA 4GWOA 4FECA 5EQ7A 3FSXA 4EI2A 4PUOB 2GZOA 5LSLA 3K2YA 2HQDA 1H44A 3VALA 2CAJA 4ED5A 4NLRA 2JNJA 2ZNUA 1YQHA 4DFKA 1T05A 2J0XA 2C3UA 1IEJA 3ZFVA 2E29A 4RKUC 4G1QA 4KFQA 3IFAA 2Y7KA 3N28A 2WCXA 2Z56B 1Z7ME 3D0GE 2FPHX 1K1SA 2XMJA 2CEYA 2HHSA 4HS7A 2GVDB 4U9RA 3SSQA 3V89B 4PPZA 2J9EA 4GWSA 2JLGA 2QL9B 3W64A 4DR3J 3GLJA 4WTYA 3DU6A 1UEVA 1NNKA 4ZIVA 2HMIB 3QZ7A 4DCYA 4LFAF 4ZITA 2KR0A 1JJ4A 1HNXJ 5HN0A 2XWIA 3VV2B 5HMYA 3QO9B 2H9BA 4F4WA 1LBZA 3DOLB 2W8LA 2OHDA 1A8EA 2CDQA 5KFEA 5DEXA 3THVA 2RUSA 5LMUF 1I6AA 1F0XA 3WDOA 2HHMA 2DDKA 4NX1A 3TUZC 3NGSA 3JS9A 2L5VA 1SC4B 3M3LA 1MMDA 5E3RA 4PFBA 4WU2A 5KCJA 4QSEA 4YMAA 4BBYA 3M6XA 2GQ2A 3VQTA 4ELPA 1MPDA 3D3BJ 3K6UA 3ISND 4M1VA 3QZ8A 3RW6A 2BJ8A 2CQGA 3HPOA 5KT6A 1HNVB 3T1HF 3TR5A 1SJRA 4L75A 5I3QA 3FASA 2DISA 1X0FA 1J5EJ 4HT7A 1VQKS 4C8KA 3KTQA 4WP9A 1MQJA 3CJKB 1WHVA 4ZK7M 2MXYA 3ITHA 4NI2A 2ATLA 4O23A 2F78A 5KZTA 2YKNA 2R8KA 1N04A 4LF7F 3EM1A 2HRYA 1FBDA 2CZLA 3SCJE 3HT0A 2J9DE 2RKIB 4KIAA 1MU2B 2O1PA 4P2MA 3EQ1A 1EJ7L 2B8QA 3AOBA 3FRZA 3VF0B 3I96A 1T02A 4YZZA 2YBVA 1M1GA 3OMBA 2ONRA 4QIVA 3VV5A 2V2QA 4Q0BB 1WEZA 2I1RA 4ED4A 4MFBB 5KFIA 1Y20A 4HCYA 3R8YA 4LRBA 2XCPA 3MP8A 4IO1A 2LA6A 1WOOA 3GFYA 2CQIA 2VV5A 2PD1A 4PWWA 3GIKA 2V69A 4ZDMA 2QSXA 3ISZA 3TZZA 4EZ6A 1LFIA 3UR3C 4X64F 2ONSA 2QGFB 4NOHA 4NEYA 1V6HA 4P10A 3PPPA 4FP9A 4J9UE 4R2FA 3DLGA 1B2HA 3MQ9A 4F3QA 4OANA 3FD3A 4R73A 1S49A 2HW3A 2ATCB 2HBQB 2G0JA 4JI6F 1RT2A 1X5PA 5J2NA 5I56B 4JVDA 5MLCV 2THIA 3SESA 2H48B 2Y3YA 3K2DA 3H5SA 1B0VA 4FBTA 1ZM9A 3DC2A 3MM7B 2PO4A 2F4FA 3ZZOA 2YH1A 4H5GA 2R3VA 1F2HA 2Z2ZA 3OBIA 4TXSA 3BBCA 3D68A 4IDKA 2YQ0A 5FHOA 3KDNA 4KD5A 3EXCX 1FPKA 4MAGA 2WKYA 5M2UA 1HQUB 1R8AA 3UPFA 1V3ZA 1MW7A 4B3RF 4UTGA 1R0BG 2FYXA 4QJVA 3OVBA 4E0XA 5L9MA 1XMOJ 2ZWPA 5B7DA 4RUAA 2NXEA 2AJ1A 1VQLS 4DXUA 4QRZA 2Q6BA 3BSCA 4J9LA 4D3GA 3I6PA 1FPBA 4HH1A 4NWBA 2KTQA 2LXIA 5CZXA 2MQMA 3W60A 1FWKA 2DR9A 2ZZNA 1RTHB 5AA2B 1MXVA 2K2PA 4DV4J 2FVCA 4C0RA 3RR7A 3W2WA 1QTNB 4KGZB 1N32J 4WCEQ 3OHBA 5CBRA 3G7WA 1HSJA 4LATA 3FIRA 3I87A 3M9NB 2HS3A 3SEXA 4PE3A 3S8SA 4FYYB 2RDDA 4GD5A 3MHYA 2F8HA 5KFXA 4CLWA 4M5KA 1FKOB 2JC1A 3FV1A 2DE4A 1OIAA 2V67A 5K20B 5C25A 1LGBC 1NK0A 2WW8A 4NG7A 2FVPA 1P9YA 2V8GA 3DLLQ 3ZNJ1 3IS9A 5DG8A 3NMRA 4QZVB 2PMZD 2ZHBA 2POKA 2B3TB 4A8SA 2VPOA 2Z2LA 3I0RB 3SCIE 2B4VA 2RSQA 1R0AB 1LEVA 2FLLA 3G87A 2MKSA 2VBYA 4MMOA 3MXHP 5B0AA 2B51A 1H0HB 2LKZA 2KVIA 1D8YA 4FZVA 5HMWA 4UQGA 3SKPA 3P8BB 1P99A 3Q89A 5KFMA 4JI5F 4PETA 3DNCA 4FBPA 4JUZA 4DSFA 4DL0C 1L5TA 3NS6A 2HHHJ 1SJQA 4TYBA 2MQNA 2QVVA 1BMQB 1X5OA 3KLFB 1NKEA 2W9CA 2CJAA 2W4CA 2RMLA 3NGTA 4IGTA 1UVNA 1WSVA 3IWXA 3D67A 1HD1A 4QR2A 1VBXA 2AEFA 3HSGA 2ZD1A 2DNMA 5IS2A 2L9NA 2I3WA 4DR5F 2HWTA 2OIHA 3HDSA 3DI6A 2CPFA 1U49A 3OTBA 2DH9A 2Y8YA 4X65J 4NZ6A 3J81Y 1FDNA 3FEXB 1FJGJ 2QYGA 1BLUA 4IG3A 1JX4A 1X60A 4KC5A 2GCFA 1UZDA 1Y4ZB 1VRUA 2Z2YB 2JRSA 2ROGA 2B9EA 2F4VF 3FGVA 5T7LB 1B58A 3FJ7A 4LRAA 2E5JA 4NTLA 2QL5B 4HCWA 2Q43A 4OVSA 1ZM3A 3GIIA 3PEJA 2XWOA 1PG5B 1RWPB 2RCBA 5IAIA 5T3JA 3T5JA 3KJQB 4WKYA 3EWGA 3ISPA 5DT6A 3O1LA 2X1FA 4EQ7A 3TA0A 3OSPA 2XMAA 4Y65A 3W65A 4OERA 3PPQA 3AY0A 1VS3A 1MY4A 1M5HA 4DCPB 5EDWA 1FFGB 3CMES 3SDFA 4RU2A 3BPSP 2VA2A 2VL1A 5A5XA 2HNYA 2XXUA 3BO3A 2O51A 1F9HA 4WP8A 2XMTA 1HHTP 5EUHA 4C8NA 2FHJA 4X62J 4KHPF 4W98A 4WJBA 2M5YA 5C42A 4GC7A 1KONA 2HZVA 2DNYA 2W7YA 1VQOS 2H65B 1N5TA 2FTRA 4R9GA 2Y1LB 2HVEA 4LP2B 3AQOA 3OD7A 1Q86T 1FEHA 2QS2A 1EP4B 3BQ0A 3EVOA 3RG6A 1RT1A 4F50A 1USYH 4JBZA 3G82A 2PCRA 2KM8B 3M7VA 3E3KA 2M9KA 3HPIA 4ZHRA 3ONMA 2ZXTA 1DLOA 5IKBA 4ED1A 3AAWB 1NJWA 3H2VE 4I1TA 3DRSB 3KK3B 2V6AA 2U2FA 2FYIA 4Q0CA 2HHWA 5KFFA 3IAS9 3OXGA 5I3UA 5A8WA 2QN6B 3KJTA 3L7UA 2BJEA 2YNFB 1FA0A 2DHSA 3KC1A 4V19J 3DU5A 5ETPA 2OPPB 4MBPA 1NEEA 4RNHA 2Y1IA 3QFWA 5K8OA 3GFXA 4IO2A 4OZ2A 1B5IA 1SIZA 4IFYA 1TVRA 4LF5J 5LT5A 3NGUA 2KG0A 2OK2A 5GAHI 4YU0A 1G0IA 4LF6F 2ZH3A 2CZKA 1PC5A 3AJDA 4U7UK 3PRDA 3LPEA 2HFUA 3MPVA 4RW9B 4ECTA 5D0EA 1S77D 2XEXA 3BGRA 4PXCA 3G3IA 3TTLA 2QMWA 3IB2A 1F6TA 1RT4B 1IKXA 1RZMA 2OCUA 1U2FA 2H5JB 3QUFA 5HM4B 3NAHA 2L08A 1YBAA 3T19A 5IQ6A 1VQSA 3KJVB 1GV8A 4YR3A 3HFZB 4R5PB 1Y3QA 1Q8IA 3NBPA 3NOCA 3NRBA 4QWCA 4HI2A 2AGQA 1FBHA 1F5AA 3UWTA 3UIFA 2V2KA 3MAMA 1U1NA 2AX1A 3LGMA 1XTZA 3NCQA 3SV3A 5D78A 2N7YA 1CQNA 1S1VA 5HBMA 2GAGC 3KN3A 4E98A 4HVZA 3ETMA 1X8DA 3EJMA 1IJEB 1SI9A 2W2MP 3GTYX 3TO8A 2VODA 2UYEA 1TL3B 4DPOA 5L8DA 4ES1A 4YUDA 1Q16B 2KG1A 2LQ5A 3HHFA 4KKOA 2ESNA 4N6PA 1CVJA 2HRUA 2VG7B 3CXCR 3IOUA 4NYZA 2GHPA 3P3DA 4ZCKA 5L9NA 4DI4B 4CDIA 1GVCA 1OJ4A 2DGXA 2Q3PA 4UUWA 3HSTA 5F3ZA 2WSCC 2F1FA 2J9DA 4ZZEA 3EDQB 2WVBA 2NXOA 2XXWA 2NUVA 3Q23A 4NA1A 1A8FA 1R6VA 5H8SA 3LR1A 1YJWS 2BJJX 4CLYA 3V6HA 5EN1A 3H98A 4EUOA 1HI1A 1VQPS 3LUYA 2C2NA 3MDFA 4Y00A 1L3UA 4DSKA 1HPZB 4X4OA 4NQ8A 5H8FA 2ASYA 2OPRA 5IM0A 4TU9A 4ZP7A 4ZPVR 2MHEA 1FX2A 3CVGA 1URSA 2K1RA 4KFBB 5KFCA 2DCLA 3RRKA 3ZTSA 1I94F 1Y3JA 4FPIA 2H4WB 2ZDPA 3I5BA 3CSBA 4CLSA 3RLFE 4RA1A 5CYMB 3PU5A 3R3TA 3H0PA 3KFMA 1B7HA 3QYTA 4OVJA 2O69A 1IITA 4PRFA 5TPAA 4M94A 2HLTA 1KSPA 5CCLA 3KN8A 3HVAA 1N8RT 1U7LA 1NV1A 3OO6A 4QHQA 4MKYA 2ZJQQ 5DVIA 4B3TJ 1U02A 3KBRA 2IDLA 3MECB 5E3AA 3IAM9 5B0FA 1VFDA 4DR6J 1OIBA 2W2NP 4M5IA 1S7HA 4MAKA 3GMGA 2DWJA 1ELJA 2EBGA 1ELOA 3THTA 1ITPA 3ZNUA 2M8DB 3TX0A 5CMCA 3HVRA 3GG0A 4HLBA 4YDDB 1TKZA 3PJXA 3V8XB 3MM5B 1IMAA 2X1AA 5AE4A 1YGYA 2HQFA 4H5FA 3JAMU 3MP6A 3ILOA 4NRUA 2PE8A 5I5PA 4A47A 3WIUA 2P3NA 1UEUA 1LW2B 1JXEA 2AWZA 1Y9UA 3ZTPA 1MPBA 5FD1A 3UVJA 4I69A 4OMFG 2C22A 1QUKA 1MROB 2BKPA 2O6AA 3PVXA 4JWYA 1VOMA 2QIFA 9RUBA 2PT1A 4WEDA 3CUNA 4X66F 4NLGA 3MPYA 1N76A 4ANCA 4LZ7A 2DEJA 3NGDA 3B6TA 4LR9A 4NWCA 2Q2AA 2DJWA 3DM2B 4Y2MA 2UXDJ 3IJXB 4FYDA 2CQ0A 5DZ6A 3PV8A 2F3DA 4IO7A 2VOOA 1FBPA 4URSA 1IZ1A 2P8IA 1VK8A 2AW0A 2M0GB 2FIXA 3BR9A 1G1XA 1N56A 4CH7A 1N5VA 1OQ3A 4M5DB 2ZOGA 1GR2A 1OLAA 2F97A 4F2SA 3QATA 4GWWA 2YNGA 4POXA 1YJVA 2BRLA 1VQ8S 3K7RA 3RYDA 4ED8A 5K9FA 1BQNB 3MUTP 1N52B 1TL7B 1B99A 4LREA 5FDLA 2WYKA 4JB8B 4FPRA 2J9CA 3M1VB 5HO4A 4I3EA 5GAGU 4LIRA 3IX1A 1UQWA 2HAVA 4A8QA 5CYQB 4X48A 2CQ4A 4WF9Q 5ETOA 5TP9A 2W9AA 2F5XA 1SW1A 1V5VA 1A55A 3JQJA 3TI0A 1OS5A 4I68A 2FC9A 2EG1A 3RPWA 3DYAA 3ZC4A 1HNIA 2PFFB 2ZOFA 3HHLC 2BM1A 1DTZA 3GSIA 3CCLS 3NNCA 3R6LB 1JNRB 1IBLJ 1U1LA 3R5AA 4G1PA 3ZTQA 1PBAA 1QE1B 1U6FA 2R9JA 5A0YB 2ASLA 1XNRJ 4DL3A 4HTGA 1H45A 2LLZA 3UNGC 2H5YA 1B7ZA 4ONYA 1FERA 1N34J 1MWZA 2KT2A 4TVAB 2V8PA 1RTJA 4FBUA 1PIEA 1NUXA 3FXRA 3OR1A 3TTKA 3ELHA 3S4UA 3HO7A 2VFSA 1C4AA 1SKSA 2GX8A 4CYUB 4GX4A 2UP1A 5I7IA 4C2MA 1S9TA 1H76A 2KKHA 4X4TA 4ZIWA 3MAAB 2UUAJ 2GO9A 1SDXA 1SUQB 2VQEF 1SYHA 2CZ9A 1VDWA 2BJ9A 2VQFJ 4LF4F 1GTEA 3LGNA 3H6UA 3IOWA 3W1YC 5K8PA 5L9XA 2HK2A 5GAHU 4PQAA 5EHMA 3R1LA 1S6QA 4IRDA 4GWXA 1S1TB 2KO1A 1OQ6A 2XSJB 2NYIA 4U23A 1NZ8A 4OI3A 2LQ9A 4OX7A 2I6WA 2EVZA 1CS4A 2XWVA 4EXKA 4DI6A 5JVHQ 4WXJA 4NF4A 3LOUA 2B7BB 4I56A 2JEGA 1WHWA 3Q2SC 3MD1A 5D6GA 4PEOA 3LP0A 1XIQA 4ZVPB 3OUYB 3RAMA 2GGPB 3LSWA 1S1WA 1TUWA 3R5DA 3AD9C 1T05B 2QVRA 2D7SA 1FPLA 1OO0B 2WYPA 4RNNA 2FJVA 3KXDA 4K4XA 1HI8A 5BJRA 1LFPA 4P71A 1X4EA 3GJRB 1RU1A 2UVVA 2HZCA 1RGVA 4G3IA 5DDOC 4NLVA 2OD6A 1JJCB 2HFZA 4U8VA 5C2CA 1PB7A 2HGNA 2FGCA 4M95A 4H4KC 3K89A 1NMUA 3R2DJ 4LBHA 2IDEA 1BWVA 2YX1A 3IBFB 4ND9A 4OYOA 2DNZA 1DTGA 1YVFA 3MM6A 2DGWA 5I42A 4P1EA 4TY8A 5B70A 3TFLA 2BJ1A 2GIFA 3DHXA 2VGQA 1K8AT 2UVIA 3D4JA 4XDDA 4ZKAA 4WEPA 1R3NA 4LFAJ 3ICLA 3G6YA 2QLWA 2OPQA 4A4JA 1N36F 3CCES 3MPKA 1GNKA 2C3OA 3FXUA 3Q26A 5KCJB 3OELA 1C1CB 5J1NA 2B5JB 2DK2A 3OFEA 1C1BB 3FV2A 2Z8DA 1YTVA 3KKFA 4O3NA 3CDEA 1SVDA 3B78A 3TKDA 1FRLA 3H03A 2I38A 1P6TA 1UPPA 2I5JA 3UDEA 1RBOB 2X1BA 3H40A 3R5BA 3MZ1A 5F7VA 1CNQA 1LBVA 4GOTA 4YN3B 4MJKA 2ZBCA 5L8RC 1V9OA 3JYTA 3PPNA 2GJ2A 2ZZWA 2Z8QA 1S72S 1VJQA 3C14B 3UORA 3PKYA 4OHWA 3ITHB 3FFIA 4PAFA 4ZP8A 1KFSA 3RRGA 4MFIA 2VBWA 3T1HJ 2C2ZB 1FNXH 3SEVA 2HVZA 4ZEBA 5BR8F 4X1BA 2EBEA 3TTMA 1ZA1B 2PA3A 2RC8A 2CPHA 3M9MB 4P7TA 2CWXA 3MW0A 3H5XA 3LSFB 2HGMA 5J2PB 2GRVA 4LF7J 4N15A 3D2WA 3CB4A 2PN6A 4DN0A 2XWKA 1LWCB 2MKZA 4U67Q 3SEUA 1IKYA 2MHNA 2DIVA 4LVNP 4X1DA 1NK5A 1FPEA 3NNHA 1YLXA 4ECYA 4P47A 2XXPA 4J91A 3FBCA 4N6KA 2ZH5A 4DS4A 3H6WA 2PMSA 1MN9A 1MLAA 4PWDA 3L6HA 4JWOA 5HJXA 3H6TA 4B3SF 2CWKA 4HACA 4CIOA 4BC7A 3VVDA 3PYDA 4MLVA 4NYPA 3TJAA 2VOPA 2A2CA 3TAPA 1UKUA 2V4JB 3DLGB 2ZH8A 1R8HA 2V84A 2HQGA 1RAHB 3CDWA 1IKVB 2VH7A 1HBOB 4X4RA 3I32A 4NF5B 2AYEA 3POTA 5KDTA 2IMOA 4BDLA 2NUUG 2O5DA 3PW0A 2D3OR 4EYIB 5T14A 3AT1B 1FT8A 4UT4A 1OYEA 4NF6B 3V81A 3UGWA 1T11A 4Q8EA 1NSAA 3SQGA 4JI6J 1R1NA 4QFNA 1QUJA 3MR2A 4IFVB 2QA1A 3PW7A 4G68A 4IO3A 1XN9A 1OMPA 2Y5LA 3VVEA 1M1KT 1RHUB 4EEYA 3GWCA 1VBKA 1QSSA 2ZBPA 4DUZF 5AXKA 1SL2A 1RTDB 3L4BC 4Y28C 1UIUA 4C6AA 4F2OA 4WE1A 4ZVFA 4ZN1A 4AD6A 3IAZA 3T93B 4K4ZA 4K5SA 4KSEB 2GQ1A 4KYDA 3NY0A 2ZITA 1MN7A 4CNZA 4B3RJ 1UEKA 5HANA 4YEAA 1D4NA 4KGMA 2DO4A 3UO0A 4OLOA 5IFMA 1S0OA 2YKOA 3W2WB 1U48A 2Y7WA 2EFPA 5C24B 2DHHA 4WU3A 3ENWA 2D5WA 5D0RA 3TOQA 4WZQA 3T1YF 3OJSA 3W2VA 2CDRB 3K5LA 3K8VA 3LQVA 2XCAA 3TW0A 3L95X 3HMJG 1SH0A 2OZZA 1M5KC 4PBQA 1VYAA 5DGAA 4DF8A 2HZAA 4G68C 1ZIUA 1VQ9S 1FNOA 4RPOA 2FGOA 1GAOA 4R0EA 4HE0A 3HHKA 4B02A 1Y4TA 2V34A 4N8OA 1MY2A 1FPFA 2WRMA 3GYGA 3N6MA 5F0UA 3MMBA 3WZ0A 4PCQA 3ILJA 4JI7F 3NGRA 2V2ZA 4ZPCA 1VQMS 4TY9A 2ZHOA 2DY9A 1D1UA 3QIPA 3DOMB 5E3CA 4XKQA 1KRPA 4IH7A 5C7PA 3D9BA 4F36A 1Q0NA 4C0HA 4JI8F 2DBBA 5DTBA 2V63A 1I6BA 3HI9A 1QD1A 3TVKA 1RP5A 3RPLA 4ILLA 1Q53A 3R9LA 2ACMA 3MTKA 2AL5A 4PABA 4FVMA 3VGSA 2OJTA 4O3CA 3GCXP 4USKA 4PGPA 1AYEA 3BO2A 1XEZA 2EG2A 4OQJA 2OWZA 4QU6A 3DELB 3FSYA 4QWAA 1VIOA 1GMVA 3CWJA 4EF1A 1HHSA 1G0HA 3PO5A 4NX9A 1U2CA 2R8JA 3DOKA 5D3GA 1ZS6A 1YG0A 4P75A 4EWTA 3H20A 3SV4A 4LF9F 4OV6A 3HK2A 2ZKTA 4LFCF 3RBXA 2BYCA 1DJ0A 5HVGA 2W4PA 3VQSA 4P2FA 2ZHAA 2AJ4A 2GAHC 2D9PA 2JL9A 4IY6A 4A48A 1BQMA 3R7XA 2KLFA 4TQRA 5A8RA 1FXRA 4JI2F 4DV0J 2V9WA 2YLNA 3TMGA 4P1LA 2BKOA 2DNGA 3FEYB 1NB2A 4KYZA 4ZVUB 4KTQA 3IO6A 1TQLA 3B50A 1GK8A 1N0UA 3W63A 2ANJA 2CZVC 3ZZZA 1VFEA 4O3SA 1SPIA 4DEZA 3SIPB 3IR1A 4EO8A 3UD4P 4ETXA 1O8BA 3KLIB 3TTNA 1IBMF 4XEQA 2DE3A 5DM6Q 4LN5A 3SEOA 5TU0A 3EVMA 3H5YA 2OEKA 3I5AA 2CZIA 2H9ZA 3V5AA 3BKTA 3DCAA 3HCXA 2VBXA 3RBEA 2QJEA 1WSRA 3FUYA 2JEJA 1P9QC 1UETA 4PE5B 5ET5A 3ILIA 5LMNF 5L46A 2QZ8A 4E0DA 3G3HA 3MVZA 3CD6S 4D3HA 5BXIA 2HHVA 2AJ0A 3EN3A 2QFLA 2XD3A 2RQMA 3V6JA 1O7TA 2RUGA 4OHYA 5C42B 2ILZA 2M2BA 2E5HA 3JTNA 4DQPA 4LJMA 4BHQA 1XVYA 3OENA 2RC9A 3UN2A 1U0HA 4AQ4A 4YB7A 4PUOA 3IO1A 1VBZA 5B08A 1SQFA 5KTQA 1HQEB 1LWEB 4A8YA 1EZPA 4KHPJ 1MXXA 1Q7LB 3D1RA 2MSTA 3CCMS 2K3KA 2E5IA 4JI0F 1X4CA 1R8BA 3GIJA 2A6OA 5ET6A 4RU9A 2RHSB 2HHUA 1UPMB 1H7WA 1NM2A 5KT3A 5IC6B 1NL5A 2DE2A 2L9WA 1S9GB 2CJKA 2GVDA 1DHMA 5GMKa 2VJVA 4OI2A 4F2QA 2DNKA 1NKBA 3VAJA 1PYOB 2HQIA 1RKMA 2HNDB 2EC2A 2HMIA 4NF0A 5CCMA 1WC0A 3T9ZA 4KH0B 4OJ3A 4NXNF 1HNZJ 1CEZA 3HULA 3QO9A 2FHJD 3DOLA 2CPJA 1GTKA 4HE1A 5FTIA 1TL1A 5AA4B 8ATCB 3IJOB 4O44B 3VGVA 1JXVA 4J9RA 1T03B 3GR1A 3VAKA 3QGPA 1NJIT 3UN6A 2YNIB 1SKRA 4Q2MA 1FQEA 5K2YA 3C31A 1B4ZA 4CTAA 3CCWA 3CCQS 4PG6A 2GO8A 1Y9OA 3BGRB 4NLXA 5GMEA 1RAIB 1IKXB 4BWJA 2D3IA 3QXMA 2ZH6A 1QW0A 5IT9U 1HNVA 4TQUQ 3IXQA 2DNPA 5CD4A 1WVJA 3D0IE 4Z37A 1RUSA 1LW0B 1F2GA 2DSFA 4CH0S 2JZ5A 1JLAB 1LK5A 3CJKA 2QS4A 4IOAQ 3IO4A 4DFPA 4QFLA 1VBYA 4ZVTB 2A1BA 3X3UA 4PG8A 4C11B 3QAXA 4YHHJ 2IA6A 1GXUA 5BYQA 4O4GB 3SBMA 3EVWA 2RKIA 2V8HA 3I4HX 1LEOA 1MU2A 2YWGA 3TELA 1GTHA 1QY7A 2W9BB 1TK0A 4EQ9A 4EMDA 1S1VB 3HJVA 1CLFA 4YS2A 2F63A 2AGOA 1LBBA 2V94A 5DLGA 3BB5A 1JLBB 4WYLA 4P6QA 5JXSA 3EGWB 4R74A 4WP3A 4ID5A 4Q0BA 2IRYA 4G65A 3DXBA 1ZM4A 4RUBA 4J9NA 1PC3A 5DDQC 2P9CA 3R1HA 2AU0A 1OLCA 4W4MA 4PQUB 3W15C 3M3FA 2F40A 1HBMB 1FK9A 4ZLPA 4AUKA 1NV4A 2QA4S 1DCUA 4QFKA 3EDRB 1SIWB 4RYAA 4USWA 1RKJA 4H46A 1NNDA 1X4BA 3C8YA 2W7PA 3G4SS 2EC0A 3ZZUA 2MKYA 3L7OA 3U65A 4LQ3A 1S57A 1XK8A 4I40A 2D1CA 4O3RA 1YZ6A 2XBPA 1AFIA 3ET6B 2F65A 4X4QA 3PRVA 3QGHA 5G4DA 3PYGA 2G0IA 5GADI 4KCDA 3MM7A 2BW2A 2K1RB 3P4UB 5JK4A 4ELTA 2HPUA 1WOPA 1B1HA 1SBRA 4CRJA 2UZAA 3QRQA 3JSYA 1ZU0A 4WWSA 1LSTA 2KHCA 1E6YB 1KNZA 3BSOA 5KG3A 4LFBJ 3NS7B 2MQOA 4RW8A 2VF3A 3LAKA 1HQUA 1B3TA 2R2RA 3MSTA 1LB9A 4FF1A 1T94A 3RZAA 3IFCA 1R27B 1I94J 4WTOB 1UWBB 4KV8B 5U47A 3IR7B 3EXYA 5CA5A 3J7ZT 1ZLQA 2AIXA 2Y0BB 3HHNB 3MOZA 1RWWB 2LU2A 5AA2A 1RTHA 1U8WA 2CJBA 5D8HB 5LXYA 3Q2TC 5I58A 5JTYB 4BDOA 2DO0A 2QG9B 1FQBA 1FTOA 2XG8A 1QSYA 1WI8A 1WJ9A 2W25A 2Q9TA 4NCGA 4DR1F 1D9FA 1S50A 4M5MA 5IZZA 4GX3A 3PUXE 5AJ3F 2AZ1A 1W25A 3I6VA 5AA3A 3T6BA 1FKOA 3LP2B 2HLUA 1OQGA 1SKUB 1JLQB 1Q79A 3UVJB 1AXQA 3M8RA 2XYHB 3TA2A 3GE9A 3DLKB 5I84A 1A9NB 1SQEA 5IGAA 2GVZB 4M1KA 3GXAA 3J80U 1D0EA 2B6AA 2HSEB 2ONKE 3CJ0A 1S9FA 3RQTA 4PXDA 2GIQA 3DLBA 2EFQA 3MUMP 4IO9Q 4GQOA 2CQPA 3A8JA 1KN6A 4QSDA 3I0RA 1G7CB 1BP5A 1GGGA 4PCDA 2PDAA 3MYUA 3HT3A 1RCOB 4QBAA 4DV2J 1UTHA 4X66J 3HHLB 4J9PA 3NNAA 1FW0A 5DRKA 1VQYA 4J90A 4ELUA 2DVZA 2C2OB 3KBZA 1I1GA 2ZZVA 3ZZ0A 4JV0A 1UVIA 2YNGB 2MSSA 3KLFA 1KHVA 1UJ6A 4BDMA 1P1UA 1D9YA 3FBBA 4GWYA 1X5SA 2LA4A 3VZHA 5FDLB 4PPDA 1N3WA 4LRFA 4FNHA 3CCUS 4R0JA 5G0RB 1H2VZ 2QMXA 1LAXA 2ZUAA 4P56A 4H4MB 4JVCA 1U26A 2HS0A 3O6GA 5KG5A 2JWNA 2Y7PA 1OY9A 4XIGQ 1HNIB 1QUVA 2ZOMA 1J5OB 1A40A 1HBUA 5T7LA 1RWMB 3IGNA 3DLEB 3FXBA 2FIUA 3C4MA 4P3LA 2E5LJ 4OZ9A 4V1Ak 2OI2A 2OGUA 4HTIA 4DV1F 4DR4F 1NNTA 1HLWA 3V83A 2Y8WA 3FJMA 3QNWB 2XS7A 2JLEA 4WFBQ 3C32A 5CRYA 1NDLA 3GJTB 4DCXA 3VCDA 4FF4A 1LWFB 3NMAA 2RF2B 2DVCA 2QL3A 3RB0A 2IHR1 4EFAC 3RB6A 2J8AA 2PVUA 1S97A 4LZ8A 2ALZA 2HHQA 5ETMA 3IR6B 5L9OA 4GKKF 2BACA 4WPAA 4B3MF 1IBKF 5ETLA 5K8MA 5J16A 4ZPBA 4DR7F 3EPEA 3N94A 4AQYF 3AA9A 4ECUA 2UXAA 4GRKA 2PFDA 3IOVA 1SV5B 1U6BA 2DNHA 1HIYA 2OSRA 3WIVA 3E13X 2NVUB 3ZSFA 4ZPWR 2CJ9A 5D4PA 2J7WA 1U1MA 5ADZA 1A6LA 2HS4A 1JEVA 2EPIA 1H72C 3CDBA 1ZTYA 5F8HA 1PC4A 1G6BA 4Q43A 2ZNSA 2E1AA 3SSRA 1Y0HA 3KOAA 1YAEA 1JW4A 4UUXA 2H99A 1TR0A 5A2QU 1POTA 3RTFB 5IV4A 3CJ2A 1EP4A 4OZ3A 4I0WA 3O29A 2HAUA 2RNEA 1JVXA 2XS2A 2J0SD 4AS5A 3K6VA 4NLTA 2F3JA 1FNMA 3MC2A 2A5SA 4CLUA 4ECVA 4NA2A 5LM7E 2APOA 4KR0B 1DARA 2N4CA 4C7QA 3ZZRA 3RT8A 5HMXA 4IO4A 4M5NA 3DRSA 3KK3A 3CJ3A 1GX6A 4EXLA 2QTWA 1VQ4S 1XS5A 4UACA 4WXWA 3KSXA 2RD5C 2YNFA 1RTIB 5KG7A 3I4PA 2F3BA 3HKZD 4GBVA 4NAPA 3MM6B 3I55S 3C66A 3CD0A 4KPTA 1T0KA 4H1XA 5E3PA 3KWMA 4PXEA 4EZ9A 5M2VA 2KT3A 3KJ7A 3LH2S 3DMJA 1YX2A 2AEMA 2GMHA 1QM9A 3M05A 2EFNA 1T95A 1NJYA 1SVXB 4C4WA 1APSA 4TLLB 2OEMA 4GKJJ 1L5UA 2OPQB 1JJHA 4KPYA 1JKHB 4J9SA 1M5EA 2KZZA 3C15B 2Q1LA 2DGUA 1HBNB 1J27A 2HIYA 2VB6A 4IH6A 3L3CA 3MR7A 3FZBA 5HSPA 3SCLE 2RINA 1MS7A 4QPXA 3NGKA 4ZEIA 3LV0A 1HA1A 1RSCA 3GG1A 4RW9A 3V5RA 2RRBA 1S48A 4NHBA 4G61A 2AQ4A 3WX8A 1N36J 5J2QB 1RT4A 4C9DA 3PJ9A 2V8VA 5K5MA 1NHUA 4K4TA 4DFJA 3TNVA 3KLGA 4UQTA 2CQCA 1N0VC 2ZNYA 2VFRA 3DN9A 1NCLA 4KQPA 3DFEA 1MM7A 1RWOB 2A5TB 2FJWA 3KJVA 2BABA 1P8GA 4R5PA 2XZDB 1IMDA 3FFIB 1IJFB 2BE7D 1FQCA 1HR0F 3M8ZA 2BV3A 4K4VA 4IOBA 3N01A 1SJ1A 1IM4A 3AODA 2EFOA 4TU8A 1KQGB 2MY7A 3E78A 2H5IB 2FUG9 2XXXA 2XLJA 1F3FA 1U24A 3H90A 5KFPA 3EUNA 2AV5A 4JI4F 1VR5A 4PYAA 3D1QA 4F04B 2XHCA 1IKYB 4Q45A 1FEEA 3MI7X 2OLBA 4NE4A 2E1MC 4WK3A 2R7SA 1Y3KA 1TL3A 1PEBA 3F73A 2DNQA 1FVQA 2F8MA 4MLQA 3D6HB 1MWYA 2VG7A 3MFIA 3SETA 3LBSA 3MEEB 4HACB 1S7YA 2HURA 1XWLA 2R7RA 1D9DA 2I0XA 1RTZA 2DGQA 2OH2A 4UZBA 1WORA 3S9MC 4J9OA 4B3OB 1EIYB 2QLJB 2CNKB 5KFSA 2RQKA 3PIPQ 3DGVA 4B3SJ 1UAWA 1PAUB 4HTJA 2U1AA 2EK6A 3A13A 1WDDA 2E5GA 3A3UA 2NXJA 1RYSA 3MMJA 1VCTA 2XGQA 3M32B 4KH1B 1HPZA 3QLHB 2JHEA 3C2PA 3R5CA 3PMVA 3F11A 1UL3A 2ERRA 4C98A 3QWUA 3VVUA 5F8GA 1FRKA 4ZVQB 2K8GA 2XLIA 1ANFA 2MDAA 4UOFA 3I0SB 1XOCA 2X7PA 4G68B 3PX0A 3BDEA 2FD2A 1HSLA 2XXIA 3QBCA 2FLOA 2ACYA 4FF3A 5CYMA 1VE4A 1M5CA 1HD0A 2JJKA 3W8GA 2LEBA 1TKTB 4RLEA 4BCAA 2P9GA 1N4LA 2Q79A 4BDQA 1B52A 2YTCA 1KQFB 1G2EA 4DUZJ 5CYJA 4EUVA 3MECA 1N84A 3JZJA 2XNRA 4R72A 2R7TA 1NV2A 3MURP 2IAJB 4K2JA 3WAFA 3CJ4A 4C1TA 1LB8A 4EQBA 1YITS 2I9SA 2HKEA 3BN7A 3N6UA 3GIRA 3W2VB 2REJA 3KFWX 4PFYA 1Q95G 1OVTA 3W9JA 5E3QA 5IZ1A 2I58A 3MM5A 4RO0A 2ZBIA 2XC9A 1VRTB 3ZZTA 2LQJA 3RGIA 2WBMA 4JI3F 5KG6A 2VD3A 1IN0A 4URQU 4MMPA 3MCMA 4CO4A 2RIJA 1LW2A 2LU1A 2NZCA 3T1YJ 4POWA 3AOCA 2QO3A 5KG4A 2Z23A 1QKAA 3VDFA 1MROA 1JLEB 3MPDA 3JAMY 1QKBA 4UOCA 3QIPB 1NPKA 3U1OA 5I4MA 2D74B 2K3IA 3LWMA 4OX8A 2HCAA 5KG0A 3MUQA 5K2XA 4KCCA 4DZ6A 4ERDA 4X4SA 2HFVA 1KQKA 1BLFA 2P6TA 4OFZA 2V4QA 3OV7A 2R2SA 4F02A 3OJUA 4JI7J 3DM2A 1S0MA 2BOAA 4CLKA 3OT9A 3H4BA 4P52A 3M3KA 1CG2A 2GFEA 4EU0A 4UA8A 1SD3A 1Z2ZA 2CMOA 2CYYA 3AB2B 4NLDA 3G96A 2ZVIA 4DX7A 1M90T 2GS8A 2YXLA 4M5DA 4Z7YA 3T66A 3N5BA 1NI9A 3OTCA 2YPZA 5BWJA 1FPIA 2V25A 2FBPA 4HT5A 2VHAA 2X3DA 4FXDA 2Y0SD 4C3MA 3PUYE 4R8UA 2OELA 4ZA1A 3SYZA 3DLHA 3EHTA 3HFKA 4R25A 1H6KX 1BQNA 3Q8YA 3GZGA 1TL7A 3PHEA 4IQXA 3PTYA 3IB1A 3M1VA 2UUCJ 1C0TB 4LT6A 1K9ZA 3DXSX 1B4SA 2QLFB 3MM9B 4I4BA 3Q8VA 3IP0A 1MXYA 3PTWA 1B64A 1RLDA 1OWXA 5B0EA 5CYQA 1IQ7A 1GMUA 2JC0A 4JV2A 3Q8UA 1LXNA 4OJHA 4ELOA 4HDHA 4XPEA 5FLXU 3H7HB 3MCNA 4GVOA 1YHQS 3MR3A 2P9EA 1BTJA 1FI4A 4QSCA 3H59A 4Y0FA 4QFOA 3VAFA 4LFCJ 3D1OA 1A7GE 4USIA 1LBCA 3CJQA 4XTTA 1DQ9A 5A0YA 1RAEB 3K0VA 1UA0A 1ZAWA 3MAQA 4NE9C 3FATA 2R8HA 5KT2A 1LBYA 3N79A 2XWYA 1Y00A 4Q8FA 3GYNA 2XD2A 3MZBA 2BE9B 2ADCA 4F3MA 2FLNA 4CYUA 2DWHA 4R6HA 1EKRA 4CO5A 4MX6A 2VFTA 3SCKE 1YTYA 4AXJA 2J0QD 3MAAA 3KSJA 5AT1B 5CAAA 1SUQA 2XYPB 3RNNA 1FO1A 3FCVA 2KRBA 3BDPA 4U4XA 5CMBA 1QAYA 3W9VA 4WBFA 1TV6B 3FRYA 4OYMA 1JK9B 2DYAA 4LBPA 3HD1A 2RS2A 3BGLA 3GYXB 1YZ0A 1LNQA 1S1TA 2H4IA 1Q5YA 2XSJA 3LSLA 3B54A 2VPXB 4KGVB 3T22A 1R6ZA 1WEYA 2YH0A 4N7TA 2WW4A 5LMNJ 2AIRB 4YB5A 1H74A 4DL7A 3HSDA 4U6PA 1FTKA 4DR3F 5IXUA 4OA4A 2HAFA 3FJGA 3OUYA 3O6QA 2GGPA 2CPEA 3U1NA 3FQLA 3C6TB 2NUHA 3QT7A 4OTEA 4RW6B 2CG8A 4NRTA 1HNXF 4OZ5A 4TKTA 3HZEA 5CABA 3TZXA 3CSKA 5H8HA 2FHYA 3CCJS 4DQQA 2L48A 1UFLA 2UV8A 2JVRA 3GSDA 3TEGA 4UOGA 3IR5B 1CJTB 1FX4A 4TN2A 2MJNA 1YZ7A 5KFGA 4U1ZA 1S12A 4ANDA 3VXCA 3V6KA 2OWTA 4DV7J 4G8MA 1MY0A 4IR8A 1AZSB 4XPCA 5AE3A 3EE3A 4RWWA 2VBZA 5K14A 1IWGA 3TAMA 4JI1F 1RHQB 3FCWA 4DL4A 3W9WA 1HW8A 5HVFA 2MKIA 4P11A 3PDNA 1I69A 5L38A 1PILA 4NL5A 1KS2A 2XMUA 3ISNC 1TL1B 2B4PA 1J5EF 2XXQA 4NF8B 2UXBJ 2Q74A 1MPCA 5H9EK 2Z2MA 4K0KJ 3I5OA 1C1CA 2B5JA 1C1BA 1D3WA 4I64A 4CTAB 1PGZA 1NHKL 1FDAA 1URDA 4NLWA 1CJUB 4DDDA 2RU3A 2HNZB 1J2VA 4QOTA 4NLPA 4ZP9A 3O28A 2UXCF 2FNCA 1QDUB 1OY8A 1RT7B 2OMOA 3IC1A 2MB0B 2DYXA 1LBWA 1MQDA 1WHYA 4I67A 2J5AA 3MEKA 3JB9k 1TFWA 3RUMA 3PG9A 3MMCB 1N5YB 3C14A 4O8MA 2BQUA 2P2CB 1NPRA 3FDSA 4Y3CA 5IM2A 2MQQA 1SC3B 1RT5B 5EWFA 1RT6A 3HHDA 4DX5A 1WOSA 2DXFA 5DQIA 2VPZB 4ZMMA 1NK8A 5IWAF 4C1UA 4B08A 1ROFA 4X8RA 5AE2A 3CI8A 2VDHA 1MH4A 1EETB 2DR8A 4DPWA 4GO5X 4CZCA 5CHCB 5J2PA 3WC0A 4LSLB 2BANB 2XULA 5LOMA 1AIVA 4A8XA 4MT1A 1BE4A 3CIZA 5E7OB 1LWCA 4YB1P 2COLA 3I5CA 4ID5B 2FHKA 4LRDA 4LQ9A 5A8KB 4KB7A 3R5GA 2MZRA 2A0FB 4RUCA 5D15A 1HL6A 3M2RB 3NKYA 4USHA 1DSNA 1IKWB 1AWBA 5M2RA 3CR9A 4Z7EA 1FK9B 4Q5VA 4OI4A 3WHIA 2FJDB 3ZO7A 1Q4RA 3Q0AA 1GH8A 3BBRA 2V4JA 4P0GA 5KFQA 4DUTA 1REVB 3H5UA 4DXBA 1Q1KA 3OSQA 2IFXA 1IKVA 5JMNA 1HBOA 2DGOA 2RHQB 1FKAF 3SEWA 3D7SB 3OXNA 4NF5A 4RXLA 2F7CA 4YFUA 1JETA 4ZS6A 4Y2CA 3MZIA 4CO2A 1XMOF 2M8CA 3BGOP 1S6PB 2PT0A 3BF4A 4AXIA 5L1LA 1IM6A 1FRXA 2DNRA 4UZCA 4CLZA 3FQKA 4NF6A 5HQ8A 1TK5A 1B7UA 4ANEA 4CWBA 4J9MA 4DV4F 3SQOP 4P7VA 5D4OA 4H8JA 2UYFA 4IFVA 3WX4A 2YJPA 5LTCA 2IM3A 4F3SA 2DCUB 4RW8B 4P8BA 4B9LA 1N32F 1DTTA 4RPFA 1TFYA 1FRMA 1R0CB 5CQGA 1EU8A 4B9NA 1X4AA 4ECWA 1AUDA 1RTDA 4MKVA 3CE8A 1UVKA 3ENAA 4DSIA 3UD5A 4PFTA 3BIGA 4RJZA 5I58B 5I57B 4ZPTR 3V6DB 3RBZA 2F5GA 2B43A 3P49B 2VUGA 3EZ5A 5C24A 1UCNA 2VJUA 4F3BA 2J7UA 4NCGB 3S9EA 2RRNA 1I51B 5D0HA 3BYRA 2NXNA 3CMAS 2EKYA 8AT1B 3NWRA 2KYZA 2B4LA 4FXVA 5F9LA 3FVOA 2QPQA 3O2IA 4ILRA 4Y34A 4ED0A 4KBIA 4N47A 4U96A 5BYRA 1RJJA 3LF0A 1HQ2A 2QLXA 2VC1A 3RB3A 1S1XA 2WZ1A 3H3GA 4GXAA 4F4ZA 2DXYA 2HHHF 1KP6A 2W2PP 2B6AB 3DOMA 1II5A 2KXFA 4MNPA 3U27A 3KHLA 1LAGE 4TNOA 1I3OB 3TZAA 1NPPA 5ETSA 4XFEA 4DV3J 2V9KA 4KJIA 2DGTA 5AA2D 3K01A 1M5DA 3QQCD 1S1UB 2HFOA 1UTHB 3MR5A 2DS9A 2HQ0A 4E0WA 5DO2A 2FC8A 4ES2A 3TA1A 2IYIA 2B4MA 4EF2A 2Q89A 4JVIA 2MQPA 1FJGF 2M3DA 1EAYC 4C8OA 3VE1B 1HARA 3TUIC 5B0BA 3CHGA 5FBPA 5IOLA 4PFIA 1BK4A 2F8EX 2PFYA 4H0WA 4ENOA 2HFNA 2G4BA 4O94A 2IRXA 1YIJS 3WAEA 3IGVA 1RAOA 4F0MA 1DURA 4Y6IA 3PACA 3JSBA 3TRGA 2H51B 1NKXA 3PD8A 4KR5A 5LL6d 3QT8A 3TX8A 2ZNTA 1A0OB 2VG5A 1DMBA 4FYVB 3NCPA 3CEDA 3H42A 4U22A 4ZJQA 5J1EB 3PEHA 2OPSB 4PFWA 1HBUB 2KXNB 1EZOA 1QVGR 2RQCA 4I2QA 4QYZJ 1FVSA 1NDKA 2QYCA 3R27A 5RUBA 1LFWA 3UDLA 1YJ7A 4RNSA 5ETKA 4CO0A 3HN0A 3BJYA 3DDIA 3M30B 3CTRA 2ZDOA 2EI5A 1NNFA 4ZVRB 3OW2R 2XXTA 3OL9A 3MVWA 3ZTOA 3KLIA 5J2MA 1WD6A 1KLNA 4X62F 4RW4B 2CPIA 4A8KA 1VISA 1JLFB 4DR4J 2MEWA 4KGKA 5B0GA 3TCFA 3TEHB 3IG1B 4BDNA 3P6YC 1Q5VA 2YNHB 2DY1A 4H4OB 4THIA 1KR4A 4MIAA 5CBSA 2GHVC 3MMAA 1NH8A 4AE5A 3ZZPA 4Y2AA 1FQDA 1KA0A 4DIGA 5HQLA 4FATA 1DZ5A 2XXHA 4GKKJ 3BREA 5LXRA 4B3MJ 2V4CA 4YR0A 2BJ7A 2QSWA 4DR7J 4OX9J 1RAAB 2L9DA 3NP5A 3J7YI 3WC2A 3HFVA 5HP1A 1NK6A 1B46A 1HQEA 1LWEA 4TQSA 3QIDA 3G6VA 3S01A 1BIYA 2BBEA 3AOAA 4KT0C 2B9YA 2Y5KA 5IT0A 2QLBB 1FKPB 3AD7C 2H25A 1WI6A 2RS8A 4UW2A 2Z8EA 1CJKB 3NLCA 2DNLA 4EBEA 1Y1ZA 3EF7A 1S9GA 3JTOA 4N8GA 5KG2A 4DZDA 3DRXA 1T9TA 1MRPA 1NSQA 3UQSA 5LOQA 2VFVA 2HNDA 3FBPA 1QJMA 1WC1A 3C33A 1LWXA 2QRYA 1MH3A 4OETA 1GXTA 1Y11A 3DMJB 4K8RA 4U7UD 5DYHA 1DTQA 4V19X 2CZHA 4X9TA 1QUPA 3K1PA 2HBRB 5ETVA 2CPZA 4U95A 3OFFA 3U93A 5AA4A 3H6VA 3MJNA 2BEFA 4O44A 2K7KA 1H98A 1HFEL 4RJVA 1T03A 4OL8A 3D66A 2CG4A 4LUBA 2DPJA 2YNIA 2G29A 2BM0A 5DS7A 5ETRA 3OEMA 4QWDA 4OXVA 1T9VA 5M2PA 4QIEA 2FVSA 4C8ZA 1B5HA 4P2SA 4P73A 1Q35A 3EMTA 3P96A 1JNFA 1IQTA 5A6PA 1D9AA 3KLGB 4OFJA 3BR8A 4PYDA 5FHNA 3M9OB 1Z1ZA 2LEAA 3UN3A 1K1QA 1WG4A 3R5JB 2XLKA 2KXHA 1FRIA 1Y10A 1LW0A 4TLMB 4ECRA 1JLAA 3ZXWA 3IM9A 5E0OA 5DQHA 3JSMB 1LFGA 4XTCQ 5KFNA 3Q8SB 1HWJA 5IT9Y 3I9ZA 3M6VA 1JJ2R 5E5NA 4C11A 3PX6A 2HYIB 2UUTA 4O4GA 1FD8A 3CVKA 2GHWA 3ADAC 1ZBTA 4NPOA 1JXLA 4F39A 2W9BA 3HFUA 2ZE2B 4CT8A 1YRTA 2JOQA 2WAQD 2NREA 2R9LA