2QMWA

The crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGTINIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQFDYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFDQNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAITTDIKKVIAILETLDFKVEMIGAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
molecule tags Structural genomics, unknown function
molecule keywords Prephenate dehydratase
total genus 71
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmwA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA02
5A5XB 4GF8A 2OWSA 4ELQA 1FQDA 2GHAA 1ZBMA 1LCTA 5AA2B 3FJGA 3S4UA 3N94A 4H8IA 3DP4A 3A3CA 3OXNA 3CVGA 4FJPA 2OBGA 2FNCA 3JZJA 1OQHA 4DXBA 4TQUQ 3T9HB 4GXAA 5CM6A 4KI0E 2X26A 1NNFA 2REGA 1JVYA 2QPQA 3DDNA 3N6TA 2B3BA 1DSNA 1US4A 4NWCA 4RY1A 4BDOA 1P99A 2NYIA 2XXPA 3N6UA 3B6QA 1O8BA 3VLVA 5AE4A 4JBZA 1I6QA 1Y9UA 4MFIA 3E13X 4PFWA 2I9SA 4M8LA 4U4XA 3TZAA 4F3SA 2YPNA 3SDFA 4IY5A 4GL0A 2NWJA 4LP2B 3VVDA 3H03A 4R2FA 3PD8A 4F1UA 4ZE8A 1VSOA 3TTKA 1PB8A 2ONSA 3OEKA 3VE1B 4ND9A 2QRRA 3V8XB 4XKQA 4EQ7A 4ESXA 1Q35A 3JYRA 2QS1A 1HSEA 5CI5A 3SEUA 3CSGA 3N0VA 4EQ9A 2Y7RA 4GXSB 2CMOA 5FHOA 3AXFA 2VD3A 3LSXA 5CMBA 4TLMB 3K00A 1KWHA 3CG1A 1NKXA 4PWUA 2I3VA 3ILUB 2ABHA 2Y7PA 5H8FA 1DOTA 1LBCA 3C32A 1H45A 1A40A 3LBSA 3GBBA 5DYHA 3TPAA 1NNKA 4N07A 4RYAA 1DPEA 3JV9A 3KOTA 3Q28A 3IBWA 1A8EA 1B46A 3SESA 1JW4A 4RNSA 2ONKE 5I58B 5JTYA 4F3GA 3MQ9A 3T22A 1IQ7A 3KGCA 1B1HA 3C36A 1SD3A 3OMBA 2XXTA 4PQJA 3K02A 3RQTA 3TDJA 4NTLA 4HW8A 1FQFA 3S9EA 2F6GA 1B4HA 3OO8A 3UP9A 1IIWA 3LSFB 4GFRA 2DP8A 4RPNA 4MBPA 3TTNA 3LOUA 1UIVA 2B65A 1LB9A 4U1OA 3MP8A 2P0SA 5I59A 2HQ0A 2CDQA 4IO1A 1QKAA 1XHYA 2F8MA 1B3LA 3OEMA 3PD9A 3OELA 3KG2A 5BWJA 3QK6A 3BBRA 1B05A 2I3WA 3N5LA 2O1LA 2Z8FA 2DWJA 4DCXA 2ZYKA 3GZGA 1BKAA 5K2XA 2LQJA 1LFGA 5EHMA 5EHSA 3DM0A 2UYEA 2O84X 5LOMA 4JWXA 3TUSA 4KFQA 3G3IA 3PPQA 1ATGA 1BIYA 4HTGA 1URDA 3ILTB 2HZLA 4R6YA 2HZKA 3TQLA 1EZPA 1MH4A 1PSDA 4NMYA 2AL4A 1RWUA 1IXHA 2G93A 4YB7A 1LK7A 3PUZE 3SEWA 3RY3A 2ZNUA 4HCWA 3W15C 5DVFA 2XXYA 4YAHX 4F3PA 3W7BA 3PUYE 1QUKA 4EXKA 3MW0A 2PYYA 4H5FA 2H9ZA 2QS3A 1OLAA 4Q0CA 4DZ1A 1EU8A 1JEVA 3TTRA 2OZZA 2XHDA 3MBPA 3DP8A 2ANJA 1LAHE 3I3VA 2DYXA 1UTBA 2V93A 4U23A 3S9NC 4IB2A 2VP1A 1JETA 1ZIUA 1MXUA 4IO4A 1XS5A 1QULA 3OFGA 1I69A 4AQ4A 2O6AA 1Y1MA 4H5GA 2RC7A 4KYSA 4JDFA 2F78A 1LLSA 1LFHA 5TPAB 5I56B 1GTKA 1TT1A 1FQBA 4QFNA 1XVXA 4GO5X 2PT1A 2X7PA 3IOVA 3IOUA 3SETA 2OWTA 3FV1A 2XXXA 1PDAA 4JWOA 1YCJA 5B7DA 1SW1A 4YMAA 4WKMA 2KO1A 1P1UA 5IT0A 3QSLA 4OHNA 3FIRA 3PUVE 2I6EA 4GOTA 3CG3A 4OYVA 4RPOA 2NVUB 3G3JA 3MPLA 4DIGA 5ISUA 3PPPA 4OETA 4H67A 1N7XA 1I6BA 2NXOA 1XC1A 1O63A 2GRVA 3M3FA 1Y20A 5IAIA 1B3EA 1IITA 4R75A 2DWIA 1R1NA 3IXQA 3N26A 1N0TA 5HPQA 2XXQA 3O1LA 5H8HA 5I57A 1SQYA 5HBCA 3OO6A 5I59B 2D5WA 4R73A 2I49A 3WAFA 2IA4A 4IGRA 4GMKA 2HCAA 5KCJA 1Z7ME 2HAVA 2OCUA 5AA1A 1ZU0A 3G7WA 1N84A 5FHMA 3TCHA 4MLQA 3MVXA 2Y7KA 3SEYA 2F34A 3VVFA 3V83A 4QSCA 3CFXA 3U7JA 1P1QA 3SERA 4RK2A 4IO5A 2HEUA 4G2ZA 2OLBA 2R71A 5KDTA 1H3DA 3SKPA 3FVKA 1UJ6A 3TQWA 3QAXA 3O28A 4M1VA 4NF4A 4GLIA 4LQ5A 5CRYA 3IO6A 1AIVA 4NF5A 1URGA 1HSLA 3B6TA 2ZNSA 1B3GA 1EZ9A 4Z7EA 5F1QA 4I1DA 3EHSA 1L5TA 4YB6A 1FQAA 3G3HA 1MM6A 3OFFA 5CC2A 3VDFA 2Z22A 3KOSA 4G8NA 3T96B 3RPWA 4QFPA 2DE4A 3H6VA 1MS7A 2ZYNA 5I2KB 3M3KA 5ICTA 3W9VA 2A5TB 3O97A 2GH9A 1N04A 1QVSA 3U94A 2DWHA 5TP9B 4EDPA 3TTMA 3F11A 4PFUA 3T9VA 3PUXE 5DT6A 4NF6A 3HSTA 4FAJA 4FEDA 4ELRA 3OOAA 1B5HA 1S7YA 5I56A 4ONYA 3CSBA 3B6WA 3DC2A 2F1FA 2NUVA 4PP0A 5BUUA 2DOJA 3E9XA 5CMMA 1M0SA 2Q88A 2ALUA 4EF2A 4GRKA 1SW2A 4JSOA 2P1SA 2V84A 3TTLA 4BDNA 2UVIA 4GD5A 3FV2A 2J0XA 1VFEA 3MVYA 4KCCA 4I62A 2RQMA 2FA7A 1M5DA 3T9XB 3ZKKA 1JVXA 1CE2A 3FVOA 4G77A 2DXYA 1LKZA 1JNFA 4FATA 1FQEA 1MY0A 3AAWB 3HN0A 1YTVA 1SI0A 4TOZA 3O66A 1DTZA 1MQGA 4OMBA 2RF1A 4BDLA 1JQFA 4QFOA 4YICA 3MUQA 1D3KA 4ECFA 3K1PA 2I0BA 5H8HB 2Z8EA 4MF3A 1B6HA 2QL3A 4YU0A 3CRBA 4LZ7A 1ZLQA 1XTZA 3RT8A 5IKBA 2ZNTA 4F31B 4ZZEA 5I2NA 2I4CA 1MDQA 1I6AA 3KN8A 1OLCA 2RCBA 1SDXA 5FHNA 1NMUA 1IEJA 1SW5A 3UORA 2PVUA 4Q8RA 3S9MC 2OJTA 2GHBA 5CBSA 3VXCA 4O3BA 2Q8JA 4IGTA 2G29A 4TLLB 4WEDA 4K3FA 4ZE9A 3ENWA 1PBQA 3TYHA 5B70A 2R6GE 3RN8A 1LAFE 3L6HA 5H8QA 4OQOA 3KJ7A 4OFJA 5T41A 2F7BA 5JEIA 3TCGA 4H1XA 4R6HA 3U93A 4UA8A 3RUMA 3FXQA 3K01A 3G3KA 3KEIA 3EN3A 4FECA 4QFKA 1USYH 4GL8A 4C1UA 5L9OA 3T93B 1FQCA 4NF8A 2I4BA 2ZXTA 2HFBA 1IXIA 3VLWA 2F7AA 3P7IA 1VR5A 4QSDA 4ZEKA 1B7UA 5K2YA 2QSXA 3C34A 1B1XA 2O51A 4RA1A 3U92A 3HPIA 4XKPA 3R7XA 2E0SA 3SEXA 2P9CA 1LBBA 1LGBC 2A5TA 3ODBA 1N3XA 2Q2CA 3BFUA 4N6PA 1B3FA 1TWYA 2DXRA 3O6HA 5FIIA 3CR9A 3HV1A 3K1MA 4NF6B 3LUYA 2RCAA 4F18A 4IY6A 4X1BA 1Y3PA 2PMSA 1GV8A 3ENVA 4ZEFA 3PMWA 1FTOA 3IB2A 3DP6A 4X84A 2GFEA 3K4UA 5I58A 1FTMA 2NOOA 2QSWA 2RC8A 2UXAA 4QHQA 3O6GA 1D9VA 3P96A 1PB7A 1ELJA 1Z7NE 3C31A 3IB0A 3T66A 1YGYA 2THIA 4EF1A 3ZSFA 3O9PA 3CFZA 1UJ5A 3L6GA 1KS2A 3HHGA 4OXVA 4BDRA 3B7DA 3MAMA 3MP1A 3C35A 1UTHB 1TFDA 2H25A 5F7VA 2E1SA 1S50A 2P2AA 4OZ9A 5J1DA 1B5IA 2MDAA 3PV0E 4Q5TA 3PU5A 4ZEIA 4BDQA 3H6UA 4KHZE 4POXA 5H8NB 4MLVA 5FTHA 3LSLA 1LFIA 4HCYA 2Q89A 1HSJA 1T0KA 1PBPA 4I8CA 2F97A 3MPKA 2V3QA 4F29A 1Y3QA 5DVJA 5I2NB 3OENA 1MY2A 4KD5A 1Q1KA 3KSJA 4JSDA 4G68A 4GWOA 3GLBA 3PGFA 1US5A 2O69A 3K6UA 3HHFA 3DLNA 5AA4A 1B3HA 3EPEA 2Y7IA 1DPPA 1B52A 3MC2A 1SBPA 2I0CA 1P1NA 3OO7A 1Y4CA 1H76A 4PETA 4U1ZA 3Q27A 3MVWA 5H8FB 1ZTYA 3CIJA 2DE3A 4HS7A 1H43A 1WODA 1MXXA 3IOTA 3R26A 3QUFA 3DHWC 1P1WA 1DMBA 2QS2A 3OD7A 3K0VA 2PT2A 1M5EA 2D21A 2FGCA 3G3GA 1WDNA 4NF8B 1LB8A 4LONB 1O64A 3U72A 3FVGA 4F2QA 4KYEA 3K5PA 3IO4A 3R6UA 1QUJA 1QJMA 4H6DA 1R9LA 1M5BA 1LCFA 4DLDA 2Z8DA 1A99A 1AL3A 5TPAA 2IEEA 3H06B 2H99A 4JB7A 2PX1A 1B5JA 3UA8A 5KZTA 5DEXA 1EH3A 3DELB 3VXBA 3KSXA 1H44A 3SEVA 1QW0A 3OBIA 3PPOA 3FJ7A 1R6ZA 1B58A 3KN3A 5DVIA 1USYE 1MH3A 1N7WA 3FXUA 5AA2D 4C1TA 3PPNA 1XT8A 4YMBA 3UIFA 5DTBA 2RQKA 4PE5B 2FYIA 5EYFA 1LSTA 2F6PA 2O7IA 5M2VA 5AA2A 2HXWA 2F36A 4MH5A 4PFYA 2KLFA 4LQ2A 3K6WA 1ZPVA 1RKMA 3FUZA 3K1NA 4FE8A 5I57B 1B9JA 4ZS9A 1OMPA 2A5SA 3HCQA 1ZJLA 3FJMA 1B0LA 4U4SA 1U8SA 1D4NA 2H4IA 4IO3A 2F35A 3A09A 1MXYA 2V3TA 1JEUA 4E0WA 3KZGA 1FW0A 1A54A 3V89B 4G8HA 4R9FA 2F5XA 5H8NA 2RINA 4FORA 3RGYA 2QJEA 1SVXB 4KYDA 3TEPA 3UK4A 1QKBA 4X1DA 1MDP1 1UTBB 1SYHA 3IX1A 3IJXB 4G68C 3VVEA 2XXHA 2DVZA 1VFDA 2CZLA 4DXCA 2AIXA 3MZ9A 3AB2B 1MXWA 4P11A 4R2BA 2AL5A 2V3UA 4EQBA 4YKJA 1B7HA 1YAEA 2F8DA 4QF9A 4GVOA 1PEBA 4N13A 1ZMGA 4NF4B 5AA4B 4GQOA 5I84A 3D4GA 3RT6B 5CMKA 1MQDA 1MM7A 2ZMBA 3E4RA 3CFLA 4IO2A 4EUOA 1NH8A 1A55A 3FGSA 4LZ5A 2P9GA 3O29A 3QUJA 3RNNA 3LC8A 4KPTA 4OVJA 3VV5A 5ITPA 3L7OA 4OTEA 2XXVA 4FEBA 5JJBA 5JTYB 3IAZA 3TELA 3KWMA 2XXIA 1MQJA 1M5FA 2UVHA 2ESNA 4OERA 1MXZA 2V25A 3FASA 4DDDA 3OFHA 3W9WA 3IR1A 2M8CA 4XTCQ 4RJZA 3MZ1A 2RC9A 3HHEA 1N3WA 4E0XA 1POTA 3GXAA 3MZBA 3D4CA 3G3FA 4H65A 2XX8A 3KBRA 3PMVA 3OO9A 2DWAA 1WVJA 4NMLA 4O3CA 2LVWA 2R9JA 4YB5A 1URSA 1B32A 2XX9A 3ENQA 3U1OA 1QUIA 1B4ZA 3C4MA 3S2VA 4IO7A 5FTIA 1B51A 4Z0IA 1J1NA 2ZYOA 4QSEA 4NEDA 3ZS6A 2QRYA 4U2RA 4PFTA 5HM4B 4OENA 3K2DA 2JOQA 5ITOA 1UIUA 3LSWA 3OFEA 1Y7PA 3IJOB 3TUZC 1MRPA 4RXLA 1AH5A 4G68B 4OFOA 5KDTB 1P1OA 2X7QA 3I6VA 2UYFA 3H4ZA 1Y4TA 4XKRA 3IORA 1GR2A 3OSQA 3LR1A 4IO6A 2YLNA 2O68A 5A5XA 3VLUA 3THIA 1TXFA 4KCDA 5KCJB 4LZ8A 3PUWE 5ELVA 3TUIC 1BTJA 1IXGA 2QMXA 4RK9A 1N76A 3EQ1A 4G4PA 4F19A 2VD2A 4WEPA 1S9TA 4AB5A 4KR5A 2PC6A 3Q26A 1FTKA 4U22A 4OEUA 3QIMA 1AOVA 4L17A 4XKNA 2REJA 1SYIA 4ZDMA 1O7TA 2DT9A 1A8FA 5JK4A 3PMXA 4LA9A 4P0GA 5IS2A 3BKIB 3MP6A 1XVYA 3IOWA 1ZKBA 2ZYMA 4R6KA 4R74A 4C0RA 4NWDA 2DS9A 1R9QA 2XXWA 2D3IA 1FCKA 3I5OA 5IT4A 3MJNA 1MPCA 5TU0A 4R72A 1JW1A 5DEXB 4LUBA 4DE8A 4XIGQ 3UN6A 5L9MA 2WKYA 1Y3NA 3O6IA 1GVCA 2LAOA 2Q9TA 1LAGE 3MWBA 1LK5A 3EHUA 4F39A 3E3KA 1NFTA 1JW5A 2W7YA 1EZOA 3BFTA 4DXUA 1BLFA 2Q2AA 4R9GA 3HO7A 4YKIA 4OESA 4YKPA 4FIMA 1FTJA 4ESWA 3OSRA 4ZZAA 2O1MA 3FZVA 3T9UA 3FD3A 5AA3A 4POWA 4F1YA 4AB6A 1SC6A 2UVGA 2ONRA 2OK2A 1PC3A 5CMCA 1B40A 2BJJX 4BDMA 2O7UA 4WXJA 1OIBA 1MXVA 3TKDA 3Q29A 2H98A 4EXLA 1NNTA 2VHAA 3TUJC 3AB4B 4OEVA 5ICQA 4ELPA 3RTWB 3Q25A 2Y84A 3QXMA 4THIA 4ZEBA 3ONMA 4F1VA 3ECRA 1RYXA 2P9EA 3A3UA 1M5CA 3PPRA 3V5AA 1MPDA 1MY4A 2RE1A 4OFLA 1MY3A 4U21A 1MG1A 4BLAA 1POY1 4X48A 1PB9A 1VE4A 1XOCA 5L9SA 3H6WA 1OVBA 4LATA 4GO7X 1OQGA 2H5YA 2VGQA 3H3GA 4QFLA 3MVZA 2Y7WA 3TODA 3TMGA 4I9DA 1B7ZA 3MTJA 3CI8A 1B2HA 3FVNA 3NRBA 3ZKLA 2XX7A 5CBRA 4NF5B 2VOZA 2JHEA 1YBAA 3FXRA 1F9BA 3TFLA 1LAXA 4ISUA 5L8DA 1CB6A 2DSFA 3KJTA 3RLFE 3C9HA 4YKKA 3USDA 2HAUA 3UW1A 1AMFA 3S1TA 1BP5A 4ZECA 1IUDA 2F7CA 1TFAA 2XD2A 3H6TA 2I58A 3O2AA 3VFJA 2YJPA 3UGWA 3KFMA 4YZZA 4M4GA 4ELOA 5I2KA 3QYTA 1IXCA 4X9TA 2RKMA 2H9BA 1Y1ZA 1RYOA 3H7MA 5H8QB 2Z23A 5TP9A 3TAJA 1YPNA 4F22A 3EHTA 4GIZA 4QRZA 4F3BA 4JXIA 1UQWA 4H0WA 3S9LC 4DCYA 1A7LA 2DVCA 3MAHA 3GBAA 2DE2A 1UJ4A 1NL5A 3M3LA 4O3AA 3M8UA 4Q30B 4H8JA 3IL1B 2AYSA 1II5A 1SW4A 2DQVA 1D9YA 4UACA 3FATA 4G8MA 2ZHOA 1IZ1A 4XXUA 1MY1A 3IB1A 2UVJA 4JWYA 1B0HA 4P0IA 1NH7A 2J0WA 4NE4A 1MQHA 3RTFB 1MPBA 2I48A 2B3FA 3CEDA 1FTLA 3DHXA 1ANFA 1UTHA 2PBWA 2QS4A 3KN7A 2XXUA 3K6VA 2QMWA 4ZEDA 2DTJA 1MQIA 3IK6B 2XD3A 3K6XA 5H8SA 1NNPA 4F2OA 1SI1A 3C33A 4LVQA 1OVTA 2XXRA 1DTGA 4OWDA 3WAEA 2PA3A 1GGGA 3TCFA 3U8QA 3EF7A 4KQPA
chains in the Genus database with same CATH superfamily
3LO3A 4GF8A 2OWSA 4ELQA 4FF2A 2RIJA 1ZBMA 5AA2B 1HHTP 2ZOGA 4BLGA 1TL3B 1GMWA 1PKUA 3Q8VA 5KFUA 3KLGA 2FLOA 4P75A 4KRWA 5LM7E 1Q0NA 3CGIA 4OIXA 4GXAA 3DDKA 4DUYJ 3P6YC 5CH7B 4ES1A 1KHWA 4NWCA 4RY1A 1HQEA 1UP1A 5EDWA 1KWMA 4ZPAA 4PQUB 3CMES 4GKKJ 3JSRA 1IMFA 1RBLA 1H6KX 4P7VA 3RJMB 5F0UA 2XXPA 1OQ6A 4JBZA 4IDKA 3RGIA 3CCMS 1HBOB 1Y9UA 4AS4A 3ILIA 5LTCA 2MY8A 3TA2A 4H4OA 2YPNA 3LGNA 1JJ4A 5I3UA 4R2FA 3PD8A 2UVVA 4E2FB 1UVJA 5KG0A 2N3OA 3OEKA 3OUYA 3V8XB 4NA2A 1CJKB 4OV6A 4I3EA 1Q35A 4NI2B 3H8YA 9RUBA 5DGAA 2QS1A 2J8SA 4P56A 5CI5A 1T05A 2JEJA 2I5JB 4EQ9A 2Y7RA 4GXSB 3F73A 2B4UA 2BRLA 4X4RA 4BCAA 2VD3A 4ECZA 3J80U 5DQGA 1KWHA 5A6PA 3QYYA 4CO4A 2LDIA 4PWUA 1UZHA 3ILUB 3DFEA 1NHKL 1LW0A 3H5XA 1DOTA 5KFPA 4PFBA 5G4DA 4KH0B 2FY1A 3DM2B 1NNKA 2ZE2A 2HXRA 5KT5A 2BE9B 2LEAA 3KOTA 2XWXA 4KV8B 4CWBA 1TV6A 1VFJA 1JW4A 2GC8A 2ONKE 1LNQA 5JTYA 1KVJA 3D0GE 3MM6A 4FF3A 3T22A 1IQ7A 3KGCA 5AXLA 2DH9A 2UXBF 3C36A 3HFVA 1ZM2A 2F3BA 4PQJA 3K02A 4DZDA 1FRJA 2VV5A 2PMWA 3TDJA 1MNEA 3AD9C 1KQGB 1R8AA 3G2XA 4PG4A 2ZJRQ 4MBPA 4HE2A 2FIUA 2B65A 1LB9A 2BABA 4FYVB 3MP8A 2P0SA 1HWUA 4MIWA 5I59A 5ETTA 2CDQA 3Q22A 2F63A 4RW4A 4CLZA 1QKAA 3T1BA 5KT6A 2C2RA 4MMPA 1HNIA 1XHYA 1PJ6A 4A48A 4KGZB 1RTIB 2MKYA 2C3UA 3T19A 5IXUA 1NB2A 2AW0A 2K8GA 4PUOA 5BWJA 3QK6A 3H42A 1FPFA 4JP8A 4JI2J 2G13A 2BQRA 3KDNA 3CJQA 1HIYA 1UVNA 2O1LA 3OVAA 2ZVSA 3CB4A 4KT0C 2FVCA 2A1BA 5EHSA 3SDEB 3VAIA 4BWJA 4AL7A 1HPZB 5DQIA 5J1NA 2NQPA 4F36A 5ETQA 1UFKA 1N0UA 2ZBPA 1ATGA 3UI3A 5J2QB 4HTGA 1URDA 3VAKA 4R6YA 1FBCA 3CDBA 5GAGU 2NSBA 5EUHA 2RQCA 2UU9F 5IM0B 2B4MA 1RWUA 4KIAA 2EFPA 4YB7A 1NSAA 4J9NA 2K3KA 2ZUGA 4YAHX 3JQJA 3POTB 4YOEA 3KC1A 1U7LA 3L9ZA 3ET6A 3PUYE 2JWNA 1QUKA 4EXKA 2J6SA 3HSDA 1T9WA 4TXSA 5JMNA 4PWDB 4R0JA 4Q0CA 2VFSA 1REGX 2VICA 3A8JA 3TTRA 1EP4A 5DZ7A 2ANJA 1C1BB 2EI5A 4OHVA 4ILRA 5HMZA 2DYXA 3KJNB 1LFWA 4PBQA 2RS8A 3CCUS 1X5OA 3NG8A 1N5SA 1K9ZA 1JETA 3BGFA 2AJFE 1TL7B 1DJ0A 1KBRA 3KJFB 3ILOA 4EZ9A 1VBXA 1FK9B 4L3KA 3RUBL 1CBKA 4EYIB 2QFJA 1RU2A 3ZZYA 2WTFA 1MU2A 1YJWS 5TPAB 4HI2A 4M5KA 3VALA 3KUGA 1E6VA 1TT1A 4DV1J 1WHXA 3MMAA 4ECWA 2QLBB 1S7IA 2PFZA 3FFIB 2PT1A 3GMGA 5DETA 2KT3A 2LQ8A 2XLKA 4RUAA 3FV1A 3K89A 3VHQA 1IWAA 4X4QA 4I40A 4GWUA 2OHDA 2DD8S 2XXXA 3BPSP 3BBCA 1U48A 2F9DA 5B7DA 4WKMA 2UP1A 4KGVB 4K0KJ 2ZJQQ 3FIRA 2HG4A 2VFVA 2I6EA 2FHYA 4GOTA 2NVUB 3KK2A 1FPGA 1CJVB 4G65A 4BBYA 5ISUA 4H67A 1AT1B 1I6BA 1FA0A 4OVTA 4ZJOA 3C6UB 1O63A 1S1XA 3CT9A 1BY9A 1RDYA 1Y20A 1IITA 4R75A 3IXQA 5H9FK 3KTQA 4C0HA 1N0TA 5HPQA 5H8HA 2XMTA 3KK1B 5AE3A 1SQYA 1S57A 3WX8A 5HBCA 2D5WA 4R73A 3I55S 1FPJA 1W25A 1T9TA 1VGYA 5KCJA 5L1JA 4CRJA 3MD1A 4NXMF 5AA1A 4R8UA 1ZU0A 5HP1B 3G7WA 2AYBA 1J27A 1IKXB 2ZWOA 3FGVA 2Y7KA 3SEYA 1YLXA 3RW7A 4QSCA 4ED0A 2MLYA 4DSEA 1P1QA 1CVJA 1EETA 1CS4A 5I42A 2M88A 3DMJB 3SERA 1SUQB 4ELUA 4DQRA 3EGZA 4G2ZA 2OLBA 4OVSA 5KDTA 4PAKA 2DGSA 1FJ7A 2BJDA 3FVKA 1Z2ZA 3QAXA 2ZH9A 1FBGA 4QJVA 4MJKA 2HNYB 3TAPA 3FEXB 4Z7EA 2OLWA 2O66A 2KM8C 4I1DA 1S1UA 1L5TA 5CYJA 3NBPA 4P73A 2WVBA 1MM6A 1BQXA 3QGPA 3OFFA 1R8PA 3T1HJ 2VG6A 2F4FA 4IR8A 4G8NA 1AFJA 1KDNA 2CQHA 1W2IA 2CQBA 4AL5A 4ZP6A 3CIZA 2A5TB 2KDOA 4Z7CA 3O97A 1RTDA 2B4OA 4ZS6A 1VQMS 2M52A 3I0RA 2ERRA 4B9NA 1JJHA 2DWHA 3FSXA 2AGPA 3N79A 3E01A 5E5NA 2JEGA 4NLYA 4NF6A 4B3TF 2CZ4A 3EVOA 5IZHA 4RBUA 3KNAA 1RTHA 2HS0A 4IOBA 1OMSA 4ONYA 3B6WA 3DC2A 3C14A 4YR0A 3DDIA 2R8TA 4GWWA 2IRXA 1Y9OA 4PP0A 1Q86T 2DOJA 2K1RB 4A8KA 4OYAA 2Q88A 5L9NA 4GRKA 2HVHA 3DLLQ 2P1SA 2V84A 4HR2A 1YKWA 3TTLA 2Z2MA 2UVIA 2XI3A 2I6WA 4WF9Q 3MAQA 3FV2A 2IMWP 2J0XA 4KY3A 1VFEA 3J7Z5 1A6LA 4OZ5A 3ZTSA 3PR4A 1JLGA 3MPWA 4OZNA 1T9YA 3GFZA 1KEKA 3T9XB 3N01A 2W7AA 1CE2A 4O8MA 2NXNA 4Q7AA 2W9CA 3G82A 4G77A 4P74A 1N88A 3WQPA 2CQIA 1S1TA 1KQKA 3AAWB 3HN0A 1SI0A 1FPEA 1XWLA 5CD4H 4N8YA 4AQYJ 3KLFA 3JSYA 3L4BC 4BDLA 5DG8A 3RAXA 4K0KF 4B9VA 2IVFB 3JTNA 4QFOA 3MUQA 4ECFA 3OD2A 3ITHA 5KG4A 3WHIA 2Q79A 2I0BA 2OPQA 2XWKA 4MF3A 5IZZA 2QL3A 2FHKA 3CRBA 4N4UA 2JNJA 4HXVA 4DQIA 5L1KA 1B64A 1LBVA 3RT8A 5J1EB 3BQ1A 3ROJA 2FZCB 4ZZEA 4DQPA 5I2NA 4RW9B 2H4WB 1OLCA 2RCBA 4ZLNA 2V8VA 1SW5A 4DR7J 2VF3A 3EPIA 3S9MC 4NOHA 3NCQA 3J7ZT 3G6XA 5KFLA 4M95A 1FX4A 3PRVA 3JTPA 4DV5J 2Q8JA 1FXLA 2ZH3A 2VPYB 4K3FA 2CJBA 4A4JA 2VB6A 2HQIA 2FC9A 2JJKA 2DGWA 4V19X 2LQ5A 2NYHA 4RNHA 4PG8A 1LAFE 1Q82T 1UMJA 4GWSA 2QYGA 4NN3A 5JVHQ 2I0XA 4OFJA 2R7RA 1RT5B 3EMTA 2F7BA 3D1RA 2CPYA 4R6HA 2Y8WA 3SMZA 3RUMA 2KYZA 2W01A 1WHYA 2IDEA 5E33A 1BC6A 1U0HB 1NV2A 2HAIA 1NUYA 4R5PA 2AZ3A 4RU2A 4C1UA 4I4BA 2BQUA 2XHWA 2DHAA 4QYRA 2HHWA 2GGPA 3HHLC 2YWGA 2MZSA 3VLWA 1M5SA 1F5BA 4L75A 2YH1A 1VR5A 4QSDA 3NAHA 3V4IB 2VL1A 3PHTA 3U92A 3DYAB 1KKHA 2E0SA 4BHQA 3FRYA 5C24B 1N3XA 2W4PA 3PO4A 2VG5B 2BW7A 2DXRA 2FZKB 2AMCB 1F5CA 4ECUA 1RDXA 3RG6A 3PCOB 5DLFA 2U2FA 4AT1B 2NXJA 3KLHB 4B3TJ 3LUYA 2PFFB 5G0RA 1RJJA 4OYIA 1Q5YA 4UF4A 2ZH6A 3CJ2A 3KHRA 4P3LA 1FBPA 4DFKA 4NG7A 2GVDA 3M8YA 3UWTA 3K4UA 5LDZA 2YNHA 2NOOA 3LF0A 5A6WA 2PMHA 4F25A 3WDOA 3PX4A 1UFLA 3C16B 4M5LA 3Q8QB 1X9SA 3P96A 1X5TA 3HDSA 4HI1A 3VWSA 4JI1F 1N54B 3IB0A 3MCSA 3NOGA 1NJZA 1YGYA 4EF1A 2CPJA 2R8JA 2XMMA 1HWKA 3L6GA 4USTA 3M2VA 4CI0B 4OXVA 1E6YA 2WAQD 4O3QA 2WCXA 2J9EA 2H25A 5HQMA 4JV0A 3KJVA 1FJ6A 1R8BA 2J5AA 4F67A 4ZEIA 2PN6A 1A0OB 1FKPB 2D69A 1ROFA 4A8OA 1IMAA 1LBYA 4MLVA 5FTHA 3V81A 3LSLA 4ECYA 1SCJB 1NK0A 1DLOB 1NSQA 5BJRA 1PBPA 2HGLA 1QTNB 4C7QA 4F29A 2KT5A 1IMCA 4N41A 2DRBA 1RHKB 5DVJA 1FTCA 2BE2A 3OENA 3D6MB 4KD5A 4QZVB 1Q1KA 2MYFA 1B99A 1L3KA 4JSDA 4J7CA 4G68A 4MJOA 1IXKA 4ZN3A 4GWOA 2F8HA 1QSSA 1X4AA 2HVIA 1US5A 2O69A 3K6UA 5JVGQ 1NUZA 1WHWA 5KFGA 1IQZA 2BANB 2Y7IA 5EN1A 4NGUA 5KG7A 2CQGA 1V6HA 2R7OA 1RWOB 3R5AA 2VPNA 5HVGA 2VKZG 4YP3A 3OPKA 3MVWA 4Q0BA 5H8FB 1XQIA 4DWIA 5LT5A 2V9WA 2XS5A 3UQSA 1H43A 2CYYA 2P5VA 4DV6F 4NLGA 3PW5A 3KG4A 5GAEI 4OJGA 3R26A 3QUFA 3DHWC 4KQZA 3ZTRA 2QS2A 4I6WA 1R7IA 1OJ4A 3K0VA 5A8KB 2BKPA 4OI6A 1J5EF 2OIHA 3T5JA 3P49B 4KPCA 3NGDA 1F2GA 4I0WA 2ZH1A 1NK5A 2QA4G 3U72A 1VQKS 3CCWA 1M1KT 4M5DB 4KYEA 3K5PA 4QWEA 1KNZA 2WBBA 4IFYA 3R6UA 4QWBA 2KZMA 3PNIA 3US5A 3ZTPA 4W92B 4GX3A 2Z8DA 2FJBB 3VVTA 4JB7A 2PX1A 2HW3A 5IM2A 3I4PA 1SIWB 2JFKA 5FDLA 5DEXA 1U02A 2XGQA 3PRDA 5A8RB 3F41A 4TVAB 3LP1A 1QW0A 5RUBA 4ICLA 3PW7A 1QVGR 4C8MA 1J2VA 4A8SA 3BGUA 5D78A 4X4SA 2FYIA 4OJHA 2YNGA 1GEHA 1RBAA 4PXCA 4CH7A 5CYMA 5LXYA 4OZ3A 3RRHA 2XSJA 2IBKA 2HXWA 4LIWA 1UKUA 3E3XA 1QSYA 3CJ3A 1VC6A 1B9JA 4ZS9A 2GAHC 1HNVA 1OMPA 1W2BR 3T5LA 3QSYB 3CMQA 3A3OB 1RHRB 8AT1B 1FPLA 3FJMA 2CJKA 2M9KA 4U4SA 3Q8YA 3OTBA 3OW2R 1U8SA 1YZ7A 2HNZB 2LU1A 5KFQA 1D4NA 2H4IA 4IO3A 2F35A 3DOLA 4WIIA 1IMDA 2V3TA 4UT4A 2CVEA 1FW0A 5F24A 2V4CA 3CCVS 3BDPA 4N6DA 4YB1P 1CSJA 3LPYA 4FORA 1JLFA 2KXHA 3UD4P 4I7FA 2XWYA 4OX7A 4MHFA 3FUYA 4KH1B 1UTBB 1C4AA 1LWFB 5AT1B 1PC5A 2CZLA 3ZZ0A 3ICLA 1XNQF 3NMAA 3TUPA 2V3UA 5C42B 3UR0A 4YKJA 4DX6A 4EQBA 2C2OB 4J9UE 1YAEA 2LLZA 1MG7A 1TL1A 1PEBA 3I56S 1ZMGA 2H3EB 4GQOA 2XTJP 3RT6B 3CJ4A 4KGXB 3DGVA 3HVWA 2Y9HA 4L74A 5CZVA 4YFUA 3ISND 5CD4A 1FNXH 1Q8BA 3GIIA 3CFLA 2EK1A 4EUOA 1NH8A 3D66A 2DPJA 1S6PA 3FGSA 1FRXA 5KFMA 2VJVA 1HHQA 3AA8A 3QUJA 3QAUA 4PXDA 2B4VA 1U0SA 4KPTA 1HQ2A 2BV3A 4ZKAA 3F56A 4FXWA 3IR7B 3LWMA 5FJ4A 4YUDA 1XN9A 4TY8A 4KFBB 2HLTA 1LBXA 2UXCF 4J9PA 2QLJB 3SQOP 4PDDA 2YXLA 1PYTA 4FEBA 5JJBA 3PJWA 1SH3A 3PIOQ 3IAZA 3TELA 2UVHA 1IM6A 2JZ5A 3E8OA 3CC4S 4OERA 3QMQA 5D3GB 4EFAC 3EVWA 3IR1A 4ECSA 4J9RA 4LFBJ 3KYLA 3DKDA 1NKCA 3OHBA 2RC9A 4E0XA 2C2MB 1N34F 3D4CA 4H65A 2JC0A 1CC8A 2FPHX 3PX6A 2F40A 3CC7S 4ED2A 4JI3F 5ETPA 1NK7A 2ZOFA 2WYPA 3QLHB 4I2PA 3M1VB 1QUIA 1B4ZA 4QBAA 3DLKA 4A8WA 1H7XA 5B0AA 4D3GA 2GMHA 2ZYOA 4ZCMA 1QE1A 1Y5LB 3FBFA 1AB8A 2B51A 1KOOA 1KN6A 3BGOP 4PFTA 2HYIB 1TUVA 5HK4A 3QIPB 4RKUC 1WKLA 4AYBD 3OFEA 3TJ9A 4JI6F 5LXRA 1MRPA 2MQOA 4RXLA 1XNQJ 1VOMA 2YKPA 4FVMA 2GMJA 1RB0A 4DN9A 2XMAA 2BOPA 4TN2A 2Q6CA 4ES3A 3H5SA 5F3TA 2YTCA 4MIAA 4X62F 2JLGA 2PA8D 5A5XA 3VLUA 1HLWA 2MEWA 1QAXA 4CT9A 4LZ8A 5ELVA 3TUIC 1IXGA 4OL8A 1S0OA 4OLOA 4MNCA 4CZCA 2QMXA 4N17A 2JX2A 4RK9A 1NK8A 3ENAA 1U8WA 2VD2A 4JV1A 2D1CA 4KB7A 4G61A 4YHHJ 4XAKA 4U22A 3A29A 3BSCA 4I64A 3QIMA 1AOVA 4WKRA 4K5RA 4L17A 4CLKA 2EG2A 1T9XA 5CCMA 3CXCR 2V67A 1KQSR 3QT5A 2HVEA 3GFHA 2UVUA 2ROGA 4DPUA 1D9QA 1YJTA 4PCDA 5JK4A 1JLBB 1WUUA 5IS2A 2CG4A 3BKIB 3GZ7A 1LWEA 2XZTB 3FQLA 1ZKBA 4K4XA 4C0RA 1AZSB 2PI4A 4C98A 2VDHA 1IM4A 4B3SF 4WZQA 5TU0A 5MLCV 1JW1A 1NMEB 2FZGB 1DTQB 1H73A 2W24A 3SV4A 4JV5J 4QXDA 1Y3NA 3O6IA 1VIOA 3I9ZA 3PY8A 1VQ8S 3W2WA 2XGPA 2L08A 5KT3A 3EHUA 1KLMA 4DL0C 2P3VA 4Z37A 2V4RA 3UN5A 5B0CA 3AQPA 2IRYA 1WC6A 2PDAA 4DXUA 1FWPA 2Q2AA 4NE9C 4YKIA 4R0EA 4NZ0A 4J9SA 2M8HA 4YKPA 2HSEB 5AE1A 4LF6F 4FIMA 2E5IA 4H45A 3CD5A 3THPA 4ZZAA 1WOSA 4A8QA 2LQ9A 1M90T 1FFGB 1TK5A 1QM9A 3MMCB 2PEBA 1RU1A 2KVIA 1J5EJ 4N6KA 1BE4A 4YMEA 4POWA 4F1YA 1INPA 3DRYA 3UDLA 1SC6A 5T14A 2UVGA 2CXEA 3FMBA 1PC3A 3HI9A 2BJJX 3MEEA 2AZ1A 3CCQS 4F4XA 1YRTA 3MM5A 3Q29A 1S49A 2XO6A 1YITS 3L3CA 4X4VA 2VHAA 1VS3A 1JWWA 3RTWB 3Q25A 3HHKA 3QXMA 4THIA 4PAFA 4ZEBA 3B8HA 3VGUA 3S6EA 3UNYA 3GTYX 3KKFA 3TNVA 3A3UA 2M4MA 1T11A 3KLGB 1YJ7A 3MM8A 3OQ2A 3PPRA 3JSMA 2W2OP 4DV4F 1T7PA 1ZZFA 5HROA 3QRRA 5HBMA 2H5JB 4X48A 2VFUA 1XMQF 4ERDA 1SQGA 4I6AA 3QT7A 2R7SA 5L9SA 3H6WA 3CIMA 4PQUA 4GO7X 1OQGA 3SI8A 4GKKF 2FY8A 5SUHA 3C66A 2VGQA 4N15A 3H3GA 3MVZA 2Y7WA 3TODA 1OSCA 5GMKa 3T0JA 4IDKB 4I9DA 3ILLA 1HBOA 4DSIA 4I3YA 4MH8A 2E7WA 2L3MA 3OLBA 2DRAA 2GIRA 4ZVSB 3A1YG 4USVA 2OI2A 2CNNB 3FXRA 3FJ2A 1F9BA 4ISUA 3DLEA 1WC0A 5DJBA 1CB6A 2YWKA 1HBMA 1AMFA 1UZDA 3KFWX 2Z56B 3G8TA 1G4CA 5AJ3F 1AXQA 4CCHA 4QW9A 3OUYB 1IUDA 2XD2A 3SCIE 2CPZA 1SKRA 4YS2A 4H54A 3HO1A 5HN0A 4M4GA 2W1BA 5I2KA 3BQ2A 3V6DB 1LW2A 4X9TA 2E66A 2AGQA 3HXMA 3PV8A 3F44A 3H7MA 4KKOB 3TAJA 1Q5VA 2HZCA 3MM7A 4F22A 4F3BA 2A0FB 1JQGA 2KVQE 4NA3A 3PYDA 3MPYA 1NL5A 2ZDPA 2EFQA 4DPXA 2HWIA 4HH1A 1ITPA 2OPRB 1NAQA 4Q30B 1FBDA 4ZIVA 4ED5A 2OFGX 4PRFA 4UACA 5A8WB 4MIBA 5HLFB 1HMVA 4JI7J 1MY1A 3OV7A 4JWYA 1B0HA 1UVKA 4LBIA 1X9WA 4ZJQA 1NH7A 4NE4A 1MQHA 5DDRC 2R8GA 1MPBA 2I48A 3TZYA 3CEDA 1UTHA 1NV6A 2PBWA 3D5MA 2XXUA 2NZCA 1NPRA 1RWNB 4GX4A 2CWKA 3CWJA 3TJ8A 4WFXA 1RTIA 1MQIA 2LP4A 2R8HA 4J9OA 5H8SA 4N91A 2SXLA 3TZZA 2DIUA 4F2OA 1S59A 5B09A 1DTGA 2MQMA 3VVUA 4NCGB 3NY0A 4NX1A 4MNPA 2CQ4A 4N77A 3CD0A 2Y1JA 2GO9A 2QN6B 3A3PB 2EKYA 3P45B 1HNXF 3FJGA 2AJQA 4HACA 3HULA 3N94A 4U8VA 2GZOA 2HRUA 4H8IA 3M2UB 3CVGA 2PO4A 2MSSA 4HE1A 3AJDA 2J0QD 3JZJA 4RPFA 5KTQA 4DXBA 2CQ0A 4UOGA 5CM6A 3FBBA 4KI0E 3HHDA 3KNGA 7AT1B 1NNFA 3GR0A 4JI5F 5HATA 3GIRA 3DDNA 2B3BA 4KYZA 1K9MT 2IM3A 4BDOA 3CCJS 1P99A 3RAQA 1YTYA 4P52A 1M5KC 1SVDA 1HARA 1BQMA 3G4SS 4DUZF 4X8RA 4WFAQ 4MAKA 2HQGA 1O8BA 1M5HA 2UUBJ 2Y1IA 3VLVA 5AE4A 4DDFA 1O5JA 4GVLA 2AYMA 1I6QA 2FJEB 3M6XA 3RPLB 4O4GA 4DV7J 4QCLA 3EUNA 4O7IA 2HWHA 1VMBA 5K14A 3TZAA 1Q95G 4IY5A 4GL0A 2ZDOA 2NWJA 1UWAA 3I5AA 4ZE8A 1WORA 3N5BA 4K2XA 1WKJA 4LF7J 1VRUB 2ONSA 5CYQB 1SJ1A 1R0AA 4EQ7A 1RBOB 1FEEA 2QSFA 1U47A 1QLNA 3VGVA 4RUHA 3GJTB 4O94A 2GIQA 4S0MA 5D4LA 1FJEB 3N0VA 1JLQB 1VQSA 5KFVA 2ZJPQ 5CMBA 2EKNA 3ILJA 2I3VA 2JLFA 3CCLS 2Y7PA 4HE0A 4OYBA 1PO6A 5CA5A 1S1WA 1XC9A 2V6AA 1I3OB 1I94F 3LBSA 3PKMA 3GBBA 5F9LA 2BJ8A 2DPIA 3A8EA 3TPAA 3TVZA 4FBPA 3T1YJ 2MSTA 1DPEA 4X64F 3JV9A 1HR0F 4KHPJ 1KTQA 1AUDA 5I58B 4IKAA 4BC9A 3KLEA 1B1HA 4W4MA 1OPZA 4YY3F 1DRZA 5IQQA 4OZLA 1SQFA 1U26A 4NASA 4RW8A 1FDNA 3AXMA 2JLEA 5ETKA 3Q89A 1P27B 2BX6A 4JI4F 4OVPA 4UW2A 1C0TA 2DITA 1NSPA 3UP9A 1IIWA 5J1PA 1UA0A 3TAMA 4GFRA 4RPNA 3MECB 3TTNA 3LOUA 2MZ1A 2ZH4A 3LP0A 2WEFA 2VJUA 4IO1A 2OAUA 3QSIA 2F8MA 2HQCA 2N82B 5IWAJ 4R8UB 2D41A 1X7VA 4P7TA 4NXNJ 2QL7B 2DY1A 4HLBA 2UUBF 3CDWA 2LFVA 3TYTA 3MEDB 2RUGA 3UVJA 2PEHA 4RNNA 1LFGA 5I42B 4DR5J 3CJTA 3DM0A 4I67A 3S8SA 4ETXA 3EVMA 4DI6A 4PAIA 1X0FA 3C6TA 3PPQA 2X1FA 3HVTA 1UWBA 1MSWD 2DKOB 2QG9B 2HZLA 2QMUB 5IV4A 3MGJA 1OYDA 3NGSA 2H5EA 1EZPA 2XWIA 3HM9A 4M5NA 2ZM6J 1PSDA 1Q7LB 3UCZP 2AL4A 3W60A 2MQLA 1IXHA 1TU0B 2G93A 2V2VA 2FJWA 4DR6J 2BJ7A 5GAEU 5DVFA 5HAOA 3JXOA 1T8EA 1URRA 2X3GA 4M94A 4DX7A 3KG1A 1HWIA 2H9ZA 4LFCJ 1JEVA 4RWWA 1WI8A 1ULRA 5CXTA 2CJQA 2QZ8A 4FYYB 5DDOC 4C6AA 2DHGA 2V93A 3MI7X 5DG9A 1U4BA 4IB2A 4O3PA 1FO1A 3QPIA 4NLTA 2IC3A 1S9FA 4LF9J 5DO2A 1TK8A 4AQ4A 1Y1MA 2YY3A 1Z1ZA 2DBBA 1JLCA 3NGTA 3W61A 1VBYA 2RC7A 4OA4A 4JI4J 2F78A 3BYPA 5KFWA 1GTKA 4ALZA 2V34A 1RZMA 2ZITA 2HFSA 1TP7A 4LRCA 4QFNA 4JV5F 2HBYB 2A3JA 3W2VB 3IOVA 1DBZA 4USHA 4DU8A 3IOUA 3SETA 4CH0S 3TA0A 1PCAA 4O3SA 1F60B 2WW4A 4OZJA 4LBPA 5GADI 3R5GA 3NGKA 4L3NA 2UZAA 3R5DA 1S6QB 2CJ9A 2ZC3A 2KO1A 4NZ6A 1P1UA 5IT0A 4OHNA 4USKA 3PUVE 3GSIA 3CG3A 4IQMA 4RPOA 4J5OA 3IBCB 4OI3A 4G1QB 4F8RA 2X1GA 3CJKA 3MPLA 3K57A 3PPPA 1IJFB 5E3CA 4N56A 1XC1A 4DLEA 4DL7A 1S1TB 2CPFA 4C8ZA 3LV0A 3OXGA 2WK4A 1WACA 1T0TV 1OY9A 1KLNA 1KD1T 3DRSA 4I1TA 3JS9A 3JTOA 3J81U 5EWGA 3ITHB 3GWCA 2HNDB 1RA6A 5KFAA 4ZIWA 2HZAA 5I57A 3OO6A 2LMIA 4USUA 1S9GB 4IGRA 4GMKA 4O0IA 4RW9A 1R8CA 3FEYB 2C1EB 2DNZA 1ZA2B 2DK2A 2MQNA 4DUZJ 5E3PA 3D3CJ 2KRRA 4DPWA 5FHMA 4MLQA 3ZZUA 2JL9A 4UUWA 2DR5A 3VVFA 3Q8UA 3CFXA 3I5BA 1BGXT 4ILMA 1IKWA 2GJFA 1URNA 1R3NA 5B7WA 1FD2A 4X66J 4CLSA 4LF9F 3SKPA 2W8LA 2R8KA 3RBZA 3TR5A 4NF4A 3IO6A 4ZITA 4X4PA 4DR5F 4NF5A 1URGA 3MEKA 3M2RA 5KFDA 4DCPB 3GIMA 5T7LA 2BUNA 2B43A 4M5HA 2KHDA 1N5TA 2KXFA 4Y2IA 2D3OR 4ED7A 5EQ8A 1ICEB 3HJVA 3FXBA 2COLA 4P1EA 5IGAA 5CC2A 3VDFA 2VQFJ 3T1HF 4PPDA 4XIUA 1Y3KA 4YDXA 3H6VA 1MS7A 5U47A 2GVZB 4LSNA 1WF0A 1Y0HA 3M3KA 2C2EA 2BR0A 2B5JB 4UY8T 2GH9A 1N04A 2XHCA 2MKCA 1JKHA 2CNKB 5LMUF 1SC3B 1SJ3P 2CEXA 5TP9B 2E9TA 1WSVA 4PFUA 5J16A 2M7SA 4DV3F 4FAJA 1JXEA 3EZ5A 4HH0A 1HI1A 4CDIA 3I5CA 2BQ3A 1B5HA 3MXHP 2RQ4A 1S7YA 3CSBA 3CJ0A 4AXIA 2D9OA 3BGRA 2F1FA 1TL5A 2NUVA 5BUUA 2Z57B 2AKWB 4UOCA 1M0SA 3PHEA 5C25A 3FBEA 2CKWA 2PFDA 5EWEA 4MMOA 2BYCA 3QWUA 4JSOA 4NHBA 5ETNA 3QGHA 4BDNA 4GD5A 3MAAA 3MVYA 2DDKA 1MWQA 4DL4A 2OUGA 5KOXA 1R6YA 3W8GA 4DPOA 2DXYA 3HFKA 4PF6A 2VT5A 1CJUA 1FWKA 2C2KB 4PG5A 1FQEA 4N8GA 1PGZA 4ZVEA 1MY0A 2HHVA 1YTVA 1VRTB 3R2CJ 3O66A 1RAIB 1DTZA 3R7SB 3SCKE 2MB0B 1RT2A 2KL8A 4ID5A 4IG0A 4MFBB 4ZVPB 2AF6A 3P4UB 1YIJS 2FYXA 4MIJA 2YKQA 3UE2A 3CCRS 1BMQB 3K1PA 2Z8EA 1HBUA 4YY3J 1DLOA 1ZLQA 1XTZA 1U1PA 1PILA 4QIGA 2YNFA 2BXJA 2ZNTA 4QWCA 1NHUA 1RTZA 1MDQA 4HVZA 1SDXA 5GMEA 2W7OA 1NMUA 1IEJA 3HLUA 4DR7F 7FD1A 2AD9A 1LWCB 1SV5A 3RBDA 3UORA 2PVUA 2DR8A 1RT7A 2KFYA 2MPUA 4IFVA 5CBSA 1C1CB 1DQAA 1RT4A 2DNOA 2QLXA 4DV5F 2G29A 4TLLB 4KO0B 3LALA 4A8YA 4ZE9A 4JVDA 3TYHA 4NLRA 4DQSA 5B70A 3Q8PB 1DTTA 3RN8A 1NDCA 1TKZB 3KLIB 3MCNA 4NZ7A 3KJ7A 5T41A 4MTPA 3TCGA 1WI6A 2XS2A 3U93A 4QIFA 1REVB 3CO9A 3OJUA 3UN2A 1NV0A 3D6TB 4QPXA 3G3KA 4C3MA 2GIFA 1TUWA 3SIPB 2WONB 3B4MA 1TAQA 3P5TL 4DSJA 5M2PA 5F8GA 1USYH 4QIWD 3MM9A 4DG1B 1G1XA 2O3DA 3ZZOA 4WFBQ 2FVQA 1IBMF 4FPIA 4YN3B 4ZEKA 4KE5A 4ENOA 3C34A 5F41A 1D9DA 4RA1A 2VQEJ 4XKPA 4DEZA 3A13A 1RWPB 4EO8A 3IMQJ 3R7XA 5B0EA 2P9CA 2G2YA 2CPXA 3LQVA 2HAFA 3SFGA 3BFUA 3BB5A 4LF2A 5FDLB 3CW2C 3PDNA 4LBHA 2JEFA 3K1MA 5DQHA 3OR1A 2RCAA 1DAXA 2DHXA 3OTEA 1UVIA 1SPBP 1FVQA 1Y3PA 1R27B 2E1AA 5GAGI 3OVBA 1GX6A 2WVCA 1S5ZA 4F04B 4X84A 4K8RA 2OPSB 4KGMA 3ZZRA 2BRKA 2QSWA 5KFBA 4QHQA 4WU3A 1JIHA 1D9VA 5LMNF 1Z7NE 5LMNJ 4JI1J 1RAHB 5HJYA 2FHOB 2I38A 3DGPA 1PBUA 1RK8A 2A6MA 4P1LA 3O9PA 2R2UA 1NNDA 4O44A 3HHGA 4RUCA 2LXUA 3B7DA 3MAMA 3MP1A 1TFDA 3BYRA 3CVKA 4X2BA 2Z4PA 1QGXA 1B0VA 1HQEB 3EGWB 2FHJD 3IS9B 1B5IA 2OKQA 3PU5A 5IZ3A 3H6UA 2DB1A 2A6OA 2V8DA 2VKRA 1LFIA 4HCYA 1JLFB 2Q89A 2GAGC 1HSJA 5FLXU 5K8NA 1T0KA 2YNIB 2HHHF 4B3OB 3MPVA 3MPKA 3NWGA 4IR1A 2HURA 3P5BP 4F2RA 1QD1A 5D4OA 1Y3QA 5DGBA 2VBZA 3MOJB 1EZZB 4MYTA 3W5YA 5EGYA 2HRYA 4DFPA 1RQ0A 2XNQA 2OP5A 3SV3A 3OL9A 1RLDA 3MMBB 3HHFA 2D3O1 1B3HA 3EPEA 1NBEB 3N6LA 2IMOA 4ETZA 1T05B 3HCXA 2I5JA 3NNAA 1QY7A 3D4JA 1NXIA 1Y4CA 3JAMU 2C3PA 1H76A 4ECXA 1J5OA 4HKQA 1LW0B 4DN0A 1ZTYA 3VAFA 2UVWA 2Z2LA 2DE3A 3CIJA 4HS7A 4OI2A 3R7NB 1RT3A 4FDFA 2HHMA 3O2IA 5KG3A 2OX3A 1FJCA 2WZ1A 2E5LJ 3SCLE 1V3ZA 4DR3F 2AJ1A 3FSIA 1P1WA 2MTLA 2QYCA 3MPUB 4EBEA 1JXVA 3H90A 1YRUA 1S0NA 1WWHA 4PGPA 4LONB 3IG1A 2W2PP 4KC5A 2BJ3A 2QFIA 1WKKA 3AOCA 4W90B 2LECA 5H9EK 2HHHJ 4H6DA 1R9LA 1M5BA 2YX4A 3PJXA 4K5SA 2MMYA 2FVPA 5B08A 1A99A 2KU7A 3TZWA 8ATCB 1SPIA 1B5JA 3R3TA 3OXFA 5F0WA 3BN4A 7FDRA 2Y0SD 4P6QA 1K73T 3U1MA 3KSXA 5LSLA 4RR5A 2XMVA 1YHQS 3NS6A 4FYDA 1NKEA 1DBDA 3RRGA 3JYTA 1KTVA 2ZD1A 3FJ7A 4FNHA 2W9BB 1T03B 2DNQA 3OLAA 4PE3A 1LEOA 2GFFA 5AA2D 1ZPWX 4C1TA 3OL7A 1SKUB 3E78A 1LBWA 5CHCB 4H4KA 1HQUA 4RLEA 4Z2XA 4N8OA 4PE5B 3BQ0A 4ZP7A 2EC0A 5K5MA 1VC0A 2O7IA 1HPZA 2YKAA 4CO0A 1IR1A 5AA2A 4O3NA 5F8MA 5I5PA 2AT1B 2DY9A 2E5GA 3MDFA 2OWZA 4OYWA 1EHWA 2KLFA 2IJFA 2IM1A 3K6WA 1RKMA 2HK3A 3K1NA 2WSEC 4FE8A 1H0HB 3TARA 1AROP 1ZJLA 2AU0A 5K8PA 3DRPB 5IM0A 1T94A 2PD1A 4C11A 4KBIA 2WX9A 1MXYA 1JEUA 3WC0A 2J8AA 1V9OA 1VIXA 1A54A 1JNRB 3E79A 1NPPA 2GJ2A 4RW7B 2RINA 5KFYA 4OI1A 4FS1A 4ZVQB 2E5LF 2QJEA 1LWXA 3AOBA 2GHWA 4GKJJ 1MDP1 2ASDA 2DR9A 1SYHA 3IX1A 4I56A 2FLPA 4B3SJ 1VFDA 4DXCA 1IKVB 3MYUA 2OH2A 1EIYB 2O01C 1B7YB 2L41A 2AL5A 1TMMA 4LR9A 2F8DA 2RB7A 1M1HA 4N13A 1D9AA 3ZTQA 5AA4B 4IR9A 5DG7A 2Y1LB 1E6VB 2VASA 4NLPA 2CWXA 5FBPA 5CMKA 1MM7A 2ZMBA 4E98A 5D0EA 1A55A 3VF0B 1CEZA 1T9UA 3DRRA 3LGMA 1FFWB 3AJ2A 1FXDA 3AODA 1SC1B 3LC8A 4I2QB 2C2NA 1VHIA 2OSQA 5IV3A 5IQ6A 2MY7A 2AHOB 1VCTA 1FTAA 1RHQB 2ZWPA 5GAHU 5KFTA 2A10A 5JTYB 3KWMA 2XXIA 1M5FA 1H38A 2DCLA 5ETSA 2E7VA 1S1XB 1L3VA 5ITHA 1IJEB 1S9EA 3MZ1A 1N3WA 2WBDA 3MZBA 3G3FA 1L3TA 2XX8A 3OO9A 5KFHA 3MEGA 1U1RA 1AW0A 3V6KA 3AH6A 3MEEB 2R9JA 3MOZA 5L39A 1JP4A 1YJUA 1B32A 3EKIA 3FK4A 3MSTA 2XX9A 2B6AA 3ONQA 3C4MA 2E1RA 5B0GA 1J1NA 2E5HA 4DF4A 1DQ8A 3BKTA 4IO9Q 2I1RA 4NXNF 2AX0A 4OENA 3MM8B 2ZH5A 2JOQA 4K7QA 2VBXA 2E1CA 2NCKL 4XFEA 2VBYA 3IWLA 1JJ2R 4I69A 1TL4A 2JRSA 5HBMB 1Y7PA 1FPDA 1I5OB 1SUQA 2E7XA 3M8SA 2IPOB 2K2PA 1TKXB 3ZZTA 2AEJA 5KDTB 1P1OA 2L9WA 1UL3A 1FPKA 5E3RA 4OVQA 1RTJB 2XMWA 2XBPA 1RDZA 1X5SA 1FE0A 1X4FA 1Q79A 4BWMA 2MGZB 4C9DA 3ETMA 1SL0A 1Z4UA 2YX1A 4DR2J 4PTKA 2VC0A 4LFBF 5AXKA 4P2SA 5J2MB 1RCOB 1TL3A 5CZXA 1N76A 3K5OA 2NSCA 4F19A 1R0CB 3NNCA 2CZHA 4AB5A 1UVMA 1NUXA 1FTKA 4IG3B 4CM0A 3BR9A 2KB2A 4NA1A 1PJ5A 5HVFA 1I94J 4UUXA 4LIRA 3UD5A 4QR2A 3RB6A 1RTDB 1EQMA 3R6LB 2MHNA 3M8RA 3EDRB 4ZDMA 1FRMA 1TL7A 4WFYA 2GCFA 1A8FA 3BJYA 4USMA 3UDCA 2ZOMA 4OHWA 3NMRA 2IAJB 3MP6A 3BO3A 2FVSA 4R6KA 4F50A 4R74A 1KSPA 4PQAA 1FDDA 1H2VZ 2D3IA 3I5OA 3I4HX 4J9LA 4C2MA 3C14B 1ZOTA 3C46A 2RSQA 5DM6Q 3R9LA 4LF4J 2PSZA 4H4MA 3MD3A 5L9MA 2WKYA 3PW4A 1FFSB 1GVCA 4TYBA 4ELTA 3V2UC 1SJ4P 2UUCJ 4EUVA 4BS2A 2LAOA 3MWBA 1LK5A 3M8PA 2CEYA 5MAOA 4AUKA 5E0OA 1JW5A 2EBEA 1X60A 1BLFA 2OPPA 2HLUA 1HYSB 4DFMA 1O6XA 4QW8A 2W9CB 3G82B 5JXSA 4Q2LA 2CRLA 1M5PC 2ZEJA 1C0UB 2CA9A 3OSRA 4HDHA 2RDJA 4B02A 2O1MA 1GTHA 2Q1LA 1OIAA 2A18A 3T9UA 5H9FJ 2AJ4A 3FD3A 2GQQA 4B9SA 1IBKJ 2R7VA 4FXDA 3OVSA 5ET6A 3GCWP 2XA5A 2HZVA 2MQPA 2OK2A 5CMCA 4OX8A 2V5HG 2X3DA 1U6ZA 3QO9B 4OZ1A 1VK8A 4HTIA 5J1EA 4BDMA 2QLFB 2NZ4A 1OIBA 5ETVA 1MXVA 1NHVA 2H98A 2DVIA 3M9NB 4OEVA 5ICQA 3LTOA 4URGA 1N34J 1HA1A 3M2UA 4F1VA 1VJQA 3QFWA 1RISA 5IFMA 1RYXA 4M5IA 1SXLA 4D3HA 2OSRA 3KUEA 4OLPA 4OFLA 1MY3A 1UEVA 2V69A 4Q5VA 4BLAA 5D0HA 1XIQA 3MFIA 1UFWA 2DGUA 5D4NA 3GV7B 4LATA 1JLAB 2VA2A 4FYXB 5LJ3Y 4QFLA 4KAIA 4PG7A 3SSQA 1SJRA 2BMBA 1B7ZA 3RPLA 3CI8A 1B2HA 4J9VA 1VLYA 3NRBA 2XX7A 5CBRA 5C2CA 4L72B 1A9NB 4R5PB 4WBFA 1NJXA 1X9MA 2HNYA 1LAXA 2V4JA 2VFTA 3KJTA 5KG6A 4V19J 2RJZA 3RLFE 4YKKA 1S1UB 5EX3A 3UW1A 6FD1A 3GV5B 3RYLA 2XG8A 4RWXA 1TFAA 1H98A 3VFJA 1IKYB 2B8QA 3TW0A 3DU6A 1EJ7L 3KFMA 4HDGA 1X4CA 4E0DA 2Z0GA 5E41A 4ECQA 1VLOA 1VI7A 4OVRA 1B7FA 3I0RB 1FVSA 3EICA 1OPIA 3MR7A 1RYOA 1YK9A 5KOWA 5H8QB 1X4BA 2EVZA 1EYIA 2ZZTA 4GIZA 3IRWP 1PIEA 4ZLPA 4NF0A 4H0WA 2FBPA 5E7OB 4ZPDA 1HWJA 3GYYA 3FZ2A 1PC4A 1QVFR 1FERA 3D68A 3NKYA 3A8KA 4HT7A 4L6V3 2Y1RI 4NEZA 3WIVA 2K1RA 1TUGB 3M3LA 3KLEB 4WIQA 3T5KA 2EW9A 3IL1B 3RR7A 3GFYA 4GX6A 4O3RA 1K0VA 1IUJA 4OYPA 2KJVA 2ZHOA 1KZ8A 3OJSA 1JNZB 3IB1A 3LW5C 4OYXA 2UVJA 4H46A 4P0IA 1MU2B 3EXCX 1N6QB 2VG7A 4N81A 2ZC4A 4PGNA 2B3FA 5EYHA 3TVKA 4WP8A 5AJ3J 1SI9A 4EWTA 3VQTA 4FP9A 2QA1A 1NLKL 5K20B 3PW2A 2GO8A 1UEUA 3IAS9 1BXNA 5FD1A 5F8IA 4LFAF 2HHQA 1K47A 3C33A 4LVQA 1P8GA 4OWDA 1NM2A 2YKMB 4IRCA 4J9QA 4NLUA 1UEKA 1UPPA 2RT3A 3W1YC 3TCFA 3U8QA 4KQPA 3GR1A 4PABA 1BD6A 2Y3YA 3DOKA 1FQDA 3C6UA 4DR4J 2RILA 4F4WA 1LCTA 1RLCL 1TKTB 4XEQA 2RF2A 2YH0A 2ZFHA 5C5JA 2PGCA 4GWZA 2ZZWA 4QWDA 4LVNP 1FDBA 3DP4A 3C6TB 2HPGA 5BYRA 2ILZA 2FNCA 5ET5A 3BIHA 4RNFA 1OQHA 4MT1A 4TQUQ 3T9HB 3K59A 4Y6IA 1JMTA 4OHXA 4DUYF 4ANEA 1JVYA 2QPQA 4LF5J 4G3IA 2J9DA 4GRSA 4TQRA 3BZQA 3N6TA 3EGVA 5IOLA 2APOA 2NREA 1FRHA 1FRLA 2NYIA 4HHHA 1S99A 4HHUA 5IWAF 2V50A 3AD8C 2YX7A 3N6UA 5C7PA 3EGNA 1N52B 1D3WA 1U09A 1MLAA 3TJAA 1RYSA 1UPMB 4MFIA 1P1LA 1CLFA 3E13X 4PFWA 4U4XA 3HSJA 3DMJA 5A0YB 4LP2B 3VVDA 4NX9A 4C8YA 4F1UA 1VSOA 4DU7A 1GAOA 2NXEA 3TTKA 2B56A 4M5DA 1S7HA 3VE1B 4ND9A 2QRRA 3R8YA 4XKQA 1Q8KA 4ZVGA 1JLEB 9ATCB 4ESXA 2M0GB 2XM3A 2WSFC 2YPYA 1YBUA 2HMIA 1HI8A 1JLCB 1CULA 1FXRA 3SEUA 3LGHA 2J7KA 3CSGA 3HZGA 4XPCA 2CMOA 3LSXA 4TLMB 4TLQA 2Z2YB 1NKXA 2XQCA 2ABHA 4WP3A 5A8RA 4FXVA 1XNRJ 2MQQA 1A40A 5ETLA 2VG6B 1RSCA 3T41A 5DDPC 2KXNB 3HK2A 4LQ3A 3DNCA 1OWXA 5BXIA 3T1YF 2DNHA 3RU0A 3IBWA 1QTMA 1B46A 2V9KA 3SESA 2YNHB 3EX7B 1SD3A 2HQFA 3GYGA 2MHEA 2YNGB 2AX1A 3RQTA 4ZCIA 2BBEA 5HO4A 4NTLA 2ACYA 2CZVC 1RP5A 3T9NA 2JFDA 2VPZB 1B4HA 2MLZA 2Q74A 1R0BG 3EE3A 1JX4A 3PR5B 3G8SA 2GQ1A 2DP8A 2W8KA 2R4FA 1RA7A 2K3IA 2VA3A 2ZBCA 4ZN1A 2HNZA 4USIA 1Q7YT 1NZAA 4YR2A 5IZ1A 1TQLA 1Q8LA 1B3LA 2C3YA 3ETOA 3PD9A 1SIZA 5F8LA 4G1IA 1RYRA 3JSBA 3A8IA 1B05A 1FKPA 3UO0A 4JI2F 3W8PA 3N5LA 3C3LA 1HI0P 5KFSA 2Z8FA 2DWJA 4LSLB 4DCXA 2V8PA 1BKAA 3GZGA 5K2XA 4OFZA 2E9RX 2O84X 2WSCC 3VZIA 5LOMA 4JWXA 2KKHA 1NJIT 4FPRA 3J81j 4NAPA 3M7VA 4KHPF 1HFEL 1TL1B 3G8QA 3BH7B 2XCPA 4DV2J 1LFPA 4X62J 2HZKA 2KJWA 2R2SA 3TQLA 4ZK7M 1IBCB 3FBCA 1MH4A 4NMYA 4NLDA 3C15B 1LXJA 1NV7A 2OD4A 4K59A 2NR0A 1LK7A 3PUZE 3SEWA 2ZNUA 4HCWA 3W15C 4NLXA 3NOHA 4UOFA 2EPIA 2XXYA 2VFRA 4F3PA 3U1NA 2VONA 3HPOA 2CFXA 2V0NA 3W7BA 4ATNA 4M5MA 2P8IA 3SSSA 2GMLA 1S1VA 1FKOA 4H5FA 2QS3A 3UCUP 1PAUB 4DZ1A 4BDPA 3H40A 5J2NB 3QGGA 1LAHE 3I3VA 4LSNB 2EEYA 4DI4B 4U23A 4EMDA 3GIKA 3O6QA 1FESA 1JKHB 3HD2A 4LF7F 3BM7A 1ZIUA 1MXUA 1XS5A 5HQLA 3OFGA 2AYEA 3B82A 3BBBA 5D3GA 4JBCA 4PG6A 2O6AA 1U1QA 3HSZA 4WP9A 4ANDA 4JDFA 2WOMA 3B78A 3NNHA 3MUVP 1U0HA 2YKNA 4CTAA 5L38A 3GYXB 3D7SB 2ZVIA 1FQBA 3FCHA 3OL6A 3BGRB 2MKKA 1HWLA 5LSOA 3GP9A 1ZZNA 4FKXA 1EARA 2QL5B 4N8NA 1GXTA 4QBUA 1NV4A 4DV2F 2KG1A 1YSJA 2PMZD 1WHVA 4XDDA 1BQNA 2UU9J 1SW1A 4YMAA 1S48A 2ROPA 5KT2A 3QSLA 2YWWA 3LWLA 2H48B 3U65A 4YR3A 3G3JA 1VK3A 2X51A 5E3AA 3HHNB 1U49A 4OETA 2RKIB 4KJIA 4IOAQ 1WC5A 5KFZA 2GRVA 4RW6B 3M3FA 1U45A 5G0RB 1WEYA 5IAIA 3W9HA 4AQYF 3PVXA 3THVA 3CF5Q 1R1NA 3NS5A 4LMZA 4DFJA 5IT9U 2VOPA 1AYEA 4PFIA 4QU6A 1SJQA 3PIPQ 4PEOA 1HNVB 4PAAA 3TEGA 5EQ9A 2ZM6F 2AV5A 2I49A 1MMNA 1VBZA 2MKZA 2IA4A 1DCUA 2HCAA 2D3UA 2F3JA 1Z7ME 2HAVA 1U2RA 3UN3A 3DOLB 3UDVA 1VISA 2MXYA 1SL2A 1CJTB 4K2JA 3U27A 4ILLA 5D8HB 2OTLS 3H20A 3D6HB 2F34A 2KT2A 2CAJA 3MR5A 3U7JA 2BEFA 2P6TA 5K8OA 4H4OB 4LN5A 2OMLA 3VAMA 3K0JA 2MZTA 1NO8A 2XY6A 3DI6B 4IO5A 3KMQA 2KQZA 1H3DA 2B4LA 1C4CA 1VQLS 3V81B 2O67A 4F7VA 1UJ6A 3TQWA 2HHUA 3UR3C 3O28A 4NEYA 4M1VA 2DNPA 4Y65A 4GLIA 5CRYA 1AIVA 1U2FA 1JK9B 1YJRA 1HSLA 1HNXJ 2QIFA 3TEHB 2RNEA 2ZNSA 1B3GA 1EZ9A 5F1QA 1R89A 3U02A 4JB8B 2BE2B 2I2YA 2L9NA 3CHGA 1YI2S 4DUTA 2JVRA 3PACA 3MPDA 4B17A 3PM9A 4LRFA 2QA2A 4IH5A 2EBGA 2Z22A 2FC8A 4NRUA 3T96B 1VBKA 2QO3A 3CJ8A 3LP2A 2KFZA 2CQ1A 5ICTA 3W9VA 3NOCA 2BJ9A 2ZKTA 5EQAA 3HZEA 4Y34A 1JXLA 2MKHA 4C0BA 4EDPA 4JI0J 2QC3A 3N4WA 3TTMA 4FVCA 3CCSS 2B4PA 2RAQA 1ZM9A 3QGIA 3W5ZA 5DT6A 3M32A 3TQ1A 5LL6d 1B0TA 4ELRA 2MZRA 3OOAA 1F9HA 4K4WA 4DI3D 3UPFA 2AEFA 5HL7Q 1HKAA 2W25A 5I56A 2DRDA 2FD2A 3VAHA 2BOAA 2IVMA 2OPSA 4UOHA 3M8QB 2K06A 3ZFVA 4EF2A 4JYAJ 3EZUA 2PT0A 2HS4A 1GFWB 3PO5A 4KHRA 2ZKUA 1DQ9A 4PUOB 2CPDA 2RQMA 4KHMA 2FA7A 2P6SA 4A8XA 3ADAC 2KTQA 1M5DA 2YBVA 4AL6A 2DR7A 1JVXA 4GC7A 1LKZA 2UV8A 3QIPA 1JNFA 4DQQA 1Y11A 4MYUA 2DNGA 3QJPA 3SDEA 1L3SA 2MQ8A 1MQGA 2RF1A 4DSLA 2V4QA 4CLPA 1LEVA 4KXPA 5IZ3B 1JQFA 1U1KA 5J2QA 4YICA 2AGOA 4DF8A 1D3KA 3BN7A 3KDOA 4CO2A 1MWYA 4K50A 1I6JA 5IKBA 5GMDA 4F31B 1DY3A 2QVRA 2I4CA 1I6AA 3KN8A 1HBMB 1RAAB 4OI4A 4LQ9A 4LRBA 2XSJB 3M30A 3MUTP 3BR8A 2LCWA 4NYPA 3AT1B 2GHBA 1VHFA 4QYZJ 1OY6A 1EP4B 4O3BA 4IGTA 2DISA 2BVZA 3EXYA 3I31A 2ASJA 4WEDA 2R7WA 1S0MA 3ENWA 1PBQA 5HI7A 4RBTA 4ZHRA 1FJ9A 2R6GE 1XR6A 3J7A1 4PYAA 3L6HA 2VDIA 5F9NA 3MMJA 3EM1A 2XLIA 4OI0A 4Y28C 1RT6A 1HW9A 5JEIA 4H1XA 1NU4A 2F7VA 1KVKA 2DNYA 4DR3J 1G6BA 3VGTA 4QQBA 3BIGA 2CJYB 3K01A 3M9OB 3K17A 4EK2A 1VR6A 3BS9A 5EX0A 3TX8A 4WYLA 3MHYA 1T3OA 5I3UB 1LWFA 3KUHA 5L9OA 2E1MC 4A8FA 3T93B 2LA4A 1T9VA 1WEZA 5HMXA 1XMOF 1N56A 1RWKB 2ZXTA 1BWVA 1IXIA 2HFBA 3QATA 4WKYA 5C42A 3P7IA 1CJKA 3W2WB 1TFWA 4U6PA 4TQSA 4RJVA 5HLFA 3I0SB 5K2YA 2QSXA 3A12A 1B1XA 3J81Y 5F8HA 3K5NA 2O51A 1GMVA 2ATLA 3CJSA 1TVRA 4CLUA 3SEXA 1QAIA 1FDAA 4GC6A 4NYZA 1LBBA 3TP2A 5KFFA 3IRXB 1G2EA 3ODBA 4ZCKA 4GBWA 3BDEA 2Q2CA 1FEHA 2B8PA 3ISZA 4N6PA 1B3FA 1TWYA 2M2BA 3O6HA 4UQGA 4EZ6A 1RT1A 3CR9A 2IYIA 1GXUA 4CNZA 3CD6S 4WE1A 2UVRA 2Z58B 2PI5A 4ZP8A 2DXDA 5D15A 4WPAA 4F18A 1WELA 2ZHAA 1OSDA 4IY6A 3DM2A 4X64J 2PMSA 1GV8A 5LJ5Y 3ENVA 4TY8B 4ZEFA 2ZE2B 4UQTA 2W4CA 1FTOA 1IQTA 1S12A 1T03A 3IB2A 1DHMA 3ZO7A 2UXCJ 3DP6A 4OV1A 5DLGA 2GFEA 3QJLA 2HFOA 2EC2A 1FTMA 3MM6B 4C8LA 2OGUA 3GJQB 3BH6B 4JI0F 1ZAXA 4WFZA 1FPBA 2ZUAA 3SXLA 4PXEA 1PB7A 5ADZA 3L09A 3C31A 4HACB 3T66A 4F4YA 2EG1A 4KPYA 3CFZA 1UJ5A 4L73A 2B9YA 2RD5C 4ZLLA 1F1BB 3DXSX 4BDRA 2V63A 1JB0C 3JSMB 2GS8A 5F7VA 3SYZA 3DRPA 3QLHA 3Q86A 3I87A 4OZ9A 1ZETA 1HNIB 1YJ9S 5J1DA 2GV1A 4CIOA 2MDAA 3DLGA 3PV0E 4MKYA 4Q5TA 4IYQA 4LSZB 4AE5A 3AJ1A 2RU9A 1S77D 3FBPA 5I3QA 3N6MA 4POXA 2B9XA 3D9BA 4RW7A 1WEXA 3SCJE 3Q8RB 2GQCA 1NK6A 4MAGA 2F97A 1T02A 4WTYA 2V3QA 1IBLF 4GKJF 2DYAA 5K14B 3T1AA 3UCGA 1MROB 1NK4A 4B08A 4JVIA 4LR8A 1MY2A 4ER8A 1XMOJ 3KSJA 3TAQA 1OO0B 2QT7A 4B3MF 3IM8A 6AT1B 3LUZA 2F65A 2IFXA 1IMEA 5AA4A 2WRMA 4RNOA 2OEMA 1DPPA 3WIUA 1B52A 1FTRA 3MC2A 4B3RJ 3Q8SB 1S6OA 1SBPA 3AHPA 5EQ7A 2I0CA 1P1NA 3OO7A 2HIYA 2GW8A 3L7UA 5KFJA 3Q27A 1N48A 3POTA 2OEKA 3CDUA 1TFYA 4RNMA 4AS5A 3E01B 4PWDA 1WODA 2BJIA 5I3SA 1RTHB 3IOTA 3KHLA 3IGVA 1DMBA 1IVZA 3FKBA 4Q8FA 2PT2A 3NCPA 1M5EA 2D21A 2CPEA 3WC2A 5B0BA 2XWVA 4BC7A 1WDNA 3PZPA 4NF8B 1OY8A 1O64A 3FVGA 4F2QA 4P2FA 1EYJA 4RW8B 3MCMA 3FVYA 3IO4A 3HKWA 1QUJA 5A8WA 1EKSA 4NI2A 2XWOA 4OZ2A 2DGVA 2B9EA 3BSOA 5THWA 1LCFA 3VR1A 1YJNS 1AL3A 5TPAA 2IEEA 4J9MA 3JB9k 2HBZB 1S72S 2LEBA 1NJYA 3C2PA 4Q2MA 3MECA 3FFIA 1PJ7A 3QZ8A 3SZ2A 3ZNUA 3DELB 2F4VF 3E2EA 5AXNA 4PPZA 5DS7A 1H44A 3SEVA 4OX9J 4P72A 3OBIA 3MURP 1QAJA 1R6ZA 1YWXA 1USYE 1HL6A 4P9KA 3SBMA 3G9CA 3BBFA 4DOZA 1NV5A 4KV8A 3MEDA 1TV6B 1N0VC 1XT8A 2LYVA 1NPKA 4YMBA 2ATCB 2RQKA 2R7QA 3NL0A 3IP0A 1LSTA 3W5XA 1R43A 1NZ8A 2G2OA 1Q4RA 3PX0A 2F6PA 5M2VA 1TKDA 3CNQP 1LXNA 3MTKA 3ZZPA 1VYAA 5GVQA 2BACA 1P9YA 1PYOB 4IRKA 5A5LA 3KK1A 3A4TA 2Q43A 3HCQA 1B0LA 2W9AA 2AIRB 3EWGA 3KZGA 1FBFA 3V89B 5J2MA 4G8HA 2F5XA 4ZVFA 2IA6A 2FHJA 5H8NA 3CD7A 2Z2ZA 3HSGA 1WC4A 2G4BA 2POKA 4F0HA 3QFHA 1SVXB 1XEZA 5HROB 4GWXA 3UK4A 1CS4B 1QKBA 4X1DA 2EFGA 3IJXB 4LREA 4CLFA 3VVEA 4RX6A 2OTJS 4F4KA 2BKOA 2G0IA 5JUMA 1OQ3A 2AIXA 3AB2B 4NLOA 3M6VA 1MXWA 4P11A 4R2BA 2GGPB 4DPYA 1AWBA 1VRUA 3IFEA 3T6JA 1B7HA 3VQSA 1SB6A 3RB3A 1YDLA 4GVOA 4PC9A 4XK8C 1NKBA 2IAJA 2HK2A 2WBRA 4CNYA 3AQOA 3CULA 3D4GA 3RW6A 4P2XA 3V6JA 1UCNA 1GNKA 5AE2A 2NXUA 1JLQA 4DHVA 4J37A 2ADCA 3E4RA 2MLXA 2ILYA 4IO2A 2DHSA 3HP6A 5ETRA 2P9GA 2HBRB 3ET6B 2M3DA 3KLHA 2AYGA 5L9XA 4QYZK 3CMAS 4OVJA 3M8PB 3VV5A 3KK3B 3TWZA 4FN5A 1KP6A 2W7PA 5ITPA 3L7OA 3TRGA 2YKOA 3H2LA 1C1BA 4OTEA 4YQWA 3QBCA 5LMUJ 3HFUA 3VZHA 3S7RA 4B9MA 4PDHA 1BWEA 2HPUA 4GBVA 1RAGB 2BJ1A 1MXZA 2V25A 3LA0A 1FK9A 4OQJA 4DL2A 1RWXB 4F4ZA 4Q44A 4DCJB 2E29A 1U1MA 3W9WA 2C3OA 8RUCA 5I7IA 3TVYA 1V3SA 3GXAA 4F4AA 5D6GA 1FWLA 4ANCA 2FJXA 3KBRA 3MMAB 5F8JA 2IVYA 3O5TB 2DWAA 1E6YB 1WVJA 4NMLA 3G86A 2LVWA 4I68A 2H5IB 1UTAA 5KT7A 2D3ZA 2VQEF 2GHPA 4QOTA 1HMVB 5FTIA 5HVHA 2XYPB 4Z0IA 3CJRA 2KYXA 5E3QA 1WD6A 4NEDA 3ZS6A 2B9WA 1RABB 2XS7A 2YWFA 5KFIA 4EEYA 2UXDF 4U2RA 5HM4B 1HD0A 2XYGB 2BA9A 5ITOA 3KK2B 4LF8J 3LSWA 4DV7F 3LAMA 1DURA 1AH5A 3KLFB 4G68B 4OFOA 2MZJA 3B54A 1FSAA 3TQEA 3ULHA 1UWBB 1B3TA 3PRBA 4RO0A 2UYFA 3H4ZA 3M9MB 1Y4TA 4XKRA 4NCGA 3J80Y 1GR2A 3OSQA 3M8ZA 3J7YU 3V5RA 3O8WA 4IO6A 1RHJB 2YLNA 2QE5A 3THIA 1KHVA 5KCJB 2XLJA 1BTJA 4RZRA 1YYZA 1P6TA 4G4PA 5HP1A 4F0MA 2IDLA 2BDPA 2XMKA 4ZMMA 1S9TA 4U7CA 2UUWA 4NLVA 4CYUB 1V3RA 4OEUA 1N32J 1UAWA 4U7UK 1EETB 5J2PB 3Q0AA 5DZ6A 1CG2A 3ZTOA 2IA0A 2WW8A 2REJA 2YQ3A 1SYIA 1IMBA 2RDDA 3Q23A 1O7TA 2DT9A 2KI2A 1DK4A 4LR7A 4U9RA 4FNIA 4MCOA 4P0GA 1RXOB 4RBVA 3PYEA 1XVYA 3BV8A 4RU9A 2OO4A 2ZYMA 3KMSA 2WYKA 2IM2A 3T9ZA 1GQEA 3ZC4A 1R9QA 3FNNA 1YRXA 1FCKA 5IT4A 3OT9A 1MPCA 4K4SA 4R25A 1Q53A 3RR8A 4Y00A 4Y3CA 3BGLA 1LOUA 4ZP9A 5DEXB 3GFXA 1IR2A 1ZYQA 3UN6A 5A2QU 4GVBB 5KFKA 2CADA 3M6UA 2QLWA 1RAOA 4LRDA 1NFTA 2HIQA 2W7YA 1EZOA 2HBQB 3TOQA 4RL1A 4TNOA 4ZVRB 5C24A 5L1IA 1N6QA 4PBHA 4NCBA 2VG7B 2VG5A 1RWWB 4M63A 5HANA 2VPXB 3D28A 4ESWA 5BYQA 2V8HA 2NUHA 1UVLA 2JDJA 4JI6J 5BYSA 3FZVA 1S0VA 3X1LB 2VUGA 3EJMA 1FE4A 1V5IB 3P8BB 4AB6A 3FCVA 3FMWA 1HBUB 5KFEA 4U7UD 2J9CA 1APSA 1WNEA 3K7RA 1KRPA 1YZ0A 1EB0A 4UTGA 2YNFB 2O7UA 2W2QP 3BSAA 4WXJA 4F3QA 2QVVA 1WJ9A 1NDKA 3Q2SC 1TKTA 2DO0A 4ED8A 2RF2B 3TUJC 3AB4B 1MW7A 3G6VA 2V2KA 3T3FA 1D09B 1JLGB 2XI2A 3DN9A 3RBXA 3OXLA 3ECRA 2E1PA 2P9EA 4IFVB 3M2VB 4ZVTB 1M5CA 3IWNC 4I7FB 4GWYA 1P1TA 1ZTTA 4ES2A 1XJWB 3LP0B 2RE1A 2LA6A 1D8YA 4U21A 1F5AA 1CQNA 1NB7A 2FJVA 2R9LA 4KSEB 1VE4A 3IO1A 4X4UA 1K0TA 1XOCA 2RU3A 3HHLB 2XO7A 2L9DA 4X66F 4IOCQ 4DL6A 2J76E 1UETA 1IBLJ 2OPQB 4LF8F 4LJMA 4NF5B 2VOZA 2EFOA 2WONA 3GQCA 3PXGa 2L48A 1SH2A 5L8DA 5A0YA 3KOAA 2XZWA 3D1HA 3KLVA 3C9HA 2M8DB 3USDA 1GXLA 3S1TA 4ZECA 2HQDA 2F8EX 4O4RA 3QIDA 4C3LA 2F7CA 2PE8A 3MFHA 3OHAA 3H6TA 4KGKA 2I58A 2BANA 1M5VC 5DM7Q 1ACMB 2XSFA 4ZLJA 2GVZA 3M6WA 5F3ZA 3QYTA 5FLXY 1IXCA 5K8MA 3I9V9 1NUEA 2EXUA 1NV1A 5KT4A 1NJWA 5TP9A 1Q9DA 2DXEA 4ED1A 5CCLA 5D4PA 4JXIA 4ZOSA 1FT8A 3S9LC 4DCYA 1EX8A 5IT9Y 4DZ6A 2DEJA 3MAHA 3GBAA 2DE2A 2FJDB 3UFCX 3MR6A 1NI9A 5A8KA 3GV8B 4USJC 2NS1B 3DLHA 2GHVC 3EDQB 1Y5IB 4ED6A 1EQ0A 4O3AA 3M8UA 2JJ4D 1VC5A 2UUCF 2UXBJ 3KBZA 3CCTA 4H8JA 4DBQA 2R2TA 4X65J 2AYSA 4JYAF 1II5A 2DQVA 1SW4A 2XMJA 3KG0A 4G8MA 3M1VA 1U1OA 3MAAB 4N7TA 4NXMJ 2Y8YA 4ZPTR 4USWA 2J0WA 1QE1B 1MMLA 4OX6A 3RTFB 4O44B 1NCLA 2F4VJ 4QWAA 1X4HA 2O5DA 3DHXA 1FX2A 3H98A 2J6TA 2QS4A 2VBWA 4ED3A 1VDWA 2XULA 3GU0A 1X4GA 2K7JA 4A8MP 3OR2B 1F2HA 2FIEA 3RB4A 4LT6A 2DTJA 4ZA1A 2NUUG 4JI8F 3K6XA 2KZZA 1RWVB 1KFDA 3CDEA 4IG0B 2GJIA 3CCES 1NNPA 4OJ1A 1SI1A 4CO3A 2GVDB 1VQ5S 1OVTA 1NSKL 1CC7A 1EYKA 4M1KA 3GPAA 1Y4ZB 4LSLA 1DFDA 3N5FA 2DJWA 3T6BA 2HFNA 3C16A 3H59A 5A5XB 1PBAA 1WF1A 1YX2A 4C8NA 2GHAA 1AFIA 5CYMB 4P2MA 3S4UA 1CPZA 3GG1A 3G87A 2RHSB 1ZTWA 3A3CA 3OXNA 4FJPA 1SV5B 3DRSB 5ET8A 4U96A 2OBGA 1X4EA 5EHHA 2ACMA 1RT7B 3W65A 1EAYC 1GK8A 4CT8A 5KG1A 2L5VA 3TZXA