4MNPA

Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. nucleatum atcc 25586
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
305
structure length
305
Chain Sequence
KYNLKMGMTAGTSQNEYKAAEVFAKELKKRSNGEIELKLYPNAQLGKDDLAMMQQLEGGALDFTFAETGRFSTFFPEAEVFTLPYMIKDFNHMKKAVNTKFGKDLFKKVHDKKGMTVLAQAYNGTRQTTSNKAIKSLADMKGMKLRVPGAAANLAYAKYTEAAPTPMAFSEVYLALQTNAVDGQENPLSTIKAQKFYEVQKYLAMTNHILNDQLYLVSNITMEELPENLQKVVKESAEVAAEYHTKLFMDEEKSLKDFFKSKGVTITEPNLVDFKKAMKPFYDEYIKKNGKVGENAIKAIEAVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords N-acetylneuraminate-binding protein
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Fusobacterium nucleatum subsp. nucleatum
total genus 114
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mnpA00
4P56A 2ZZWA 4PDDA 4MMPA 4PAFA 4P1EA 2CEXA 4N6KA 4PAIA 4PFBA 4O8MA 2XWIA 4N91A 4XFEA 4P47A 4PF6A 4MHFA 4NG7A 5LTCA 4OVPA 4N4UA 4MAGA 3B50A 4OVSA 2VPOA 2WYPA 3GYYA 4X04A 4NGUA 4N8GA 4YICA 4PBQA 4PGPA 4PETA 4MEVA 4PGNA 5IM2A 4PCDA 4NHBA 4MIJA 5CM6A 4OA4A 2CEYA 2PFZA 2XWVA 2ZZXA 4P3LA 4P8BA 4OVQA 4OVRA 4O7MA 4LN5A 5I7IA 4X8RA 4OVTA 4DI4B 5IZZA 4NX1A 2HZLA 2ZZVA 4O94A 2WX9A 4N6DA 2XWOA 4MX6A 2V4CA 4PE3A 4PAKA 4PC9A 2PFYA 4MNIA 4PDHA 4XEQA 4N15A 4P1LA 2WYKA 3U65A 2HPGA 5IGAA 4NF0A 5I5PA 4MNCA 4XF5A 4YZZA 2VPNA 4N17A 4N8YA 2XWKA 2XA5A 4OANA 4NAPA 4PFRA 2HZKA 4DI3D 4UABA 2XXKA 4P9KA 4PBHA 3FXBA 4PF8A 4NN3A 4NQ8A 4MNPA 4MCOA 4PFIA
chains in the Genus database with same CATH superfamily
4EDPA 2Q74A 3B7DA 4MMPA 4NF6A 1YCJA 1JP4A 3H6TA 2G93A 3MJNA 4OMBA 4P47A 1J1NA 4RA1A 4OVPA 4EQ7A 3OEMA 3PMXA 4ZECA 3USDA 2YJPA 1MY0A 1N84A 5B70A 4F3BA 5ESYA 5ELVA 4GRKA 4RY1A 1OVTA 2QL3A 4KD5A 4Q30B 2XWVA 3HPIA 1I69A 3S2VA 3DP8A 5I59B 4YKKA 2M8CA 3CSBA 2QVVA 4MBPA 5I56B 3ZKLA 4QF9A 2ZYOA 1ZBMA 3MUQA 1XI6A 5DYHA 2G29A 4XTCQ 3O28A 4KCCA 4PE3A 3TEPA 4KYDA 3QUJA 4JSDA 5F7VA 3RYDA 3LR1A 3IR1A 3C4MA 3G3GA 2HPGA 1LBXA 1FTAA 1NFTA 1FTOA 2PCRA 5DEXA 4EXKA 2HCAA 4ZDMA 4DCXA 3KJ7A 4G8NA 3V83A 4FE8A 3TMGA 3VVEA 5IZ3A 2YPNA 4YMBA 1MY3A 1YTVA 5KCJA 4Q5TA 3M3KA 1M5BA 5EHMA 3C34A 2VD3A 1QKAA 5H8QA 1B32A 2ZZWA 1IXCA 3A3UA 5EYGA 4NF6B 3RN8A 1MH4A 1FRPA 1H45A 3KBRA 1MS7A 4O8MA 1MXZA 3LBSA 1NNPA 3UGWA 1O63A 4ZEDA 3THIA 3LSLA 4NG7A 3RLFE 3DP6A 1Y9UA 1NUYA 3H4ZA 3IOVA 3O29A 2V93A 1P1WA 4PQJA 1FQFA 5L9SA 3BKIB 3FD3A 4NTLA 2QJEA 3TUSA 2O84X 5L9MA 4HE2A 4PBQA 1MQIA 1PB8A 4PETA 4LZ7A 2CZKA 1B5JA 2HXRA 4H8JA 2YLNA 4IO4A 4U2RA 5ITOA 3O6HA 5CBSA 2QS3A 4JVCA 4EQBA 5ICQA 1FBPA 5HM4B 2XXUA 1POY1 3B6TA 2Q88A 3U94A 1G0IA 2ONRA 2OK2A 4H5FA 2Q2CA 3TTMA 2UVHA 1JW4A 1N04A 1A99A 4PDHA 3HCQA 3PU5A 3GZGA 3V89B 5IGAA 2RKMA 5DEXB 4GX6A 1CE2A 5AA2A 2Y5KA 1URGA 3GBAA 5IZ3B 2CZIA 2UYEA 2DVZA 2F97A 1JETA 5KCJB 3N6UA 3IL1B 3FXBA 5H8QB 2P3NA 1NI9A 3LUYA 2OZZA 1ZU0A 5A5XA 1SBPA 4LZ8A 3PV0E 3IO6A 1LBBA 2OBGA 4NF5A 3H3GA 4R73A 1MY4A 1LFGA 1VR5A 4OHNA 3TODA 5IZ1A 3MBPA 4F31B 4GXAA 4GWOA 1MQHA 4OVSA 2V3UA 4GQOA 2F8DA 4G77A 3MQ9A 3BFUA 1JW1A 1B46A 2I4BA 3E13X 3VFJA 1N7XA 4YAHX 4AB5A 3NOHA 4KCDA 3S9LC 1B3HA 2VD2A 3LSFB 4RNSA 2NOOA 2HFBA 4WEDA 4F3PA 4I3YA 3G3IA 4ND9A 4XKNA 2XX7A 2ZMBA 4R6KA 2DWJA 1A8EA 4FEDA 2QVUA 4YKPA 3K0VA 2X7QA 5FTIA 4OVTA 4GWYA 2Z23A 1ZKBA 1YZ0A 3PPPA 3K00A 3CI8A 1OLAA 4U4XA 4POWA 1K9ZA 2UVGA 1SVXB 4ELOA 1N7WA 3RPWA 4LA9A 4H65A 1MQGA 2E0SA 1HSEA 1OQHA 4RJZA 4PFUA 1N3WA 5I5PA 2UXAA 5AA2B 3OO8A 2A5SA 2XA5A 1XVYA 3OMBA 1NNKA 3O66A 4BLAA 3QYTA 3C31A 1I6QA 1MXWA 4OTEA 4PAFA 4PFYA 3U72A 3TKDA 4OESA 5A5XB 2KR0A 4NF5B 2ZXTA 2O1MA 1GVCA 5CC2A 1MXXA 4PP0A 5DVFA 1IIWA 1UIVA 4MHFA 4O7IA 2H99A 1B5IA 4LP2B 3CRBA 2NUVA 2B3BA 4ZEKA 1O64A 4ZEBA 4R9GA 1IMDA 4OXVA 4GBWA 3OO6A 3TCFA 1FTMA 3LV0A 1Q35A 3OENA 4OA4A 3TFLA 1XS5A 1G0HA 2O51A 2ZZXA 3H6UA 3D4GA 3N26A 4FATA 1IXIA 3FATA 2BJIA 4O3BA 4ESWA 3CG1A 4X1BA 1LBCA 2Y7PA 2HAVA 4PC9A 3EPEA 1P1UA 2L5VA 1A54A 1N3XA 4FORA 2QSXA 3Q28A 2UYFA 1QUIA 5EYHA 2F35A 1WDNA 4XF5A 2XX8A 3UORA 4NE4A 3JV9A 1H44A 4OANA 3T9XB 1DPEA 2Q89A 3FUZA 4I9DA 4R2FA 2MKZA 3BBRA 2QFLA 3TTNA 3MSTA 5M2VA 4X9TA 2Y5LA 4IGRA 4P0GA 4IO2A 4YB7A 3U8QA 5IKBA 2I48A 3SEUA 1MXVA 4L17A 3MPLA 2FIEA 1N0TA 1B4ZA 4EF1A 1FJ6A 1PBPA 3SESA 4OFLA 5FBPA 3LSXA 3U1OA 4UA8A 1CNQA 2AIXA 1TFAA 3O97A 3CFZA 1IUDA 3IO4A 2F3DA 3EN3A 4HXVA 1LGBC 4OQOA 1OMPA 1VDWA 1NV7A 2PFZA 1M5CA 1FBEA 3M3FA 2HAUA 1SYHA 3SKPA 3P7IA 5I7IA 4XKRA 3RY3A 2ZYNA 4DI4B 2O69A 1NV0A 4F2OA 3LUZA 1Y1ZA 4GOTA 3C35A 2R71A 4LQ2A 3ZS6A 2FVZA 4MX6A 4TLMB 2PVUA 2QS4A 2HXWA 2DE2A 4QFNA 3O2AA 3PTYA 5CMBA 3ECRA 2IEEA 4GBVA 3W9VA 3M8UA 4GLIA 4YB6A 3L6HA 1D4NA 3FXUA 5AA4A 3Q25A 4K3FA 3S9MC 3DP4A 4QSCA 1D9QA 1URSA 3BIHA 1CB6A 3C33A 1ZTYA 3OEKA 3UK4A 4ELPA 4GF8A 2GRVA 4JWXA 1IMCA 1JEVA 1P1QA 4DCYA 2QMWA 1NV2A 3CHGA 2I0BA 1MQJA 1AMFA 3VVDA 3GYYA 1P1OA 1M5FA 3H03A 4ZE9A 4MEVA 2H25A 4BDRA 1AH5A 1FTJA 1LCTA 4R72A 2VP1A 1SW4A 1KA1A 4MFIA 4MIJA 2CEYA 2FBPA 3C9HA 4GXSB 4QSDA 2I3WA 1LAFE 4LN5A 3MP1A 3KGCA 4GX4A 4KPTA 1BP5A 3KC0A 3RQTA 4NWCA 1EYJA 1LAXA 3BIGA 4YMAA 2ZYMA 4C1TA 3S9EA 2GQ1A 3A29A 3IOUA 3HFUA 4JVIA 1LFIA 2GHBA 5DT6A 1M5EA 1B2HA 1FPKA 3K4UA 3SEXA 2DE3A 3IX1A 5JTYA 5AA4B 1RDYA 3SETA 4N07A 2Z8DA 4THIA 3TDJA 1R6ZA 4NN3A 2F6GA 3PUYE 4R9FA 4OVJA 4G68C 2F7BA 1FW0A 4ZEFA 2ANJA 3MP8A 1TT1A 4POXA 3IOTA 3PPNA 2XXXA 1SD3A 4LUBA 1H76A 4EF2A 3FJ7A 1B0HA 1MY1A 1IXHA 3ILUB 2D21A 4FJPA 1EZOA 3Q29A 4IY6A 4DLDA 1B7ZA 1FQBA 1M5DA 1B1HA 4YICA 5AA1A 1MPCA 4NMYA 1OIBA 2WBDA 1SI1A 3T96B 2NVUB 1OVBA 4OVRA 5I2NA 3K02A 3SEWA 3MC2A 1K9YA 1H43A 1D3KA 5DVIA 3T1BA 4NX1A 3TELA 2WX9A 2DVCA 4MLVA 1B7UA 1MM6A 2FIXA 3R7XA 1AOVA 1A7LA 3FXRA 1NV1A 4LONB 5J1DA 3TTKA 2H9BA 3OSRA 3IB2A 1NMUA 4NF4A 4QFPA 3T22A 3C32A 3V8XB 3I3VA 1YAEA 4F19A 5TPAA 1MY2A 4F1VA 5JTYB 2V3TA 1FPJA 1PC3A 1B5HA 3ZSFA 3E79A 4JVDA 5I84A 4DXUA 4G68A 1P1NA 4AQ4A 3CSGA 2HHMA 1NL5A 1IITA 2OLBA 2X26A 4HCWA 1Y4TA 4IO3A 1URDA 3C36A 3I5OA 5I57A 1VFEA 1FQAA 1S9TA 2QRYA 4HE1A 2I6EA 4Z0IA 4KXPA 2Y7WA 3TTRA 4GWZA 3UA8A 3K01A 4N8GA 1LAHE 1NV4A 1OQGA 4UACA 4JSOA 1PDAA 3KSXA 3TTLA 5I2NB 3IJXB 3HO7A 3T93B 1MXUA 4AS4A 2DYXA 1Q9DA 3FASA 2DE4A 2FHYA 4H8IA 3SEYA 1NV3A 1FBDA 3ODBA 4O3CA 4RPOA 5H8HA 1BIYA 1FBHA 3O9PA 1MM7A 1Z7ME 3T9VA 4OENA 2B3FA 1FBCA 3RNNA 1UQWA 4QFLA 2O7UA 4EUOA 1IZ1A 4KYSA 2V25A 4H67A 3MVYA 1WODA 5L9OA 3K6XA 4NF4B 4ZEIA 2B65A 1DPPA 3D4CA 3R6UA 5TPAB 4F39A 4N17A 4N8YA 4QHQA 5L8DA 4R74A 1B58A 5TU0A 1EU8A 5K2XA 4PBHA 4IO6A 4RXLA 3QXMA 1SPIA 2DXYA 4G68B 1AWBA 3K1MA 3A3CA 3H6WA 4WEPA 3EHSA 5ICTA 3SDFA 4NWDA 1FQEA 3KN7A 2F3BA 4XFEA 3TPAA 3WAEA 4R2BA 5I2KA 5I57B 4ZS9A 2DDKA 4MAGA 1FPLA 3SZPA 2Z22A 4OYVA 4EQ9A 1MPBA 3RPLA 1FPIA 3PD8A 4OFOA 3KZGA 4PGPA 1XC1A 1INPA 1F9BA 2QS1A 3IORA 3A09A 1FTKA 1R9QA 4PCDA 5K2YA 3HSTA 5CM6A 5AE4A 4QFOA 5FHOA 1QUJA 4BDOA 2PX1A 1VSOA 5JK4A 4KFQA 4O94A 4HCYA 1II5A 4WKMA 3VLWA 3CR9A 2XWOA 4ONYA 5H8HB 1B0LA 4JWOA 2OWSA 4KI0E 1T0KA 4QBAA 5CMMA 3R26A 1DBZA 4MH5A 4BDNA 1R1NA 1RYXA 3TQWA 5DTBA 1YXIA 1FSAA 3OSQA 3G3JA 3JZJA 3N6TA 4QXDA 3W15C 1NH7A 1NV6A 4IB2A 4YZZA 3CVGA 2Y84A 1EZ9A 2QVRA 2I58A 2IA4A 5LOMA 2XXQA 4HS7A 2ALUA 4U21A 5ET6A 4HW8A 3MP6A 3VE1B 2OCUA 2XXKA 2RCAA 3CFLA 1NNFA 5EQ7A 4MNPA 3KG2A 2Q8JA 4P56A 3PPOA 2B4LA 3W9WA 1ZLQA 1LFHA 1RKMA 1MDQA 3EHUA 4TQUQ 4E0WA 2AL5A 3FV2A 4FEBA 4R6YA 1PB7A 3E9XA 4PF6A 5I2KB 3T9UA 5EQ8A 2H5YA 3LSWA 3T66A 2WYPA 2DS9A 3RPLB 4JXIA 3EHTA 1MG1A 4Q0CA 2PT2A 3FVNA 1DTZA 2XXVA 1XT8A 5BWJA 2WBBA 4FBPA 3RUMA 1BLFA 3U93A 1H3DA 4R75A 5ISUA 3KFMA 1Y4CA 4F3SA 1A40A 1GR2A 2H98A 2I0CA 1FBGA 1LEVA 1GGGA 3IFCA 1NNTA 3B6WA 1QVSA 1AL3A 1GTKA 5KDTA 4U1OA 5H8FA 1Y1MA 3ROJA 1IXGA 1JVYA 1OLCA 1GV8A 3S4UA 3OO7A 4N81A 4NEDA 2XXIA 1R9LA 1US5A 3T9HB 2WYKA 1UTBA 3MZ1A 1QJMA 1Q1KA 2THIA 3PD9A 1QUKA 2VT5A 4P11A 2F5XA 2XWKA 5ITPA 1FBFA 4F18A 2REGA 1D9YA 3E78A 4P9KA 2Z8FA 2ZNUA 2QMXA 1B7HA 4ZZEA 3ZKKA 3QIMA 1SQYA 5JEIA 3PGFA 3VXCA 2CEXA 2LAOA 3PPRA 5EYFA 2ESNA 4DDDA 5CRYA 2OJTA 1S7YA 3QK6A 4GWWA 1FTLA 4OZ9A 1QULA 4H5GA 1MDP1 3FJGA 4ECFA 3PUXE 3AXFA 2VPOA 4KYEA 2Q8MA 4X04A 1B3LA 1SI0A 3N94A 1BTJA 4IR8A 2RINA 4NHBA 1FPGA 4LZ5A 5DW8A 4OVQA 5J16A 3IJOB 3H6VA 1DTGA 3D1RA 1LBZA 2RC8A 2Q9TA 3T0JA 5KDTB 1FPEA 5H8FB 3EKIA 2ONSA 5TP9A 1QKBA 4RPNA 4RYAA 1JQFA 4PFWA 1MH3A 1UTBB 3H06B 5AA3A 4QFKA 1O7TA 4NF0A 3VXBA 1SW1A 3O6IA 3RT8A 4F29A 4U4SA 1FJ9A 2VPNA 5ET5A 2X7PA 3IFAA 3PUVE 4UABA 3B6QA 4F2QA 3CFXA 3TYHA 1UTHA 1LBVA 4PFIA 3GLBA 1LBWA 4X48A 2OWTA 4RK2A 3TCHA 4PAIA 3OD7A 1FPDA 4TLLB 1DSNA 1ZMGA 3PUZE 3TQLA 4Z7EA 4F22A 3KEIA 5LTCA 2Q2AA 3B50A 2P1SA 4C1UA 3G3HA 3RGYA 3FXQA 3K6VA 2WKYA 2RC9A 4BDLA 1S50A 4IGTA 1MXYA 4OEVA 4LQ5A 3MVZA 4F1YA 1LAGE 1XVXA 2CZLA 3G3KA 2JJKA 4PFTA 2V3QA 1UIUA 5CMCA 1FPBA 2BJJX 3K6UA 4I62A 1IMEA 1LSTA 3MW0A 2P0SA 2XXHA 3GXAA 4MJOA 3K1NA 1ANFA 4RK9A 5H8SA 3FJMA 5AA2D 2Y7KA 5TP9B 2XHDA 4M1VA 2ZNSA 3RTWB 3FZVA 1WVJA 3KN3A 2QS2A 4XKPA 1B05A 1MRPA 1B9JA 3MYUA 3FGSA 1VFDA 1B52A 4JBZA 4O3AA 4XXUA 1L5TA 3MWBA 4PTKA 5EHSA 4PF8A 1NUXA 1DCUA 1MPDA 3E4RA 1UTHB 2OX3A 5IAIA 3ILTB 1POTA 3UIFA 5BUUA 2B4MA 3MVXA 3L6GA 4U22A 3VVFA 4PFBA 1BK4A 3PMWA 3O6GA 5HPQA 4OERA 4WXJA 3UP9A 2PMSA 5F24A 3Q27A 1ATGA 4KR5A 2DXRA 3KOTA 1LB9A 3EF7A 3GBBA 1IEJA 3TCGA 3QSLA 2FA7A 3KOSA 3FIRA 4GD5A 1ZIUA 4H1XA 4HE0A 3HV1A 2I4CA 2RC7A 4KQPA 4PGNA 4ZE8A 1SW2A 2R6GE 2KQZA 4G2ZA 5HBCA 3CG3A 1FQDA 2XXTA 2DWHA 3G3FA 4BDMA 5F1QA 4ISUA 4O7MA 5FTHA 4FIMA 4MF3A 1QW0A 2DSFA 3PMVA 5T3JA 5IZZA 5I58A 1B40A 3OOAA 2O6AA 2D5WA 4OETA 3QMFA 4N6PA 2V4CA 2RCBA 2I49A 4G61A 2F7CA 4YU0A 4DZ1A 3U65A 1JNFA 3SERA 2XX9A 1B1XA 2O68A 2REJA 3IK6B 4F3GA 4HTGA 2F78A 3FBPA 2O1LA 5EQ9A 4GIZA 5CI5A 4QSEA 2XXRA 5FHMA 5EQAA 1I6AA 1DMBA 2FNCA 4PDDA 2UVIA 4DXBA 4P1EA 3E3KA 4OFJA 2I3VA 3MZ9A 1XHYA 4XKQA 1EH3A 4U1ZA 4Q8RA 1YPNA 2ZYKA 4OEUA 4N4UA 3KC1A 4IY5A 1JEUA 3M3LA 3VV5A 4DXCA 3KSJA 3F11A 1I6BA 1LLSA 1IMBA 4NGUA 2P2AA 2HEUA 1DOTA 3IB0A 4NF8A 4AB6A 4DE8A 4E0XA 1IMAA 4EXLA 3LC8A 4N13A 1FPFA 4P8BA 1FQCA 5DVJA 4H45A 4GFRA 3FVKA 4GVOA 5FHNA 3IAZA 1XOCA 4PE5B 5I58B 2PYYA 1LCFA 1PBQA 3DELB 2A5TA 3WAFA 3CIJA 1RDXA 1TWYA 3RTFB 4GWXA 4M4GA 2WEFA 4ESXA 4OWDA 3KN8A 1JW5A 2PFYA 4MNIA 1KA0A 3HHGA 3DM0A 3K6WA 4ELQA 3UN6A 3IB1A 4G4PA 3IOWA 4DIGA 2ONKE 1EYIA 2AYSA 2XXPA 3TAJA 1HSJA 4ELRA 1TFDA 2O7IA 1NKXA 4NAPA 4PFRA 4X1DA 3VLUA 4ZZAA 2HQ0A 4LVQA 2GHAA 1JVXA 2NXOA 1BKAA 4NQ8A 3SEVA 2W7YA 2Z8EA 4MCOA 4FAJA 1Y3QA 1QGXA 2NWJA 3ONMA 4AS5A 4XIGQ 2FYIA 4GX3A 4G8MA 3MPKA 1TXFA 4N91A 2R8TA 4IO5A 4JDFA 3MZBA 3FVGA 2OWZA 5ET7A 2E1SA 4TOZA 1A8FA 3I6VA 3MVWA 2XD2A 4F1UA 3DLNA 1NV5A 5A5LA 3PUWE 4NF8B 3N5LA 2VGQA 3QUFA 4I1DA 1B3FA 3KJTA 4P0IA 3FVOA 2XXYA 5B7DA 3HHFA 2VHAA 2F36A 2DWAA 4X8RA 4MLQA 1Y20A 4YB5A 1USYH 2DP8A 4YKJA 2HZLA 2Y7RA 4IO7A 1USYE 2ZNTA 1LBYA 2A5TB 4GL8A 1PEBA 1ZJLA 2RF1A 4YKIA 2DWIA 2GFEA 5I3SA 2P3VA 3K2DA 2F7AA 4N15A 4P1LA 2AL4A 1RDZA 4JWYA 1SW5A 5LDZA 3B8BA 4GWSA 5H8NA 4G8HA 4H6DA 3OXNA 2V84A 1FCKA 3OELA 3KBZA 3G7WA 1VE4A 2Y7IA 3JYRA 1NH8A 3BFTA 1EYKA 1Z7NE 4R6HA 1B4HA 4H0WA 4N6KA 1A55A 2PT1A 1B51A 2XWIA 5CMKA 1B3GA 2GH9A 3VDFA 2CMOA 2F6PA 2UVJA 4GL0A 1DK4A 4JB7A 2CZHA 3K1PA 2ABHA 2H4IA 3VLVA 4I8CA 2PBWA 3H7MA 3RT6B 4C0RA 1Y3PA 1IQ7A 1B3EA 3MAMA 2R9JA 3Q26A 4I40A 2F34A 4QRZA 1IMFA 3HN0A 4BDQA 5IM2A 3TZAA 1Y3NA 4H46A 2VOZA 4P3LA 4GWUA 2XD3A 2DOJA 5I59A 1LB8A 1RYOA 3QAXA 1AIVA 5I56A 4I3EA 1EZPA 3S9NC 5KZTA 2ZZVA 1B6HA 2DQVA 2XXWA 4N6DA 1D9VA 1YYZA 3U92A 1PB9A 4PAKA 4LATA 1MQDA 1NUWA 4FECA 4XEQA 2KLFA 4KHZE 1SYIA 3EQ1A 1N76A 3OO9A 4U23A 1US4A 4MNCA 5H8NB 3PPQA 1ELJA 3ISPA 1P99A 1SDXA 5CBRA 3V5AA 1KZ8A 5ET8A 2HZKA 4DI3D 2QPQA 1NUZA 1HSLA 2D3IA 3FV1A 1KWHA
chains in the Genus database with same CATH topology
2Q74A 4MMPA 2B4MA 4X9TA 2Y5LA 4PFBA 1JP4A 1BK4A 2F3BA 4XFEA 4P47A 5F24A 2DDKA 4OVPA 2FIEA 4MAGA 1FPLA 3SZPA 1FJ6A 5FBPA 1CNQA 3RPLA 4HE0A 1FPIA 4PGPA 2F3DA 4HXVA 1INPA 5ESYA 4PGNA 4PCDA 1VDWA 5CM6A 1NV7A 2KQZA 2PFZA 2XWVA 1FBEA 2QVVA 4O7MA 5I7IA 4DI4B 5T3JA 5IZZA 1NV0A 3LUZA 5JK4A 4O94A 4HCYA 1XI6A 2FVZA 2XWOA 4MX6A 3QMFA 2V4CA 4PE3A 3RYDA 4G61A 2DE2A 4QBAA 3U65A 1DBZA 3PTYA 2HPGA 1LBXA 1FTAA 4GBVA 2PCRA 1YXIA 3W9VA 1FSAA 4QXDA 1NV6A 4YZZA 3FBPA 2QVRA 5EQ9A 5IZ3A 5ET6A 2XXKA 1D9QA 5EQ7A 5EQAA 3BIHA 4MNPA 4P56A 2ZZWA 4PDDA 5EYGA 4P1EA 1FRPA 2B4LA 3W9WA 4O8MA 1IMCA 4PF6A 1NV2A 4NG7A 3CHGA 1NUYA 4N4UA 5EQ8A 3KC1A 2WYPA 3RPLB 3GYYA 1IMBA 2WBBA 4FBPA 4NGUA 4HE2A 4PBQA 4PETA 4MEVA 2CZKA 1KA1A 1IMAA 4MIJA 2HXRA 2CEYA 2FBPA 1FPFA 4P8BA 4H45A 1FBGA 4LN5A 1LEVA 4JVCA 3IFCA 1FBPA 4GX4A 3KC0A 1EYJA 1G0IA 3BIGA 1RDXA 3ROJA 4GWXA 2WEFA 2GQ1A 4N81A 2PFYA 3A29A 4MNIA 4PDHA 4JVIA 3HFUA 1KA0A 2WYKA 5IGAA 4GX6A 1EYIA 1FPKA 2VT5A 2Y5KA 2DE3A 2F5XA 5IZ3B 2XWKA 2CZIA 4NAPA 4PFRA 1RDYA 1FBFA 2DVZA 4F18A 3E78A 4P9KA 3FXBA 4NN3A 4NQ8A 4MCOA 2P3NA 1NI9A 1QGXA 2CEXA 4AS5A 4GX3A 4GWWA 4N91A 2R8TA 5IZ1A 4OVSA 2OWZA 5ET7A 2VPOA 2Q8MA 4X04A 3NOHA 4F1UA 4YICA 1NV5A 5A5LA 4IR8A 4I3YA 4NHBA 1FPGA 2WBDA 5DW8A 4OVQA 4OVRA 5J16A 2QVUA 1K9YA 4X8RA 4OVTA 4GWYA 1YZ0A 3T1BA 4NX1A 2HZLA 3D1RA 1LBZA 3T0JA 2Q9TA 2WX9A 1LBYA 1K9ZA 1FPEA 3EKIA 2FIXA 1NV1A 5I3SA 2P3VA 4N15A 5J1DA 4P1LA 1RDZA 4NF0A 5LDZA 3B8BA 5I5PA 4GWSA 4F19A 1FJ9A 2VPNA 5ET5A 2XA5A 4F1VA 3IFAA 3KBZA 4UABA 1FPJA 3E79A 1EYKA 4JVDA 1LBVA 4PFIA 1LBWA 2HHMA 4PAFA 4N6KA 4PAIA 2KR0A 1FPDA 4HCWA 2XWIA 4MHFA 4O7IA 5LTCA 3B50A 1DK4A 4HE1A 2CZHA 4KXPA 4GWZA 1IMDA 4N8GA 4GBWA 1NV4A 4I40A 3LV0A 1IMFA 5IM2A 4OA4A 2JJKA 4H46A 1G0HA 2V3QA 2ZZXA 4P3LA 1FPBA 4GWUA 1IMEA 4I3EA 4AS4A 1Q9DA 2BJIA 4MJOA 2DE4A 2ZZVA 2FHYA 1NV3A 1FBDA 4N6DA 1YYZA 1FBHA 4M1VA 4PAKA 4PC9A 1NUWA 1FBCA 4XEQA 2L5VA 5EYHA 4MNCA 4XF5A 3MYUA 3ISPA 4N17A 4N8YA 1KZ8A 4OANA 5ET8A 2HZKA 4DI3D 4PTKA 2MKZA 2QPQA 4PBHA 1NUZA 2QFLA 1NUXA 4PF8A 1DCUA 1SPIA 2OX3A 3MSTA 1AWBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4P56 A;  2ZZW A;  4PDD A;  4MMP A;  4PAF A;  4P1E A;  2CEX A;  4N6K A;  4PAI A;  4PFB A;  4O8M A;  2XWI A;  4N91 A;  4XFE A;  4P47 A;  4PF6 A;  4MHF A;  4NG7 A;  5LTC A;  4OVP A;  4N4U A;  4MAG A;  3B50 A;  4OVS A;  2VPO A;  2WYP A;  3GYY A;  4X04 A;  4NGU A;  4N8G A;  4YIC A;  4PBQ A;  4PGP A;  4PET A;  4MEV A;  4PGN A;  5IM2 A;  4PCD A;  4NHB A;  4MIJ A;  5CM6 A;  4OA4 A;  2CEY A;  2PFZ A;  2XWV A;  2ZZX A;  4P3L A;  4P8B A;  4OVQ A;  4OVR A;  4O7M A;  4LN5 A;  5I7I A;  4X8R A;  4OVT A;  4DI4 B;  5IZZ A;  4NX1 A;  2HZL A;  2ZZV A;  4O94 A;  2WX9 A;  4N6D A;  2XWO A;  4MX6 A;  2V4C A;  4PE3 A;  4PAK A;  4PC9 A;  2PFY A;  4MNI A;  4PDH A;  4XEQ A;  4N15 A;  4P1L A;  2WYK A;  3U65 A;  2HPG A;  5IGA A;  4NF0 A;  5I5P A;  4MNC A;  4XF5 A;  4YZZ A;  2VPN A;  4N17 A;  4N8Y A;  2XWK A;  2XA5 A;  4OAN A;  4NAP A;  4PFR A;  2HZK A;  4DI3 D;  4UAB A;  2XXK A;  4P9K A;  4PBH A;  3FXB A;  4PF8 A;  4NN3 A;  4NQ8 A;  4MNP A;  4MCO A;  4PFI A; 
#chains in the Genus database with same CATH topology
 4EDP A;  2Q74 A;  3B7D A;  4MMP A;  4NF6 A;  1YCJ A;  1JP4 A;  3H6T A;  2G93 A;  3MJN A;  4OMB A;  4P47 A;  1J1N A;  4RA1 A;  4OVP A;  4EQ7 A;  3OEM A;  3PMX A;  4ZEC A;  3USD A;  2YJP A;  1MY0 A;  1N84 A;  5B70 A;  4F3B A;  5ESY A;  5ELV A;  4GRK A;  4RY1 A;  1OVT A;  2QL3 A;  4KD5 A;  4Q30 B;  2XWV A;  3HPI A;  1I69 A;  3S2V A;  3DP8 A;  5I59 B;  4YKK A;  2M8C A;  3CSB A;  2QVV A;  4MBP A;  5I56 B;  3ZKL A;  4QF9 A;  2ZYO A;  1ZBM A;  3MUQ A;  1XI6 A;  5DYH A;  2G29 A;  4XTC Q;  3O28 A;  4KCC A;  4PE3 A;  3TEP A;  4KYD A;  3QUJ A;  4JSD A;  5F7V A;  3RYD A;  3LR1 A;  3IR1 A;  3C4M A;  3G3G A;  2HPG A;  1LBX A;  1FTA A;  1NFT A;  1FTO A;  2PCR A;  5DEX A;  4EXK A;  2HCA A;  4ZDM A;  4DCX A;  3KJ7 A;  4G8N A;  3V83 A;  4FE8 A;  3TMG A;  3VVE A;  5IZ3 A;  2YPN A;  4YMB A;  1MY3 A;  1YTV A;  5KCJ A;  4Q5T A;  3M3K A;  1M5B A;  5EHM A;  3C34 A;  2VD3 A;  1QKA A;  5H8Q A;  1B32 A;  2ZZW A;  1IXC A;  3A3U A;  5EYG A;  4NF6 B;  3RN8 A;  1MH4 A;  1FRP A;  1H45 A;  3KBR A;  1MS7 A;  4O8M A;  1MXZ A;  3LBS A;  1NNP A;  3UGW A;  1O63 A;  4ZED A;  3THI A;  3LSL A;  4NG7 A;  3RLF E;  3DP6 A;  1Y9U A;  1NUY A;  3H4Z A;  3IOV A;  3O29 A;  2V93 A;  1P1W A;  4PQJ A;  1FQF A;  5L9S A;  3BKI B;  3FD3 A;  4NTL A;  2QJE A;  3TUS A;  2O84 X;  5L9M A;  4HE2 A;  4PBQ A;  1MQI A;  1PB8 A;  4PET A;  4LZ7 A;  2CZK A;  1B5J A;  2HXR A;  4H8J A;  2YLN A;  4IO4 A;  4U2R A;  5ITO A;  3O6H A;  5CBS A;  2QS3 A;  4JVC A;  4EQB A;  5ICQ A;  1FBP A;  5HM4 B;  2XXU A;  1POY 1;  3B6T A;  2Q88 A;  3U94 A;  1G0I A;  2ONR A;  2OK2 A;  4H5F A;  2Q2C A;  3TTM A;  2UVH A;  1JW4 A;  1N04 A;  1A99 A;  4PDH A;  3HCQ A;  3PU5 A;  3GZG A;  3V89 B;  5IGA A;  2RKM A;  5DEX B;  4GX6 A;  1CE2 A;  5AA2 A;  2Y5K A;  1URG A;  3GBA A;  5IZ3 B;  2CZI A;  2UYE A;  2DVZ A;  2F97 A;  1JET A;  5KCJ B;  3N6U A;  3IL1 B;  3FXB A;  5H8Q B;  2P3N A;  1NI9 A;  3LUY A;  2OZZ A;  1ZU0 A;  5A5X A;  1SBP A;  4LZ8 A;  3PV0 E;  3IO6 A;  1LBB A;  2OBG A;  4NF5 A;  3H3G A;  4R73 A;  1MY4 A;  1LFG A;  1VR5 A;  4OHN A;  3TOD A;  5IZ1 A;  3MBP A;  4F31 B;  4GXA A;  4GWO A;  1MQH A;  4OVS A;  2V3U A;  4GQO A;  2F8D A;  4G77 A;  3MQ9 A;  3BFU A;  1JW1 A;  1B46 A;  2I4B A;  3E13 X;  3VFJ A;  1N7X A;  4YAH X;  4AB5 A;  3NOH A;  4KCD A;  3S9L C;  1B3H A;  2VD2 A;  3LSF B;  4RNS A;  2NOO A;  2HFB A;  4WED A;  4F3P A;  4I3Y A;  3G3I A;  4ND9 A;  4XKN A;  2XX7 A;  2ZMB A;  4R6K A;  2DWJ A;  1A8E A;  4FED A;  2QVU A;  4YKP A;  3K0V A;  2X7Q A;  5FTI A;  4OVT A;  4GWY A;  2Z23 A;  1ZKB A;  1YZ0 A;  3PPP A;  3K00 A;  3CI8 A;  1OLA A;  4U4X A;  4POW A;  1K9Z A;  2UVG A;  1SVX B;  4ELO A;  1N7W A;  3RPW A;  4LA9 A;  4H65 A;  1MQG A;  2E0S A;  1HSE A;  1OQH A;  4RJZ A;  4PFU A;  1N3W A;  5I5P A;  2UXA A;  5AA2 B;  3OO8 A;  2A5S A;  2XA5 A;  1XVY A;  3OMB A;  1NNK A;  3O66 A;  4BLA A;  3QYT A;  3C31 A;  1I6Q A;  1MXW A;  4OTE A;  4PAF A;  4PFY A;  3U72 A;  3TKD A;  4OES A;  5A5X B;  2KR0 A;  4NF5 B;  2ZXT A;  2O1M A;  1GVC A;  5CC2 A;  1MXX A;  4PP0 A;  5DVF A;  1IIW A;  1UIV A;  4MHF A;  4O7I A;  2H99 A;  1B5I A;  4LP2 B;  3CRB A;  2NUV A;  2B3B A;  4ZEK A;  1O64 A;  4ZEB A;  4R9G A;  1IMD A;  4OXV A;  4GBW A;  3OO6 A;  3TCF A;  1FTM A;  3LV0 A;  1Q35 A;  3OEN A;  4OA4 A;  3TFL A;  1XS5 A;  1G0H A;  2O51 A;  2ZZX A;  3H6U A;  3D4G A;  3N26 A;  4FAT A;  1IXI A;  3FAT A;  2BJI A;  4O3B A;  4ESW A;  3CG1 A;  4X1B A;  1LBC A;  2Y7P A;  2HAV A;  4PC9 A;  3EPE A;  1P1U A;  2L5V A;  1A54 A;  1N3X A;  4FOR A;  2QSX A;  3Q28 A;  2UYF A;  1QUI A;  5EYH A;  2F35 A;  1WDN A;  4XF5 A;  2XX8 A;  3UOR A;  4NE4 A;  3JV9 A;  1H44 A;  4OAN A;  3T9X B;  1DPE A;  2Q89 A;  3FUZ A;  4I9D A;  4R2F A;  2MKZ A;  3BBR A;  2QFL A;  3TTN A;  3MST A;  5M2V A;  4X9T A;  2Y5L A;  4IGR A;  4P0G A;  4IO2 A;  4YB7 A;  3U8Q A;  5IKB A;  2I48 A;  3SEU A;  1MXV A;  4L17 A;  3MPL A;  2FIE A;  1N0T A;  1B4Z A;  4EF1 A;  1FJ6 A;  1PBP A;  3SES A;  4OFL A;  5FBP A;  3LSX A;  3U1O A;  4UA8 A;  1CNQ A;  2AIX A;  1TFA A;  3O97 A;  3CFZ A;  1IUD A;  3IO4 A;  2F3D A;  3EN3 A;  4HXV A;  1LGB C;  4OQO A;  1OMP A;  1VDW A;  1NV7 A;  2PFZ A;  1M5C A;  1FBE A;  3M3F A;  2HAU A;  1SYH A;  3SKP A;  3P7I A;  5I7I A;  4XKR A;  3RY3 A;  2ZYN A;  4DI4 B;  2O69 A;  1NV0 A;  4F2O A;  3LUZ A;  1Y1Z A;  4GOT A;  3C35 A;  2R71 A;  4LQ2 A;  3ZS6 A;  2FVZ A;  4MX6 A;  4TLM B;  2PVU A;  2QS4 A;  2HXW A;  2DE2 A;  4QFN A;  3O2A A;  3PTY A;  5CMB A;  3ECR A;  2IEE A;  4GBV A;  3W9V A;  3M8U A;  4GLI A;  4YB6 A;  3L6H A;  1D4N A;  3FXU A;  5AA4 A;  3Q25 A;  4K3F A;  3S9M C;  3DP4 A;  4QSC A;  1D9Q A;  1URS A;  3BIH A;  1CB6 A;  3C33 A;  1ZTY A;  3OEK A;  3UK4 A;  4ELP A;  4GF8 A;  2GRV A;  4JWX A;  1IMC A;  1JEV A;  1P1Q A;  4DCY A;  2QMW A;  1NV2 A;  3CHG A;  2I0B A;  1MQJ A;  1AMF A;  3VVD A;  3GYY A;  1P1O A;  1M5F A;  3H03 A;  4ZE9 A;  4MEV A;  2H25 A;  4BDR A;  1AH5 A;  1FTJ A;  1LCT A;  4R72 A;  2VP1 A;  1SW4 A;  1KA1 A;  4MFI A;  4MIJ A;  2CEY A;  2FBP A;  3C9H A;  4GXS B;  4QSD A;  2I3W A;  1LAF E;  4LN5 A;  3MP1 A;  3KGC A;  4GX4 A;  4KPT A;  1BP5 A;  3KC0 A;  3RQT A;  4NWC A;  1EYJ A;  1LAX A;  3BIG A;  4YMA A;  2ZYM A;  4C1T A;  3S9E A;  2GQ1 A;  3A29 A;  3IOU A;  3HFU A;  4JVI A;  1LFI A;  2GHB A;  5DT6 A;  1M5E A;  1B2H A;  1FPK A;  3K4U A;  3SEX A;  2DE3 A;  3IX1 A;  5JTY A;  5AA4 B;  1RDY A;  3SET A;  4N07 A;  2Z8D A;  4THI A;  3TDJ A;  1R6Z A;  4NN3 A;  2F6G A;  3PUY E;  4R9F A;  4OVJ A;  4G68 C;  2F7B A;  1FW0 A;  4ZEF A;  2ANJ A;  3MP8 A;  1TT1 A;  4POX A;  3IOT A;  3PPN A;  2XXX A;  1SD3 A;  4LUB A;  1H76 A;  4EF2 A;  3FJ7 A;  1B0H A;  1MY1 A;  1IXH A;  3ILU B;  2D21 A;  4FJP A;  1EZO A;  3Q29 A;  4IY6 A;  4DLD A;  1B7Z A;  1FQB A;  1M5D A;  1B1H A;  4YIC A;  5AA1 A;  1MPC A;  4NMY A;  1OIB A;  2WBD A;  1SI1 A;  3T96 B;  2NVU B;  1OVB A;  4OVR A;  5I2N A;  3K02 A;  3SEW A;  3MC2 A;  1K9Y A;  1H43 A;  1D3K A;  5DVI A;  3T1B A;  4NX1 A;  3TEL A;  2WX9 A;  2DVC A;  4MLV A;  1B7U A;  1MM6 A;  2FIX A;  3R7X A;  1AOV A;  1A7L A;  3FXR A;  1NV1 A;  4LON B;  5J1D A;  3TTK A;  2H9B A;  3OSR A;  3IB2 A;  1NMU A;  4NF4 A;  4QFP A;  3T22 A;  3C32 A;  3V8X B;  3I3V A;  1YAE A;  4F19 A;  5TPA A;  1MY2 A;  4F1V A;  5JTY B;  2V3T A;  1FPJ A;  1PC3 A;  1B5H A;  3ZSF A;  3E79 A;  4JVD A;  5I84 A;  4DXU A;  4G68 A;  1P1N A;  4AQ4 A;  3CSG A;  2HHM A;  1NL5 A;  1IIT A;  2OLB A;  2X26 A;  4HCW A;  1Y4T A;  4IO3 A;  1URD A;  3C36 A;  3I5O A;  5I57 A;  1VFE A;  1FQA A;  1S9T A;  2QRY A;  4HE1 A;  2I6E A;  4Z0I A;  4KXP A;  2Y7W A;  3TTR A;  4GWZ A;  3UA8 A;  3K01 A;  4N8G A;  1LAH E;  1NV4 A;  1OQG A;  4UAC A;  4JSO A;  1PDA A;  3KSX A;  3TTL A;  5I2N B;  3IJX B;  3HO7 A;  3T93 B;  1MXU A;  4AS4 A;  2DYX A;  1Q9D A;  3FAS A;  2DE4 A;  2FHY A;  4H8I A;  3SEY A;  1NV3 A;  1FBD A;  3ODB A;  4O3C A;  4RPO A;  5H8H A;  1BIY A;  1FBH A;  3O9P A;  1MM7 A;  1Z7M E;  3T9V A;  4OEN A;  2B3F A;  1FBC A;  3RNN A;  1UQW A;  4QFL A;  2O7U A;  4EUO A;  1IZ1 A;  4KYS A;  2V25 A;  4H67 A;  3MVY A;  1WOD A;  5L9O A;  3K6X A;  4NF4 B;  4ZEI A;  2B65 A;  1DPP A;  3D4C A;  3R6U A;  5TPA B;  4F39 A;  4N17 A;  4N8Y A;  4QHQ A;  5L8D A;  4R74 A;  1B58 A;  5TU0 A;  1EU8 A;  5K2X A;  4PBH A;  4IO6 A;  4RXL A;  3QXM A;  1SPI A;  2DXY A;  4G68 B;  1AWB A;  3K1M A;  3A3C A;  3H6W A;  4WEP A;  3EHS A;  5ICT A;  3SDF A;  4NWD A;  1FQE A;  3KN7 A;  2F3B A;  4XFE A;  3TPA A;  3WAE A;  4R2B A;  5I2K A;  5I57 B;  4ZS9 A;  2DDK A;  4MAG A;  1FPL A;  3SZP A;  2Z22 A;  4OYV A;  4EQ9 A;  1MPB A;  3RPL A;  1FPI A;  3PD8 A;  4OFO A;  3KZG A;  4PGP A;  1XC1 A;  1INP A;  1F9B A;  2QS1 A;  3IOR A;  3A09 A;  1FTK A;  1R9Q A;  4PCD A;  5K2Y A;  3HST A;  5CM6 A;  5AE4 A;  4QFO A;  5FHO A;  1QUJ A;  4BDO A;  2PX1 A;  1VSO A;  5JK4 A;  4KFQ A;  4O94 A;  4HCY A;  1II5 A;  4WKM A;  3VLW A;  3CR9 A;  2XWO A;  4ONY A;  5H8H B;  1B0L A;  4JWO A;  2OWS A;  4KI0 E;  1T0K A;  4QBA A;  5CMM A;  3R26 A;  1DBZ A;  4MH5 A;  4BDN A;  1R1N A;  1RYX A;  3TQW A;  5DTB A;  1YXI A;  1FSA A;  3OSQ A;  3G3J A;  3JZJ A;  3N6T A;  4QXD A;  3W15 C;  1NH7 A;  1NV6 A;  4IB2 A;  4YZZ A;  3CVG A;  2Y84 A;  1EZ9 A;  2QVR A;  2I58 A;  2IA4 A;  5LOM A;  2XXQ A;  4HS7 A;  2ALU A;  4U21 A;  5ET6 A;  4HW8 A;  3MP6 A;  3VE1 B;  2OCU A;  2XXK A;  2RCA A;  3CFL A;  1NNF A;  5EQ7 A;  4MNP A;  3KG2 A;  2Q8J A;  4P56 A;  3PPO A;  2B4L A;  3W9W A;  1ZLQ A;  1LFH A;  1RKM A;  1MDQ A;  3EHU A;  4TQU Q;  4E0W A;  2AL5 A;  3FV2 A;  4FEB A;  4R6Y A;  1PB7 A;  3E9X A;  4PF6 A;  5I2K B;  3T9U A;  5EQ8 A;  2H5Y A;  3LSW A;  3T66 A;  2WYP A;  2DS9 A;  3RPL B;  4JXI A;  3EHT A;  1MG1 A;  4Q0C A;  2PT2 A;  3FVN A;  1DTZ A;  2XXV A;  1XT8 A;  5BWJ A;  2WBB A;  4FBP A;  3RUM A;  1BLF A;  3U93 A;  1H3D A;  4R75 A;  5ISU A;  3KFM A;  1Y4C A;  4F3S A;  1A40 A;  1GR2 A;  2H98 A;  2I0C A;  1FBG A;  1LEV A;  1GGG A;  3IFC A;  1NNT A;  3B6W A;  1QVS A;  1AL3 A;  1GTK A;  5KDT A;  4U1O A;  5H8F A;  1Y1M A;  3ROJ A;  1IXG A;  1JVY A;  1OLC A;  1GV8 A;  3S4U A;  3OO7 A;  4N81 A;  4NED A;  2XXI A;  1R9L A;  1US5 A;  3T9H B;  2WYK A;  1UTB A;  3MZ1 A;  1QJM A;  1Q1K A;  2THI A;  3PD9 A;  1QUK A;  2VT5 A;  4P11 A;  2F5X A;  2XWK A;  5ITP A;  1FBF A;  4F18 A;  2REG A;  1D9Y A;  3E78 A;  4P9K A;  2Z8F A;  2ZNU A;  2QMX A;  1B7H A;  4ZZE A;  3ZKK A;  3QIM A;  1SQY A;  5JEI A;  3PGF A;  3VXC A;  2CEX A;  2LAO A;  3PPR A;  5EYF A;  2ESN A;  4DDD A;  5CRY A;  2OJT A;  1S7Y A;  3QK6 A;  4GWW A;  1FTL A;  4OZ9 A;  1QUL A;  4H5G A;  1MDP 1;  3FJG A;  4ECF A;  3PUX E;  3AXF A;  2VPO A;  4KYE A;  2Q8M A;  4X04 A;  1B3L A;  1SI0 A;  3N94 A;  1BTJ A;  4IR8 A;  2RIN A;  4NHB A;  1FPG A;  4LZ5 A;  5DW8 A;  4OVQ A;  5J16 A;  3IJO B;  3H6V A;  1DTG A;  3D1R A;  1LBZ A;  2RC8 A;  2Q9T A;  3T0J A;  5KDT B;  1FPE A;  5H8F B;  3EKI A;  2ONS A;  5TP9 A;  1QKB A;  4RPN A;  4RYA A;  1JQF A;  4PFW A;  1MH3 A;  1UTB B;  3H06 B;  5AA3 A;  4QFK A;  1O7T A;  4NF0 A;  3VXB A;  1SW1 A;  3O6I A;  3RT8 A;  4F29 A;  4U4S A;  1FJ9 A;  2VPN A;  5ET5 A;  2X7P A;  3IFA A;  3PUV E;  4UAB A;  3B6Q A;  4F2Q A;  3CFX A;  3TYH A;  1UTH A;  1LBV A;  4PFI A;  3GLB A;  1LBW A;  4X48 A;  2OWT A;  4RK2 A;  3TCH A;  4PAI A;  3OD7 A;  1FPD A;  4TLL B;  1DSN A;  1ZMG A;  3PUZ E;  3TQL A;  4Z7E A;  4F22 A;  3KEI A;  5LTC A;  2Q2A A;  3B50 A;  2P1S A;  4C1U A;  3G3H A;  3RGY A;  3FXQ A;  3K6V A;  2WKY A;  2RC9 A;  4BDL A;  1S50 A;  4IGT A;  1MXY A;  4OEV A;  4LQ5 A;  3MVZ A;  4F1Y A;  1LAG E;  1XVX A;  2CZL A;  3G3K A;  2JJK A;  4PFT A;  2V3Q A;  1UIU A;  5CMC A;  1FPB A;  2BJJ X;  3K6U A;  4I62 A;  1IME A;  1LST A;  3MW0 A;  2P0S A;  2XXH A;  3GXA A;  4MJO A;  3K1N A;  1ANF A;  4RK9 A;  5H8S A;  3FJM A;  5AA2 D;  2Y7K A;  5TP9 B;  2XHD A;  4M1V A;  2ZNS A;  3RTW B;  3FZV A;  1WVJ A;  3KN3 A;  2QS2 A;  4XKP A;  1B05 A;  1MRP A;  1B9J A;  3MYU A;  3FGS A;  1VFD A;  1B52 A;  4JBZ A;  4O3A A;  4XXU A;  1L5T A;  3MWB A;  4PTK A;  5EHS A;  4PF8 A;  1NUX A;  1DCU A;  1MPD A;  3E4R A;  1UTH B;  2OX3 A;  5IAI A;  3ILT B;  1POT A;  3UIF A;  5BUU A;  2B4M A;  3MVX A;  3L6G A;  4U22 A;  3VVF A;  4PFB A;  1BK4 A;  3PMW A;  3O6G A;  5HPQ A;  4OER A;  4WXJ A;  3UP9 A;  2PMS A;  5F24 A;  3Q27 A;  1ATG A;  4KR5 A;  2DXR A;  3KOT A;  1LB9 A;  3EF7 A;  3GBB A;  1IEJ A;  3TCG A;  3QSL A;  2FA7 A;  3KOS A;  3FIR A;  4GD5 A;  1ZIU A;  4H1X A;  4HE0 A;  3HV1 A;  2I4C A;  2RC7 A;  4KQP A;  4PGN A;  4ZE8 A;  1SW2 A;  2R6G E;  2KQZ A;  4G2Z A;  5HBC A;  3CG3 A;  1FQD A;  2XXT A;  2DWH A;  3G3F A;  4BDM A;  5F1Q A;  4ISU A;  4O7M A;  5FTH A;  4FIM A;  4MF3 A;  1QW0 A;  2DSF A;  3PMV A;  5T3J A;  5IZZ A;  5I58 A;  1B40 A;  3OOA A;  2O6A A;  2D5W A;  4OET A;  3QMF A;  4N6P A;  2V4C A;  2RCB A;  2I49 A;  4G61 A;  2F7C A;  4YU0 A;  4DZ1 A;  3U65 A;  1JNF A;  3SER A;  2XX9 A;  1B1X A;  2O68 A;  2REJ A;  3IK6 B;  4F3G A;  4HTG A;  2F78 A;  3FBP A;  2O1L A;  5EQ9 A;  4GIZ A;  5CI5 A;  4QSE A;  2XXR A;  5FHM A;  5EQA A;  1I6A A;  1DMB A;  2FNC A;  4PDD A;  2UVI A;  4DXB A;  4P1E A;  3E3K A;  4OFJ A;  2I3V A;  3MZ9 A;  1XHY A;  4XKQ A;  1EH3 A;  4U1Z A;  4Q8R A;  1YPN A;  2ZYK A;  4OEU A;  4N4U A;  3KC1 A;  4IY5 A;  1JEU A;  3M3L A;  3VV5 A;  4DXC A;  3KSJ A;  3F11 A;  1I6B A;  1LLS A;  1IMB A;  4NGU A;  2P2A A;  2HEU A;  1DOT A;  3IB0 A;  4NF8 A;  4AB6 A;  4DE8 A;  4E0X A;  1IMA A;  4EXL A;  3LC8 A;  4N13 A;  1FPF A;  4P8B A;  1FQC A;  5DVJ A;  4H45 A;  4GFR A;  3FVK A;  4GVO A;  5FHN A;  3IAZ A;  1XOC A;  4PE5 B;  5I58 B;  2PYY A;  1LCF A;  1PBQ A;  3DEL B;  2A5T A;  3WAF A;  3CIJ A;  1RDX A;  1TWY A;  3RTF B;  4GWX A;  4M4G A;  2WEF A;  4ESX A;  4OWD A;  3KN8 A;  1JW5 A;  2PFY A;  4MNI A;  1KA0 A;  3HHG A;  3DM0 A;  3K6W A;  4ELQ A;  3UN6 A;  3IB1 A;  4G4P A;  3IOW A;  4DIG A;  2ONK E;  1EYI A;  2AYS A;  2XXP A;  3TAJ A;  1HSJ A;  4ELR A;  1TFD A;  2O7I A;  1NKX A;  4NAP A;  4PFR A;  4X1D A;  3VLU A;  4ZZA A;  2HQ0 A;  4LVQ A;  2GHA A;  1JVX A;  2NXO A;  1BKA A;  4NQ8 A;  3SEV A;  2W7Y A;  2Z8E A;  4MCO A;  4FAJ A;  1Y3Q A;  1QGX A;  2NWJ A;  3ONM A;  4AS5 A;  4XIG Q;  2FYI A;  4GX3 A;  4G8M A;  3MPK A;  1TXF A;  4N91 A;  2R8T A;  4IO5 A;  4JDF A;  3MZB A;  3FVG A;  2OWZ A;  5ET7 A;  2E1S A;  4TOZ A;  1A8F A;  3I6V A;  3MVW A;  2XD2 A;  4F1U A;  3DLN A;  1NV5 A;  5A5L A;  3PUW E;  4NF8 B;  3N5L A;  2VGQ A;  3QUF A;  4I1D A;  1B3F A;  3KJT A;  4P0I A;  3FVO A;  2XXY A;  5B7D A;  3HHF A;  2VHA A;  2F36 A;  2DWA A;  4X8R A;  4MLQ A;  1Y20 A;  4YB5 A;  1USY H;  2DP8 A;  4YKJ A;  2HZL A;  2Y7R A;  4IO7 A;  1USY E;  2ZNT A;  1LBY A;  2A5T B;  4GL8 A;  1PEB A;  1ZJL A;  2RF1 A;  4YKI A;  2DWI A;  2GFE A;  5I3S A;  2P3V A;  3K2D A;  2F7A A;  4N15 A;  4P1L A;  2AL4 A;  1RDZ A;  4JWY A;  1SW5 A;  5LDZ A;  3B8B A;  4GWS A;  5H8N A;  4G8H A;  4H6D A;  3OXN A;  2V84 A;  1FCK A;  3OEL A;  3KBZ A;  3G7W A;  1VE4 A;  2Y7I A;  3JYR A;  1NH8 A;  3BFT A;  1EYK A;  1Z7N E;  4R6H A;  1B4H A;  4H0W A;  4N6K A;  1A55 A;  2PT1 A;  1B51 A;  2XWI A;  5CMK A;  1B3G A;  2GH9 A;  3VDF A;  2CMO A;  2F6P A;  2UVJ A;  4GL0 A;  1DK4 A;  4JB7 A;  2CZH A;  3K1P A;  2ABH A;  2H4I A;  3VLV A;  4I8C A;  2PBW A;  3H7M A;  3RT6 B;  4C0R A;  1Y3P A;  1IQ7 A;  1B3E A;  3MAM A;  2R9J A;  3Q26 A;  4I40 A;  2F34 A;  4QRZ A;  1IMF A;  3HN0 A;  4BDQ A;  5IM2 A;  3TZA A;  1Y3N A;  4H46 A;  2VOZ A;  4P3L A;  4GWU A;  2XD3 A;  2DOJ A;  5I59 A;  1LB8 A;  1RYO A;  3QAX A;  1AIV A;  5I56 A;  4I3E A;  1EZP A;  3S9N C;  5KZT A;  2ZZV A;  1B6H A;  2DQV A;  2XXW A;  4N6D A;  1D9V A;  1YYZ A;  3U92 A;  1PB9 A;  4PAK A;  4LAT A;  1MQD A;  1NUW A;  4FEC A;  4XEQ A;  2KLF A;  4KHZ E;  1SYI A;  3EQ1 A;  1N76 A;  3OO9 A;  4U23 A;  1US4 A;  4MNC A;  5H8N B;  3PPQ A;  1ELJ A;  3ISP A;  1P99 A;  1SDX A;  5CBR A;  3V5A A;  1KZ8 A;  5ET8 A;  2HZK A;  4DI3 D;  2QPQ A;  1NUZ A;  1HSL A;  2D3I A;  3FV1 A;  1KWH A; 
#chains in the Genus database with same CATH homology
 2Q74 A;  4MMP A;  2B4M A;  4X9T A;  2Y5L A;  4PFB A;  1JP4 A;  1BK4 A;  2F3B A;  4XFE A;  4P47 A;  5F24 A;  2DDK A;  4OVP A;  2FIE A;  4MAG A;  1FPL A;  3SZP A;  1FJ6 A;  5FBP A;  1CNQ A;  3RPL A;  4HE0 A;  1FPI A;  4PGP A;  2F3D A;  4HXV A;  1INP A;  5ESY A;  4PGN A;  4PCD A;  1VDW A;  5CM6 A;  1NV7 A;  2KQZ A;  2PFZ A;  2XWV A;  1FBE A;  2QVV A;  4O7M A;  5I7I A;  4DI4 B;  5T3J A;  5IZZ A;  1NV0 A;  3LUZ A;  5JK4 A;  4O94 A;  4HCY A;  1XI6 A;  2FVZ A;  2XWO A;  4MX6 A;  3QMF A;  2V4C A;  4PE3 A;  3RYD A;  4G61 A;  2DE2 A;  4QBA A;  3U65 A;  1DBZ A;  3PTY A;  2HPG A;  1LBX A;  1FTA A;  4GBV A;  2PCR A;  1YXI A;  3W9V A;  1FSA A;  4QXD A;  1NV6 A;  4YZZ A;  3FBP A;  2QVR A;  5EQ9 A;  5IZ3 A;  5ET6 A;  2XXK A;  1D9Q A;  5EQ7 A;  5EQA A;  3BIH A;  4MNP A;  4P56 A;  2ZZW A;  4PDD A;  5EYG A;  4P1E A;  1FRP A;  2B4L A;  3W9W A;  4O8M A;  1IMC A;  4PF6 A;  1NV2 A;  4NG7 A;  3CHG A;  1NUY A;  4N4U A;  5EQ8 A;  3KC1 A;  2WYP A;  3RPL B;  3GYY A;  1IMB A;  2WBB A;  4FBP A;  4NGU A;  4HE2 A;  4PBQ A;  4PET A;  4MEV A;  2CZK A;  1KA1 A;  1IMA A;  4MIJ A;  2HXR A;  2CEY A;  2FBP A;  1FPF A;  4P8B A;  4H45 A;  1FBG A;  4LN5 A;  1LEV A;  4JVC A;  3IFC A;  1FBP A;  4GX4 A;  3KC0 A;  1EYJ A;  1G0I A;  3BIG A;  1RDX A;  3ROJ A;  4GWX A;  2WEF A;  2GQ1 A;  4N81 A;  2PFY A;  3A29 A;  4MNI A;  4PDH A;  4JVI A;  3HFU A;  1KA0 A;  2WYK A;  5IGA A;  4GX6 A;  1EYI A;  1FPK A;  2VT5 A;  2Y5K A;  2DE3 A;  2F5X A;  5IZ3 B;  2XWK A;  2CZI A;  4NAP A;  4PFR A;  1RDY A;  1FBF A;  2DVZ A;  4F18 A;  3E78 A;  4P9K A;  3FXB A;  4NN3 A;  4NQ8 A;  4MCO A;  2P3N A;  1NI9 A;  1QGX A;  2CEX A;  4AS5 A;  4GX3 A;  4GWW A;  4N91 A;  2R8T A;  5IZ1 A;  4OVS A;  2OWZ A;  5ET7 A;  2VPO A;  2Q8M A;  4X04 A;  3NOH A;  4F1U A;  4YIC A;  1NV5 A;  5A5L A;  4IR8 A;  4I3Y A;  4NHB A;  1FPG A;  2WBD A;  5DW8 A;  4OVQ A;  4OVR A;  5J16 A;  2QVU A;  1K9Y A;  4X8R A;  4OVT A;  4GWY A;  1YZ0 A;  3T1B A;  4NX1 A;  2HZL A;  3D1R A;  1LBZ A;  3T0J A;  2Q9T A;  2WX9 A;  1LBY A;  1K9Z A;  1FPE A;  3EKI A;  2FIX A;  1NV1 A;  5I3S A;  2P3V A;  4N15 A;  5J1D A;  4P1L A;  1RDZ A;  4NF0 A;  5LDZ A;  3B8B A;  5I5P A;  4GWS A;  4F19 A;  1FJ9 A;  2VPN A;  5ET5 A;  2XA5 A;  4F1V A;  3IFA A;  3KBZ A;  4UAB A;  1FPJ A;  3E79 A;  1EYK A;  4JVD A;  1LBV A;  4PFI A;  1LBW A;  2HHM A;  4PAF A;  4N6K A;  4PAI A;  2KR0 A;  1FPD A;  4HCW A;  2XWI A;  4MHF A;  4O7I A;  5LTC A;  3B50 A;  1DK4 A;  4HE1 A;  2CZH A;  4KXP A;  4GWZ A;  1IMD A;  4N8G A;  4GBW A;  1NV4 A;  4I40 A;  3LV0 A;  1IMF A;  5IM2 A;  4OA4 A;  2JJK A;  4H46 A;  1G0H A;  2V3Q A;  2ZZX A;  4P3L A;  1FPB A;  4GWU A;  1IME A;  4I3E A;  4AS4 A;  1Q9D A;  2BJI A;  4MJO A;  2DE4 A;  2ZZV A;  2FHY A;  1NV3 A;  1FBD A;  4N6D A;  1YYZ A;  1FBH A;  4M1V A;  4PAK A;  4PC9 A;  1NUW A;  1FBC A;  4XEQ A;  2L5V A;  5EYH A;  4MNC A;  4XF5 A;  3MYU A;  3ISP A;  4N17 A;  4N8Y A;  1KZ8 A;  4OAN A;  5ET8 A;  2HZK A;  4DI3 D;  4PTK A;  2MKZ A;  2QPQ A;  4PBH A;  1NUZ A;  2QFL A;  1NUX A;  4PF8 A;  1DCU A;  1SPI A;  2OX3 A;  3MST A;  1AWB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...