4MNPA

Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. nucleatum atcc 25586
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
305
structure length
305
Chain Sequence
KYNLKMGMTAGTSQNEYKAAEVFAKELKKRSNGEIELKLYPNAQLGKDDLAMMQQLEGGALDFTFAETGRFSTFFPEAEVFTLPYMIKDFNHMKKAVNTKFGKDLFKKVHDKKGMTVLAQAYNGTRQTTSNKAIKSLADMKGMKLRVPGAAANLAYAKYTEAAPTPMAFSEVYLALQTNAVDGQENPLSTIKAQKFYEVQKYLAMTNHILNDQLYLVSNITMEELPENLQKVVKESAEVAAEYHTKLFMDEEKSLKDFFKSKGVTITEPNLVDFKKAMKPFYDEYIKKNGKVGENAIKAIEAVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords N-acetylneuraminate-binding protein
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Fusobacterium nucleatum subsp. nucleatum
molecule tags Sugar binding protein
total genus 114
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mnpA00
4UABA 4MIJA 5I5PA 4O8MA 2WX9A 4O94A 4PBHA 2HZLA 4DI4B 2WYKA 2PFZA 2ZZVA 4PC9A 4NHBA 4YZZA 4PAIA 4PDDA 4PBQA 2WYPA 5LTCA 4PFIA 4P47A 4MNPA 2VPOA 4NGUA 4PF8A 4MNIA 2XWKA 4DI3D 4NQ8A 4PAFA 4PGNA 4P1EA 4OVRA 4N6KA 4MEVA 4MCOA 4X04A 4YICA 3FXBA 4OANA 4N15A 4N17A 4PAKA 4PE3A 4OVQA 4N4UA 4MNCA 4NN3A 4PFBA 5I7IA 4XFEA 4N6DA 4LN5A 2XWVA 4MMPA 4PCDA 2V4CA 4PFRA 4OVPA 4OA4A 4MX6A 4PETA 4O7MA 5IM2A 4XF5A 3U65A 4NX1A 4N8GA 4NAPA 4NF0A 4NG7A 4P3LA 2VPNA 4MHFA 2XWIA 3GYYA 4P9KA 4PF6A 4P56A 2CEXA 5IGAA 5CM6A 4P8BA 2ZZWA 2HZKA 2CEYA 4PGPA 2XWOA 4N91A 2XA5A 4MAGA 2ZZXA 2XXKA 4XEQA 3B50A 4OVSA 5IZZA 2PFYA 4OVTA 2HPGA 4X8RA 4PDHA 4N8YA 4P1LA
chains in the Genus database with same CATH superfamily
1JW5A 3KC1A 1XHYA 2QS3A 1P1UA 2NXOA 1HSEA 1FTJA 2HAVA 1AWBA 2Q8MA 1B32A 4G8NA 4KYEA 2QPQA 4BDNA 4F29A 2I3VA 3F11A 3LC8A 4IO2A 3TTRA 4JWOA 3FXRA 1I69A 2IEEA 1KA1A 4BDLA 3QSLA 2Z8EA 3RPLA 1I6AA 1QUKA 4F3SA 4RJZA 1H3DA 3HV1A 4IO5A 3MVWA 1ZIUA 3FVGA 4P1EA 3TFLA 1DOTA 2HAUA 1Y4CA 2XXPA 4BLAA 3KN3A 4F3GA 1Y3PA 2QSXA 3E4RA 5I84A 2HXRA 4BDOA 1B5IA 4PFBA 1MPBA 1MQJA 3ZKLA 4OVPA 3GBBA 5I3SA 1FPDA 3IL1B 3EKIA 2FHYA 2V25A 4MBPA 1XT8A 4NMYA 4G2ZA 3VVDA 5I59B 1LCFA 4XKQA 3FVNA 5IZ3A 1CNQA 4HCYA 2AIXA 3L6HA 2RCBA 3K6WA 1POTA 2QVUA 4QSCA 3IK6B 3Q27A 1IEJA 3D4GA 3MVXA 2XA5A 3KSXA 2NUVA 1P1NA 4ZZAA 3PMXA 2Q9TA 4ZE8A 4ZS9A 5JEIA 3IJOB 2Z8FA 3TCHA 1MY0A 3JV9A 3H7MA 5I5PA 3PUWE 4YKKA 5H8NB 2DQVA 1QUJA 4FBPA 1EZPA 5I57A 3I6VA 4NF6A 3G3GA 2FVZA 2V93A 4U21A 2WYKA 4GD5A 2B65A 1G0IA 4EXLA 4NHBA 3T22A 2B3BA 1RDYA 2XX9A 3HSTA 1B1HA 2ONSA 1BK4A 2XWKA 2Q89A 1Z7ME 4RK2A 1BTJA 4GWZA 2KQZA 1NH8A 1FBHA 1USYH 2Z23A 1URGA 3T9VA 3MZBA 4OETA 4NTLA 5CC2A 4PAKA 3D4CA 4OVJA 3PUVE 3ODBA 3VVEA 2CZHA 1VE4A 4AQ4A 4JVDA 3VLWA 2XD3A 4IGTA 3TTKA 3KZGA 4P3LA 4KHZE 3W9WA 1LLSA 3MVYA 4E0WA 3OEKA 3KEIA 2CEYA 1SDXA 5F24A 2RF1A 4O3BA 5DVIA 3RTFB 3C9HA 4LA9A 1B3HA 4LONB 5CMKA 4GVOA 2I0BA 3OO6A 2DWJA 4ZEDA 3S9MC 4C1TA 4G77A 2Y7KA 3PUXE 3CSBA 1B0LA 1LBBA 2PFZA 3SETA 4R73A 3TEPA 1LBZA 1XVYA 1B4HA 2ZZVA 3OXNA 2D5WA 2Q2CA 3FJMA 1JEVA 1EU8A 3FD3A 1SI0A 4ESWA 3IO6A 1R9QA 3B7DA 3MBPA 3PPOA 2X7QA 2F7AA 2AYSA 4HW8A 3C35A 3PGFA 3IB1A 3FXUA 4G68B 1R6ZA 3HO7A 3SEUA 4IY5A 4MCOA 2D3IA 1S7YA 4LUBA 1D4NA 2OJTA 1RKMA 3KN7A 4ZE9A 2OBGA 3NOHA 4MJOA 4Q0CA 4DXUA 2M8CA 3W15C 2FA7A 4OA4A 1R9LA 2OWSA 3H3GA 3MAMA 1GVCA 4N8GA 5L9OA 3G3JA 2RC8A 1B7ZA 2XWIA 3GYYA 3HFUA 4KCCA 2XXHA 4RK9A 4PF6A 4I40A 3MPLA 3S9EA 4OFOA 5ET8A 3AXFA 3K0VA 4H67A 3MZ9A 1LFIA 1XI6A 4O3AA 2XHDA 2QJEA 2ZYKA 3MSTA 1FQCA 5DVJA 3B50A 3OD7A 1INPA 2ABHA 2CZLA 5FBPA 4UABA 4NF5B 3B6TA 5EHSA 4O8MA 1SBPA 5T3JA 1OMPA 1MXVA 4HXVA 1UTHA 4PAIA 1FQEA 2O69A 2UVJA 3BKIB 3QUJA 2PYYA 4P11A 2UVGA 1MY4A 4I8CA 5L8DA 5J16A 4ZEBA 5TP9B 2Z8DA 4XKRA 4DIGA 1PC3A 4ESXA 3MWBA 2P0SA 3W9VA 1SYHA 1NV5A 1NL5A 4EF1A 1S9TA 2DE4A 4R74A 3QIMA 1IITA 4MNCA 1G0HA 4KCDA 3U94A 5I58A 1Y3QA 1ZBMA 3DELB 4I62A 4MMPA 2OWTA 4NF4B 3U72A 4G4PA 4H8IA 2AL5A 1CE2A 1HSLA 4GL8A 2XXQA 3VLVA 1J1NA 5JTYB 1NV0A 1RYOA 5FHNA 3PU5A 2XXYA 2OX3A 2REGA 5CMBA 5DW8A 5H8HA 1UIVA 3P7IA 4PFWA 1A99A 3MUQA 4AB5A 2HPGA 2A5TA 2FBPA 1Y1ZA 2H4IA 2OK2A 3M8UA 4F18A 5KCJB 4IO3A 4NWDA 1FTAA 1LBCA 1D9VA 1EZ9A 4ONYA 4POXA 3N5LA 4R6HA 3JZJA 2P3NA 3GBAA 5CMMA 4R2FA 3ZSFA 2THIA 2ZMBA 4HE2A 3VV5A 1QGXA 1NNFA 2FNCA 3TZAA 3B6QA 3RPLB 2R71A 1N0TA 3IR1A 1NV1A 1A55A 4F2QA 1FPLA 4NQ8A 1NV6A 5CI5A 5DEXA 3LSXA 4N6KA 1NNPA 2DWAA 5I2KA 1IMDA 3GLBA 1FSAA 4OVQA 1FBDA 2QVRA 1JNFA 5ET7A 5H8SA 1O63A 3CR9A 4JSOA 3WAEA 1N76A 4LN5A 1CB6A 5ESYA 3ECRA 5IM2A 1B58A 1FQFA 5CMCA 3UN6A 4FAJA 4X48A 2VPNA 4KR5A 1WDNA 3CFZA 1FPBA 3RT6B 1B52A 3BIHA 5IZ3B 1DSNA 3O97A 4GFRA 4DXBA 1LFGA 3MC2A 1JEUA 1FCKA 3TTNA 4QSDA 4R9FA 1IXHA 2ZNUA 3LR1A 2DYXA 5FHMA 4NWCA 5IZ1A 1FTLA 3FJ7A 4KXPA 3KN8A 3BFTA 3SEXA 3K01A 2WX9A 1POY1 1DK4A 5I57B 4NF6B 2O84X 4JWYA 3FASA 1SD3A 2X26A 3FXQA 4FEBA 1H76A 4PP0A 4LQ2A 1MQGA 4KI0E 5LTCA 3D1RA 4MNPA 1MH4A 4RYAA 5ISUA 4NGUA 4MNIA 3UK4A 5HPQA 1NUZA 1LAGE 5A5XA 4HE0A 2O51A 3FVOA 4LP2B 3TMGA 4PGNA 3OSQA 1B46A 3O6HA 4JBZA 4JWXA 2UYEA 3PPRA 1QKAA 4I9DA 2ZYMA 1I6BA 3UGWA 2R8TA 1MH3A 4YICA 3A09A 3SESA 1LGBC 2I49A 4C1UA 2UVHA 2PT1A 4KD5A 2QL3A 1URDA 4NN3A 1OVTA 4HCWA 3CFXA 1PB9A 2KR0A 1IUDA 2OCUA 3QMFA 4GWSA 2VP1A 1JVYA 1B3LA 4LATA 1MXUA 4P9KA 1FBEA 1AOVA 2XXRA 1Y3NA 3FIRA 2HZKA 3IX1A 4RY1A 4O3CA 4JDFA 2F78A 1B0HA 4XEQA 4H5GA 4GWXA 2XXVA 1MXZA 1DMBA 2XXIA 4QFOA 1YPNA 3OO9A 3MJNA 5L9SA 3HHFA 2ESNA 5I56A 4O94A 2JJKA 3USDA 1B2HA 1VFEA 1LBVA 4ZEIA 4YB6A 1Y20A 1H43A 1URSA 4OERA 4FIMA 1Y1MA 3WAFA 3MVZA 3KC0A 4R2BA 4OESA 2VPOA 3K02A 4G8HA 4PF8A 1FPKA 1II5A 2O1LA 4OWDA 3M3LA 1RDZA 4BDQA 3JYRA 2DWHA 2Q74A 4YMAA 4OVRA 5KZTA 4MEVA 3TCFA 4NF8A 4IGRA 2RINA 4IB2A 4OEVA 3TYHA 3C31A 4PE3A 3H6UA 4N17A 1DCUA 2QMXA 2I4CA 1LB9A 5I7IA 3Q26A 4XFEA 3RGYA 4M1VA 4PTKA 4F31B 1NV3A 1ELJA 1SQYA 3N6TA 1Q35A 4GLIA 3PD9A 4NF0A 3SKPA 4OQOA 1MXXA 4GXAA 3T9HB 2CEXA 3IOWA 1DTGA 1MY3A 4KYDA 1NUXA 1QW0A 2Z22A 4O7IA 4RXLA 2I4BA 4EF2A 3FUZA 4OVTA 1LCTA 1MRPA 4LZ7A 4LQ5A 3O6GA 4MIJA 3HPIA 4DDDA 4GX4A 3G3KA 1OQHA 2NWJA 2QS4A 4XTCQ 1JVXA 2YLNA 1MQIA 1UTHB 1TFAA 3QAXA 3FJGA 4H6DA 3MQ9A 4QFPA 3IOUA 4YKPA 5F1QA 3K4UA 2F35A 2Y5LA 4ELOA 1JW1A 2B4MA 3S9LC 1FBGA 4X04A 4MF3A 3RNNA 4M4GA 1ATGA 1B51A 3PD8A 1B9JA 1NH7A 4JB7A 3EN3A 1YZ0A 1SYIA 1ZU0A 3K6UA 1SPIA 2UXAA 4LVQA 4O7MA 1GV8A 3A29A 5L9MA 3TAJA 1BLFA 5IGAA 4P8BA 4U22A 3GXAA 1LBWA 5J1DA 1B4ZA 3TUSA 4ELQA 2RCAA 2NOOA 2AL4A 4FORA 3BBRA 3TTMA 5H8QA 1K9YA 2VHAA 1FQBA 4X8RA 2A5TB 4GF8A 3HHGA 5I2NA 4HE1A 1IMAA 1N7WA 3TODA 3DP4A 3K6VA 3PV0E 3TTLA 4POWA 1YTVA 5TU0A 3T0JA 4LZ5A 4PDDA 4U4XA 2H98A 4PFIA 3BIGA 1OVBA 1I6QA 5DYHA 2KLFA 5FTIA 1M5DA 1USYE 4WEPA 2F7BA 1AIVA 2F6GA 4JVCA 4DI3D 1FQAA 3LBSA 3IJXB 4F19A 4KYSA 4PAFA 5DEXB 3L6GA 5K2YA 1FTMA 2VGQA 4NEDA 4PQJA 2FIEA 5I2KB 1M5FA 4OFLA 1RYXA 2I3WA 4G61A 4N15A 2UYFA 1D9QA 2O1MA 4ZEFA 5EQ7A 2Q2AA 4QRZA 5A5LA 2Q88A 1YXIA 4BDRA 2CZKA 1Q1KA 4QFKA 3KGCA 2DSFA 4PETA 2Q8JA 1JETA 4GBWA 5EQ8A 3T1BA 4YU0A 3HCQA 5H8FB 1B7HA 3H6WA 1NNTA 3IB2A 5TPAA 5CM6A 3KSJA 2PMSA 2HEUA 4THIA 4X9TA 3FZVA 3U1OA 3K00A 4GL0A 2XWOA 1B3EA 2ZYNA 4IR8A 2GH9A 2VD2A 3OELA 3CIJA 1O7TA 2I58A 1LSTA 4U2RA 1P1QA 1BIYA 2L5VA 4GWOA 4H0WA 1AMFA 1EYJA 4PDHA 2HFBA 2GFEA 1ZLQA 1PB7A 1YAEA 1IMFA 1B6HA 3C4MA 2XXXA 4F3BA 3RN8A 1NI9A 5EQAA 4R75A 1F9BA 1FPJA 1B40A 4QFLA 1IXIA 4DZ1A 3O2AA 3ZKKA 5HM4B 4DXCA 3B8BA 3RLFE 3U8QA 3QXMA 5A5XB 1O64A 4QSEA 2V3TA 1TFDA 1LBYA 3RQTA 3PPPA 1NMUA 3OSRA 3N94A 4EUOA 5AA2D 1PBQA 3MP8A 4GRKA 3T66A 2OWZA 3O29A 3LV0A 3ONMA 4WXJA 4EQ9A 1B5JA 1PDAA 4AS5A 1MM6A 4PFRA 3QYTA 1NNKA 2PT2A 1HSJA 4F1UA 2FIXA 4MX6A 2UVIA 4U1OA 2DE2A 3IFCA 5BWJA 3H6TA 1NFTA 4TQUQ 2CMOA 4OYVA 3B6WA 3A3UA 4YB5A 1A54A 5HBCA 4AB6A 4FATA 5ITOA 1MQHA 4MH5A 3CFLA 2ALUA 3V83A 5KDTA 3FATA 1FTOA 3MPKA 2ONRA 1MY2A 1OQGA 1N04A 4N8YA 2HHMA 1EYIA 4ND9A 1T0KA 4H65A 3SEVA 3V5AA 4QXDA 4IO6A 5I56B 3N6UA 1XOCA 1MY1A 2O7UA 4PBHA 4GX6A 2HZLA 4H45A 5ICQA 3RTWB 1SW5A 2P1SA 3BFUA 4UACA 2ZYOA 3VE1B 3VFJA 3H4ZA 4KFQA 4ZECA 5LDZA 4H1XA 4TLMB 4YAHX 2V3UA 3I5OA 1MQDA 1MPCA 1P1OA 1SW1A 1MDQA 3QUFA 4OXVA 1A8EA 4R9GA 4DCXA 1TWYA 4Q5TA 5JTYA 4FECA 4UA8A 3OENA 4QHQA 1DPPA 1A8FA 4NF8B 2O68A 5LOMA 5AA3A 3ROJA 2DWIA 3FVKA 2R6GE 4WEDA 3RT8A 4P0IA 1SW2A 3K1MA 4N4UA 3KG2A 4I3YA 4GWWA 4BDMA 4N6DA 4YMBA 4EDPA 3LUZA 3G3IA 2Y5KA 2QVVA 4LZ8A 1IIWA 4OHNA 4F3PA 2F6PA 5IKBA 4YB7A 3K2DA 4F22A 1KZ8A 3T93B 4R6KA 1FTKA 1FW0A 4ELRA 1M5CA 3OMBA 4MLQA 1NUWA 2VOZA 3LSWA 1NV4A 2B4LA 4Z0IA 1Y9UA 2DOJA 4EXKA 2QS2A 3H03A 2ZZXA 4QF9A 1NKXA 2Y7RA 1FBFA 3DP8A 4PFTA 2VT5A 4IY6A 3M3FA 1FRPA 1JW4A 3EHTA 4RPNA 5EHMA 4DLDA 1QJMA 3H06B 1DPEA 2Y84A 2GHBA 2ONKE 5AA4A 2XXTA 2REJA 3G3HA 2PVUA 1UTBA 3TELA 1KWHA 2D21A 1YYZA 3DP6A 1FBCA 1QUIA 2VD3A 2WYPA 1EZOA 5EQ9A 2X7PA 1N7XA 3EQ1A 3G3FA 3E78A 3T9UA 1VR5A 1XS5A 3RUMA 4ECFA 4K3FA 1QKBA 4QBAA 5ELVA 3TCGA 2P2AA 1B5HA 3H6VA 4MLVA 3UP9A 5AA2A 1OLAA 5EYHA 3S9NC 1PB8A 3MYUA 1IMEA 3Q25A 3O66A 1N3WA 2B3FA 1DBZA 2DXYA 2XXUA 5BUUA 4TOZA 2A5SA 3FV2A 3O28A 2Y7IA 2XWVA 4AS4A 4GXSB 1TXFA 1VFDA 2V4CA 1VDWA 4KQPA 1D3KA 1JP4A 1ZTYA 3O6IA 1IXGA 4PFUA 3T96B 1WODA 2OLBA 3IORA 3R7XA 4E0XA 3Q28A 3CG3A 4N81A 2OZZA 4P56A 2HCAA 3M3KA 2I48A 2H9BA 1AL3A 4XKPA 2ZNSA 4MAGA 1FJ6A 4DCYA 4JSDA 5H8QB 2WBDA 1ZKBA 5I2NB 4P1LA 1L5TA 4I1DA 2E1SA 5ICTA 1OLCA 1A7LA 2DP8A 2I6EA 3VDFA 4XXUA 1FJ9A 1JQFA 3T9XB 4Q8RA 3EPEA 1XVXA 1MM7A 4JVIA 3PPQA 1VSOA 3LSFB 1ANFA 4OFJA 1XC1A 3HN0A 1A40A 4F2OA 1EH3A 3U92A 3SEYA 2NVUB 3VLUA 4P0GA 4RPOA 2O7IA 1MDP1 3TQWA 4XIGQ 4OANA 2GQ1A 2H99A 1MXYA 2PCRA 4X1BA 2HQ0A 4C0RA 1UQWA 3OO7A 3UORA 4F39A 4PFYA 5CBRA 3ZS6A 1Q9DA 1GGGA 3IOTA 4XF5A 2YJPA 4NX1A 4NAPA 5ET5A 5F7VA 1P99A 1DTZA 5I59A 1R1NA 3O9PA 5TPAB 1LB8A 3LUYA 1MG1A 2BJJX 2RC9A 4L17A 4MFIA 5I58B 3V8XB 1D9YA 2XX7A 4G68C 4QFNA 2WEFA 2XXKA 5IZZA 2PFYA 4ELPA 1N3XA 3UIFA 5ITPA 4OEUA 5DVFA 5H8NA 1SVXB 3IO4A 2F3BA 4I3EA 5H8HB 4DI4B 4GOTA 2RC7A 4YZZA 3C32A 1QULA 3EHUA 3R6UA 3PPNA 2BJIA 3RPWA 1Y4TA 2DE3A 2I0CA 3CRBA 2F36A 1LEVA 2H25A 1AH5A 1NV2A 3MZ1A 4RA1A 4R6YA 1FPIA 3OEMA 4U1ZA 4NE4A 5JK4A 3C33A 4ZEKA 2F97A 2FYIA 3R26A 4Q30B 3DLNA 4GX3A 3RY3A 3K1NA 3IOVA 3Q29A 3CI8A 3OOAA 1IQ7A 1OIBA 1BP5A 3U65A 1IZ1A 4NG7A 3TDJA 1MXWA 3PUZE 4ISUA 3THIA 5M2VA 3IB0A 1LBXA 3EF7A 4GBVA 3TKDA 4DE8A 5IAIA 2F3DA 5DTBA 1H45A 1LAFE 1B3FA 4PGPA 2G93A 4U4SA 4N91A 4N6PA 2Y7PA 3VXCA 3CG1A 5K2XA 1K9ZA 5KDTB 3A3CA 5AA1A 2QS1A 3U93A 2DVCA 3CSGA 4OTEA 3FBPA 1GR2A 2CZIA 2XXWA 3KOSA 3K1PA 3E3KA 5FHOA 5DT6A 3PUYE 5EYFA 2MKZA 3MP1A 1FQDA 2RKMA 3FV1A 2F5XA 1WVJA 3I3VA 2Y7WA 4H46A 3S4UA 4FE8A 4N07A 4N13A 4RNSA 4P47A 3VVFA 4EQ7A 5EYGA 3E13X 3TQLA 2V84A 2F34A 1ZMGA 1UIUA 3DM0A 1NV7A 3CVGA 4G68A 4ZDMA 2DS9A 5B70A 4OZ9A 3TPAA 1NUYA 3PMWA 2WKYA 1IMCA 2PBWA 2GRVA 4R72A 5CBSA 1ZJLA 2IA4A 1IXCA 1GTKA 1B1XA 1BKAA 1US4A 1PEBA 3EHSA 3V89B 1M5EA 5B7DA 2W7YA 3C36A 1SW4A 3MP6A 4OMBA 1TT1A 2ZXTA 2QMWA 2HXWA 3VXBA 3SEWA 1M5BA 2DXRA 4JXIA 1US5A 5ET6A 4MHFA 4OENA 3KJTA 4H8JA 1H44A 4G8MA 4H5FA 2XX8A 2YPNA 1KA0A 4PE5B 5FTHA 1FPFA 2ZZWA 4HTGA 4ZZEA 4GQOA 4X1DA 2GHAA 2H5YA 3N26A 2ZNTA 1P1WA 2E0SA 1QVSA 3GZGA 3IAZA 1YCJA 3PMVA 2P3VA 2PX1A 4OVSA 4EQBA 3KBZA 4IO7A 4IO4A 4NF5A 2ANJA 1B7UA 1FBPA 4KPTA 3C34A 4U23A 1Z7NE 3CHGA 3PTYA 3SZPA 1B05A 4HS7A 5AA4B 3SERA 1LAHE 3KBRA 4YKJA 1UTBB 4PC9A 1N84A 3IFAA 1IMBA 2QFLA 4PBQA 3G7WA 3K6XA 2QRYA 3KOTA 4F1YA 3E9XA 1RDXA 3SDFA 4YKIA 2O6AA 1SI1A 1B3GA 2V3QA 2WBBA 3S2VA 3FGSA 4GIZA 1PBPA 4GWUA 4FEDA 5TP9A 2DVZA 1MS7A 1FPEA 2F7CA 5AA2B 5H8FA 3FXBA 3UA8A 4XKNA 5CRYA 4Z7EA 2G29A 2XD2A 4NF4A 4PCDA 4WKMA 3KFMA 4GWYA 1MPDA 2F8DA 3QK6A 3E79A 3MW0A 1LAXA 1S50A 2R9JA 1FPGA 5AE4A 4TLLB 3ILTB 4FJPA 3LSLA 3ISPA 1LFHA 3RYDA 3ILUB 1EYKA 2DDKA 3OO8A 2LAOA 3KJ7A 4F1VA 5KCJA
chains in the Genus database with same CATH topology
1IMAA 3KC1A 1FTAA 1FJ9A 1AWBA 4F18A 2Q8MA 3T0JA 2QPQA 4PDDA 2P3NA 4JVIA 4PFIA 3BIGA 1KA1A 4HE2A 1QGXA 3RPLA 3RPLB 1NV1A 4JVCA 1FPLA 4DI3D 4NQ8A 1NV6A 4F19A 4PAFA 4P1EA 4N6KA 2FIEA 1IMDA 4OANA 2GQ1A 1FSAA 4G61A 4N15A 2PCRA 2HXRA 1D9QA 4OVQA 1FBDA 5EQ7A 2QVRA 5ET7A 4PFBA 5A5LA 1YXIA 2CZKA 4LN5A 4OVPA 5ESYA 5I3SA 1FPDA 4PETA 3EKIA 2FHYA 1Q9DA 5IM2A 4XF5A 4GBWA 4NX1A 5EQ8A 4NAPA 5ET5A 3T1BA 2VPNA 1FPBA 5IZ3A 5CM6A 1CNQA 4HCYA 3BIHA 5IZ3B 4X9TA 2QVUA 2XWOA 2XA5A 4IR8A 2WEFA 2XXKA 2Q9TA 5IZZA 5IZ1A 2PFYA 2L5VA 1EYJA 4PDHA 4KXPA 5I5PA 2WX9A 4FBPA 1DK4A 2F3BA 1IMFA 2FVZA 4I3EA 4DI4B 2WYKA 1G0IA 1NI9A 4NHBA 4YZZA 5EQAA 1FPJA 2BJIA 5LTCA 1RDYA 2DE3A 3D1RA 4MNPA 4NGUA 3B8BA 4MNIA 1NUZA 1BK4A 2XWKA 1LEVA 4HE0A 4GWZA 2KQZA 1NV2A 1FBHA 4PGNA 1LBYA 1FPIA 5JK4A 2R8TA 4YICA 4PAKA 2OWZA 3LV0A 4NN3A 4GX3A 2CZHA 4HCWA 4JVDA 2KR0A 4AS5A 4PFRA 3QMFA 4GWSA 4F1UA 2FIXA 4MX6A 2DE2A 3U65A 4NG7A 4P3LA 3IFCA 3W9WA 4P9KA 1LBXA 4GBVA 1FBEA 2F3DA 2HZKA 2CEYA 4PGPA 4N91A 5F24A 4XEQA 4GWXA 1K9ZA 3FBPA 4N8YA 2CZIA 2HHMA 1EYIA 4QXDA 4O94A 2JJKA 4PBHA 4GX6A 1LBVA 2HZLA 4H45A 2PFZA 2MKZA 1LBZA 2ZZVA 2F5XA 3KC0A 4H46A 4P47A 5LDZA 2VPOA 5EYGA 4PF8A 1FPKA 1NV7A 1RDZA 2Q74A 4OVRA 4MEVA 4MCOA 1NUYA 3ROJA 1IMCA 4N17A 4PE3A 1DCUA 3NOHA 4N4UA 4MJOA 4I3YA 5I7IA 4GWWA 4XFEA 4N6DA 4M1VA 4PTKA 1NV3A 4OA4A 3LUZA 2Y5KA 2QVVA 4N8GA 4NF0A 5ET6A 1KZ8A 4MHFA 2XWIA 3GYYA 3HFUA 4PF6A 4I40A 1KA0A 2CEXA 1FPFA 1NUWA 2ZZWA 1NV4A 2B4LA 5ET8A 1NUXA 1XI6A 3MSTA 2ZZXA 4O7IA 3B50A 2P3VA 4OVSA 1INPA 1FBFA 4OVTA 2VT5A 3KBZA 5FBPA 1FRPA 4UABA 4MIJA 1FBPA 4O8MA 3CHGA 4GX4A 3PTYA 3SZPA 5T3JA 4HXVA 4PC9A 3IFAA 1IMBA 1YYZA 4PAIA 1FBCA 2QFLA 4PBQA 2WYPA 5EQ9A 3E78A 1RDXA 4QBAA 2V3QA 2WBBA 4GWUA 5J16A 2Y5LA 2DVZA 2B4MA 5EYHA 1FPEA 1FBGA 4X04A 3MYUA 3W9VA 1IMEA 3FXBA 1NV5A 2DE4A 1DBZA 4MNCA 1G0HA 1YZ0A 2XWVA 4MMPA 4AS4A 4PCDA 2V4CA 1VDWA 1JP4A 4GWYA 3E79A 1SPIA 4O7MA 1NV0A 3A29A 1FPGA 4N81A 4P56A 5IGAA 4P8BA 2OX3A 5DW8A 1LBWA 5J1DA 3ISPA 4MAGA 3RYDA 1FJ6A 1EYKA 2DDKA 1K9YA 2HPGA 2WBDA 2FBPA 4X8RA 4F1VA 4P1LA 4HE1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UAB A;  4MIJ A;  5I5P A;  4O8M A;  2WX9 A;  4O94 A;  4PBH A;  2HZL A;  4DI4 B;  2WYK A;  2PFZ A;  2ZZV A;  4PC9 A;  4NHB A;  4YZZ A;  4PAI A;  4PDD A;  4PBQ A;  2WYP A;  5LTC A;  4PFI A;  4P47 A;  4MNP A;  2VPO A;  4NGU A;  4PF8 A;  4MNI A;  2XWK A;  4DI3 D;  4NQ8 A;  4PAF A;  4PGN A;  4P1E A;  4OVR A;  4N6K A;  4MEV A;  4MCO A;  4X04 A;  4YIC A;  3FXB A;  4OAN A;  4N15 A;  4N17 A;  4PAK A;  4PE3 A;  4OVQ A;  4N4U A;  4MNC A;  4NN3 A;  4PFB A;  5I7I A;  4XFE A;  4N6D A;  4LN5 A;  2XWV A;  4MMP A;  4PCD A;  2V4C A;  4PFR A;  4OVP A;  4OA4 A;  4MX6 A;  4PET A;  4O7M A;  5IM2 A;  4XF5 A;  3U65 A;  4NX1 A;  4N8G A;  4NAP A;  4NF0 A;  4NG7 A;  4P3L A;  2VPN A;  4MHF A;  2XWI A;  3GYY A;  4P9K A;  4PF6 A;  4P56 A;  2CEX A;  5IGA A;  5CM6 A;  4P8B A;  2ZZW A;  2HZK A;  2CEY A;  4PGP A;  2XWO A;  4N91 A;  2XA5 A;  4MAG A;  2ZZX A;  2XXK A;  4XEQ A;  3B50 A;  4OVS A;  5IZZ A;  2PFY A;  4OVT A;  2HPG A;  4X8R A;  4PDH A;  4N8Y A;  4P1L A; 
#chains in the Genus database with same CATH topology
 1JW5 A;  3KC1 A;  1XHY A;  2QS3 A;  1P1U A;  2NXO A;  1HSE A;  1FTJ A;  2HAV A;  1AWB A;  2Q8M A;  1B32 A;  4G8N A;  4KYE A;  2QPQ A;  4BDN A;  4F29 A;  2I3V A;  3F11 A;  3LC8 A;  4IO2 A;  3TTR A;  4JWO A;  3FXR A;  1I69 A;  2IEE A;  1KA1 A;  4BDL A;  3QSL A;  2Z8E A;  3RPL A;  1I6A A;  1QUK A;  4F3S A;  4RJZ A;  1H3D A;  3HV1 A;  4IO5 A;  3MVW A;  1ZIU A;  3FVG A;  4P1E A;  3TFL A;  1DOT A;  2HAU A;  1Y4C A;  2XXP A;  4BLA A;  3KN3 A;  4F3G A;  1Y3P A;  2QSX A;  3E4R A;  5I84 A;  2HXR A;  4BDO A;  1B5I A;  4PFB A;  1MPB A;  1MQJ A;  3ZKL A;  4OVP A;  3GBB A;  5I3S A;  1FPD A;  3IL1 B;  3EKI A;  2FHY A;  2V25 A;  4MBP A;  1XT8 A;  4NMY A;  4G2Z A;  3VVD A;  5I59 B;  1LCF A;  4XKQ A;  3FVN A;  5IZ3 A;  1CNQ A;  4HCY A;  2AIX A;  3L6H A;  2RCB A;  3K6W A;  1POT A;  2QVU A;  4QSC A;  3IK6 B;  3Q27 A;  1IEJ A;  3D4G A;  3MVX A;  2XA5 A;  3KSX A;  2NUV A;  1P1N A;  4ZZA A;  3PMX A;  2Q9T A;  4ZE8 A;  4ZS9 A;  5JEI A;  3IJO B;  2Z8F A;  3TCH A;  1MY0 A;  3JV9 A;  3H7M A;  5I5P A;  3PUW E;  4YKK A;  5H8N B;  2DQV A;  1QUJ A;  4FBP A;  1EZP A;  5I57 A;  3I6V A;  4NF6 A;  3G3G A;  2FVZ A;  2V93 A;  4U21 A;  2WYK A;  4GD5 A;  2B65 A;  1G0I A;  4EXL A;  4NHB A;  3T22 A;  2B3B A;  1RDY A;  2XX9 A;  3HST A;  1B1H A;  2ONS A;  1BK4 A;  2XWK A;  2Q89 A;  1Z7M E;  4RK2 A;  1BTJ A;  4GWZ A;  2KQZ A;  1NH8 A;  1FBH A;  1USY H;  2Z23 A;  1URG A;  3T9V A;  3MZB A;  4OET A;  4NTL A;  5CC2 A;  4PAK A;  3D4C A;  4OVJ A;  3PUV E;  3ODB A;  3VVE A;  2CZH A;  1VE4 A;  4AQ4 A;  4JVD A;  3VLW A;  2XD3 A;  4IGT A;  3TTK A;  3KZG A;  4P3L A;  4KHZ E;  3W9W A;  1LLS A;  3MVY A;  4E0W A;  3OEK A;  3KEI A;  2CEY A;  1SDX A;  5F24 A;  2RF1 A;  4O3B A;  5DVI A;  3RTF B;  3C9H A;  4LA9 A;  1B3H A;  4LON B;  5CMK A;  4GVO A;  2I0B A;  3OO6 A;  2DWJ A;  4ZED A;  3S9M C;  4C1T A;  4G77 A;  2Y7K A;  3PUX E;  3CSB A;  1B0L A;  1LBB A;  2PFZ A;  3SET A;  4R73 A;  3TEP A;  1LBZ A;  1XVY A;  1B4H A;  2ZZV A;  3OXN A;  2D5W A;  2Q2C A;  3FJM A;  1JEV A;  1EU8 A;  3FD3 A;  1SI0 A;  4ESW A;  3IO6 A;  1R9Q A;  3B7D A;  3MBP A;  3PPO A;  2X7Q A;  2F7A A;  2AYS A;  4HW8 A;  3C35 A;  3PGF A;  3IB1 A;  3FXU A;  4G68 B;  1R6Z A;  3HO7 A;  3SEU A;  4IY5 A;  4MCO A;  2D3I A;  1S7Y A;  4LUB A;  1D4N A;  2OJT A;  1RKM A;  3KN7 A;  4ZE9 A;  2OBG A;  3NOH A;  4MJO A;  4Q0C A;  4DXU A;  2M8C A;  3W15 C;  2FA7 A;  4OA4 A;  1R9L A;  2OWS A;  3H3G A;  3MAM A;  1GVC A;  4N8G A;  5L9O A;  3G3J A;  2RC8 A;  1B7Z A;  2XWI A;  3GYY A;  3HFU A;  4KCC A;  2XXH A;  4RK9 A;  4PF6 A;  4I40 A;  3MPL A;  3S9E A;  4OFO A;  5ET8 A;  3AXF A;  3K0V A;  4H67 A;  3MZ9 A;  1LFI A;  1XI6 A;  4O3A A;  2XHD A;  2QJE A;  2ZYK A;  3MST A;  1FQC A;  5DVJ A;  3B50 A;  3OD7 A;  1INP A;  2ABH A;  2CZL A;  5FBP A;  4UAB A;  4NF5 B;  3B6T A;  5EHS A;  4O8M A;  1SBP A;  5T3J A;  1OMP A;  1MXV A;  4HXV A;  1UTH A;  4PAI A;  1FQE A;  2O69 A;  2UVJ A;  3BKI B;  3QUJ A;  2PYY A;  4P11 A;  2UVG A;  1MY4 A;  4I8C A;  5L8D A;  5J16 A;  4ZEB A;  5TP9 B;  2Z8D A;  4XKR A;  4DIG A;  1PC3 A;  4ESX A;  3MWB A;  2P0S A;  3W9V A;  1SYH A;  1NV5 A;  1NL5 A;  4EF1 A;  1S9T A;  2DE4 A;  4R74 A;  3QIM A;  1IIT A;  4MNC A;  1G0H A;  4KCD A;  3U94 A;  5I58 A;  1Y3Q A;  1ZBM A;  3DEL B;  4I62 A;  4MMP A;  2OWT A;  4NF4 B;  3U72 A;  4G4P A;  4H8I A;  2AL5 A;  1CE2 A;  1HSL A;  4GL8 A;  2XXQ A;  3VLV A;  1J1N A;  5JTY B;  1NV0 A;  1RYO A;  5FHN A;  3PU5 A;  2XXY A;  2OX3 A;  2REG A;  5CMB A;  5DW8 A;  5H8H A;  1UIV A;  3P7I A;  4PFW A;  1A99 A;  3MUQ A;  4AB5 A;  2HPG A;  2A5T A;  2FBP A;  1Y1Z A;  2H4I A;  2OK2 A;  3M8U A;  4F18 A;  5KCJ B;  4IO3 A;  4NWD A;  1FTA A;  1LBC A;  1D9V A;  1EZ9 A;  4ONY A;  4POX A;  3N5L A;  4R6H A;  3JZJ A;  2P3N A;  3GBA A;  5CMM A;  4R2F A;  3ZSF A;  2THI A;  2ZMB A;  4HE2 A;  3VV5 A;  1QGX A;  1NNF A;  2FNC A;  3TZA A;  3B6Q A;  3RPL B;  2R71 A;  1N0T A;  3IR1 A;  1NV1 A;  1A55 A;  4F2Q A;  1FPL A;  4NQ8 A;  1NV6 A;  5CI5 A;  5DEX A;  3LSX A;  4N6K A;  1NNP A;  2DWA A;  5I2K A;  1IMD A;  3GLB A;  1FSA A;  4OVQ A;  1FBD A;  2QVR A;  1JNF A;  5ET7 A;  5H8S A;  1O63 A;  3CR9 A;  4JSO A;  3WAE A;  1N76 A;  4LN5 A;  1CB6 A;  5ESY A;  3ECR A;  5IM2 A;  1B58 A;  1FQF A;  5CMC A;  3UN6 A;  4FAJ A;  4X48 A;  2VPN A;  4KR5 A;  1WDN A;  3CFZ A;  1FPB A;  3RT6 B;  1B52 A;  3BIH A;  5IZ3 B;  1DSN A;  3O97 A;  4GFR A;  4DXB A;  1LFG A;  3MC2 A;  1JEU A;  1FCK A;  3TTN A;  4QSD A;  4R9F A;  1IXH A;  2ZNU A;  3LR1 A;  2DYX A;  5FHM A;  4NWC A;  5IZ1 A;  1FTL A;  3FJ7 A;  4KXP A;  3KN8 A;  3BFT A;  3SEX A;  3K01 A;  2WX9 A;  1POY 1;  1DK4 A;  5I57 B;  4NF6 B;  2O84 X;  4JWY A;  3FAS A;  1SD3 A;  2X26 A;  3FXQ A;  4FEB A;  1H76 A;  4PP0 A;  4LQ2 A;  1MQG A;  4KI0 E;  5LTC A;  3D1R A;  4MNP A;  1MH4 A;  4RYA A;  5ISU A;  4NGU A;  4MNI A;  3UK4 A;  5HPQ A;  1NUZ A;  1LAG E;  5A5X A;  4HE0 A;  2O51 A;  3FVO A;  4LP2 B;  3TMG A;  4PGN A;  3OSQ A;  1B46 A;  3O6H A;  4JBZ A;  4JWX A;  2UYE A;  3PPR A;  1QKA A;  4I9D A;  2ZYM A;  1I6B A;  3UGW A;  2R8T A;  1MH3 A;  4YIC A;  3A09 A;  3SES A;  1LGB C;  2I49 A;  4C1U A;  2UVH A;  2PT1 A;  4KD5 A;  2QL3 A;  1URD A;  4NN3 A;  1OVT A;  4HCW A;  3CFX A;  1PB9 A;  2KR0 A;  1IUD A;  2OCU A;  3QMF A;  4GWS A;  2VP1 A;  1JVY A;  1B3L A;  4LAT A;  1MXU A;  4P9K A;  1FBE A;  1AOV A;  2XXR A;  1Y3N A;  3FIR A;  2HZK A;  3IX1 A;  4RY1 A;  4O3C A;  4JDF A;  2F78 A;  1B0H A;  4XEQ A;  4H5G A;  4GWX A;  2XXV A;  1MXZ A;  1DMB A;  2XXI A;  4QFO A;  1YPN A;  3OO9 A;  3MJN A;  5L9S A;  3HHF A;  2ESN A;  5I56 A;  4O94 A;  2JJK A;  3USD A;  1B2H A;  1VFE A;  1LBV A;  4ZEI A;  4YB6 A;  1Y20 A;  1H43 A;  1URS A;  4OER A;  4FIM A;  1Y1M A;  3WAF A;  3MVZ A;  3KC0 A;  4R2B A;  4OES A;  2VPO A;  3K02 A;  4G8H A;  4PF8 A;  1FPK A;  1II5 A;  2O1L A;  4OWD A;  3M3L A;  1RDZ A;  4BDQ A;  3JYR A;  2DWH A;  2Q74 A;  4YMA A;  4OVR A;  5KZT A;  4MEV A;  3TCF A;  4NF8 A;  4IGR A;  2RIN A;  4IB2 A;  4OEV A;  3TYH A;  3C31 A;  4PE3 A;  3H6U A;  4N17 A;  1DCU A;  2QMX A;  2I4C A;  1LB9 A;  5I7I A;  3Q26 A;  4XFE A;  3RGY A;  4M1V A;  4PTK A;  4F31 B;  1NV3 A;  1ELJ A;  1SQY A;  3N6T A;  1Q35 A;  4GLI A;  3PD9 A;  4NF0 A;  3SKP A;  4OQO A;  1MXX A;  4GXA A;  3T9H B;  2CEX A;  3IOW A;  1DTG A;  1MY3 A;  4KYD A;  1NUX A;  1QW0 A;  2Z22 A;  4O7I A;  4RXL A;  2I4B A;  4EF2 A;  3FUZ A;  4OVT A;  1LCT A;  1MRP A;  4LZ7 A;  4LQ5 A;  3O6G A;  4MIJ A;  3HPI A;  4DDD A;  4GX4 A;  3G3K A;  1OQH A;  2NWJ A;  2QS4 A;  4XTC Q;  1JVX A;  2YLN A;  1MQI A;  1UTH B;  1TFA A;  3QAX A;  3FJG A;  4H6D A;  3MQ9 A;  4QFP A;  3IOU A;  4YKP A;  5F1Q A;  3K4U A;  2F35 A;  2Y5L A;  4ELO A;  1JW1 A;  2B4M A;  3S9L C;  1FBG A;  4X04 A;  4MF3 A;  3RNN A;  4M4G A;  1ATG A;  1B51 A;  3PD8 A;  1B9J A;  1NH7 A;  4JB7 A;  3EN3 A;  1YZ0 A;  1SYI A;  1ZU0 A;  3K6U A;  1SPI A;  2UXA A;  4LVQ A;  4O7M A;  1GV8 A;  3A29 A;  5L9M A;  3TAJ A;  1BLF A;  5IGA A;  4P8B A;  4U22 A;  3GXA A;  1LBW A;  5J1D A;  1B4Z A;  3TUS A;  4ELQ A;  2RCA A;  2NOO A;  2AL4 A;  4FOR A;  3BBR A;  3TTM A;  5H8Q A;  1K9Y A;  2VHA A;  1FQB A;  4X8R A;  2A5T B;  4GF8 A;  3HHG A;  5I2N A;  4HE1 A;  1IMA A;  1N7W A;  3TOD A;  3DP4 A;  3K6V A;  3PV0 E;  3TTL A;  4POW A;  1YTV A;  5TU0 A;  3T0J A;  4LZ5 A;  4PDD A;  4U4X A;  2H98 A;  4PFI A;  3BIG A;  1OVB A;  1I6Q A;  5DYH A;  2KLF A;  5FTI A;  1M5D A;  1USY E;  4WEP A;  2F7B A;  1AIV A;  2F6G A;  4JVC A;  4DI3 D;  1FQA A;  3LBS A;  3IJX B;  4F19 A;  4KYS A;  4PAF A;  5DEX B;  3L6G A;  5K2Y A;  1FTM A;  2VGQ A;  4NED A;  4PQJ A;  2FIE A;  5I2K B;  1M5F A;  4OFL A;  1RYX A;  2I3W A;  4G61 A;  4N15 A;  2UYF A;  1D9Q A;  2O1M A;  4ZEF A;  5EQ7 A;  2Q2A A;  4QRZ A;  5A5L A;  2Q88 A;  1YXI A;  4BDR A;  2CZK A;  1Q1K A;  4QFK A;  3KGC A;  2DSF A;  4PET A;  2Q8J A;  1JET A;  4GBW A;  5EQ8 A;  3T1B A;  4YU0 A;  3HCQ A;  5H8F B;  1B7H A;  3H6W A;  1NNT A;  3IB2 A;  5TPA A;  5CM6 A;  3KSJ A;  2PMS A;  2HEU A;  4THI A;  4X9T A;  3FZV A;  3U1O A;  3K00 A;  4GL0 A;  2XWO A;  1B3E A;  2ZYN A;  4IR8 A;  2GH9 A;  2VD2 A;  3OEL A;  3CIJ A;  1O7T A;  2I58 A;  1LST A;  4U2R A;  1P1Q A;  1BIY A;  2L5V A;  4GWO A;  4H0W A;  1AMF A;  1EYJ A;  4PDH A;  2HFB A;  2GFE A;  1ZLQ A;  1PB7 A;  1YAE A;  1IMF A;  1B6H A;  3C4M A;  2XXX A;  4F3B A;  3RN8 A;  1NI9 A;  5EQA A;  4R75 A;  1F9B A;  1FPJ A;  1B40 A;  4QFL A;  1IXI A;  4DZ1 A;  3O2A A;  3ZKK A;  5HM4 B;  4DXC A;  3B8B A;  3RLF E;  3U8Q A;  3QXM A;  5A5X B;  1O64 A;  4QSE A;  2V3T A;  1TFD A;  1LBY A;  3RQT A;  3PPP A;  1NMU A;  3OSR A;  3N94 A;  4EUO A;  5AA2 D;  1PBQ A;  3MP8 A;  4GRK A;  3T66 A;  2OWZ A;  3O29 A;  3LV0 A;  3ONM A;  4WXJ A;  4EQ9 A;  1B5J A;  1PDA A;  4AS5 A;  1MM6 A;  4PFR A;  3QYT A;  1NNK A;  2PT2 A;  1HSJ A;  4F1U A;  2FIX A;  4MX6 A;  2UVI A;  4U1O A;  2DE2 A;  3IFC A;  5BWJ A;  3H6T A;  1NFT A;  4TQU Q;  2CMO A;  4OYV A;  3B6W A;  3A3U A;  4YB5 A;  1A54 A;  5HBC A;  4AB6 A;  4FAT A;  5ITO A;  1MQH A;  4MH5 A;  3CFL A;  2ALU A;  3V83 A;  5KDT A;  3FAT A;  1FTO A;  3MPK A;  2ONR A;  1MY2 A;  1OQG A;  1N04 A;  4N8Y A;  2HHM A;  1EYI A;  4ND9 A;  1T0K A;  4H65 A;  3SEV A;  3V5A A;  4QXD A;  4IO6 A;  5I56 B;  3N6U A;  1XOC A;  1MY1 A;  2O7U A;  4PBH A;  4GX6 A;  2HZL A;  4H45 A;  5ICQ A;  3RTW B;  1SW5 A;  2P1S A;  3BFU A;  4UAC A;  2ZYO A;  3VE1 B;  3VFJ A;  3H4Z A;  4KFQ A;  4ZEC A;  5LDZ A;  4H1X A;  4TLM B;  4YAH X;  2V3U A;  3I5O A;  1MQD A;  1MPC A;  1P1O A;  1SW1 A;  1MDQ A;  3QUF A;  4OXV A;  1A8E A;  4R9G A;  4DCX A;  1TWY A;  4Q5T A;  5JTY A;  4FEC A;  4UA8 A;  3OEN A;  4QHQ A;  1DPP A;  1A8F A;  4NF8 B;  2O68 A;  5LOM A;  5AA3 A;  3ROJ A;  2DWI A;  3FVK A;  2R6G E;  4WED A;  3RT8 A;  4P0I A;  1SW2 A;  3K1M A;  4N4U A;  3KG2 A;  4I3Y A;  4GWW A;  4BDM A;  4N6D A;  4YMB A;  4EDP A;  3LUZ A;  3G3I A;  2Y5K A;  2QVV A;  4LZ8 A;  1IIW A;  4OHN A;  4F3P A;  2F6P A;  5IKB A;  4YB7 A;  3K2D A;  4F22 A;  1KZ8 A;  3T93 B;  4R6K A;  1FTK A;  1FW0 A;  4ELR A;  1M5C A;  3OMB A;  4MLQ A;  1NUW A;  2VOZ A;  3LSW A;  1NV4 A;  2B4L A;  4Z0I A;  1Y9U A;  2DOJ A;  4EXK A;  2QS2 A;  3H03 A;  2ZZX A;  4QF9 A;  1NKX A;  2Y7R A;  1FBF A;  3DP8 A;  4PFT A;  2VT5 A;  4IY6 A;  3M3F A;  1FRP A;  1JW4 A;  3EHT A;  4RPN A;  5EHM A;  4DLD A;  1QJM A;  3H06 B;  1DPE A;  2Y84 A;  2GHB A;  2ONK E;  5AA4 A;  2XXT A;  2REJ A;  3G3H A;  2PVU A;  1UTB A;  3TEL A;  1KWH A;  2D21 A;  1YYZ A;  3DP6 A;  1FBC A;  1QUI A;  2VD3 A;  2WYP A;  1EZO A;  5EQ9 A;  2X7P A;  1N7X A;  3EQ1 A;  3G3F A;  3E78 A;  3T9U A;  1VR5 A;  1XS5 A;  3RUM A;  4ECF A;  4K3F A;  1QKB A;  4QBA A;  5ELV A;  3TCG A;  2P2A A;  1B5H A;  3H6V A;  4MLV A;  3UP9 A;  5AA2 A;  1OLA A;  5EYH A;  3S9N C;  1PB8 A;  3MYU A;  1IME A;  3Q25 A;  3O66 A;  1N3W A;  2B3F A;  1DBZ A;  2DXY A;  2XXU A;  5BUU A;  4TOZ A;  2A5S A;  3FV2 A;  3O28 A;  2Y7I A;  2XWV A;  4AS4 A;  4GXS B;  1TXF A;  1VFD A;  2V4C A;  1VDW A;  4KQP A;  1D3K A;  1JP4 A;  1ZTY A;  3O6I A;  1IXG A;  4PFU A;  3T96 B;  1WOD A;  2OLB A;  3IOR A;  3R7X A;  4E0X A;  3Q28 A;  3CG3 A;  4N81 A;  2OZZ A;  4P56 A;  2HCA A;  3M3K A;  2I48 A;  2H9B A;  1AL3 A;  4XKP A;  2ZNS A;  4MAG A;  1FJ6 A;  4DCY A;  4JSD A;  5H8Q B;  2WBD A;  1ZKB A;  5I2N B;  4P1L A;  1L5T A;  4I1D A;  2E1S A;  5ICT A;  1OLC A;  1A7L A;  2DP8 A;  2I6E A;  3VDF A;  4XXU A;  1FJ9 A;  1JQF A;  3T9X B;  4Q8R A;  3EPE A;  1XVX A;  1MM7 A;  4JVI A;  3PPQ A;  1VSO A;  3LSF B;  1ANF A;  4OFJ A;  1XC1 A;  3HN0 A;  1A40 A;  4F2O A;  1EH3 A;  3U92 A;  3SEY A;  2NVU B;  3VLU A;  4P0G A;  4RPO A;  2O7I A;  1MDP 1;  3TQW A;  4XIG Q;  4OAN A;  2GQ1 A;  2H99 A;  1MXY A;  2PCR A;  4X1B A;  2HQ0 A;  4C0R A;  1UQW A;  3OO7 A;  3UOR A;  4F39 A;  4PFY A;  5CBR A;  3ZS6 A;  1Q9D A;  1GGG A;  3IOT A;  4XF5 A;  2YJP A;  4NX1 A;  4NAP A;  5ET5 A;  5F7V A;  1P99 A;  1DTZ A;  5I59 A;  1R1N A;  3O9P A;  5TPA B;  1LB8 A;  3LUY A;  1MG1 A;  2BJJ X;  2RC9 A;  4L17 A;  4MFI A;  5I58 B;  3V8X B;  1D9Y A;  2XX7 A;  4G68 C;  4QFN A;  2WEF A;  2XXK A;  5IZZ A;  2PFY A;  4ELP A;  1N3X A;  3UIF A;  5ITP A;  4OEU A;  5DVF A;  5H8N A;  1SVX B;  3IO4 A;  2F3B A;  4I3E A;  5H8H B;  4DI4 B;  4GOT A;  2RC7 A;  4YZZ A;  3C32 A;  1QUL A;  3EHU A;  3R6U A;  3PPN A;  2BJI A;  3RPW A;  1Y4T A;  2DE3 A;  2I0C A;  3CRB A;  2F36 A;  1LEV A;  2H25 A;  1AH5 A;  1NV2 A;  3MZ1 A;  4RA1 A;  4R6Y A;  1FPI A;  3OEM A;  4U1Z A;  4NE4 A;  5JK4 A;  3C33 A;  4ZEK A;  2F97 A;  2FYI A;  3R26 A;  4Q30 B;  3DLN A;  4GX3 A;  3RY3 A;  3K1N A;  3IOV A;  3Q29 A;  3CI8 A;  3OOA A;  1IQ7 A;  1OIB A;  1BP5 A;  3U65 A;  1IZ1 A;  4NG7 A;  3TDJ A;  1MXW A;  3PUZ E;  4ISU A;  3THI A;  5M2V A;  3IB0 A;  1LBX A;  3EF7 A;  4GBV A;  3TKD A;  4DE8 A;  5IAI A;  2F3D A;  5DTB A;  1H45 A;  1LAF E;  1B3F A;  4PGP A;  2G93 A;  4U4S A;  4N91 A;  4N6P A;  2Y7P A;  3VXC A;  3CG1 A;  5K2X A;  1K9Z A;  5KDT B;  3A3C A;  5AA1 A;  2QS1 A;  3U93 A;  2DVC A;  3CSG A;  4OTE A;  3FBP A;  1GR2 A;  2CZI A;  2XXW A;  3KOS A;  3K1P A;  3E3K A;  5FHO A;  5DT6 A;  3PUY E;  5EYF A;  2MKZ A;  3MP1 A;  1FQD A;  2RKM A;  3FV1 A;  2F5X A;  1WVJ A;  3I3V A;  2Y7W A;  4H46 A;  3S4U A;  4FE8 A;  4N07 A;  4N13 A;  4RNS A;  4P47 A;  3VVF A;  4EQ7 A;  5EYG A;  3E13 X;  3TQL A;  2V84 A;  2F34 A;  1ZMG A;  1UIU A;  3DM0 A;  1NV7 A;  3CVG A;  4G68 A;  4ZDM A;  2DS9 A;  5B70 A;  4OZ9 A;  3TPA A;  1NUY A;  3PMW A;  2WKY A;  1IMC A;  2PBW A;  2GRV A;  4R72 A;  5CBS A;  1ZJL A;  2IA4 A;  1IXC A;  1GTK A;  1B1X A;  1BKA A;  1US4 A;  1PEB A;  3EHS A;  3V89 B;  1M5E A;  5B7D A;  2W7Y A;  3C36 A;  1SW4 A;  3MP6 A;  4OMB A;  1TT1 A;  2ZXT A;  2QMW A;  2HXW A;  3VXB A;  3SEW A;  1M5B A;  2DXR A;  4JXI A;  1US5 A;  5ET6 A;  4MHF A;  4OEN A;  3KJT A;  4H8J A;  1H44 A;  4G8M A;  4H5F A;  2XX8 A;  2YPN A;  1KA0 A;  4PE5 B;  5FTH A;  1FPF A;  2ZZW A;  4HTG A;  4ZZE A;  4GQO A;  4X1D A;  2GHA A;  2H5Y A;  3N26 A;  2ZNT A;  1P1W A;  2E0S A;  1QVS A;  3GZG A;  3IAZ A;  1YCJ A;  3PMV A;  2P3V A;  2PX1 A;  4OVS A;  4EQB A;  3KBZ A;  4IO7 A;  4IO4 A;  4NF5 A;  2ANJ A;  1B7U A;  1FBP A;  4KPT A;  3C34 A;  4U23 A;  1Z7N E;  3CHG A;  3PTY A;  3SZP A;  1B05 A;  4HS7 A;  5AA4 B;  3SER A;  1LAH E;  3KBR A;  4YKJ A;  1UTB B;  4PC9 A;  1N84 A;  3IFA A;  1IMB A;  2QFL A;  4PBQ A;  3G7W A;  3K6X A;  2QRY A;  3KOT A;  4F1Y A;  3E9X A;  1RDX A;  3SDF A;  4YKI A;  2O6A A;  1SI1 A;  1B3G A;  2V3Q A;  2WBB A;  3S2V A;  3FGS A;  4GIZ A;  1PBP A;  4GWU A;  4FED A;  5TP9 A;  2DVZ A;  1MS7 A;  1FPE A;  2F7C A;  5AA2 B;  5H8F A;  3FXB A;  3UA8 A;  4XKN A;  5CRY A;  4Z7E A;  2G29 A;  2XD2 A;  4NF4 A;  4PCD A;  4WKM A;  3KFM A;  4GWY A;  1MPD A;  2F8D A;  3QK6 A;  3E79 A;  3MW0 A;  1LAX A;  1S50 A;  2R9J A;  1FPG A;  5AE4 A;  4TLL B;  3ILT B;  4FJP A;  3LSL A;  3ISP A;  1LFH A;  3RYD A;  3ILU B;  1EYK A;  2DDK A;  3OO8 A;  2LAO A;  3KJ7 A;  4F1V A;  5KCJ A; 
#chains in the Genus database with same CATH homology
 1IMA A;  3KC1 A;  1FTA A;  1FJ9 A;  1AWB A;  4F18 A;  2Q8M A;  3T0J A;  2QPQ A;  4PDD A;  2P3N A;  4JVI A;  4PFI A;  3BIG A;  1KA1 A;  4HE2 A;  1QGX A;  3RPL A;  3RPL B;  1NV1 A;  4JVC A;  1FPL A;  4DI3 D;  4NQ8 A;  1NV6 A;  4F19 A;  4PAF A;  4P1E A;  4N6K A;  2FIE A;  1IMD A;  4OAN A;  2GQ1 A;  1FSA A;  4G61 A;  4N15 A;  2PCR A;  2HXR A;  1D9Q A;  4OVQ A;  1FBD A;  5EQ7 A;  2QVR A;  5ET7 A;  4PFB A;  5A5L A;  1YXI A;  2CZK A;  4LN5 A;  4OVP A;  5ESY A;  5I3S A;  1FPD A;  4PET A;  3EKI A;  2FHY A;  1Q9D A;  5IM2 A;  4XF5 A;  4GBW A;  4NX1 A;  5EQ8 A;  4NAP A;  5ET5 A;  3T1B A;  2VPN A;  1FPB A;  5IZ3 A;  5CM6 A;  1CNQ A;  4HCY A;  3BIH A;  5IZ3 B;  4X9T A;  2QVU A;  2XWO A;  2XA5 A;  4IR8 A;  2WEF A;  2XXK A;  2Q9T A;  5IZZ A;  5IZ1 A;  2PFY A;  2L5V A;  1EYJ A;  4PDH A;  4KXP A;  5I5P A;  2WX9 A;  4FBP A;  1DK4 A;  2F3B A;  1IMF A;  2FVZ A;  4I3E A;  4DI4 B;  2WYK A;  1G0I A;  1NI9 A;  4NHB A;  4YZZ A;  5EQA A;  1FPJ A;  2BJI A;  5LTC A;  1RDY A;  2DE3 A;  3D1R A;  4MNP A;  4NGU A;  3B8B A;  4MNI A;  1NUZ A;  1BK4 A;  2XWK A;  1LEV A;  4HE0 A;  4GWZ A;  2KQZ A;  1NV2 A;  1FBH A;  4PGN A;  1LBY A;  1FPI A;  5JK4 A;  2R8T A;  4YIC A;  4PAK A;  2OWZ A;  3LV0 A;  4NN3 A;  4GX3 A;  2CZH A;  4HCW A;  4JVD A;  2KR0 A;  4AS5 A;  4PFR A;  3QMF A;  4GWS A;  4F1U A;  2FIX A;  4MX6 A;  2DE2 A;  3U65 A;  4NG7 A;  4P3L A;  3IFC A;  3W9W A;  4P9K A;  1LBX A;  4GBV A;  1FBE A;  2F3D A;  2HZK A;  2CEY A;  4PGP A;  4N91 A;  5F24 A;  4XEQ A;  4GWX A;  1K9Z A;  3FBP A;  4N8Y A;  2CZI A;  2HHM A;  1EYI A;  4QXD A;  4O94 A;  2JJK A;  4PBH A;  4GX6 A;  1LBV A;  2HZL A;  4H45 A;  2PFZ A;  2MKZ A;  1LBZ A;  2ZZV A;  2F5X A;  3KC0 A;  4H46 A;  4P47 A;  5LDZ A;  2VPO A;  5EYG A;  4PF8 A;  1FPK A;  1NV7 A;  1RDZ A;  2Q74 A;  4OVR A;  4MEV A;  4MCO A;  1NUY A;  3ROJ A;  1IMC A;  4N17 A;  4PE3 A;  1DCU A;  3NOH A;  4N4U A;  4MJO A;  4I3Y A;  5I7I A;  4GWW A;  4XFE A;  4N6D A;  4M1V A;  4PTK A;  1NV3 A;  4OA4 A;  3LUZ A;  2Y5K A;  2QVV A;  4N8G A;  4NF0 A;  5ET6 A;  1KZ8 A;  4MHF A;  2XWI A;  3GYY A;  3HFU A;  4PF6 A;  4I40 A;  1KA0 A;  2CEX A;  1FPF A;  1NUW A;  2ZZW A;  1NV4 A;  2B4L A;  5ET8 A;  1NUX A;  1XI6 A;  3MST A;  2ZZX A;  4O7I A;  3B50 A;  2P3V A;  4OVS A;  1INP A;  1FBF A;  4OVT A;  2VT5 A;  3KBZ A;  5FBP A;  1FRP A;  4UAB A;  4MIJ A;  1FBP A;  4O8M A;  3CHG A;  4GX4 A;  3PTY A;  3SZP A;  5T3J A;  4HXV A;  4PC9 A;  3IFA A;  1IMB A;  1YYZ A;  4PAI A;  1FBC A;  2QFL A;  4PBQ A;  2WYP A;  5EQ9 A;  3E78 A;  1RDX A;  4QBA A;  2V3Q A;  2WBB A;  4GWU A;  5J16 A;  2Y5L A;  2DVZ A;  2B4M A;  5EYH A;  1FPE A;  1FBG A;  4X04 A;  3MYU A;  3W9V A;  1IME A;  3FXB A;  1NV5 A;  2DE4 A;  1DBZ A;  4MNC A;  1G0H A;  1YZ0 A;  2XWV A;  4MMP A;  4AS4 A;  4PCD A;  2V4C A;  1VDW A;  1JP4 A;  4GWY A;  3E79 A;  1SPI A;  4O7M A;  1NV0 A;  3A29 A;  1FPG A;  4N81 A;  4P56 A;  5IGA A;  4P8B A;  2OX3 A;  5DW8 A;  1LBW A;  5J1D A;  3ISP A;  4MAG A;  3RYD A;  1FJ6 A;  1EYK A;  2DDK A;  1K9Y A;  2HPG A;  2WBD A;  2FBP A;  4X8R A;  4F1V A;  4P1L A;  4HE1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...