2QMWA

The crystal structure of the prephenate dehydratase (pdt) from staphylococcus aureus subsp. aureus mu50
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
264
structure length
264
Chain Sequence
MQLYYLGPKGTFSYLACRQYFSENEATFQPKSNLFEVIKAVADDDTSIGVVPIENSIEGTINIVADALAQQDVFAHGEIRLDINFALYGNGTDSISDIKKVYSIAPAISQTTNYIHQHQFDYDYVDSTIQSLTKIENGVAAIAPLGSGEAYGFTPIDTHIEDYPHNVTRFLVIKNQQQFDQNATSLMFLITPMHDKPGLLASVLNTFALFNINLSWIESRPLKTQLGMYRFFVQADSAITTDIKKVIAILETLDFKVEMIGAFN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural genomics, unknown function
molecule keywords Prephenate dehydratase
publication title Structures of open (R) and close (T) states of prephenate dehydratase (PDT) - implication of allosteric regulation by L-phenylalanine.
pubmed doi rcsb
source organism Staphylococcus aureus subsp. aureus
total genus 71
structure length 264
sequence length 264
chains with identical sequence B
ec nomenclature
pdb deposition date 2007-07-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00800 PDT Prephenate dehydratase
A PF01842 ACT ACT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.260 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2qmwA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2qmwA02
4Q5TA 2QS4A 2ZXTA 4R6YA 5AA4B 1Y20A 4WEPA 3QYTA 3TAJA 1RYOA 2P0SA 3EN3A 3TPAA 4F19A 1UJ4A 4PETA 4GOTA 5DEXB 3IORA 1IUDA 5IS2A 5I84A 1GGGA 1IXIA 5H8HA 3AAWB 5TP9B 4YMBA 3VVDA 5TPAB 3IB1A 2XX8A 3A3UA 2GFEA 2UVHA 2I48A 3DP8A 4F39A 3H06B 1R6ZA 1QKAA 3K1PA 5K2YA 4F3GA 4G77A 1VFDA 1M5FA 2Z8EA 5H8QA 3M3LA 4EDPA 3TCHA 4FECA 4QSCA 2PC6A 4ZDMA 3RNNA 1SQYA 1SC6A 3LOUA 2Y7PA 4ESWA 2A5TB 2GHBA 4H67A 4PFWA 3W9VA 3FVGA 2FA7A 2NUVA 5EHMA 5DVFA 4WEDA 3DHXA 4JWXA 2REJA 4JSOA 1FQAA 2O68A 3TKDA 1MXUA 1A8EA 4IO2A 3CSGA 2ONRA 1J1NA 5H8FB 4H5FA 1URSA 1PBPA 5B7DA 5ICTA 4N6PA 2QL3A 3Q25A 3HHFA 4G2ZA 2NXOA 3K6WA 3DP6A 3A3CA 3H6WA 2H25A 2H9BA 3TZAA 4NF5B 4X9TA 2PT1A 2I0CA 3OFGA 2P9CA 5CBRA 3BKIB 1BKAA 1UTBA 1QUJA 3TTMA 3G3JA 4DXCA 3TMGA 4IO5A 4ZECA 1MY3A 5ITOA 5AA2D 1XHYA 3B6QA 4JXIA 3PUWE 5AA3A 3BBRA 3O97A 5AA2B 3K4UA 3CFXA 3VLVA 3THIA 3RTFB 2DT9A 3TUJC 4G68B 2NWJA 2XXUA 3OSQA 2PVUA 3ENQA 3C32A 3O29A 5FTIA 4Q0CA 4I8CA 3O6HA 3GBAA 1BLFA 4GO7X 5ICQA 4NWDA 2G93A 2F5XA 3KGCA 5I57A 3ZSFA 5FHMA 4MF3A 1QULA 2HCAA 3M3KA 4UACA 4YKJA 4DXUA 3MAHA 5AA1A 4OEUA 3IJXB 1YCJA 1DTGA 3MZ9A 3TUSA 2XXTA 1M5CA 1FTLA 4LUBA 1JVYA 1GV8A 2XD2A 3MAMA 3OO7A 5HPQA 2F34A 1SI0A 1IXCA 2OZZA 1XVYA 2AYSA 4IY6A 3N94A 4XKQA 4RNSA 5HBCA 1Y4CA 4NTLA 3UORA 2DE2A 3RLFE 4GVOA 4KR5A 1JQFA 3Q29A 1MDP1 2ABHA 1VE4A 3G3IA 2F8MA 3ILTB 4OWDA 4F3PA 4F29A 2Z8DA 3OFFA 3MW0A 3KJ7A 5I2NB 3Q26A 4H6DA 2YJPA 3QUFA 1LSTA 1ELJA 3EF7A 2WKYA 3G7WA 3N26A 2OCUA 1ZPVA 4GQOA 3TUZC 3FJMA 3PUVE 4POXA 3HHGA 2OJTA 4HS7A 1I6BA 2D5WA 1FTKA 1T0KA 3E9XA 3RT6B 5K2XA 2RC8A 3CG3A 4NMYA 3MVXA 5LOMA 1AMFA 4IO6A 3KZGA 3P96A 3H6TA 1LLSA 1FQEA 3L6GA 1TFDA 4I9DA 1SBPA 1F9BA 1D4NA 1I6QA 3MZBA 2UXAA 4THIA 1PC3A 3PMVA 3QK6A 4R6HA 4IO4A 2PT2A 1LK5A 2A5SA 1GVCA 2DE3A 1PBQA 3O28A 2B3FA 4GFRA 4R9FA 1PB7A 3N6UA 2DYXA 3L6HA 4FATA 4R9GA 1HSJA 3TODA 1B32A 2QMWA 1MY1A 4OHNA 1B46A 1O63A 3TEPA 1MM6A 3U72A 5H8NB 1QJMA 1WDNA 3T22A 4PQJA 3N5LA 3B7DA 3IAZA 2D3IA 3C4MA 3IX1A 3CFLA 1FTMA 4F3SA 3Q27A 2DP8A 4LZ5A 5A5XB 2H9ZA 5DYHA 2Z8FA 1TWYA 2NYIA 3MVYA 4EQ7A 3K01A 3JV9A 1N04A 3U94A 1IITA 4QFNA 5IKBA 1USYE 1OQHA 3VVEA 1O7TA 2IEEA 1S50A 5EYFA 4BDRA 2F7AA 2UVGA 3PD9A 2PMSA 3D4GA 1S7YA 4Z7EA 1OIBA 3S4UA 2NVUB 1B3LA 1Z7ME 4H1XA 3S9LC 1EZOA 1LAGE 3H03A 4O3BA 3ZS6A 3PPOA 3QUJA 4ELPA 1DPPA 1MQGA 3PU5A 4OYVA 3PPRA 4RY1A 4FAJA 2R6GE 4G8NA 3TQLA 3FZVA 4ESXA 1DPEA 3PGFA 3SERA 3SEYA 1ZJLA 3LC8A 3OELA 2V25A 1DSNA 4NF8A 1JEVA 1HSEA 3NRBA 4ECFA 1FTOA 1B52A 4G4PA 2AL4A 1N7XA 3RTWB 4DCXA 4IO3A 3K1NA 3DLNA 5I56B 3TQWA 2UVIA 1YPNA 3IO4A 2FNCA 2HAUA 3FJGA 3UW1A 4RYAA 1B5IA 3MP8A 4F2OA 2ANJA 1ZU0A 1LFHA 3I5OA 3AXFA 3KFMA 2DSFA 3ENVA 3MUQA 3KN3A 5I58B 3HCQA 3UGWA 2V84A 4C1TA 4XKNA 3IOTA 1FQCA 1IQ7A 2XXYA 3BFUA 4LZ8A 5EHSA 5KCJA 3C35A 3CVGA 3FVNA 3SDFA 3KEIA 1U8SA 3C36A 5DVJA 4R72A 1B3HA 1LAHE 4OZ9A 2Y84A 4PP0A 1MXZA 3RY3A 1MXYA 3OMBA 4YB6A 4O3AA 5JTYB 4WKMA 3FV2A 3V89B 4GXAA 1P1QA 3MQ9A 5CBSA 3RGYA 3HHEA 4FORA 3R7XA 3P7IA 1XS5A 1ZKBA 3UP9A 1Y1ZA 2P9GA 1KWHA 2RINA 3VDFA 1OQGA 4LVQA 5F1QA 3SESA 2J0WA 1URDA 1JEUA 2QMXA 2V3UA 1B51A 4H8IA 4TLMB 1OVBA 3CR9A 4LATA 5L9MA 2Q89A 1BP5A 1Y3PA 2QSWA 1A8FA 4IY5A 3MC2A 4IGTA 3SEWA 3KSXA 3E3KA 2DVCA 1XTZA 1LFGA 2XXRA 3PV0E 3MTJA 2G29A 4R73A 1S9TA 4F18A 2LAOA 2RC9A 3DM0A 1OLAA 5I2KB 3ZKKA 4F1UA 1LFIA 5F7VA 4GD5A 3HO7A 3KBRA 1VSOA 3CRBA 5KDTB 5CRYA 4M8LA 1B9JA 3LSLA 4FEBA 3L7OA 4TQUQ 2F7BA 1AOVA 3OO6A 1ZBMA 4M1VA 3HV1A 1I69A 2RQMA 1MQHA 4N13A 3TCFA 1OMPA 4XXUA 3OFHA 1FCKA 4GIZA 2Y7RA 4TLLB 3U8QA 3E13X 5CC2A 3ONMA 1VFEA 3IL1B 1JNFA 3TTLA 1MY4A 4RPNA 1WODA 2QRYA 3KOSA 3OEMA 3SKPA 5I59B 4PFTA 1SW2A 1ZTYA 1SW5A 2M8CA 3VXCA 1USYH 1WVJA 3EHUA 3PMWA 4XIGQ 1P1UA 4MH5A 4DE8A 2I3WA 3FD3A 4FIMA 4R74A 4NF4A 3TCGA 3VE1B 4GWOA 4QFLA 3S9MC 3CI8A 1B3EA 2Q2CA 4ELRA 2H99A 2E1SA 1Y7PA 2ZHOA 4QFOA 1JW5A 2RF1A 1GTKA 1SI1A 1Z7NE 2RCAA 3H6UA 4G68C 2XXVA 2ZMBA 1N84A 4FJPA 3KG2A 5JK4A 2ZYKA 2QS2A 2P2AA 3LBSA 5H8HB 3TELA 1US5A 5KZTA 1H3DA 4N07A 2AIXA 4NWCA 1R1NA 2O7UA 3VXBA 2ZNTA 3KWMA 4H0WA 4XTCQ 5H8QB 1TXFA 1RYXA 3LSXA 3TDJA 3O6IA 1PB8A 1SDXA 4ZEIA 4JDFA 1MQDA 2J0XA 4U4SA 4LP2B 2I4CA 2UYFA 4E0XA 2HQ0A 4ZEDA 2GHAA 4OTEA 1QVSA 4GRKA 2XXHA 2Z22A 4NEDA 1UQWA 2UVJA 2DS9A 1IIWA 3FIRA 1RWUA 2F36A 2JOQA 2I6EA 2ZYMA 3K0VA 3F11A 1CB6A 5CMCA 2F1FA 4F3BA 3PUXE 3SETA 1UTBB 3W7BA 1Y1MA 4PE5B 3H3GA 4GXSB 4KQPA 4QSDA 3EQ1A 4OFLA 4ND9A 3EPEA 4YICA 3UK4A 3O6GA 3FASA 5FTHA 1FTJA 4GL0A 3O2AA 3ZKLA 3O66A 1H45A 4JWOA 3MPKA 1B7UA 5TU0A 2O84X 1D9VA 1A7LA 2DTJA 2PX1A 2NOOA 4F31B 2XHDA 3TUIC 4EQ9A 5ITPA 3LUYA 5I57B 2OLBA 4F1YA 2X26A 3O9PA 1N7WA 1P1NA 1CE2A 3K1MA 3MVZA 2CMOA 4NF6A 3VFJA 3K02A 2F6PA 3G3KA 2V93A 4PFYA 4U23A 2HFBA 1AL3A 4OQOA 2V3TA 4LQ2A 1P1OA 4U21A 1I6AA 3EHTA 4EF1A 2VHAA 1LAFE 2UYEA 1UTHA 3SEXA 2REGA 2VP1A 3DP4A 2OWSA 2XXWA 3FGSA 1IXHA 4FEDA 1MXVA 4KYEA 2RCBA 1LCTA 4TOZA 3M3FA 1BIYA 3U1OA 3IXQA 3DDNA 2LVWA 3OO8A 1ZLQA 3I3VA 4YZZA 1EH3A 1TT1A 1SW1A 1B2HA 3HPIA 2O69A 2KO1A 3BFTA 3FUZA 3PUYE 4PWUA 2Z23A 5FHOA 2O6AA 3B6WA 1M0SA 1PDAA 2X7QA 3H4ZA 4FE8A 3K2DA 3RUMA 4RK9A 4YU0A 3MJNA 4BLAA 1OVTA 4OFOA 4E0WA 5FIIA 1UJ6A 1QKBA 2HZKA 4IB2A 4M4GA 1NNFA 4RXLA 4Z0IA 1POY1 3PPQA 1MQJA 2YPNA 5AA4A 1LB9A 2QSXA 4OXVA 4U1ZA 1JW1A 1UIVA 3U92A 4P11A 3IB0A 5DEXA 3OOAA 2YLNA 2XX9A 1OLCA 4G8HA 5ISUA 1PB9A 3JZJA 5AE4A 3KN8A 5TP9A 3QSLA 3LSWA 4OFJA 5IAIA 5TPAA 1NNPA 1QW0A 2ZNUA 3VLUA 3S2VA 3MPLA 3FXUA 4QF9A 4GF8A 1Q35A 3UA8A 1R9QA 5DVIA 4BDLA 1UIUA 2H4IA 2P1SA 4F1VA 1B3FA 4BDQA 3RPWA 2DWJA 4H5GA 1EZ9A 2A5TA 1MM7A 3A09A 4H8JA 4MBPA 2ONSA 4LZ7A 3DHWC 4Q30B 2GH9A 3FXQA 4QFKA 3E4RA 1BTJA 2F97A 1EZPA 1H43A 4NF6B 4X1BA 1JW4A 2ZYOA 3FVKA 4WXJA 3KOTA 5BUUA 1AIVA 2XXQA 3PUZE 5H8FA 4LQ5A 3VLWA 3FVOA 1Y3QA 3RN8A 1XOCA 2VD3A 4DCYA 3DC2A 4K3FA 5CI5A 2DWHA 1UTHB 2RQKA 3QAXA 3G3FA 1HSLA 1FQBA 4OENA 4YKPA 4NF5A 3PPPA 4R2FA 1B1HA 3ODBA 3W15C 4ZEFA 4OEVA 4KYDA 5DTBA 4DZ1A 1JETA 3USDA 1H44A 1LBCA 5AA2A 4I1DA 2VGQA 3IOVA 2F7CA 3K6XA 1DOTA 4IO7A 1ZMGA 2HEUA 4G68A 1GR2A 1DMBA 2V3QA 3GXAA 4YB5A 3ENWA 1B5HA 1XVXA 4ZE8A 1D9YA 3T96B 1JVXA 3EHSA 1LAXA 1ATGA 1POTA 1B6HA 4YMAA 4C0RA 1US4A 4C1UA 4X48A 1MDQA 4KCCA 3T93B 3UN6A 1II5A 5JEIA 5BWJA 4NF8B 2QS3A 1N3XA 3W9WA 3T9VA 4L17A 3LR1A 1B1XA 4ONYA 1EU8A 2LQJA 3IO6A 4YB7A 4EXLA 4GMKA 2F78A 1B7HA 2MDAA 2Y7KA 1LKZA 2GRVA 2I9SA 1MPBA 4HCYA 5HM4B 1Y9UA 4LA9A 4BDMA 3N6TA 1MY2A 4U4XA 3T9HB 4LONB 1MXXA 3IOWA 1NKXA 3OSRA 5L9SA 3MP6A 3IOUA 1O8BA 3TTNA 4AB6A 1MY0A 1FQFA 2ESNA 4DXBA 2ZYNA 4XKPA 5KCJB 2ONKE 3OFEA 5I2NA 2I0BA 1B40A 4ISUA 3TTKA 1A54A 2DVZA 1B58A 1IEJA 1MPDA 2B3BA 1B0HA 4RPOA 4H65A 3V8XB 1PSDA 1VR5A 1LBBA 3H6VA 2FGCA 5CMBA 3MP1A 2H5YA 1MH3A 3CG1A 3ECRA 2Y7IA 1SVXB 1L5TA 3C9HA 4JB7A 1FQDA 1Q1KA 4POWA 4OMBA 3K5PA 3IB2A 1YGYA 2RKMA 1H76A 3LSFB 1SYHA 3T9XB 1YTVA 5H8SA 4QRZA 3FATA 1MRPA 1URGA 3MZ1A 4ZZEA 3JYRA 5L8DA 4OETA 2PBWA 3PMXA 4YAHX 2Q2AA 3AB2B 2X7PA 2PA3A 5H8NA 3K6UA 2ALUA 4X84A 2DXYA 4RA1A 2XXXA 3GZGA 1D3KA 1MG1A 1XC1A 5A5XA 3N0VA 3MVWA 2F35A 2O51A 2THIA 5DT6A 1NH7A 2KLFA 1YAEA 2Y7WA 3IK6B 4PFUA 1A40A 1NL5A 2CZLA 4KI0E 4XKRA 2OBGA 1NMUA 1LB8A 4DDDA 5CMMA 2I4BA 2DWIA 3R6UA 3C33A 1MXWA 4U1OA 2PYYA 2JHEA 4ZE9A 2ZNSA 2AL5A 5JJBA 1XT8A 1Y4TA 1N0TA 4KPTA 3MWBA 3MBPA 4UA8A 2XXPA 4ZS9A 2IA4A 3TFLA 1NH8A 4EQBA 2RE1A 4EF2A 4AB5A 4F2QA 3HN0A 3WAFA 4IGRA 3H7MA 1IXGA 4NF4B 3QXMA 1LGBC 4U22A 4OESA 5L9OA 3V83A 2DOJA 3KN7A 1B4ZA 4KYSA 1B4HA 1DTZA 4ZZAA 5CMKA 3G3GA 3GLBA 2VD2A 1TFAA 1PEBA 2Q9TA 3S9NC 2BJJX 4KFQA 5FHNA 5I56A 1UJ5A 1Y3NA 4JWYA 2DQVA 3AB4B 2O1MA 4GL8A 3V5AA 3K00A 1NNKA 3T9UA 3I6VA 3G3HA 1YBAA 3T66A 5I58A 1AH5A 3D4CA 3TTRA 4YKKA 3FV1A 1B0LA 1M5EA 3PPNA 1RKMA 3B6TA 1KS2A 3S1TA 1SYIA 3VV5A 4MFIA 2QS1A 1B5JA 4DLDA 2I3VA 3TYHA 1LK7A 3OENA 4F22A 3IBWA 4MLVA 4JSDA 3DELB 2Q8JA 3PD8A 2H98A 2HXWA 4R6KA 1P1WA 1M5BA 1QUIA 3RT8A 3OO9A 2DXRA 2F8DA 2XXIA 1ZIUA 4HTGA 4HW8A 2OWTA 4GO5X 4OERA 5JTYA 3OD7A 2W7YA 1NNTA 2XD3A 1MH4A 3WAEA 2O7IA 4NMLA 1NFTA 1FW0A 3CEDA 5M2VA 1B7ZA 5IT4A 3FXRA 4KHZE 4KCDA 4MLQA 2DE4A 4BDOA 5ELVA 2O1LA 3OBIA 5B70A 2B65A 4ELOA 4KD5A 4P0IA 3RQTA 4P0GA 3K6VA 4YKIA 3C31A 4JBZA 1ANFA 5IT0A 3GBBA 4RK2A 3VVFA 1A99A 2OK2A 1SW4A 4X1DA 4EXKA 3Q28A 2DWAA 4ZEKA 1QUKA 3CSBA 2QPQA 3IJOB 5I2KA 4RJZA 3U7JA 2VOZA 4U2RA 3CFZA 4I62A 3OEKA 5KDTA 2I58A 2F6GA 3OXNA 1P99A 2RC7A 2XX7A 1MS7A 3QIMA 4QHQA 2E0SA 3UIFA 4R2BA 4GLIA 1B05A 4ZEBA 3KJTA 3FJ7A 4EUOA 4OVJA 2I49A 4QSEA 4R75A 3O1LA 1O64A 3CIJA 5J1DA 4G8MA 1MPCA 1LCFA 5T41A 1N3WA 2FYIA 2Q88A 4ELQA 3ILUB 3S9EA 3C34A 1SD3A 4O3CA 3M8UA 4BDNA 3KSJA 3SEVA 2CDQA 5I59A 4IO1A 4HCWA 3SEUA 3HSTA 1MQIA 1A55A 4NE4A 4AQ4A 1B3GA 1N76A 3IR1A 2HZLA 2QJEA 2D21A 2HAVA 4DIGA 4Q8RA 1IZ1A 2P9EA 3R26A 1R9LA 4QFPA 2QRRA 2R71A 1M5DA 3U93A 5CM6A 2R9JA
chains in the Genus database with same CATH superfamily
1VQKS 4Q5TA 3HZEA 2QS4A 2HVEA 4R6YA 2M52A 2W9BA 4N6KA 1EQMA 1R0AB 2HBRB 1WG4A 4PGPA 2C2DA 4DZDA 5GAEI 4F19A 4GOTA 1HLWA 3MECB 5IS2A 1F9HA 3PDNA 1S9EA 3GTYX 4C11B 1GGGA 1S1XB 3KJQB 5TP9B 4O94A 1NRKA 5TPAB 5IT9Y 1SC4B 5A8KA 2COLA 4WKYA 1TR0A 3U27A 1CBKA 1LWXA 1X5OA 2FB0A 1R6ZA 3K1PA 4F3GA 2FLPA 5LOQA 4LFAF 4DL4A 2PC6A 4A8SA 4ZDMA 2VQEF 3QJLA 2AWZA 1T9XA 2JEIA 4ESWA 3VCDA 4H67A 4H4OA 2GQQA 2RAQA 5EX3A 3RU0A 1BK4A 2V94A 4H4KC 2REJA 2O68A 2HPUA 1MXUA 3TKDA 1A8EA 3J7YU 4I2QB 4JP8A 4OQJA 3KK2B 1RISA 3MEDB 3R1HA 3H5XA 1URSA 3IN5A 5B7DA 4MKVA 4OI0A 1KLNA 5ICTA 4EWTA 1H38A 1S77D 2HGLA 2NXOA 4DU7A 3DP6A 4PDHA 3R5DA 5L46A 5E5NA 5L1JA 5I3PA 2BEFA 4RW8B 3MM8B 3K5MA 3PRDA 3BGFA 5FJ4A 5CBRA 1UTBA 1NV5A 1QUJA 3W8PA 4ZECA 2V68A 1MY3A 1WOPA 5AA2D 5AA3A 3BBRA 2BANA 4TXSA 4QYZK 4TU7A 4DG1A 3RTFB 4UQTA 5DQHA 4QWEA 5DRKA 4F0KA 3FJ2A 3G6ES 2PVUA 2VPZB 2XMVA 3CIMA 3NMRA 3C32A 4WP8A 3CCUS 3O29A 4XDCA 1EB0A 1Q9DA 4DR4F 5FTIA 2G9OA 4K2XA 3EXCX 4I8CA 3GBAA 1T7PA 2JNJA 1AWBA 4QR0A 5G4DA 3UCZP 2I2YA 2BYCA 3IGNA 2PD1A 3BN7A 4JI2F 4OZNA 2H4WB 4TKTA 3ZSFA 4Y2CA 2I5JB 3FXBA 3C6UA 1K8AT 4F4KA 3QRPA 4YKJA 4DXUA 2ACYA 1WF0A 4CLLA 3ETOA 4KHPJ 3SQGB 2XXTA 4GWYA 1T9WA 4FBUA 3AOCA 4ES3A 2YWFA 3R6LB 2EC0A 2EKYA 4LUBA 3OLAA 2EBEA 1GV8A 2WSEC 3LO3A 2E7WA 4RW9B 1IXCA 2FLOA 5I3QA 2Y0SD 3NXZA 5CH7B 2GMHA 4IY6A 2V2ZA 2ADBA 1BQMA 4ED0A 1K73T 2JLEA 3NS6A 4IKAA 3UORA 2DE2A 3I56S 3ZNJ1 2KL8A 5ET7A 3R6GB 3H0PA 4LQ9A 1MDP1 3D3BJ 2BE9B 3DKDA 1CSJA 3HVWA 4KR0B 2ZEJA 1U4BA 3ZC4A 2DY9A 3BO4A 2Z8DA 3MW0A 2C42A 4WK1A 3Q26A 3G6XA 4FBPA 2EFPA 5F9LA 3ILOA 4ILLA 5GAHI 2HS4A 1FEEA 4GQOA 1ZZNA 3FJMA 3PUVE 5F8LA 1A7GE 2ZOGA 2L08A 3D6MB 2IHR1 3RJMB 5MLCV 4ZVHA 3KG0A 2RC8A 1SQFA 4NMYA 2EEYA 3UO0A 2IVFB 4PBQA 5LOMA 3N6MA 3OXLA 1NSKL 1TK5A 3KZGA 4ID5A 3OHAA 5EYGA 5DG7A 2MJUA 1TFDA 5I42A 1DBDA 4I9DA 2UUWA 1D4NA 3EZUA 2UXAA 1PC3A 4ATNA 3AJDA 3I82A 1T0TV 2PT2A 2YKPA 4D3GA 3Q8YA 4FYYB 1JLBB 1G0IA 2DCUB 4OVSA 4H46A 3B8BA 3N6UA 5LMNJ 3L6HA 2L41A 3TODA 1B32A 3QPIA 3C2PA 1MY1A 4OHNA 1O63A 3IA0A 3GIRA 2FUG9 1UWBB 2IDLA 5KG2A 2ZZTA 1QJMA 5I3UA 2IY5B 3PVXA 3T22A 4PQJA 1OIAA 5ET6A 3D66A 3B7DA 3IAZA 2GW8A 1XR7A 3CDUA 5E3QA 3QATA 1YLXA 4C8ZA 2N82B 1RHRB 2R7RA 4LZ5A 5DQGA 5DYHA 3SSQA 3GV7B 5D77A 1F5BA 2B5JB 2QLXA 2HGMA 2UUBJ 3CJ4A 5IKBA 4PWDB 4CNZA 3UVJA 4Y2MA 4JI8J 3BQ1A 2CQIA 1S50A 5EYFA 3N79A 4ED2A 5EYHA 3ZTOA 1U26A 1XNRF 1SUQB 3I32A 3PW4A 5KFVA 1LBZA 1YRTA 1B3LA 4H1XA 3S9LC 1LAGE 4IR9A 1NV3A 3PO4A 3QUJA 2PMZD 4ZLJA 2C2OB 2WOMB 2XLKA 1DPPA 1SKSA 5J2NB 1RUSA 4OYVA 4F4XA 4RY1A 2R6GE 1DTQB 1IMBA 1KLMA 3CJKA 1FXRA 3GFXA 1FRXA 3PW7A 1IBLF 1DPEA 4WFXA 4FS2A 3PGFA 3J81U 4ES2A 4AE5A 3UDLA 2B9YA 3BSAA 1IJFB 2V25A 4I3EA 5IM2A 1JEVA 1FBEA 4ZN3A 1HSEA 2VG5A 3DI6B 1KFDA 2QL9B 1N7XA 3EVOA 4RPFA 5FLXY 4FF2A 3W66A 4GWWA 1YPNA 4P3LA 4EZ6A 4P47A 4B3TJ 2YKQA 2RT3A 1TL7B 4NLDA 3FJGA 1HI0P 1FNOA 3T0JA 4NN3A 3M8PA 3KJFB 2GS8A 3I5OA 3AXFA 1QDUB 3KFMA 2DNQA 2DSFA 3ENVA 4PXCA 4OYWA 2DISA 2FZKB 4O23A 3CGIA 4KPCA 4ZA1A 4N4UA 5H1SV 2V84A 2YNGA 2XMTA 1HQEB 1NK5A 1OMSA 2XULA 3OR1A 3IO1A 3NGRA 1V3ZA 3Q8RB 4LFBF 2HNDB 3KFWX 5BJRA 4RR5A 3T9ZA 1WC5A 1U0SA 1S0OA 1U1MA 2MQQA 1U8SA 4L76A 1KA1A 2GVZB 3BR8A 3C36A 3G8TA 3HI9A 2MKZA 1B3HA 2ILYA 3MR5A 4PP0A 3TAMA 1MXYA 1UVIA 1IKVA 3KUHA 5JTYB 2A0FB 4DF4A 1Q8BA 3V89B 3DMJB 4ZVPB 5KFUA 3P7IA 3HSJA 5HBMB 3UP9A 1S79A 1Y1ZA 2YNHB 3HVTB 2V2VA 2KFZA 3VDFA 3TUPA 5F1QA 4LFCJ 3RB3A 4E0DA 4HVZA 2DRBA 2HQFA 3PRVA 3SEOA 4DR6J 5KFPA 4PKDB 1CQNA 2NXNA 4LATA 2KRRA 4IRDA 1VQ4S 3I0RB 1A8FA 4LVOP 4IY5A 1KFSA 4ICLB 2B8PA 3MC2A 4IGTA 3E3KA 1VI7A 5HO4A 3G8QA 2QLJB 1LFGA 2DHHA 3LGHA 2MLZA 2G29A 1S9TA 2LAOA 2M3DA 3ZKKA 2FTRA 1LFIA 4F1UA 3HO7A 2BJ1A 2BMBA 1VSOA 3W2VB 2NPIA 3QSIA 5CRYA 1TL4A 4NRTA 5DO2A 3EM1A 1RTIB 3LSLA 4FEBA 4ZIVA 2F7BA 4M5JA 1FJ9A 4LSLA 4J9RA 3OO6A 2GHWA 4M1VA 3HV1A 4FF4A 4L74A 5F8IA 4WBFA 1WDTA 4USKA 3H5SA 3AXMA 2OFGX 1MQHA 2FY8A 1FCKA 2KJWA 2Y7RA 3MOJB 4DUZF 2F4FA 1EP4A 3QSYB 3ONMA 2DYAA 3RG6A 1VFEA 1JNFA 2G1HA 2C2NA 1C0UB 1JLCA 4HT5A 2DGXA 3DLKB 1TL1A 5AE3A 4WXWA 2SXLA 1MN9A 3MAQA 2R7TA 1IBKF 4BWJA 3BO2A 1P1UA 4OVRA 3VF0B 3NNAA 2HBZB 2NLWA 2Q66A 2XGQA 4DUYF 3J80U 3VZIA 3TCGA 1U1NA 1ICEB 2VJUA 3SBMA 4F3OA 1DJ0A 2IBKA 2Q2CA 1RAOA 1H98A 2AJ2A 2E1SA 1XIQA 3E01A 4CO4A 4BCAA 3D6FB 2ZHOA 2RHQB 4K4VA 3LQVA 5J2MA 2ERRA 3LF0A 3IFAA 3LP1B 1NPRA 4KGKA 2FJBB 1PAUB 1MWZA 2XXVA 2ZMBA 2Z56B 5H8HB 2BOPA 1WACA 3TELA 2E5IA 5E3PA 4PG5A 2W24A 2O67A 1H3DA 4U7CA 4Q5VA 3G82A 2NXCA 2ZNTA 2M4MA 3KWMA 3W60A 3R97A 1JLAB 4PG8A 1TXFA 4AQYF 4IYQA 2PI4A 1HBUB 3O6IA 4B3SJ 4ZEIA 1MW7A 2FIXA 4LRDA 1YDLA 4N15A 2MQ8A 4EGLA 3OHBA 3SI8A 4X4OA 1FPLA 3QT7A 4CYUA 4E0XA 4QU7A 2HQ0A 2GHAA 2FJXA 3PFEA 2GMJA 1QVSA 1TKTA 4RO0A 3M9NB 1E6YA 2PEHA 3LGMA 1UQWA 3SV4A 3FIRA 3CNQP 5LJ5Y 1VQ9S 4G1QB 2BBEA 2VG6B 3AOAA 2F36A 2LEPA 3QZ8A 2ZYMA 4B9VA 1LWCB 2JC0A 3F11A 3HJVA 4ILRA 5CMCA 3SETA 3W7BA 1RWMB 2AGPA 2OJ3A 3LPYA 4XEQA 3MM6B 2F3BA 4GXSB 3CJSA 2KT3A 5EQ9A 2JC1A 2V6AA 2HHUA 1DLOA 3EQ1A 2DNPA 2LXFA 3RRGA 3EPEA 2ASYA 3EICA 1RAHB 2HFNA 3PXGa 3FASA 2V8HA 4DL2A 1ULRA 4L3NA 1HNIA 3E51A 1FTJA 4GL0A 3ZKLA 3O66A 3PJ9A 1T05A 4IUFA 3MPKA 3GSDA 3KMQA 3CJ8A 2BQRA 5TU0A 2QL7B 4RL1A 2ZDOA 4ECVA 3CXCR 1L3SA 2F4VF 2RVJA 4URSA 3TUIC 2HVIA 4EQ9A 2QG9B 4OYBA 5I57B 4P71A 1JKHA 1NI9A 4F1YA 1UCNA 2K2PA 2DDKA 1W7WA 1S97A 2RMLA 4NF6A 2Z8QA 4PG6A 1RT4A 2GJFA 3K02A 3CCVS 3G3KA 2XYPB 4I67A 1HI1A 4OZ1A 4PFYA 4U23A 2ASDA 4JI7F 4OQOA 4LRBA 4QR2A 4LBHA 3G6VA 2ZUAA 3AA8A 3V6DB 1WC6A 5AJ3F 3N4WA 1I6AA 2VIHA 3D1QA 3SEXA 2ATCB 1UTHA 1OPIA 3MMAB 2VFUA 3PJWA 1WHWA 2VP1A 3DP4A 1IBMJ 2PDAA 1RT1B 3FGSA 4FEDA 1DY3A 3IRWP 4ZCIA 3HSGA 2UXBF 5LSRA 3U1OA 3DDNA 5DM6Q 3KJNB 1X7VA 4I4BA 2IM2A 4DV1J 4DSJA 4IRCA 1CJUA 2QT7A 3HPIA 4DV7J 5B0AA 2DY1A 3FUZA 4PXDA 3TAPA 2KFYA 1JLGB 3B6WA 2MY7A 2X7QA 3IWXA 3K2DA 2F3DA 4PCQA 3ZTPA 2CYYA 1XI6A 3MMCA 2V63A 4E0WA 2CVEA 2UVVA 2X1FA 4AS4A 3P3DA 4RXLA 4OX6A 3PPQA 2QFIA 4DPWA 5KFEA 4X65J 2IIHA 2DEJA 2YKAA 1I5OB 1R0AA 3ICLA 1UIVA 3U92A 5CXTA 1BHNA 4QIVA 2R8TA 4DLEA 2R9LA 2CQ2A 3MECA 4C11A 2YLNA 3PCOB 1S1XA 2QIFA 3QGIA 4K50A 1PB9A 5AE4A 5TP9A 2MQOA 3QSLA 3LSWA 2JLGA 3CD0A 5IAIA 2FPHX 5TPAA 3QT5A 1X9WA 1NNPA 1X8DA 5T7LB 4FS1A 1Q35A 5ADZA 3H4DA 1P9QC 3HMJG 1YSJA 5F3ZA 2H4IA 2EBGA 3OR2B 1UW4A 1GK8A 2DWJA 4H5GA 4YP3A 1TL5A 4PFRA 4JI4F 4Q30B 1HW9A 1TMJA 3KC1A 2F97A 1H43A 3H5YA 1KVJA 2H4YB 3KOTA 4I2QA 1H2VZ 3ILLA 3LPEA 1UEUA 3KK2A 4QPTA 2YWHA 3MEDA 3KNAA 2H51B 1MWYA 2QJ3A 4DCYA 1HI8A 3QAXA 1Z2LA 2NYHA 2XG8A 4OVQA 1DQ9A 4HL9A 3EZ5A 4RW8A 4UY8T 3MM8A 3PPPA 4PUOB 2CADA 1TL3B 3VGTA 4DZ1A 1S76D 4G3IA 5CD4A 3USDA 1QAJA 2QTWA 1LBCA 4P73A 5EWFA 1X4DA 4I1DA 5MAOA 2CDRB 3K6XA 5JVGQ 2A6OA 2V8DA 1GR2A 4JV2A 1MN7A 3GXAA 2GVDB 3V81B 4YB5A 4N47A 4BC7A 3KMSA 1B70B 1RAJA 3OSPA 1D9YA 3NCRA 4JI6F 1NO8A 1U47A 2QV6A 4P75A 3SCJE 2RU3A 5GADI 4FF3A 1MG7A 3LA0A 2QX0A 2NXUA 2V8VA 4ZPVR 3OPKA 2HHTA 1VIXA 1MDQA 2I5JA 2M2BA 4KCCA 3BIGA 1II5A 3KUGA 2QS3A 1SQEA 3W5XA 3RUBL 1RWVB 2VDIA 1UTAA 3RR8A 3SQGA 4KT0C 2VG7B 3P5TL 5K14B 1VHFA 1SC1B 1KTQA 2F8HA 2V9KA 2KRBA 2DGOA 4GMKA 4RW9A 2VODA 3R5AA 1B7HA 1C4CA 2GRVA 2I9SA 3HF5A 1BQNB 5KOXA 5IQ6A 2Q6BA 4U7UK 3G4SS 4XF5A 3BBFA 4F04B 3J81j 3N6TA 1Q7LB 3T9HB 1MXXA 1NHKL 5L9SA 2QA4S 2HXRA 1MY0A 3GWCA 1FQFA 2ESNA 1WEZA 2ONKE 2CQGA 3IRXB 5DDPC 1B40A 1CJTB 1PYOB 1A54A 2FQQB 1FI4A 1VC6A 1MPDA 1B0HA 3WQPA 2MKCA 3T9NA 5J2QB 3V8XB 3LANA 3T5JA 1VR5A 4J90A 1XJWB 1LNQA 4ZPWR 1N33J 3LH2S 5CMBA 2RKIB 2H5YA 2YH1A 4MYTA 4PAKA 2HGNA 4DV5J 1SVXB 4F7VA 3BKFA 4TLQA 1Y5IB 2RSQA 4POWA 1RWNB 3CCQS 1BC6A 4ZPTR 2CQ4A 1B99A 3SFUA 3IB2A 2BRKA 1X4EA 2E7XA 4HE0A 2AYEA 1H76A 1IR2A 3LSFB 1FA0A 2XMMA 5F0WA 3RAXA 1JLBA 2AEFA 1YTVA 2MKSA 3R9LA 4QRZA 3DGPB 1URGA 3GJRB 4O3NA 3DN9A 4OETA 3TEHB 1G0HA 9RUBA 3LWLA 3U1MA 3KHHA 3AB2B 2P6TA 5F0UA 3V4IB 4DHVA 1Q16B 4LQ3A 1UWBA 4CRJA 1D0EA 4BS2A 2DGSA 1ZH5A 4KHPF 1MNEA 4CH0S 3JSMB 1FKOB 4RA1A 2K8GA 4G1PA 1PIEA 5KFTA 1VQMS 2X1GA 1YZ6A 2GAGC 4ECYA 2HHVA 3KLHB 2MKKA 4YUDA 3MVWA 1YJ7A 3K59A 2THIA 2WTFA 4DCJB 3KLFB 2B5JA 2E9TA 2GAHC 1J5OB 1C2PA 4PWDA 2NSCA 1VS3A 2Y7WA 1TQLA 3D5MA 4OL8A 2IC3B 2NSBA 3IK6B 4PAAA 5A6PA 4PFUA 1A40A 1FRMA 3EWGA 3BSOA 3M32B 3CCWA 1XK8A 1KQSR 4C8LA 2XWXA 1LB8A 1FBHA 4UOGA 1UVKA 3P49B 5CMMA 1SUQA 4CWBA 3R6UA 2UP1A 2DNMA 3W1YC 1MXWA 2CJKA 4U1OA 4NA1A 3CE8A 1I94J 3GYYA 2AL5A 3TOQA 5JJBA 2WOMA 3GJQB 4A47A 1XT8A 5J2NA 3MBPA 3PYGA 2IA4A 4DQQA 3TFLA 1NH8A 4TQRA 5HI7A 1DTQA 4J37A 2HBQB 1YJUA 3HN0A 2HKEA 4IGRA 1RDRA 1LGBC 1WG1A 4OESA 3VWSA 5L9OA 4FF1A 3V83A 1NZ8A 2WCXA 4GKKJ 1B4HA 2DGQA 3DI6A 2R42A 1K9ZA 5CMKA 2CPJA 2I38A 1YJTA 3PEHA 2BJJX 4KFQA 5FHNA 2HW3A 2DO4A 1UJ5A 1Q8LA 4UY85 1Y3NA 4JWYA 3D67A 3UR0A 4KE5A 2VJVA 4C2MA 4WZMA 1TL7A 3MHYA 4B3MJ 4ECWA 1UP1A 5LMNF 4GL8A 5K5MA 4GBWA 2KHDA 2M88A 4ETZA 1YBAA 2W1BA 3PHEA 3TAQA 3OTEA 2CJBA 1AZSB 3CT9A 4YKKA 3FV1A 3NOHA 3PPNA 4DI4B 3HFVA 2IJNA 2ZBIA 3MUMP 3Q8UA 4DX8H 2VASA 3VV5A 3MPYA 2QS1A 2HEKA 2HNDA 4P8BA 4DLDA 1LK7A 2KT2A 2ZZWA 3PYFA 1VQOS 2Q8JA 4YR3A 5J2PB 2H98A 2HXWA 5BXIA 2UUBF 2GVZA 4R6KA 3WIVA 2LQ5A 1M5BA 1QUIA 2EG2A 4RNNA 4JB8B 3M2RB 2XXIA 4C0BA 2IMWP 4JI8F 2V8PA 5JTYA 2RDIA 1UA0A 1SCJB 4I64A 3DMJA 2GA7A 3CMAS 1PCAA 4B9TA 1VQ8S 5L38A 1FW0A 5M2VA 1B7ZA 5HBMA 2DNZA 1U6BA 2R7QA 2YNHA 3HVTA 1RT2B 1HBOB 4BDOA 2QMUB 3ZFVA 5ELVA 4ZVGA 2XEXA 2R8KA 2VOOA 4JI0F 2B65A 1JNRB 1C1CB 1NK0A 3R7SB 3MM9B 1DRZA 4IG0B 2MY8A 2FVQA 1KHWA 3BV8A 5DQIA 1Y4ZB 2QEXS 3DRYA 4Q44A 5IT0A 3I0RA 4NCAA 1NJXA 2FBPA 2BOAA 4ICLA 1UAWA 2PFZA 4ANCA 3J7A1 4Y6IA 4B17A 2DCLA 1HYSB 4WE1B 3CJ3A 4ZEKA 1KONA 5KFOA 3CSBA 1QSSA 2IYGA 1KOOA 2QPQA 3U1NA 3U7JA 2HNZB 1RQ0A 4NPOA 4YS2A 4QYRA 5CCLA 4G61A 1J27A 3B4MA 3W2VA 1RDZA 2DNRA 2F6GA 1NBEB 2PA8D 4ZVSB 1RTIA 3BDPA 2RC7A 3GG0A 4B3TF 4OLPA 3QIMA 2E0SA 3UIFA 2XS5A 4HACB 5JXSA 1BQXA 2KYZA 4ECZA 3KJTA 1VCTA 3R2CJ 3UD5A 4EUOA 4OVJA 4QSEA 3O44A 3CIJA 1REGX 2ZVSA 4PPDA 3FKBA 4NCBA 5T41A 2DHGA 2FYIA 3TJAA 3UI3A 5T14A 3GP9A 2WYKA 4NYZA 4DFPA 1Y5LB 4PFIA 4BDNA 2MZRA 3W62A 1C0UA 1QTMA 3DLKA 1TK8A 4WKRA 3SEUA 1BWVA 2E5JA 4NE4A 4J9LA 4NF0A 4E98A 1S4FA 4F4ZA 2MKIA 1B3GA 3EMTA 1KVKA 3RB4A 1SV5B 1Y11A 5DETA 2E29A 2P5VA 2B0GA 2VFVA 4HT7A 4KJIA 3OV7A 1CPZA 1F60B 4ECSA 4PQUB 1U1RA 3QT8A 1R7IA 2P9EA 4F36A 3R26A 1FHTA 2XBPA 1FVQA 2EXUA 2R71A 2U1AA 2VV5A 4HXVA 5CM6A 3CJ0A 3LP1A 2IPOB 2ZXTA 2XCAA 1IMFA 2DH8A 2F8EX 2FIEA 4WEPA 5E3RA 3H5UA 3OL6A 4LFCF 3TPAA 3MCNA 1UJ4A 5A8RB 4PETA 3CC4S 2RDJA 4X4TA 4OJ3A 3B50A 2KJVA 2L9WA 5H8HA 1FPDA 4YMBA 2YX7A 3THVA 5IT9U 3IB1A 1B3TA 2IM0A 1F9EB 2UVHA 3PEJA 3H06B 4LT6A 2C22A 1QKAA 1VFDA 4P9KA 2BACA 4ECRA 1JLAA 1NU4A 3H4BA 1SQYA 4U7UD 1HBUA 1SC6A 5I3SA 4F02A 2Y7PA 2ZJRQ 4PFWA 2DH7A 1S12A 1T3NA 4BWMA 5M2PA 3FVGA 4OHZA 2FA7A 2ZNYA 2GGPB 3CIZA 1X60A 4ZOSA 1TVRB 2XY6A 4WEDA 3I5BA 3DHXA 4JSOA 1FERA 1FQAA 3NAIA 2F3JA 4EBDA 2R7UA 5EDWA 3IFEA 5HATA 1TP7A 3VAJA 1PBUA 2VBXA 4H5FA 1SJ3P 1PGZA 1PBPA 3SCIE 1Q81T 2MPUA 3R7NB 5K8OA 3GILA 4G1QA 2VG6A 1S99A 3PTYA 2RS2A 2CZIA 3WIUA 3K6WA 1LWCA 3A3CA 3H6WA 3I0SB 3TZAA 4X9TA 3I96A 2I0CA 4O3QA 5FBPA 1BKAA 4GWZA 2GQCA 3G3JA 4PDDA 4IO5A 1H74A 1VGYA 4PC9A 1JB0C 3B6QA 2QN6B 4FXWA 4TN2A 3PUWE 2HQ3A 2OX3A 2VOPA 5CD4H 4RLEA 2R2TA 2GQ2A 3CFXA 3VLVA 3NMAA 2HZAA 2DT9A 5BYQA 4P9SA 2NWJA 1F6TA 4O4GB 1SKRA 2VZ9A 1RAEB 1SQGA 1NJWA 2HZVA 3CMES 1H7WA 4K4SA 3ENQA 1M1KT 1Q78A 4N8OA 4DR4J 4ZHRB 2EI5A 3HLUA 2CUYA 1LBWA 2G1DA 1X4CA 2F5XA 3KGCA 3C46A 5I57A 1NAQA 1XBWA 4JI2J 4EO8A 3G6YA 5FHMA 1AT1B 5THWA 4WIQA 1QULA 2HCAA 1TUVA 2GNKA 3LP2B 3MAHA 4C4WA 1JWWA 4OEUA 4YOEA 3IJXB 1H72C 3TUSA 3MZ9A 1FBGA 3HO1A 4IQMA 3V6DA 1FTLA 4DWIA 2XD2A 1P9YA 2OZZA 3LV0A 1RT1A 1VQLS 4B3SF 2VKZG 2UVUA 4RNSA 4LIRA 2QC3A 3P45B 2KZZA 1S6QA 3QAEA 4Q0BB 2V2KA 3NG8A 4CO2A 1FTCA 2K7JA 4GVOA 4KR5A 3Q29A 3QFHA 4P6QA 2Q8MA 5B08A 2QSFA 2DNGA 2FYXA 4F3PA 1N5YB 3DU6A 2V4CA 1JLGA 1FDAA 4FP9A 3OFFA 1LW0B 2DPIA 1H73A 3KJ7A 1RU2A 3DDKA 3KKFA 3TARA 5I2NB 2GMLA 1WD6A 1YKWA 4H6DA 3JXOA 3QWUA 3QUFA 4RW6A 4DL3A 1ELJA 1LBVA 4DCOB 5LJ3Y 3EF7A 3P6YC 2BR0A 4K8RA 2ASLA 1NUYA 1D9DA 3K7RA 5HVHA 2AJ4A 4UOHA 2OJTA 3A12A 2D5WA 4WYWA 1FTKA 1T0KA 3E9XA 3TA0A 1SJFA 5K2XA 1OYDA 1SJ1A 3W5YA 3H6TA 3MZIA 1YVFA 1FCAA 2C2KB 2KYXA 2VBWA 1RT7B 2CPHA 1VQNS 3Q22A 4DL5A 1F9BA 1SBPA 3KXDA 1I6QA 3CDAA 5T7LA 4MHFA 3MZBA 4NYOA 3PMVA 2WZ1A 4R6HA 1WC1A 2WBMA 1JLFB 1HNZJ 3W63A 3OR2A 2B3FA 4IG3B 4GFRA 4NCGA 1IUJA 1KWMA 2JDJA 2PGCA 4PQAA 2DYXA 5C42B 3AQOA 1HSJA 4OHVA 2IA0A 4MAKA 4LJMA 1XWLA 1F3VA 4JV1A 4P7VA 4I2PB 4U8VA 3U72A 5DDRC 1DCUA 3HZGA 5BYRA 5J16A 2KZMA 2B4MA 3N5LA 1S0NA 2MLYA 1SL2A 2D3IA 3EX7B 5AE1A 3C4MA 3CFLA 5EWEA 4F3SA 1Z1ZA 1RHQB 4NZ6A 2H9ZA 3M2UB 1RWKB 3PX6A 1IBMF 2PFDA 3I31A 4QFNA 1WC3A 1WHVA 3FEYB 3LP0B 1BQMB 1RACB 4FDFA 1VQ5S 4PUOA 3VZHA 1TL3A 2BABA 5A2QY 1EKRA 3GZ7A 1DARA 2YKNB 3M2VB 2K3KA 3EZOA 1LQ9A 4PE3A 2IEEA 4BDRA 2HLTA 2KM8C 1NJIT 4DV1F 3Q23A 1HIYA 4PAIA 4JVIA 2ZBRA 5KG1A 4MKAA 3MR6A 2P6SA 4KH1B 1OIBA 4HDHA 4DV7F 4O3BA 2BUNA 3PPOA 1G6BA 5LMUJ 1Q82T 3TYTA 2GVDA 3V81A 5B7WA 4ELPA 2HQGA 1R3NA 1MQGA 3PU5A 1DHMA 3PPRA 2ALZA 3DDIA 4FAJA 4MFBB 1FBFA 1VJWA 5ESYA 2JLFA 4FNHA 3TQLA 3FZVA 4ESXA 2O3DA 3SEYA 1ZJLA 1XEZA 1HKAA 3ZO7A 4U95A 5GAGI 1DSNA 1JJHA 1YJ9S 2CWXA 3NRBA 1IN0A 2VU5A 3OXGA 1FFWB 1CC7A 2L9DA 2AL4A 4DMZA 1RAGB 1MMDA 5K14A 5FLXU 5I56B 1TZ0A 3TQWA 2UVIA 2M0GB 3IO4A 1VBYA 4KGVB 1IWAA 5CZVA 3UW1A 2DK2A 4K4YA 4NLXA 3PX4A 2MMYA 4RYAA 1B5IA 3VAGA 4LRAA 1X9MA 2ANJA 1ZU0A 1LFHA 1BQNA 3D9BA 1FBPA 3KN3A 5I58B 1XR5A 2BDPA 3UGWA 1VC5A 1U24A 4NLTA 4QBAA 4WWSA 3MYUA 5IZHA 1QAYA 1DBZA 1MSWD 5KFNA 1TFWA 4C1TA 5L1KA 2BQUA 2E1RA 1FQCA 4LZ8A 3Q86A 4NXNF 3GQCA 2AGOA 3EDRB 3IRXA 3AT1B 2JVOA 2IJRA 1CJTA 5D3GB 1FJ7A 3KEIA 3KG4A 3K89A 1YX2A 1M5VC 1RBAA 3ISNC 2XNRA 2YKMB 5J2QA 1LAHE 4OZ9A 7FDRA 1RA6A 3PIOQ 3GR0A 1QJHA 1MXZA 3RY3A 4RBTA 4USJC 3TX0A 4K0KJ 3V6HA 4PFBA 4ZPBA 2RKIA 3EDQB 4UOFA 2VONA 1K9MT 3MQ9A 1FWLA 3OQ2A 3PX0A 1Y00A 3TWZA 5KFCA 1N0VC 3WC0A 3NCQA 2RINA 1OQGA 4MMOA 1FESA 2MZQA 4LR8A 2V3UA 1B51A 2YNFB 1IR0A 4QXDA 3CJKB 1OVBA 3VR1A 1WSVA 4OYZA 2Z2MA 3DGPA 2IRYA 1BP5A 1VRTB 5KFFA 3K57A 3SEWA 2JVRA 2VDHA 4NG7A 3W9IA 2Q3PA 3V4IA 2E44A 2XWYA 2XY7A 2J0SD 3JSMA 2POKA 1TAUA 1FKOA 2V8GA 4ZIWA 4O3SA 5KFKA 4C8OA 2GCFA 3KLHA 4M8LA 4KGXB 1URNA 4YMEA 4QIGA 5IC4B 1X9SA 1NHVA 2R4FA 3KLFA 1AROP 1AOVA 1LFPA 4QJVA 2ZZNA 3RBDA 5CAAA 5HQLA 2RQMA 2W2NP 1J5OA 2XMUA 1RGVA 4N13A 3VGSA 2IC3A 1OMPA 4XXUA 2ZBQA 3OFHA 1OS5A 3RBXA 4JI3J 3M32A 3DYAB 4TLLB 4CIOA 4M5LA 2GHPA 5CC2A 3RBEA 1GT8A 3H2LA 2WSCC 4ZCMA 3IL1B 3W9HA 3TTLA 4RPNA 4IH5A 2DH9A 1WODA 1UEVA 3D1RA 2CJQA 4NMXA 4B08A 3OEMA 5CCMA 1SJQA 2DXFA 4QWDA 4PFTA 1ZTYA 1F1BB 1SW5A 2M8CA 1WVJA 3LWMA 2CPEA 4YDDB 3Q8PB 4PAFA 5I5PA 1F9FA 1WI6A 2Q43A 3PG9A 4MH5A 1Z4UA 4DE8A 2I3WA 1H7XA 4F2SA 4IR8A 2N7CA 4C0HA 1UFKA 1HNWJ 1NV0A 2YXLA 3VQSA 4DX5A 1N33F 5M2RA 3CCJS 3S9MC 1ACMB 4DV5F 4U8YA 4ELRA 2H99A 3ILJA 1Y7PA 1PG5B 4OX8A 2QA4G 4A8XA 1YIJS 1RBOB 4X4SA 2CZHA 4KKOB 1RAFB 3RYLA 3MAAB 2RCAA 1LWFB 4OZ0A 2DO0A 4FJPA 3HSZA 1Q4RA 2P2AA 3LBSA 1E6VB 2ZNZA 3BSNA 2YWWA 4DEZA 4BBYA 2E5LJ 2PFFB 4RUHA 3R7BB 5KZTA 2JL9A 2QYCA 4X4UA 3X1LB 2DB1A 3HT3A 4H0WA 4PYDA 1FRJA 4XTCQ 5H8QB 2N7YA 3R5CA 3VTIA 3LSXA 3FCVA 2AEMA 1AZSA 4OHWA 1PB8A 4ZCLA 3ULHA 2MQNA 4W90B 3J7YI 1MQDA 4EFAC 4XPEA 4U4SA 4CO5A 2PMHA 4FN5A 9ATCB 5IV3A 4LP2B 5L8RC 2FVPA 4ZEDA 5J2PA 2FZCB 1QVFR 3RBZA 1Q95G 4MIWA 4C6AA 2XXHA 3T1AA 3G96A 2CJYB 3M2RA 3V4MA 4C3KA 4XPCA 2DS9A 4JVDA 1RWUA 1T9TA 3FCHA 4K7QA 2JOQA 3EXYA 5GVQA 3K0VA 5FD1A 1WKJA 1U09A 2C3YA 3RTVA 2V9WA 3UR3C 1EP4B 4O7MA 1FBDA 4F3BA 3TZZA 5JUMA 1Y10A 2GO8A 1I94F 4UT4A 4KYZA 1RT2A 1HBOA 3GIKA 5HANA 1TL1B 3BGRB 2XI2A 5HLFB 3GU0A 3TANA 3ITHB 4I6WA 3OXFA 2MZSA 4DR5J 5KT7A 1C1CA 3MM9A 2R8IA 2E1MC 4TYAA 4N17A 1QUPA 4IG0A 1LEVA 2Y1IA 4OFLA 3BGOP 4ND9A 2HRTA 4YICA 3Q2TC 4HDGA 5IXUA 3O6GA 5FTHA 1NSQA 2G0JA 2DXEA 3MF5A 3U1LA 1U1QA 4GKKF 1RU1A 3T1HJ 1HYSA 1HMVB 4WE1A 5J2MB 2UXCF 3F41A 3W64A 2OUGA 3FBPA 2CZ4A 2DTJA 4EBCA 2PX1A 2ZZVA 2NOOA 1KNZA 2HNZA 4F31B 3AHPA 1B7FA 5ITPA 3LUYA 1FTAA 2E1CA 2NREA 2BJ8A 2X26A 5D78A 3O9PA 4M5MA 3K1MA 1TAQA 2EC2A 3MVZA 2F6PA 1CJVB 3Q83A 4HACA 4CLUA 2LQ9A 2WBRA 3KLVA 4GKJJ 2JRSA 3LUZA 2V3TA 4LQ2A 1P1OA 3ENAA 1DURA 4K5SA 1QD1A 4USTA 1FPKA 2VHAA 3HXMA 2OMOA 3QRQA 5HROB 4GVBB 1OO0B 4TOZA 3G87A 4GX4A 3MCMA 3IFCA 5SZTA 5I7IA 2LVWA 3OO8A 1ZLQA 4DR1J 4YZZA 2VPOA 1Q8IA 1ZM3A 1EH3A 3W61A 1TT1A 4AFFA 2KO1A 5KAKA 3BFTA 4PWUA 2A10A 5FHOA 1SV5A 3AD8C 1S0VA 1QE1A 3DCAA 1PDAA 2D9OA 2DNHA 3H4ZA 2AV5A 4RK9A 3BB5A 2G2ZA 4YU0A 1HWJA 1SPBP 2FC8A 4PQUA 3MJNA 4BLAA 4FPIA 1OVTA 5FIIA 3ROJA 4BLGA 4YN3B 1UVLA 4NHBA 1P1TA 4M4GA 1POY1 1RT5B 1RHJB 4MYUA 3PR5B 2YPNA 1GX6A 3MFHA 5HQ8A 1LB9A 4N6DA 1GMUA 2M70A 5HAOA 5A8RA 1U1PA 2KXHA 4G8HA 1GTEA 5ISUA 4YEAA 4LF4J 3FRYA 5KFRA 3VLUA 1CS4B 3MPLA 2DBBA 2NPFA 3FXUA 4GF8A 2W9AA 4HHHA 4Y3CA 1UW9A 2IBOA 1FK9B 1B3FA 3RPWA 2MZJA 3CO9A 4H8JA 4MBPA 3HHNB 5D4OA 4RUCA 2GGPA 3RPLB 1TVRA 3FXQA 3THTA 4QFKA 4O3OA 1J2VA 2D74B 4NF6B 1AXQA 4X1BA 1HBMB 4WXJA 5BUUA 2XXQA 2N4DA 3HCXA 2FC9A 4JV0A 1FO1A 4LQ5A 3FVOA 3IAS9 2HQIA 3BREA 4RU2A 3F56A 5F8JA 4K3FA 4OI3A 1L3VA 4A8YA 5F9NA 2WB4A 2DWHA 1UTHB 1FPEA 1T9VA 5CYJA 2LU1A 1HSLA 5KT6A 3I0SA 4C0OC 2WVBA 2OTJS 2AJ1A 4DQIA 1XERA 3QWPA 3GLJA 2U2FA 1RDYA 3TA1A 3W15C 2KB2A 4OEVA 1PO6A 5DTBA 1JETA 4TVAB 3TZYA 2DNYA 3QRRA 2FHJA 1H44A 2HAIA 1HD1A 2F7CA 2W4CA 3GFHA 4OI2A 1FJEB 1FDDA 3GB0A 2LCWA 1N5SA 2B9WA 1ZMGA 4QOTA 1S6UA 4OX9F 3EPGA 1K0VA 2HEUA 1NNDA 4O4GA 3FNNA 3N6NA 4DFKA 1LV5A 4NAPA 2NUUG 1UVNA 3ENWA 1S6OA 4DR2J 3GIIA 4ZE8A 1LBYA 3T96B 2R7VA 1NXIA 2LXUA 2LXIA 2W4PA 1KQKA 4RNOA 2E7VA 4FYXB 2WW8A 4ZHRA 1POTA 1RTJB 4YMAA 3GJTB 1RI7A 2Q79A 2DNKA 1IM6A 4L75A 1R43A 3UN6A 2XS2A 1VQYA 1L3UA 5E3AA 3LP2A 2B4UA 3JSBA 2RHSB 2L9NA 3GIMA 3PHTA 3W9WA 1O0PA 2APOA 4QIWD 2RS8A 1RBLA 1F2HA 4YY3J 2CQ3A 3IS9B 3NP5A 1JJ4A 3NNCA 4B3RJ 2LQJA 3KDNA 1H6KX 4LR7A 1TUWA 4ED7A 2F78A 4DU8A 3OUYB 4F3QA 1R8BA 1YZ0A 4HCYA 4Q0BA 1Y9UA 4BDMA 4FKXA 4WFYA 1S48A 1UPMB 1MY2A 4ID8A 3DOKB 1NJYA 5HJXA 3IOWA 2HZCA 3IOUA 1WTBA 2GQ1A 1N5YA 4HI2A 1LW0A 4K4UA 2ZYNA 4CLSA 1RXOB 3CC2S 4XKPA 5KCJB 5I2NA 5GMKa 2KVIA 5IZ1A 3TTKA 3D28A 1W26A 3GCXP 1JX4A 2PEBA 4OYIA 3SCLE 2D41A 1HWLA 2WRMA 3FK4A 1YBTA 4H65A 5CABA 4P2XA 4RBVA 2R3VA 4Y34A 1IBCB 4WXOA 1LBBA 3H6VA 2HFZA 1TU0B 1L5UA 3A13A 3CTRA 1WKKA 5KG5A 4RW7B 1L5TA 4OYAA 3H98A 1Q1KA 4F4YA 5DG9A 3BPSP 3BBBA 3DNCA 1RT7A 2XS7A 2NXJA 4OMBA 3FQKA 1YWXA 2IVMA 3EPIA 4X4PA 1C1BB 4PG4A 3UNGC 3HKWA 3T9XB 4JI1J 1JLFA 1BLUA 1UWAA 2CWKA 4NLSA 2FVSA 2JEFA 2Z2LA 3SCKE 4IG3A 2WONB 3FATA 5C42A 3AXKA 3OJSA 4X4RA 2MEWA 3MZ1A 4PZVA 3H90A 3PMXA 1S1UB 4N91A 1IM4A 4F0HA 2Q2AA 5HVGA 2X7PA 4ENOA 4I2PA 4KC5A 3NGKA 3GCWP 3PIPQ 2CAJA 2BE2B 1KP6A 2UV8A 4DFMA 4CT9A 2DRDA 1R6VA 2XXXA 3GZGA 1KRPA 4PR6A 1KN6A 2B4VA 2XWVA 1YK9A 1HD0A 2YY3A 1TV6B 1CC8A 4UW2A 3AJ1A 3N0VA 1NV2A 4FYDA 3M2UA 1IVZA 3OVBA 3NOCA 3EGWB 5K8NA 3UQSA 3M30A 2VPNA 1NH7A 2OHDA 3LP0A 4MEVA 3DLLQ 2GO9A 3TZXA 3JSYA 3J7ZT 1M5PC 2YKNA 2LEAA 3M2VA 4DQRA 2B56A 4DV3J 2OBGA 4DDDA 3DRRB 3F44A 2I4BA 1FDNA 2DWIA 1EKSA 3C33A 4OI1A 2J9CA 3G2XA 4U67Q 3H2UB 4MX6A 2YKOA 3B78A 4WIIA 4GVLA 4YR0A 2YPZA 3PW0A 3MDFA 3O2IA 1Y4TA 3M8QB 4UA8A 4OZJA 2FJDB 4UQGA 2XXPA 4ZS9A 2XHCA 4MFBA 3GMGA 3H2VE 4AB5A 2E1AA 2E66A 3WAFA 3NWRA 2WVEA 3QXMA 2JFDA 2B8QA 3HD2A 1KQFB 2AYGA 5B0EA 1F3FA 4Q2LA 2RIJA 2Y5LA 2QVRA 4P10A 3FBCA 2DOJA 3CB4A 3UD3P 4KYSA 4ZVEA 3OL9A 3ADAC 1WEXA 6AT1B 4NXMJ 4LF5J 3HFKA 1TUGB 3POTB 2QLBB 4AXIA 2Q9TA 3HSDA 3RB0A 4Q2MA 5I56A 4A8WA 4EZ9A 3FFIB 3GR1A 1HNZF 4QIEA 3BGLA 1OY9A 5A8WB 1B64A 2ZUGA 3V5AA 2AIRB 4L72B 1JLEB 3M1VB 3K00A 1NNKA 3M05A 2X51A 5LXRA 3I6VA 1YITS 4YHHJ 1VFJA 5I58A 2ROPA 1KBRA 1Z2ZA 3HD1A 2YX1A 3M7VA 1U02A 3VAFA 2OTLS 3C3LA 3GE9A 2VPYB 3TTRA 2GFFA 2X3GA 3W65A 3MR3A 1Y5NB 5KFJA 2XA5A 3B6TA 2W2PP 3OLBA 1HWUA 5KFIA 2A3JA 2I3VA 3TYHA 3OENA 4QZVB 4F22A 5D3GA 1GXLA 2J5AA 2X1BA 1ZYQA 5KFMA 1U8WA 4PPZA 1P1WA 5L9XA 3RT8A 4HR2A 2YKMA 1ZIUA 3SDEB 1RWWB 3SSSA 2V67A 2FVCA 2L3MA 2XD3A 3A3OB 3CCRS 3FQLA 4NMLA 2BRLA 2DR8A 5ET5A 4QW9A 5D0HA 3LAMA 2UVWA 5LMUF 4DX7A 3UN2A 1Q5VA 2DE4A 1KZ8A 1V3RA 4JI0J 4MJKA 2OEMA 4ELOA 2JX2A 3F0NA 4Y2KA 4P0IA 3QGGA 4FYWB 3I55S 3RQTA 3NWGA 2CPIA 4ED8A 2YNFA 2DGWA 3JTNA 2B4PA 3K6VA 2DNLA 1ANFA 1VRTA 5EWGA 2DD8S 4U9RA 2CQ1A 2DHSA 2DR7A 3Q28A 2ASJA 2DWAA 4Z7CA 1W2BR 5DLFA 2IRUA 2AD9A 2MSSA 3IJOB 2AF6A 1B7YB 1CNQA 5H9FJ 4O4RA 2W8LA 2LA6A 1U45A 4ERDA 1R8CA 2I58A 1S5ZA 4Q8EA 1FRLA 4KGMA 1P99A 3SXLA 1U0HB 2IM3A 1AW0A 4R2BA 4GLIA 1K47A 4Q8FA 5IQQA 3FJ7A 2XTJP 2I49A 5J1DA 3W2WB 1MPCA 1LCFA 3DYAA 1N3WA 4B02A 5RUBA 3HT0A 5LL6d 2Y5KA 4O3CA 1SD3A 1QAXA 3N5BA 4KRWA 3KSJA 5AXNA 3K8WA 1EJ7L 4LSZB 1KDNA 2CDQA 3MGJA 1OSDA 2KDOA 2ZE2B 4ZJLA 3OJUA 1MQIA 1A55A 4AQ4A 1S59A 3EKIA 1PYTA 1B0TA 2OFHX 2ROEA 1RTZA 4DV0J 2QJEA 2VPXB 2D21A 1HHTP 4K0KF 5DS7A 5D8HB 1RAAB 1FKAF 4HE1A 2RRNA 3WX4A 1WC0A 2BKPA 3BKUA 3S01A 2XO7A 3U93A 1OPZA 2RUSA 2R9JA 1FPGA 3T1BA 1Y20A 2AJQA 3QYTA 2RF2B 4KKOA 1RWPB 4UZCA 4ECTA 3TAJA 3B6BA 1RYOA 3MAAA 5U47A 4YB1P 1LWFA 2ABYA 1R89A 3GIJA 3IORA 1IUDA 3BSCA 2H48B 1IXIA 1IMDA 1E6VA 4TQSA 2JJKA 2W2QP 3GJSB 4M5DB 3J7Z5 4UABA 1WKLA 3PZPA 1SL0A 2GFEA 4DV6J 3D6HB 3DP8A 4F39A 3EGZA 1ZAWA 1M5FA 3UN3A 5H8QA 4ED1A 4FECA 4C9DA 1OYEA 4OVTA 3RNNA 5AXKA 2WYPA 1XMBA 3VGUA 2A1BA 2A5TB 4PGNA 4K2JA 2B4LA 4LF2A 2NUVA 2XLIA 4JWXA 1QLNA 3D1OA 4DPUA 4YR2A 4IO2A 4IFYB 4EMDA 1RCOB 4C8NA 4FXDA 4DPOA 3CSGA 2ONRA 4DV2J 1J1NA 1AFJA 4ZP9A 1YRXA 3GYXB 1QTNB 5ETVA 4JI3F 2MXYA 4N6PA 3Q25A 3HHFA 4G2ZA 2YTCA 2DHAA 4RW4B 4TY9A 2E5GA 3M8SA 2PT1A 3O5TB 2YWEA 5EN1A 4DZ6A 3BKIB 4FBTA 3TMGA 3BZQA 3BGRA 2ZH1A 5HLFA 1XHYA 3ITHA 3HP6A 3PW2A 4QU6A 2HRYA 3QLHB 4EU0A 5EQ7A 3K4UA 2ZHAA 3QZ7A 4HI1A 3THIA 2HHSA 1FRIA 2N4CA 1YJNS 1HQ2A 3HM9A 2VF3A 4Y65A 3TUJC 4WFZA 2VBYA 2HLUA 4G68B 1HNWF 5KFBA 2XXUA 6FD1A 5ET8A 3CJTA 5F41A 4IH7A 3NGTA 1JP4A 4WFAQ 4DQPA 1SJ4P 1YJRA 1GNKA 3IGVA 2CPZA 2D1CA 4Q0CA 5ETPA 1HMVA 1FWPA 3RAQA 1BLFA 3QGHA 4GO7X 4ZPAA 2CG8A 5EQAA 2I1RA 3M6VA 4PF8A 2CPYA 2CZVC 3EYZA 2H5EA 4NWDA 4PEOA 1RHKB 3I9ZA 3PFOA 4NASA 3BO3A 3BYPA 1CJVA 2M9KA 4WCEQ 1S7IA 2E5LF 3MD1A 2CQ0A 4G6VB 1M5CA 4MNIA 2ZKUA 1VK3A 2Z57B 4N8GA 1ZA1B 2ZD1B 3ET6B 4IRKA 2XMWA 3C15B 3T3FA 1JVYA 3PM9A 2NZ4A 5L9NA 3MAMA 4KO0B 3HFUA 5HPQA 1RWXB 1NV1A 2F34A 1SI0A 4ZVRB 5EGYA 2ZZMA 5CYMB 2OLWA 1XVYA 2AYSA 3N94A 2CQCA 4J91A 5HROA 2FLNA 4GVBA 4XKQA 2W2MP 2IM1A 2KG1A 2FIUA 3HX9A 3R5GA 4A8FA 2ROGA 4S0MA 2HFVA 4CM0A 3FSXA 2Y1JA 1JQFA 2ABHA 1VE4A 3G3IA 2F8MA 4MAGA 1IR1A 3DOMB 2HPGA 3R5JB 1TMMA 5LTCA 3KBZA 4Z7YA 3KTQA 2UVRA 2YJPA 3IMQJ 2DR5A 1LSTA 1WOSA 1RTDB 1OQ3A 2AEJA 2B51A 1RT3B 1M5OC 2MQMA 2OCUA 1ZPVA 3TUZC 2ZWPA 3N28A 1ITPA 3BJYA 3CJQA 4POXA 3HHGA 3CD5A 1RT5A 1EYKA 2CXEA 4I56A 8RUCA 3RT6B 1UKUA 3CG3A 3E78A 1DTTB 2ZM6F 4DR5F 2O01C 3MVXA 3CDBA 4LF8J 4IO6A 2KFNA 3I5AA 1NK7A 1FQEA 2XMKA 4A8MP 1CS4A 4HHUA 3DXSX 1T03B 3QK6A 2GV1A 4NI2B 2LQBA 2Y8YA 4IO4A 1IKXB 4DCPB 3T1HF 2UUCJ 2DE3A 1PBQA 1FK9A 2BJ3A 2HFOA 1PB7A 2JWNA 4FATA 3CDEA 3FCWA 1Q5YA 2QMWA 3RPLA 3G71S 2IAJB 2ATLA 1WWHA 3TEPA 4IOCQ 4B9NA 4KTQA 1HBMA 1MM6A 2Z4PA 2OO4A 2WVFA 1WDNA 4GKJF 5KTQA 4LIWA 2KH9A 1SVDA 2CZ9A 2VUGA 3Q27A 4OZ5A 3DGVA 4QW8A 3QMQA 1TWYA 3UN5A 1F0XA 1SXLA 2NYIA 3MVYA 2QO3A 1N04A 3FZ2A 1IITA 1REVB 5KT3A 5A2QU 1OQHA 3VVEA 1S6QB 2QA1A 2LEBA 4QCLA 4DR1F 1O7TA 2KXNB 3Q0AA 2QVUA 1RHUB 1S49A 2OPRA 4J9NA 2F7AA 4MT1A 2UVGA 2PMSA 2AGQA 3D4GA 1S7YA 3A8JA 3BH6B 3DLHA 1LW2B 1N4LA 1Z7ME 2VA2A 3G86A 3MPWA 5B0CA 3H03A 4NQ8A 2V4RA 1N5TA 2R8JA 3P5BP 4C8KA 3KK1B 3NLCA 4KV8B 4RW6B 2L5VA 3NBPB 2YQ0A 4XDDA 2KR0A 2Q6CA 1NUEA 3CJ2A 2XMJA 5M2UA 3PKYA 3E79A 4OANA 1RTJA 4ECUA 1D8YA 1UMJA 3O3LA 3OELA 2B7BB 5C5JA 4EI2A 1WDDA 5E3CA 1U1LA 4DI6A 4XIUA 2B9XA 4LF4F 1SB6A 4UUXA 2CNLB 1B52A 4G4PA 3RRKA 2K3IA 3CCLS 3KK3B 5H9EJ 3DLNA 3IS9A 2XSFA 3S7RA 3NCPA 3QIPB 5KT4A 1N5QA 4P2SA 2Q1LA 1C4AA 4NCGB 1VDWA 3OUYA 5J1NA 4DF8A 3MUQA 2VFSA 2K06A 4CTAB 3T5KA 3C16A 3HCQA 4ZPDA 3DOKA 4KBIA 4ECQA 4N56A 2AHOB 4XKNA 7FD1A 3IOTA 1FFGB 3A8EA 1R8HA 4OFZA 3BFUA 1FWKA 1GXUA 4NXNJ 1SIZA 5KCJA 3CVGA 1VBXA 3N9UC 5D4PA 2VKRA 4LF7J 4YDXA 2HHWA 4ZVTB 2WBDA 4X66J 3K58A 2HS3A 4O3RA 5DVJA 4NGUA 3CMQA 2AU0A 4M5GA 2D9PA 2LA4A 4Y2AA 2Y84A 3OMBA 2R7XA 4NEZA 4OV6A 3DU5A 4WKMA 4QPXA 4RW7A 5CBSA 3HHEA 4FORA 4C8MA 3JAMY 3R7XA 1J5EJ 1XS5A 1FPBA 3V2UC 1ZKBA 3P4UB 3DLGB 4LBPA 1HR0J 4LVQA 3TVKA 1ZA2B 4DR2F 3SESA 1QAIA 1C1BA 3DOLB 2V34A 1SKWA 4URQU 4A4JA 1URDA 2EKNA 1JEUA 2CRLA 3GPAA 4CH7A 2QMXA 2XYGB 2ZC4A 4H8IA 4X8RA 1ZM4A 1PC5A 3CR9A 4W92B 3I9V9 5L9MA 3AD7C 2Q89A 2WONA 1KD1T 4FYVB 4KAIA 3T6JA 3FBBA 2BW7A 1S1UA 2XXRA 2OWZA 1P1LA 3LW5C 3MTJA 4A8KA 2C2MB 3DM0A 1OLAA 2BE2A 4M5HA 4EUVA 4RUAA 1NK8A 3PYEA 2XHWA 3KBRA 1ZPWX 4K4WA 3VAMA 5KDTB 4YY3F 1TV6A 5E41A 1FPFA 4B3RF 2RJZA 3CC7S 3L7OA 4TQUQ 1BMQB 2GIRA 4CP5A 3TJ8A 4OYOA 4RJVA 2OEJA 1F2GA 2YPYA 1ZBMA 1I69A 4HHJA 2HWIA 2W9CB 4WTYA 5FDLB 5HSPA 3MOZA 4J5OA 4GC6A 2Y9HA 3DRRA 5KG4A 3U8QA 3E13X 5KFYA 5HQMA 5IZ3B 3NGDA 3GSIA 3PTWA 4XTTA 3EJMA 4OJGA 2QRYA 2M8HA 4QWAA 3KOSA 5F24A 2C28A 1YRUA 1SW2A 3M8QA 4WK3A 3T5LA 2AT1B 3PMWA 2VICA 3UCGA 4XIGQ 4FIMA 4R74A 2FD2A 3FBEA 1ZETA 1FPIA 3VE1B 2RB7A 1YJVA 3A29A 4F26A 3CI8A 1B3EA 1JXEA 2FJEB 3R5BA 1HPZB 2CG4A 3DRPB 1U6ZA 2JH3A 4AL7A 5AXMA 4QFOA 1YYZA 1JW5A 1MMNA 4QWBA 3POTA 4QQBA 5L39A 1Z7NE 1FFSB 3H6UA 4NOHA 3M6WA 3D68A 4URGA 3OT9A 1ZTWA 1LWEB 3K5OA 3FFIA 2FY1A 2V69A 4JI1F 1FSAA 3KG2A 1ZS6A 2FLLA 1NV7A 5A8WA 3I87A 1JLEA 1BXNA 1US5A 3M1VA 4I0WA 3M4XA 1D3WA 1NMEB 4N07A 4NWCA 4FNIA 2R8GA 1R1NA 1TK0A 3T41A 3T6BA 3Q8VA 2BX6A 3TDJA 3UNYA 3RZAA 5KT5A 1SDXA 2LFVA 1SC3B 1IQTA 2WBBA 1U6FA 3KNGA 1SL1A 2I4CA 1S0MA 4OTEA 4DS5A 4FZVA 5EX0A 2F9JA 4LREA 2Z22A 4NEDA 4L3KA 3SDEA 4IDKB 1W25A 3MI7X 4DV3F 2Z2ZA 4CM2A 5KT2A 4ZJQA 5G0RB 2F1FA 3PUXE 4NX9A 4PE5B 4I68A 1W2IA 3H3GA 4KQPA 4QSDA 1KR4A 2UUTA 3L9ZA 2AMCB 4ITSA 1N8RT 2CZKA 2JJ4D 1S1WB 3UK4A 1Q79A 5IM0B 4CH1A 2KVQE 1MWQA 1TKXB 3AJ2A 3O2AA 4DPYA 5K8MA 1H45A 4JWOA 2FHMA 1B7UA 3IAM9 2UXCJ 1R8AA 2Z0GA 2ZFHA 2O84X 1D9VA 1JJ2R 4WFBQ 4NXMF 2RQ4A 4LF5F 2VH7A 5KG6A 1RAIB 4QWCA 3FEZA 4FXVA 1N7WA 4NLOA 1CE2A 1U0HA 3VFJA 5C2CA 2W25A 3LGNA 2V93A 1I3OB 2MYFA 2F5GA 3BIHA 4U21A 4YHHF 4JVCA 3W2WA 3VHQA 4PG7A 3QNWB 2ZBPA 5ETOA 3EHTA 2KQZA 2UYEA 2O1PA 3SQOP 2XNQA 4WU3A 1FXLA 2OWSA 1U49A 1MMLA 1LXNA 1MXVA 4K4ZA 2RCBA 1SJRA 1LCTA 5DW8A 3JTPA 3M3FA 1BIYA 4E2FB 2DVIA 1JQGA 3I3VA 2ZE2A 2ACMA 3RW7A 3VQTA 1X5PA 1PILA 4MIBA 8AT1B 1L3KA 2KKHA 3SZ2A 1SW1A 2MKYA 1B2HA 3KC0A 4OZLA 1LXJA 4FE8A 2R7WA 4USMA 1WHYA 4XFEA 1OY6A 3RRHA 3MM5B 4DR7F 4NA2A 1UJ6A 1QKBA 1X5SA 1X0PA 2IYIA 2PSZA 4Z0IA 1MQJA 3N5FA 3TQ1A 2NXEA 4OXVA 2O5DA 1APSA 2RF2A 5KFSA 4U1ZA 2XWKA 2D69A 5LSOA 3IB0A 1RT6B 3LAKA 4E8UA 4D3HA 3OOAA 2XX9A 3PW5A 1WHXA 3LALA 2HYIB 1OLCA 2ZH8A 1CJKB 4ZDNA 5DZ7A 3JZJA 3VGVA 4M5DA 2B6AA 5GAEU 1QW0A 4ZJOA 2QLFB 4WYLA 2FHOB 3S2VA 5CHCB 4QF9A 4KHRA 3DLEB 5DM7Q 1QM9A 2RD5C 4O8MA 1PYSB 3L3CA 1N32F 1R9QA 4RU9A 2DR9A 1VYAA 4RNFA 1YI2S 3JYTB 2D3ZA 4F1VA 4BDQA 4HKQA 2WVDA 3NKYA 3BPDA 4R0EA 2A5TA 1MM7A 2AJFE 5B0FA 2ONSA 4LZ7A 3KOAA 1FNXH 2ZH9A 2GH9A 5C7PA 3E4RA 1BTJA 4ZPCA 1NDLA 1D8ZA 4ELVA 1WEYA 1JW4A 3A8KA 3FVKA 1WJ9A 4IFYA 1AIVA 4N5SA 2A2CA 4GWUA 2B9EA 3I5CA 2XC9A 3HHLB 1Y3QA 4A8QA 2HBYB 3ISND 3ZTSA 4ZP7A 3DXBA 5B0DA 4LF9F 2BKNA 2RQKA 1V5IB 2OGUA 3FMBA 4RW4A 2R2SA 3QJJA 3HHDA 3D0HE 3TRGA 4N8YA 3HKZD 3TX8A 4ZEFA 4DXLA 3CJ5A 1QSLA 3IP0A 3QLHA 4FPRA 3IOVA 2LP4A 1V5VA 4DV0F 3FZBA 1DOTA 1SPIA 1QE1B 4OX9J 4G68A 3T5HA 2EVZA 2W2OP 1EQ0A 4MMPA 3OD2A 2VHGA 4KH0B 1B5HA 1OJ4A 5F8HA 1XVXA 3IM9A 3MFIA 4F4WA 2E9RX 3CVKA 3BQ0A 1X4FA 4RBUA 2YVSA 2QGFB 3EHSA 4H4MB 1RYSA 1BGXT 1ATGA 5EUHA 2DXDA 3K5NA 3UCUP 1CEZA 1B6HA 1JIHA 4C0RA 4C1UA 1KQGB 3L4BC 4X48A 5KFDA 5HL7Q 4PTKA 3U65A 4JYAJ 4ZVUB 4NF8B 3KG1A 3ZNUA 4Y28C 1GX5A 2CQHA 3DRSB 2Z58B 4V1Ak 3HJFA 4DV6F 1MU2B 3T9VA 1U7LA 1T9YA 2D3O1 2ZD1A 3ET6A 1EYIA 3LR1A 1FJGJ 4ONYA 3CO0P 3KYLA 1ZAXA 3C15A 4ZKAA 2P3VA 2KG0A 3IO6A 4KO0A 1HQUB 3K17A 1PC4A 3BH7B 3OL8A 2YX4A 1QUVA 2AZ1A 5CYMA 4U96A 3IWNC 2CPDA 3FDSA 4ZITA 5H9FK 1N34J 4RNHA 1MPBA 1XMOJ 4PXEA 3DLBA 3VALA 4ZMMA 4ZVOB 4JV5J 5HM4B 4J9PA 5LSLA 3UWTA 4X62J 4H45A 2BA9A 1XC9A 4P1LA 5D4LA 4CNYA 3K0JA 2OIHA 3VVUA 4ZLPA 2HSEB 1OQ6A 4DV2F 2MKHA 4LONB 1G3OA 2XZTB 1NKXA 2OELA 3DOMA 1RADB 2LECA 3TTNA 4F3MA 4AL5A 4AB6A 2FVRA 1G7CB 4A48A 1VIOA 5IC6B 2I6WA 3OFEA 2GJIA 3T1YJ 4ISUA 4X64J 1RTDA 3KLIB 4GC7A 2DVZA 1NB2A 1RT3A 1IEJA 5CZXA 2H5JB 3M8YA 4J9MA 2CNKB 3Q89A 2J7KA 1PSDA 3H8YA 5GAHU 2FGCA 5KFWA 3SIPB 3MP1A 1DTTA 3CG1A 2Y7IA 4HEA9 2YQ3A 3JQJA 4JB7A 1FQDA 3C6TB 3H40A 1DFDA 4CO1A 4NE9C 4OZ3A 1YGYA 2BV3A 2RKMA 1T03A 4NI2A 2HQDA 3HULA 1IKXA 3ISPA 2XYHB 1PJ7A 5KOWA 3CPWR 4P2MA 4XO0A 3CCES 2UUAJ 2UU9J 5A0YB 3M6UA 3SYZA 3CCSS 1MRPA 4ZZEA 3JYRA 4I69A 3MCOA 1D9QA 1SH0A 2KXFA 2PBWA 4YAHX 1NLKL 2IAJA 4DSLA 4ZCKA 2LDYA 3A4TA 2PA3A 2WSFC 3TO8A 3K6UA 3K2YA 2FHKA 2J7UA 1K9YA 4NLRA 4X84A 2DXYA 4EK2A 4UOCA 1T95A 4NLGA 1BY9A 3UE2A 2DIVA 4ILMA 1LFWA 1PJ5A 1EYJA 2F35A 1NB7A 2RNEA 4MJOA 2KLFA 4KPYA 1YAEA 1REVA 2CQPA 1RWOB 5C24B 4CLYA 3PJXA 1NL5A 4DR3J 4KI0E 4N41A 1AUDA 1KHVA 1LOUA 3WBZA 1RTHB 1GMWA 5DJBA 3R2DJ 2C3UA 1LW2A 4EYHB 3N6LA 3IR6B 2J8SA 4NX1A 4NLUA 4ZE9A 2K7KA 4OYPA 4P1EA 3RYDA 2EK1A 5IV4A 3QJPA 4FKYA 4KV8A 3KK1A 1HL6A 1MROB 4KPTA 3NBPA 3MWBA 3B82A 2ZVIA 1IWGA 4J9KA 3SV3A 2HHHF 2ZWOA 4EQBA 2RE1A 3VAKA 4F2QA 1H0HB 3RGIA 1SI9A 4NF4B 3CD6S 3CCMS 4U22A 4ANEA 1Y3JA 2IA6A 2V4JB 5I4MA 4HE2A 4LF8F 2F63A 1UFWA 2HK2A 1OSCA 2NZCA 5ETTA 5F3TA 3ZZOA 4KFBB 1HHQA 3FBFA 2IMOA 1JLQB 1U25A 3GLBA 4OLOA 1TFAA 4NLWA 3KK3A 2R2RA 4WJBA 3S9NC 2ADCA 3GYGA 1X0FA 2XSJB 4CQ1A 2HG4A 4N76A 3QIPA 2AYMA 2UUCF 5ETLA 1FD8A 3TQEA 3AB4B 2YWGA 3MUTP 1HHSA 5D0EA 2RDDA 2MZ1A 3T9UA 4OHYA 3G3HA 1YJWS 1S6PB 4CTAA 4F0MA 2FJWA 3VVTA 2B43A 3MR7A 3PR4A 4R0JA 1AH5A 1IQZA 3D4CA 1B0LA 2C2ZB 1RKMA 3I6PA 3ILIA 2EK6A 2FDNA 4BC9A 3S1TA 4U6PA 4IH6A 5ITHA 1B5JA 1Q7YT 1S9GB 4KSEB 2J9EA 4YQWA 3B54A 3ZTRA 4MLVA 2MHEA 4C3MA 1KVIA 4JSDA 1NV6A 3DELB 1RLDA 4NWBA 3PD8A 3M30B 5KFLA 1V9OA 3MXHP 1X4HA 1NDPA 3OO9A 5CYQB 2MKJA 3C14B 1NKEA 4HTGA 4HW8A 2OWTA 3MM7B 3SSRA 4GO5X 4OERA 2I0XA 1FRPA 3BYRA 5KG7A 1NUXA 5HMXA 1TTHB 2OPQB 4EO6A 1MH4A 4PABA 4I6AA 2UXDF 3WAEA 2O7IA 4ANDA 1NFTA 3CEDA 4CLKA 3FXRA 4OYXA 3DLGA 4LF6J 4J9UE 2QVVA 1VLYA 2O1LA 4B3OB 5B70A 3MPVA 2VB6A 1UZDA 2AJ0A 3DOLA 1VBKA 3MEGB 2BM1A 2RUGA 4USWA 1IMEA 3KLEB 4YKIA 4ZP6A 3D54A 1PJ6A 2J8AA 3GBBA 4RK2A 3VVFA 5IWAJ 4IQXA 1A99A 3C8YA 1SW4A 4X1DA 1XMQJ 2PIIA 4OIXA 4G1IA 2ZH2A 1NUZA 3IR5B 1K1SA 4CCHA 2H65B 2X1AA 3QBCA 4KQZA 2ZC3A 4DSKA 1P6TA 3AY0A 2VOZA 3Q8QB 1EETB 3HFZB 2ZZXA 1YBUA 3CFZA 4I62A 1RCXB 2JEGA 4JOUA 5KDTA 4DBQA 4HYKA 3OXNA 3M9MB 4AYBD 2XWIA 1RLCL 1S57A 4Y00A 4I7FB 1B05A 1WNEA 2EFOA 4M5NA 3WC2A 4TY8B 1HNXJ 2W9CA 1FE4A 2A2DA 2AYBA 4O0NA 5FDLA 3O1LA 4PBHA 2R2UA 4RWWA 2ILZA 1S1VB 4G8MA 1RABB 4PCDA 1QY7A 1N48A 1FX2A 3C19A 4ELQA 1CLFA 3ILUB 5HN0A 1NK4A 5IZ3A 3M8UA 1FKPB 2VC1A 1M1GA 4PWWA 2FVZA 4L6V3 3EUNA 3JTOA 4ZN1A 4IO1A 4HCWA 5ETQA 2PI5A 2XMAA 4LF7F 3AH6A 1O5JA 4KHMA 1MLAA 4X66F 3FVYA 2G4BA 3KUEA 3IR1A 4L73A 3HDSA 2HZLA 1X4BA 3KJVB 2HAVA 2QA2A 1XQIA 5HP1B 4DIGA 1R9LA 2UV8G 2QRRA 1GAOA 1K1QA 1J5EF 1HPZA 1GMVA 3VAIA 3SZPA 4WPAA 3DRPA 5J1EB 5AA4B 4H54A 4W4MA 2C2EA 2Y1RI 2BVZA 1HR0F 3QYYA 1BUXA 2F9DA 2P0SA 3EN3A