3Q29A

Cyrstal structure of human alpha-synuclein (1-19) fused to maltose binding protein (mbp)
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
381
structure length
381
Chain Sequence
KIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSSMDVFMKGLSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein, protein fibril
molecule keywords Maltose-binding periplasmic protein/alpha-synuclein chimeric
publication title Structures of segments of alpha-synuclein fused to maltose-binding protein suggest intermediate states during amyloid formation
pubmed doi rcsb
source organism Escherichia coli
total genus 123
structure length 381
sequence length 381
chains with identical sequence C
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q29A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q29A01
2ANJA 3IO4A 3LSWA 2O6AA 2H99A 3A09A 3K1MA 2KLFA 3OOAA 2ZNUA 5CBSA 2DE4A 1A8FA 2RC7A 4JDFA 2UYEA 2VD2A 1SVXB 1PBQA 1B5JA 3MPLA 3MZ1A 1ZTYA 3PPPA 2DVCA 1LFIA 2PT2A 1URGA 3M3KA 4DXUA 1DTZA 4DDDA 2YPNA 2XXHA 2RCAA 1MXZA 3TCGA 4OTEA 4U22A 1MM6A 3EHSA 2OLBA 4MLVA 2NVUB 4YMAA 3K6WA 4KD5A 2F36A 1QKAA 1SW4A 4P0IA 3CRBA 3KG2A 3MBPA 1TWYA 2DVZA 4X48A 1ZBMA 4JB7A 3PMVA 4HTGA 1B3LA 1LCTA 3HN0A 2P2AA 1FTKA 3LSFB 2HAUA 5DEXA 3Q29A 2D5WA 1SBPA 3FVNA 3QIMA 4G8NA 2R6GE 3SEYA 3OENA 1B0LA 3G3HA 3Q27A 1N84A 4JWOA 1MXYA 2IA4A 2D21A 5J1DA 1MXUA 4E0WA 2X7PA 4NF4B 2F97A 1FTOA 4HW8A 4G68B 2OWSA 3G3IA 4QHQA 5I59B 4PP0A 4O3BA 4ONYA 2GRVA 4HS7A 5ITOA 2I3VA 3GZGA 1N7WA 4F2QA 2P0SA 3FVGA 3PPNA 3BFTA 3OO7A 4GXSB 4U23A 2Q2AA 1BKAA 1DPEA 4QSCA 1B51A 4BDOA 4ZZEA 4FAJA 1H76A 4F3SA 2UVHA 1UIUA 1NL5A 5DVJA 2RC9A 3H06B 3TTNA 3FATA 2F8DA 2OJTA 4LQ2A 2P1SA 1TT1A 4IO6A 3SDFA 4F18A 3K01A 3DLNA 2ZNTA 4YZZA 1NNFA 4G77A 3OEKA 3S9NC 5CMMA 3RY3A 1TFAA 5KDTB 3V5AA 5ELVA 3CI8A 4GWOA 1N3WA 4ZS9A 3U93A 1O64A 4FIMA 3CVGA 3RGYA 1QULA 3W15C 5CM6A 4NF5A 3IOWA 3MC2A 1Y1MA 3CFLA 5H8HA 3ILUB 2DSFA 3KN3A 2B65A 1EH3A 5FTHA 3MW0A 4YB5A 4R6KA 5CI5A 3JZJA 5JEIA 3MQ9A 1A40A 4X1BA 3GBAA 1OQHA 5KCJA 4RXLA 1B3EA 2Q2CA 1LAGE 1US4A 3E9XA 1WODA 3BKIB 4RA1A 4QFOA 4EQ9A 2UVGA 2ZYOA 2DWAA 2FNCA 3SEVA 1B3HA 4F3BA 1HSJA 3UIFA 4FEDA 5L9OA 3TODA 4YKJA 4NF8B 1FQCA 4R72A 4KCCA 3PUXE 4P11A 3G7WA 4MFIA 3ZKKA 1VE4A 1MQDA 4EQBA 3H3GA 5KDTA 4LATA 1S7YA 2XXUA 4NWCA 4ZE9A 4H6DA 1SQYA 3RTFB 3H7MA 1J1NA 5AA1A 1SD3A 3DP8A 4HCYA 3TTKA 2F7AA 4KYDA 2I0BA 3IR1A 3OO9A 3C32A 4R9FA 2I58A 3TMGA 1IXIA 2RINA 4OESA 5TU0A 4F29A 3O29A 3MPKA 3PMXA 1B0HA 4KYEA 3E4RA 2UXAA 4Q0CA 3N26A 4Q5TA 3VXCA 2IEEA 3QK6A 4FORA 4I62A 2QJEA 2AYSA 3U94A 1B7HA 1SW1A 3QUFA 5HBCA 3GBBA 2Z8DA 4GD5A 3MWBA 3F11A 4WXJA 1R9LA 1B4HA 1XOCA 1HSLA 4ZEIA 3KN8A 4EF2A 5AE4A 4NF8A 4JWYA 4OZ9A 5I57A 1PBPA 2ZNSA 3RUMA 3FZVA 4Q30B 2OWTA 5F1QA 5I2KB 2Z23A 3KJ7A 5I58B 1LAFE 3KSJA 4FEBA 3FJ7A 4G2ZA 4C1UA 1SI1A 1KWHA 2I4CA 4OEUA 3GLBA 2B3FA 3K6VA 3USDA 1JEUA 5FHOA 3T9XB 2V3QA 3QXMA 5EHSA 1PB7A 2DWIA 1T0KA 3UORA 3N6UA 3C9HA 1POY1 2A5TA 1Y4TA 4XKPA 3OSRA 4JXIA 4R2BA 3FXRA 2GHBA 3ZSFA 4GOTA 2Y7RA 3SEXA 1FTJA 4N07A 4G8MA 4QF9A 5H8FA 2ZXTA 1Z7NE 3LBSA 1LFHA 2XD3A 1MDP1 4U2RA 1N76A 3EHUA 3IB1A 1H43A 3KOSA 3PGFA 1QKBA 4KQPA 2REJA 4JSDA 3SEWA 4F39A 2HAVA 3QAXA 3ECRA 2QPQA 2ALUA 3CG3A 1USYH 3RQTA 4AB6A 1MQJA 4DCYA 3KSXA 4EF1A 5LOMA 2HEUA 1YAEA 3SKPA 3OELA 4Q8RA 1H45A 3BFUA 3IB2A 2HXWA 4DE8A 4BLAA 2ESNA 1XVXA 3MZ9A 3RTWB 1IIWA 4ECFA 5EYFA 3PPQA 2RKMA 3FD3A 3DM0A 1LCFA 3PUVE 4ZE8A 5B70A 3O6GA 2VHAA 1MM7A 1LB9A 2I49A 2B3BA 1FQBA 2O69A 4GF8A 4KPTA 1YPNA 5H8SA 2VGQA 1LAHE 4OFJA 4R73A 3IL1B 3IOTA 2XXIA 2ZMBA 4MH5A 1N7XA 2YJPA 2PT1A 3U8QA 4RK9A 3O66A 3K1NA 4OYVA 3FJMA 2QRYA 4KI0E 2OBGA 5TPAB 4QFKA 3S9LC 4LZ7A 2REGA 1RKMA 5AA3A 2DWHA 4WEPA 2NOOA 3PV0E 3G3GA 4NF6B 3RT8A 1Y3NA 1FCKA 1F9BA 1EZPA 3HV1A 4F3PA 1BP5A 3TELA 1ZLQA 2XXWA 3L6HA 2WKYA 4DCXA 1LB8A 1GV8A 4TLMB 1UTHB 1UTBB 1URDA 2F35A 4KFQA 4KCDA 4XKQA 1M5FA 1ZMGA 1B05A 4PFUA 3FGSA 3VV5A 4LUBA 1JW4A 4H1XA 1XHYA 4BDMA 1VFEA 4WEDA 1OVTA 2DYXA 3KJTA 4IO5A 1NFTA 3I3VA 4IGRA 3UP9A 5FHMA 5TPAA 3VVEA 2HQ0A 1MY4A 3S9EA 3UA8A 4R6HA 1ATGA 1QJMA 1FTLA 2O51A 1RYXA 4MBPA 5I2NB 3ILTB 1R6ZA 1B40A 5H8QB 1OMPA 3C4MA 4F31B 1B58A 3V89B 2QS3A 3EPEA 1S50A 4OXVA 2F6GA 3K00A 1QUKA 4F19A 3PPRA 2YLNA 1A8EA 2DQVA 4NMYA 4DZ1A 3D4GA 3O6IA 2XX7A 1OIBA 1JVXA 3U92A 2OZZA 4L17A 2AIXA 2I48A 2Q89A 5BUUA 3R6UA 2I0CA 3T66A 4NF4A 5A5XB 3PU5A 1O63A 1NNTA 4G68A 5DVFA 3FXQA 3S4UA 2Z8EA 1MXXA 5I59A 4LA9A 1B6HA 5TP9B 4H5GA 3SETA 5ITPA 4G68C 3PMWA 4EXKA 4C0RA 4TQUQ 2F7BA 1PB9A 3ODBA 3M3LA 3TAJA 3MVZA 1XT8A 1BTJA 3K4UA 1B4ZA 3BBRA 3OXNA 4LVQA 4KYSA 2O1MA 3TTRA 3CG1A 1XC1A 2XXVA 4R2FA 1M5BA 4I8CA 4JBZA 2O68A 3OD7A 3U72A 1MY0A 1A54A 1USYE 3FASA 3K02A 4GVOA 2LAOA 1OQGA 3H03A 5JTYB 1SI0A 1B52A 3O28A 4IY5A 1UQWA 4H5FA 4YAHX 1EZOA 1BIYA 1I6QA 2F34A 5TP9A 3MVYA 1IZ1A 2FYIA 1SDXA 3N5LA 1A55A 1D9YA 3HHGA 2CMOA 4NEDA 1PC3A 4IY6A 2F6PA 4OETA 2I6EA 4QRZA 3G3KA 5HM4B 3I6VA 5CC2A 3WAFA 1Y20A 4OQOA 3VDFA 1QUIA 5FTIA 3RN8A 4DIGA 3JYRA 2DS9A 3FUZA 4IGTA 5AA4B 5H8NB 2O84X 1P99A 3V83A 3TCHA 3Q28A 1JEVA 2VP1A 3K6XA 1QW0A 4ESXA 3T9HB 2F7CA 3PUYE 5M2VA 4AQ4A 2DP8A 4BDLA 1PB8A 3EF7A 2ONKE 2Q8JA 4U1ZA 2HZKA 1B32A 1ELJA 3FV1A 1R9QA 4PETA 1H3DA 1I69A 3C36A 1AOVA 3KFMA 4HCWA 2X7QA 4XTCQ 3LR1A 1Y3PA 5FHNA 4F2OA 3V8XB 5B7DA 4I9DA 1TFDA 3B6QA 5AA2D 4DXBA 5IKBA 2RF1A 4TLLB 3TUSA 4BDNA 3L6GA 2F78A 5CBRA 3K0VA 4F22A 3EHTA 2THIA 2XX9A 4ELQA 1NH8A 2DWJA 2I4BA 1MS7A 1SYHA 2PVUA 1Y4CA 2FA7A 1B7UA 1P1UA 3WAEA 1DPPA 4E0XA 2QS2A 3KGCA 1Y9UA 5AA2B 5I56B 3H6TA 1B1XA 1MY3A 3E3KA 3FVOA 1O7TA 2QMWA 4QSEA 4U4XA 1NNKA 3ONMA 5I2KA 3VLWA 5I58A 1JVYA 1UIVA 2ONSA 1LAXA 3T96B 4EDPA 4BDRA 2Y7IA 1NMUA 4DXCA 1MQIA 4LQ5A 2DE3A 2CZLA 4ZECA 4XIGQ 1D9VA 4OENA 2Z8FA 2ZYKA 3U1OA 3CIJA 4LONB 1QVSA 4X1DA 1MDQA 4IO4A 3HCQA 4TOZA 4Z0IA 3VVFA 3OMBA 3TPAA 3R7XA 3K6UA 3IAZA 1I6AA 5K2YA 1ZU0A 4N13A 3C34A 3P7IA 1N0TA 3HPIA 3TFLA 1VR5A 2Q9TA 2QS4A 4P0GA 2H9BA 1P1OA 2GFEA 2D3IA 3FVKA 3DP4A 4I1DA 4X9TA 3UN6A 1AH5A 3VVDA 1Y1ZA 1MQHA 4F3GA 4YKKA 4Z7EA 2XXYA 2UVIA 3HO7A 4GRKA 1URSA 1FTMA 3T9UA 3KBRA 2ABHA 4XKRA 2PMSA 3N94A 2V3UA 4POWA 5DEXB 4ISUA 4RK2A 4BDQA 4ELOA 3K1PA 3W9VA 1AIVA 2G93A 2DE2A 1FQEA 4FJPA 4RNSA 1A99A 1LSTA 3B7DA 3SESA 3FJGA 1H44A 3VE1B 1IUDA 1B1HA 3CFZA 5L8DA 3O6HA 4PFTA 3QSLA 4C1TA 4U1OA 3TEPA 4H67A 2I3WA 3LSXA 4UA8A 1VFDA 1MQGA 2O7UA 2VOZA 4FATA 2AL5A 4GL8A 1GVCA 3DP6A 1WVJA 1OLCA 1JNFA 2XXPA 1NNPA 3TKDA 1B7ZA 1MH3A 4G4PA 1ZIUA 1IXHA 4OFLA 2V25A 3IX1A 3M8UA 4OVJA 5CMBA 1FQAA 3O97A 4R9GA 3TZAA 2H25A 4ZZAA 4EUOA 4IO7A 3IK6B 1MG1A 3FXUA 3LUYA 4POXA 3OO8A 3SERA 1JW1A 4GL0A 3KZGA 1MPCA 3Q26A 1EU8A 2GH9A 3EN3A 3T22A 4F1UA 2VD3A 3HSTA 3TCFA 1JW5A 3PD8A 3OEMA 3VXBA 4MF3A 1MPDA 2PYYA 3N6TA 3FIRA 3T93B 4H65A 4PQJA 4ZDMA 1DMBA 1IITA 1B46A 4QFLA 3MP1A 4YB7A 3MVXA 3UK4A 1ZKBA 1M5CA 4LZ5A 3DELB 4NF5B 1DTGA 3PPOA 4OEVA 4PFWA 2R71A 1OVBA 4OFOA 1WDNA 4NF6A 5H8HB 1Z7ME 1FW0A 3KN7A 2DOJA 1AMFA 2W7YA 3S2VA 5IAIA 1BLFA 3MJNA 4IB2A 5DT6A 1A7LA 3RNNA 1UTHA 2G29A 1UTBA 2H98A 5KCJB 2UYFA 2XXXA 3H6WA 1HSEA 1D3KA 4U4SA 1B2HA 2DXRA 4GQOA 4N6PA 5JK4A 4RPNA 1FQFA 3MAMA 4AB5A 1L5TA 1M5EA 3H6VA 3HHFA 3AXFA 1ANFA 3O9PA 2F5XA 1RYOA 1MY2A 3CSGA 4IO2A 4ZEDA 2H5YA 3UGWA 4MLQA 2E1SA 3PUZE 1LBBA 3C35A 3QYTA 3MUQA 4XKNA 2HZLA 4YB6A 3KOTA 4PFYA 4U21A 2QS1A 3IORA 5DYHA 4KHZE 5CMCA 1S9TA 5I2NA 4ELRA 4F1VA 1D4NA 5H8QA 3TTLA 1N04A 3H4ZA 3FV2A 4G8HA 2A5SA 2AL4A 4H8JA 4WKMA 5L9MA 4ND9A 1SYIA 4OMBA 4M1VA 5CRYA 5F7VA 4THIA 3TTMA 1R1NA 2Y7WA 3TQWA 4QFPA 3LC8A 4O3CA 1YTVA 3VFJA 2XX8A 2NWJA 4H0WA 3LSLA 2ZYMA 4DLDA 4ZEBA 3RLFE 1CB6A 4OERA 1IXGA 3TYHA 5A5XA 3ZKLA 2QL3A 1QUJA 4UACA 1TXFA 3SEUA 5L9SA 2H4IA 2Z22A 5DTBA 5I84A 4RPOA 1PDAA 3O2AA 2ONRA 2BJJX 2UVJA 5I57B 4ZEFA 1IQ7A 5K2XA 1B3GA 1DSNA 2Y84A 4O3AA 3C33A 3T9VA 3PD9A 3MVWA 3A3UA 3VLVA 1LFGA 4KR5A 3G3JA 4OWDA 3IO6A 4GXAA 1M5DA 1CE2A 1MPBA 5CMKA 2X26A 3IB0A 1FQDA 2HFBA 1IXCA 1P1QA 3IJXB 3C31A 1B3FA 1MH4A 5KZTA 1SW2A 1EZ9A 1Q1KA 4NE4A 2Y7KA 4M4GA 3TQLA 4ELPA 3PUWE 2E0SA 2XHDA 4JWXA 4R6YA 2A5TB 1NH7A 5JTYA 4ZEKA 2XD2A 4F1YA 3R26A 2QMXA 3CSBA 3MZBA 2R9JA 4QSDA 2M8CA 4RY1A 1N3XA 3MP8A 3EQ1A 1MY1A 3E13X 5ICTA 2NXOA 4LZ8A 4QFNA 5H8FB 1B5IA 2RC8A 4JSOA 5ICQA 3KEIA 4FE8A 4RJZA 3MP6A 4EQ7A 5ISUA 4IO3A 3OO6A 3B6WA 4FECA 3G3FA 4OHNA 3OSQA 1YCJA 1II5A 4GFRA 2XXTA 3IOUA 1LBCA 3RT6B 5EHMA 3VLUA 1GR2A 4H8IA 3H6UA 2V93A 3B6TA 1XS5A 5H8NA 5AA4A 1XVYA 4RYAA 1P1NA 4XXUA 5BWJA 1I6BA 1Y3QA 1AL3A 2XXRA 2RCBA 4NWDA 4YKPA 2O7IA 1OLAA 1Q35A 3W9WA 4GLIA 4K3FA 2PX1A 4YKIA 2V84A 1IEJA 2GHAA 1MXWA 2OCUA 2O1LA 1PEBA 1MXVA 3TDJA 3JV9A 1JQFA 2XXQA 4YU0A 1DOTA 2DXYA 3IJOB 4NTLA 2NUVA 1P1WA 3ZS6A 1GTKA 2ZYNA 1B9JA 3CFXA 3THIA 1LGBC 2OK2A 1MRPA 3GXAA 1POTA 1US5A 4GIZA 4ESWA 3A3CA 2QSXA 2HCAA 4EXLA 3K2DA 1VSOA 1LLSA 3IOVA 3I5OA 4R75A 4LP2B 1GGGA 4YICA 3QUJA 3CR9A 1JETA 1ZJLA 4PE5B 2PBWA 1SW5A 2V3TA 2Q88A 2Y7PA 1NKXA 3Q25A 4R74A 3S9MC 3D4CA 4YMBA 5AA2A 3M3FA 5I56A 1B5HA 5DVIA 5HPQA 3RPWA
chains in the Genus database with same CATH superfamily
2ANJA 3IO4A 3LSWA 2O6AA 2H99A 3A09A 3KC1A 3K1MA 2KLFA 1IMDA 3OOAA 2ZNUA 3BIHA 5CBSA 2DE4A 1A8FA 4NQ8A 2RC7A 4JDFA 2UYEA 2VD2A 1SVXB 1PBQA 4MX6A 1B5JA 3MPLA 3MZ1A 2WYPA 1ZTYA 3PPPA 1DCUA 2DVCA 1LFIA 2PT2A 1URGA 3BIGA 3M3KA 4DXUA 1DTZA 4DDDA 4G61A 2YPNA 2XXHA 1FPKA 2RCAA 5I7IA 1MXZA 3TCGA 4OTEA 4U22A 4P56A 1MM6A 3EHSA 2OLBA 4MLVA 2NVUB 3T0JA 4YMAA 3K6WA 4KD5A 2F36A 1QKAA 1SW4A 4P0IA 3CRBA 3KG2A 3MBPA 1TWYA 2DVZA 4X48A 1ZBMA 4JB7A 3PMVA 4HTGA 4PTKA 1B3LA 1LCTA 3HN0A 2P2AA 1FTKA 4O8MA 3LSFB 2HAUA 3T1BA 5DEXA 2CZHA 3Q29A 2D5WA 2WBBA 1SBPA 3FVNA 3QIMA 4G8NA 2R6GE 3SEYA 3OENA 1B0LA 3G3HA 3Q27A 1N84A 4JWOA 1MXYA 2IA4A 2D21A 1NUZA 5J1DA 1MXUA 1NUWA 4E0WA 3NOHA 2X7PA 4NF4B 2F97A 2PFYA 1FTOA 4HW8A 4G68B 2OWSA 3G3IA 4QHQA 5I59B 4PP0A 4GBWA 4O3BA 4ONYA 2GRVA 4HS7A 1FTAA 5ITOA 2I3VA 3GZGA 1N7WA 1VDWA 4F2QA 2CEXA 2OX3A 2P0SA 3FVGA 3PPNA 4MNIA 3BFTA 3OO7A 4GXSB 4U23A 2Q2AA 1BKAA 1DPEA 4QSCA 1B51A 3PTYA 4BDOA 4ZZEA 4FAJA 1H76A 4F3SA 2UVHA 1UIUA 1NL5A 5DVJA 2RC9A 3H06B 3TTNA 3FATA 4MEVA 1LBZA 2F8DA 2OJTA 4LQ2A 2P1SA 1TT1A 4IO6A 3SDFA 4F18A 3K01A 3DLNA 2ZNTA 4H45A 4YZZA 1NNFA 4G77A 3OEKA 4NHBA 3S9NC 5CMMA 3RY3A 3QMFA 1TFAA 5KDTB 3V5AA 5ELVA 2VPNA 3CI8A 4GWOA 1N3WA 4ZS9A 2XA5A 3U93A 1O64A 4FIMA 3CVGA 3RGYA 1QULA 3W15C 4PDHA 5CM6A 4NF5A 3IOWA 3MC2A 4PFRA 3MSTA 1Y1MA 3CFLA 4X04A 5H8HA 3ILUB 2DSFA 3KN3A 2B65A 1EH3A 5FTHA 3MW0A 4YB5A 4R6KA 5CI5A 3JZJA 1K9YA 2XWOA 5JEIA 3MQ9A 1A40A 4X1BA 3GBAA 1OQHA 1FPJA 5KCJA 4RXLA 1B3EA 2Q2CA 4PAFA 1LAGE 1US4A 3E9XA 1WODA 3BKIB 4RA1A 4QFOA 4EQ9A 2UVGA 1EYKA 2ZYOA 2DWAA 2FNCA 3SEVA 1B3HA 4F3BA 1HSJA 3UIFA 4FEDA 5L9OA 4XF5A 3TODA 2ZZXA 4YKJA 4NF8B 1FQCA 4R72A 4KCCA 3PUXE 4P11A 3G7WA 4MFIA 1FBPA 3ZKKA 1VE4A 1MQDA 4EQBA 3H3GA 4P9KA 5KDTA 4LATA 1S7YA 2XXUA 4N4UA 4NWCA 4ZE9A 4H6DA 1SQYA 1Q9DA 3RTFB 3H7MA 1J1NA 5AA1A 1SD3A 1FBCA 3DP8A 4HCYA 3TTKA 2F7AA 4KYDA 5I3SA 2I0BA 3IR1A 3OO9A 1FBFA 2QVVA 3C32A 4R9FA 2I58A 3TMGA 1IXIA 2RINA 4OESA 5TU0A 4F29A 3O29A 3MPKA 1FBDA 3PMXA 3A29A 5FBPA 1B0HA 4GWXA 4KYEA 3E4RA 2UXAA 5ET8A 4Q0CA 3N26A 4Q5TA 3VXCA 2IEEA 3QK6A 4FORA 4I62A 2QJEA 2ZZVA 2AYSA 3U94A 4OVPA 1B7HA 1G0IA 1SW1A 2JJKA 3QUFA 5HBCA 3GBBA 2Z8DA 4GD5A 3MWBA 3F11A 4WXJA 1R9LA 1B4HA 1INPA 4GWSA 1FPGA 1XOCA 1HSLA 4ZEIA 4HXVA 3KN8A 2PCRA 4EF2A 5AE4A 4NF8A 2FVZA 4JWYA 1FSAA 4O94A 4OZ9A 5I57A 3RYDA 1PBPA 2ZNSA 3RUMA 3FZVA 4Q30B 2Y5KA 2OWTA 5F1QA 5LDZA 5I2KB 2Z23A 3KJ7A 5I58B 1LAFE 3KSJA 4FEBA 3FJ7A 4G2ZA 3HFUA 4C1UA 1SI1A 1KWHA 2I4CA 4OEUA 4PDDA 5IZ3B 3GLBA 4NN3A 2B3FA 3K6VA 3USDA 1JEUA 5FHOA 3T9XB 2V3QA 3QXMA 1FPLA 5EHSA 2B4MA 1PB7A 4GX6A 2DWIA 1T0KA 3B8BA 3UORA 3N6UA 3C9HA 1POY1 2A5TA 1Y4TA 4XKPA 3OSRA 4JXIA 1NUYA 1RDXA 4R2BA 3FXRA 2GHBA 3ZSFA 4GOTA 2Y7RA 1YYZA 3SEXA 1FTJA 4N07A 4G8MA 3CHGA 4QF9A 3EKIA 4P8BA 2ZXTA 4JVIA 5H8FA 1Z7NE 3LBSA 1LFHA 2XD3A 4PBHA 1MDP1 4U2RA 2XXKA 1N76A 3EHUA 4N15A 3IB1A 1H43A 3KOSA 4OA4A 3PGFA 1QKBA 4KQPA 2REJA 4JSDA 1K9ZA 3SEWA 4F39A 2HAVA 3QAXA 3ECRA 2QPQA 2ALUA 3CG3A 1USYH 3RQTA 4AB6A 1MQJA 4DCYA 3KSXA 4EF1A 5LOMA 2HEUA 1YAEA 3SKPA 3OELA 4Q8RA 1H45A 3BFUA 1IMEA 3IB2A 2HXWA 4DE8A 4BLAA 2ESNA 1XVXA 3MZ9A 2XWVA 3RTWB 1IIWA 1FPFA 4XFEA 4ECFA 5EYFA 3PPQA 5T3JA 2RKMA 3FD3A 3DM0A 1LCFA 3PUVE 4ZE8A 5B70A 3O6GA 2VHAA 1MM7A 1LB9A 2I49A 2B3BA 1FQBA 2O69A 4GF8A 4KPTA 1YPNA 5H8SA 2VGQA 1G0HA 1LAHE 1RDYA 4OFJA 2Q74A 4R73A 4OVSA 3IL1B 2XWIA 3IOTA 2XXIA 2KQZA 2ZMBA 4MH5A 1N7XA 2YJPA 2PT1A 3U8QA 4RK9A 3O66A 3K1NA 4OVRA 4OYVA 4P1LA 3FJMA 2QRYA 4NG7A 4KI0E 1DBZA 2OBGA 5TPAB 4QFKA 3S9LC 4LZ7A 5F24A 2REGA 1RKMA 5AA3A 2DWHA 4WEPA 2NOOA 3PV0E 3G3GA 4NF6B 3RT8A 1FPDA 1Y3NA 3GYYA 1FCKA 1F9BA 1EZPA 3HV1A 4F3PA 1BP5A 3TELA 1ZLQA 2XXWA 1KZ8A 3L6HA 2HHMA 2WKYA 4DCXA 1LB8A 1GV8A 4TLMB 1UTHB 4GWUA 4IR8A 4AS5A 1UTBB 1URDA 2F35A 4KFQA 4KCDA 4XKQA 1M5FA 1ZMGA 2V4CA 2OWZA 1B05A 5I5PA 4PFUA 3FGSA 3VV5A 4LUBA 1JW4A 4I40A 4MJOA 4H1XA 1XHYA 4BDMA 1VFEA 4WEDA 1OVTA 5ET7A 2DYXA 3KJTA 4IO5A 1NFTA 1FJ6A 3I3VA 4IGRA 3UP9A 5FHMA 5TPAA 3VVEA 5IZ1A 2HQ0A 1MY4A 3S9EA 4N6DA 1JP4A 3UA8A 4MHFA 4R6HA 1ATGA 1QJMA 1FTLA 4O7IA 2O51A 1RYXA 3LV0A 4MBPA 5I2NB 3ILTB 1R6ZA 1B40A 4PAKA 5H8QB 1OMPA 3C4MA 4PAIA 4F31B 4JVDA 1B58A 2P3NA 3V89B 2QS3A 3EPEA 1NV0A 1S50A 4OXVA 2F6GA 3K00A 1QUKA 4F19A 3PPRA 2YLNA 1A8EA 2DQVA 4NMYA 4DZ1A 3D4GA 3O6IA 3ROJA 2XX7A 2CZIA 1OIBA 1JVXA 3U92A 1LBYA 2OZZA 4L17A 2AIXA 2I48A 2Q89A 5BUUA 1LBWA 3R6UA 2I0CA 3T66A 4NF4A 5A5XB 3PU5A 1O63A 1NNTA 4G68A 5DVFA 3FXQA 3S4UA 2Z8EA 1MXXA 5I59A 4LA9A 1B6HA 5TP9B 4H5GA 3SETA 4PGNA 5ITPA 4G68C 3PMWA 4EXKA 4C0RA 4TQUQ 2F7BA 1PB9A 3ODBA 3M3LA 1IMBA 3TAJA 3MVZA 1XT8A 1BTJA 3K4UA 1B4ZA 3BBRA 3OXNA 2FHYA 4LVQA 4KYSA 2O1MA 3TTRA 3CG1A 1XC1A 2XXVA 4R2FA 1M5BA 4I8CA 2QVUA 2WYKA 4JBZA 4QXDA 2O68A 1KA0A 4PE3A 3OD7A 3U72A 1MY0A 1A54A 1USYE 3FASA 3K02A 4GVOA 4UABA 4FBPA 2LAOA 1OQGA 3H03A 5JTYB 1SI0A 1B52A 3O28A 4IY5A 1UQWA 4NAPA 4H5FA 4YAHX 1EZOA 2XWKA 1NV1A 4HE1A 1BIYA 1I6QA 2F34A 2WEFA 3MVYA 5TP9A 4AS4A 1IZ1A 2FYIA 4PFBA 1SDXA 3N5LA 5DW8A 1A55A 1D9YA 3HHGA 2CMOA 4NEDA 1PC3A 4IY6A 2F6PA 4OETA 5EQAA 2I6EA 4QRZA 3G3KA 5HM4B 3I6VA 5CC2A 3WAFA 1Y20A 4OQOA 3VDFA 1QUIA 5FTIA 3RN8A 4DIGA 3JYRA 2DS9A 3FUZA 4GX4A 4IGTA 5AA4B 5H8NB 3MYUA 2O84X 1P99A 4N8GA 3V83A 3TCHA 3Q28A 1JEVA 2VP1A 4PFIA 3K6XA 1QW0A 4ESXA 1LBVA 3T9HB 2F7CA 3PUYE 5M2VA 4AQ4A 2DP8A 4BDLA 1PB8A 3EF7A 2ONKE 2Q8JA 4U1ZA 2HZKA 4GWYA 1B32A 1ELJA 3FV1A 1R9QA 4PETA 1H3DA 1I69A 5A5LA 3C36A 1AOVA 3KFMA 4HCWA 2X7QA 4XTCQ 3LR1A 1Y3PA 5FHNA 4F2OA 3V8XB 5B7DA 4I9DA 4PF6A 1FBHA 1TFDA 3B6QA 5AA2D 4MIJA 4DXBA 5IKBA 2RF1A 4TLLB 3TUSA 4BDNA 2B4LA 3L6GA 1NI9A 2F78A 5CBRA 3K0VA 5EYHA 4F22A 3EHTA 2THIA 2XX9A 4ELQA 1NUXA 1QGXA 1NH8A 2DWJA 2I4BA 1MS7A 1SYHA 4GX3A 2PVUA 1Y4CA 2FA7A 1B7UA 1P1UA 3WAEA 1DPPA 4E0XA 2QS2A 3KGCA 1Y9UA 5AA2B 5I56B 3H6TA 1B1XA 1MY3A 3E3KA 3FVOA 1O7TA 2QMWA 4QSEA 4PBQA 4U4XA 1NNKA 3ONMA 4HE2A 5I2KA 3VLWA 5I58A 1JVYA 3E79A 1UIVA 2ONSA 1IMFA 1LAXA 1LEVA 3U65A 5IZ3A 5LTCA 3T96B 4EDPA 4BDRA 2Y7IA 1NMUA 4DXCA 1MQIA 4LQ5A 2DE3A 2CZLA 4ZECA 4XIGQ 1D9VA 4OENA 1EYJA 2Z8FA 2ZYKA 3FBPA 3U1OA 3CIJA 4LONB 1QVSA 4X1DA 4H46A 1MDQA 4IO4A 3HCQA 4TOZA 4Z0IA 3VVFA 3OMBA 4JVCA 3TPAA 2FIXA 4I3YA 3R7XA 3K6UA 3IAZA 4P3LA 1FRPA 1I6AA 5K2YA 1ZU0A 4N13A 3C34A 2HXRA 3P7IA 1N0TA 3HPIA 3TFLA 1VR5A 2Q9TA 2QS4A 4MAGA 4P0GA 4OANA 2H9BA 1P1OA 2GFEA 2D3IA 3FVKA 3DP4A 4I1DA 4X9TA 3UN6A 1AH5A 3VVDA 1Y1ZA 1MQHA 4F3GA 4YKKA 4Z7EA 1IMCA 2XXYA 2UVIA 3HO7A 4GRKA 1URSA 1FTMA 3T9UA 3KBRA 2ABHA 4XKRA 2PMSA 3N94A 2V3UA 4POWA 5DEXB 4ISUA 4RK2A 4BDQA 4ELOA 3K1PA 3W9VA 3KBZA 1AIVA 4P47A 2G93A 2DE2A 1FQEA 1IMAA 4FJPA 4RNSA 1A99A 1LSTA 3B7DA 3SESA 3FJGA 1NV5A 1H44A 4GBVA 3VE1B 1IUDA 1B1HA 3CFZA 2Y5LA 5L8DA 2L5VA 3O6HA 4PFTA 1D9QA 5J16A 3QSLA 4C1TA 4U1OA 3TEPA 4H67A 2I3WA 3LSXA 4UA8A 1VFDA 2KR0A 1MQGA 2O7UA 2VOZA 4FATA 1EYIA 2AL5A 4GL8A 1GVCA 1KA1A 3DP6A 1WVJA 1AWBA 1OLCA 1JNFA 4MNPA 2XXPA 1NNPA 3TKDA 1CNQA 1B7ZA 1MH3A 4G4PA 1ZIUA 1IXHA 2PFZA 4OFLA 2V25A 3IX1A 3M8UA 4OVJA 5CMBA 1DK4A 1FQAA 3O97A 4N81A 4R9GA 3TZAA 2H25A 4ZZAA 4QBAA 4EUOA 4IO7A 5IZZA 3IK6B 1MG1A 3FXUA 3LUYA 4POXA 3OO8A 3SERA 1JW1A 4GL0A 3KZGA 1MPCA 1NV4A 3Q26A 1EU8A 2GH9A 3EN3A 3T22A 4F1UA 2VD3A 5IM2A 2GQ1A 4N8YA 3HSTA 3TCFA 1JW5A 3PD8A 3OEMA 3VXBA 4MF3A 1MPDA 2PYYA 3N6TA 3FIRA 3T93B 4H65A 4PQJA 4ZDMA 1DMBA 4NX1A 1IITA 1B46A 4QFLA 3MP1A 4YB7A 3MVXA 3UK4A 4GWZA 1ZKBA 1M5CA 4LZ5A 3DELB 4NF5B 1DTGA 2F3BA 3PPOA 4OEVA 4PFWA 2R71A 1OVBA 4OFOA 1WDNA 4NF6A 5H8HB 1Z7ME 1FW0A 3KN7A 2FIEA 2DOJA 1AMFA 2WX9A 2W7YA 3S2VA 5IAIA 2HPGA 1BLFA 3MJNA 4IB2A 5DT6A 4DI4B 1A7LA 3RNNA 1UTHA 2G29A 1UTBA 2H98A 5KCJB 2UYFA 2XXXA 3H6WA 1HSEA 1D3KA 2FBPA 4U4SA 1B2HA 2DXRA 4GQOA 4N6PA 4OVQA 5JK4A 4RPNA 4DI3D 1FQFA 3MAMA 2VT5A 4AB5A 1L5TA 1M5EA 3H6VA 3HHFA 2VPOA 3AXFA 4LN5A 1ANFA 3O9PA 2F5XA 1RYOA 4NGUA 5EQ7A 1MY2A 3CSGA 4IO2A 4ZEDA 2H5YA 3UGWA 4MLQA 2E1SA 1NV2A 3PUZE 3E78A 1LBBA 3C35A 3QYTA 3MUQA 5ESYA 4XKNA 2HZLA 4YB6A 3KOTA 4PFYA 4U21A 2QS1A 3IORA 5DYHA 4KHZE 5EYGA 1XI6A 5CMCA 1S9TA 5I2NA 2QVRA 4ELRA 4F1VA 1D4NA 5IGAA 4N91A 5H8QA 3TTLA 1N04A 3H4ZA 3FV2A 4G8HA 2A5SA 2AL4A 4H8JA 4WKMA 5L9MA 4ND9A 1SYIA 4OMBA 4M1VA 5CRYA 5F7VA 4THIA 3TTMA 1R1NA 2Y7WA 3TQWA 4QFPA 3LC8A 4O3CA 1YTVA 3VFJA 2XX8A 2NWJA 4H0WA 3LSLA 2ZYMA 4DLDA 4ZEBA 3ISPA 3RLFE 1CB6A 4OERA 1IXGA 3TYHA 5A5XA 3ZKLA 2R8TA 2QL3A 1QUJA 4OVTA 4UACA 1TXFA 2Q8MA 3SEUA 5L9SA 2H4IA 2Z22A 5DTBA 5I84A 4RPOA 1PDAA 3O2AA 2ONRA 2BJJX 2UVJA 5I57B 4ZEFA 1IQ7A 4PF8A 5K2XA 1B3GA 1NV3A 1DSNA 2Y84A 4O3AA 3C33A 3T9VA 3PD9A 3MVWA 1FBEA 4KXPA 4N17A 3A3UA 3VLVA 1LFGA 4KR5A 3G3JA 1LBXA 4OWDA 3IO6A 4GXAA 1M5DA 1CE2A 1MPBA 5CMKA 2X26A 3IB0A 3IFCA 1FQDA 2HFBA 1IXCA 1P1QA 3IJXB 3C31A 1B3FA 2WBDA 1MH4A 4O7MA 5KZTA 4X8RA 4XEQA 1SW2A 1EZ9A 1Q1KA 4NE4A 2Y7KA 4M4GA 3TQLA 4ELPA 3PUWE 1FPEA 2E0SA 2XHDA 4JWXA 4R6YA 2A5TB 1NH7A 2DDKA 5JTYA 4ZEKA 4GWWA 2XD2A 4F1YA 3R26A 2QMXA 3CSBA 3MZBA 2F3DA 2R9JA 4QSDA 2M8CA 1FPBA 4RY1A 1N3XA 3MP8A 3B50A 3EQ1A 1MY1A 3E13X 5ICTA 1NV6A 2NXOA 4N6KA 4PGPA 4LZ8A 4QFNA 1YXIA 5H8FB 1B5IA 2RC8A 4JSOA 5ET6A 5ICQA 3KEIA 4FE8A 4RJZA 3MP6A 4EQ7A 5ISUA 4IO3A 3OO6A 3B6WA 4FECA 3G3FA 3SZPA 2QFLA 4OHNA 3OSQA 1YCJA 1II5A 4GFRA 2XXTA 3IOUA 1LBCA 3RT6B 5EHMA 3VLUA 4MMPA 1GR2A 4H8IA 4PC9A 2CZKA 3RPLB 3H6UA 2V93A 3B6TA 1XS5A 5H8NA 5AA4A 1XVYA 4RYAA 3IFAA 1P1NA 4XXUA 5BWJA 1I6BA 1Y3QA 1AL3A 5EQ9A 3FXBA 2XXRA 2RCBA 4NWDA 4YKPA 2O7IA 1OLAA 1Q35A 3W9WA 1SPIA 4GLIA 3LUZA 4K3FA 2PX1A 4YKIA 1FJ9A 2V84A 1IEJA 1BK4A 2GHAA 1MXWA 2OCUA 2O1LA 1PEBA 5EQ8A 1MXVA 3TDJA 3JV9A 1JQFA 2XXQA 4YU0A 1DOTA 2DXYA 3IJOB 4NTLA 2MKZA 2NUVA 1P1WA 3ZS6A 1GTKA 2ZYNA 3D1RA 1B9JA 3CFXA 3THIA 1LGBC 2OK2A 1MRPA 3GXAA 1POTA 1US5A 4GIZA 4ESWA 3A3CA 1FPIA 2QSXA 2HCAA 4EXLA 3K2DA 1VSOA 1LLSA 3IOVA 3KC0A 1NV7A 3I5OA 4R75A 4LP2B 5ET5A 3RPLA 1GGGA 4PCDA 2P3VA 4MNCA 4P1EA 4YICA 3QUJA 3CR9A 1JETA 1ZJLA 1RDZA 4HE0A 4PE5B 2PBWA 1SW5A 4I3EA 4NF0A 2V3TA 2BJIA 2Q88A 2Y7PA 1NKXA 3Q25A 4R74A 3S9MC 3D4CA 4YMBA 4MCOA 2ZZWA 5AA2A 3M3FA 5I56A 1YZ0A 1B5HA 1FBGA 5DVIA 2CEYA 5HPQA 3RPWA
chains in the Genus database with same CATH topology
2ANJA 3IO4A 3LSWA 2O6AA 2H99A 3A09A 3K1MA 2KLFA 3OOAA 2ZNUA 5CBSA 2DE4A 1A8FA 2RC7A 4JDFA 2UYEA 2VD2A 1SVXB 1PBQA 1B5JA 3MPLA 3MZ1A 1ZTYA 3PPPA 2DVCA 1LFIA 2PT2A 1URGA 3M3KA 4DXUA 1DTZA 4DDDA 2YPNA 2XXHA 2RCAA 1MXZA 3TCGA 4OTEA 4U22A 1MM6A 3EHSA 2OLBA 4MLVA 2NVUB 4YMAA 3K6WA 4KD5A 2F36A 1QKAA 1SW4A 4P0IA 3CRBA 3KG2A 3MBPA 1TWYA 2DVZA 4X48A 1ZBMA 4JB7A 3PMVA 4HTGA 1B3LA 1LCTA 3HN0A 2P2AA 1FTKA 3LSFB 2HAUA 5DEXA 3Q29A 2D5WA 1SBPA 3FVNA 3QIMA 4G8NA 2R6GE 3SEYA 3OENA 1B0LA 3G3HA 3Q27A 1N84A 4JWOA 1MXYA 2IA4A 2D21A 5J1DA 1MXUA 4E0WA 2X7PA 4NF4B 2F97A 1FTOA 4HW8A 4G68B 2OWSA 3G3IA 4QHQA 5I59B 4PP0A 4O3BA 4ONYA 2GRVA 4HS7A 5ITOA 2I3VA 3GZGA 1N7WA 4F2QA 2P0SA 3FVGA 3PPNA 3BFTA 3OO7A 4GXSB 4U23A 2Q2AA 1BKAA 1DPEA 4QSCA 1B51A 4BDOA 4ZZEA 4FAJA 1H76A 4F3SA 2UVHA 1UIUA 1NL5A 5DVJA 2RC9A 3H06B 3TTNA 3FATA 2F8DA 2OJTA 4LQ2A 2P1SA 1TT1A 4IO6A 3SDFA 4F18A 3K01A 3DLNA 2ZNTA 4YZZA 1NNFA 4G77A 3OEKA 3S9NC 5CMMA 3RY3A 1TFAA 5KDTB 3V5AA 5ELVA 3CI8A 4GWOA 1N3WA 4ZS9A 3U93A 1O64A 4FIMA 3CVGA 3RGYA 1QULA 3W15C 5CM6A 4NF5A 3IOWA 3MC2A 1Y1MA 3CFLA 5H8HA 3ILUB 2DSFA 3KN3A 2B65A 1EH3A 5FTHA 3MW0A 4YB5A 4R6KA 5CI5A 3JZJA 5JEIA 3MQ9A 1A40A 4X1BA 3GBAA 1OQHA 5KCJA 4RXLA 1B3EA 2Q2CA 1LAGE 1US4A 3E9XA 1WODA 3BKIB 4RA1A 4QFOA 4EQ9A 2UVGA 2ZYOA 2DWAA 2FNCA 3SEVA 1B3HA 4F3BA 1HSJA 3UIFA 4FEDA 5L9OA 3TODA 4YKJA 4NF8B 1FQCA 4R72A 4KCCA 3PUXE 4P11A 3G7WA 4MFIA 3ZKKA 1VE4A 1MQDA 4EQBA 3H3GA 5KDTA 4LATA 1S7YA 2XXUA 4NWCA 4ZE9A 4H6DA 1SQYA 3RTFB 3H7MA 1J1NA 5AA1A 1SD3A 3DP8A 4HCYA 3TTKA 2F7AA 4KYDA 2I0BA 3IR1A 3OO9A 3C32A 4R9FA 2I58A 3TMGA 1IXIA 2RINA 4OESA 5TU0A 4F29A 3O29A 3MPKA 3PMXA 1B0HA 4KYEA 3E4RA 2UXAA 4Q0CA 3N26A 4Q5TA 3VXCA 2IEEA 3QK6A 4FORA 4I62A 2QJEA 2AYSA 3U94A 1B7HA 1SW1A 3QUFA 5HBCA 3GBBA 2Z8DA 4GD5A 3MWBA 3F11A 4WXJA 1R9LA 1B4HA 1XOCA 1HSLA 4ZEIA 3KN8A 4EF2A 5AE4A 4NF8A 4JWYA 4OZ9A 5I57A 1PBPA 2ZNSA 3RUMA 3FZVA 4Q30B 2OWTA 5F1QA 5I2KB 2Z23A 3KJ7A 5I58B 1LAFE 3KSJA 4FEBA 3FJ7A 4G2ZA 4C1UA 1SI1A 1KWHA 2I4CA 4OEUA 3GLBA 2B3FA 3K6VA 3USDA 1JEUA 5FHOA 3T9XB 2V3QA 3QXMA 5EHSA 1PB7A 2DWIA 1T0KA 3UORA 3N6UA 3C9HA 1POY1 2A5TA 1Y4TA 4XKPA 3OSRA 4JXIA 4R2BA 3FXRA 2GHBA 3ZSFA 4GOTA 2Y7RA 3SEXA 1FTJA 4N07A 4G8MA 4QF9A 5H8FA 2ZXTA 1Z7NE 3LBSA 1LFHA 2XD3A 1MDP1 4U2RA 1N76A 3EHUA 3IB1A 1H43A 3KOSA 3PGFA 1QKBA 4KQPA 2REJA 4JSDA 3SEWA 4F39A 2HAVA 3QAXA 3ECRA 2QPQA 2ALUA 3CG3A 1USYH 3RQTA 4AB6A 1MQJA 4DCYA 3KSXA 4EF1A 5LOMA 2HEUA 1YAEA 3SKPA 3OELA 4Q8RA 1H45A 3BFUA 3IB2A 2HXWA 4DE8A 4BLAA 2ESNA 1XVXA 3MZ9A 3RTWB 1IIWA 4ECFA 5EYFA 3PPQA 2RKMA 3FD3A 3DM0A 1LCFA 3PUVE 4ZE8A 5B70A 3O6GA 2VHAA 1MM7A 1LB9A 2I49A 2B3BA 1FQBA 2O69A 4GF8A 4KPTA 1YPNA 5H8SA 2VGQA 1LAHE 4OFJA 4R73A 3IL1B 3IOTA 2XXIA 2ZMBA 4MH5A 1N7XA 2YJPA 2PT1A 3U8QA 4RK9A 3O66A 3K1NA 4OYVA 3FJMA 2QRYA 4KI0E 2OBGA 5TPAB 4QFKA 3S9LC 4LZ7A 2REGA 1RKMA 5AA3A 2DWHA 4WEPA 2NOOA 3PV0E 3G3GA 4NF6B 3RT8A 1Y3NA 1FCKA 1F9BA 1EZPA 3HV1A 4F3PA 1BP5A 3TELA 1ZLQA 2XXWA 3L6HA 2WKYA 4DCXA 1LB8A 1GV8A 4TLMB 1UTHB 1UTBB 1URDA 2F35A 4KFQA 4KCDA 4XKQA 1M5FA 1ZMGA 1B05A 4PFUA 3FGSA 3VV5A 4LUBA 1JW4A 4H1XA 1XHYA 4BDMA 1VFEA 4WEDA 1OVTA 2DYXA 3KJTA 4IO5A 1NFTA 3I3VA 4IGRA 3UP9A 5FHMA 5TPAA 3VVEA 2HQ0A 1MY4A 3S9EA 3UA8A 4R6HA 1ATGA 1QJMA 1FTLA 2O51A 1RYXA 4MBPA 5I2NB 3ILTB 1R6ZA 1B40A 5H8QB 1OMPA 3C4MA 4F31B 1B58A 3V89B 2QS3A 3EPEA 1S50A 4OXVA 2F6GA 3K00A 1QUKA 4F19A 3PPRA 2YLNA 1A8EA 2DQVA 4NMYA 4DZ1A 3D4GA 3O6IA 2XX7A 1OIBA 1JVXA 3U92A 2OZZA 4L17A 2AIXA 2I48A 2Q89A 5BUUA 3R6UA 2I0CA 3T66A 4NF4A 5A5XB 3PU5A 1O63A 1NNTA 4G68A 5DVFA 3FXQA 3S4UA 2Z8EA 1MXXA 5I59A 4LA9A 1B6HA 5TP9B 4H5GA 3SETA 5ITPA 4G68C 3PMWA 4EXKA 4C0RA 4TQUQ 2F7BA 1PB9A 3ODBA 3M3LA 3TAJA 3MVZA 1XT8A 1BTJA 3K4UA 1B4ZA 3BBRA 3OXNA 4LVQA 4KYSA 2O1MA 3TTRA 3CG1A 1XC1A 2XXVA 4R2FA 1M5BA 4I8CA 4JBZA 2O68A 3OD7A 3U72A 1MY0A 1A54A 1USYE 3FASA 3K02A 4GVOA 2LAOA 1OQGA 3H03A 5JTYB 1SI0A 1B52A 3O28A 4IY5A 1UQWA 4H5FA 4YAHX 1EZOA 1BIYA 1I6QA 2F34A 5TP9A 3MVYA 1IZ1A 2FYIA 1SDXA 3N5LA 1A55A 1D9YA 3HHGA 2CMOA 4NEDA 1PC3A 4IY6A 2F6PA 4OETA 2I6EA 4QRZA 3G3KA 5HM4B 3I6VA 5CC2A 3WAFA 1Y20A 4OQOA 3VDFA 1QUIA 5FTIA 3RN8A 4DIGA 3JYRA 2DS9A 3FUZA 4IGTA 5AA4B 5H8NB 2O84X 1P99A 3V83A 3TCHA 3Q28A 1JEVA 2VP1A 3K6XA 1QW0A 4ESXA 3T9HB 2F7CA 3PUYE 5M2VA 4AQ4A 2DP8A 4BDLA 1PB8A 3EF7A 2ONKE 2Q8JA 4U1ZA 2HZKA 1B32A 1ELJA 3FV1A 1R9QA 4PETA 1H3DA 1I69A 3C36A 1AOVA 3KFMA 4HCWA 2X7QA 4XTCQ 3LR1A 1Y3PA 5FHNA 4F2OA 3V8XB 5B7DA 4I9DA 1TFDA 3B6QA 5AA2D 4DXBA 5IKBA 2RF1A 4TLLB 3TUSA 4BDNA 3L6GA 2F78A 5CBRA 3K0VA 4F22A 3EHTA 2THIA 2XX9A 4ELQA 1NH8A 2DWJA 2I4BA 1MS7A 1SYHA 2PVUA 1Y4CA 2FA7A 1B7UA 1P1UA 3WAEA 1DPPA 4E0XA 2QS2A 3KGCA 1Y9UA 5AA2B 5I56B 3H6TA 1B1XA 1MY3A 3E3KA 3FVOA 1O7TA 2QMWA 4QSEA 4U4XA 1NNKA 3ONMA 5I2KA 3VLWA 5I58A 1JVYA 1UIVA 2ONSA 1LAXA 3T96B 4EDPA 4BDRA 2Y7IA 1NMUA 4DXCA 1MQIA 4LQ5A 2DE3A 2CZLA 4ZECA 4XIGQ 1D9VA 4OENA 2Z8FA 2ZYKA 3U1OA 3CIJA 4LONB 1QVSA 4X1DA 1MDQA 4IO4A 3HCQA 4TOZA 4Z0IA 3VVFA 3OMBA 3TPAA 3R7XA 3K6UA 3IAZA 1I6AA 5K2YA 1ZU0A 4N13A 3C34A 3P7IA 1N0TA 3HPIA 3TFLA 1VR5A 2Q9TA 2QS4A 4P0GA 2H9BA 1P1OA 2GFEA 2D3IA 3FVKA 3DP4A 4I1DA 4X9TA 3UN6A 1AH5A 3VVDA 1Y1ZA 1MQHA 4F3GA 4YKKA 4Z7EA 2XXYA 2UVIA 3HO7A 4GRKA 1URSA 1FTMA 3T9UA 3KBRA 2ABHA 4XKRA 2PMSA 3N94A 2V3UA 4POWA 5DEXB 4ISUA 4RK2A 4BDQA 4ELOA 3K1PA 3W9VA 1AIVA 2G93A 2DE2A 1FQEA 4FJPA 4RNSA 1A99A 1LSTA 3B7DA 3SESA 3FJGA 1H44A 3VE1B 1IUDA 1B1HA 3CFZA 5L8DA 3O6HA 4PFTA 3QSLA 4C1TA 4U1OA 3TEPA 4H67A 2I3WA 3LSXA 4UA8A 1VFDA 1MQGA 2O7UA 2VOZA 4FATA 2AL5A 4GL8A 1GVCA 3DP6A 1WVJA 1OLCA 1JNFA 2XXPA 1NNPA 3TKDA 1B7ZA 1MH3A 4G4PA 1ZIUA 1IXHA 4OFLA 2V25A 3IX1A 3M8UA 4OVJA 5CMBA 1FQAA 3O97A 4R9GA 3TZAA 2H25A 4ZZAA 4EUOA 4IO7A 3IK6B 1MG1A 3FXUA 3LUYA 4POXA 3OO8A 3SERA 1JW1A 4GL0A 3KZGA 1MPCA 3Q26A 1EU8A 2GH9A 3EN3A 3T22A 4F1UA 2VD3A 3HSTA 3TCFA 1JW5A 3PD8A 3OEMA 3VXBA 4MF3A 1MPDA 2PYYA 3N6TA 3FIRA 3T93B 4H65A 4PQJA 4ZDMA 1DMBA 1IITA 1B46A 4QFLA 3MP1A 4YB7A 3MVXA 3UK4A 1ZKBA 1M5CA 4LZ5A 3DELB 4NF5B 1DTGA 3PPOA 4OEVA 4PFWA 2R71A 1OVBA 4OFOA 1WDNA 4NF6A 5H8HB 1Z7ME 1FW0A 3KN7A 2DOJA 1AMFA 2W7YA 3S2VA 5IAIA 1BLFA 3MJNA 4IB2A 5DT6A 1A7LA 3RNNA 1UTHA 2G29A 1UTBA 2H98A 5KCJB 2UYFA 2XXXA 3H6WA 1HSEA 1D3KA 4U4SA 1B2HA 2DXRA 4GQOA 4N6PA 5JK4A 4RPNA 1FQFA 3MAMA 4AB5A 1L5TA 1M5EA 3H6VA 3HHFA 3AXFA 1ANFA 3O9PA 2F5XA 1RYOA 1MY2A 3CSGA 4IO2A 4ZEDA 2H5YA 3UGWA 4MLQA 2E1SA 3PUZE 1LBBA 3C35A 3QYTA 3MUQA 4XKNA 2HZLA 4YB6A 3KOTA 4PFYA 4U21A 2QS1A 3IORA 5DYHA 4KHZE 5CMCA 1S9TA 5I2NA 4ELRA 4F1VA 1D4NA 5H8QA 3TTLA 1N04A 3H4ZA 3FV2A 4G8HA 2A5SA 2AL4A 4H8JA 4WKMA 5L9MA 4ND9A 1SYIA 4OMBA 4M1VA 5CRYA 5F7VA 4THIA 3TTMA 1R1NA 2Y7WA 3TQWA 4QFPA 3LC8A 4O3CA 1YTVA 3VFJA 2XX8A 2NWJA 4H0WA 3LSLA 2ZYMA 4DLDA 4ZEBA 3RLFE 1CB6A 4OERA 1IXGA 3TYHA 5A5XA 3ZKLA 2QL3A 1QUJA 4UACA 1TXFA 3SEUA 5L9SA 2H4IA 2Z22A 5DTBA 5I84A 4RPOA 1PDAA 3O2AA 2ONRA 2BJJX 2UVJA 5I57B 4ZEFA 1IQ7A 5K2XA 1B3GA 1DSNA 2Y84A 4O3AA 3C33A 3T9VA 3PD9A 3MVWA 3A3UA 3VLVA 1LFGA 4KR5A 3G3JA 4OWDA 3IO6A 4GXAA 1M5DA 1CE2A 1MPBA 5CMKA 2X26A 3IB0A 1FQDA 2HFBA 1IXCA 1P1QA 3IJXB 3C31A 1B3FA 1MH4A 5KZTA 1SW2A 1EZ9A 1Q1KA 4NE4A 2Y7KA 4M4GA 3TQLA 4ELPA 3PUWE 2E0SA 2XHDA 4JWXA 4R6YA 2A5TB 1NH7A 5JTYA 4ZEKA 2XD2A 4F1YA 3R26A 2QMXA 3CSBA 3MZBA 2R9JA 4QSDA 2M8CA 4RY1A 1N3XA 3MP8A 3EQ1A 1MY1A 3E13X 5ICTA 2NXOA 4LZ8A 4QFNA 5H8FB 1B5IA 2RC8A 4JSOA 5ICQA 3KEIA 4FE8A 4RJZA 3MP6A 4EQ7A 5ISUA 4IO3A 3OO6A 3B6WA 4FECA 3G3FA 4OHNA 3OSQA 1YCJA 1II5A 4GFRA 2XXTA 3IOUA 1LBCA 3RT6B 5EHMA 3VLUA 1GR2A 4H8IA 3H6UA 2V93A 3B6TA 1XS5A 5H8NA 5AA4A 1XVYA 4RYAA 1P1NA 4XXUA 5BWJA 1I6BA 1Y3QA 1AL3A 2XXRA 2RCBA 4NWDA 4YKPA 2O7IA 1OLAA 1Q35A 3W9WA 4GLIA 4K3FA 2PX1A 4YKIA 2V84A 1IEJA 2GHAA 1MXWA 2OCUA 2O1LA 1PEBA 1MXVA 3TDJA 3JV9A 1JQFA 2XXQA 4YU0A 1DOTA 2DXYA 3IJOB 4NTLA 2NUVA 1P1WA 3ZS6A 1GTKA 2ZYNA 1B9JA 3CFXA 3THIA 1LGBC 2OK2A 1MRPA 3GXAA 1POTA 1US5A 4GIZA 4ESWA 3A3CA 2QSXA 2HCAA 4EXLA 3K2DA 1VSOA 1LLSA 3IOVA 3I5OA 4R75A 4LP2B 1GGGA 4YICA 3QUJA 3CR9A 1JETA 1ZJLA 4PE5B 2PBWA 1SW5A 2V3TA 2Q88A 2Y7PA 1NKXA 3Q25A 4R74A 3S9MC 3D4CA 4YMBA 5AA2A 3M3FA 5I56A 1B5HA 5DVIA 5HPQA 3RPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ANJ A;  3IO4 A;  3LSW A;  2O6A A;  2H99 A;  3A09 A;  3K1M A;  2KLF A;  3OOA A;  2ZNU A;  5CBS A;  2DE4 A;  1A8F A;  2RC7 A;  4JDF A;  2UYE A;  2VD2 A;  1SVX B;  1PBQ A;  1B5J A;  3MPL A;  3MZ1 A;  1ZTY A;  3PPP A;  2DVC A;  1LFI A;  2PT2 A;  1URG A;  3M3K A;  4DXU A;  1DTZ A;  4DDD A;  2YPN A;  2XXH A;  2RCA A;  1MXZ A;  3TCG A;  4OTE A;  4U22 A;  1MM6 A;  3EHS A;  2OLB A;  4MLV A;  2NVU B;  4YMA A;  3K6W A;  4KD5 A;  2F36 A;  1QKA A;  1SW4 A;  4P0I A;  3CRB A;  3KG2 A;  3MBP A;  1TWY A;  2DVZ A;  4X48 A;  1ZBM A;  4JB7 A;  3PMV A;  4HTG A;  1B3L A;  1LCT A;  3HN0 A;  2P2A A;  1FTK A;  3LSF B;  2HAU A;  5DEX A;  3Q29 A;  2D5W A;  1SBP A;  3FVN A;  3QIM A;  4G8N A;  2R6G E;  3SEY A;  3OEN A;  1B0L A;  3G3H A;  3Q27 A;  1N84 A;  4JWO A;  1MXY A;  2IA4 A;  2D21 A;  5J1D A;  1MXU A;  4E0W A;  2X7P A;  4NF4 B;  2F97 A;  1FTO A;  4HW8 A;  4G68 B;  2OWS A;  3G3I A;  4QHQ A;  5I59 B;  4PP0 A;  4O3B A;  4ONY A;  2GRV A;  4HS7 A;  5ITO A;  2I3V A;  3GZG A;  1N7W A;  4F2Q A;  2P0S A;  3FVG A;  3PPN A;  3BFT A;  3OO7 A;  4GXS B;  4U23 A;  2Q2A A;  1BKA A;  1DPE A;  4QSC A;  1B51 A;  4BDO A;  4ZZE A;  4FAJ A;  1H76 A;  4F3S A;  2UVH A;  1UIU A;  1NL5 A;  5DVJ A;  2RC9 A;  3H06 B;  3TTN A;  3FAT A;  2F8D A;  2OJT A;  4LQ2 A;  2P1S A;  1TT1 A;  4IO6 A;  3SDF A;  4F18 A;  3K01 A;  3DLN A;  2ZNT A;  4YZZ A;  1NNF A;  4G77 A;  3OEK A;  3S9N C;  5CMM A;  3RY3 A;  1TFA A;  5KDT B;  3V5A A;  5ELV A;  3CI8 A;  4GWO A;  1N3W A;  4ZS9 A;  3U93 A;  1O64 A;  4FIM A;  3CVG A;  3RGY A;  1QUL A;  3W15 C;  5CM6 A;  4NF5 A;  3IOW A;  3MC2 A;  1Y1M A;  3CFL A;  5H8H A;  3ILU B;  2DSF A;  3KN3 A;  2B65 A;  1EH3 A;  5FTH A;  3MW0 A;  4YB5 A;  4R6K A;  5CI5 A;  3JZJ A;  5JEI A;  3MQ9 A;  1A40 A;  4X1B A;  3GBA A;  1OQH A;  5KCJ A;  4RXL A;  1B3E A;  2Q2C A;  1LAG E;  1US4 A;  3E9X A;  1WOD A;  3BKI B;  4RA1 A;  4QFO A;  4EQ9 A;  2UVG A;  2ZYO A;  2DWA A;  2FNC A;  3SEV A;  1B3H A;  4F3B A;  1HSJ A;  3UIF A;  4FED A;  5L9O A;  3TOD A;  4YKJ A;  4NF8 B;  1FQC A;  4R72 A;  4KCC A;  3PUX E;  4P11 A;  3G7W A;  4MFI A;  3ZKK A;  1VE4 A;  1MQD A;  4EQB A;  3H3G A;  5KDT A;  4LAT A;  1S7Y A;  2XXU A;  4NWC A;  4ZE9 A;  4H6D A;  1SQY A;  3RTF B;  3H7M A;  1J1N A;  5AA1 A;  1SD3 A;  3DP8 A;  4HCY A;  3TTK A;  2F7A A;  4KYD A;  2I0B A;  3IR1 A;  3OO9 A;  3C32 A;  4R9F A;  2I58 A;  3TMG A;  1IXI A;  2RIN A;  4OES A;  5TU0 A;  4F29 A;  3O29 A;  3MPK A;  3PMX A;  1B0H A;  4KYE A;  3E4R A;  2UXA A;  4Q0C A;  3N26 A;  4Q5T A;  3VXC A;  2IEE A;  3QK6 A;  4FOR A;  4I62 A;  2QJE A;  2AYS A;  3U94 A;  1B7H A;  1SW1 A;  3QUF A;  5HBC A;  3GBB A;  2Z8D A;  4GD5 A;  3MWB A;  3F11 A;  4WXJ A;  1R9L A;  1B4H A;  1XOC A;  1HSL A;  4ZEI A;  3KN8 A;  4EF2 A;  5AE4 A;  4NF8 A;  4JWY A;  4OZ9 A;  5I57 A;  1PBP A;  2ZNS A;  3RUM A;  3FZV A;  4Q30 B;  2OWT A;  5F1Q A;  5I2K B;  2Z23 A;  3KJ7 A;  5I58 B;  1LAF E;  3KSJ A;  4FEB A;  3FJ7 A;  4G2Z A;  4C1U A;  1SI1 A;  1KWH A;  2I4C A;  4OEU A;  3GLB A;  2B3F A;  3K6V A;  3USD A;  1JEU A;  5FHO A;  3T9X B;  2V3Q A;  3QXM A;  5EHS A;  1PB7 A;  2DWI A;  1T0K A;  3UOR A;  3N6U A;  3C9H A;  1POY 1;  2A5T A;  1Y4T A;  4XKP A;  3OSR A;  4JXI A;  4R2B A;  3FXR A;  2GHB A;  3ZSF A;  4GOT A;  2Y7R A;  3SEX A;  1FTJ A;  4N07 A;  4G8M A;  4QF9 A;  5H8F A;  2ZXT A;  1Z7N E;  3LBS A;  1LFH A;  2XD3 A;  1MDP 1;  4U2R A;  1N76 A;  3EHU A;  3IB1 A;  1H43 A;  3KOS A;  3PGF A;  1QKB A;  4KQP A;  2REJ A;  4JSD A;  3SEW A;  4F39 A;  2HAV A;  3QAX A;  3ECR A;  2QPQ A;  2ALU A;  3CG3 A;  1USY H;  3RQT A;  4AB6 A;  1MQJ A;  4DCY A;  3KSX A;  4EF1 A;  5LOM A;  2HEU A;  1YAE A;  3SKP A;  3OEL A;  4Q8R A;  1H45 A;  3BFU A;  3IB2 A;  2HXW A;  4DE8 A;  4BLA A;  2ESN A;  1XVX A;  3MZ9 A;  3RTW B;  1IIW A;  4ECF A;  5EYF A;  3PPQ A;  2RKM A;  3FD3 A;  3DM0 A;  1LCF A;  3PUV E;  4ZE8 A;  5B70 A;  3O6G A;  2VHA A;  1MM7 A;  1LB9 A;  2I49 A;  2B3B A;  1FQB A;  2O69 A;  4GF8 A;  4KPT A;  1YPN A;  5H8S A;  2VGQ A;  1LAH E;  4OFJ A;  4R73 A;  3IL1 B;  3IOT A;  2XXI A;  2ZMB A;  4MH5 A;  1N7X A;  2YJP A;  2PT1 A;  3U8Q A;  4RK9 A;  3O66 A;  3K1N A;  4OYV A;  3FJM A;  2QRY A;  4KI0 E;  2OBG A;  5TPA B;  4QFK A;  3S9L C;  4LZ7 A;  2REG A;  1RKM A;  5AA3 A;  2DWH A;  4WEP A;  2NOO A;  3PV0 E;  3G3G A;  4NF6 B;  3RT8 A;  1Y3N A;  1FCK A;  1F9B A;  1EZP A;  3HV1 A;  4F3P A;  1BP5 A;  3TEL A;  1ZLQ A;  2XXW A;  3L6H A;  2WKY A;  4DCX A;  1LB8 A;  1GV8 A;  4TLM B;  1UTH B;  1UTB B;  1URD A;  2F35 A;  4KFQ A;  4KCD A;  4XKQ A;  1M5F A;  1ZMG A;  1B05 A;  4PFU A;  3FGS A;  3VV5 A;  4LUB A;  1JW4 A;  4H1X A;  1XHY A;  4BDM A;  1VFE A;  4WED A;  1OVT A;  2DYX A;  3KJT A;  4IO5 A;  1NFT A;  3I3V A;  4IGR A;  3UP9 A;  5FHM A;  5TPA A;  3VVE A;  2HQ0 A;  1MY4 A;  3S9E A;  3UA8 A;  4R6H A;  1ATG A;  1QJM A;  1FTL A;  2O51 A;  1RYX A;  4MBP A;  5I2N B;  3ILT B;  1R6Z A;  1B40 A;  5H8Q B;  1OMP A;  3C4M A;  4F31 B;  1B58 A;  3V89 B;  2QS3 A;  3EPE A;  1S50 A;  4OXV A;  2F6G A;  3K00 A;  1QUK A;  4F19 A;  3PPR A;  2YLN A;  1A8E A;  2DQV A;  4NMY A;  4DZ1 A;  3D4G A;  3O6I A;  2XX7 A;  1OIB A;  1JVX A;  3U92 A;  2OZZ A;  4L17 A;  2AIX A;  2I48 A;  2Q89 A;  5BUU A;  3R6U A;  2I0C A;  3T66 A;  4NF4 A;  5A5X B;  3PU5 A;  1O63 A;  1NNT A;  4G68 A;  5DVF A;  3FXQ A;  3S4U A;  2Z8E A;  1MXX A;  5I59 A;  4LA9 A;  1B6H A;  5TP9 B;  4H5G A;  3SET A;  5ITP A;  4G68 C;  3PMW A;  4EXK A;  4C0R A;  4TQU Q;  2F7B A;  1PB9 A;  3ODB A;  3M3L A;  3TAJ A;  3MVZ A;  1XT8 A;  1BTJ A;  3K4U A;  1B4Z A;  3BBR A;  3OXN A;  4LVQ A;  4KYS A;  2O1M A;  3TTR A;  3CG1 A;  1XC1 A;  2XXV A;  4R2F A;  1M5B A;  4I8C A;  4JBZ A;  2O68 A;  3OD7 A;  3U72 A;  1MY0 A;  1A54 A;  1USY E;  3FAS A;  3K02 A;  4GVO A;  2LAO A;  1OQG A;  3H03 A;  5JTY B;  1SI0 A;  1B52 A;  3O28 A;  4IY5 A;  1UQW A;  4H5F A;  4YAH X;  1EZO A;  1BIY A;  1I6Q A;  2F34 A;  5TP9 A;  3MVY A;  1IZ1 A;  2FYI A;  1SDX A;  3N5L A;  1A55 A;  1D9Y A;  3HHG A;  2CMO A;  4NED A;  1PC3 A;  4IY6 A;  2F6P A;  4OET A;  2I6E A;  4QRZ A;  3G3K A;  5HM4 B;  3I6V A;  5CC2 A;  3WAF A;  1Y20 A;  4OQO A;  3VDF A;  1QUI A;  5FTI A;  3RN8 A;  4DIG A;  3JYR A;  2DS9 A;  3FUZ A;  4IGT A;  5AA4 B;  5H8N B;  2O84 X;  1P99 A;  3V83 A;  3TCH A;  3Q28 A;  1JEV A;  2VP1 A;  3K6X A;  1QW0 A;  4ESX A;  3T9H B;  2F7C A;  3PUY E;  5M2V A;  4AQ4 A;  2DP8 A;  4BDL A;  1PB8 A;  3EF7 A;  2ONK E;  2Q8J A;  4U1Z A;  2HZK A;  1B32 A;  1ELJ A;  3FV1 A;  1R9Q A;  4PET A;  1H3D A;  1I69 A;  3C36 A;  1AOV A;  3KFM A;  4HCW A;  2X7Q A;  4XTC Q;  3LR1 A;  1Y3P A;  5FHN A;  4F2O A;  3V8X B;  5B7D A;  4I9D A;  1TFD A;  3B6Q A;  5AA2 D;  4DXB A;  5IKB A;  2RF1 A;  4TLL B;  3TUS A;  4BDN A;  3L6G A;  2F78 A;  5CBR A;  3K0V A;  4F22 A;  3EHT A;  2THI A;  2XX9 A;  4ELQ A;  1NH8 A;  2DWJ A;  2I4B A;  1MS7 A;  1SYH A;  2PVU A;  1Y4C A;  2FA7 A;  1B7U A;  1P1U A;  3WAE A;  1DPP A;  4E0X A;  2QS2 A;  3KGC A;  1Y9U A;  5AA2 B;  5I56 B;  3H6T A;  1B1X A;  1MY3 A;  3E3K A;  3FVO A;  1O7T A;  2QMW A;  4QSE A;  4U4X A;  1NNK A;  3ONM A;  5I2K A;  3VLW A;  5I58 A;  1JVY A;  1UIV A;  2ONS A;  1LAX A;  3T96 B;  4EDP A;  4BDR A;  2Y7I A;  1NMU A;  4DXC A;  1MQI A;  4LQ5 A;  2DE3 A;  2CZL A;  4ZEC A;  4XIG Q;  1D9V A;  4OEN A;  2Z8F A;  2ZYK A;  3U1O A;  3CIJ A;  4LON B;  1QVS A;  4X1D A;  1MDQ A;  4IO4 A;  3HCQ A;  4TOZ A;  4Z0I A;  3VVF A;  3OMB A;  3TPA A;  3R7X A;  3K6U A;  3IAZ A;  1I6A A;  5K2Y A;  1ZU0 A;  4N13 A;  3C34 A;  3P7I A;  1N0T A;  3HPI A;  3TFL A;  1VR5 A;  2Q9T A;  2QS4 A;  4P0G A;  2H9B A;  1P1O A;  2GFE A;  2D3I A;  3FVK A;  3DP4 A;  4I1D A;  4X9T A;  3UN6 A;  1AH5 A;  3VVD A;  1Y1Z A;  1MQH A;  4F3G A;  4YKK A;  4Z7E A;  2XXY A;  2UVI A;  3HO7 A;  4GRK A;  1URS A;  1FTM A;  3T9U A;  3KBR A;  2ABH A;  4XKR A;  2PMS A;  3N94 A;  2V3U A;  4POW A;  5DEX B;  4ISU A;  4RK2 A;  4BDQ A;  4ELO A;  3K1P A;  3W9V A;  1AIV A;  2G93 A;  2DE2 A;  1FQE A;  4FJP A;  4RNS A;  1A99 A;  1LST A;  3B7D A;  3SES A;  3FJG A;  1H44 A;  3VE1 B;  1IUD A;  1B1H A;  3CFZ A;  5L8D A;  3O6H A;  4PFT A;  3QSL A;  4C1T A;  4U1O A;  3TEP A;  4H67 A;  2I3W A;  3LSX A;  4UA8 A;  1VFD A;  1MQG A;  2O7U A;  2VOZ A;  4FAT A;  2AL5 A;  4GL8 A;  1GVC A;  3DP6 A;  1WVJ A;  1OLC A;  1JNF A;  2XXP A;  1NNP A;  3TKD A;  1B7Z A;  1MH3 A;  4G4P A;  1ZIU A;  1IXH A;  4OFL A;  2V25 A;  3IX1 A;  3M8U A;  4OVJ A;  5CMB A;  1FQA A;  3O97 A;  4R9G A;  3TZA A;  2H25 A;  4ZZA A;  4EUO A;  4IO7 A;  3IK6 B;  1MG1 A;  3FXU A;  3LUY A;  4POX A;  3OO8 A;  3SER A;  1JW1 A;  4GL0 A;  3KZG A;  1MPC A;  3Q26 A;  1EU8 A;  2GH9 A;  3EN3 A;  3T22 A;  4F1U A;  2VD3 A;  3HST A;  3TCF A;  1JW5 A;  3PD8 A;  3OEM A;  3VXB A;  4MF3 A;  1MPD A;  2PYY A;  3N6T A;  3FIR A;  3T93 B;  4H65 A;  4PQJ A;  4ZDM A;  1DMB A;  1IIT A;  1B46 A;  4QFL A;  3MP1 A;  4YB7 A;  3MVX A;  3UK4 A;  1ZKB A;  1M5C A;  4LZ5 A;  3DEL B;  4NF5 B;  1DTG A;  3PPO A;  4OEV A;  4PFW A;  2R71 A;  1OVB A;  4OFO A;  1WDN A;  4NF6 A;  5H8H B;  1Z7M E;  1FW0 A;  3KN7 A;  2DOJ A;  1AMF A;  2W7Y A;  3S2V A;  5IAI A;  1BLF A;  3MJN A;  4IB2 A;  5DT6 A;  1A7L A;  3RNN A;  1UTH A;  2G29 A;  1UTB A;  2H98 A;  5KCJ B;  2UYF A;  2XXX A;  3H6W A;  1HSE A;  1D3K A;  4U4S A;  1B2H A;  2DXR A;  4GQO A;  4N6P A;  5JK4 A;  4RPN A;  1FQF A;  3MAM A;  4AB5 A;  1L5T A;  1M5E A;  3H6V A;  3HHF A;  3AXF A;  1ANF A;  3O9P A;  2F5X A;  1RYO A;  1MY2 A;  3CSG A;  4IO2 A;  4ZED A;  2H5Y A;  3UGW A;  4MLQ A;  2E1S A;  3PUZ E;  1LBB A;  3C35 A;  3QYT A;  3MUQ A;  4XKN A;  2HZL A;  4YB6 A;  3KOT A;  4PFY A;  4U21 A;  2QS1 A;  3IOR A;  5DYH A;  4KHZ E;  5CMC A;  1S9T A;  5I2N A;  4ELR A;  4F1V A;  1D4N A;  5H8Q A;  3TTL A;  1N04 A;  3H4Z A;  3FV2 A;  4G8H A;  2A5S A;  2AL4 A;  4H8J A;  4WKM A;  5L9M A;  4ND9 A;  1SYI A;  4OMB A;  4M1V A;  5CRY A;  5F7V A;  4THI A;  3TTM A;  1R1N A;  2Y7W A;  3TQW A;  4QFP A;  3LC8 A;  4O3C A;  1YTV A;  3VFJ A;  2XX8 A;  2NWJ A;  4H0W A;  3LSL A;  2ZYM A;  4DLD A;  4ZEB A;  3RLF E;  1CB6 A;  4OER A;  1IXG A;  3TYH A;  5A5X A;  3ZKL A;  2QL3 A;  1QUJ A;  4UAC A;  1TXF A;  3SEU A;  5L9S A;  2H4I A;  2Z22 A;  5DTB A;  5I84 A;  4RPO A;  1PDA A;  3O2A A;  2ONR A;  2BJJ X;  2UVJ A;  5I57 B;  4ZEF A;  1IQ7 A;  5K2X A;  1B3G A;  1DSN A;  2Y84 A;  4O3A A;  3C33 A;  3T9V A;  3PD9 A;  3MVW A;  3A3U A;  3VLV A;  1LFG A;  4KR5 A;  3G3J A;  4OWD A;  3IO6 A;  4GXA A;  1M5D A;  1CE2 A;  1MPB A;  5CMK A;  2X26 A;  3IB0 A;  1FQD A;  2HFB A;  1IXC A;  1P1Q A;  3IJX B;  3C31 A;  1B3F A;  1MH4 A;  5KZT A;  1SW2 A;  1EZ9 A;  1Q1K A;  4NE4 A;  2Y7K A;  4M4G A;  3TQL A;  4ELP A;  3PUW E;  2E0S A;  2XHD A;  4JWX A;  4R6Y A;  2A5T B;  1NH7 A;  5JTY A;  4ZEK A;  2XD2 A;  4F1Y A;  3R26 A;  2QMX A;  3CSB A;  3MZB A;  2R9J A;  4QSD A;  2M8C A;  4RY1 A;  1N3X A;  3MP8 A;  3EQ1 A;  1MY1 A;  3E13 X;  5ICT A;  2NXO A;  4LZ8 A;  4QFN A;  5H8F B;  1B5I A;  2RC8 A;  4JSO A;  5ICQ A;  3KEI A;  4FE8 A;  4RJZ A;  3MP6 A;  4EQ7 A;  5ISU A;  4IO3 A;  3OO6 A;  3B6W A;  4FEC A;  3G3F A;  4OHN A;  3OSQ A;  1YCJ A;  1II5 A;  4GFR A;  2XXT A;  3IOU A;  1LBC A;  3RT6 B;  5EHM A;  3VLU A;  1GR2 A;  4H8I A;  3H6U A;  2V93 A;  3B6T A;  1XS5 A;  5H8N A;  5AA4 A;  1XVY A;  4RYA A;  1P1N A;  4XXU A;  5BWJ A;  1I6B A;  1Y3Q A;  1AL3 A;  2XXR A;  2RCB A;  4NWD A;  4YKP A;  2O7I A;  1OLA A;  1Q35 A;  3W9W A;  4GLI A;  4K3F A;  2PX1 A;  4YKI A;  2V84 A;  1IEJ A;  2GHA A;  1MXW A;  2OCU A;  2O1L A;  1PEB A;  1MXV A;  3TDJ A;  3JV9 A;  1JQF A;  2XXQ A;  4YU0 A;  1DOT A;  2DXY A;  3IJO B;  4NTL A;  2NUV A;  1P1W A;  3ZS6 A;  1GTK A;  2ZYN A;  1B9J A;  3CFX A;  3THI A;  1LGB C;  2OK2 A;  1MRP A;  3GXA A;  1POT A;  1US5 A;  4GIZ A;  4ESW A;  3A3C A;  2QSX A;  2HCA A;  4EXL A;  3K2D A;  1VSO A;  1LLS A;  3IOV A;  3I5O A;  4R75 A;  4LP2 B;  1GGG A;  4YIC A;  3QUJ A;  3CR9 A;  1JET A;  1ZJL A;  4PE5 B;  2PBW A;  1SW5 A;  2V3T A;  2Q88 A;  2Y7P A;  1NKX A;  3Q25 A;  4R74 A;  3S9M C;  3D4C A;  4YMB A;  5AA2 A;  3M3F A;  5I56 A;  1B5H A;  5DVI A;  5HPQ A;  3RPW A; 
#chains in the Genus database with same CATH topology
 2ANJ A;  3IO4 A;  3LSW A;  2O6A A;  2H99 A;  3A09 A;  3KC1 A;  3K1M A;  2KLF A;  1IMD A;  3OOA A;  2ZNU A;  3BIH A;  5CBS A;  2DE4 A;  1A8F A;  4NQ8 A;  2RC7 A;  4JDF A;  2UYE A;  2VD2 A;  1SVX B;  1PBQ A;  4MX6 A;  1B5J A;  3MPL A;  3MZ1 A;  2WYP A;  1ZTY A;  3PPP A;  1DCU A;  2DVC A;  1LFI A;  2PT2 A;  1URG A;  3BIG A;  3M3K A;  4DXU A;  1DTZ A;  4DDD A;  4G61 A;  2YPN A;  2XXH A;  1FPK A;  2RCA A;  5I7I A;  1MXZ A;  3TCG A;  4OTE A;  4U22 A;  4P56 A;  1MM6 A;  3EHS A;  2OLB A;  4MLV A;  2NVU B;  3T0J A;  4YMA A;  3K6W A;  4KD5 A;  2F36 A;  1QKA A;  1SW4 A;  4P0I A;  3CRB A;  3KG2 A;  3MBP A;  1TWY A;  2DVZ A;  4X48 A;  1ZBM A;  4JB7 A;  3PMV A;  4HTG A;  4PTK A;  1B3L A;  1LCT A;  3HN0 A;  2P2A A;  1FTK A;  4O8M A;  3LSF B;  2HAU A;  3T1B A;  5DEX A;  2CZH A;  3Q29 A;  2D5W A;  2WBB A;  1SBP A;  3FVN A;  3QIM A;  4G8N A;  2R6G E;  3SEY A;  3OEN A;  1B0L A;  3G3H A;  3Q27 A;  1N84 A;  4JWO A;  1MXY A;  2IA4 A;  2D21 A;  1NUZ A;  5J1D A;  1MXU A;  1NUW A;  4E0W A;  3NOH A;  2X7P A;  4NF4 B;  2F97 A;  2PFY A;  1FTO A;  4HW8 A;  4G68 B;  2OWS A;  3G3I A;  4QHQ A;  5I59 B;  4PP0 A;  4GBW A;  4O3B A;  4ONY A;  2GRV A;  4HS7 A;  1FTA A;  5ITO A;  2I3V A;  3GZG A;  1N7W A;  1VDW A;  4F2Q A;  2CEX A;  2OX3 A;  2P0S A;  3FVG A;  3PPN A;  4MNI A;  3BFT A;  3OO7 A;  4GXS B;  4U23 A;  2Q2A A;  1BKA A;  1DPE A;  4QSC A;  1B51 A;  3PTY A;  4BDO A;  4ZZE A;  4FAJ A;  1H76 A;  4F3S A;  2UVH A;  1UIU A;  1NL5 A;  5DVJ A;  2RC9 A;  3H06 B;  3TTN A;  3FAT A;  4MEV A;  1LBZ A;  2F8D A;  2OJT A;  4LQ2 A;  2P1S A;  1TT1 A;  4IO6 A;  3SDF A;  4F18 A;  3K01 A;  3DLN A;  2ZNT A;  4H45 A;  4YZZ A;  1NNF A;  4G77 A;  3OEK A;  4NHB A;  3S9N C;  5CMM A;  3RY3 A;  3QMF A;  1TFA A;  5KDT B;  3V5A A;  5ELV A;  2VPN A;  3CI8 A;  4GWO A;  1N3W A;  4ZS9 A;  2XA5 A;  3U93 A;  1O64 A;  4FIM A;  3CVG A;  3RGY A;  1QUL A;  3W15 C;  4PDH A;  5CM6 A;  4NF5 A;  3IOW A;  3MC2 A;  4PFR A;  3MST A;  1Y1M A;  3CFL A;  4X04 A;  5H8H A;  3ILU B;  2DSF A;  3KN3 A;  2B65 A;  1EH3 A;  5FTH A;  3MW0 A;  4YB5 A;  4R6K A;  5CI5 A;  3JZJ A;  1K9Y A;  2XWO A;  5JEI A;  3MQ9 A;  1A40 A;  4X1B A;  3GBA A;  1OQH A;  1FPJ A;  5KCJ A;  4RXL A;  1B3E A;  2Q2C A;  4PAF A;  1LAG E;  1US4 A;  3E9X A;  1WOD A;  3BKI B;  4RA1 A;  4QFO A;  4EQ9 A;  2UVG A;  1EYK A;  2ZYO A;  2DWA A;  2FNC A;  3SEV A;  1B3H A;  4F3B A;  1HSJ A;  3UIF A;  4FED A;  5L9O A;  4XF5 A;  3TOD A;  2ZZX A;  4YKJ A;  4NF8 B;  1FQC A;  4R72 A;  4KCC A;  3PUX E;  4P11 A;  3G7W A;  4MFI A;  1FBP A;  3ZKK A;  1VE4 A;  1MQD A;  4EQB A;  3H3G A;  4P9K A;  5KDT A;  4LAT A;  1S7Y A;  2XXU A;  4N4U A;  4NWC A;  4ZE9 A;  4H6D A;  1SQY A;  1Q9D A;  3RTF B;  3H7M A;  1J1N A;  5AA1 A;  1SD3 A;  1FBC A;  3DP8 A;  4HCY A;  3TTK A;  2F7A A;  4KYD A;  5I3S A;  2I0B A;  3IR1 A;  3OO9 A;  1FBF A;  2QVV A;  3C32 A;  4R9F A;  2I58 A;  3TMG A;  1IXI A;  2RIN A;  4OES A;  5TU0 A;  4F29 A;  3O29 A;  3MPK A;  1FBD A;  3PMX A;  3A29 A;  5FBP A;  1B0H A;  4GWX A;  4KYE A;  3E4R A;  2UXA A;  5ET8 A;  4Q0C A;  3N26 A;  4Q5T A;  3VXC A;  2IEE A;  3QK6 A;  4FOR A;  4I62 A;  2QJE A;  2ZZV A;  2AYS A;  3U94 A;  4OVP A;  1B7H A;  1G0I A;  1SW1 A;  2JJK A;  3QUF A;  5HBC A;  3GBB A;  2Z8D A;  4GD5 A;  3MWB A;  3F11 A;  4WXJ A;  1R9L A;  1B4H A;  1INP A;  4GWS A;  1FPG A;  1XOC A;  1HSL A;  4ZEI A;  4HXV A;  3KN8 A;  2PCR A;  4EF2 A;  5AE4 A;  4NF8 A;  2FVZ A;  4JWY A;  1FSA A;  4O94 A;  4OZ9 A;  5I57 A;  3RYD A;  1PBP A;  2ZNS A;  3RUM A;  3FZV A;  4Q30 B;  2Y5K A;  2OWT A;  5F1Q A;  5LDZ A;  5I2K B;  2Z23 A;  3KJ7 A;  5I58 B;  1LAF E;  3KSJ A;  4FEB A;  3FJ7 A;  4G2Z A;  3HFU A;  4C1U A;  1SI1 A;  1KWH A;  2I4C A;  4OEU A;  4PDD A;  5IZ3 B;  3GLB A;  4NN3 A;  2B3F A;  3K6V A;  3USD A;  1JEU A;  5FHO A;  3T9X B;  2V3Q A;  3QXM A;  1FPL A;  5EHS A;  2B4M A;  1PB7 A;  4GX6 A;  2DWI A;  1T0K A;  3B8B A;  3UOR A;  3N6U A;  3C9H A;  1POY 1;  2A5T A;  1Y4T A;  4XKP A;  3OSR A;  4JXI A;  1NUY A;  1RDX A;  4R2B A;  3FXR A;  2GHB A;  3ZSF A;  4GOT A;  2Y7R A;  1YYZ A;  3SEX A;  1FTJ A;  4N07 A;  4G8M A;  3CHG A;  4QF9 A;  3EKI A;  4P8B A;  2ZXT A;  4JVI A;  5H8F A;  1Z7N E;  3LBS A;  1LFH A;  2XD3 A;  4PBH A;  1MDP 1;  4U2R A;  2XXK A;  1N76 A;  3EHU A;  4N15 A;  3IB1 A;  1H43 A;  3KOS A;  4OA4 A;  3PGF A;  1QKB A;  4KQP A;  2REJ A;  4JSD A;  1K9Z A;  3SEW A;  4F39 A;  2HAV A;  3QAX A;  3ECR A;  2QPQ A;  2ALU A;  3CG3 A;  1USY H;  3RQT A;  4AB6 A;  1MQJ A;  4DCY A;  3KSX A;  4EF1 A;  5LOM A;  2HEU A;  1YAE A;  3SKP A;  3OEL A;  4Q8R A;  1H45 A;  3BFU A;  1IME A;  3IB2 A;  2HXW A;  4DE8 A;  4BLA A;  2ESN A;  1XVX A;  3MZ9 A;  2XWV A;  3RTW B;  1IIW A;  1FPF A;  4XFE A;  4ECF A;  5EYF A;  3PPQ A;  5T3J A;  2RKM A;  3FD3 A;  3DM0 A;  1LCF A;  3PUV E;  4ZE8 A;  5B70 A;  3O6G A;  2VHA A;  1MM7 A;  1LB9 A;  2I49 A;  2B3B A;  1FQB A;  2O69 A;  4GF8 A;  4KPT A;  1YPN A;  5H8S A;  2VGQ A;  1G0H A;  1LAH E;  1RDY A;  4OFJ A;  2Q74 A;  4R73 A;  4OVS A;  3IL1 B;  2XWI A;  3IOT A;  2XXI A;  2KQZ A;  2ZMB A;  4MH5 A;  1N7X A;  2YJP A;  2PT1 A;  3U8Q A;  4RK9 A;  3O66 A;  3K1N A;  4OVR A;  4OYV A;  4P1L A;  3FJM A;  2QRY A;  4NG7 A;  4KI0 E;  1DBZ A;  2OBG A;  5TPA B;  4QFK A;  3S9L C;  4LZ7 A;  5F24 A;  2REG A;  1RKM A;  5AA3 A;  2DWH A;  4WEP A;  2NOO A;  3PV0 E;  3G3G A;  4NF6 B;  3RT8 A;  1FPD A;  1Y3N A;  3GYY A;  1FCK A;  1F9B A;  1EZP A;  3HV1 A;  4F3P A;  1BP5 A;  3TEL A;  1ZLQ A;  2XXW A;  1KZ8 A;  3L6H A;  2HHM A;  2WKY A;  4DCX A;  1LB8 A;  1GV8 A;  4TLM B;  1UTH B;  4GWU A;  4IR8 A;  4AS5 A;  1UTB B;  1URD A;  2F35 A;  4KFQ A;  4KCD A;  4XKQ A;  1M5F A;  1ZMG A;  2V4C A;  2OWZ A;  1B05 A;  5I5P A;  4PFU A;  3FGS A;  3VV5 A;  4LUB A;  1JW4 A;  4I40 A;  4MJO A;  4H1X A;  1XHY A;  4BDM A;  1VFE A;  4WED A;  1OVT A;  5ET7 A;  2DYX A;  3KJT A;  4IO5 A;  1NFT A;  1FJ6 A;  3I3V A;  4IGR A;  3UP9 A;  5FHM A;  5TPA A;  3VVE A;  5IZ1 A;  2HQ0 A;  1MY4 A;  3S9E A;  4N6D A;  1JP4 A;  3UA8 A;  4MHF A;  4R6H A;  1ATG A;  1QJM A;  1FTL A;  4O7I A;  2O51 A;  1RYX A;  3LV0 A;  4MBP A;  5I2N B;  3ILT B;  1R6Z A;  1B40 A;  4PAK A;  5H8Q B;  1OMP A;  3C4M A;  4PAI A;  4F31 B;  4JVD A;  1B58 A;  2P3N A;  3V89 B;  2QS3 A;  3EPE A;  1NV0 A;  1S50 A;  4OXV A;  2F6G A;  3K00 A;  1QUK A;  4F19 A;  3PPR A;  2YLN A;  1A8E A;  2DQV A;  4NMY A;  4DZ1 A;  3D4G A;  3O6I A;  3ROJ A;  2XX7 A;  2CZI A;  1OIB A;  1JVX A;  3U92 A;  1LBY A;  2OZZ A;  4L17 A;  2AIX A;  2I48 A;  2Q89 A;  5BUU A;  1LBW A;  3R6U A;  2I0C A;  3T66 A;  4NF4 A;  5A5X B;  3PU5 A;  1O63 A;  1NNT A;  4G68 A;  5DVF A;  3FXQ A;  3S4U A;  2Z8E A;  1MXX A;  5I59 A;  4LA9 A;  1B6H A;  5TP9 B;  4H5G A;  3SET A;  4PGN A;  5ITP A;  4G68 C;  3PMW A;  4EXK A;  4C0R A;  4TQU Q;  2F7B A;  1PB9 A;  3ODB A;  3M3L A;  1IMB A;  3TAJ A;  3MVZ A;  1XT8 A;  1BTJ A;  3K4U A;  1B4Z A;  3BBR A;  3OXN A;  2FHY A;  4LVQ A;  4KYS A;  2O1M A;  3TTR A;  3CG1 A;  1XC1 A;  2XXV A;  4R2F A;  1M5B A;  4I8C A;  2QVU A;  2WYK A;  4JBZ A;  4QXD A;  2O68 A;  1KA0 A;  4PE3 A;  3OD7 A;  3U72 A;  1MY0 A;  1A54 A;  1USY E;  3FAS A;  3K02 A;  4GVO A;  4UAB A;  4FBP A;  2LAO A;  1OQG A;  3H03 A;  5JTY B;  1SI0 A;  1B52 A;  3O28 A;  4IY5 A;  1UQW A;  4NAP A;  4H5F A;  4YAH X;  1EZO A;  2XWK A;  1NV1 A;  4HE1 A;  1BIY A;  1I6Q A;  2F34 A;  2WEF A;  3MVY A;  5TP9 A;  4AS4 A;  1IZ1 A;  2FYI A;  4PFB A;  1SDX A;  3N5L A;  5DW8 A;  1A55 A;  1D9Y A;  3HHG A;  2CMO A;  4NED A;  1PC3 A;  4IY6 A;  2F6P A;  4OET A;  5EQA A;  2I6E A;  4QRZ A;  3G3K A;  5HM4 B;  3I6V A;  5CC2 A;  3WAF A;  1Y20 A;  4OQO A;  3VDF A;  1QUI A;  5FTI A;  3RN8 A;  4DIG A;  3JYR A;  2DS9 A;  3FUZ A;  4GX4 A;  4IGT A;  5AA4 B;  5H8N B;  3MYU A;  2O84 X;  1P99 A;  4N8G A;  3V83 A;  3TCH A;  3Q28 A;  1JEV A;  2VP1 A;  4PFI A;  3K6X A;  1QW0 A;  4ESX A;  1LBV A;  3T9H B;  2F7C A;  3PUY E;  5M2V A;  4AQ4 A;  2DP8 A;  4BDL A;  1PB8 A;  3EF7 A;  2ONK E;  2Q8J A;  4U1Z A;  2HZK A;  4GWY A;  1B32 A;  1ELJ A;  3FV1 A;  1R9Q A;  4PET A;  1H3D A;  1I69 A;  5A5L A;  3C36 A;  1AOV A;  3KFM A;  4HCW A;  2X7Q A;  4XTC Q;  3LR1 A;  1Y3P A;  5FHN A;  4F2O A;  3V8X B;  5B7D A;  4I9D A;  4PF6 A;  1FBH A;  1TFD A;  3B6Q A;  5AA2 D;  4MIJ A;  4DXB A;  5IKB A;  2RF1 A;  4TLL B;  3TUS A;  4BDN A;  2B4L A;  3L6G A;  1NI9 A;  2F78 A;  5CBR A;  3K0V A;  5EYH A;  4F22 A;  3EHT A;  2THI A;  2XX9 A;  4ELQ A;  1NUX A;  1QGX A;  1NH8 A;  2DWJ A;  2I4B A;  1MS7 A;  1SYH A;  4GX3 A;  2PVU A;  1Y4C A;  2FA7 A;  1B7U A;  1P1U A;  3WAE A;  1DPP A;  4E0X A;  2QS2 A;  3KGC A;  1Y9U A;  5AA2 B;  5I56 B;  3H6T A;  1B1X A;  1MY3 A;  3E3K A;  3FVO A;  1O7T A;  2QMW A;  4QSE A;  4PBQ A;  4U4X A;  1NNK A;  3ONM A;  4HE2 A;  5I2K A;  3VLW A;  5I58 A;  1JVY A;  3E79 A;  1UIV A;  2ONS A;  1IMF A;  1LAX A;  1LEV A;  3U65 A;  5IZ3 A;  5LTC A;  3T96 B;  4EDP A;  4BDR A;  2Y7I A;  1NMU A;  4DXC A;  1MQI A;  4LQ5 A;  2DE3 A;  2CZL A;  4ZEC A;  4XIG Q;  1D9V A;  4OEN A;  1EYJ A;  2Z8F A;  2ZYK A;  3FBP A;  3U1O A;  3CIJ A;  4LON B;  1QVS A;  4X1D A;  4H46 A;  1MDQ A;  4IO4 A;  3HCQ A;  4TOZ A;  4Z0I A;  3VVF A;  3OMB A;  4JVC A;  3TPA A;  2FIX A;  4I3Y A;  3R7X A;  3K6U A;  3IAZ A;  4P3L A;  1FRP A;  1I6A A;  5K2Y A;  1ZU0 A;  4N13 A;  3C34 A;  2HXR A;  3P7I A;  1N0T A;  3HPI A;  3TFL A;  1VR5 A;  2Q9T A;  2QS4 A;  4MAG A;  4P0G A;  4OAN A;  2H9B A;  1P1O A;  2GFE A;  2D3I A;  3FVK A;  3DP4 A;  4I1D A;  4X9T A;  3UN6 A;  1AH5 A;  3VVD A;  1Y1Z A;  1MQH A;  4F3G A;  4YKK A;  4Z7E A;  1IMC A;  2XXY A;  2UVI A;  3HO7 A;  4GRK A;  1URS A;  1FTM A;  3T9U A;  3KBR A;  2ABH A;  4XKR A;  2PMS A;  3N94 A;  2V3U A;  4POW A;  5DEX B;  4ISU A;  4RK2 A;  4BDQ A;  4ELO A;  3K1P A;  3W9V A;  3KBZ A;  1AIV A;  4P47 A;  2G93 A;  2DE2 A;  1FQE A;  1IMA A;  4FJP A;  4RNS A;  1A99 A;  1LST A;  3B7D A;  3SES A;  3FJG A;  1NV5 A;  1H44 A;  4GBV A;  3VE1 B;  1IUD A;  1B1H A;  3CFZ A;  2Y5L A;  5L8D A;  2L5V A;  3O6H A;  4PFT A;  1D9Q A;  5J16 A;  3QSL A;  4C1T A;  4U1O A;  3TEP A;  4H67 A;  2I3W A;  3LSX A;  4UA8 A;  1VFD A;  2KR0 A;  1MQG A;  2O7U A;  2VOZ A;  4FAT A;  1EYI A;  2AL5 A;  4GL8 A;  1GVC A;  1KA1 A;  3DP6 A;  1WVJ A;  1AWB A;  1OLC A;  1JNF A;  4MNP A;  2XXP A;  1NNP A;  3TKD A;  1CNQ A;  1B7Z A;  1MH3 A;  4G4P A;  1ZIU A;  1IXH A;  2PFZ A;  4OFL A;  2V25 A;  3IX1 A;  3M8U A;  4OVJ A;  5CMB A;  1DK4 A;  1FQA A;  3O97 A;  4N81 A;  4R9G A;  3TZA A;  2H25 A;  4ZZA A;  4QBA A;  4EUO A;  4IO7 A;  5IZZ A;  3IK6 B;  1MG1 A;  3FXU A;  3LUY A;  4POX A;  3OO8 A;  3SER A;  1JW1 A;  4GL0 A;  3KZG A;  1MPC A;  1NV4 A;  3Q26 A;  1EU8 A;  2GH9 A;  3EN3 A;  3T22 A;  4F1U A;  2VD3 A;  5IM2 A;  2GQ1 A;  4N8Y A;  3HST A;  3TCF A;  1JW5 A;  3PD8 A;  3OEM A;  3VXB A;  4MF3 A;  1MPD A;  2PYY A;  3N6T A;  3FIR A;  3T93 B;  4H65 A;  4PQJ A;  4ZDM A;  1DMB A;  4NX1 A;  1IIT A;  1B46 A;  4QFL A;  3MP1 A;  4YB7 A;  3MVX A;  3UK4 A;  4GWZ A;  1ZKB A;  1M5C A;  4LZ5 A;  3DEL B;  4NF5 B;  1DTG A;  2F3B A;  3PPO A;  4OEV A;  4PFW A;  2R71 A;  1OVB A;  4OFO A;  1WDN A;  4NF6 A;  5H8H B;  1Z7M E;  1FW0 A;  3KN7 A;  2FIE A;  2DOJ A;  1AMF A;  2WX9 A;  2W7Y A;  3S2V A;  5IAI A;  2HPG A;  1BLF A;  3MJN A;  4IB2 A;  5DT6 A;  4DI4 B;  1A7L A;  3RNN A;  1UTH A;  2G29 A;  1UTB A;  2H98 A;  5KCJ B;  2UYF A;  2XXX A;  3H6W A;  1HSE A;  1D3K A;  2FBP A;  4U4S A;  1B2H A;  2DXR A;  4GQO A;  4N6P A;  4OVQ A;  5JK4 A;  4RPN A;  4DI3 D;  1FQF A;  3MAM A;  2VT5 A;  4AB5 A;  1L5T A;  1M5E A;  3H6V A;  3HHF A;  2VPO A;  3AXF A;  4LN5 A;  1ANF A;  3O9P A;  2F5X A;  1RYO A;  4NGU A;  5EQ7 A;  1MY2 A;  3CSG A;  4IO2 A;  4ZED A;  2H5Y A;  3UGW A;  4MLQ A;  2E1S A;  1NV2 A;  3PUZ E;  3E78 A;  1LBB A;  3C35 A;  3QYT A;  3MUQ A;  5ESY A;  4XKN A;  2HZL A;  4YB6 A;  3KOT A;  4PFY A;  4U21 A;  2QS1 A;  3IOR A;  5DYH A;  4KHZ E;  5EYG A;  1XI6 A;  5CMC A;  1S9T A;  5I2N A;  2QVR A;  4ELR A;  4F1V A;  1D4N A;  5IGA A;  4N91 A;  5H8Q A;  3TTL A;  1N04 A;  3H4Z A;  3FV2 A;  4G8H A;  2A5S A;  2AL4 A;  4H8J A;  4WKM A;  5L9M A;  4ND9 A;  1SYI A;  4OMB A;  4M1V A;  5CRY A;  5F7V A;  4THI A;  3TTM A;  1R1N A;  2Y7W A;  3TQW A;  4QFP A;  3LC8 A;  4O3C A;  1YTV A;  3VFJ A;  2XX8 A;  2NWJ A;  4H0W A;  3LSL A;  2ZYM A;  4DLD A;  4ZEB A;  3ISP A;  3RLF E;  1CB6 A;  4OER A;  1IXG A;  3TYH A;  5A5X A;  3ZKL A;  2R8T A;  2QL3 A;  1QUJ A;  4OVT A;  4UAC A;  1TXF A;  2Q8M A;  3SEU A;  5L9S A;  2H4I A;  2Z22 A;  5DTB A;  5I84 A;  4RPO A;  1PDA A;  3O2A A;  2ONR A;  2BJJ X;  2UVJ A;  5I57 B;  4ZEF A;  1IQ7 A;  4PF8 A;  5K2X A;  1B3G A;  1NV3 A;  1DSN A;  2Y84 A;  4O3A A;  3C33 A;  3T9V A;  3PD9 A;  3MVW A;  1FBE A;  4KXP A;  4N17 A;  3A3U A;  3VLV A;  1LFG A;  4KR5 A;  3G3J A;  1LBX A;  4OWD A;  3IO6 A;  4GXA A;  1M5D A;  1CE2 A;  1MPB A;  5CMK A;  2X26 A;  3IB0 A;  3IFC A;  1FQD A;  2HFB A;  1IXC A;  1P1Q A;  3IJX B;  3C31 A;  1B3F A;  2WBD A;  1MH4 A;  4O7M A;  5KZT A;  4X8R A;  4XEQ A;  1SW2 A;  1EZ9 A;  1Q1K A;  4NE4 A;  2Y7K A;  4M4G A;  3TQL A;  4ELP A;  3PUW E;  1FPE A;  2E0S A;  2XHD A;  4JWX A;  4R6Y A;  2A5T B;  1NH7 A;  2DDK A;  5JTY A;  4ZEK A;  4GWW A;  2XD2 A;  4F1Y A;  3R26 A;  2QMX A;  3CSB A;  3MZB A;  2F3D A;  2R9J A;  4QSD A;  2M8C A;  1FPB A;  4RY1 A;  1N3X A;  3MP8 A;  3B50 A;  3EQ1 A;  1MY1 A;  3E13 X;  5ICT A;  1NV6 A;  2NXO A;  4N6K A;  4PGP A;  4LZ8 A;  4QFN A;  1YXI A;  5H8F B;  1B5I A;  2RC8 A;  4JSO A;  5ET6 A;  5ICQ A;  3KEI A;  4FE8 A;  4RJZ A;  3MP6 A;  4EQ7 A;  5ISU A;  4IO3 A;  3OO6 A;  3B6W A;  4FEC A;  3G3F A;  3SZP A;  2QFL A;  4OHN A;  3OSQ A;  1YCJ A;  1II5 A;  4GFR A;  2XXT A;  3IOU A;  1LBC A;  3RT6 B;  5EHM A;  3VLU A;  4MMP A;  1GR2 A;  4H8I A;  4PC9 A;  2CZK A;  3RPL B;  3H6U A;  2V93 A;  3B6T A;  1XS5 A;  5H8N A;  5AA4 A;  1XVY A;  4RYA A;  3IFA A;  1P1N A;  4XXU A;  5BWJ A;  1I6B A;  1Y3Q A;  1AL3 A;  5EQ9 A;  3FXB A;  2XXR A;  2RCB A;  4NWD A;  4YKP A;  2O7I A;  1OLA A;  1Q35 A;  3W9W A;  1SPI A;  4GLI A;  3LUZ A;  4K3F A;  2PX1 A;  4YKI A;  1FJ9 A;  2V84 A;  1IEJ A;  1BK4 A;  2GHA A;  1MXW A;  2OCU A;  2O1L A;  1PEB A;  5EQ8 A;  1MXV A;  3TDJ A;  3JV9 A;  1JQF A;  2XXQ A;  4YU0 A;  1DOT A;  2DXY A;  3IJO B;  4NTL A;  2MKZ A;  2NUV A;  1P1W A;  3ZS6 A;  1GTK A;  2ZYN A;  3D1R A;  1B9J A;  3CFX A;  3THI A;  1LGB C;  2OK2 A;  1MRP A;  3GXA A;  1POT A;  1US5 A;  4GIZ A;  4ESW A;  3A3C A;  1FPI A;  2QSX A;  2HCA A;  4EXL A;  3K2D A;  1VSO A;  1LLS A;  3IOV A;  3KC0 A;  1NV7 A;  3I5O A;  4R75 A;  4LP2 B;  5ET5 A;  3RPL A;  1GGG A;  4PCD A;  2P3V A;  4MNC A;  4P1E A;  4YIC A;  3QUJ A;  3CR9 A;  1JET A;  1ZJL A;  1RDZ A;  4HE0 A;  4PE5 B;  2PBW A;  1SW5 A;  4I3E A;  4NF0 A;  2V3T A;  2BJI A;  2Q88 A;  2Y7P A;  1NKX A;  3Q25 A;  4R74 A;  3S9M C;  3D4C A;  4YMB A;  4MCO A;  2ZZW A;  5AA2 A;  3M3F A;  5I56 A;  1YZ0 A;  1B5H A;  1FBG A;  5DVI A;  2CEY A;  5HPQ A;  3RPW A; 
#chains in the Genus database with same CATH homology
 2ANJ A;  3IO4 A;  3LSW A;  2O6A A;  2H99 A;  3A09 A;  3K1M A;  2KLF A;  3OOA A;  2ZNU A;  5CBS A;  2DE4 A;  1A8F A;  2RC7 A;  4JDF A;  2UYE A;  2VD2 A;  1SVX B;  1PBQ A;  1B5J A;  3MPL A;  3MZ1 A;  1ZTY A;  3PPP A;  2DVC A;  1LFI A;  2PT2 A;  1URG A;  3M3K A;  4DXU A;  1DTZ A;  4DDD A;  2YPN A;  2XXH A;  2RCA A;  1MXZ A;  3TCG A;  4OTE A;  4U22 A;  1MM6 A;  3EHS A;  2OLB A;  4MLV A;  2NVU B;  4YMA A;  3K6W A;  4KD5 A;  2F36 A;  1QKA A;  1SW4 A;  4P0I A;  3CRB A;  3KG2 A;  3MBP A;  1TWY A;  2DVZ A;  4X48 A;  1ZBM A;  4JB7 A;  3PMV A;  4HTG A;  1B3L A;  1LCT A;  3HN0 A;  2P2A A;  1FTK A;  3LSF B;  2HAU A;  5DEX A;  3Q29 A;  2D5W A;  1SBP A;  3FVN A;  3QIM A;  4G8N A;  2R6G E;  3SEY A;  3OEN A;  1B0L A;  3G3H A;  3Q27 A;  1N84 A;  4JWO A;  1MXY A;  2IA4 A;  2D21 A;  5J1D A;  1MXU A;  4E0W A;  2X7P A;  4NF4 B;  2F97 A;  1FTO A;  4HW8 A;  4G68 B;  2OWS A;  3G3I A;  4QHQ A;  5I59 B;  4PP0 A;  4O3B A;  4ONY A;  2GRV A;  4HS7 A;  5ITO A;  2I3V A;  3GZG A;  1N7W A;  4F2Q A;  2P0S A;  3FVG A;  3PPN A;  3BFT A;  3OO7 A;  4GXS B;  4U23 A;  2Q2A A;  1BKA A;  1DPE A;  4QSC A;  1B51 A;  4BDO A;  4ZZE A;  4FAJ A;  1H76 A;  4F3S A;  2UVH A;  1UIU A;  1NL5 A;  5DVJ A;  2RC9 A;  3H06 B;  3TTN A;  3FAT A;  2F8D A;  2OJT A;  4LQ2 A;  2P1S A;  1TT1 A;  4IO6 A;  3SDF A;  4F18 A;  3K01 A;  3DLN A;  2ZNT A;  4YZZ A;  1NNF A;  4G77 A;  3OEK A;  3S9N C;  5CMM A;  3RY3 A;  1TFA A;  5KDT B;  3V5A A;  5ELV A;  3CI8 A;  4GWO A;  1N3W A;  4ZS9 A;  3U93 A;  1O64 A;  4FIM A;  3CVG A;  3RGY A;  1QUL A;  3W15 C;  5CM6 A;  4NF5 A;  3IOW A;  3MC2 A;  1Y1M A;  3CFL A;  5H8H A;  3ILU B;  2DSF A;  3KN3 A;  2B65 A;  1EH3 A;  5FTH A;  3MW0 A;  4YB5 A;  4R6K A;  5CI5 A;  3JZJ A;  5JEI A;  3MQ9 A;  1A40 A;  4X1B A;  3GBA A;  1OQH A;  5KCJ A;  4RXL A;  1B3E A;  2Q2C A;  1LAG E;  1US4 A;  3E9X A;  1WOD A;  3BKI B;  4RA1 A;  4QFO A;  4EQ9 A;  2UVG A;  2ZYO A;  2DWA A;  2FNC A;  3SEV A;  1B3H A;  4F3B A;  1HSJ A;  3UIF A;  4FED A;  5L9O A;  3TOD A;  4YKJ A;  4NF8 B;  1FQC A;  4R72 A;  4KCC A;  3PUX E;  4P11 A;  3G7W A;  4MFI A;  3ZKK A;  1VE4 A;  1MQD A;  4EQB A;  3H3G A;  5KDT A;  4LAT A;  1S7Y A;  2XXU A;  4NWC A;  4ZE9 A;  4H6D A;  1SQY A;  3RTF B;  3H7M A;  1J1N A;  5AA1 A;  1SD3 A;  3DP8 A;  4HCY A;  3TTK A;  2F7A A;  4KYD A;  2I0B A;  3IR1 A;  3OO9 A;  3C32 A;  4R9F A;  2I58 A;  3TMG A;  1IXI A;  2RIN A;  4OES A;  5TU0 A;  4F29 A;  3O29 A;  3MPK A;  3PMX A;  1B0H A;  4KYE A;  3E4R A;  2UXA A;  4Q0C A;  3N26 A;  4Q5T A;  3VXC A;  2IEE A;  3QK6 A;  4FOR A;  4I62 A;  2QJE A;  2AYS A;  3U94 A;  1B7H A;  1SW1 A;  3QUF A;  5HBC A;  3GBB A;  2Z8D A;  4GD5 A;  3MWB A;  3F11 A;  4WXJ A;  1R9L A;  1B4H A;  1XOC A;  1HSL A;  4ZEI A;  3KN8 A;  4EF2 A;  5AE4 A;  4NF8 A;  4JWY A;  4OZ9 A;  5I57 A;  1PBP A;  2ZNS A;  3RUM A;  3FZV A;  4Q30 B;  2OWT A;  5F1Q A;  5I2K B;  2Z23 A;  3KJ7 A;  5I58 B;  1LAF E;  3KSJ A;  4FEB A;  3FJ7 A;  4G2Z A;  4C1U A;  1SI1 A;  1KWH A;  2I4C A;  4OEU A;  3GLB A;  2B3F A;  3K6V A;  3USD A;  1JEU A;  5FHO A;  3T9X B;  2V3Q A;  3QXM A;  5EHS A;  1PB7 A;  2DWI A;  1T0K A;  3UOR A;  3N6U A;  3C9H A;  1POY 1;  2A5T A;  1Y4T A;  4XKP A;  3OSR A;  4JXI A;  4R2B A;  3FXR A;  2GHB A;  3ZSF A;  4GOT A;  2Y7R A;  3SEX A;  1FTJ A;  4N07 A;  4G8M A;  4QF9 A;  5H8F A;  2ZXT A;  1Z7N E;  3LBS A;  1LFH A;  2XD3 A;  1MDP 1;  4U2R A;  1N76 A;  3EHU A;  3IB1 A;  1H43 A;  3KOS A;  3PGF A;  1QKB A;  4KQP A;  2REJ A;  4JSD A;  3SEW A;  4F39 A;  2HAV A;  3QAX A;  3ECR A;  2QPQ A;  2ALU A;  3CG3 A;  1USY H;  3RQT A;  4AB6 A;  1MQJ A;  4DCY A;  3KSX A;  4EF1 A;  5LOM A;  2HEU A;  1YAE A;  3SKP A;  3OEL A;  4Q8R A;  1H45 A;  3BFU A;  3IB2 A;  2HXW A;  4DE8 A;  4BLA A;  2ESN A;  1XVX A;  3MZ9 A;  3RTW B;  1IIW A;  4ECF A;  5EYF A;  3PPQ A;  2RKM A;  3FD3 A;  3DM0 A;  1LCF A;  3PUV E;  4ZE8 A;  5B70 A;  3O6G A;  2VHA A;  1MM7 A;  1LB9 A;  2I49 A;  2B3B A;  1FQB A;  2O69 A;  4GF8 A;  4KPT A;  1YPN A;  5H8S A;  2VGQ A;  1LAH E;  4OFJ A;  4R73 A;  3IL1 B;  3IOT A;  2XXI A;  2ZMB A;  4MH5 A;  1N7X A;  2YJP A;  2PT1 A;  3U8Q A;  4RK9 A;  3O66 A;  3K1N A;  4OYV A;  3FJM A;  2QRY A;  4KI0 E;  2OBG A;  5TPA B;  4QFK A;  3S9L C;  4LZ7 A;  2REG A;  1RKM A;  5AA3 A;  2DWH A;  4WEP A;  2NOO A;  3PV0 E;  3G3G A;  4NF6 B;  3RT8 A;  1Y3N A;  1FCK A;  1F9B A;  1EZP A;  3HV1 A;  4F3P A;  1BP5 A;  3TEL A;  1ZLQ A;  2XXW A;  3L6H A;  2WKY A;  4DCX A;  1LB8 A;  1GV8 A;  4TLM B;  1UTH B;  1UTB B;  1URD A;  2F35 A;  4KFQ A;  4KCD A;  4XKQ A;  1M5F A;  1ZMG A;  1B05 A;  4PFU A;  3FGS A;  3VV5 A;  4LUB A;  1JW4 A;  4H1X A;  1XHY A;  4BDM A;  1VFE A;  4WED A;  1OVT A;  2DYX A;  3KJT A;  4IO5 A;  1NFT A;  3I3V A;  4IGR A;  3UP9 A;  5FHM A;  5TPA A;  3VVE A;  2HQ0 A;  1MY4 A;  3S9E A;  3UA8 A;  4R6H A;  1ATG A;  1QJM A;  1FTL A;  2O51 A;  1RYX A;  4MBP A;  5I2N B;  3ILT B;  1R6Z A;  1B40 A;  5H8Q B;  1OMP A;  3C4M A;  4F31 B;  1B58 A;  3V89 B;  2QS3 A;  3EPE A;  1S50 A;  4OXV A;  2F6G A;  3K00 A;  1QUK A;  4F19 A;  3PPR A;  2YLN A;  1A8E A;  2DQV A;  4NMY A;  4DZ1 A;  3D4G A;  3O6I A;  2XX7 A;  1OIB A;  1JVX A;  3U92 A;  2OZZ A;  4L17 A;  2AIX A;  2I48 A;  2Q89 A;  5BUU A;  3R6U A;  2I0C A;  3T66 A;  4NF4 A;  5A5X B;  3PU5 A;  1O63 A;  1NNT A;  4G68 A;  5DVF A;  3FXQ A;  3S4U A;  2Z8E A;  1MXX A;  5I59 A;  4LA9 A;  1B6H A;  5TP9 B;  4H5G A;  3SET A;  5ITP A;  4G68 C;  3PMW A;  4EXK A;  4C0R A;  4TQU Q;  2F7B A;  1PB9 A;  3ODB A;  3M3L A;  3TAJ A;  3MVZ A;  1XT8 A;  1BTJ A;  3K4U A;  1B4Z A;  3BBR A;  3OXN A;  4LVQ A;  4KYS A;  2O1M A;  3TTR A;  3CG1 A;  1XC1 A;  2XXV A;  4R2F A;  1M5B A;  4I8C A;  4JBZ A;  2O68 A;  3OD7 A;  3U72 A;  1MY0 A;  1A54 A;  1USY E;  3FAS A;  3K02 A;  4GVO A;  2LAO A;  1OQG A;  3H03 A;  5JTY B;  1SI0 A;  1B52 A;  3O28 A;  4IY5 A;  1UQW A;  4H5F A;  4YAH X;  1EZO A;  1BIY A;  1I6Q A;  2F34 A;  5TP9 A;  3MVY A;  1IZ1 A;  2FYI A;  1SDX A;  3N5L A;  1A55 A;  1D9Y A;  3HHG A;  2CMO A;  4NED A;  1PC3 A;  4IY6 A;  2F6P A;  4OET A;  2I6E A;  4QRZ A;  3G3K A;  5HM4 B;  3I6V A;  5CC2 A;  3WAF A;  1Y20 A;  4OQO A;  3VDF A;  1QUI A;  5FTI A;  3RN8 A;  4DIG A;  3JYR A;  2DS9 A;  3FUZ A;  4IGT A;  5AA4 B;  5H8N B;  2O84 X;  1P99 A;  3V83 A;  3TCH A;  3Q28 A;  1JEV A;  2VP1 A;  3K6X A;  1QW0 A;  4ESX A;  3T9H B;  2F7C A;  3PUY E;  5M2V A;  4AQ4 A;  2DP8 A;  4BDL A;  1PB8 A;  3EF7 A;  2ONK E;  2Q8J A;  4U1Z A;  2HZK A;  1B32 A;  1ELJ A;  3FV1 A;  1R9Q A;  4PET A;  1H3D A;  1I69 A;  3C36 A;  1AOV A;  3KFM A;  4HCW A;  2X7Q A;  4XTC Q;  3LR1 A;  1Y3P A;  5FHN A;  4F2O A;  3V8X B;  5B7D A;  4I9D A;  1TFD A;  3B6Q A;  5AA2 D;  4DXB A;  5IKB A;  2RF1 A;  4TLL B;  3TUS A;  4BDN A;  3L6G A;  2F78 A;  5CBR A;  3K0V A;  4F22 A;  3EHT A;  2THI A;  2XX9 A;  4ELQ A;  1NH8 A;  2DWJ A;  2I4B A;  1MS7 A;  1SYH A;  2PVU A;  1Y4C A;  2FA7 A;  1B7U A;  1P1U A;  3WAE A;  1DPP A;  4E0X A;  2QS2 A;  3KGC A;  1Y9U A;  5AA2 B;  5I56 B;  3H6T A;  1B1X A;  1MY3 A;  3E3K A;  3FVO A;  1O7T A;  2QMW A;  4QSE A;  4U4X A;  1NNK A;  3ONM A;  5I2K A;  3VLW A;  5I58 A;  1JVY A;  1UIV A;  2ONS A;  1LAX A;  3T96 B;  4EDP A;  4BDR A;  2Y7I A;  1NMU A;  4DXC A;  1MQI A;  4LQ5 A;  2DE3 A;  2CZL A;  4ZEC A;  4XIG Q;  1D9V A;  4OEN A;  2Z8F A;  2ZYK A;  3U1O A;  3CIJ A;  4LON B;  1QVS A;  4X1D A;  1MDQ A;  4IO4 A;  3HCQ A;  4TOZ A;  4Z0I A;  3VVF A;  3OMB A;  3TPA A;  3R7X A;  3K6U A;  3IAZ A;  1I6A A;  5K2Y A;  1ZU0 A;  4N13 A;  3C34 A;  3P7I A;  1N0T A;  3HPI A;  3TFL A;  1VR5 A;  2Q9T A;  2QS4 A;  4P0G A;  2H9B A;  1P1O A;  2GFE A;  2D3I A;  3FVK A;  3DP4 A;  4I1D A;  4X9T A;  3UN6 A;  1AH5 A;  3VVD A;  1Y1Z A;  1MQH A;  4F3G A;  4YKK A;  4Z7E A;  2XXY A;  2UVI A;  3HO7 A;  4GRK A;  1URS A;  1FTM A;  3T9U A;  3KBR A;  2ABH A;  4XKR A;  2PMS A;  3N94 A;  2V3U A;  4POW A;  5DEX B;  4ISU A;  4RK2 A;  4BDQ A;  4ELO A;  3K1P A;  3W9V A;  1AIV A;  2G93 A;  2DE2 A;  1FQE A;  4FJP A;  4RNS A;  1A99 A;  1LST A;  3B7D A;  3SES A;  3FJG A;  1H44 A;  3VE1 B;  1IUD A;  1B1H A;  3CFZ A;  5L8D A;  3O6H A;  4PFT A;  3QSL A;  4C1T A;  4U1O A;  3TEP A;  4H67 A;  2I3W A;  3LSX A;  4UA8 A;  1VFD A;  1MQG A;  2O7U A;  2VOZ A;  4FAT A;  2AL5 A;  4GL8 A;  1GVC A;  3DP6 A;  1WVJ A;  1OLC A;  1JNF A;  2XXP A;  1NNP A;  3TKD A;  1B7Z A;  1MH3 A;  4G4P A;  1ZIU A;  1IXH A;  4OFL A;  2V25 A;  3IX1 A;  3M8U A;  4OVJ A;  5CMB A;  1FQA A;  3O97 A;  4R9G A;  3TZA A;  2H25 A;  4ZZA A;  4EUO A;  4IO7 A;  3IK6 B;  1MG1 A;  3FXU A;  3LUY A;  4POX A;  3OO8 A;  3SER A;  1JW1 A;  4GL0 A;  3KZG A;  1MPC A;  3Q26 A;  1EU8 A;  2GH9 A;  3EN3 A;  3T22 A;  4F1U A;  2VD3 A;  3HST A;  3TCF A;  1JW5 A;  3PD8 A;  3OEM A;  3VXB A;  4MF3 A;  1MPD A;  2PYY A;  3N6T A;  3FIR A;  3T93 B;  4H65 A;  4PQJ A;  4ZDM A;  1DMB A;  1IIT A;  1B46 A;  4QFL A;  3MP1 A;  4YB7 A;  3MVX A;  3UK4 A;  1ZKB A;  1M5C A;  4LZ5 A;  3DEL B;  4NF5 B;  1DTG A;  3PPO A;  4OEV A;  4PFW A;  2R71 A;  1OVB A;  4OFO A;  1WDN A;  4NF6 A;  5H8H B;  1Z7M E;  1FW0 A;  3KN7 A;  2DOJ A;  1AMF A;  2W7Y A;  3S2V A;  5IAI A;  1BLF A;  3MJN A;  4IB2 A;  5DT6 A;  1A7L A;  3RNN A;  1UTH A;  2G29 A;  1UTB A;  2H98 A;  5KCJ B;  2UYF A;  2XXX A;  3H6W A;  1HSE A;  1D3K A;  4U4S A;  1B2H A;  2DXR A;  4GQO A;  4N6P A;  5JK4 A;  4RPN A;  1FQF A;  3MAM A;  4AB5 A;  1L5T A;  1M5E A;  3H6V A;  3HHF A;  3AXF A;  1ANF A;  3O9P A;  2F5X A;  1RYO A;  1MY2 A;  3CSG A;  4IO2 A;  4ZED A;  2H5Y A;  3UGW A;  4MLQ A;  2E1S A;  3PUZ E;  1LBB A;  3C35 A;  3QYT A;  3MUQ A;  4XKN A;  2HZL A;  4YB6 A;  3KOT A;  4PFY A;  4U21 A;  2QS1 A;  3IOR A;  5DYH A;  4KHZ E;  5CMC A;  1S9T A;  5I2N A;  4ELR A;  4F1V A;  1D4N A;  5H8Q A;  3TTL A;  1N04 A;  3H4Z A;  3FV2 A;  4G8H A;  2A5S A;  2AL4 A;  4H8J A;  4WKM A;  5L9M A;  4ND9 A;  1SYI A;  4OMB A;  4M1V A;  5CRY A;  5F7V A;  4THI A;  3TTM A;  1R1N A;  2Y7W A;  3TQW A;  4QFP A;  3LC8 A;  4O3C A;  1YTV A;  3VFJ A;  2XX8 A;  2NWJ A;  4H0W A;  3LSL A;  2ZYM A;  4DLD A;  4ZEB A;  3RLF E;  1CB6 A;  4OER A;  1IXG A;  3TYH A;  5A5X A;  3ZKL A;  2QL3 A;  1QUJ A;  4UAC A;  1TXF A;  3SEU A;  5L9S A;  2H4I A;  2Z22 A;  5DTB A;  5I84 A;  4RPO A;  1PDA A;  3O2A A;  2ONR A;  2BJJ X;  2UVJ A;  5I57 B;  4ZEF A;  1IQ7 A;  5K2X A;  1B3G A;  1DSN A;  2Y84 A;  4O3A A;  3C33 A;  3T9V A;  3PD9 A;  3MVW A;  3A3U A;  3VLV A;  1LFG A;  4KR5 A;  3G3J A;  4OWD A;  3IO6 A;  4GXA A;  1M5D A;  1CE2 A;  1MPB A;  5CMK A;  2X26 A;  3IB0 A;  1FQD A;  2HFB A;  1IXC A;  1P1Q A;  3IJX B;  3C31 A;  1B3F A;  1MH4 A;  5KZT A;  1SW2 A;  1EZ9 A;  1Q1K A;  4NE4 A;  2Y7K A;  4M4G A;  3TQL A;  4ELP A;  3PUW E;  2E0S A;  2XHD A;  4JWX A;  4R6Y A;  2A5T B;  1NH7 A;  5JTY A;  4ZEK A;  2XD2 A;  4F1Y A;  3R26 A;  2QMX A;  3CSB A;  3MZB A;  2R9J A;  4QSD A;  2M8C A;  4RY1 A;  1N3X A;  3MP8 A;  3EQ1 A;  1MY1 A;  3E13 X;  5ICT A;  2NXO A;  4LZ8 A;  4QFN A;  5H8F B;  1B5I A;  2RC8 A;  4JSO A;  5ICQ A;  3KEI A;  4FE8 A;  4RJZ A;  3MP6 A;  4EQ7 A;  5ISU A;  4IO3 A;  3OO6 A;  3B6W A;  4FEC A;  3G3F A;  4OHN A;  3OSQ A;  1YCJ A;  1II5 A;  4GFR A;  2XXT A;  3IOU A;  1LBC A;  3RT6 B;  5EHM A;  3VLU A;  1GR2 A;  4H8I A;  3H6U A;  2V93 A;  3B6T A;  1XS5 A;  5H8N A;  5AA4 A;  1XVY A;  4RYA A;  1P1N A;  4XXU A;  5BWJ A;  1I6B A;  1Y3Q A;  1AL3 A;  2XXR A;  2RCB A;  4NWD A;  4YKP A;  2O7I A;  1OLA A;  1Q35 A;  3W9W A;  4GLI A;  4K3F A;  2PX1 A;  4YKI A;  2V84 A;  1IEJ A;  2GHA A;  1MXW A;  2OCU A;  2O1L A;  1PEB A;  1MXV A;  3TDJ A;  3JV9 A;  1JQF A;  2XXQ A;  4YU0 A;  1DOT A;  2DXY A;  3IJO B;  4NTL A;  2NUV A;  1P1W A;  3ZS6 A;  1GTK A;  2ZYN A;  1B9J A;  3CFX A;  3THI A;  1LGB C;  2OK2 A;  1MRP A;  3GXA A;  1POT A;  1US5 A;  4GIZ A;  4ESW A;  3A3C A;  2QSX A;  2HCA A;  4EXL A;  3K2D A;  1VSO A;  1LLS A;  3IOV A;  3I5O A;  4R75 A;  4LP2 B;  1GGG A;  4YIC A;  3QUJ A;  3CR9 A;  1JET A;  1ZJL A;  4PE5 B;  2PBW A;  1SW5 A;  2V3T A;  2Q88 A;  2Y7P A;  1NKX A;  3Q25 A;  4R74 A;  3S9M C;  3D4C A;  4YMB A;  5AA2 A;  3M3F A;  5I56 A;  1B5H A;  5DVI A;  5HPQ A;  3RPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...