4MNPA

Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. nucleatum atcc 25586
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
305
structure length
305
Chain Sequence
KYNLKMGMTAGTSQNEYKAAEVFAKELKKRSNGEIELKLYPNAQLGKDDLAMMQQLEGGALDFTFAETGRFSTFFPEAEVFTLPYMIKDFNHMKKAVNTKFGKDLFKKVHDKKGMTVLAQAYNGTRQTTSNKAIKSLADMKGMKLRVPGAAANLAYAKYTEAAPTPMAFSEVYLALQTNAVDGQENPLSTIKAQKFYEVQKYLAMTNHILNDQLYLVSNITMEELPENLQKVVKESAEVAAEYHTKLFMDEEKSLKDFFKSKGVTITEPNLVDFKKAMKPFYDEYIKKNGKVGENAIKAIEAVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate-binding protein
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Fusobacterium nucleatum subsp. nucleatum
molecule tags Sugar binding protein
total genus 114
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mnpA00
2ZZXA 2HZLA 4OVQA 4PGPA 4PE3A 2ZZVA 4PF6A 4OANA 2CEXA 4XF5A 4OA4A 4N15A 4NG7A 2PFYA 4PFRA 4PFIA 2WYKA 4MMPA 5I7IA 4X04A 4N91A 4XEQA 4MNCA 4MNIA 4O7MA 2HPGA 4MHFA 2V4CA 2XWKA 4PCDA 4OVPA 4O8MA 2XWOA 2XA5A 4NGUA 4OVSA 4PAFA 4NHBA 2XXKA 4PETA 4LN5A 2WX9A 4MX6A 4MCOA 4NX1A 2HZKA 4MNPA 4MAGA 4NAPA 4PDHA 4OVRA 4P1LA 4P9KA 4MIJA 4PF8A 2VPOA 4N17A 4N4UA 4YICA 4X8RA 4P3LA 2XWIA 4PAIA 4PC9A 2WYPA 4NF0A 5CM6A 4O94A 4PBHA 4OVTA 5IGAA 2CEYA 4UABA 4N6DA 4MEVA 4PDDA 5IZZA 4PAKA 4PGNA 2VPNA 4DI3D 5I5PA 4PFBA 5LTCA 4P47A 2ZZWA 4NN3A 4N8GA 4XFEA 2XWVA 4P1EA 4YZZA 3GYYA 3U65A 4DI4B 4P8BA 4N8YA 2PFZA 3B50A 4N6KA 4P56A 4NQ8A 5IM2A 4PBQA 3FXBA
chains in the Genus database with same CATH superfamily
2V93A 3VXCA 4BDOA 4IO4A 4YB7A 2FYIA 4RA1A 5KCJB 4RK2A 3UK4A 5CC2A 3B6QA 3KOSA 4JBZA 4FATA 4Z7EA 3AXFA 4YKIA 1P1NA 1IXGA 2QS3A 4O8MA 1N84A 4F1UA 1NNFA 4NF8A 2PMSA 4PETA 4LN5A 2OX3A 2B65A 3T96B 4MCOA 3IOWA 4R75A 4GX4A 1XVXA 1MH4A 2RC8A 4IO6A 2Y7WA 4BLAA 5AA3A 5HM4B 4LZ5A 1Y4TA 1FBDA 3BBRA 1Y20A 1LCFA 1N04A 3A3CA 5H8NA 1NUZA 5T3JA 1JEUA 3MVXA 1XVYA 2P2AA 2DWHA 1MS7A 4PFUA 4ELQA 1QVSA 3MC2A 1FBHA 3U65A 2XXUA 5IZ3B 1US5A 5CMCA 3HCQA 4NF5A 4ZDMA 2YLNA 3FJMA 4ZE8A 4U23A 5K2YA 4RPOA 2ZMBA 4HTGA 3TFLA 4XF5A 5JTYA 4KHZE 1S50A 1S9TA 4M4GA 1FPKA 4NG7A 5EQ8A 1MDQA 1USYE 4ND9A 2GFEA 4OXVA 5I58A 4RY1A 4O7IA 2DE4A 4U1ZA 2F97A 1NV4A 5I3SA 4JVIA 2G29A 3T9VA 4MLVA 2XA5A 5JK4A 1BLFA 1OVTA 1UTHB 3N6TA 4AB6A 4KCCA 4OZ9A 5F7VA 4G61A 3TTLA 2HZKA 5H8FA 3TEPA 4R6YA 1JVYA 1NUWA 1QUKA 3SKPA 1LLSA 1QKBA 4JWXA 3C34A 4NF8B 3SDFA 1JEVA 3MPKA 1NV0A 3MVWA 2O6AA 1B52A 5I56A 2R71A 3VLUA 2PX1A 3ZSFA 1YAEA 2RINA 4DI3D 5I5PA 4G68B 3TELA 4NN3A 3SEVA 3IFAA 4OTEA 1QGXA 1VR5A 3EF7A 3MWBA 4KD5A 4QRZA 1POTA 4P0GA 1MM6A 4POXA 5TPAA 3C32A 1QUJA 2HAUA 3R6UA 4OEUA 1PBQA 3FBPA 1MPDA 3T1BA 5ESYA 1ZLQA 1B9JA 4Q30B 4KCDA 5CMKA 1Z7ME 2Y7KA 1OVBA 2X7PA 1B7HA 1HSEA 3TCHA 4I40A 1IMBA 1BIYA 1RDXA 2XX9A 1N7XA 3QUFA 1Y4CA 2XXIA 4I1DA 1IQ7A 3TUSA 1R6ZA 2ABHA 4F22A 4N07A 2F5XA 1LBWA 4F2QA 2XWKA 1D3KA 1MQGA 5DTBA 2KR0A 4H0WA 1VFEA 4I8CA 4PFWA 1XS5A 1NV3A 2DXRA 4MAGA 1B5IA 2WEFA 4R9GA 4O3AA 3TTMA 2Q2AA 1AWBA 4YKKA 4EQ9A 4ZE9A 3RPLA 5EHMA 4PBHA 3BKIB 4OVTA 3TKDA 5IGAA 1FBEA 4Q0CA 1OLAA 3K1MA 4MJOA 4PFBA 4QBAA 2A5SA 4OMBA 1XC1A 2O7IA 1B46A 3G3GA 2VGQA 3CSBA 1Y1ZA 5IM2A 1MY2A 3UIFA 3H6TA 3LR1A 2KQZA 1FQAA 3MQ9A 4ZEDA 3U93A 1TXFA 3P7IA 2F3DA 2ONSA 2OWSA 3TTRA 3UN6A 2CMOA 3ZKKA 4MH5A 4E0WA 3SEYA 3V8XB 1IUDA 4O7MA 2H25A 5J16A 2V4CA 1N7WA 3IORA 5I2NA 1VSOA 4OFJA 1WODA 4H1XA 3MZBA 2O1MA 1ANFA 1I6QA 4NHBA 3FV1A 3H4ZA 1NUXA 3GZGA 4GX6A 2FA7A 3PUYE 1A8EA 1Y9UA 4BDNA 3O97A 3GBBA 3SESA 1PEBA 1LFGA 2XX7A 1NNPA 2VD3A 4DXUA 2WYPA 2DYXA 5AE4A 2Q9TA 3C31A 1FRPA 3CRBA 2KLFA 4OEVA 1EZ9A 2H98A 2XXPA 1LGBC 2PBWA 5B70A 1EH3A 2Z23A 4OFOA 1IXCA 1IIWA 1FSAA 3HO7A 4NWDA 1B1HA 3K1NA 4N8GA 1MY1A 5ITPA 1A8FA 2RKMA 4U4SA 1SQYA 3T9HB 4HE0A 1P1UA 3Q26A 5KZTA 1FBFA 1LAXA 4M1VA 4NQ8A 4FIMA 1CE2A 3KBRA 1AOVA 3RQTA 4R9FA 4GBWA 3LSWA 3IK6B 1FTLA 1B6HA 3FV2A 2FIXA 3M8UA 4PGPA 1Y1MA 2ZZVA 1JW1A 4U22A 2F7AA 4UA8A 1OMPA 3MP8A 3KGCA 2X7QA 3OEMA 3SETA 3C4MA 4PFTA 5KCJA 3E78A 2PFYA 2WYKA 2DS9A 4MMPA 1I6AA 1IZ1A 2DWAA 1II5A 2AYSA 2XXHA 1RYOA 3FZVA 3I3VA 4GL8A 3KSXA 2A5TA 1H3DA 1MQDA 2DWJA 2XD2A 3OELA 3TODA 1IMAA 5DT6A 1ZBMA 3IJXB 2Y7PA 4ZECA 4ELPA 1IXHA 1DOTA 5EYHA 3S9MC 4OESA 1D9YA 4LONB 2PT1A 1NV7A 4NE4A 3HHFA 1JNFA 3K02A 1M5EA 1SVXB 1NI9A 4YICA 1NMUA 3C35A 3USDA 4ECFA 4HE1A 2XX8A 2DOJA 1R9LA 3E4RA 1FQDA 4IO2A 1PBPA 5DYHA 3UA8A 3IB2A 4MEVA 3KEIA 1EZPA 5EQ7A 2F6PA 4FJPA 4GRKA 3OO6A 4OYVA 3FVNA 1B4HA 3K6WA 5I57B 4RYAA 4H5FA 2OJTA 4IB2A 5LDZA 5DVJA 2I6EA 4N8YA 4ELOA 3L6HA 3TTNA 1EYKA 4G8NA 5IZ3A 2DDKA 5TP9B 3SEXA 1EYJA 2HXWA 4IO7A 2M8CA 3CHGA 1Y3PA 2PYYA 3QAXA 3I5OA 4YKJA 4OANA 2CEXA 2WKYA 2FHYA 3RT8A 4NTLA 2FNCA 1VE4A 4JDFA 4R73A 1Q1KA 4F3BA 1N3WA 2XXTA 4ZS9A 3Q27A 3PMVA 1LSTA 4FEDA 3KN3A 2P3VA 4X04A 2XXVA 4GWZA 4QFOA 1I69A 3PPPA 3B6TA 3IO4A 2WBBA 2B3BA 4H65A 4U1OA 4JWYA 2Q8JA 3JYRA 2Y5LA 2VP1A 3G3JA 2Y7RA 1UTHA 2R8TA 3W9WA 3QYTA 3SEWA 1DSNA 3FVGA 4OVRA 2DP8A 4TOZA 1XOCA 2A5TB 1ATGA 1ZKBA 2OCUA 2VD2A 5JEIA 2ZYOA 3O2AA 4OFLA 3U72A 1BTJA 1SD3A 4PQJA 3MUQA 3RTWB 4N6DA 2Q8MA 3T0JA 1GGGA 3IL1B 2RCAA 4C0RA 2H4IA 3IOUA 1SI1A 3MW0A 2ESNA 4IO5A 2P3NA 4G68A 4IR8A 3BIHA 3SEUA 2XWVA 4EDPA 1B7ZA 3MJNA 1B5JA 1Z7NE 4BDLA 3KC1A 4GLIA 4U21A 2NVUB 2GQ1A 5KDTB 4GXSB 4PBQA 3PV0E 1FTOA 4QFNA 2O7UA 2PT2A 2QPQA 1MDP1 3A3UA 4MBPA 3T22A 4PE3A 1N0TA 1OLCA 4G8MA 3CG1A 4U2RA 4YKPA 4Q8RA 3QSLA 3U1OA 4QXDA 1MXXA 1TFDA 3KN7A 2ZYKA 4KI0E 1M5FA 1KA1A 2NUVA 3TMGA 2FBPA 2ANJA 4RPNA 4R2BA 1A7LA 1AH5A 1PDAA 2O68A 5CRYA 4F1YA 1FQBA 3U94A 4MF3A 1G0HA 4TLMB 1FTKA 5A5LA 1KWHA 4RXLA 2XXWA 4GWXA 2XXKA 4THIA 2NXOA 3LV0A 4GWOA 1AL3A 3K6XA 3M3FA 2ONRA 4PF8A 1JETA 5ET7A 3OO9A 4X8RA 2F34A 2R6GE 4EQBA 3MP1A 1MPCA 5I59B 2LAOA 3MVYA 4EQ7A 2F8DA 1LAFE 5IZZA 4N13A 4GFRA 1IXIA 3IX1A 4PAKA 3L6GA 3WAEA 1UTBB 2THIA 2Y84A 3Q28A 4GWUA 1Q9DA 1FJ9A 4QSCA 4ISUA 3FD3A 4NF6B 3RY3A 2GHAA 2NWJA 2R9JA 2VHAA 4E0XA 1FPJA 4GOTA 3OO8A 1FPLA 4HCWA 1H76A 3U92A 3OSRA 4F2OA 4AB5A 4QFLA 3RLFE 4IO3A 1BKAA 4NWCA 4N6PA 1MY3A 3SZPA 2QVVA 3D1RA 4OA4A 4XKNA 4GWWA 3VLVA 1B05A 4KYDA 1CNQA 5ET8A 1LCTA 4F3PA 4R6KA 4JSOA 4XKPA 4FEBA 3O6IA 1SW5A 1KA0A 2HPGA 3FXQA 5ISUA 3OOAA 5F1QA 1YTVA 2HHMA 4OVSA 4ZZAA 3CFZA 1WVJA 3ONMA 1MXVA 2WX9A 1AIVA 2Z22A 4ZEKA 3GLBA 1MXZA 3UORA 3TAJA 2UYEA 3BFTA 4DXBA 1M5BA 4P9KA 3O28A 5DVIA 3U8QA 2I4BA 4ZZEA 1QJMA 3C33A 2F35A 2XXXA 1LBYA 3OEKA 4QFKA 2Q88A 3K6UA 4KYSA 5ICQA 2DVCA 4OERA 4UABA 4NEDA 1NL5A 3G3KA 3G3HA 2D5WA 3A09A 3PPNA 5EHSA 1LBCA 2H99A 3Q29A 3RYDA 3VDFA 5F24A 2QS1A 3FGSA 1SBPA 1MXWA 1LFIA 4P47A 3H06B 4IY6A 3UGWA 2P0SA 3ZKLA 2CZKA 4P1EA 4LUBA 1LBXA 1MQJA 3H03A 3HSTA 3MYUA 3DM0A 1F9BA 5EQ9A 2OZZA 4DI4B 3K6VA 3IOTA 1ZTYA 3T9XB 2OWTA 1MM7A 1PB7A 2DWIA 5BWJA 3SERA 1YXIA 4HW8A 2UYFA 1DPPA 3PGFA 1INPA 5J1DA 2Q74A 4PF6A 5EQAA 4GF8A 3PD8A 2RCBA 4Z0IA 2H5YA 3ODBA 4OHNA 3GBAA 3KZGA 2DE2A 2HEUA 1FCKA 1NUYA 2QFLA 3EN3A 5IZ1A 3MVZA 1DPEA 3HV1A 4XIGQ 2IEEA 1N3XA 2F3BA 1XHYA 4H8JA 1URDA 3RGYA 4H45A 4AS4A 1D9QA 3O9PA 1QUIA 1K9ZA 4R74A 4MIJA 4DLDA 4QSEA 3PUZE 1B2HA 3ILUB 4U4XA 1LBBA 4QF9A 4G8HA 4EF2A 2I0CA 2Y5KA 1R9QA 4JVDA 1URGA 3VVDA 3B6WA 5FHOA 2QVRA 1DMBA 3CG3A 3S2VA 2GHBA 3RNNA 2E1SA 1SPIA 5CI5A 3CR9A 3PUXE 2HCAA 3F11A 1S7YA 3G3IA 2XD3A 1MY0A 1SW2A 2CZHA 2YJPA 1PB9A 4X1DA 5I57A 3I6VA 3LUYA 3ILTB 4KQPA 1PC3A 3GXAA 1NFTA 2B3FA 3PPOA 4G2ZA 3O6HA 1Y3QA 4YMBA 1J1NA 4KXPA 5CBSA 2UVIA 5TP9A 2P1SA 5HBCA 1K9YA 3TYHA 1FTAA 4ESWA 2X26A 3CVGA 4OETA 1FPEA 2V3TA 5FBPA 1POY1 3K01A 1IMFA 5ET6A 4I9DA 4OQOA 5H8SA 2I4CA 4C1UA 1KZ8A 2XXYA 1A55A 1NV2A 2BJJX 1EZOA 3HHGA 1USYH 1NNKA 4MHFA 3PPQA 3UP9A 4LQ2A 4OVPA 3G7WA 5IKBA 4JXIA 4UACA 3WAFA 4I62A 2XXQA 1MRPA 3JV9A 4HS7A 4PP0A 3NOHA 2Z8EA 2GRVA 3PMWA 3O66A 1HSJA 3KJTA 1O64A 1B40A 4EXLA 1NV1A 1B3LA 1QKAA 1NKXA 4GIZA 2MKZA 3O6GA 4DZ1A 4QFPA 3EKIA 1HSLA 4H8IA 2ONKE 3H6UA 3KJ7A 3OSQA 1MQHA 1NNTA 1SYIA 1RKMA 4MFIA 3K4UA 4FE8A 1QULA 1FJ6A 5H8QB 4KPTA 1BK4A 4OWDA 3K0VA 2F78A 4ONYA 5KDTA 3FXBA 3MAMA 4YB5A 2AIXA 4MLQA 2OBGA 3PU5A 1IMEA 1MXUA 1XI6A 2QSXA 2REGA 1DBZA 1EYIA 4RK9A 2RC9A 1JP4A 4PFRA 1B5HA 1H45A 3S4UA 1OQHA 1B7UA 4IY5A 1LEVA 4P11A 1JQFA 4QHQA 1JW4A 2O84X 2ZYNA 1DK4A 1YZ0A 1VFDA 2AL4A 3TQLA 1MY4A 2WBDA 5DVFA 4KYEA 2HXRA 1FTMA 4NAPA 3DP8A 2QJEA 3V89B 1O63A 2NOOA 1LB9A 4N4UA 4EF1A 5K2XA 4GQOA 3IR1A 4DCXA 1GR2A 3OO7A 3FJ7A 5FHMA 2PCRA 1O7TA 5I59A 1B3GA 5IAIA 1SW1A 4WEDA 1N76A 2DSFA 1LAHE 1A40A 3LSXA 4JB7A 2OLBA 3PTYA 4ZEIA 2Q2CA 2VPNA 3TCGA 1UTBA 2O1LA 4G4PA 4IGTA 3KSJA 2ZZWA 3PPRA 4BDMA 4YZZA 1M5DA 1B32A 4P8BA 4F3GA 5L9SA 4RJZA 4NF6A 3B50A 5AA4B 2D21A 2ZZXA 5I84A 5H8HB 2F36A 1ZMGA 4P0IA 5L9OA 4XXUA 1FPIA 4GBVA 3VV5A 4YAHX 5FTIA 4N91A 4XEQA 1RYXA 3PUVE 4PCDA 3FUZA 4LVQA 5AA2D 5DEXB 3JZJA 4BDRA 5CBRA 2ZNTA 3OD7A 4F1VA 3RN8A 1FPDA 1NV5A 2QS4A 2ZXTA 3N5LA 4X48A 4ESXA 4FAJA 1B3EA 3IJOB 5L9MA 1UIVA 5AA2B 3PMXA 5I2KB 1MG1A 2H9BA 3MPLA 4P3LA 3MBPA 2OWZA 4LP2B 4O94A 4JVCA 4NF4B 3S9LC 4BDQA 1URSA 3QMFA 3S9EA 3FXRA 5LTCA 1EU8A 1MPBA 2QRYA 4ELRA 4XTCQ 4OENA 5DW8A 1SYHA 3N6UA 1BP5A 2PFZA 4G68C 4PFYA 3CI8A 3E3KA 1P1WA 3LSLA 3N26A 4P56A 2ZYMA 5FTHA 3ZS6A 4O3CA 1ZIUA 1DTZA 2O69A 5A5XA 3DP4A 1UIUA 3HN0A 1M5CA 3TCFA 4N15A 1AMFA 2I49A 1D4NA 3KFMA 3TPAA 2I3VA 4F19A 4POWA 4R2FA 3KBZA 3VE1B 1IITA 2V84A 1IMCA 4R6HA 1H43A 3OXNA 4GL0A 4MNIA 1B3FA 3PUWE 3IFCA 4QSDA 4NGUA 1FTJA 1GTKA 3N94A 4LZ8A 5L8DA 3KC0A 4MX6A 4ZEFA 1CB6A 3G3FA 4NX1A 4K3FA 2O51A 4GD5A 3EHSA 4WEPA 2DQVA 5ET5A 3DELB 5AA1A 4P1LA 4RNSA 3DLNA 2E0SA 3QIMA 1L5TA 1TWYA 3CIJA 3R26A 3C36A 2HAVA 4F3SA 1NH8A 5H8NB 1FW0A 1RDZA 3RTFB 2F6GA 2FIEA 3H6WA 1YPNA 2DXYA 1MH3A 3LSFB 1FBGA 1B51A 2ZNUA 1WDNA 4HCYA 3H6VA 3GYYA 3TTKA 4NF5B 3C9HA 3D4CA 3CFXA 3HPIA 4N6KA 2OK2A 2REJA 3T93B 1RDYA 2QS2A 2Q89A 4H5GA 4LZ7A 5EYGA 3MZ1A 1FQEA 4JWOA 5JTYB 2QMWA 2VOZA 4YMAA 5I58B 2I3WA 1NH7A 1H44A 1LB8A 4LATA 3D4GA 4PFIA 4KFQA 5I7IA 2F7BA 4KR5A 4MNCA 4DIGA 2I0BA 1P1QA 4C1TA 5A5XB 3K1PA 3VLWA 4DXCA 2RC7A 3H7MA 3RUMA 3V5AA 5H8FB 2QVUA 5ELVA 4L17A 2JJKA 2YPNA 1FPGA 3FATA 2W7YA 4N17A 4TLLB 4YU0A 3E79A 3OMBA 2UVHA 2V25A 4NF0A 3IOVA 3LUZA 4PE5B 1LBVA 3W15C 2CZLA 3ECRA 3E13X 4F18A 2Y7IA 3FXUA 3IO6A 5I56B 1FBPA 1B1XA 5B7DA 3MSTA 4EUOA 3IB0A 1B58A 2ZNSA 4GWSA 5FHNA 4XFEA 1UQWA 3FASA 4XKRA 1Y3NA 5ICTA 1OIBA 3THIA 2V3QA 5TPAB 3RPWA 2AL5A 4FECA 3ISPA 5H8QA 4HXVA 4I3YA 4H6DA 4LA9A 1ZU0A 1P1OA 1YYZA 4PTKA 3ROJA 1B3HA 4F29A 2HZLA 3M3KA 3OENA 3Q25A 3K2DA 3LBSA 1IEJA 1FQCA 2ALUA 5ITOA 1DCUA 3VVFA 3B8BA 1B4ZA 1D9VA 3MZ9A 3KN8A 3EHTA 1OQGA 4DCYA 3V83A 2DVZA 2IA4A 2XWOA 2PVUA 2BJIA 4PAFA 3KOTA 3K00A 1GV8A 1SDXA 1FQFA 1FPBA 1T0KA 2B4LA 2UVGA 3BIGA 3T66A 4AS5A 1LAGE 3HFUA 5EYFA 3TDJA 5CMMA 4PDHA 1P99A 3T9UA 4F31B 4AQ4A 3RPLB 4I3EA 2QMXA 5TU0A 5CM6A 4G77A 4JSDA 1I6BA 1B0HA 1US4A 2CEYA 2CZIA 2HFBA 1LBZA 1DTGA 4H67A 3FJGA 3B7DA 1LFHA 2XHDA 2RF1A 4O3BA 2Z8FA 4N81A 5HPQA 1Q35A 3EQ1A 1R1NA 4H46A 3VFJA 1YCJA 3W9VA 3BFUA 1IMDA 1ZJLA 3QK6A 2DE3A 1FPFA 5CMBA 3CFLA 1A99A 2GH9A 1JW5A 1SI0A 4DE8A 5AA4A 3FVOA 3PD9A 4OVJA 3FIRA 3E9XA 2UXAA 4GWYA 3S9NC 3KG2A 4OVQA 4X9TA 4IGRA 1NV6A 1SW4A 4HE2A 5H8HA 1VDWA 1PB8A 1TFAA 3O29A 4R72A 2G93A 4YB6A 3H3GA 1XT8A 5I2NB 3LC8A 4WKMA 3VVEA 2L5VA 5DEXA 2I58A 5BUUA 3EHUA 4Q5TA 1A54A 1QW0A 3MP6A 4NMYA 3A29A 3CSGA 4WXJA 4MNPA 4DDDA 1G0IA 3IB1A 1B0LA 1FBCA 2UVJA 5AA2A 2V3UA 5I2KA 2VPOA 1MXYA 2XWIA 3R7XA 1MQIA 2I48A 4PAIA 4TQUQ 4PC9A 2B4MA 4GXAA 4EXKA 3FVKA 3QXMA 4GX3A 3TZAA 3TQWA 3IAZA 5M2VA 4NF4A 3RT6B 2VT5A 4PDDA 2FVZA 1ELJA 4PGNA 5LOMA 2Z8DA 4GVOA 4LQ5A 4F39A 3QUJA 4FBPA 2HQ0A 1GVCA 3M3LA 2D3IA 4ZEBA 3DP6A 1TT1A 4X1BA 3VXBA 2F7CA 2XXRA 2QL3A 4FORA 1JVXA 4XKQA 3EPEA
chains in the Genus database with same CATH topology
1YXIA 4GBWA 1INPA 2FIXA 5J1DA 4PGPA 2ZZVA 2Q74A 4PF6A 5EQAA 4N15A 3E78A 2PFYA 4F19A 2WYKA 4MMPA 3KBZA 1IMCA 4MNIA 3IFCA 2DE2A 1NUYA 4O8MA 2QFLA 4NGUA 5IZ1A 4F1UA 1IMAA 4PETA 4LN5A 2F3BA 3KC0A 4MX6A 2OX3A 4MCOA 5EYHA 4NX1A 4H45A 4AS4A 1D9QA 1NV7A 5ET5A 4GX4A 1K9ZA 4P1LA 4MIJA 1NI9A 4YICA 4HE1A 1FBDA 2Y5KA 4JVDA 1RDZA 2QVRA 4MEVA 1NUZA 5EQ7A 5T3JA 2FIEA 1SPIA 1FBGA 2CZHA 5LDZA 1FBHA 4HCYA 3GYYA 3U65A 4N8YA 5IZ3B 1EYKA 5IZ3A 4N6KA 2DDKA 4KXPA 1EYJA 3CHGA 1RDYA 1K9YA 1FTAA 5EYGA 1FPEA 4OANA 2CEXA 5FBPA 2FHYA 4XF5A 1IMFA 5ET6A 1FPKA 4NG7A 5EQ8A 1KZ8A 4PFIA 4O7IA 5I7IA 2DE4A 1NV2A 1NV4A 2P3VA 4X04A 4GWZA 5I3SA 4MNCA 4MHFA 4JVIA 2WBBA 4OVPA 2XA5A 5JK4A 2Y5LA 3NOHA 2R8TA 3W9WA 4G61A 2QVUA 2HZKA 2JJKA 1NUWA 4OVRA 1FPGA 1NV1A 4N17A 3E79A 2MKZA 4NF0A 3LUZA 3EKIA 1LBVA 4N6DA 2Q8MA 3T0JA 4F18A 1NV0A 1FBPA 3MSTA 4DI3D 5I5PA 2P3NA 4NN3A 4GWSA 3BIHA 4IR8A 3IFAA 4XFEA 1QGXA 2XWVA 3KC1A 1FJ6A 2V3QA 2GQ1A 1BK4A 3ISPA 4HXVA 4I3YA 4PBQA 3FBPA 4PTKA 1YYZA 3T1BA 3FXBA 3ROJA 2HZLA 5ESYA 2QPQA 4PE3A 4I40A 1IMBA 1IMEA 1RDXA 1DCUA 1XI6A 3B8BA 1DBZA 1EYIA 4QXDA 1JP4A 4PFRA 1KA1A 2F5XA 2FBPA 1LBWA 2DVZA 2XWKA 2XWOA 1G0HA 1LEVA 2KR0A 2BJIA 4PAFA 5A5LA 1FPBA 2B4LA 1DK4A 1YZ0A 2XXKA 4GWXA 3BIGA 2WBDA 1NV3A 4AS5A 3HFUA 3LV0A 2HXRA 4MAGA 4NAPA 4PDHA 2WEFA 4PF8A 4N4UA 5ET7A 4X8RA 3RPLB 1AWBA 4I3EA 3RPLA 5CM6A 4PBHA 4OVTA 5IGAA 2CEYA 2PCRA 2CZIA 1LBZA 1FBEA 5IZZA 4PAKA 3PTYA 2VPNA 4MJOA 4N81A 4PFBA 4QBAA 2ZZWA 4GWUA 1Q9DA 4YZZA 1FJ9A 4H46A 3W9VA 4P8BA 1IMDA 3B50A 2DE3A 1FPFA 5IM2A 1FPJA 1FPLA 4HCWA 2KQZA 2ZZXA 4GWYA 4OVQA 4X9TA 1NV6A 4HE2A 3SZPA 2QVVA 1VDWA 2F3DA 3D1RA 4OA4A 4GWWA 1FPIA 5ET8A 1CNQA 4GBVA 4N91A 4XEQA 4O7MA 1KA0A 2HPGA 5J16A 2V4CA 4PCDA 2HHMA 4OVSA 4NHBA 2L5VA 1NUXA 4GX6A 4F1VA 2WX9A 1FPDA 1NV5A 3A29A 4MNPA 1G0IA 1FBCA 4P9KA 2VPOA 4P3LA 2XWIA 4PAIA 1LBYA 4PC9A 2B4MA 2WYPA 2OWZA 4GX3A 4O94A 4JVCA 2Q9TA 1FRPA 4UABA 2VT5A 3QMFA 4PDDA 3RYDA 2FVZA 4PGNA 5F24A 1FSAA 4FBPA 5LTCA 4P47A 4N8GA 2CZKA 4P1EA 1LBXA 5DW8A 3MYUA 5EQ9A 4HE0A 4DI4B 2PFZA 1FBFA 4M1VA 4P56A 4NQ8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZZX A;  2HZL A;  4OVQ A;  4PGP A;  4PE3 A;  2ZZV A;  4PF6 A;  4OAN A;  2CEX A;  4XF5 A;  4OA4 A;  4N15 A;  4NG7 A;  2PFY A;  4PFR A;  4PFI A;  2WYK A;  4MMP A;  5I7I A;  4X04 A;  4N91 A;  4XEQ A;  4MNC A;  4MNI A;  4O7M A;  2HPG A;  4MHF A;  2V4C A;  2XWK A;  4PCD A;  4OVP A;  4O8M A;  2XWO A;  2XA5 A;  4NGU A;  4OVS A;  4PAF A;  4NHB A;  2XXK A;  4PET A;  4LN5 A;  2WX9 A;  4MX6 A;  4MCO A;  4NX1 A;  2HZK A;  4MNP A;  4MAG A;  4NAP A;  4PDH A;  4OVR A;  4P1L A;  4P9K A;  4MIJ A;  4PF8 A;  2VPO A;  4N17 A;  4N4U A;  4YIC A;  4X8R A;  4P3L A;  2XWI A;  4PAI A;  4PC9 A;  2WYP A;  4NF0 A;  5CM6 A;  4O94 A;  4PBH A;  4OVT A;  5IGA A;  2CEY A;  4UAB A;  4N6D A;  4MEV A;  4PDD A;  5IZZ A;  4PAK A;  4PGN A;  2VPN A;  4DI3 D;  5I5P A;  4PFB A;  5LTC A;  4P47 A;  2ZZW A;  4NN3 A;  4N8G A;  4XFE A;  2XWV A;  4P1E A;  4YZZ A;  3GYY A;  3U65 A;  4DI4 B;  4P8B A;  4N8Y A;  2PFZ A;  3B50 A;  4N6K A;  4P56 A;  4NQ8 A;  5IM2 A;  4PBQ A;  3FXB A; 
#chains in the Genus database with same CATH topology
 2V93 A;  3VXC A;  4BDO A;  4IO4 A;  4YB7 A;  2FYI A;  4RA1 A;  5KCJ B;  4RK2 A;  3UK4 A;  5CC2 A;  3B6Q A;  3KOS A;  4JBZ A;  4FAT A;  4Z7E A;  3AXF A;  4YKI A;  1P1N A;  1IXG A;  2QS3 A;  4O8M A;  1N84 A;  4F1U A;  1NNF A;  4NF8 A;  2PMS A;  4PET A;  4LN5 A;  2OX3 A;  2B65 A;  3T96 B;  4MCO A;  3IOW A;  4R75 A;  4GX4 A;  1XVX A;  1MH4 A;  2RC8 A;  4IO6 A;  2Y7W A;  4BLA A;  5AA3 A;  5HM4 B;  4LZ5 A;  1Y4T A;  1FBD A;  3BBR A;  1Y20 A;  1LCF A;  1N04 A;  3A3C A;  5H8N A;  1NUZ A;  5T3J A;  1JEU A;  3MVX A;  1XVY A;  2P2A A;  2DWH A;  1MS7 A;  4PFU A;  4ELQ A;  1QVS A;  3MC2 A;  1FBH A;  3U65 A;  2XXU A;  5IZ3 B;  1US5 A;  5CMC A;  3HCQ A;  4NF5 A;  4ZDM A;  2YLN A;  3FJM A;  4ZE8 A;  4U23 A;  5K2Y A;  4RPO A;  2ZMB A;  4HTG A;  3TFL A;  4XF5 A;  5JTY A;  4KHZ E;  1S50 A;  1S9T A;  4M4G A;  1FPK A;  4NG7 A;  5EQ8 A;  1MDQ A;  1USY E;  4ND9 A;  2GFE A;  4OXV A;  5I58 A;  4RY1 A;  4O7I A;  2DE4 A;  4U1Z A;  2F97 A;  1NV4 A;  5I3S A;  4JVI A;  2G29 A;  3T9V A;  4MLV A;  2XA5 A;  5JK4 A;  1BLF A;  1OVT A;  1UTH B;  3N6T A;  4AB6 A;  4KCC A;  4OZ9 A;  5F7V A;  4G61 A;  3TTL A;  2HZK A;  5H8F A;  3TEP A;  4R6Y A;  1JVY A;  1NUW A;  1QUK A;  3SKP A;  1LLS A;  1QKB A;  4JWX A;  3C34 A;  4NF8 B;  3SDF A;  1JEV A;  3MPK A;  1NV0 A;  3MVW A;  2O6A A;  1B52 A;  5I56 A;  2R71 A;  3VLU A;  2PX1 A;  3ZSF A;  1YAE A;  2RIN A;  4DI3 D;  5I5P A;  4G68 B;  3TEL A;  4NN3 A;  3SEV A;  3IFA A;  4OTE A;  1QGX A;  1VR5 A;  3EF7 A;  3MWB A;  4KD5 A;  4QRZ A;  1POT A;  4P0G A;  1MM6 A;  4POX A;  5TPA A;  3C32 A;  1QUJ A;  2HAU A;  3R6U A;  4OEU A;  1PBQ A;  3FBP A;  1MPD A;  3T1B A;  5ESY A;  1ZLQ A;  1B9J A;  4Q30 B;  4KCD A;  5CMK A;  1Z7M E;  2Y7K A;  1OVB A;  2X7P A;  1B7H A;  1HSE A;  3TCH A;  4I40 A;  1IMB A;  1BIY A;  1RDX A;  2XX9 A;  1N7X A;  3QUF A;  1Y4C A;  2XXI A;  4I1D A;  1IQ7 A;  3TUS A;  1R6Z A;  2ABH A;  4F22 A;  4N07 A;  2F5X A;  1LBW A;  4F2Q A;  2XWK A;  1D3K A;  1MQG A;  5DTB A;  2KR0 A;  4H0W A;  1VFE A;  4I8C A;  4PFW A;  1XS5 A;  1NV3 A;  2DXR A;  4MAG A;  1B5I A;  2WEF A;  4R9G A;  4O3A A;  3TTM A;  2Q2A A;  1AWB A;  4YKK A;  4EQ9 A;  4ZE9 A;  3RPL A;  5EHM A;  4PBH A;  3BKI B;  4OVT A;  3TKD A;  5IGA A;  1FBE A;  4Q0C A;  1OLA A;  3K1M A;  4MJO A;  4PFB A;  4QBA A;  2A5S A;  4OMB A;  1XC1 A;  2O7I A;  1B46 A;  3G3G A;  2VGQ A;  3CSB A;  1Y1Z A;  5IM2 A;  1MY2 A;  3UIF A;  3H6T A;  3LR1 A;  2KQZ A;  1FQA A;  3MQ9 A;  4ZED A;  3U93 A;  1TXF A;  3P7I A;  2F3D A;  2ONS A;  2OWS A;  3TTR A;  3UN6 A;  2CMO A;  3ZKK A;  4MH5 A;  4E0W A;  3SEY A;  3V8X B;  1IUD A;  4O7M A;  2H25 A;  5J16 A;  2V4C A;  1N7W A;  3IOR A;  5I2N A;  1VSO A;  4OFJ A;  1WOD A;  4H1X A;  3MZB A;  2O1M A;  1ANF A;  1I6Q A;  4NHB A;  3FV1 A;  3H4Z A;  1NUX A;  3GZG A;  4GX6 A;  2FA7 A;  3PUY E;  1A8E A;  1Y9U A;  4BDN A;  3O97 A;  3GBB A;  3SES A;  1PEB A;  1LFG A;  2XX7 A;  1NNP A;  2VD3 A;  4DXU A;  2WYP A;  2DYX A;  5AE4 A;  2Q9T A;  3C31 A;  1FRP A;  3CRB A;  2KLF A;  4OEV A;  1EZ9 A;  2H98 A;  2XXP A;  1LGB C;  2PBW A;  5B70 A;  1EH3 A;  2Z23 A;  4OFO A;  1IXC A;  1IIW A;  1FSA A;  3HO7 A;  4NWD A;  1B1H A;  3K1N A;  4N8G A;  1MY1 A;  5ITP A;  1A8F A;  2RKM A;  4U4S A;  1SQY A;  3T9H B;  4HE0 A;  1P1U A;  3Q26 A;  5KZT A;  1FBF A;  1LAX A;  4M1V A;  4NQ8 A;  4FIM A;  1CE2 A;  3KBR A;  1AOV A;  3RQT A;  4R9F A;  4GBW A;  3LSW A;  3IK6 B;  1FTL A;  1B6H A;  3FV2 A;  2FIX A;  3M8U A;  4PGP A;  1Y1M A;  2ZZV A;  1JW1 A;  4U22 A;  2F7A A;  4UA8 A;  1OMP A;  3MP8 A;  3KGC A;  2X7Q A;  3OEM A;  3SET A;  3C4M A;  4PFT A;  5KCJ A;  3E78 A;  2PFY A;  2WYK A;  2DS9 A;  4MMP A;  1I6A A;  1IZ1 A;  2DWA A;  1II5 A;  2AYS A;  2XXH A;  1RYO A;  3FZV A;  3I3V A;  4GL8 A;  3KSX A;  2A5T A;  1H3D A;  1MQD A;  2DWJ A;  2XD2 A;  3OEL A;  3TOD A;  1IMA A;  5DT6 A;  1ZBM A;  3IJX B;  2Y7P A;  4ZEC A;  4ELP A;  1IXH A;  1DOT A;  5EYH A;  3S9M C;  4OES A;  1D9Y A;  4LON B;  2PT1 A;  1NV7 A;  4NE4 A;  3HHF A;  1JNF A;  3K02 A;  1M5E A;  1SVX B;  1NI9 A;  4YIC A;  1NMU A;  3C35 A;  3USD A;  4ECF A;  4HE1 A;  2XX8 A;  2DOJ A;  1R9L A;  3E4R A;  1FQD A;  4IO2 A;  1PBP A;  5DYH A;  3UA8 A;  3IB2 A;  4MEV A;  3KEI A;  1EZP A;  5EQ7 A;  2F6P A;  4FJP A;  4GRK A;  3OO6 A;  4OYV A;  3FVN A;  1B4H A;  3K6W A;  5I57 B;  4RYA A;  4H5F A;  2OJT A;  4IB2 A;  5LDZ A;  5DVJ A;  2I6E A;  4N8Y A;  4ELO A;  3L6H A;  3TTN A;  1EYK A;  4G8N A;  5IZ3 A;  2DDK A;  5TP9 B;  3SEX A;  1EYJ A;  2HXW A;  4IO7 A;  2M8C A;  3CHG A;  1Y3P A;  2PYY A;  3QAX A;  3I5O A;  4YKJ A;  4OAN A;  2CEX A;  2WKY A;  2FHY A;  3RT8 A;  4NTL A;  2FNC A;  1VE4 A;  4JDF A;  4R73 A;  1Q1K A;  4F3B A;  1N3W A;  2XXT A;  4ZS9 A;  3Q27 A;  3PMV A;  1LST A;  4FED A;  3KN3 A;  2P3V A;  4X04 A;  2XXV A;  4GWZ A;  4QFO A;  1I69 A;  3PPP A;  3B6T A;  3IO4 A;  2WBB A;  2B3B A;  4H65 A;  4U1O A;  4JWY A;  2Q8J A;  3JYR A;  2Y5L A;  2VP1 A;  3G3J A;  2Y7R A;  1UTH A;  2R8T A;  3W9W A;  3QYT A;  3SEW A;  1DSN A;  3FVG A;  4OVR A;  2DP8 A;  4TOZ A;  1XOC A;  2A5T B;  1ATG A;  1ZKB A;  2OCU A;  2VD2 A;  5JEI A;  2ZYO A;  3O2A A;  4OFL A;  3U72 A;  1BTJ A;  1SD3 A;  4PQJ A;  3MUQ A;  3RTW B;  4N6D A;  2Q8M A;  3T0J A;  1GGG A;  3IL1 B;  2RCA A;  4C0R A;  2H4I A;  3IOU A;  1SI1 A;  3MW0 A;  2ESN A;  4IO5 A;  2P3N A;  4G68 A;  4IR8 A;  3BIH A;  3SEU A;  2XWV A;  4EDP A;  1B7Z A;  3MJN A;  1B5J A;  1Z7N E;  4BDL A;  3KC1 A;  4GLI A;  4U21 A;  2NVU B;  2GQ1 A;  5KDT B;  4GXS B;  4PBQ A;  3PV0 E;  1FTO A;  4QFN A;  2O7U A;  2PT2 A;  2QPQ A;  1MDP 1;  3A3U A;  4MBP A;  3T22 A;  4PE3 A;  1N0T A;  1OLC A;  4G8M A;  3CG1 A;  4U2R A;  4YKP A;  4Q8R A;  3QSL A;  3U1O A;  4QXD A;  1MXX A;  1TFD A;  3KN7 A;  2ZYK A;  4KI0 E;  1M5F A;  1KA1 A;  2NUV A;  3TMG A;  2FBP A;  2ANJ A;  4RPN A;  4R2B A;  1A7L A;  1AH5 A;  1PDA A;  2O68 A;  5CRY A;  4F1Y A;  1FQB A;  3U94 A;  4MF3 A;  1G0H A;  4TLM B;  1FTK A;  5A5L A;  1KWH A;  4RXL A;  2XXW A;  4GWX A;  2XXK A;  4THI A;  2NXO A;  3LV0 A;  4GWO A;  1AL3 A;  3K6X A;  3M3F A;  2ONR A;  4PF8 A;  1JET A;  5ET7 A;  3OO9 A;  4X8R A;  2F34 A;  2R6G E;  4EQB A;  3MP1 A;  1MPC A;  5I59 B;  2LAO A;  3MVY A;  4EQ7 A;  2F8D A;  1LAF E;  5IZZ A;  4N13 A;  4GFR A;  1IXI A;  3IX1 A;  4PAK A;  3L6G A;  3WAE A;  1UTB B;  2THI A;  2Y84 A;  3Q28 A;  4GWU A;  1Q9D A;  1FJ9 A;  4QSC A;  4ISU A;  3FD3 A;  4NF6 B;  3RY3 A;  2GHA A;  2NWJ A;  2R9J A;  2VHA A;  4E0X A;  1FPJ A;  4GOT A;  3OO8 A;  1FPL A;  4HCW A;  1H76 A;  3U92 A;  3OSR A;  4F2O A;  4AB5 A;  4QFL A;  3RLF E;  4IO3 A;  1BKA A;  4NWC A;  4N6P A;  1MY3 A;  3SZP A;  2QVV A;  3D1R A;  4OA4 A;  4XKN A;  4GWW A;  3VLV A;  1B05 A;  4KYD A;  1CNQ A;  5ET8 A;  1LCT A;  4F3P A;  4R6K A;  4JSO A;  4XKP A;  4FEB A;  3O6I A;  1SW5 A;  1KA0 A;  2HPG A;  3FXQ A;  5ISU A;  3OOA A;  5F1Q A;  1YTV A;  2HHM A;  4OVS A;  4ZZA A;  3CFZ A;  1WVJ A;  3ONM A;  1MXV A;  2WX9 A;  1AIV A;  2Z22 A;  4ZEK A;  3GLB A;  1MXZ A;  3UOR A;  3TAJ A;  2UYE A;  3BFT A;  4DXB A;  1M5B A;  4P9K A;  3O28 A;  5DVI A;  3U8Q A;  2I4B A;  4ZZE A;  1QJM A;  3C33 A;  2F35 A;  2XXX A;  1LBY A;  3OEK A;  4QFK A;  2Q88 A;  3K6U A;  4KYS A;  5ICQ A;  2DVC A;  4OER A;  4UAB A;  4NED A;  1NL5 A;  3G3K A;  3G3H A;  2D5W A;  3A09 A;  3PPN A;  5EHS A;  1LBC A;  2H99 A;  3Q29 A;  3RYD A;  3VDF A;  5F24 A;  2QS1 A;  3FGS A;  1SBP A;  1MXW A;  1LFI A;  4P47 A;  3H06 B;  4IY6 A;  3UGW A;  2P0S A;  3ZKL A;  2CZK A;  4P1E A;  4LUB A;  1LBX A;  1MQJ A;  3H03 A;  3HST A;  3MYU A;  3DM0 A;  1F9B A;  5EQ9 A;  2OZZ A;  4DI4 B;  3K6V A;  3IOT A;  1ZTY A;  3T9X B;  2OWT A;  1MM7 A;  1PB7 A;  2DWI A;  5BWJ A;  3SER A;  1YXI A;  4HW8 A;  2UYF A;  1DPP A;  3PGF A;  1INP A;  5J1D A;  2Q74 A;  4PF6 A;  5EQA A;  4GF8 A;  3PD8 A;  2RCB A;  4Z0I A;  2H5Y A;  3ODB A;  4OHN A;  3GBA A;  3KZG A;  2DE2 A;  2HEU A;  1FCK A;  1NUY A;  2QFL A;  3EN3 A;  5IZ1 A;  3MVZ A;  1DPE A;  3HV1 A;  4XIG Q;  2IEE A;  1N3X A;  2F3B A;  1XHY A;  4H8J A;  1URD A;  3RGY A;  4H45 A;  4AS4 A;  1D9Q A;  3O9P A;  1QUI A;  1K9Z A;  4R74 A;  4MIJ A;  4DLD A;  4QSE A;  3PUZ E;  1B2H A;  3ILU B;  4U4X A;  1LBB A;  4QF9 A;  4G8H A;  4EF2 A;  2I0C A;  2Y5K A;  1R9Q A;  4JVD A;  1URG A;  3VVD A;  3B6W A;  5FHO A;  2QVR A;  1DMB A;  3CG3 A;  3S2V A;  2GHB A;  3RNN A;  2E1S A;  1SPI A;  5CI5 A;  3CR9 A;  3PUX E;  2HCA A;  3F11 A;  1S7Y A;  3G3I A;  2XD3 A;  1MY0 A;  1SW2 A;  2CZH A;  2YJP A;  1PB9 A;  4X1D A;  5I57 A;  3I6V A;  3LUY A;  3ILT B;  4KQP A;  1PC3 A;  3GXA A;  1NFT A;  2B3F A;  3PPO A;  4G2Z A;  3O6H A;  1Y3Q A;  4YMB A;  1J1N A;  4KXP A;  5CBS A;  2UVI A;  5TP9 A;  2P1S A;  5HBC A;  1K9Y A;  3TYH A;  1FTA A;  4ESW A;  2X26 A;  3CVG A;  4OET A;  1FPE A;  2V3T A;  5FBP A;  1POY 1;  3K01 A;  1IMF A;  5ET6 A;  4I9D A;  4OQO A;  5H8S A;  2I4C A;  4C1U A;  1KZ8 A;  2XXY A;  1A55 A;  1NV2 A;  2BJJ X;  1EZO A;  3HHG A;  1USY H;  1NNK A;  4MHF A;  3PPQ A;  3UP9 A;  4LQ2 A;  4OVP A;  3G7W A;  5IKB A;  4JXI A;  4UAC A;  3WAF A;  4I62 A;  2XXQ A;  1MRP A;  3JV9 A;  4HS7 A;  4PP0 A;  3NOH A;  2Z8E A;  2GRV A;  3PMW A;  3O66 A;  1HSJ A;  3KJT A;  1O64 A;  1B40 A;  4EXL A;  1NV1 A;  1B3L A;  1QKA A;  1NKX A;  4GIZ A;  2MKZ A;  3O6G A;  4DZ1 A;  4QFP A;  3EKI A;  1HSL A;  4H8I A;  2ONK E;  3H6U A;  3KJ7 A;  3OSQ A;  1MQH A;  1NNT A;  1SYI A;  1RKM A;  4MFI A;  3K4U A;  4FE8 A;  1QUL A;  1FJ6 A;  5H8Q B;  4KPT A;  1BK4 A;  4OWD A;  3K0V A;  2F78 A;  4ONY A;  5KDT A;  3FXB A;  3MAM A;  4YB5 A;  2AIX A;  4MLQ A;  2OBG A;  3PU5 A;  1IME A;  1MXU A;  1XI6 A;  2QSX A;  2REG A;  1DBZ A;  1EYI A;  4RK9 A;  2RC9 A;  1JP4 A;  4PFR A;  1B5H A;  1H45 A;  3S4U A;  1OQH A;  1B7U A;  4IY5 A;  1LEV A;  4P11 A;  1JQF A;  4QHQ A;  1JW4 A;  2O84 X;  2ZYN A;  1DK4 A;  1YZ0 A;  1VFD A;  2AL4 A;  3TQL A;  1MY4 A;  2WBD A;  5DVF A;  4KYE A;  2HXR A;  1FTM A;  4NAP A;  3DP8 A;  2QJE A;  3V89 B;  1O63 A;  2NOO A;  1LB9 A;  4N4U A;  4EF1 A;  5K2X A;  4GQO A;  3IR1 A;  4DCX A;  1GR2 A;  3OO7 A;  3FJ7 A;  5FHM A;  2PCR A;  1O7T A;  5I59 A;  1B3G A;  5IAI A;  1SW1 A;  4WED A;  1N76 A;  2DSF A;  1LAH E;  1A40 A;  3LSX A;  4JB7 A;  2OLB A;  3PTY A;  4ZEI A;  2Q2C A;  2VPN A;  3TCG A;  1UTB A;  2O1L A;  4G4P A;  4IGT A;  3KSJ A;  2ZZW A;  3PPR A;  4BDM A;  4YZZ A;  1M5D A;  1B32 A;  4P8B A;  4F3G A;  5L9S A;  4RJZ A;  4NF6 A;  3B50 A;  5AA4 B;  2D21 A;  2ZZX A;  5I84 A;  5H8H B;  2F36 A;  1ZMG A;  4P0I A;  5L9O A;  4XXU A;  1FPI A;  4GBV A;  3VV5 A;  4YAH X;  5FTI A;  4N91 A;  4XEQ A;  1RYX A;  3PUV E;  4PCD A;  3FUZ A;  4LVQ A;  5AA2 D;  5DEX B;  3JZJ A;  4BDR A;  5CBR A;  2ZNT A;  3OD7 A;  4F1V A;  3RN8 A;  1FPD A;  1NV5 A;  2QS4 A;  2ZXT A;  3N5L A;  4X48 A;  4ESX A;  4FAJ A;  1B3E A;  3IJO B;  5L9M A;  1UIV A;  5AA2 B;  3PMX A;  5I2K B;  1MG1 A;  2H9B A;  3MPL A;  4P3L A;  3MBP A;  2OWZ A;  4LP2 B;  4O94 A;  4JVC A;  4NF4 B;  3S9L C;  4BDQ A;  1URS A;  3QMF A;  3S9E A;  3FXR A;  5LTC A;  1EU8 A;  1MPB A;  2QRY A;  4ELR A;  4XTC Q;  4OEN A;  5DW8 A;  1SYH A;  3N6U A;  1BP5 A;  2PFZ A;  4G68 C;  4PFY A;  3CI8 A;  3E3K A;  1P1W A;  3LSL A;  3N26 A;  4P56 A;  2ZYM A;  5FTH A;  3ZS6 A;  4O3C A;  1ZIU A;  1DTZ A;  2O69 A;  5A5X A;  3DP4 A;  1UIU A;  3HN0 A;  1M5C A;  3TCF A;  4N15 A;  1AMF A;  2I49 A;  1D4N A;  3KFM A;  3TPA A;  2I3V A;  4F19 A;  4POW A;  4R2F A;  3KBZ A;  3VE1 B;  1IIT A;  2V84 A;  1IMC A;  4R6H A;  1H43 A;  3OXN A;  4GL0 A;  4MNI A;  1B3F A;  3PUW E;  3IFC A;  4QSD A;  4NGU A;  1FTJ A;  1GTK A;  3N94 A;  4LZ8 A;  5L8D A;  3KC0 A;  4MX6 A;  4ZEF A;  1CB6 A;  3G3F A;  4NX1 A;  4K3F A;  2O51 A;  4GD5 A;  3EHS A;  4WEP A;  2DQV A;  5ET5 A;  3DEL B;  5AA1 A;  4P1L A;  4RNS A;  3DLN A;  2E0S A;  3QIM A;  1L5T A;  1TWY A;  3CIJ A;  3R26 A;  3C36 A;  2HAV A;  4F3S A;  1NH8 A;  5H8N B;  1FW0 A;  1RDZ A;  3RTF B;  2F6G A;  2FIE A;  3H6W A;  1YPN A;  2DXY A;  1MH3 A;  3LSF B;  1FBG A;  1B51 A;  2ZNU A;  1WDN A;  4HCY A;  3H6V A;  3GYY A;  3TTK A;  4NF5 B;  3C9H A;  3D4C A;  3CFX A;  3HPI A;  4N6K A;  2OK2 A;  2REJ A;  3T93 B;  1RDY A;  2QS2 A;  2Q89 A;  4H5G A;  4LZ7 A;  5EYG A;  3MZ1 A;  1FQE A;  4JWO A;  5JTY B;  2QMW A;  2VOZ A;  4YMA A;  5I58 B;  2I3W A;  1NH7 A;  1H44 A;  1LB8 A;  4LAT A;  3D4G A;  4PFI A;  4KFQ A;  5I7I A;  2F7B A;  4KR5 A;  4MNC A;  4DIG A;  2I0B A;  1P1Q A;  4C1T A;  5A5X B;  3K1P A;  3VLW A;  4DXC A;  2RC7 A;  3H7M A;  3RUM A;  3V5A A;  5H8F B;  2QVU A;  5ELV A;  4L17 A;  2JJK A;  2YPN A;  1FPG A;  3FAT A;  2W7Y A;  4N17 A;  4TLL B;  4YU0 A;  3E79 A;  3OMB A;  2UVH A;  2V25 A;  4NF0 A;  3IOV A;  3LUZ A;  4PE5 B;  1LBV A;  3W15 C;  2CZL A;  3ECR A;  3E13 X;  4F18 A;  2Y7I A;  3FXU A;  3IO6 A;  5I56 B;  1FBP A;  1B1X A;  5B7D A;  3MST A;  4EUO A;  3IB0 A;  1B58 A;  2ZNS A;  4GWS A;  5FHN A;  4XFE A;  1UQW A;  3FAS A;  4XKR A;  1Y3N A;  5ICT A;  1OIB A;  3THI A;  2V3Q A;  5TPA B;  3RPW A;  2AL5 A;  4FEC A;  3ISP A;  5H8Q A;  4HXV A;  4I3Y A;  4H6D A;  4LA9 A;  1ZU0 A;  1P1O A;  1YYZ A;  4PTK A;  3ROJ A;  1B3H A;  4F29 A;  2HZL A;  3M3K A;  3OEN A;  3Q25 A;  3K2D A;  3LBS A;  1IEJ A;  1FQC A;  2ALU A;  5ITO A;  1DCU A;  3VVF A;  3B8B A;  1B4Z A;  1D9V A;  3MZ9 A;  3KN8 A;  3EHT A;  1OQG A;  4DCY A;  3V83 A;  2DVZ A;  2IA4 A;  2XWO A;  2PVU A;  2BJI A;  4PAF A;  3KOT A;  3K00 A;  1GV8 A;  1SDX A;  1FQF A;  1FPB A;  1T0K A;  2B4L A;  2UVG A;  3BIG A;  3T66 A;  4AS5 A;  1LAG E;  3HFU A;  5EYF A;  3TDJ A;  5CMM A;  4PDH A;  1P99 A;  3T9U A;  4F31 B;  4AQ4 A;  3RPL B;  4I3E A;  2QMX A;  5TU0 A;  5CM6 A;  4G77 A;  4JSD A;  1I6B A;  1B0H A;  1US4 A;  2CEY A;  2CZI A;  2HFB A;  1LBZ A;  1DTG A;  4H67 A;  3FJG A;  3B7D A;  1LFH A;  2XHD A;  2RF1 A;  4O3B A;  2Z8F A;  4N81 A;  5HPQ A;  1Q35 A;  3EQ1 A;  1R1N A;  4H46 A;  3VFJ A;  1YCJ A;  3W9V A;  3BFU A;  1IMD A;  1ZJL A;  3QK6 A;  2DE3 A;  1FPF A;  5CMB A;  3CFL A;  1A99 A;  2GH9 A;  1JW5 A;  1SI0 A;  4DE8 A;  5AA4 A;  3FVO A;  3PD9 A;  4OVJ A;  3FIR A;  3E9X A;  2UXA A;  4GWY A;  3S9N C;  3KG2 A;  4OVQ A;  4X9T A;  4IGR A;  1NV6 A;  1SW4 A;  4HE2 A;  5H8H A;  1VDW A;  1PB8 A;  1TFA A;  3O29 A;  4R72 A;  2G93 A;  4YB6 A;  3H3G A;  1XT8 A;  5I2N B;  3LC8 A;  4WKM A;  3VVE A;  2L5V A;  5DEX A;  2I58 A;  5BUU A;  3EHU A;  4Q5T A;  1A54 A;  1QW0 A;  3MP6 A;  4NMY A;  3A29 A;  3CSG A;  4WXJ A;  4MNP A;  4DDD A;  1G0I A;  3IB1 A;  1B0L A;  1FBC A;  2UVJ A;  5AA2 A;  2V3U A;  5I2K A;  2VPO A;  1MXY A;  2XWI A;  3R7X A;  1MQI A;  2I48 A;  4PAI A;  4TQU Q;  4PC9 A;  2B4M A;  4GXA A;  4EXK A;  3FVK A;  3QXM A;  4GX3 A;  3TZA A;  3TQW A;  3IAZ A;  5M2V A;  4NF4 A;  3RT6 B;  2VT5 A;  4PDD A;  2FVZ A;  1ELJ A;  4PGN A;  5LOM A;  2Z8D A;  4GVO A;  4LQ5 A;  4F39 A;  3QUJ A;  4FBP A;  2HQ0 A;  1GVC A;  3M3L A;  2D3I A;  4ZEB A;  3DP6 A;  1TT1 A;  4X1B A;  3VXB A;  2F7C A;  2XXR A;  2QL3 A;  4FOR A;  1JVX A;  4XKQ A;  3EPE A; 
#chains in the Genus database with same CATH homology
 1YXI A;  4GBW A;  1INP A;  2FIX A;  5J1D A;  4PGP A;  2ZZV A;  2Q74 A;  4PF6 A;  5EQA A;  4N15 A;  3E78 A;  2PFY A;  4F19 A;  2WYK A;  4MMP A;  3KBZ A;  1IMC A;  4MNI A;  3IFC A;  2DE2 A;  1NUY A;  4O8M A;  2QFL A;  4NGU A;  5IZ1 A;  4F1U A;  1IMA A;  4PET A;  4LN5 A;  2F3B A;  3KC0 A;  4MX6 A;  2OX3 A;  4MCO A;  5EYH A;  4NX1 A;  4H45 A;  4AS4 A;  1D9Q A;  1NV7 A;  5ET5 A;  4GX4 A;  1K9Z A;  4P1L A;  4MIJ A;  1NI9 A;  4YIC A;  4HE1 A;  1FBD A;  2Y5K A;  4JVD A;  1RDZ A;  2QVR A;  4MEV A;  1NUZ A;  5EQ7 A;  5T3J A;  2FIE A;  1SPI A;  1FBG A;  2CZH A;  5LDZ A;  1FBH A;  4HCY A;  3GYY A;  3U65 A;  4N8Y A;  5IZ3 B;  1EYK A;  5IZ3 A;  4N6K A;  2DDK A;  4KXP A;  1EYJ A;  3CHG A;  1RDY A;  1K9Y A;  1FTA A;  5EYG A;  1FPE A;  4OAN A;  2CEX A;  5FBP A;  2FHY A;  4XF5 A;  1IMF A;  5ET6 A;  1FPK A;  4NG7 A;  5EQ8 A;  1KZ8 A;  4PFI A;  4O7I A;  5I7I A;  2DE4 A;  1NV2 A;  1NV4 A;  2P3V A;  4X04 A;  4GWZ A;  5I3S A;  4MNC A;  4MHF A;  4JVI A;  2WBB A;  4OVP A;  2XA5 A;  5JK4 A;  2Y5L A;  3NOH A;  2R8T A;  3W9W A;  4G61 A;  2QVU A;  2HZK A;  2JJK A;  1NUW A;  4OVR A;  1FPG A;  1NV1 A;  4N17 A;  3E79 A;  2MKZ A;  4NF0 A;  3LUZ A;  3EKI A;  1LBV A;  4N6D A;  2Q8M A;  3T0J A;  4F18 A;  1NV0 A;  1FBP A;  3MST A;  4DI3 D;  5I5P A;  2P3N A;  4NN3 A;  4GWS A;  3BIH A;  4IR8 A;  3IFA A;  4XFE A;  1QGX A;  2XWV A;  3KC1 A;  1FJ6 A;  2V3Q A;  2GQ1 A;  1BK4 A;  3ISP A;  4HXV A;  4I3Y A;  4PBQ A;  3FBP A;  4PTK A;  1YYZ A;  3T1B A;  3FXB A;  3ROJ A;  2HZL A;  5ESY A;  2QPQ A;  4PE3 A;  4I40 A;  1IMB A;  1IME A;  1RDX A;  1DCU A;  1XI6 A;  3B8B A;  1DBZ A;  1EYI A;  4QXD A;  1JP4 A;  4PFR A;  1KA1 A;  2F5X A;  2FBP A;  1LBW A;  2DVZ A;  2XWK A;  2XWO A;  1G0H A;  1LEV A;  2KR0 A;  2BJI A;  4PAF A;  5A5L A;  1FPB A;  2B4L A;  1DK4 A;  1YZ0 A;  2XXK A;  4GWX A;  3BIG A;  2WBD A;  1NV3 A;  4AS5 A;  3HFU A;  3LV0 A;  2HXR A;  4MAG A;  4NAP A;  4PDH A;  2WEF A;  4PF8 A;  4N4U A;  5ET7 A;  4X8R A;  3RPL B;  1AWB A;  4I3E A;  3RPL A;  5CM6 A;  4PBH A;  4OVT A;  5IGA A;  2CEY A;  2PCR A;  2CZI A;  1LBZ A;  1FBE A;  5IZZ A;  4PAK A;  3PTY A;  2VPN A;  4MJO A;  4N81 A;  4PFB A;  4QBA A;  2ZZW A;  4GWU A;  1Q9D A;  4YZZ A;  1FJ9 A;  4H46 A;  3W9V A;  4P8B A;  1IMD A;  3B50 A;  2DE3 A;  1FPF A;  5IM2 A;  1FPJ A;  1FPL A;  4HCW A;  2KQZ A;  2ZZX A;  4GWY A;  4OVQ A;  4X9T A;  1NV6 A;  4HE2 A;  3SZP A;  2QVV A;  1VDW A;  2F3D A;  3D1R A;  4OA4 A;  4GWW A;  1FPI A;  5ET8 A;  1CNQ A;  4GBV A;  4N91 A;  4XEQ A;  4O7M A;  1KA0 A;  2HPG A;  5J16 A;  2V4C A;  4PCD A;  2HHM A;  4OVS A;  4NHB A;  2L5V A;  1NUX A;  4GX6 A;  4F1V A;  2WX9 A;  1FPD A;  1NV5 A;  3A29 A;  4MNP A;  1G0I A;  1FBC A;  4P9K A;  2VPO A;  4P3L A;  2XWI A;  4PAI A;  1LBY A;  4PC9 A;  2B4M A;  2WYP A;  2OWZ A;  4GX3 A;  4O94 A;  4JVC A;  2Q9T A;  1FRP A;  4UAB A;  2VT5 A;  3QMF A;  4PDD A;  3RYD A;  2FVZ A;  4PGN A;  5F24 A;  1FSA A;  4FBP A;  5LTC A;  4P47 A;  4N8G A;  2CZK A;  4P1E A;  1LBX A;  5DW8 A;  3MYU A;  5EQ9 A;  4HE0 A;  4DI4 B;  2PFZ A;  1FBF A;  4M1V A;  4P56 A;  4NQ8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...