4MNPA

Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. nucleatum atcc 25586
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
305
structure length
305
Chain Sequence
KYNLKMGMTAGTSQNEYKAAEVFAKELKKRSNGEIELKLYPNAQLGKDDLAMMQQLEGGALDFTFAETGRFSTFFPEAEVFTLPYMIKDFNHMKKAVNTKFGKDLFKKVHDKKGMTVLAQAYNGTRQTTSNKAIKSLADMKGMKLRVPGAAANLAYAKYTEAAPTPMAFSEVYLALQTNAVDGQENPLSTIKAQKFYEVQKYLAMTNHILNDQLYLVSNITMEELPENLQKVVKESAEVAAEYHTKLFMDEEKSLKDFFKSKGVTITEPNLVDFKKAMKPFYDEYIKKNGKVGENAIKAIEAVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Fusobacterium nucleatum subsp. nucleatum
molecule tags Sugar binding protein
molecule keywords N-acetylneuraminate-binding protein
total genus 114
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mnpA00
5CM6A 5IZZA 4YZZA 4MNIA 4P56A 2WYPA 3FXBA 4P9KA 2HPGA 4N6KA 4N6DA 4NGUA 4PBQA 4PAKA 2VPNA 4PFIA 4NN3A 4PGNA 4P1EA 4OANA 4PC9A 5LTCA 2CEYA 2XA5A 4OVQA 5IGAA 2XWIA 2HZLA 4PFRA 2CEXA 4OVPA 4P47A 4PDDA 4NG7A 4PGPA 4MNPA 4O8MA 4MMPA 5I7IA 4PETA 4XEQA 2WX9A 4P8BA 4MX6A 4PF8A 4OVSA 4O94A 4PBHA 2VPOA 5IM2A 4O7MA 4PAFA 2XXKA 2XWOA 2ZZVA 4N4UA 4PE3A 3U65A 4X8RA 4PCDA 4P1LA 3B50A 4X04A 2XWVA 2ZZXA 4MNCA 4NQ8A 4NHBA 4NX1A 2PFYA 4NAPA 4DI3D 3GYYA 4OA4A 4XF5A 4LN5A 2HZKA 4OVTA 4PF6A 2PFZA 4DI4B 2XWKA 4MHFA 4N17A 4MCOA 4N91A 4N15A 4NF0A 4UABA 4YICA 4PDHA 4MAGA 2WYKA 4N8GA 4XFEA 4OVRA 4MEVA 4N8YA 4PFBA 2ZZWA 4MIJA 5I5PA 4PAIA 4P3LA 2V4CA
chains in the Genus database with same CATH superfamily
1QUIA 4YZZA 3BIGA 3RY3A 1FJ6A 2BJIA 3HO7A 1SBPA 3G3GA 3EQ1A 4F2OA 1Q35A 3MVWA 3KZGA 1K9YA 4KQPA 5H8FA 1NH8A 2PVUA 2RC8A 3QXMA 1MY4A 2KQZA 4M4GA 4R9GA 3OO9A 1H76A 2PX1A 4WXJA 5B70A 3N94A 2XHDA 2DE2A 3SETA 4OHNA 3OO8A 4F39A 2A5SA 2F7AA 4G77A 1TXFA 5I2NA 1OLAA 1MY2A 2OLBA 1M5EA 3IAZA 1MQGA 1UTHA 1Y9UA 1US4A 1EZ9A 4EQBA 3H6UA 3MJNA 1XC1A 4GBWA 1XOCA 2Z8DA 1POY1 1XHYA 4RYAA 2D21A 5EQAA 5ICTA 4ZEKA 2Y7WA 1R1NA 4Z0IA 5AA2D 2XXRA 1ZBMA 2QPQA 3RT6B 3KN3A 1LFHA 3C33A 4H67A 2I4BA 4NF8A 5AA3A 2ONRA 3OO6A 4ESXA 4F3GA 1FQBA 3P7IA 1YYZA 4HXVA 2XXQA 4OERA 3K00A 3IOVA 4POXA 2QFLA 4TOZA 3ZKLA 2B4LA 4EXKA 1B3FA 2ZYKA 1MXWA 2O7UA 2P3VA 2PT2A 1B46A 1VFEA 3VLVA 3E79A 5IGAA 3IFCA 2YPNA 3MVYA 1AWBA 2FYIA 1UIUA 5LDZA 3FVGA 4FEDA 4NF6B 3FVNA 5CI5A 1MXVA 1DCUA 1LAHE 3FVOA 4M1VA 1T0KA 5F1QA 4G2ZA 1EYKA 4GWSA 2QSXA 5JEIA 2Q89A 4GIZA 3TTNA 5DVJA 3N6UA 4GWXA 3V83A 2R71A 4I3EA 3SEYA 3D1RA 4NF4A 4U4XA 1B40A 4PQJA 2V84A 4QFPA 3D4CA 1IUDA 2D3IA 4YB5A 2Y5KA 2XXIA 4MLVA 4E0WA 1LLSA 5A5XA 4ZZEA 3V89B 4XXUA 2I0BA 4IGRA 4MNIA 4ZEBA 4GWWA 3Q28A 5AA1A 3RQTA 4P11A 5L9OA 2DS9A 5HBCA 3PPNA 3IFAA 4X9TA 1FPEA 5H8NA 4P1EA 1JETA 3ZKKA 1Y4CA 2O51A 3G3HA 3PMXA 3JZJA 2XA5A 1QW0A 3O29A 1P1QA 1LSTA 2E0SA 4QBAA 4F22A 3PMVA 5H8SA 4U22A 1SW2A 4C0RA 1L5TA 3TKDA 2XXYA 1I69A 3LV0A 3SZPA 5I7IA 3OOAA 2V3TA 2B65A 1XS5A 4H1XA 1MY3A 2O1LA 4ESWA 2XXKA 1NV4A 1HSEA 4G68A 2ZZVA 1QUJA 4RNSA 5ISUA 1B0LA 1YPNA 1UTBA 2VOZA 5TPAA 1IXGA 3ISPA 4I8CA 1M5DA 4KHZE 4N81A 1NV2A 3DELB 3MP8A 4MF3A 1OQGA 2PMSA 1KWHA 2LAOA 3E78A 3MC2A 4Z7EA 2ALUA 3MSTA 4POWA 1II5A 4QSEA 1FSAA 1MM7A 3KOSA 4U1ZA 1R9QA 1NV6A 3IK6B 3MP6A 3BIHA 4KFQA 4QHQA 4PFBA 2ZZWA 4K3FA 3TAJA 4LA9A 3MBPA 1MY1A 4EUOA 1B7UA 5K2XA 5CC2A 1DPEA 1LB9A 2F3DA 5ET8A 4P56A 1UQWA 3EHSA 5JTYB 4DCYA 1FQAA 3IORA 1A7LA 2UXAA 5I56B 1OVTA 3T9VA 1EZOA 3UA8A 1VSOA 3U94A 5KDTA 3ODBA 3TCFA 3K1PA 3T9HB 4X1BA 3HHFA 2XXHA 2DVCA 2ZYNA 3KG2A 4IO6A 2O68A 4OVPA 4P47A 4PDDA 2H9BA 1Y3QA 4I40A 3HFUA 1PB7A 2GRVA 1N84A 1A54A 1ZKBA 4P8BA 2FHYA 1YCJA 4Q0CA 2AL5A 2FIXA 4G68B 3RTWB 1D9QA 3LR1A 3Q26A 3TTKA 3U72A 4QFOA 3I6VA 1DTGA 1FBCA 2UVIA 1PBPA 1Q1KA 1SDXA 4THIA 4OQOA 1MQJA 3TFLA 3UN6A 3UP9A 3T9XB 1LCFA 3D4GA 4XF5A 2HZKA 4OVJA 1P1NA 4U4SA 5IAIA 4LQ2A 4H5FA 4N91A 4OETA 3TMGA 3EN3A 3A3UA 3VLWA 2O69A 4OTEA 2RC7A 1URSA 3QUJA 4RY1A 3G7WA 2DWAA 3KN7A 3TTLA 4BDOA 3CG1A 3R26A 1RDXA 4F31B 3UK4A 4U21A 2YLNA 4LQ5A 3FZVA 2CZLA 4TQUQ 2B3FA 3CRBA 3O66A 4NF5B 1LBXA 4LVQA 3A29A 2I3WA 4FAJA 3FASA 4PAKA 4XIGQ 3RYDA 1GGGA 1WDNA 2BJJX 3TZAA 1LBZA 4KCCA 2ONSA 3FJMA 4OEUA 2NVUB 1FQCA 1D9YA 2CEYA 4I62A 3K1MA 4YB6A 4RK9A 1LGBC 1JVYA 4DE8A 2CZKA 3TTMA 3K6XA 2I48A 5I2NB 3BFTA 1GVCA 3MVZA 3FIRA 3VVEA 2P2AA 2XXXA 4PETA 4XEQA 5ITPA 3GLBA 4JXIA 1AH5A 1NV5A 4OENA 2DXYA 3ILUB 3FVKA 1LFGA 2A5TA 2XWOA 1IITA 2QJEA 5DYHA 3VXBA 3H6WA 3RPWA 4XKPA 1VDWA 5L8DA 4P1LA 3OENA 4YKJA 4DZ1A 1PB9A 5ITOA 2Q2AA 3VXCA 1UTBB 1INPA 4DI3D 1HSJA 4G68C 2Y7RA 4H5GA 4GX3A 1F9BA 4BDNA 1EYIA 4H8IA 4OFOA 3BKIB 5L9MA 3E9XA 3PU5A 2Q8MA 1OLCA 4NF8B 4GLIA 4BDLA 2KLFA 3LUZA 3PTYA 4HCYA 1IMBA 1MG1A 3UORA 3DM0A 4HCWA 2W7YA 5ICQA 1B1HA 1LCTA 4KYEA 1FBGA 4GBVA 4JVCA 5DTBA 1JVXA 5AA2B 5I3SA 3KOTA 1NUZA 4GQOA 4MJOA 4HE2A 4N6KA 3A09A 2F7BA 3ONMA 2OK2A 4ELRA 3C9HA 3MZ1A 3AXFA 3B6WA 2I4CA 4F2QA 1PC3A 1NUYA 4HS7A 1BKAA 1S50A 3CFXA 5IKBA 3FV1A 1Y3PA 1VE4A 3RGYA 2XXTA 3SEVA 5LOMA 1URDA 4TLMB 2Q8JA 1NV1A 3M3KA 4NG7A 4F29A 4JSDA 3FXUA 2F6GA 4YU0A 4EF1A 3EPEA 5TP9A 3RNNA 4WEDA 2B3BA 5EHSA 2DWJA 1NL5A 1JW5A 3ECRA 1Y20A 1DBZA 2HFBA 3K1NA 3FUZA 1ZLQA 4WKMA 3S9NC 4QFKA 1IMDA 2AIXA 4DLDA 1BLFA 3FATA 2CZIA 2XX8A 1DK4A 3V8XB 1MH3A 3G3JA 1FTAA 4LZ5A 2R6GE 4QFLA 5FHMA 1Z7NE 5I5PA 3TUSA 1MQHA 1FJ9A 1B5IA 1FPLA 4OFLA 5ET6A 1SYHA 1SW4A 2REJA 5I58A 3T22A 4BDMA 4X48A 3T1BA 5H8NB 1IEJA 3IOTA 1CB6A 3IOUA 5I59A 3KSXA 1NV7A 2GFEA 2QS2A 3UIFA 3K0VA 4GFRA 4I9DA 4OFJA 1QULA 1FCKA 3UGWA 4OVQA 5I84A 2CEXA 4DXCA 3K6UA 5KCJA 2Q74A 4R2BA 5K2YA 2OWTA 4MNPA 3T93B 2WEFA 2QVUA 3VDFA 1JP4A 1G0IA 3K6VA 3RLFE 2QRYA 4MLQA 2Z23A 3W9VA 4PBHA 3QYTA 3E4RA 4NE4A 4EF2A 2NOOA 2QMXA 3C32A 2H5YA 2ONKE 4P0IA 5DVIA 5TPAB 4IY5A 3RT8A 3IJOB 3HCQA 4NAPA 2OWZA 1DSNA 1MRPA 1NNTA 1VFDA 4PF6A 3L6GA 4OXVA 1MXXA 3IB0A 4QRZA 3PUZE 4OYVA 4G8MA 1P1UA 4NF0A 2VHAA 3Q29A 4OEVA 5HM4B 3VFJA 4YMAA 1FW0A 3IR1A 1US5A 2NXOA 2I6EA 1A99A 4RPNA 4XKNA 5AE4A 1MDQA 4RJZA 3V5AA 1TFDA 4PFTA 2Y84A 3MW0A 4PE5B 2V25A 2ZYOA 1A8EA 3IL1B 2HPGA 1B5HA 5AA2A 1D9VA 2VD2A 2F6PA 1UIVA 3PMWA 3KEIA 2F35A 1S9TA 3TPAA 3HHGA 2DVZA 4AS5A 5CMCA 3MPLA 3FJGA 1NUXA 3TDJA 4ELOA 4HW8A 1TT1A 2HXRA 4PTKA 2H99A 4AS4A 3FBPA 1KA0A 1SD3A 2H25A 3N6TA 2HEUA 2WX9A 2V93A 1MH4A 2JJKA 3BFUA 3H3GA 3PD8A 3MQ9A 4L17A 4ZEIA 4AB6A 4KR5A 4N4UA 2R9JA 3U65A 4X8RA 4IO3A 2NWJA 3B50A 4X04A 2AL4A 5FHNA 3R6UA 4IO7A 2QVVA 1MPCA 1WVJA 4G61A 3KFMA 4GX4A 1QKAA 1SW5A 1B4HA 3Q25A 4P0GA 4EQ7A 1SW1A 1JEVA 3SESA 3T66A 4F3SA 4GX6A 4I1DA 3OSRA 1MXYA 1ZMGA 4PDHA 1H3DA 2WYKA 4KPTA 2ZNTA 1JEUA 2AYSA 5H8QB 4JWYA 4GD5A 2UVGA 1O63A 2H4IA 1MQIA 2DDKA 3K2DA 3KJ7A 4GWZA 1PEBA 2P3NA 5I58B 3FD3A 3PPOA 2G93A 5I59B 2Y7KA 1USYH 1QKBA 1LBBA 3LSLA 4BDQA 3MZBA 2I58A 4KYSA 1I6BA 2X7QA 4H65A 2YJPA 3R7XA 2IA4A 5J16A 3DP8A 5I2KB 4MMPA 1B4ZA 3OSQA 2DWHA 1K9ZA 2OJTA 1FBFA 1FTJA 4MX6A 2A5TB 1R9LA 4ISUA 4OWDA 3THIA 1FPGA 1B58A 3VV5A 4PFUA 3W9WA 1DMBA 4PAFA 1IXCA 1MDP1 2XXUA 2F8DA 5FHOA 4N13A 1N0TA 2HHMA 5TU0A 4F1UA 1FQDA 4KI0E 1JW1A 4YAHX 4H6DA 4BDRA 2OX3A 3M3FA 3B6TA 4FEBA 4MCOA 1N7XA 4HE0A 1QVSA 4YMBA 4UABA 1CNQA 4JVIA 3LUYA 1O64A 4ZZAA 1LAGE 4YKKA 3C31A 4N07A 5EQ9A 5A5XB 4GL0A 1KZ8A 4ZEFA 1MXZA 5CM6A 4F1VA 4QSCA 4R2FA 3TQLA 1MPDA 3O6HA 2M8CA 2Y5LA 5BWJA 1USYE 4FE8A 3WAFA 1A8FA 3H7MA 4KCDA 5IZ1A 2HAVA 4P9KA 4N6DA 4PBQA 4GOTA 4R6YA 4JSOA 3T9UA 3DP6A 1NNFA 4PC9A 3CIJA 2RKMA 4H45A 1IZ1A 4O7IA 3PUYE 2RC9A 3WAEA 2X7PA 4YKPA 3KJTA 3MPKA 1LBYA 5ELVA 1FPKA 4QFNA 3PUWE 4GRKA 1MPBA 3TQWA 1NKXA 4Q5TA 1OVBA 3OMBA 3GXAA 3G3FA 1B2HA 1UTHB 4Q8RA 1QGXA 3EF7A 4NWDA 3DP4A 3CR9A 5EHMA 4HE1A 1FTMA 1ZJLA 2O6AA 3MWBA 4NQ8A 3C35A 2PFYA 4LONB 1EZPA 4U2RA 3U93A 2L5VA 3USDA 1B7HA 1IMCA 2ZNSA 4O3AA 1FBDA 4FATA 4N17A 4FORA 4GXSB 3SEXA 1FPIA 4N15A 2WKYA 4WEPA 4NMYA 4YKIA 2P1SA 3B7DA 4XTCQ 1I6QA 2RCAA 5JK4A 4YICA 1NFTA 1M5FA 4N8GA 3T96B 1DOTA 1H45A 1ZU0A 2QS1A 3SDFA 3IB2A 5CRYA 3G3KA 4X1DA 3EKIA 2Y7PA 1NV0A 3PPPA 1SI0A 2HCAA 2THIA 3G3IA 1LFIA 1JW4A 4DXBA 5BUUA 2WYPA 4EQ9A 2I3VA 4RK2A 5I56A 1AMFA 3O6GA 2GQ1A 4PFIA 2GHBA 3RUMA 4PFWA 2OBGA 2OWSA 4O3BA 4QXDA 1B7ZA 5DEXB 4XKRA 5KCJB 2HZLA 3C4MA 3U8QA 1HSLA 3BBRA 1FBPA 4PGPA 2PT1A 5F24A 1SVXB 2F7CA 5I2KA 2HXWA 1LBVA 1BK4A 2X26A 1O7TA 5IM2A 4NF6A 4LUBA 3C36A 4PFYA 1ZIUA 5EQ7A 1LB8A 1B3EA 3CFLA 1WODA 4PE3A 4GL8A 3S2VA 4HTGA 4ZE9A 1N76A 3RN8A 2RINA 1Y3NA 3OD7A 1H43A 5EYFA 1NUWA 4OESA 5FTHA 2ZNUA 1D3KA 4F1YA 4LN5A 1POTA 3RTFB 2G29A 1YZ0A 2GHAA 2PBWA 1URGA 3CFZA 1Q9DA 1ATGA 4MHFA 5AA4A 1S7YA 2WBDA 3OELA 4DCXA 1N3XA 2HQ0A 4MEVA 2VP1A 4LZ8A 2Q9TA 4ZDMA 2F5XA 1SPIA 1XVXA 1TWYA 1B6HA 1RDYA 2DYXA 4DDDA 4R74A 1B9JA 3FV2A 2F36A 1LAFE 2Q2CA 3K02A 1G0HA 1MXUA 4IGTA 3HV1A 4ZS9A 1D4NA 3H06B 2F3BA 3E3KA 3FJ7A 3B8BA 1NI9A 1BIYA 1H44A 1M5BA 1B3LA 1LAXA 4I3YA 5LTCA 3QK6A 4H0WA 3TTRA 4DIGA 4H8JA 1B3HA 3ZSFA 1OIBA 2Q88A 2DP8A 3ZS6A 3HN0A 4N6PA 3ROJA 2REGA 5M2VA 1CE2A 3U92A 1N3WA 4RPOA 4IR8A 5FTIA 1Z7ME 3GBBA 4G8HA 4GWYA 4BLAA 1NV3A 5CMKA 2VPOA 1IXHA 3VVDA 1ELJA 2ANJA 3TCHA 4IO2A 4R6HA 2O84X 4JBZA 3QUFA 3ILTB 4JWOA 3M3LA 4MNCA 2DQVA 3S9EA 3HPIA 1R6ZA 4NX1A 1B51A 5DW8A 2QVRA 3IX1A 3GYYA 3S9MC 1SYIA 4XKQA 2XWKA 5EYHA 1IIWA 3QSLA 3LBSA 1MS7A 1PB8A 2XX7A 3KC0A 3OEMA 1FPJA 3TEPA 3CHGA 4R9FA 4MBPA 4NTLA 2XD3A 2FNCA 3S9LC 4R75A 1Y1MA 1ZTYA 4TLLB 3IO4A 1B32A 5CBRA 1A55A 1B0HA 2ABHA 2P0SA 1FPFA 2Y7IA 3PUXE 4EDPA 1QJMA 5B7DA 5JTYA 3FXRA 4FJPA 4PGNA 3TELA 1JNFA 4IO5A 3O97A 2O1MA 3O2AA 2UYEA 1Y1ZA 5H8HA 3MP1A 5HPQA 2OCUA 4ZE8A 2Z8FA 2H98A 1I6AA 2F97A 3TYHA 3MVXA 3S4UA 4H46A 4U1OA 4PF8A 3VLUA 1IMEA 4O7MA 1FBHA 2QL3A 1B1XA 3PV0E 4ZECA 3I3VA 2XWVA 1RYXA 4NHBA 3KSJA 4C1TA 2O7IA 5IZ3A 2DXRA 1P1WA 3CI8A 1Y4TA 4DI4B 1YAEA 4IO4A 3CSGA 2ZMBA 3OO7A 1FTKA 4YB7A 5I57B 2QS3A 2UVHA 4R6KA 4ELPA 1A40A 1FRPA 5AA4B 4MFIA 4GVOA 4JDFA 4MH5A 3CVGA 2Z8EA 1RDZA 2DSFA 3EHUA 3E13X 2UVJA 3LSFB 2V4CA 3OXNA 1B52A 2FA7A 2E1SA 4ECFA 4AB5A 2FVZA 1FQFA 2CMOA 3FXBA 4GWOA 1FBEA 5KZTA 4NF5A 5ET7A 1XVYA 1LBWA 1MY0A 1RKMA 3W15C 5DVFA 4OANA 3IO6A 4F3PA 1XI6A 1IXIA 1B05A 2FIEA 4GWUA 4O3CA 4PFRA 3PPQA 3SERA 2VT5A 3LC8A 4PP0A 1PDAA 3MYUA 2PCRA 1RYOA 4UA8A 2QS4A 2ESNA 3RPLA 3IJXB 3U1OA 4KYDA 2PYYA 1EU8A 4F18A 4JB7A 3K4UA 4JWXA 1KA1A 3SEUA 3PD9A 2UYFA 4EXLA 3PGFA 3H6TA 4PCDA 3O28A 1FQEA 1FTLA 4GF8A 4NWCA 1AL3A 1QUKA 4OVTA 2PFZA 5T3JA 3PUVE 3TCGA 3FGSA 1GV8A 3KN8A 1IMAA 1NNPA 3O9PA 3C34A 4G8NA 4MAGA 3NOHA 1DTZA 4FECA 1JQFA 3HSTA 5FBPA 1SI1A 4AQ4A 2V3QA 3CG3A 3I5OA 3K01A 4ND9A 1XT8A 1B5JA 1TFAA 4NEDA 3KC1A 1OQHA 5L9SA 3IOWA 3SEWA 2VPNA 2KR0A 4NN3A 2DOJA 1AOVA 1GTKA 2MKZA 4R72A 1EYJA 3Q27A 3SKPA 5ET5A 5DEXA 1NNKA 2XD2A 3MZ9A 2R8TA 1FPDA 2DE3A 5CMMA 4ONYA 5H8HB 4U23A 3JYRA 4FBPA 3T0JA 1YXIA 3LSXA 5EQ8A 3KBRA 2DWIA 5ESYA 3MAMA 4LP2B 5TP9B 2ZXTA 3H4ZA 3N26A 4IB2A 3GBAA 1GR2A 5CBSA 1FPBA 4KXPA 4LZ7A 4ELQA 2XX9A 2QMWA 4OMBA 1BP5A 4OA4A 4E0XA 2HAUA 5IZ3B 3GZGA 2CZHA 1J1NA 4DXUA 1LEVA 3KGCA 2NUVA 5I57A 3VVFA 4UACA 3H6VA 2I0CA 3OEKA 3L6HA 5A5LA 4OVRA 5H8QA 1N04A 1SQYA 4ZEDA 3LSWA 4PAIA 4N8YA 4P3LA 1B3GA 5IZZA 3K6WA 2XXPA 2XXVA 2V3UA 2IEEA 1DPPA 3MUQA 4G4PA 3N5LA 4Q30B 4QF9A 5CMBA 2I49A 5F7VA 2RF1A 3TODA 3FXQA 2OZZA 1MQDA 1AIVA 1IQ7A 1OMPA 4NGUA 4KD5A 3QMFA 4RXLA 3QAXA 5H8FB 3M8UA 5EYGA 4F19A 3DLNA 1P99A 1PBQA 4JVDA 3PPRA 2VGQA 2XWIA 5KDTB 3A3CA 1MM6A 1NH7A 2WBBA 3CSBA 3JV9A 3EHTA 2ZYMA 4O8MA 4FIMA 2VD3A 1IMFA 5J1DA 1EH3A 5DT6A 4OVSA 1N7WA 4O94A 3IB1A 4OZ9A 1BTJA 3RPLB 4IY6A 3KBZA 2F78A 2RCBA 4RA1A 4F3BA 3O6IA 2XXWA 2F34A 4LATA 2B4MA 1VR5A 2DE4A 4R73A 2ZZXA 1NMUA 4QSDA 1YTVA 2Z22A 3QIMA 1FTOA 2D5WA 3H03A 4NF4B 1LBCA 3B6QA 4GXAA 3VE1B 4XFEA 2FBPA 3F11A 4C1UA 2GH9A 1ANFA 1P1OA 4MIJA 1M5CA
chains in the Genus database with same CATH topology
1FJ9A 5CM6A 1RDXA 1SPIA 3EKIA 4HCWA 1NV0A 4YZZA 4F1VA 5IZZA 1FPLA 1RDYA 3BIGA 1FBGA 4MNIA 1FJ6A 3PTYA 4GBVA 4GWWA 2Y5LA 4JVCA 2F3DA 5ET6A 2BJIA 2FVZA 5ET8A 1LBXA 1YYZA 2DDKA 4HXVA 4P56A 5I3SA 2WYPA 3FXBA 1IMBA 1FPFA 1FBEA 3A29A 1NUZA 3KC1A 5IZ1A 4MJOA 4P9KA 2HPGA 4HE2A 3IFAA 1G0HA 4N6KA 4GWZA 4N6DA 5ET7A 3T1BA 2P3NA 4NGUA 4PBQA 4PAKA 2GQ1A 2VPNA 3QMFA 4X9TA 3RYDA 1LBWA 2KR0A 1K9YA 2QFLA 4PFIA 3W9VA 1FPEA 1NV7A 2F3BA 4NN3A 2KQZA 4PGNA 2MKZA 4P1EA 4OANA 1EYJA 2DVZA 1NI9A 3B8BA 4PC9A 2B4LA 1XI6A 4H45A 4AS5A 4O7IA 1LBZA 1NUYA 5EYGA 5ET5A 4F19A 2DE2A 2P3VA 4I3YA 5LTCA 1NUXA 4QXDA 2CEYA 2XA5A 3E79A 2FIEA 4GWUA 4JVDA 4OVQA 5IGAA 2R8TA 2XWIA 1FPDA 2CZKA 2DE3A 2HZLA 3IFCA 4PFRA 2CEXA 2WBBA 2HXRA 1LBYA 4QBAA 4PTKA 4OVPA 2VT5A 1FPKA 4P47A 4PDDA 3ROJA 2V4CA 1AWBA 1NV1A 1FBPA 2Q74A 3MYUA 4FBPA 4NG7A 3T0JA 3LV0A 3FBPA 4AS4A 4PGPA 4MNPA 1KA0A 1YXIA 2WEFA 2PCRA 4MMPA 4O8MA 4PAIA 5F24A 2QVUA 4I40A 3SZPA 4P3LA 1JP4A 4PETA 3HFUA 1G0IA 4IR8A 4XEQA 1IMFA 1K9ZA 1FBFA 3RPLA 4H46A 2WX9A 5J1DA 4GWYA 4MX6A 2FHYA 4P8BA 1NV3A 4OVSA 1LBVA 4PF8A 4O94A 4PBHA 1BK4A 1NV5A 2FIXA 5EQ8A 2JJKA 2VPOA 3RPLB 4F18A 1IMEA 1DCUA 3KBZA 5IM2A 1FPGA 4O7MA 1KA1A 3W9WA 1FBHA 4M1VA 1D9QA 4PAFA 5EQ7A 5ESYA 2XXKA 1NV4A 1QGXA 2XWOA 2ZZVA 1FBCA 4N4UA 4PE3A 1EYKA 2B4MA 4GWSA 4X8RA 3U65A 1VDWA 4PCDA 4HE1A 2HHMA 4P1LA 4GBWA 2DE4A 3B50A 4X04A 4F1UA 2XWVA 2ZZXA 4MNCA 2QVVA 4NQ8A 1FPBA 4KXPA 1NUWA 4NHBA 5EQAA 4NX1A 5DW8A 2PFYA 2QVRA 4NAPA 2OWZA 5IZ3A 1DBZA 1INPA 4DI3D 3ISPA 3GYYA 5LDZA 4G61A 4OA4A 4GWXA 2L5VA 2HZKA 4LN5A 4XF5A 5J16A 1IMCA 4OVTA 4PF6A 1FBDA 2PFZA 4N81A 1YZ0A 1NV2A 4GX4A 5IZ3B 5T3JA 4DI4B 2XWKA 2OX3A 1Q9DA 4I3EA 4MHFA 5EYHA 5I7IA 2CZHA 3D1RA 4GX3A 4N17A 3E78A 4MCOA 4N91A 1IMDA 1LEVA 4HE0A 3MSTA 1FPIA 4N15A 1FSAA 4NF0A 1FRPA 1CNQA 4GX6A 4UABA 1EYIA 4JVIA 2QPQA 2WBDA 3KC0A 5JK4A 4YICA 4PDHA 1IMAA 4MAGA 1NV6A 1FPJA 2CZIA 2WYKA 3BIHA 4N8GA 1DK4A 3NOHA 2Q8MA 3CHGA 4XFEA 2FBPA 2Y5KA 1RDZA 5A5LA 4OVRA 5EQ9A 1FTAA 4MEVA 4PFBA 2Q9TA 2ZZWA 3LUZA 5FBPA 5I5PA 2V3QA 4HCYA 1KZ8A 4MIJA 4N8YA 2F5XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CM6 A;  5IZZ A;  4YZZ A;  4MNI A;  4P56 A;  2WYP A;  3FXB A;  4P9K A;  2HPG A;  4N6K A;  4N6D A;  4NGU A;  4PBQ A;  4PAK A;  2VPN A;  4PFI A;  4NN3 A;  4PGN A;  4P1E A;  4OAN A;  4PC9 A;  5LTC A;  2CEY A;  2XA5 A;  4OVQ A;  5IGA A;  2XWI A;  2HZL A;  4PFR A;  2CEX A;  4OVP A;  4P47 A;  4PDD A;  4NG7 A;  4PGP A;  4MNP A;  4O8M A;  4MMP A;  5I7I A;  4PET A;  4XEQ A;  2WX9 A;  4P8B A;  4MX6 A;  4PF8 A;  4OVS A;  4O94 A;  4PBH A;  2VPO A;  5IM2 A;  4O7M A;  4PAF A;  2XXK A;  2XWO A;  2ZZV A;  4N4U A;  4PE3 A;  3U65 A;  4X8R A;  4PCD A;  4P1L A;  3B50 A;  4X04 A;  2XWV A;  2ZZX A;  4MNC A;  4NQ8 A;  4NHB A;  4NX1 A;  2PFY A;  4NAP A;  4DI3 D;  3GYY A;  4OA4 A;  4XF5 A;  4LN5 A;  2HZK A;  4OVT A;  4PF6 A;  2PFZ A;  4DI4 B;  2XWK A;  4MHF A;  4N17 A;  4MCO A;  4N91 A;  4N15 A;  4NF0 A;  4UAB A;  4YIC A;  4PDH A;  4MAG A;  2WYK A;  4N8G A;  4XFE A;  4OVR A;  4MEV A;  4N8Y A;  4PFB A;  2ZZW A;  4MIJ A;  5I5P A;  4PAI A;  4P3L A;  2V4C A; 
#chains in the Genus database with same CATH topology
 1QUI A;  4YZZ A;  3BIG A;  3RY3 A;  1FJ6 A;  2BJI A;  3HO7 A;  1SBP A;  3G3G A;  3EQ1 A;  4F2O A;  1Q35 A;  3MVW A;  3KZG A;  1K9Y A;  4KQP A;  5H8F A;  1NH8 A;  2PVU A;  2RC8 A;  3QXM A;  1MY4 A;  2KQZ A;  4M4G A;  4R9G A;  3OO9 A;  1H76 A;  2PX1 A;  4WXJ A;  5B70 A;  3N94 A;  2XHD A;  2DE2 A;  3SET A;  4OHN A;  3OO8 A;  4F39 A;  2A5S A;  2F7A A;  4G77 A;  1TXF A;  5I2N A;  1OLA A;  1MY2 A;  2OLB A;  1M5E A;  3IAZ A;  1MQG A;  1UTH A;  1Y9U A;  1US4 A;  1EZ9 A;  4EQB A;  3H6U A;  3MJN A;  1XC1 A;  4GBW A;  1XOC A;  2Z8D A;  1POY 1;  1XHY A;  4RYA A;  2D21 A;  5EQA A;  5ICT A;  4ZEK A;  2Y7W A;  1R1N A;  4Z0I A;  5AA2 D;  2XXR A;  1ZBM A;  2QPQ A;  3RT6 B;  3KN3 A;  1LFH A;  3C33 A;  4H67 A;  2I4B A;  4NF8 A;  5AA3 A;  2ONR A;  3OO6 A;  4ESX A;  4F3G A;  1FQB A;  3P7I A;  1YYZ A;  4HXV A;  2XXQ A;  4OER A;  3K00 A;  3IOV A;  4POX A;  2QFL A;  4TOZ A;  3ZKL A;  2B4L A;  4EXK A;  1B3F A;  2ZYK A;  1MXW A;  2O7U A;  2P3V A;  2PT2 A;  1B46 A;  1VFE A;  3VLV A;  3E79 A;  5IGA A;  3IFC A;  2YPN A;  3MVY A;  1AWB A;  2FYI A;  1UIU A;  5LDZ A;  3FVG A;  4FED A;  4NF6 B;  3FVN A;  5CI5 A;  1MXV A;  1DCU A;  1LAH E;  3FVO A;  4M1V A;  1T0K A;  5F1Q A;  4G2Z A;  1EYK A;  4GWS A;  2QSX A;  5JEI A;  2Q89 A;  4GIZ A;  3TTN A;  5DVJ A;  3N6U A;  4GWX A;  3V83 A;  2R71 A;  4I3E A;  3SEY A;  3D1R A;  4NF4 A;  4U4X A;  1B40 A;  4PQJ A;  2V84 A;  4QFP A;  3D4C A;  1IUD A;  2D3I A;  4YB5 A;  2Y5K A;  2XXI A;  4MLV A;  4E0W A;  1LLS A;  5A5X A;  4ZZE A;  3V89 B;  4XXU A;  2I0B A;  4IGR A;  4MNI A;  4ZEB A;  4GWW A;  3Q28 A;  5AA1 A;  3RQT A;  4P11 A;  5L9O A;  2DS9 A;  5HBC A;  3PPN A;  3IFA A;  4X9T A;  1FPE A;  5H8N A;  4P1E A;  1JET A;  3ZKK A;  1Y4C A;  2O51 A;  3G3H A;  3PMX A;  3JZJ A;  2XA5 A;  1QW0 A;  3O29 A;  1P1Q A;  1LST A;  2E0S A;  4QBA A;  4F22 A;  3PMV A;  5H8S A;  4U22 A;  1SW2 A;  4C0R A;  1L5T A;  3TKD A;  2XXY A;  1I69 A;  3LV0 A;  3SZP A;  5I7I A;  3OOA A;  2V3T A;  2B65 A;  1XS5 A;  4H1X A;  1MY3 A;  2O1L A;  4ESW A;  2XXK A;  1NV4 A;  1HSE A;  4G68 A;  2ZZV A;  1QUJ A;  4RNS A;  5ISU A;  1B0L A;  1YPN A;  1UTB A;  2VOZ A;  5TPA A;  1IXG A;  3ISP A;  4I8C A;  1M5D A;  4KHZ E;  4N81 A;  1NV2 A;  3DEL B;  3MP8 A;  4MF3 A;  1OQG A;  2PMS A;  1KWH A;  2LAO A;  3E78 A;  3MC2 A;  4Z7E A;  2ALU A;  3MST A;  4POW A;  1II5 A;  4QSE A;  1FSA A;  1MM7 A;  3KOS A;  4U1Z A;  1R9Q A;  1NV6 A;  3IK6 B;  3MP6 A;  3BIH A;  4KFQ A;  4QHQ A;  4PFB A;  2ZZW A;  4K3F A;  3TAJ A;  4LA9 A;  3MBP A;  1MY1 A;  4EUO A;  1B7U A;  5K2X A;  5CC2 A;  1DPE A;  1LB9 A;  2F3D A;  5ET8 A;  4P56 A;  1UQW A;  3EHS A;  5JTY B;  4DCY A;  1FQA A;  3IOR A;  1A7L A;  2UXA A;  5I56 B;  1OVT A;  3T9V A;  1EZO A;  3UA8 A;  1VSO A;  3U94 A;  5KDT A;  3ODB A;  3TCF A;  3K1P A;  3T9H B;  4X1B A;  3HHF A;  2XXH A;  2DVC A;  2ZYN A;  3KG2 A;  4IO6 A;  2O68 A;  4OVP A;  4P47 A;  4PDD A;  2H9B A;  1Y3Q A;  4I40 A;  3HFU A;  1PB7 A;  2GRV A;  1N84 A;  1A54 A;  1ZKB A;  4P8B A;  2FHY A;  1YCJ A;  4Q0C A;  2AL5 A;  2FIX A;  4G68 B;  3RTW B;  1D9Q A;  3LR1 A;  3Q26 A;  3TTK A;  3U72 A;  4QFO A;  3I6V A;  1DTG A;  1FBC A;  2UVI A;  1PBP A;  1Q1K A;  1SDX A;  4THI A;  4OQO A;  1MQJ A;  3TFL A;  3UN6 A;  3UP9 A;  3T9X B;  1LCF A;  3D4G A;  4XF5 A;  2HZK A;  4OVJ A;  1P1N A;  4U4S A;  5IAI A;  4LQ2 A;  4H5F A;  4N91 A;  4OET A;  3TMG A;  3EN3 A;  3A3U A;  3VLW A;  2O69 A;  4OTE A;  2RC7 A;  1URS A;  3QUJ A;  4RY1 A;  3G7W A;  2DWA A;  3KN7 A;  3TTL A;  4BDO A;  3CG1 A;  3R26 A;  1RDX A;  4F31 B;  3UK4 A;  4U21 A;  2YLN A;  4LQ5 A;  3FZV A;  2CZL A;  4TQU Q;  2B3F A;  3CRB A;  3O66 A;  4NF5 B;  1LBX A;  4LVQ A;  3A29 A;  2I3W A;  4FAJ A;  3FAS A;  4PAK A;  4XIG Q;  3RYD A;  1GGG A;  1WDN A;  2BJJ X;  3TZA A;  1LBZ A;  4KCC A;  2ONS A;  3FJM A;  4OEU A;  2NVU B;  1FQC A;  1D9Y A;  2CEY A;  4I62 A;  3K1M A;  4YB6 A;  4RK9 A;  1LGB C;  1JVY A;  4DE8 A;  2CZK A;  3TTM A;  3K6X A;  2I48 A;  5I2N B;  3BFT A;  1GVC A;  3MVZ A;  3FIR A;  3VVE A;  2P2A A;  2XXX A;  4PET A;  4XEQ A;  5ITP A;  3GLB A;  4JXI A;  1AH5 A;  1NV5 A;  4OEN A;  2DXY A;  3ILU B;  3FVK A;  1LFG A;  2A5T A;  2XWO A;  1IIT A;  2QJE A;  5DYH A;  3VXB A;  3H6W A;  3RPW A;  4XKP A;  1VDW A;  5L8D A;  4P1L A;  3OEN A;  4YKJ A;  4DZ1 A;  1PB9 A;  5ITO A;  2Q2A A;  3VXC A;  1UTB B;  1INP A;  4DI3 D;  1HSJ A;  4G68 C;  2Y7R A;  4H5G A;  4GX3 A;  1F9B A;  4BDN A;  1EYI A;  4H8I A;  4OFO A;  3BKI B;  5L9M A;  3E9X A;  3PU5 A;  2Q8M A;  1OLC A;  4NF8 B;  4GLI A;  4BDL A;  2KLF A;  3LUZ A;  3PTY A;  4HCY A;  1IMB A;  1MG1 A;  3UOR A;  3DM0 A;  4HCW A;  2W7Y A;  5ICQ A;  1B1H A;  1LCT A;  4KYE A;  1FBG A;  4GBV A;  4JVC A;  5DTB A;  1JVX A;  5AA2 B;  5I3S A;  3KOT A;  1NUZ A;  4GQO A;  4MJO A;  4HE2 A;  4N6K A;  3A09 A;  2F7B A;  3ONM A;  2OK2 A;  4ELR A;  3C9H A;  3MZ1 A;  3AXF A;  3B6W A;  2I4C A;  4F2Q A;  1PC3 A;  1NUY A;  4HS7 A;  1BKA A;  1S50 A;  3CFX A;  5IKB A;  3FV1 A;  1Y3P A;  1VE4 A;  3RGY A;  2XXT A;  3SEV A;  5LOM A;  1URD A;  4TLM B;  2Q8J A;  1NV1 A;  3M3K A;  4NG7 A;  4F29 A;  4JSD A;  3FXU A;  2F6G A;  4YU0 A;  4EF1 A;  3EPE A;  5TP9 A;  3RNN A;  4WED A;  2B3B A;  5EHS A;  2DWJ A;  1NL5 A;  1JW5 A;  3ECR A;  1Y20 A;  1DBZ A;  2HFB A;  3K1N A;  3FUZ A;  1ZLQ A;  4WKM A;  3S9N C;  4QFK A;  1IMD A;  2AIX A;  4DLD A;  1BLF A;  3FAT A;  2CZI A;  2XX8 A;  1DK4 A;  3V8X B;  1MH3 A;  3G3J A;  1FTA A;  4LZ5 A;  2R6G E;  4QFL A;  5FHM A;  1Z7N E;  5I5P A;  3TUS A;  1MQH A;  1FJ9 A;  1B5I A;  1FPL A;  4OFL A;  5ET6 A;  1SYH A;  1SW4 A;  2REJ A;  5I58 A;  3T22 A;  4BDM A;  4X48 A;  3T1B A;  5H8N B;  1IEJ A;  3IOT A;  1CB6 A;  3IOU A;  5I59 A;  3KSX A;  1NV7 A;  2GFE A;  2QS2 A;  3UIF A;  3K0V A;  4GFR A;  4I9D A;  4OFJ A;  1QUL A;  1FCK A;  3UGW A;  4OVQ A;  5I84 A;  2CEX A;  4DXC A;  3K6U A;  5KCJ A;  2Q74 A;  4R2B A;  5K2Y A;  2OWT A;  4MNP A;  3T93 B;  2WEF A;  2QVU A;  3VDF A;  1JP4 A;  1G0I A;  3K6V A;  3RLF E;  2QRY A;  4MLQ A;  2Z23 A;  3W9V A;  4PBH A;  3QYT A;  3E4R A;  4NE4 A;  4EF2 A;  2NOO A;  2QMX A;  3C32 A;  2H5Y A;  2ONK E;  4P0I A;  5DVI A;  5TPA B;  4IY5 A;  3RT8 A;  3IJO B;  3HCQ A;  4NAP A;  2OWZ A;  1DSN A;  1MRP A;  1NNT A;  1VFD A;  4PF6 A;  3L6G A;  4OXV A;  1MXX A;  3IB0 A;  4QRZ A;  3PUZ E;  4OYV A;  4G8M A;  1P1U A;  4NF0 A;  2VHA A;  3Q29 A;  4OEV A;  5HM4 B;  3VFJ A;  4YMA A;  1FW0 A;  3IR1 A;  1US5 A;  2NXO A;  2I6E A;  1A99 A;  4RPN A;  4XKN A;  5AE4 A;  1MDQ A;  4RJZ A;  3V5A A;  1TFD A;  4PFT A;  2Y84 A;  3MW0 A;  4PE5 B;  2V25 A;  2ZYO A;  1A8E A;  3IL1 B;  2HPG A;  1B5H A;  5AA2 A;  1D9V A;  2VD2 A;  2F6P A;  1UIV A;  3PMW A;  3KEI A;  2F35 A;  1S9T A;  3TPA A;  3HHG A;  2DVZ A;  4AS5 A;  5CMC A;  3MPL A;  3FJG A;  1NUX A;  3TDJ A;  4ELO A;  4HW8 A;  1TT1 A;  2HXR A;  4PTK A;  2H99 A;  4AS4 A;  3FBP A;  1KA0 A;  1SD3 A;  2H25 A;  3N6T A;  2HEU A;  2WX9 A;  2V93 A;  1MH4 A;  2JJK A;  3BFU A;  3H3G A;  3PD8 A;  3MQ9 A;  4L17 A;  4ZEI A;  4AB6 A;  4KR5 A;  4N4U A;  2R9J A;  3U65 A;  4X8R A;  4IO3 A;  2NWJ A;  3B50 A;  4X04 A;  2AL4 A;  5FHN A;  3R6U A;  4IO7 A;  2QVV A;  1MPC A;  1WVJ A;  4G61 A;  3KFM A;  4GX4 A;  1QKA A;  1SW5 A;  1B4H A;  3Q25 A;  4P0G A;  4EQ7 A;  1SW1 A;  1JEV A;  3SES A;  3T66 A;  4F3S A;  4GX6 A;  4I1D A;  3OSR A;  1MXY A;  1ZMG A;  4PDH A;  1H3D A;  2WYK A;  4KPT A;  2ZNT A;  1JEU A;  2AYS A;  5H8Q B;  4JWY A;  4GD5 A;  2UVG A;  1O63 A;  2H4I A;  1MQI A;  2DDK A;  3K2D A;  3KJ7 A;  4GWZ A;  1PEB A;  2P3N A;  5I58 B;  3FD3 A;  3PPO A;  2G93 A;  5I59 B;  2Y7K A;  1USY H;  1QKB A;  1LBB A;  3LSL A;  4BDQ A;  3MZB A;  2I58 A;  4KYS A;  1I6B A;  2X7Q A;  4H65 A;  2YJP A;  3R7X A;  2IA4 A;  5J16 A;  3DP8 A;  5I2K B;  4MMP A;  1B4Z A;  3OSQ A;  2DWH A;  1K9Z A;  2OJT A;  1FBF A;  1FTJ A;  4MX6 A;  2A5T B;  1R9L A;  4ISU A;  4OWD A;  3THI A;  1FPG A;  1B58 A;  3VV5 A;  4PFU A;  3W9W A;  1DMB A;  4PAF A;  1IXC A;  1MDP 1;  2XXU A;  2F8D A;  5FHO A;  4N13 A;  1N0T A;  2HHM A;  5TU0 A;  4F1U A;  1FQD A;  4KI0 E;  1JW1 A;  4YAH X;  4H6D A;  4BDR A;  2OX3 A;  3M3F A;  3B6T A;  4FEB A;  4MCO A;  1N7X A;  4HE0 A;  1QVS A;  4YMB A;  4UAB A;  1CNQ A;  4JVI A;  3LUY A;  1O64 A;  4ZZA A;  1LAG E;  4YKK A;  3C31 A;  4N07 A;  5EQ9 A;  5A5X B;  4GL0 A;  1KZ8 A;  4ZEF A;  1MXZ A;  5CM6 A;  4F1V A;  4QSC A;  4R2F A;  3TQL A;  1MPD A;  3O6H A;  2M8C A;  2Y5L A;  5BWJ A;  1USY E;  4FE8 A;  3WAF A;  1A8F A;  3H7M A;  4KCD A;  5IZ1 A;  2HAV A;  4P9K A;  4N6D A;  4PBQ A;  4GOT A;  4R6Y A;  4JSO A;  3T9U A;  3DP6 A;  1NNF A;  4PC9 A;  3CIJ A;  2RKM A;  4H45 A;  1IZ1 A;  4O7I A;  3PUY E;  2RC9 A;  3WAE A;  2X7P A;  4YKP A;  3KJT A;  3MPK A;  1LBY A;  5ELV A;  1FPK A;  4QFN A;  3PUW E;  4GRK A;  1MPB A;  3TQW A;  1NKX A;  4Q5T A;  1OVB A;  3OMB A;  3GXA A;  3G3F A;  1B2H A;  1UTH B;  4Q8R A;  1QGX A;  3EF7 A;  4NWD A;  3DP4 A;  3CR9 A;  5EHM A;  4HE1 A;  1FTM A;  1ZJL A;  2O6A A;  3MWB A;  4NQ8 A;  3C35 A;  2PFY A;  4LON B;  1EZP A;  4U2R A;  3U93 A;  2L5V A;  3USD A;  1B7H A;  1IMC A;  2ZNS A;  4O3A A;  1FBD A;  4FAT A;  4N17 A;  4FOR A;  4GXS B;  3SEX A;  1FPI A;  4N15 A;  2WKY A;  4WEP A;  4NMY A;  4YKI A;  2P1S A;  3B7D A;  4XTC Q;  1I6Q A;  2RCA A;  5JK4 A;  4YIC A;  1NFT A;  1M5F A;  4N8G A;  3T96 B;  1DOT A;  1H45 A;  1ZU0 A;  2QS1 A;  3SDF A;  3IB2 A;  5CRY A;  3G3K A;  4X1D A;  3EKI A;  2Y7P A;  1NV0 A;  3PPP A;  1SI0 A;  2HCA A;  2THI A;  3G3I A;  1LFI A;  1JW4 A;  4DXB A;  5BUU A;  2WYP A;  4EQ9 A;  2I3V A;  4RK2 A;  5I56 A;  1AMF A;  3O6G A;  2GQ1 A;  4PFI A;  2GHB A;  3RUM A;  4PFW A;  2OBG A;  2OWS A;  4O3B A;  4QXD A;  1B7Z A;  5DEX B;  4XKR A;  5KCJ B;  2HZL A;  3C4M A;  3U8Q A;  1HSL A;  3BBR A;  1FBP A;  4PGP A;  2PT1 A;  5F24 A;  1SVX B;  2F7C A;  5I2K A;  2HXW A;  1LBV A;  1BK4 A;  2X26 A;  1O7T A;  5IM2 A;  4NF6 A;  4LUB A;  3C36 A;  4PFY A;  1ZIU A;  5EQ7 A;  1LB8 A;  1B3E A;  3CFL A;  1WOD A;  4PE3 A;  4GL8 A;  3S2V A;  4HTG A;  4ZE9 A;  1N76 A;  3RN8 A;  2RIN A;  1Y3N A;  3OD7 A;  1H43 A;  5EYF A;  1NUW A;  4OES A;  5FTH A;  2ZNU A;  1D3K A;  4F1Y A;  4LN5 A;  1POT A;  3RTF B;  2G29 A;  1YZ0 A;  2GHA A;  2PBW A;  1URG A;  3CFZ A;  1Q9D A;  1ATG A;  4MHF A;  5AA4 A;  1S7Y A;  2WBD A;  3OEL A;  4DCX A;  1N3X A;  2HQ0 A;  4MEV A;  2VP1 A;  4LZ8 A;  2Q9T A;  4ZDM A;  2F5X A;  1SPI A;  1XVX A;  1TWY A;  1B6H A;  1RDY A;  2DYX A;  4DDD A;  4R74 A;  1B9J A;  3FV2 A;  2F36 A;  1LAF E;  2Q2C A;  3K02 A;  1G0H A;  1MXU A;  4IGT A;  3HV1 A;  4ZS9 A;  1D4N A;  3H06 B;  2F3B A;  3E3K A;  3FJ7 A;  3B8B A;  1NI9 A;  1BIY A;  1H44 A;  1M5B A;  1B3L A;  1LAX A;  4I3Y A;  5LTC A;  3QK6 A;  4H0W A;  3TTR A;  4DIG A;  4H8J A;  1B3H A;  3ZSF A;  1OIB A;  2Q88 A;  2DP8 A;  3ZS6 A;  3HN0 A;  4N6P A;  3ROJ A;  2REG A;  5M2V A;  1CE2 A;  3U92 A;  1N3W A;  4RPO A;  4IR8 A;  5FTI A;  1Z7M E;  3GBB A;  4G8H A;  4GWY A;  4BLA A;  1NV3 A;  5CMK A;  2VPO A;  1IXH A;  3VVD A;  1ELJ A;  2ANJ A;  3TCH A;  4IO2 A;  4R6H A;  2O84 X;  4JBZ A;  3QUF A;  3ILT B;  4JWO A;  3M3L A;  4MNC A;  2DQV A;  3S9E A;  3HPI A;  1R6Z A;  4NX1 A;  1B51 A;  5DW8 A;  2QVR A;  3IX1 A;  3GYY A;  3S9M C;  1SYI A;  4XKQ A;  2XWK A;  5EYH A;  1IIW A;  3QSL A;  3LBS A;  1MS7 A;  1PB8 A;  2XX7 A;  3KC0 A;  3OEM A;  1FPJ A;  3TEP A;  3CHG A;  4R9F A;  4MBP A;  4NTL A;  2XD3 A;  2FNC A;  3S9L C;  4R75 A;  1Y1M A;  1ZTY A;  4TLL B;  3IO4 A;  1B32 A;  5CBR A;  1A55 A;  1B0H A;  2ABH A;  2P0S A;  1FPF A;  2Y7I A;  3PUX E;  4EDP A;  1QJM A;  5B7D A;  5JTY A;  3FXR A;  4FJP A;  4PGN A;  3TEL A;  1JNF A;  4IO5 A;  3O97 A;  2O1M A;  3O2A A;  2UYE A;  1Y1Z A;  5H8H A;  3MP1 A;  5HPQ A;  2OCU A;  4ZE8 A;  2Z8F A;  2H98 A;  1I6A A;  2F97 A;  3TYH A;  3MVX A;  3S4U A;  4H46 A;  4U1O A;  4PF8 A;  3VLU A;  1IME A;  4O7M A;  1FBH A;  2QL3 A;  1B1X A;  3PV0 E;  4ZEC A;  3I3V A;  2XWV A;  1RYX A;  4NHB A;  3KSJ A;  4C1T A;  2O7I A;  5IZ3 A;  2DXR A;  1P1W A;  3CI8 A;  1Y4T A;  4DI4 B;  1YAE A;  4IO4 A;  3CSG A;  2ZMB A;  3OO7 A;  1FTK A;  4YB7 A;  5I57 B;  2QS3 A;  2UVH A;  4R6K A;  4ELP A;  1A40 A;  1FRP A;  5AA4 B;  4MFI A;  4GVO A;  4JDF A;  4MH5 A;  3CVG A;  2Z8E A;  1RDZ A;  2DSF A;  3EHU A;  3E13 X;  2UVJ A;  3LSF B;  2V4C A;  3OXN A;  1B52 A;  2FA7 A;  2E1S A;  4ECF A;  4AB5 A;  2FVZ A;  1FQF A;  2CMO A;  3FXB A;  4GWO A;  1FBE A;  5KZT A;  4NF5 A;  5ET7 A;  1XVY A;  1LBW A;  1MY0 A;  1RKM A;  3W15 C;  5DVF A;  4OAN A;  3IO6 A;  4F3P A;  1XI6 A;  1IXI A;  1B05 A;  2FIE A;  4GWU A;  4O3C A;  4PFR A;  3PPQ A;  3SER A;  2VT5 A;  3LC8 A;  4PP0 A;  1PDA A;  3MYU A;  2PCR A;  1RYO A;  4UA8 A;  2QS4 A;  2ESN A;  3RPL A;  3IJX B;  3U1O A;  4KYD A;  2PYY A;  1EU8 A;  4F18 A;  4JB7 A;  3K4U A;  4JWX A;  1KA1 A;  3SEU A;  3PD9 A;  2UYF A;  4EXL A;  3PGF A;  3H6T A;  4PCD A;  3O28 A;  1FQE A;  1FTL A;  4GF8 A;  4NWC A;  1AL3 A;  1QUK A;  4OVT A;  2PFZ A;  5T3J A;  3PUV E;  3TCG A;  3FGS A;  1GV8 A;  3KN8 A;  1IMA A;  1NNP A;  3O9P A;  3C34 A;  4G8N A;  4MAG A;  3NOH A;  1DTZ A;  4FEC A;  1JQF A;  3HST A;  5FBP A;  1SI1 A;  4AQ4 A;  2V3Q A;  3CG3 A;  3I5O A;  3K01 A;  4ND9 A;  1XT8 A;  1B5J A;  1TFA A;  4NED A;  3KC1 A;  1OQH A;  5L9S A;  3IOW A;  3SEW A;  2VPN A;  2KR0 A;  4NN3 A;  2DOJ A;  1AOV A;  1GTK A;  2MKZ A;  4R72 A;  1EYJ A;  3Q27 A;  3SKP A;  5ET5 A;  5DEX A;  1NNK A;  2XD2 A;  3MZ9 A;  2R8T A;  1FPD A;  2DE3 A;  5CMM A;  4ONY A;  5H8H B;  4U23 A;  3JYR A;  4FBP A;  3T0J A;  1YXI A;  3LSX A;  5EQ8 A;  3KBR A;  2DWI A;  5ESY A;  3MAM A;  4LP2 B;  5TP9 B;  2ZXT A;  3H4Z A;  3N26 A;  4IB2 A;  3GBA A;  1GR2 A;  5CBS A;  1FPB A;  4KXP A;  4LZ7 A;  4ELQ A;  2XX9 A;  2QMW A;  4OMB A;  1BP5 A;  4OA4 A;  4E0X A;  2HAU A;  5IZ3 B;  3GZG A;  2CZH A;  1J1N A;  4DXU A;  1LEV A;  3KGC A;  2NUV A;  5I57 A;  3VVF A;  4UAC A;  3H6V A;  2I0C A;  3OEK A;  3L6H A;  5A5L A;  4OVR A;  5H8Q A;  1N04 A;  1SQY A;  4ZED A;  3LSW A;  4PAI A;  4N8Y A;  4P3L A;  1B3G A;  5IZZ A;  3K6W A;  2XXP A;  2XXV A;  2V3U A;  2IEE A;  1DPP A;  3MUQ A;  4G4P A;  3N5L A;  4Q30 B;  4QF9 A;  5CMB A;  2I49 A;  5F7V A;  2RF1 A;  3TOD A;  3FXQ A;  2OZZ A;  1MQD A;  1AIV A;  1IQ7 A;  1OMP A;  4NGU A;  4KD5 A;  3QMF A;  4RXL A;  3QAX A;  5H8F B;  3M8U A;  5EYG A;  4F19 A;  3DLN A;  1P99 A;  1PBQ A;  4JVD A;  3PPR A;  2VGQ A;  2XWI A;  5KDT B;  3A3C A;  1MM6 A;  1NH7 A;  2WBB A;  3CSB A;  3JV9 A;  3EHT A;  2ZYM A;  4O8M A;  4FIM A;  2VD3 A;  1IMF A;  5J1D A;  1EH3 A;  5DT6 A;  4OVS A;  1N7W A;  4O94 A;  3IB1 A;  4OZ9 A;  1BTJ A;  3RPL B;  4IY6 A;  3KBZ A;  2F78 A;  2RCB A;  4RA1 A;  4F3B A;  3O6I A;  2XXW A;  2F34 A;  4LAT A;  2B4M A;  1VR5 A;  2DE4 A;  4R73 A;  2ZZX A;  1NMU A;  4QSD A;  1YTV A;  2Z22 A;  3QIM A;  1FTO A;  2D5W A;  3H03 A;  4NF4 B;  1LBC A;  3B6Q A;  4GXA A;  3VE1 B;  4XFE A;  2FBP A;  3F11 A;  4C1U A;  2GH9 A;  1ANF A;  1P1O A;  4MIJ A;  1M5C A; 
#chains in the Genus database with same CATH homology
 1FJ9 A;  5CM6 A;  1RDX A;  1SPI A;  3EKI A;  4HCW A;  1NV0 A;  4YZZ A;  4F1V A;  5IZZ A;  1FPL A;  1RDY A;  3BIG A;  1FBG A;  4MNI A;  1FJ6 A;  3PTY A;  4GBV A;  4GWW A;  2Y5L A;  4JVC A;  2F3D A;  5ET6 A;  2BJI A;  2FVZ A;  5ET8 A;  1LBX A;  1YYZ A;  2DDK A;  4HXV A;  4P56 A;  5I3S A;  2WYP A;  3FXB A;  1IMB A;  1FPF A;  1FBE A;  3A29 A;  1NUZ A;  3KC1 A;  5IZ1 A;  4MJO A;  4P9K A;  2HPG A;  4HE2 A;  3IFA A;  1G0H A;  4N6K A;  4GWZ A;  4N6D A;  5ET7 A;  3T1B A;  2P3N A;  4NGU A;  4PBQ A;  4PAK A;  2GQ1 A;  2VPN A;  3QMF A;  4X9T A;  3RYD A;  1LBW A;  2KR0 A;  1K9Y A;  2QFL A;  4PFI A;  3W9V A;  1FPE A;  1NV7 A;  2F3B A;  4NN3 A;  2KQZ A;  4PGN A;  2MKZ A;  4P1E A;  4OAN A;  1EYJ A;  2DVZ A;  1NI9 A;  3B8B A;  4PC9 A;  2B4L A;  1XI6 A;  4H45 A;  4AS5 A;  4O7I A;  1LBZ A;  1NUY A;  5EYG A;  5ET5 A;  4F19 A;  2DE2 A;  2P3V A;  4I3Y A;  5LTC A;  1NUX A;  4QXD A;  2CEY A;  2XA5 A;  3E79 A;  2FIE A;  4GWU A;  4JVD A;  4OVQ A;  5IGA A;  2R8T A;  2XWI A;  1FPD A;  2CZK A;  2DE3 A;  2HZL A;  3IFC A;  4PFR A;  2CEX A;  2WBB A;  2HXR A;  1LBY A;  4QBA A;  4PTK A;  4OVP A;  2VT5 A;  1FPK A;  4P47 A;  4PDD A;  3ROJ A;  2V4C A;  1AWB A;  1NV1 A;  1FBP A;  2Q74 A;  3MYU A;  4FBP A;  4NG7 A;  3T0J A;  3LV0 A;  3FBP A;  4AS4 A;  4PGP A;  4MNP A;  1KA0 A;  1YXI A;  2WEF A;  2PCR A;  4MMP A;  4O8M A;  4PAI A;  5F24 A;  2QVU A;  4I40 A;  3SZP A;  4P3L A;  1JP4 A;  4PET A;  3HFU A;  1G0I A;  4IR8 A;  4XEQ A;  1IMF A;  1K9Z A;  1FBF A;  3RPL A;  4H46 A;  2WX9 A;  5J1D A;  4GWY A;  4MX6 A;  2FHY A;  4P8B A;  1NV3 A;  4OVS A;  1LBV A;  4PF8 A;  4O94 A;  4PBH A;  1BK4 A;  1NV5 A;  2FIX A;  5EQ8 A;  2JJK A;  2VPO A;  3RPL B;  4F18 A;  1IME A;  1DCU A;  3KBZ A;  5IM2 A;  1FPG A;  4O7M A;  1KA1 A;  3W9W A;  1FBH A;  4M1V A;  1D9Q A;  4PAF A;  5EQ7 A;  5ESY A;  2XXK A;  1NV4 A;  1QGX A;  2XWO A;  2ZZV A;  1FBC A;  4N4U A;  4PE3 A;  1EYK A;  2B4M A;  4GWS A;  4X8R A;  3U65 A;  1VDW A;  4PCD A;  4HE1 A;  2HHM A;  4P1L A;  4GBW A;  2DE4 A;  3B50 A;  4X04 A;  4F1U A;  2XWV A;  2ZZX A;  4MNC A;  2QVV A;  4NQ8 A;  1FPB A;  4KXP A;  1NUW A;  4NHB A;  5EQA A;  4NX1 A;  5DW8 A;  2PFY A;  2QVR A;  4NAP A;  2OWZ A;  5IZ3 A;  1DBZ A;  1INP A;  4DI3 D;  3ISP A;  3GYY A;  5LDZ A;  4G61 A;  4OA4 A;  4GWX A;  2L5V A;  2HZK A;  4LN5 A;  4XF5 A;  5J16 A;  1IMC A;  4OVT A;  4PF6 A;  1FBD A;  2PFZ A;  4N81 A;  1YZ0 A;  1NV2 A;  4GX4 A;  5IZ3 B;  5T3J A;  4DI4 B;  2XWK A;  2OX3 A;  1Q9D A;  4I3E A;  4MHF A;  5EYH A;  5I7I A;  2CZH A;  3D1R A;  4GX3 A;  4N17 A;  3E78 A;  4MCO A;  4N91 A;  1IMD A;  1LEV A;  4HE0 A;  3MST A;  1FPI A;  4N15 A;  1FSA A;  4NF0 A;  1FRP A;  1CNQ A;  4GX6 A;  4UAB A;  1EYI A;  4JVI A;  2QPQ A;  2WBD A;  3KC0 A;  5JK4 A;  4YIC A;  4PDH A;  1IMA A;  4MAG A;  1NV6 A;  1FPJ A;  2CZI A;  2WYK A;  3BIH A;  4N8G A;  1DK4 A;  3NOH A;  2Q8M A;  3CHG A;  4XFE A;  2FBP A;  2Y5K A;  1RDZ A;  5A5L A;  4OVR A;  5EQ9 A;  1FTA A;  4MEV A;  4PFB A;  2Q9T A;  2ZZW A;  3LUZ A;  5FBP A;  5I5P A;  2V3Q A;  4HCY A;  1KZ8 A;  4MIJ A;  4N8Y A;  2F5X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...