4MNPA

Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. nucleatum atcc 25586
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
305
structure length
305
Chain Sequence
KYNLKMGMTAGTSQNEYKAAEVFAKELKKRSNGEIELKLYPNAQLGKDDLAMMQQLEGGALDFTFAETGRFSTFFPEAEVFTLPYMIKDFNHMKKAVNTKFGKDLFKKVHDKKGMTVLAQAYNGTRQTTSNKAIKSLADMKGMKLRVPGAAANLAYAKYTEAAPTPMAFSEVYLALQTNAVDGQENPLSTIKAQKFYEVQKYLAMTNHILNDQLYLVSNITMEELPENLQKVVKESAEVAAEYHTKLFMDEEKSLKDFFKSKGVTITEPNLVDFKKAMKPFYDEYIKKNGKVGENAIKAIEAVRL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Bacterial periplasmic sialic acid-binding proteins exhibit a conserved binding site.
pubmed doi rcsb
source organism Fusobacterium nucleatum subsp. nucleatum
molecule tags Sugar binding protein
molecule keywords N-acetylneuraminate-binding protein
total genus 114
structure length 305
sequence length 305
ec nomenclature
pdb deposition date 2013-09-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mnpA00
2HZKA 4OVQA 5LTCA 4MX6A 4UABA 4OANA 4NAPA 4OVSA 2V4CA 4LN5A 4PF8A 4YZZA 4X04A 4PDDA 2XWKA 4N8GA 4P3LA 2CEXA 4MNIA 2XA5A 4PFIA 5I7IA 4MCOA 4PF6A 4DI4B 4MHFA 4P9KA 4PAKA 4P8BA 4NGUA 5CM6A 4OVRA 4PFBA 4N6KA 4P1EA 4NQ8A 4P56A 4N15A 3B50A 4O94A 2XWOA 2PFZA 2CEYA 4MNPA 2ZZVA 4N6DA 4PDHA 4N17A 4NN3A 2XXKA 2VPNA 2WYPA 4OA4A 3U65A 4NF0A 4X8RA 2WYKA 5IZZA 4MIJA 4MMPA 4PAIA 4PE3A 4YICA 5IM2A 4PGNA 4N91A 4P47A 2ZZXA 4O8MA 4PCDA 4NG7A 2XWVA 2WX9A 2XWIA 4PGPA 4N4UA 5I5PA 4MNCA 4PFRA 4PBQA 4XFEA 4OVPA 4PC9A 3GYYA 4DI3D 4PBHA 4XF5A 3FXBA 4MAGA 4XEQA 4NX1A 4P1LA 2ZZWA 4O7MA 4OVTA 4NHBA 2HZLA 4MEVA 2HPGA 2VPOA 2PFYA 4N8YA 4PAFA 4PETA 5IGAA
chains in the Genus database with same CATH superfamily
5TPAA 3PD8A 4X48A 2OX3A 3KSXA 1NV6A 4U4SA 3N6TA 3D4CA 1FQEA 4GXSB 3IB0A 2PT2A 4PDDA 4N8GA 1N3WA 2VOZA 1S50A 1JETA 4OHNA 3VXCA 4QXDA 2BJJX 4ZEBA 4OVRA 2MKZA 4KYEA 1J1NA 2QSXA 4F39A 4N15A 2PFZA 3TFLA 1ZLQA 1JP4A 1BK4A 5LDZA 2X7PA 1Y4TA 4NN3A 1NI9A 3OO7A 1N84A 1LCTA 1DOTA 1Y3NA 2L5VA 3C31A 2DWAA 4ONYA 1LBCA 4GX6A 3B8BA 3S4UA 1R6ZA 4RK9A 5DW8A 1D9VA 3T93B 2F36A 4ND9A 3HPIA 2ZYOA 3C33A 1PB7A 3IOVA 1JW1A 3K1MA 3PMXA 4F3PA 4NF4A 2Q89A 2R71A 3O9PA 3IFCA 3UN6A 1OLCA 1LGBC 3PUZE 3FXUA 1FPLA 4KD5A 1USYE 5ET6A 2PFYA 4TLLB 4R72A 4GF8A 1B52A 2IEEA 3LV0A 1O63A 3EPEA 2VD3A 1B4HA 3G3GA 3DELB 3BFUA 4BDRA 3IOTA 2DSFA 4QRZA 3QXMA 2PT1A 4OVSA 2F6PA 4H6DA 4N81A 3E3KA 2H99A 3D4GA 2O7UA 2YPNA 1P1QA 4FAJA 1MQHA 3A29A 3KJ7A 2ZYMA 3M3KA 4DCXA 4GX4A 4E0XA 4XKQA 1TFDA 1IXIA 1IEJA 1RDYA 1G0IA 1EZOA 1M5EA 1D9QA 1ZTYA 2VGQA 3ISPA 2AIXA 1K9ZA 4F2QA 4ISUA 5HBCA 4O3CA 4MNPA 1MXXA 2ZZVA 1FQBA 3IK6B 4MBPA 1QULA 2HCAA 1O7TA 5FBPA 2HXRA 3RGYA 3VDFA 1GR2A 2NWJA 4EUOA 5EQ7A 1N7XA 3RUMA 3O29A 2Q74A 3OELA 4PFWA 1UIVA 2QS1A 3ILTB 5JTYA 4JVDA 4RK2A 3JV9A 3MVYA 3T9UA 1Y1ZA 4BDLA 1FSAA 3IFAA 3TMGA 4MFIA 5H8FB 2DQVA 4AS4A 4F22A 2ZZWA 2WBBA 1IMCA 3C36A 4G68C 1DTGA 1TWYA 4L17A 1DTZA 1QUIA 4YMAA 4XXUA 3PPPA 3TKDA 2F6GA 4OMBA 1SW2A 1QGXA 4HE0A 4RA1A 1LBVA 1SD3A 2CZLA 2Y7IA 3OO6A 4FE8A 4LUBA 5FHOA 4M4GA 5AE4A 4KQPA 2RCAA 4HE1A 3QUJA 4GWWA 5DEXA 4ZE8A 2XXPA 3ODBA 5DVFA 4PF8A 2XX9A 1US4A 3BKIB 3AXFA 1TT1A 1URDA 4RPOA 1LFIA 3RQTA 4R9FA 4I40A 4P8BA 1SW4A 5I58B 1H3DA 3VE1B 2Z8DA 4ZZAA 3FV1A 1JVYA 3KOTA 4O94A 2XX7A 3IB2A 2Y7PA 1G0HA 4WKMA 2O1MA 4N6DA 2E1SA 1P99A 3KZGA 4G68A 4U22A 1XVYA 5I2KB 4H8IA 5IM2A 2HQ0A 4LZ8A 4N91A 2ZYKA 2Z23A 3ZSFA 2B4LA 1PB8A 2OWZA 4O3AA 2F7CA 1GTKA 4GWYA 5CBSA 3FUZA 2XWVA 1FBEA 3O6GA 1UTBA 4U2RA 5EQAA 3H7MA 1AWBA 4POWA 3FD3A 5J16A 1VFEA 5EHMA 4YKPA 3ROJA 3KN7A 1RYXA 1VDWA 3PD9A 4H0WA 4ZDMA 3TUSA 1ANFA 2Y5LA 3CFZA 2XX8A 2Q8MA 2V3TA 3CFLA 4G2ZA 4N8YA 3HO7A 4ESWA 4OEUA 4O7IA 1FTLA 2AYSA 1Y9UA 3U1OA 3IJOB 2QJEA 1R9QA 3C9HA 4DZ1A 3CVGA 3K00A 4NF6B 2I6EA 4U4XA 3MSTA 4X04A 1TXFA 4NEDA 3RPLA 4MCOA 3DP8A 3S9NC 4P9KA 1LBXA 4HW8A 2XXRA 1D4NA 4LATA 1Q1KA 1YCJA 1A40A 2D5WA 4PFUA 5T3JA 4G8NA 3E9XA 1FBGA 3MJNA 1HSEA 4LONB 3H6UA 4Q0CA 2H25A 2WKYA 4LQ5A 5CC2A 2Y7WA 3RPWA 2XHDA 1SBPA 3U65A 2P1SA 3N94A 5I2KA 4GL0A 5ITOA 2Y5KA 5H8NB 1K9YA 4YKJA 3K01A 4IO3A 2CMOA 3OO9A 2ONKE 1MM6A 3FXQA 3A09A 4LQ2A 5EQ9A 1B46A 1XI6A 1FW0A 4MF3A 3H6WA 4YB7A 3O66A 1KWHA 3ZKLA 3O6IA 3K1PA 2XD3A 2ZYNA 1NH8A 2F78A 4QFKA 1UIUA 1MY4A 2DWIA 1SVXB 3GBBA 4ESXA 3UA8A 2HZKA 1NV2A 4F1VA 1FBFA 4QHQA 5M2VA 4H65A 4EQ7A 5AA3A 3TAJA 3L6GA 3LBSA 2OBGA 4FEDA 3M8UA 1PDAA 3RPLB 1IMEA 4IO4A 4ELOA 1XC1A 5CMCA 4HXVA 3FVKA 4MNIA 1EU8A 4MHFA 1P1OA 1YZ0A 5I84A 4DCYA 3FBPA 1LBYA 1A54A 1LB8A 1XT8A 2YLNA 3EHUA 3QMFA 4YMBA 1QW0A 5LOMA 4IO7A 1LLSA 2DVZA 2O51A 2B3BA 3Q29A 1BP5A 3M3FA 2Y84A 4DXBA 1B58A 2VP1A 4XKNA 4PE3A 1DMBA 3K6WA 3HCQA 3MZBA 3HV1A 3VLUA 2R9JA 2B3FA 3TDJA 4GWZA 3FASA 1Y3QA 4XKPA 2I48A 3I5OA 4OYVA 3T22A 2HAVA 4N4UA 4R2BA 3CHGA 4N6PA 4FORA 4TOZA 4NE4A 3S9LC 1FBCA 4F3BA 5ICQA 1RDXA 1MH3A 2I4BA 4MEVA 1OQGA 4R73A 5H8SA 5DYHA 3SKPA 2F8DA 1NV0A 2RC7A 4KHZE 3ZKKA 3MPKA 1LCFA 5ET8A 4I62A 1FPFA 3G7WA 3O97A 4OVQA 4DLDA 4GWUA 5DVIA 3L6HA 1N76A 1MPCA 4YKKA 4MX6A 5TP9A 1MQGA 3FJMA 4XKRA 1OVBA 5I2NA 3FV2A 3PPRA 5AA2D 3ILUB 3CFXA 1B7ZA 4PAKA 3E4RA 4F31B 3S9MC 2G93A 3CR9A 4FBPA 2Z8FA 4QBAA 1RYOA 2O69A 3RT8A 4UACA 3PUXE 4FJPA 4JWXA 3FATA 2O6AA 4P56A 4AQ4A 1IZ1A 3O28A 1LFGA 4ELRA 2DE3A 4HE2A 5B70A 4N17A 4NF8B 4OENA 4NF5A 3HHFA 2DWHA 4FECA 1MXWA 1QKBA 5IZZA 3UK4A 1NV3A 5ET7A 3MVXA 5I57B 1A7LA 1IMFA 1N3XA 2AL4A 5A5LA 3MYUA 3N5LA 5JTYB 3OD7A 5L9OA 3OSQA 1NNPA 1LAFE 3IOUA 1YAEA 2GRVA 4F1YA 3FGSA 1OVTA 4NWDA 3GYYA 5BWJA 4MAGA 3FZVA 2XXUA 2I3VA 4OEVA 2RKMA 5AA2B 2HPGA 1NNKA 2VPOA 3CSBA 3FVNA 3P7IA 1YXIA 2F5XA 3IORA 1VFDA 1JNFA 2XXTA 3LSLA 1S7YA 4IGTA 4NAPA 4E0WA 3H03A 2V4CA 1YPNA 3K6XA 4DDDA 2ESNA 2OK2A 4RNSA 3I6VA 4LZ5A 4X1DA 4QSDA 2GHBA 5I58A 4NGUA 4JVCA 3T66A 1I6AA 3A3UA 3D1RA 1MRPA 5L9MA 4U1OA 1FQFA 4OXVA 3K6UA 2XWOA 4ZEKA 1MS7A 2E0SA 1NUXA 5L8DA 4Z7EA 2FVZA 1DCUA 3SEUA 1UTHA 1B5HA 1B1XA 3K0VA 4KXPA 2UVGA 4QFLA 4UA8A 3FVGA 3DM0A 1DSNA 4OFOA 3MPLA 3B6TA 1LB9A 2DE4A 2A5TB 3QIMA 1B0LA 3I3VA 1FPBA 3OOAA 1O64A 2QS3A 5FHNA 2PVUA 3SERA 3LUYA 4OERA 2PMSA 4DI3D 3VXBA 2UVHA 4F1UA 5DVJA 2AL5A 2DXYA 4EF2A 2I49A 4PQJA 4I1DA 3MZ1A 3HFUA 2O7IA 4KYDA 5EHSA 2Q2CA 1CNQA 3FJGA 1MQJA 2OJTA 5LTCA 1POY1 1A8EA 1I69A 4JDFA 1EYIA 5TP9B 4JWYA 3MBPA 3OENA 2GH9A 4U23A 2Y7KA 1FJ9A 3T1BA 5FTIA 2XXYA 4I9DA 5ITPA 1NNFA 5KZTA 1VSOA 1WVJA 2R8TA 3MWBA 1FPEA 3U72A 1INPA 3BIHA 2I58A 5IZ3B 5JK4A 2OWSA 4MLQA 3RY3A 3VLVA 4EF1A 3IO6A 1M5FA 2CEYA 2RF1A 4JSOA 1B5JA 1NNTA 5HM4B 5H8QA 4QFNA 4GIZA 4ECFA 5ICTA 3PMWA 3S9EA 4FIMA 3B6QA 2ZZXA 4BDMA 3OO8A 4LA9A 4AS5A 4PCDA 3N6UA 1NMUA 4R74A 4H5FA 3SEWA 2KLFA 3U8QA 2V3UA 2DS9A 3EN3A 3EHTA 5EQ8A 4PBQA 2QVVA 5L9SA 1SYIA 4ZE9A 2QMXA 3MP6A 1Y3PA 3ONMA 1EZ9A 1FTAA 1R1NA 1I6QA 3RLFE 4FEBA 2THIA 1JEUA 4F3GA 2RCBA 1XOCA 4F18A 3GLBA 4YAHX 4TLMB 1BIYA 2O1LA 4EXLA 2DYXA 3QSLA 5I56A 2QPQA 2REGA 1QJMA 3EKIA 1MQDA 2QS2A 1ZBMA 4H8JA 1MQIA 1A55A 4GQOA 1GV8A 3VFJA 3PU5A 3BFTA 1FQDA 4NTLA 2PCRA 1M5CA 4BDNA 5B7DA 3FJ7A 2DWJA 5KDTA 1BKAA 3G3JA 1NUZA 3SEYA 2WYPA 1PBQA 1B7HA 2HXWA 4GWXA 2Q9TA 1NKXA 5J1DA 3TTRA 1USYH 2QVRA 3TELA 4K3FA 1SPIA 3G3HA 2OZZA 3MVZA 2XWIA 1AOVA 4NF4B 3KFMA 4R6HA 1GGGA 1LEVA 3LUZA 1FPKA 3MUQA 4OESA 5DT6A 1R9LA 1IXCA 2Z8EA 1WDNA 3GXAA 2LAOA 4IR8A 1XS5A 3W9WA 4XEQA 2P3NA 4HCWA 4OVTA 3U92A 1FPJA 2F97A 2B4MA 4G4PA 2A5SA 2RINA 3C4MA 4PAFA 4PETA 4MJOA 5CMBA 4GD5A 1B3EA 1ZU0A 3W9VA 3TQLA 4ZS9A 1OLAA 4G8MA 1PC3A 2QRYA 3Q28A 4QFPA 1TFAA 4PTKA 3RTFB 1FTOA 4GWOA 4GX3A 3TCHA 1SQYA 1P1NA 5I7IA 2P3VA 4R75A 4DE8A 4GVOA 4DI4B 1YYZA 2PX1A 1I6BA 1AIVA 1FBPA 3OEKA 3TTNA 3TODA 4PFBA 4IGRA 3R6UA 2WBDA 4QSCA 5A5XB 2ZNTA 4NMYA 4KPTA 4LVQA 4F19A 3HN0A 1WODA 3U94A 5EYFA 1B5IA 2DP8A 1PEBA 1URSA 4PDHA 3USDA 1B1HA 2R6GE 4NF0A 3U93A 2VT5A 5I57A 1B05A 1H43A 2NUVA 2UYEA 3N26A 3Q27A 3GBAA 2QMWA 4G77A 2DXRA 2UVIA 4XTCQ 3KEIA 1N7WA 1P1UA 2GQ1A 4MNCA 4KR5A 1ZJLA 5TU0A 4WEDA 3H6VA 4H1XA 1IMBA 3OMBA 3EQ1A 3G3IA 5AA2A 4ZECA 1IMDA 3LSFB 2FHYA 1KA1A 4GBWA 5ESYA 5H8HB 1NV1A 5TPAB 1B2HA 1SW1A 1H76A 4WEPA 3T96B 4H67A 2X7QA 5CRYA 1SI0A 5F7VA 4AB5A 4OVJA 3CRBA 1NUYA 3E13X 2FYIA 3RTWB 1ATGA 5AA4B 1B0HA 4HTGA 3KJTA 2P2AA 3V8XB 4PF6A 1Y20A 3PUWE 3G3KA 4KCDA 3TCFA 4GWSA 1T0KA 2I4CA 2FIXA 1POTA 4RY1A 2XXQA 1F9BA 2B65A 3ECRA 4JBZA 5DTBA 5IZ3A 4C1UA 3TCGA 1KA0A 4WXJA 4G68B 2ABHA 2CZKA 2ALUA 1IMAA 4HCYA 3IO4A 3PMVA 4IO6A 4MMPA 3IOWA 1Q9DA 3FIRA 4BLAA 1NFTA 3MP8A 2UVJA 1VR5A 4NG7A 3QK6A 1XHYA 1MY1A 1QUKA 2NOOA 1DBZA 4YKIA 3Q25A 4PBHA 3VVFA 5H8HA 2XXIA 5ISUA 3TTKA 1QVSA 4YB6A 3OEMA 3SZPA 1JW4A 3O6HA 2V93A 4JXIA 3VLWA 4OANA 1H45A 1PBPA 1II5A 4LN5A 2P0SA 2ONRA 2V25A 2F35A 1RKMA 2HHMA 4NF6A 4Z0IA 4RYAA 4GLIA 3O2AA 2ONSA 2REJA 1MDQA 1Q35A 3CG3A 1H44A 2QVUA 3S2VA 2UXAA 1JQFA 3VVEA 1DPEA 1MY2A 3C35A 4ZEIA 1Y1MA 4OZ9A 5H8QB 4QSEA 2HFBA 4F3SA 3Q26A 2Q88A 4XIGQ 4F29A 2H4IA 1SI1A 4OA4A 3KG2A 1UTHB 4ELPA 2QL3A 3EHSA 3PV0E 2NVUB 4JVIA 5I59A 5H8NA 1A99A 3H4ZA 1S9TA 3MVWA 4M1VA 2Q8JA 1FQAA 5IAIA 3ZS6A 1Z7ME 3WAEA 1XVXA 1LBBA 1N04A 3V83A 4X9TA 3H6TA 3IB1A 4PGPA 3V89B 1AH5A 4GXAA 2YJPA 3MZ9A 4QF9A 1FPDA 5K2YA 3M3LA 4OFLA 3FXRA 1N0TA 3CSGA 3RNNA 4GBVA 4XF5A 4H5GA 4H46A 4N07A 4N13A 4NHBA 3UIFA 3CI8A 2ZMBA 5KCJA 3TZAA 2RC9A 3PUYE 3H3GA 1A8FA 3QUFA 5ET5A 2D21A 5DEXB 2QS4A 2XXHA 4ZEFA 4UABA 5I56B 1B6HA 4JWOA 3QAXA 2XXXA 3FVOA 1LBZA 4C1TA 2XA5A 4LP2B 5EYHA 5I3SA 5F1QA 3E78A 1NH7A 3IR1A 1LFHA 1D3KA 3KGCA 1OQHA 5CM6A 1B51A 2V3QA 2GHAA 1DK4A 4BDQA 3TTMA 1NUWA 3K4UA 2FNCA 1QUJA 3JYRA 1SW5A 3UORA 4DXUA 3UP9A 1PB9A 4PP0A 5FTHA 4POXA 1FPIA 2UYFA 4P47A 1EYJA 2HEUA 2FA7A 4Q5TA 4KCCA 4RJZA 1EZPA 3MQ9A 4PFRA 4YB5A 5BUUA 4U1ZA 3LSXA 3FXBA 3SEXA 4P1LA 1MG1A 3TQWA 1FRPA 4OETA 2KQZA 4Q30B 1LSTA 3RT6B 4KI0E 4G8HA 2W7YA 1DPPA 1MY3A 5K2XA 3KC1A 3PUVE 3K1NA 2H5YA 4QFOA 4H45A 3BBRA 2CZHA 1JVXA 1UQWA 3EF7A 3CG1A 2NXOA 4YZZA 1LAHE 4X1BA 1M5BA 3KC0A 4NWCA 2CEXA 3W15C 4ELQA 1BTJA 2ZXTA 3KN8A 2RC8A 1EYKA 1YTVA 4PFYA 3PTYA 4I3EA 1IUDA 3GZGA 3K02A 1RDZA 4LZ7A 4DXCA 1MXYA 2Y7RA 3SDFA 4P0GA 4EQ9A 2FBPA 3OXNA 3PPNA 2VHAA 3IJXB 4NF8A 4NF5B 2WYKA 2F3DA 4GOTA 4PAIA 5F24A 3R26A 1NV7A 2F7BA 5I59B 1AMFA 1ELJA 2V84A 1URGA 2F7AA 2ANJA 3HSTA 2M8CA 3T0JA 3JZJA 3TYHA 2D3IA 3UGWA 5CMKA 4Q8RA 3RYDA 3KSJA 2XXWA 1ZIUA 4OVPA 3MC2A 1HSLA 4IO2A 2XXVA 1LAXA 1OIBA 2H98A 5HPQA 2HZLA 1OMPA 1LAGE 1JEVA 2WEFA 3WAFA 4GRKA 1FTMA 5AA1A 4FATA 2QFLA 1Y4CA 2GFEA 1US5A 2I3WA 3SEVA 3IX1A 4IY6A 4PFTA 1B9JA 1B32A 3PPQA 5AA4A 1MXUA 4HS7A 2XWKA 3KBZA 3NOHA 1B40A 5CI5A 1B3FA 4PE5B 1ZMGA 1FPGA 2Z22A 4GL8A 1MY0A 3DLNA 4N6KA 4P1EA 1QKAA 4NQ8A 2XD2A 4ZEDA 3V5AA 1MXVA 1ZKBA 3CIJA 4IY5A 4ZZEA 2PBWA 2G29A 3HHGA 1SYHA 1IXHA 1MPBA 3BIGA 2XXKA 1MXZA 3E79A 4EDPA 5KDTB 3LR1A 1MDP1 4X8RA 4AB6A 4MH5A 1CB6A 1JW5A 4MIJA 3DP6A 3KOSA 1B3HA 3K2DA 5IKBA 2F34A 2ZNUA 2A5TA 2DVCA 4YU0A 5JEIA 1B3GA 2JJKA 2OWTA 4OFJA 2DDKA 1IITA 3H06B 4BDOA 2FIEA 2OCUA 3TTLA 3VV5A 1MH4A 4OWDA 5I5PA 3THIA 2Q2AA 2CZIA 4XFEA 5H8FA 1Z7NE 3T9XB 3OSRA 4NX1A 4O7MA 2DOJA 5EYGA 4EQBA 3PPOA 4THIA 2IA4A 3RN8A 2H9BA 3MP1A 1LBWA 4IO5A 3SESA 1NV4A 1GVCA 3K6VA 4JB7A 1NL5A 5IZ1A 1NV5A 2O68A 4R6YA 3KN3A 2X26A 3F11A 1L5TA 4R2FA 3IL1B 5I2NB 1IIWA 4RPNA 3A3CA 4KYSA 3SETA 3KBRA 4OTEA 1P1WA 1FJ6A 1BLFA 4G61A 4P3LA 4MLVA 4PFIA 1MPDA 5CBRA 1B4ZA 2HAUA 3T9HB 1FBHA 1FBDA 2BJIA 3LC8A 2OLBA 3PGFA 4RXLA 3R7XA 3QYTA 3B50A 1B3LA 4F2OA 1FTJA 2DE2A 1FQCA 4U21A 4DIGA 5A5XA 3T9VA 3VVDA 5FHMA 3B6WA 4GFRA 3DP4A 2F3BA 2VPNA 3C34A 4C0RA 1M5DA 2I0CA 1B7UA 4YICA 3TPAA 4PGNA 1MM7A 4P11A 2VD2A 4R9GA 1VE4A 4O3BA 1FCKA 2ZNSA 3IAZA 1D9YA 1UTBB 3MW0A 4O8MA 1AL3A 4KFQA 1KZ8A 4I8CA 2WX9A 2O84X 4P0IA 2PYYA 1HSJA 1IQ7A 3G3FA 4PC9A 1FTKA 4IB2A 4EXKA 3TEPA 2I0BA 4JSDA 3LSWA 2KR0A 1CE2A 5CMMA 5KCJB 5ELVA 4R6KA 3B7DA 3C32A 4I3YA 4TQUQ 4OQOA 1IXGA 1SDXA 1EH3A 5IGAA 3MAMA
chains in the Genus database with same CATH topology
1FPFA 1LBVA 2HZKA 1NV2A 4OVQA 5IZ1A 3W9VA 4F1VA 3KC1A 5ET5A 1FBFA 4GWUA 1NV5A 1CNQA 4HE0A 2OX3A 5LTCA 3W9WA 1NV6A 4HE1A 4MX6A 4UABA 4GWWA 4H45A 4OANA 2CZHA 4NAPA 4OVSA 2V4CA 4PTKA 1EYIA 4LN5A 4PF8A 4YZZA 1LBZA 1NUYA 4GX3A 3RPLB 1IMEA 1FJ6A 3MSTA 4N81A 4X04A 2QPQA 4PDDA 4G61A 2HHMA 4HXVA 2XWKA 3KBZA 3KC0A 3NOHA 1FJ9A 2CEXA 3EKIA 2XA5A 4MNIA 4N8GA 2P3VA 4PFIA 5EYHA 3RPLA 3T1BA 5I7IA 4MCOA 5I3SA 4PF6A 3A29A 3E78A 4DI4B 1YYZA 4I40A 1FBHA 1FPGA 4MHFA 4P9KA 1LBXA 4PAKA 4P8BA 1EYKA 4GX4A 4NGUA 1FBPA 2R8TA 4QXDA 4JVCA 5LDZA 1FPEA 2QVUA 5CM6A 1FBDA 2BJIA 4GWSA 4OVRA 1RDYA 4PFBA 1YZ0A 2MKZA 1G0IA 1INPA 2FIXA 3BIHA 3D1RA 3PTYA 2V3QA 2WBDA 4I3EA 4NQ8A 4QBAA 5IZ3B 5JK4A 1DK4A 4P56A 1D9QA 3FBPA 4N15A 5IZ3A 5T3JA 3B50A 3ISPA 1FBGA 2DE2A 2QFLA 1K9ZA 4O94A 2PCRA 4P3LA 4F19A 2XWOA 1LBYA 1RDZA 2PFZA 2DE3A 1KA0A 1NUWA 2CEYA 5IGAA 1JP4A 1BK4A 4MNPA 1G0HA 1NUXA 4HE2A 2FVZA 2CZKA 1DCUA 2ZZVA 4N6DA 4PDHA 3QMFA 3BIGA 4N17A 4NN3A 3LV0A 1NI9A 1IMAA 2XXKA 2F3BA 2FBPA 1NUZA 2VPNA 3E79A 2DVZA 2WYPA 4HCYA 4OA4A 3U65A 5FBPA 2HXRA 4NF0A 4X8RA 2VT5A 2Y5KA 4KXPA 2WYKA 4O7IA 2F3DA 5IZZA 4MIJA 1K9YA 4MMPA 4PAIA 1NV3A 4PE3A 4YICA 4PGNA 5ET7A 5F24A 5IM2A 5EQ7A 1NV7A 1Q9DA 4JVIA 4N91A 1FPIA 4GWXA 2Q9TA 4M1VA 2L5VA 2B4LA 1IMFA 2OWZA 4P47A 4GX6A 2Q74A 5J1DA 3B8BA 2JJKA 1EYJA 2ZZXA 2DE4A 2QVRA 5A5LA 3MYUA 4AS5A 4GWZA 4O8MA 4F18A 4GWYA 4PCDA 5DW8A 4NG7A 1SPIA 3T0JA 2DDKA 1FPBA 1KZ8A 4FBPA 2XWVA 1FBEA 2FIEA 2WX9A 2XWIA 4X9TA 5EQ9A 5EQAA 1XI6A 4PGPA 4N4UA 4JVDA 1AWBA 5I5PA 2GQ1A 3CHGA 4MNCA 1FPDA 5J16A 4PFRA 3RYDA 1LEVA 1FBCA 2CZIA 3LUZA 4PBQA 1DBZA 1FPKA 2QVVA 4XFEA 5EQ8A 4OVPA 4PC9A 1IMBA 4GBVA 3GYYA 1FSAA 3IFAA 4PBHA 4XF5A 4DI3D 1IMDA 3FXBA 4IR8A 4MAGA 3ROJA 4F1UA 4AS4A 1RDXA 1VDWA 2KR0A 3IFCA 4H46A 4NX1A 4XEQA 2P3NA 2ZZWA 4HCWA 2WBBA 4P1LA 4O7MA 1IMCA 1FTAA 2FHYA 4OVTA 1FPJA 1FRPA 1KA1A 2B4MA 2HZLA 2Y5LA 4GBWA 4NHBA 5ESYA 5EYGA 2KQZA 2HPGA 4I3YA 4MEVA 1FPLA 2VPOA 2Q8MA 1LBWA 2WEFA 1NV0A 1NV1A 5ET6A 2PFYA 4N8YA 1NV4A 4N6KA 4PAFA 3SZPA 1YXIA 4P1EA 4MJOA 4PETA 2F5XA 3HFUA 5ET8A 1QGXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HZK A;  4OVQ A;  5LTC A;  4MX6 A;  4UAB A;  4OAN A;  4NAP A;  4OVS A;  2V4C A;  4LN5 A;  4PF8 A;  4YZZ A;  4X04 A;  4PDD A;  2XWK A;  4N8G A;  4P3L A;  2CEX A;  4MNI A;  2XA5 A;  4PFI A;  5I7I A;  4MCO A;  4PF6 A;  4DI4 B;  4MHF A;  4P9K A;  4PAK A;  4P8B A;  4NGU A;  5CM6 A;  4OVR A;  4PFB A;  4N6K A;  4P1E A;  4NQ8 A;  4P56 A;  4N15 A;  3B50 A;  4O94 A;  2XWO A;  2PFZ A;  2CEY A;  4MNP A;  2ZZV A;  4N6D A;  4PDH A;  4N17 A;  4NN3 A;  2XXK A;  2VPN A;  2WYP A;  4OA4 A;  3U65 A;  4NF0 A;  4X8R A;  2WYK A;  5IZZ A;  4MIJ A;  4MMP A;  4PAI A;  4PE3 A;  4YIC A;  5IM2 A;  4PGN A;  4N91 A;  4P47 A;  2ZZX A;  4O8M A;  4PCD A;  4NG7 A;  2XWV A;  2WX9 A;  2XWI A;  4PGP A;  4N4U A;  5I5P A;  4MNC A;  4PFR A;  4PBQ A;  4XFE A;  4OVP A;  4PC9 A;  3GYY A;  4DI3 D;  4PBH A;  4XF5 A;  3FXB A;  4MAG A;  4XEQ A;  4NX1 A;  4P1L A;  2ZZW A;  4O7M A;  4OVT A;  4NHB A;  2HZL A;  4MEV A;  2HPG A;  2VPO A;  2PFY A;  4N8Y A;  4PAF A;  4PET A;  5IGA A; 
#chains in the Genus database with same CATH topology
 5TPA A;  3PD8 A;  4X48 A;  2OX3 A;  3KSX A;  1NV6 A;  4U4S A;  3N6T A;  3D4C A;  1FQE A;  4GXS B;  3IB0 A;  2PT2 A;  4PDD A;  4N8G A;  1N3W A;  2VOZ A;  1S50 A;  1JET A;  4OHN A;  3VXC A;  4QXD A;  2BJJ X;  4ZEB A;  4OVR A;  2MKZ A;  4KYE A;  1J1N A;  2QSX A;  4F39 A;  4N15 A;  2PFZ A;  3TFL A;  1ZLQ A;  1JP4 A;  1BK4 A;  5LDZ A;  2X7P A;  1Y4T A;  4NN3 A;  1NI9 A;  3OO7 A;  1N84 A;  1LCT A;  1DOT A;  1Y3N A;  2L5V A;  3C31 A;  2DWA A;  4ONY A;  1LBC A;  4GX6 A;  3B8B A;  3S4U A;  1R6Z A;  4RK9 A;  5DW8 A;  1D9V A;  3T93 B;  2F36 A;  4ND9 A;  3HPI A;  2ZYO A;  3C33 A;  1PB7 A;  3IOV A;  1JW1 A;  3K1M A;  3PMX A;  4F3P A;  4NF4 A;  2Q89 A;  2R71 A;  3O9P A;  3IFC A;  3UN6 A;  1OLC A;  1LGB C;  3PUZ E;  3FXU A;  1FPL A;  4KD5 A;  1USY E;  5ET6 A;  2PFY A;  4TLL B;  4R72 A;  4GF8 A;  1B52 A;  2IEE A;  3LV0 A;  1O63 A;  3EPE A;  2VD3 A;  1B4H A;  3G3G A;  3DEL B;  3BFU A;  4BDR A;  3IOT A;  2DSF A;  4QRZ A;  3QXM A;  2PT1 A;  4OVS A;  2F6P A;  4H6D A;  4N81 A;  3E3K A;  2H99 A;  3D4G A;  2O7U A;  2YPN A;  1P1Q A;  4FAJ A;  1MQH A;  3A29 A;  3KJ7 A;  2ZYM A;  3M3K A;  4DCX A;  4GX4 A;  4E0X A;  4XKQ A;  1TFD A;  1IXI A;  1IEJ A;  1RDY A;  1G0I A;  1EZO A;  1M5E A;  1D9Q A;  1ZTY A;  2VGQ A;  3ISP A;  2AIX A;  1K9Z A;  4F2Q A;  4ISU A;  5HBC A;  4O3C A;  4MNP A;  1MXX A;  2ZZV A;  1FQB A;  3IK6 B;  4MBP A;  1QUL A;  2HCA A;  1O7T A;  5FBP A;  2HXR A;  3RGY A;  3VDF A;  1GR2 A;  2NWJ A;  4EUO A;  5EQ7 A;  1N7X A;  3RUM A;  3O29 A;  2Q74 A;  3OEL A;  4PFW A;  1UIV A;  2QS1 A;  3ILT B;  5JTY A;  4JVD A;  4RK2 A;  3JV9 A;  3MVY A;  3T9U A;  1Y1Z A;  4BDL A;  1FSA A;  3IFA A;  3TMG A;  4MFI A;  5H8F B;  2DQV A;  4AS4 A;  4F22 A;  2ZZW A;  2WBB A;  1IMC A;  3C36 A;  4G68 C;  1DTG A;  1TWY A;  4L17 A;  1DTZ A;  1QUI A;  4YMA A;  4XXU A;  3PPP A;  3TKD A;  2F6G A;  4OMB A;  1SW2 A;  1QGX A;  4HE0 A;  4RA1 A;  1LBV A;  1SD3 A;  2CZL A;  2Y7I A;  3OO6 A;  4FE8 A;  4LUB A;  5FHO A;  4M4G A;  5AE4 A;  4KQP A;  2RCA A;  4HE1 A;  3QUJ A;  4GWW A;  5DEX A;  4ZE8 A;  2XXP A;  3ODB A;  5DVF A;  4PF8 A;  2XX9 A;  1US4 A;  3BKI B;  3AXF A;  1TT1 A;  1URD A;  4RPO A;  1LFI A;  3RQT A;  4R9F A;  4I40 A;  4P8B A;  1SW4 A;  5I58 B;  1H3D A;  3VE1 B;  2Z8D A;  4ZZA A;  3FV1 A;  1JVY A;  3KOT A;  4O94 A;  2XX7 A;  3IB2 A;  2Y7P A;  1G0H A;  4WKM A;  2O1M A;  4N6D A;  2E1S A;  1P99 A;  3KZG A;  4G68 A;  4U22 A;  1XVY A;  5I2K B;  4H8I A;  5IM2 A;  2HQ0 A;  4LZ8 A;  4N91 A;  2ZYK A;  2Z23 A;  3ZSF A;  2B4L A;  1PB8 A;  2OWZ A;  4O3A A;  2F7C A;  1GTK A;  4GWY A;  5CBS A;  3FUZ A;  2XWV A;  1FBE A;  3O6G A;  1UTB A;  4U2R A;  5EQA A;  3H7M A;  1AWB A;  4POW A;  3FD3 A;  5J16 A;  1VFE A;  5EHM A;  4YKP A;  3ROJ A;  3KN7 A;  1RYX A;  1VDW A;  3PD9 A;  4H0W A;  4ZDM A;  3TUS A;  1ANF A;  2Y5L A;  3CFZ A;  2XX8 A;  2Q8M A;  2V3T A;  3CFL A;  4G2Z A;  4N8Y A;  3HO7 A;  4ESW A;  4OEU A;  4O7I A;  1FTL A;  2AYS A;  1Y9U A;  3U1O A;  3IJO B;  2QJE A;  1R9Q A;  3C9H A;  4DZ1 A;  3CVG A;  3K00 A;  4NF6 B;  2I6E A;  4U4X A;  3MST A;  4X04 A;  1TXF A;  4NED A;  3RPL A;  4MCO A;  3DP8 A;  3S9N C;  4P9K A;  1LBX A;  4HW8 A;  2XXR A;  1D4N A;  4LAT A;  1Q1K A;  1YCJ A;  1A40 A;  2D5W A;  4PFU A;  5T3J A;  4G8N A;  3E9X A;  1FBG A;  3MJN A;  1HSE A;  4LON B;  3H6U A;  4Q0C A;  2H25 A;  2WKY A;  4LQ5 A;  5CC2 A;  2Y7W A;  3RPW A;  2XHD A;  1SBP A;  3U65 A;  2P1S A;  3N94 A;  5I2K A;  4GL0 A;  5ITO A;  2Y5K A;  5H8N B;  1K9Y A;  4YKJ A;  3K01 A;  4IO3 A;  2CMO A;  3OO9 A;  2ONK E;  1MM6 A;  3FXQ A;  3A09 A;  4LQ2 A;  5EQ9 A;  1B46 A;  1XI6 A;  1FW0 A;  4MF3 A;  3H6W A;  4YB7 A;  3O66 A;  1KWH A;  3ZKL A;  3O6I A;  3K1P A;  2XD3 A;  2ZYN A;  1NH8 A;  2F78 A;  4QFK A;  1UIU A;  1MY4 A;  2DWI A;  1SVX B;  3GBB A;  4ESX A;  3UA8 A;  2HZK A;  1NV2 A;  4F1V A;  1FBF A;  4QHQ A;  5M2V A;  4H65 A;  4EQ7 A;  5AA3 A;  3TAJ A;  3L6G A;  3LBS A;  2OBG A;  4FED A;  3M8U A;  1PDA A;  3RPL B;  1IME A;  4IO4 A;  4ELO A;  1XC1 A;  5CMC A;  4HXV A;  3FVK A;  4MNI A;  1EU8 A;  4MHF A;  1P1O A;  1YZ0 A;  5I84 A;  4DCY A;  3FBP A;  1LBY A;  1A54 A;  1LB8 A;  1XT8 A;  2YLN A;  3EHU A;  3QMF A;  4YMB A;  1QW0 A;  5LOM A;  4IO7 A;  1LLS A;  2DVZ A;  2O51 A;  2B3B A;  3Q29 A;  1BP5 A;  3M3F A;  2Y84 A;  4DXB A;  1B58 A;  2VP1 A;  4XKN A;  4PE3 A;  1DMB A;  3K6W A;  3HCQ A;  3MZB A;  3HV1 A;  3VLU A;  2R9J A;  2B3F A;  3TDJ A;  4GWZ A;  3FAS A;  1Y3Q A;  4XKP A;  2I48 A;  3I5O A;  4OYV A;  3T22 A;  2HAV A;  4N4U A;  4R2B A;  3CHG A;  4N6P A;  4FOR A;  4TOZ A;  4NE4 A;  3S9L C;  1FBC A;  4F3B A;  5ICQ A;  1RDX A;  1MH3 A;  2I4B A;  4MEV A;  1OQG A;  4R73 A;  5H8S A;  5DYH A;  3SKP A;  2F8D A;  1NV0 A;  2RC7 A;  4KHZ E;  3ZKK A;  3MPK A;  1LCF A;  5ET8 A;  4I62 A;  1FPF A;  3G7W A;  3O97 A;  4OVQ A;  4DLD A;  4GWU A;  5DVI A;  3L6H A;  1N76 A;  1MPC A;  4YKK A;  4MX6 A;  5TP9 A;  1MQG A;  3FJM A;  4XKR A;  1OVB A;  5I2N A;  3FV2 A;  3PPR A;  5AA2 D;  3ILU B;  3CFX A;  1B7Z A;  4PAK A;  3E4R A;  4F31 B;  3S9M C;  2G93 A;  3CR9 A;  4FBP A;  2Z8F A;  4QBA A;  1RYO A;  2O69 A;  3RT8 A;  4UAC A;  3PUX E;  4FJP A;  4JWX A;  3FAT A;  2O6A A;  4P56 A;  4AQ4 A;  1IZ1 A;  3O28 A;  1LFG A;  4ELR A;  2DE3 A;  4HE2 A;  5B70 A;  4N17 A;  4NF8 B;  4OEN A;  4NF5 A;  3HHF A;  2DWH A;  4FEC A;  1MXW A;  1QKB A;  5IZZ A;  3UK4 A;  1NV3 A;  5ET7 A;  3MVX A;  5I57 B;  1A7L A;  1IMF A;  1N3X A;  2AL4 A;  5A5L A;  3MYU A;  3N5L A;  5JTY B;  3OD7 A;  5L9O A;  3OSQ A;  1NNP A;  1LAF E;  3IOU A;  1YAE A;  2GRV A;  4F1Y A;  3FGS A;  1OVT A;  4NWD A;  3GYY A;  5BWJ A;  4MAG A;  3FZV A;  2XXU A;  2I3V A;  4OEV A;  2RKM A;  5AA2 B;  2HPG A;  1NNK A;  2VPO A;  3CSB A;  3FVN A;  3P7I A;  1YXI A;  2F5X A;  3IOR A;  1VFD A;  1JNF A;  2XXT A;  3LSL A;  1S7Y A;  4IGT A;  4NAP A;  4E0W A;  3H03 A;  2V4C A;  1YPN A;  3K6X A;  4DDD A;  2ESN A;  2OK2 A;  4RNS A;  3I6V A;  4LZ5 A;  4X1D A;  4QSD A;  2GHB A;  5I58 A;  4NGU A;  4JVC A;  3T66 A;  1I6A A;  3A3U A;  3D1R A;  1MRP A;  5L9M A;  4U1O A;  1FQF A;  4OXV A;  3K6U A;  2XWO A;  4ZEK A;  1MS7 A;  2E0S A;  1NUX A;  5L8D A;  4Z7E A;  2FVZ A;  1DCU A;  3SEU A;  1UTH A;  1B5H A;  1B1X A;  3K0V A;  4KXP A;  2UVG A;  4QFL A;  4UA8 A;  3FVG A;  3DM0 A;  1DSN A;  4OFO A;  3MPL A;  3B6T A;  1LB9 A;  2DE4 A;  2A5T B;  3QIM A;  1B0L A;  3I3V A;  1FPB A;  3OOA A;  1O64 A;  2QS3 A;  5FHN A;  2PVU A;  3SER A;  3LUY A;  4OER A;  2PMS A;  4DI3 D;  3VXB A;  2UVH A;  4F1U A;  5DVJ A;  2AL5 A;  2DXY A;  4EF2 A;  2I49 A;  4PQJ A;  4I1D A;  3MZ1 A;  3HFU A;  2O7I A;  4KYD A;  5EHS A;  2Q2C A;  1CNQ A;  3FJG A;  1MQJ A;  2OJT A;  5LTC A;  1POY 1;  1A8E A;  1I69 A;  4JDF A;  1EYI A;  5TP9 B;  4JWY A;  3MBP A;  3OEN A;  2GH9 A;  4U23 A;  2Y7K A;  1FJ9 A;  3T1B A;  5FTI A;  2XXY A;  4I9D A;  5ITP A;  1NNF A;  5KZT A;  1VSO A;  1WVJ A;  2R8T A;  3MWB A;  1FPE A;  3U72 A;  1INP A;  3BIH A;  2I58 A;  5IZ3 B;  5JK4 A;  2OWS A;  4MLQ A;  3RY3 A;  3VLV A;  4EF1 A;  3IO6 A;  1M5F A;  2CEY A;  2RF1 A;  4JSO A;  1B5J A;  1NNT A;  5HM4 B;  5H8Q A;  4QFN A;  4GIZ A;  4ECF A;  5ICT A;  3PMW A;  3S9E A;  4FIM A;  3B6Q A;  2ZZX A;  4BDM A;  3OO8 A;  4LA9 A;  4AS5 A;  4PCD A;  3N6U A;  1NMU A;  4R74 A;  4H5F A;  3SEW A;  2KLF A;  3U8Q A;  2V3U A;  2DS9 A;  3EN3 A;  3EHT A;  5EQ8 A;  4PBQ A;  2QVV A;  5L9S A;  1SYI A;  4ZE9 A;  2QMX A;  3MP6 A;  1Y3P A;  3ONM A;  1EZ9 A;  1FTA A;  1R1N A;  1I6Q A;  3RLF E;  4FEB A;  2THI A;  1JEU A;  4F3G A;  2RCB A;  1XOC A;  4F18 A;  3GLB A;  4YAH X;  4TLM B;  1BIY A;  2O1L A;  4EXL A;  2DYX A;  3QSL A;  5I56 A;  2QPQ A;  2REG A;  1QJM A;  3EKI A;  1MQD A;  2QS2 A;  1ZBM A;  4H8J A;  1MQI A;  1A55 A;  4GQO A;  1GV8 A;  3VFJ A;  3PU5 A;  3BFT A;  1FQD A;  4NTL A;  2PCR A;  1M5C A;  4BDN A;  5B7D A;  3FJ7 A;  2DWJ A;  5KDT A;  1BKA A;  3G3J A;  1NUZ A;  3SEY A;  2WYP A;  1PBQ A;  1B7H A;  2HXW A;  4GWX A;  2Q9T A;  1NKX A;  5J1D A;  3TTR A;  1USY H;  2QVR A;  3TEL A;  4K3F A;  1SPI A;  3G3H A;  2OZZ A;  3MVZ A;  2XWI A;  1AOV A;  4NF4 B;  3KFM A;  4R6H A;  1GGG A;  1LEV A;  3LUZ A;  1FPK A;  3MUQ A;  4OES A;  5DT6 A;  1R9L A;  1IXC A;  2Z8E A;  1WDN A;  3GXA A;  2LAO A;  4IR8 A;  1XS5 A;  3W9W A;  4XEQ A;  2P3N A;  4HCW A;  4OVT A;  3U92 A;  1FPJ A;  2F97 A;  2B4M A;  4G4P A;  2A5S A;  2RIN A;  3C4M A;  4PAF A;  4PET A;  4MJO A;  5CMB A;  4GD5 A;  1B3E A;  1ZU0 A;  3W9V A;  3TQL A;  4ZS9 A;  1OLA A;  4G8M A;  1PC3 A;  2QRY A;  3Q28 A;  4QFP A;  1TFA A;  4PTK A;  3RTF B;  1FTO A;  4GWO A;  4GX3 A;  3TCH A;  1SQY A;  1P1N A;  5I7I A;  2P3V A;  4R75 A;  4DE8 A;  4GVO A;  4DI4 B;  1YYZ A;  2PX1 A;  1I6B A;  1AIV A;  1FBP A;  3OEK A;  3TTN A;  3TOD A;  4PFB A;  4IGR A;  3R6U A;  2WBD A;  4QSC A;  5A5X B;  2ZNT A;  4NMY A;  4KPT A;  4LVQ A;  4F19 A;  3HN0 A;  1WOD A;  3U94 A;  5EYF A;  1B5I A;  2DP8 A;  1PEB A;  1URS A;  4PDH A;  3USD A;  1B1H A;  2R6G E;  4NF0 A;  3U93 A;  2VT5 A;  5I57 A;  1B05 A;  1H43 A;  2NUV A;  2UYE A;  3N26 A;  3Q27 A;  3GBA A;  2QMW A;  4G77 A;  2DXR A;  2UVI A;  4XTC Q;  3KEI A;  1N7W A;  1P1U A;  2GQ1 A;  4MNC A;  4KR5 A;  1ZJL A;  5TU0 A;  4WED A;  3H6V A;  4H1X A;  1IMB A;  3OMB A;  3EQ1 A;  3G3I A;  5AA2 A;  4ZEC A;  1IMD A;  3LSF B;  2FHY A;  1KA1 A;  4GBW A;  5ESY A;  5H8H B;  1NV1 A;  5TPA B;  1B2H A;  1SW1 A;  1H76 A;  4WEP A;  3T96 B;  4H67 A;  2X7Q A;  5CRY A;  1SI0 A;  5F7V A;  4AB5 A;  4OVJ A;  3CRB A;  1NUY A;  3E13 X;  2FYI A;  3RTW B;  1ATG A;  5AA4 B;  1B0H A;  4HTG A;  3KJT A;  2P2A A;  3V8X B;  4PF6 A;  1Y20 A;  3PUW E;  3G3K A;  4KCD A;  3TCF A;  4GWS A;  1T0K A;  2I4C A;  2FIX A;  1POT A;  4RY1 A;  2XXQ A;  1F9B A;  2B65 A;  3ECR A;  4JBZ A;  5DTB A;  5IZ3 A;  4C1U A;  3TCG A;  1KA0 A;  4WXJ A;  4G68 B;  2ABH A;  2CZK A;  2ALU A;  1IMA A;  4HCY A;  3IO4 A;  3PMV A;  4IO6 A;  4MMP A;  3IOW A;  1Q9D A;  3FIR A;  4BLA A;  1NFT A;  3MP8 A;  2UVJ A;  1VR5 A;  4NG7 A;  3QK6 A;  1XHY A;  1MY1 A;  1QUK A;  2NOO A;  1DBZ A;  4YKI A;  3Q25 A;  4PBH A;  3VVF A;  5H8H A;  2XXI A;  5ISU A;  3TTK A;  1QVS A;  4YB6 A;  3OEM A;  3SZP A;  1JW4 A;  3O6H A;  2V93 A;  4JXI A;  3VLW A;  4OAN A;  1H45 A;  1PBP A;  1II5 A;  4LN5 A;  2P0S A;  2ONR A;  2V25 A;  2F35 A;  1RKM A;  2HHM A;  4NF6 A;  4Z0I A;  4RYA A;  4GLI A;  3O2A A;  2ONS A;  2REJ A;  1MDQ A;  1Q35 A;  3CG3 A;  1H44 A;  2QVU A;  3S2V A;  2UXA A;  1JQF A;  3VVE A;  1DPE A;  1MY2 A;  3C35 A;  4ZEI A;  1Y1M A;  4OZ9 A;  5H8Q B;  4QSE A;  2HFB A;  4F3S A;  3Q26 A;  2Q88 A;  4XIG Q;  4F29 A;  2H4I A;  1SI1 A;  4OA4 A;  3KG2 A;  1UTH B;  4ELP A;  2QL3 A;  3EHS A;  3PV0 E;  2NVU B;  4JVI A;  5I59 A;  5H8N A;  1A99 A;  3H4Z A;  1S9T A;  3MVW A;  4M1V A;  2Q8J A;  1FQA A;  5IAI A;  3ZS6 A;  1Z7M E;  3WAE A;  1XVX A;  1LBB A;  1N04 A;  3V83 A;  4X9T A;  3H6T A;  3IB1 A;  4PGP A;  3V89 B;  1AH5 A;  4GXA A;  2YJP A;  3MZ9 A;  4QF9 A;  1FPD A;  5K2Y A;  3M3L A;  4OFL A;  3FXR A;  1N0T A;  3CSG A;  3RNN A;  4GBV A;  4XF5 A;  4H5G A;  4H46 A;  4N07 A;  4N13 A;  4NHB A;  3UIF A;  3CI8 A;  2ZMB A;  5KCJ A;  3TZA A;  2RC9 A;  3PUY E;  3H3G A;  1A8F A;  3QUF A;  5ET5 A;  2D21 A;  5DEX B;  2QS4 A;  2XXH A;  4ZEF A;  4UAB A;  5I56 B;  1B6H A;  4JWO A;  3QAX A;  2XXX A;  3FVO A;  1LBZ A;  4C1T A;  2XA5 A;  4LP2 B;  5EYH A;  5I3S A;  5F1Q A;  3E78 A;  1NH7 A;  3IR1 A;  1LFH A;  1D3K A;  3KGC A;  1OQH A;  5CM6 A;  1B51 A;  2V3Q A;  2GHA A;  1DK4 A;  4BDQ A;  3TTM A;  1NUW A;  3K4U A;  2FNC A;  1QUJ A;  3JYR A;  1SW5 A;  3UOR A;  4DXU A;  3UP9 A;  1PB9 A;  4PP0 A;  5FTH A;  4POX A;  1FPI A;  2UYF A;  4P47 A;  1EYJ A;  2HEU A;  2FA7 A;  4Q5T A;  4KCC A;  4RJZ A;  1EZP A;  3MQ9 A;  4PFR A;  4YB5 A;  5BUU A;  4U1Z A;  3LSX A;  3FXB A;  3SEX A;  4P1L A;  1MG1 A;  3TQW A;  1FRP A;  4OET A;  2KQZ A;  4Q30 B;  1LST A;  3RT6 B;  4KI0 E;  4G8H A;  2W7Y A;  1DPP A;  1MY3 A;  5K2X A;  3KC1 A;  3PUV E;  3K1N A;  2H5Y A;  4QFO A;  4H45 A;  3BBR A;  2CZH A;  1JVX A;  1UQW A;  3EF7 A;  3CG1 A;  2NXO A;  4YZZ A;  1LAH E;  4X1B A;  1M5B A;  3KC0 A;  4NWC A;  2CEX A;  3W15 C;  4ELQ A;  1BTJ A;  2ZXT A;  3KN8 A;  2RC8 A;  1EYK A;  1YTV A;  4PFY A;  3PTY A;  4I3E A;  1IUD A;  3GZG A;  3K02 A;  1RDZ A;  4LZ7 A;  4DXC A;  1MXY A;  2Y7R A;  3SDF A;  4P0G A;  4EQ9 A;  2FBP A;  3OXN A;  3PPN A;  2VHA A;  3IJX B;  4NF8 A;  4NF5 B;  2WYK A;  2F3D A;  4GOT A;  4PAI A;  5F24 A;  3R26 A;  1NV7 A;  2F7B A;  5I59 B;  1AMF A;  1ELJ A;  2V84 A;  1URG A;  2F7A A;  2ANJ A;  3HST A;  2M8C A;  3T0J A;  3JZJ A;  3TYH A;  2D3I A;  3UGW A;  5CMK A;  4Q8R A;  3RYD A;  3KSJ A;  2XXW A;  1ZIU A;  4OVP A;  3MC2 A;  1HSL A;  4IO2 A;  2XXV A;  1LAX A;  1OIB A;  2H98 A;  5HPQ A;  2HZL A;  1OMP A;  1LAG E;  1JEV A;  2WEF A;  3WAF A;  4GRK A;  1FTM A;  5AA1 A;  4FAT A;  2QFL A;  1Y4C A;  2GFE A;  1US5 A;  2I3W A;  3SEV A;  3IX1 A;  4IY6 A;  4PFT A;  1B9J A;  1B32 A;  3PPQ A;  5AA4 A;  1MXU A;  4HS7 A;  2XWK A;  3KBZ A;  3NOH A;  1B40 A;  5CI5 A;  1B3F A;  4PE5 B;  1ZMG A;  1FPG A;  2Z22 A;  4GL8 A;  1MY0 A;  3DLN A;  4N6K A;  4P1E A;  1QKA A;  4NQ8 A;  2XD2 A;  4ZED A;  3V5A A;  1MXV A;  1ZKB A;  3CIJ A;  4IY5 A;  4ZZE A;  2PBW A;  2G29 A;  3HHG A;  1SYH A;  1IXH A;  1MPB A;  3BIG A;  2XXK A;  1MXZ A;  3E79 A;  4EDP A;  5KDT B;  3LR1 A;  1MDP 1;  4X8R A;  4AB6 A;  4MH5 A;  1CB6 A;  1JW5 A;  4MIJ A;  3DP6 A;  3KOS A;  1B3H A;  3K2D A;  5IKB A;  2F34 A;  2ZNU A;  2A5T A;  2DVC A;  4YU0 A;  5JEI A;  1B3G A;  2JJK A;  2OWT A;  4OFJ A;  2DDK A;  1IIT A;  3H06 B;  4BDO A;  2FIE A;  2OCU A;  3TTL A;  3VV5 A;  1MH4 A;  4OWD A;  5I5P A;  3THI A;  2Q2A A;  2CZI A;  4XFE A;  5H8F A;  1Z7N E;  3T9X B;  3OSR A;  4NX1 A;  4O7M A;  2DOJ A;  5EYG A;  4EQB A;  3PPO A;  4THI A;  2IA4 A;  3RN8 A;  2H9B A;  3MP1 A;  1LBW A;  4IO5 A;  3SES A;  1NV4 A;  1GVC A;  3K6V A;  4JB7 A;  1NL5 A;  5IZ1 A;  1NV5 A;  2O68 A;  4R6Y A;  3KN3 A;  2X26 A;  3F11 A;  1L5T A;  4R2F A;  3IL1 B;  5I2N B;  1IIW A;  4RPN A;  3A3C A;  4KYS A;  3SET A;  3KBR A;  4OTE A;  1P1W A;  1FJ6 A;  1BLF A;  4G61 A;  4P3L A;  4MLV A;  4PFI A;  1MPD A;  5CBR A;  1B4Z A;  2HAU A;  3T9H B;  1FBH A;  1FBD A;  2BJI A;  3LC8 A;  2OLB A;  3PGF A;  4RXL A;  3R7X A;  3QYT A;  3B50 A;  1B3L A;  4F2O A;  1FTJ A;  2DE2 A;  1FQC A;  4U21 A;  4DIG A;  5A5X A;  3T9V A;  3VVD A;  5FHM A;  3B6W A;  4GFR A;  3DP4 A;  2F3B A;  2VPN A;  3C34 A;  4C0R A;  1M5D A;  2I0C A;  1B7U A;  4YIC A;  3TPA A;  4PGN A;  1MM7 A;  4P11 A;  2VD2 A;  4R9G A;  1VE4 A;  4O3B A;  1FCK A;  2ZNS A;  3IAZ A;  1D9Y A;  1UTB B;  3MW0 A;  4O8M A;  1AL3 A;  4KFQ A;  1KZ8 A;  4I8C A;  2WX9 A;  2O84 X;  4P0I A;  2PYY A;  1HSJ A;  1IQ7 A;  3G3F A;  4PC9 A;  1FTK A;  4IB2 A;  4EXK A;  3TEP A;  2I0B A;  4JSD A;  3LSW A;  2KR0 A;  1CE2 A;  5CMM A;  5KCJ B;  5ELV A;  4R6K A;  3B7D A;  3C32 A;  4I3Y A;  4TQU Q;  4OQO A;  1IXG A;  1SDX A;  1EH3 A;  5IGA A;  3MAM A; 
#chains in the Genus database with same CATH homology
 1FPF A;  1LBV A;  2HZK A;  1NV2 A;  4OVQ A;  5IZ1 A;  3W9V A;  4F1V A;  3KC1 A;  5ET5 A;  1FBF A;  4GWU A;  1NV5 A;  1CNQ A;  4HE0 A;  2OX3 A;  5LTC A;  3W9W A;  1NV6 A;  4HE1 A;  4MX6 A;  4UAB A;  4GWW A;  4H45 A;  4OAN A;  2CZH A;  4NAP A;  4OVS A;  2V4C A;  4PTK A;  1EYI A;  4LN5 A;  4PF8 A;  4YZZ A;  1LBZ A;  1NUY A;  4GX3 A;  3RPL B;  1IME A;  1FJ6 A;  3MST A;  4N81 A;  4X04 A;  2QPQ A;  4PDD A;  4G61 A;  2HHM A;  4HXV A;  2XWK A;  3KBZ A;  3KC0 A;  3NOH A;  1FJ9 A;  2CEX A;  3EKI A;  2XA5 A;  4MNI A;  4N8G A;  2P3V A;  4PFI A;  5EYH A;  3RPL A;  3T1B A;  5I7I A;  4MCO A;  5I3S A;  4PF6 A;  3A29 A;  3E78 A;  4DI4 B;  1YYZ A;  4I40 A;  1FBH A;  1FPG A;  4MHF A;  4P9K A;  1LBX A;  4PAK A;  4P8B A;  1EYK A;  4GX4 A;  4NGU A;  1FBP A;  2R8T A;  4QXD A;  4JVC A;  5LDZ A;  1FPE A;  2QVU A;  5CM6 A;  1FBD A;  2BJI A;  4GWS A;  4OVR A;  1RDY A;  4PFB A;  1YZ0 A;  2MKZ A;  1G0I A;  1INP A;  2FIX A;  3BIH A;  3D1R A;  3PTY A;  2V3Q A;  2WBD A;  4I3E A;  4NQ8 A;  4QBA A;  5IZ3 B;  5JK4 A;  1DK4 A;  4P56 A;  1D9Q A;  3FBP A;  4N15 A;  5IZ3 A;  5T3J A;  3B50 A;  3ISP A;  1FBG A;  2DE2 A;  2QFL A;  1K9Z A;  4O94 A;  2PCR A;  4P3L A;  4F19 A;  2XWO A;  1LBY A;  1RDZ A;  2PFZ A;  2DE3 A;  1KA0 A;  1NUW A;  2CEY A;  5IGA A;  1JP4 A;  1BK4 A;  4MNP A;  1G0H A;  1NUX A;  4HE2 A;  2FVZ A;  2CZK A;  1DCU A;  2ZZV A;  4N6D A;  4PDH A;  3QMF A;  3BIG A;  4N17 A;  4NN3 A;  3LV0 A;  1NI9 A;  1IMA A;  2XXK A;  2F3B A;  2FBP A;  1NUZ A;  2VPN A;  3E79 A;  2DVZ A;  2WYP A;  4HCY A;  4OA4 A;  3U65 A;  5FBP A;  2HXR A;  4NF0 A;  4X8R A;  2VT5 A;  2Y5K A;  4KXP A;  2WYK A;  4O7I A;  2F3D A;  5IZZ A;  4MIJ A;  1K9Y A;  4MMP A;  4PAI A;  1NV3 A;  4PE3 A;  4YIC A;  4PGN A;  5ET7 A;  5F24 A;  5IM2 A;  5EQ7 A;  1NV7 A;  1Q9D A;  4JVI A;  4N91 A;  1FPI A;  4GWX A;  2Q9T A;  4M1V A;  2L5V A;  2B4L A;  1IMF A;  2OWZ A;  4P47 A;  4GX6 A;  2Q74 A;  5J1D A;  3B8B A;  2JJK A;  1EYJ A;  2ZZX A;  2DE4 A;  2QVR A;  5A5L A;  3MYU A;  4AS5 A;  4GWZ A;  4O8M A;  4F18 A;  4GWY A;  4PCD A;  5DW8 A;  4NG7 A;  1SPI A;  3T0J A;  2DDK A;  1FPB A;  1KZ8 A;  4FBP A;  2XWV A;  1FBE A;  2FIE A;  2WX9 A;  2XWI A;  4X9T A;  5EQ9 A;  5EQA A;  1XI6 A;  4PGP A;  4N4U A;  4JVD A;  1AWB A;  5I5P A;  2GQ1 A;  3CHG A;  4MNC A;  1FPD A;  5J16 A;  4PFR A;  3RYD A;  1LEV A;  1FBC A;  2CZI A;  3LUZ A;  4PBQ A;  1DBZ A;  1FPK A;  2QVV A;  4XFE A;  5EQ8 A;  4OVP A;  4PC9 A;  1IMB A;  4GBV A;  3GYY A;  1FSA A;  3IFA A;  4PBH A;  4XF5 A;  4DI3 D;  1IMD A;  3FXB A;  4IR8 A;  4MAG A;  3ROJ A;  4F1U A;  4AS4 A;  1RDX A;  1VDW A;  2KR0 A;  3IFC A;  4H46 A;  4NX1 A;  4XEQ A;  2P3N A;  2ZZW A;  4HCW A;  2WBB A;  4P1L A;  4O7M A;  1IMC A;  1FTA A;  2FHY A;  4OVT A;  1FPJ A;  1FRP A;  1KA1 A;  2B4M A;  2HZL A;  2Y5L A;  4GBW A;  4NHB A;  5ESY A;  5EYG A;  2KQZ A;  2HPG A;  4I3Y A;  4MEV A;  1FPL A;  2VPO A;  2Q8M A;  1LBW A;  2WEF A;  1NV0 A;  1NV1 A;  5ET6 A;  2PFY A;  4N8Y A;  1NV4 A;  4N6K A;  4PAF A;  3SZP A;  1YXI A;  4P1E A;  4MJO A;  4PET A;  2F5X A;  3HFU A;  5ET8 A;  1QGX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...