4MCOA

Crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
LKISHQFPGGTIKEGDFRDRLVRNFAAEVEKRSKGAMKFEIYPGSSLMKTNAQFSSMRKGALDMALIPLSYAGGEVPELNIGLMPGLVVSYEQAYSWKTKPVGIELTRVLQEKGIVLISWIWQAGGVASRGKPVVEPEDAKGMKIRGGSREMDMILKDAGAAVVSLPSNEIYAAMQTGAMDAAMTSSTSFISFRLEEVAKALTTGRTGAYWFMFEPLMMSKAIFDKLPKDQRDMLMTVGAEMEKFALEAAKKDDIDVAAVYQKAGAKVVDLSDGTIKKWQDIARKTAWKDYGAKNEGCAKLLALAQQTLAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodoferax ferrireducens
total genus 116
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mcoA00
4NG7A 4MNPA 2V4CA 2PFYA 4PAKA 2WX9A 4P56A 4DI3D 4DI4B 4YICA 4PE3A 3FXBA 4OVPA 4MHFA 2XA5A 2XXKA 3B50A 2ZZVA 4N8GA 5IZZA 4NN3A 4O7MA 4OVTA 2WYPA 4UABA 4NHBA 5I5PA 4PCDA 2ZZXA 4P9KA 4PF8A 2HPGA 3GYYA 2VPOA 5CM6A 4OVQA 5I7IA 4N6KA 4P1LA 4O94A 4XEQA 4P8BA 2XWIA 4XFEA 2HZKA 4N91A 4OVSA 4NAPA 4N17A 4PBHA 4NQ8A 4PGPA 4OA4A 4X04A 4X8RA 4XF5A 4N4UA 2PFZA 4PAIA 5LTCA 5IM2A 4OANA 4PFIA 4NX1A 4O8MA 2CEXA 4PBQA 2XWOA 2WYKA 4MEVA 4PDDA 4LN5A 4PETA 4PC9A 4PFBA 3U65A 4NGUA 4MNCA 4PDHA 4MAGA 4NF0A 4PF6A 4MCOA 4PFRA 4P3LA 4OVRA 2HZLA 4MNIA 4YZZA 4P47A 4PAFA 4MX6A 2CEYA 4MMPA 4MIJA 5IGAA 2ZZWA 4PGNA 2XWVA 4P1EA 2VPNA 4N15A 2XWKA 4N8YA 4N6DA
chains in the Genus database with same CATH superfamily
4YB7A 2F34A 4GBWA 4OZ9A 4P56A 1P1NA 2D5WA 2GQ1A 1FQDA 4LUBA 1US4A 3HHFA 1IZ1A 4JVCA 5CC2A 1SVXB 1FQCA 1FSAA 4UABA 4TLMB 2AL4A 1A54A 3B6QA 3SEVA 1FPEA 3PMVA 1B32A 4KQPA 2FBPA 4I3EA 1LBZA 5ET7A 5ET8A 3SDFA 3MPLA 4I40A 3RT6B 3CHGA 4OFLA 1B3LA 3TDJA 3G3GA 1HSLA 3KC1A 3VLUA 1USYH 3VLVA 4GF8A 1II5A 1CNQA 1B5HA 3FGSA 1FBHA 1FQFA 3B7DA 1MQDA 5TP9B 1NV4A 4IY5A 3ISPA 2Q2AA 4GX3A 1MPDA 5I84A 2F6GA 1FJ6A 4PDHA 4ZS9A 3TCFA 3C36A 4WKMA 4MCOA 4OMBA 1OVBA 3F11A 1EYJA 4HE2A 3TMGA 3SESA 5AA3A 4RA1A 3KN3A 1HSEA 4MMPA 4QFPA 1B4HA 3VVEA 1B3HA 3E79A 4FECA 1DPPA 1P1UA 1G0IA 2PT1A 4N15A 5J1DA 3LSLA 2A5TA 3OO9A 3MJNA 1LBYA 2B4LA 4BDLA 3TQLA 3FXBA 3RY3A 1FTKA 3PD8A 1R9QA 3KFMA 4NN3A 4FBPA 3DLNA 1XOCA 2WEFA 4QFKA 5IKBA 2UVJA 2QFLA 5CM6A 1YYZA 4UACA 1ZBMA 3H6VA 3TTLA 4XFEA 2HZKA 4OVSA 2V3UA 1URSA 2RCAA 2V3QA 2GRVA 4QSCA 1NNTA 4JSOA 1N04A 3FV1A 1ELJA 4P11A 1B7ZA 4GFRA 4GX4A 2I0BA 1GR2A 4LN5A 1Z7ME 2NWJA 1AH5A 1INPA 2UVHA 2P2AA 3FVOA 1H3DA 2LAOA 4WEDA 4YKKA 4PF6A 3TUSA 3LBSA 2XXVA 2ZYOA 1USYE 3MBPA 3C35A 3QUFA 4NF4B 2H4IA 5ICQA 2REJA 3QIMA 5IGAA 1M5BA 3MZBA 4H8JA 5ITPA 4LZ7A 1CE2A 1IMFA 2H99A 3IAZA 1B7HA 5TPAB 4NF8B 1F9BA 4Q0CA 3GZGA 4R74A 1YZ0A 1B3GA 1NNFA 3HN0A 3C4MA 4ZE8A 4O7MA 4YKIA 1I6QA 4G8HA 4YAHX 4DCXA 5FHOA 3GYYA 3KSJA 5DTBA 5DEXB 1LSTA 3OOAA 4FORA 2E1SA 1DOTA 3JV9A 3G3IA 3OELA 2H9BA 2B3FA 1M5DA 2ONRA 4YKJA 4ELRA 5I58A 5FBPA 3S9MC 1B5JA 1LB9A 1PB9A 4QSEA 1Y3NA 3PUWE 4OA4A 2X7PA 4ESWA 3VV5A 4H6DA 4Q30B 3MZ9A 3S9NC 5ESYA 3RPWA 1LCFA 1MG1A 3CRBA 5A5XA 3A3CA 4GBVA 4MH5A 3RGYA 1IITA 1ZTYA 2OWSA 3UN6A 3KJTA 1POTA 1QUJA 1P1QA 4RXLA 3KC0A 3VLWA 1JVXA 3L6GA 1M5EA 3Q29A 2PX1A 4IO7A 3IJXB 4C0RA 3H6TA 1H44A 2VD2A 4F1VA 2PVUA 1LFIA 1B46A 2HAVA 4I8CA 1XS5A 1LB8A 1G0HA 1FQEA 2P0SA 4YMAA 1MQIA 2PBWA 3K2DA 3PV0E 4F3SA 2H25A 1MXXA 4YB6A 2O51A 5AA2D 4PCDA 3K6VA 4G68C 3K1PA 2P3NA 3DP8A 3KN7A 2RKMA 4BDMA 5ITOA 1BLFA 3RT8A 3PMWA 4P1LA 3CFZA 1VDWA 4C1TA 2M8CA 3TFLA 1P99A 4TLLB 3FUZA 2F5XA 1UQWA 4H0WA 5IZ3B 2XXUA 4N07A 4GWZA 3QMFA 1NL5A 1H76A 1VSOA 1B9JA 5CMKA 4PFTA 2ZNSA 4WXJA 2DQVA 4DXBA 4O8MA 5I59A 1LLSA 1SQYA 2UVIA 1NV7A 2ESNA 5DVJA 5LOMA 1B40A 2IEEA 3MVZA 1TXFA 1A99A 1ZMGA 4NF0A 4KPTA 4GQOA 3PMXA 2Z23A 3MVWA 2O7UA 1LBVA 3K1NA 1OIBA 2WBBA 2DE4A 2B4MA 4XTCQ 4G68B 2QS2A 2FIXA 4LVQA 5CRYA 4MIJA 2KQZA 1NV2A 3ROJA 2XWVA 4KCDA 2DWIA 5DYHA 3EHSA 3MP1A 3H06B 1JVYA 4I9DA 4MJOA 3BFUA 3PPPA 3RQTA 3V5AA 1FPFA 2HXWA 4NG7A 4EDPA 3S2VA 4EF1A 1NNPA 4OXVA 1N7XA 3MSTA 2WX9A 3H3GA 3W9VA 3FVNA 3T96B 3GBAA 3DM0A 3U1OA 1MPCA 3N94A 2O1MA 4QHQA 3FXQA 2CZHA 3SEWA 1TFDA 3IR1A 5FTHA 4BDNA 4NE4A 3E78A 3FATA 4OVQA 2FYIA 4R9FA 2UYFA 1SD3A 2F6PA 4N91A 2A5TB 2VT5A 1SW4A 3HPIA 3PUXE 3CSBA 5H8QA 2OLBA 2A5SA 1FPJA 1KWHA 4ZEIA 2D3IA 1FTAA 1FPLA 1M5CA 3RUMA 4PAIA 5F1QA 4NF5B 4GLIA 4IY6A 2RC7A 1NNKA 4JVDA 2OZZA 3DP6A 1UTHA 3EQ1A 1LGBC 1PB8A 1LAXA 2F97A 3IORA 1RYXA 5I57A 2P3VA 2BJJX 4YKPA 1YXIA 3PPQA 4PFRA 4DLDA 3OENA 1FW0A 4LQ2A 1B58A 1DPEA 4ZEDA 3T22A 1FPDA 3SEUA 1EZ9A 3RN8A 3Q28A 1BKAA 2YLNA 5EHSA 4EQ9A 1OQGA 3N6UA 3FASA 3FJ7A 3ODBA 5I2KB 2F7BA 1LCTA 4R72A 4XIGQ 3OXNA 2I49A 3FZVA 4DI4B 5H8FB 1B05A 1MS7A 1P1OA 3V8XB 1QVSA 4Z0IA 4OVTA 3ZKKA 4QFOA 5KCJB 1MXWA 3DELB 4P9KA 4GVOA 2HPGA 4FEBA 2XXTA 3OEMA 2Y7PA 3M8UA 4JWYA 1LAHE 2VPOA 4IB2A 1IIWA 4NWDA 3SEYA 3KOTA 5CI5A 3RTFB 1XI6A 3UIFA 4XEQA 4R73A 2XWIA 1RYOA 4EXLA 3G3FA 2H98A 1FCKA 3ZS6A 2XX8A 1FPIA 2HAUA 2KR0A 4OQOA 5ET5A 3VFJA 2Y5LA 2I58A 3FVGA 1R9LA 3GLBA 4IR8A 4KYSA 4NMYA 5KDTB 4GOTA 4LZ8A 1IMCA 3I5OA 2FNCA 2Z22A 5H8NA 3Q25A 5LTCA 1Q1KA 4OANA 3S9LC 1A7LA 4QXDA 3CG1A 3B8BA 4O3AA 4HE1A 2XWOA 4OHNA 1PB7A 5EYHA 4RJZA 2DDKA 3FJMA 4R75A 1MXZA 3K1MA 3W15C 3OO8A 4BLAA 3EHTA 5FHNA 4KYDA 4PQJA 4I1DA 5M2VA 2CZIA 1Q35A 5I58B 1RDXA 2ONSA 3HV1A 3BFTA 1ATGA 2AYSA 1A55A 4GXSB 4GWSA 3ONMA 2X26A 4PGNA 1N3XA 3N26A 4DXUA 4FATA 2XWKA 1FBPA 1ZLQA 2AIXA 4U4SA 1ZIUA 3QXMA 1XVYA 2DOJA 5A5XB 4LATA 4DIGA 1JW4A 4TQUQ 1O7TA 3TEPA 4YICA 4OWDA 4BDRA 4RPNA 4X1BA 1URDA 3T9XB 1JW1A 5I3SA 3JYRA 1RDYA 4G2ZA 3LUZA 2HCAA 4ELQA 4H5GA 3FV2A 3EKIA 2DXYA 2ZNTA 4O94A 1S7YA 3PUZE 1L5TA 1NKXA 2REGA 3IOTA 4EQ7A 3OD7A 3T9HB 3TCHA 3IB2A 2DP8A 4NQ8A 3O9PA 4PGPA 3D4GA 4OEVA 1DCUA 1R1NA 3USDA 4ESXA 4JSDA 2HHMA 2DWHA 2G93A 4FEDA 3MVXA 2XXXA 3MW0A 3CFLA 3TTNA 4LZ5A 1AIVA 2Y7RA 4PC9A 4PFBA 3RLFE 3T66A 1VFEA 2NOOA 1GTKA 1FJ9A 1NV6A 3FVKA 3O2AA 1MDP1 1MM6A 1MM7A 1SW2A 2V3TA 3IFAA 2OWTA 4F2QA 2OBGA 2ZXTA 4F1UA 2O1LA 3TTMA 4MX6A 1Q9DA 3UGWA 4EUOA 1MQGA 3K6UA 3LSFB 2WBDA 3U93A 1FTLA 2Y84A 4F3PA 1TFAA 3B6TA 4N6PA 2OWZA 3N6TA 1JP4A 3O28A 4F22A 2VOZA 2OK2A 3C31A 1MXVA 1A8EA 1SDXA 2V4CA 3LSWA 3MWBA 4OVPA 3MPKA 1EYKA 2XXKA 2ZZVA 3IOVA 1US5A 3KBRA 1YTVA 2Q74A 2Q88A 3MP6A 2V25A 4NHBA 2DE3A 5B7DA 2AL5A 5EQ7A 3N5LA 1HSJA 5HM4B 4P0GA 1T0KA 4OFJA 4KYEA 2VGQA 3C32A 1NV3A 5CBSA 4KXPA 3KZGA 1VE4A 3QK6A 2QL3A 1MXUA 1Y9UA 2ZYKA 4GRKA 1D4NA 3IB1A 2B65A 2ALUA 3CSGA 4ELPA 3A29A 4HS7A 3EPEA 4MNCA 4F18A 3FXRA 3KEIA 4IO4A 1B5IA 5ISUA 3CFXA 1MRPA 3SZPA 2CEYA 2G29A 2HXRA 2X7QA 2JJKA 4DDDA 1SYIA 5H8HA 5AA4A 1K9YA 2V93A 1B0LA 1SPIA 3VXCA 1N84A 3L6HA 3O97A 3EF7A 2D21A 3T9UA 3CIJA 1M5FA 4PAKA 1MQJA 1H45A 3LR1A 3E9XA 1Y3PA 4U2RA 4NEDA 5L8DA 5I57B 2HEUA 3EN3A 3IB0A 3IOUA 1IXHA 4JBZA 4HCYA 2R71A 5EQ8A 1S50A 1I6AA 1FRPA 4AB5A 1FBDA 2Q2CA 5H8SA 2B3BA 3IK6B 2Y7IA 3NOHA 4PTKA 1SI0A 4NAPA 1PBPA 1N7WA 4OESA 3T1BA 3V83A 4OETA 3CG3A 1PEBA 4PFWA 3CI8A 3MUQA 3PUVE 1PDAA 4GX6A 2O6AA 4OTEA 1UTBB 1P1WA 3LSXA 5ELVA 1FQBA 2F78A 3MP8A 1NUYA 3MZ1A 5EHMA 2Q89A 1TT1A 4PFYA 4HW8A 2R6GE 4NTLA 3M3KA 2I4CA 2F7CA 1Y3QA 2PMSA 4XKNA 3U72A 1MXYA 4F2OA 4DXCA 3E4RA 3LV0A 5F24A 2F3BA 4X9TA 4N13A 2ZZWA 2PCRA 1BTJA 3KSXA 1B51A 3MC2A 3O6GA 3GXAA 2QMWA 3R6UA 2RC8A 3D4CA 1OLCA 1EU8A 2I4BA 4JVIA 4L17A 3TELA 3UA8A 1JW5A 4K3FA 2UYEA 5IZZA 1AOVA 4E0XA 4NF4A 2Q9TA 1KA1A 2CZLA 4IO6A 4EF2A 3W9WA 4PP0A 4GWYA 1B52A 5EQ9A 4OEUA 3UP9A 2NUVA 3FD3A 1FTOA 1MPBA 1DTZA 3QAXA 3G3HA 4R6YA 5L9OA 4X1DA 2GHAA 2I0CA 3Q26A 4DZ1A 4GD5A 3QSLA 2DVZA 2P1SA 1B3EA 3KN8A 5TPAA 1I6BA 1D9YA 5EYFA 1LEVA 1XHYA 3K0VA 3G3KA 1AL3A 4JWOA 4ZEFA 1FBCA 4X8RA 2Q8JA 2CMOA 4N4UA 2MKZA 2DXRA 3IJOB 5B70A 2PT2A 5DEXA 1QW0A 2YPNA 1J1NA 4KHZE 4YMBA 3O29A 2OJTA 3V89B 1UIVA 5ET6A 4MAGA 2O7IA 3UORA 1AWBA 3HO7A 4ONYA 4ZEBA 3KJ7A 2F36A 4LONB 1LBWA 1SBPA 4GIZA 4Q5TA 5JTYA 4DCYA 3E13X 4IO2A 2GFEA 2R8TA 2Y7KA 4N6DA 1D9QA 3PPNA 1XVXA 1NUWA 2DWJA 4DI3D 1MQHA 4PE3A 2BJIA 4KCCA 1B6HA 3PGFA 4FAJA 5JK4A 4ZEKA 1DK4A 3IO4A 4ZZEA 4POXA 2I3WA 1A40A 4GWWA 4KR5A 4XKPA 1B0HA 4RK9A 1B3FA 1VFDA 1RDZA 3SEXA 1GGGA 1DTGA 2F7AA 1MY2A 3OEKA 4U23A 1SI1A 4R6KA 4QBAA 3HSTA 4N17A 2Y5KA 2QJEA 4ISUA 2QS1A 4PE5B 4QFNA 3S9EA 2XX7A 4H45A 1IMBA 4AB6A 4X48A 3CVGA 4GWUA 1IUDA 4PETA 4I62A 1FQAA 5BUUA 1B2HA 5IZ3A 4XXUA 3RPLA 4M1VA 1UIUA 3MYUA 1NV0A 1FPGA 1OMPA 1IXGA 1QKAA 4RY1A 3ECRA 3TPAA 4XKRA 1LAGE 2XXRA 3IOWA 3LUYA 3M3LA 4LA9A 3P7IA 2ZYNA 3TTKA 3KG2A 1QKBA 4QSDA 4BDQA 4IO5A 5I2NA 4GWOA 3T0JA 3PTYA 4ZECA 4MFIA 2Z8FA 4N8GA 3BIGA 4MLVA 4G68A 2ANJA 5F7VA 1I69A 4R9GA 3VVDA 4F31B 4PF8A 2O69A 4C1UA 2FHYA 1ZKBA 1IMEA 2L5VA 1N0TA 5H8HB 3KGCA 5AA4B 1NUXA 1OLAA 2QVRA 4ND9A 4P8BA 3TZAA 4MBPA 3I3VA 4YB5A 4DE8A 4HE0A 1IQ7A 1RKMA 2XXIA 3PU5A 1PBQA 4NF6A 4X04A 3MAMA 3MVYA 3PD9A 3IFCA 3VE1B 4PFIA 4F3GA 4NX1A 2OCUA 3H7MA 1O64A 2CEXA 2WKYA 1EZOA 5CMMA 1O63A 1JEVA 2XD2A 5AA2A 3T93B 1MY3A 3U65A 1LAFE 5IZ1A 2QVUA 2F3DA 3ZKLA 3FXUA 1FTMA 4NF5A 4KI0E 2GH9A 1WDNA 1TWYA 3D1RA 1NV1A 2NVUB 3C34A 2I6EA 5K2YA 3U8QA 2I48A 1MH4A 4G61A 3R26A 3T9VA 1FTJA 3KBZA 4EQBA 5JEIA 3H03A 1BP5A 3OSRA 1WVJA 1EH3A 4OENA 2F35A 2W7YA 4IGRA 5HBCA 1IMAA 2ZZXA 1R6ZA 3O6IA 3E3KA 2THIA 2VD3A 1FBGA 2ZYMA 5I56A 1FBEA 2XXYA 2QRYA 4F29A 3FJGA 4H5FA 5I7IA 5L9SA 4TOZA 3K4UA 1LFHA 5I2KA 5I59B 2O84X 4ELOA 2HFBA 5H8FA 3OMBA 2HQ0A 2R9JA 3TODA 4UA8A 3VDFA 4G77A 4R6HA 4P0IA 3K01A 2KLFA 4MLQA 3HCQA 5KCJA 1LFGA 2PFZA 4FIMA 2RC9A 4HCWA 2NXOA 4F19A 1QGXA 1SW5A 4QF9A 1FPBA 1N76A 4PBQA 3K6XA 1SW1A 2QS4A 3DP4A 4PDDA 3C9HA 2QPQA 1PC3A 3U94A 5IAIA 4KFQA 4AS5A 5AE4A 3ILUB 4R2FA 1ANFA 2Z8DA 3TQWA 5KDTA 5K2XA 3THIA 2HZLA 4MNIA 1ZJLA 3EHUA 1NV5A 2RCBA 1XT8A 2FA7A 4H8IA 1YAEA 1JETA 3IO6A 4OVJA 2H5YA 4XKQA 1Y1MA 4MNPA 3SETA 4IGTA 2PFYA 3IX1A 4GL0A 5A5LA 4GL8A 5TP9A 2GHBA 2I3VA 5H8QB 5DVFA 1CB6A 2CZKA 1S9TA 1N3WA 5I5PA 5ICTA 3G7WA 4O7IA 2DSFA 4ZZAA 4NWCA 1LBCA 4IO3A 5JTYB 3C33A 4LQ5A 1POY1 2Y7WA 4F39A 1UTHB 4RNSA 3BKIB 1EYIA 3WAEA 1B7UA 5DVIA 4BDOA 1DBZA 3AXFA 2FVZA 4F1YA 3H4ZA 4PBHA 1NH7A 1DSNA 3M3FA 3OO6A 1K9ZA 4XF5A 3JZJA 4JB7A 5LDZA 1QJMA 2ABHA 5IM2A 1NFTA 1SYHA 1BIYA 2RF1A 4KD5A 4MEVA 2UVGA 1MY4A 5HPQA 1FPKA 4YU0A 3SKPA 1Y1ZA 1QUKA 1LBXA 1H43A 3R7XA 4U22A 3TAJA 1MH3A 3UK4A 2XD3A 2XXWA 3H6WA 4U1ZA 3A09A 3BIHA 4P1EA 2VPNA 1D3KA 4JDFA 1NH8A 5BWJA 1IXCA 2YJPA 3G3JA 3MQ9A 4GWXA 1FBFA 3K00A 3Q27A 1Z7NE 4H67A 4THIA 4POWA 4MF3A 5L9MA 4AS4A 1QUIA 2XA5A 2DS9A 3ZSFA 2DVCA 4M4GA 3RPLB 4HTGA 2O68A 1YPNA 4QRZA 1Y4CA 5H8NB 3RTWB 1YCJA 3HFUA 3KOSA 3TCGA 2XX9A 4ECFA 1IXIA 1GVCA 4EXKA 1MY1A 4LP2B 1ZU0A 3I6VA 4FJPA 1D9VA 1A8FA 1OQHA 3TTRA 1JQFA 5I2NB 1LBBA 4H46A 2QSXA 2FIEA 1KZ8A 4O3CA 4G8MA 4AQ4A 1QULA 4ZDMA 4JXIA 4I3YA 3ILTB 1Y20A 2Z8EA 3GBBA 3SERA 4G4PA 5FTIA 3QUJA 4OFOA 4GXAA 4NF8A 2UXAA 4H1XA 4JWXA 4PFUA 3K02A 2V84A 5CMBA 1XC1A 2ONKE 2DYXA 3FIRA 5CMCA 3OO7A 2ZNUA 4OYVA 4P3LA 4OVRA 3PPOA 4OERA 1EZPA 3RNNA 3A3UA 4E0WA 2F8DA 1WODA 5KZTA 1NI9A 1MDQA 4NF6B 4RPOA 1IMDA 5T3JA 3WAFA 2VP1A 4N8YA 3OSQA 1B1HA 1AMFA 2XXQA 5FHMA 1DMBA 4R2BA 4QFLA 4O3BA 1IEJA 1URGA 3HHGA 4FE8A 4MHFA 4HXVA 5AA2B 4RK2A 4WEPA 3B50A 1GV8A 1VR5A 3PUYE 4U1OA 3K6WA 2WYPA 3O6HA 2XXHA 2XXPA 5DT6A 1B1XA 5J16A 2ZMBA 2DE2A 1NMUA 2QMXA 3H6UA 4ZE9A 4N6KA 3CR9A 1JNFA 5EYGA 4U4XA 3QYTA 5AA1A 2RINA 1JEUA 1KA0A 2XHDA 5CBRA 2IA4A 3VVFA 3VXBA 3BBRA 3TYHA 3U92A 2QVVA 2Q8MA 4U21A 5DW8A 5EQAA 1NUZA 4F3BA 3TKDA 2WYKA 1OVTA 5I56B 1BK4A 4G8NA 3LC8A 4NGUA 1Y4TA 4Z7EA 1B4ZA 3RYDA 3S4UA 3FBPA 4RYAA 5TU0A 2OX3A 2E0SA 2PYYA 4YZZA 4P47A 2VHAA 4PAFA 2QS3A 1UTBA 3IL1B 4N81A 1MY0A 4Q8RA 3PPRA 3O66A 4H65A 3B6WA 2DWAA
chains in the Genus database with same CATH topology
3KBZA 1FPFA 4NG7A 4GBWA 3MSTA 4PAKA 2WX9A 4P56A 2GQ1A 3W9VA 4JVCA 1FSAA 2CZHA 4UABA 4HCYA 1IMAA 2ZZXA 5EQ8A 1FRPA 3E78A 1FBGA 1FBEA 1FBDA 1FPEA 4OVQA 5I7IA 2FBPA 4I3EA 1LBZA 5ET7A 5ET8A 4I40A 3NOHA 4PTKA 4N91A 3CHGA 4NAPA 3KC1A 2VT5A 3T1BA 1CNQA 1FBHA 1FPJA 1FTAA 1FPLA 2PFZA 4PAIA 4HCWA 4GX6A 1NV4A 4F19A 1QGXA 4JVDA 1NUYA 3ISPA 1FPBA 4PBQA 4GX3A 4PDDA 2QPQA 1FJ6A 2P3VA 4PDHA 4AS5A 1YXIA 4MCOA 4PFRA 1EYJA 4HE2A 2HZLA 4MNIA 3LV0A 5F24A 1NV5A 2F3BA 4MMPA 4X9TA 1FPDA 3E79A 2ZZWA 1G0IA 2PCRA 4N15A 5J1DA 4MNPA 1LBYA 2B4LA 2PFYA 4JVIA 4DI4B 5A5LA 3FXBA 5IZZA 2Q9TA 2CZKA 1KA1A 4NN3A 4OVTA 4FBPA 3W9WA 5I5PA 4GWYA 2WEFA 5EQ9A 4P9KA 4O7IA 2HPGA 2VPOA 2QFLA 5CM6A 1YYZA 1EYIA 1XI6A 2DVZA 4XEQA 1DBZA 2XWIA 4XFEA 1LEVA 2HZKA 2FVZA 4OVSA 1FPIA 2KR0A 5ET5A 4PBHA 2V3QA 2Y5LA 4IR8A 1FBCA 4X8RA 1K9ZA 4XF5A 4N4UA 2MKZA 1IMCA 5LDZA 5LTCA 5IM2A 4OANA 4QXDA 4GX4A 3B8BA 4HE1A 2XWOA 4MEVA 4LN5A 5EYHA 2DDKA 1INPA 1FPKA 5ET6A 4MAGA 4PF6A 1AWBA 1LBXA 2CZIA 1LBWA 1RDXA 4GWSA 5IGAA 4PGNA 3BIHA 4P1EA 2VPNA 1IMFA 2XWKA 1FBPA 2R8TA 4N6DA 1D9QA 1NUWA 4GWXA 1FBFA 4DI3D 4YICA 4PE3A 2BJIA 4AS4A 1YZ0A 2XA5A 4O7MA 3RPLB 5I3SA 5JK4A 1RDYA 3LUZA 1DK4A 3GYYA 4GWWA 3HFUA 3EKIA 1RDZA 4O94A 5FBPA 4QBAA 4N17A 2Y5KA 4NQ8A 4PGPA 4OA4A 4H46A 1DCUA 2FIEA 1KZ8A 2HHMA 5ESYA 4I3YA 4H45A 4GBVA 1IMBA 4GWUA 3KC0A 4PETA 4PC9A 4PFBA 1NV6A 1FJ9A 5IZ3A 3RPLA 4M1VA 3MYUA 3IFAA 4P3LA 1NV0A 4OVRA 1FPGA 4F1UA 4MX6A 1Q9DA 4F1VA 1NI9A 2WBDA 1IMDA 5T3JA 4N8YA 2OWZA 1JP4A 2V4CA 1G0HA 3T0JA 3PTYA 4OVPA 4HXVA 4MHFA 1EYKA 2XXKA 3B50A 2ZZVA 4N8GA 3BIGA 2Q74A 2WYPA 4NHBA 4PCDA 2P3NA 4PF8A 5J16A 2FHYA 2DE3A 2DE2A 5EQ7A 1IMEA 2L5VA 4N6KA 4P1LA 1VDWA 1NUXA 2QVRA 5EYGA 4P8BA 1NV3A 2F5XA 4HE0A 5IZ3B 4KXPA 1KA0A 4X04A 4GWZA 3QMFA 3IFCA 2QVVA 2Q8MA 4PFIA 4NX1A 5DW8A 5EQAA 1NUZA 4O8MA 2CEXA 1NV7A 2WYKA 3A29A 1BK4A 3U65A 4NGUA 4MNCA 4F18A 5IZ1A 4NF0A 3RYDA 3FBPA 2OX3A 2QVUA 2F3DA 1LBVA 4YZZA 4P47A 4PAFA 2WBBA 2DE4A 2B4MA 3SZPA 2CEYA 2HXRA 2JJKA 2FIXA 4MIJA 2KQZA 1NV2A 3D1RA 3ROJA 1K9YA 1NV1A 4N81A 2XWVA 1SPIA 4G61A 4MJOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NG7 A;  4MNP A;  2V4C A;  2PFY A;  4PAK A;  2WX9 A;  4P56 A;  4DI3 D;  4DI4 B;  4YIC A;  4PE3 A;  3FXB A;  4OVP A;  4MHF A;  2XA5 A;  2XXK A;  3B50 A;  2ZZV A;  4N8G A;  5IZZ A;  4NN3 A;  4O7M A;  4OVT A;  2WYP A;  4UAB A;  4NHB A;  5I5P A;  4PCD A;  2ZZX A;  4P9K A;  4PF8 A;  2HPG A;  3GYY A;  2VPO A;  5CM6 A;  4OVQ A;  5I7I A;  4N6K A;  4P1L A;  4O94 A;  4XEQ A;  4P8B A;  2XWI A;  4XFE A;  2HZK A;  4N91 A;  4OVS A;  4NAP A;  4N17 A;  4PBH A;  4NQ8 A;  4PGP A;  4OA4 A;  4X04 A;  4X8R A;  4XF5 A;  4N4U A;  2PFZ A;  4PAI A;  5LTC A;  5IM2 A;  4OAN A;  4PFI A;  4NX1 A;  4O8M A;  2CEX A;  4PBQ A;  2XWO A;  2WYK A;  4MEV A;  4PDD A;  4LN5 A;  4PET A;  4PC9 A;  4PFB A;  3U65 A;  4NGU A;  4MNC A;  4PDH A;  4MAG A;  4NF0 A;  4PF6 A;  4MCO A;  4PFR A;  4P3L A;  4OVR A;  2HZL A;  4MNI A;  4YZZ A;  4P47 A;  4PAF A;  4MX6 A;  2CEY A;  4MMP A;  4MIJ A;  5IGA A;  2ZZW A;  4PGN A;  2XWV A;  4P1E A;  2VPN A;  4N15 A;  2XWK A;  4N8Y A;  4N6D A; 
#chains in the Genus database with same CATH topology
 4YB7 A;  2F34 A;  4GBW A;  4OZ9 A;  4P56 A;  1P1N A;  2D5W A;  2GQ1 A;  1FQD A;  4LUB A;  1US4 A;  3HHF A;  1IZ1 A;  4JVC A;  5CC2 A;  1SVX B;  1FQC A;  1FSA A;  4UAB A;  4TLM B;  2AL4 A;  1A54 A;  3B6Q A;  3SEV A;  1FPE A;  3PMV A;  1B32 A;  4KQP A;  2FBP A;  4I3E A;  1LBZ A;  5ET7 A;  5ET8 A;  3SDF A;  3MPL A;  4I40 A;  3RT6 B;  3CHG A;  4OFL A;  1B3L A;  3TDJ A;  3G3G A;  1HSL A;  3KC1 A;  3VLU A;  1USY H;  3VLV A;  4GF8 A;  1II5 A;  1CNQ A;  1B5H A;  3FGS A;  1FBH A;  1FQF A;  3B7D A;  1MQD A;  5TP9 B;  1NV4 A;  4IY5 A;  3ISP A;  2Q2A A;  4GX3 A;  1MPD A;  5I84 A;  2F6G A;  1FJ6 A;  4PDH A;  4ZS9 A;  3TCF A;  3C36 A;  4WKM A;  4MCO A;  4OMB A;  1OVB A;  3F11 A;  1EYJ A;  4HE2 A;  3TMG A;  3SES A;  5AA3 A;  4RA1 A;  3KN3 A;  1HSE A;  4MMP A;  4QFP A;  1B4H A;  3VVE A;  1B3H A;  3E79 A;  4FEC A;  1DPP A;  1P1U A;  1G0I A;  2PT1 A;  4N15 A;  5J1D A;  3LSL A;  2A5T A;  3OO9 A;  3MJN A;  1LBY A;  2B4L A;  4BDL A;  3TQL A;  3FXB A;  3RY3 A;  1FTK A;  3PD8 A;  1R9Q A;  3KFM A;  4NN3 A;  4FBP A;  3DLN A;  1XOC A;  2WEF A;  4QFK A;  5IKB A;  2UVJ A;  2QFL A;  5CM6 A;  1YYZ A;  4UAC A;  1ZBM A;  3H6V A;  3TTL A;  4XFE A;  2HZK A;  4OVS A;  2V3U A;  1URS A;  2RCA A;  2V3Q A;  2GRV A;  4QSC A;  1NNT A;  4JSO A;  1N04 A;  3FV1 A;  1ELJ A;  4P11 A;  1B7Z A;  4GFR A;  4GX4 A;  2I0B A;  1GR2 A;  4LN5 A;  1Z7M E;  2NWJ A;  1AH5 A;  1INP A;  2UVH A;  2P2A A;  3FVO A;  1H3D A;  2LAO A;  4WED A;  4YKK A;  4PF6 A;  3TUS A;  3LBS A;  2XXV A;  2ZYO A;  1USY E;  3MBP A;  3C35 A;  3QUF A;  4NF4 B;  2H4I A;  5ICQ A;  2REJ A;  3QIM A;  5IGA A;  1M5B A;  3MZB A;  4H8J A;  5ITP A;  4LZ7 A;  1CE2 A;  1IMF A;  2H99 A;  3IAZ A;  1B7H A;  5TPA B;  4NF8 B;  1F9B A;  4Q0C A;  3GZG A;  4R74 A;  1YZ0 A;  1B3G A;  1NNF A;  3HN0 A;  3C4M A;  4ZE8 A;  4O7M A;  4YKI A;  1I6Q A;  4G8H A;  4YAH X;  4DCX A;  5FHO A;  3GYY A;  3KSJ A;  5DTB A;  5DEX B;  1LST A;  3OOA A;  4FOR A;  2E1S A;  1DOT A;  3JV9 A;  3G3I A;  3OEL A;  2H9B A;  2B3F A;  1M5D A;  2ONR A;  4YKJ A;  4ELR A;  5I58 A;  5FBP A;  3S9M C;  1B5J A;  1LB9 A;  1PB9 A;  4QSE A;  1Y3N A;  3PUW E;  4OA4 A;  2X7P A;  4ESW A;  3VV5 A;  4H6D A;  4Q30 B;  3MZ9 A;  3S9N C;  5ESY A;  3RPW A;  1LCF A;  1MG1 A;  3CRB A;  5A5X A;  3A3C A;  4GBV A;  4MH5 A;  3RGY A;  1IIT A;  1ZTY A;  2OWS A;  3UN6 A;  3KJT A;  1POT A;  1QUJ A;  1P1Q A;  4RXL A;  3KC0 A;  3VLW A;  1JVX A;  3L6G A;  1M5E A;  3Q29 A;  2PX1 A;  4IO7 A;  3IJX B;  4C0R A;  3H6T A;  1H44 A;  2VD2 A;  4F1V A;  2PVU A;  1LFI A;  1B46 A;  2HAV A;  4I8C A;  1XS5 A;  1LB8 A;  1G0H A;  1FQE A;  2P0S A;  4YMA A;  1MQI A;  2PBW A;  3K2D A;  3PV0 E;  4F3S A;  2H25 A;  1MXX A;  4YB6 A;  2O51 A;  5AA2 D;  4PCD A;  3K6V A;  4G68 C;  3K1P A;  2P3N A;  3DP8 A;  3KN7 A;  2RKM A;  4BDM A;  5ITO A;  1BLF A;  3RT8 A;  3PMW A;  4P1L A;  3CFZ A;  1VDW A;  4C1T A;  2M8C A;  3TFL A;  1P99 A;  4TLL B;  3FUZ A;  2F5X A;  1UQW A;  4H0W A;  5IZ3 B;  2XXU A;  4N07 A;  4GWZ A;  3QMF A;  1NL5 A;  1H76 A;  1VSO A;  1B9J A;  5CMK A;  4PFT A;  2ZNS A;  4WXJ A;  2DQV A;  4DXB A;  4O8M A;  5I59 A;  1LLS A;  1SQY A;  2UVI A;  1NV7 A;  2ESN A;  5DVJ A;  5LOM A;  1B40 A;  2IEE A;  3MVZ A;  1TXF A;  1A99 A;  1ZMG A;  4NF0 A;  4KPT A;  4GQO A;  3PMX A;  2Z23 A;  3MVW A;  2O7U A;  1LBV A;  3K1N A;  1OIB A;  2WBB A;  2DE4 A;  2B4M A;  4XTC Q;  4G68 B;  2QS2 A;  2FIX A;  4LVQ A;  5CRY A;  4MIJ A;  2KQZ A;  1NV2 A;  3ROJ A;  2XWV A;  4KCD A;  2DWI A;  5DYH A;  3EHS A;  3MP1 A;  3H06 B;  1JVY A;  4I9D A;  4MJO A;  3BFU A;  3PPP A;  3RQT A;  3V5A A;  1FPF A;  2HXW A;  4NG7 A;  4EDP A;  3S2V A;  4EF1 A;  1NNP A;  4OXV A;  1N7X A;  3MST A;  2WX9 A;  3H3G A;  3W9V A;  3FVN A;  3T96 B;  3GBA A;  3DM0 A;  3U1O A;  1MPC A;  3N94 A;  2O1M A;  4QHQ A;  3FXQ A;  2CZH A;  3SEW A;  1TFD A;  3IR1 A;  5FTH A;  4BDN A;  4NE4 A;  3E78 A;  3FAT A;  4OVQ A;  2FYI A;  4R9F A;  2UYF A;  1SD3 A;  2F6P A;  4N91 A;  2A5T B;  2VT5 A;  1SW4 A;  3HPI A;  3PUX E;  3CSB A;  5H8Q A;  2OLB A;  2A5S A;  1FPJ A;  1KWH A;  4ZEI A;  2D3I A;  1FTA A;  1FPL A;  1M5C A;  3RUM A;  4PAI A;  5F1Q A;  4NF5 B;  4GLI A;  4IY6 A;  2RC7 A;  1NNK A;  4JVD A;  2OZZ A;  3DP6 A;  1UTH A;  3EQ1 A;  1LGB C;  1PB8 A;  1LAX A;  2F97 A;  3IOR A;  1RYX A;  5I57 A;  2P3V A;  2BJJ X;  4YKP A;  1YXI A;  3PPQ A;  4PFR A;  4DLD A;  3OEN A;  1FW0 A;  4LQ2 A;  1B58 A;  1DPE A;  4ZED A;  3T22 A;  1FPD A;  3SEU A;  1EZ9 A;  3RN8 A;  3Q28 A;  1BKA A;  2YLN A;  5EHS A;  4EQ9 A;  1OQG A;  3N6U A;  3FAS A;  3FJ7 A;  3ODB A;  5I2K B;  2F7B A;  1LCT A;  4R72 A;  4XIG Q;  3OXN A;  2I49 A;  3FZV A;  4DI4 B;  5H8F B;  1B05 A;  1MS7 A;  1P1O A;  3V8X B;  1QVS A;  4Z0I A;  4OVT A;  3ZKK A;  4QFO A;  5KCJ B;  1MXW A;  3DEL B;  4P9K A;  4GVO A;  2HPG A;  4FEB A;  2XXT A;  3OEM A;  2Y7P A;  3M8U A;  4JWY A;  1LAH E;  2VPO A;  4IB2 A;  1IIW A;  4NWD A;  3SEY A;  3KOT A;  5CI5 A;  3RTF B;  1XI6 A;  3UIF A;  4XEQ A;  4R73 A;  2XWI A;  1RYO A;  4EXL A;  3G3F A;  2H98 A;  1FCK A;  3ZS6 A;  2XX8 A;  1FPI A;  2HAU A;  2KR0 A;  4OQO A;  5ET5 A;  3VFJ A;  2Y5L A;  2I58 A;  3FVG A;  1R9L A;  3GLB A;  4IR8 A;  4KYS A;  4NMY A;  5KDT B;  4GOT A;  4LZ8 A;  1IMC A;  3I5O A;  2FNC A;  2Z22 A;  5H8N A;  3Q25 A;  5LTC A;  1Q1K A;  4OAN A;  3S9L C;  1A7L A;  4QXD A;  3CG1 A;  3B8B A;  4O3A A;  4HE1 A;  2XWO A;  4OHN A;  1PB7 A;  5EYH A;  4RJZ A;  2DDK A;  3FJM A;  4R75 A;  1MXZ A;  3K1M A;  3W15 C;  3OO8 A;  4BLA A;  3EHT A;  5FHN A;  4KYD A;  4PQJ A;  4I1D A;  5M2V A;  2CZI A;  1Q35 A;  5I58 B;  1RDX A;  2ONS A;  3HV1 A;  3BFT A;  1ATG A;  2AYS A;  1A55 A;  4GXS B;  4GWS A;  3ONM A;  2X26 A;  4PGN A;  1N3X A;  3N26 A;  4DXU A;  4FAT A;  2XWK A;  1FBP A;  1ZLQ A;  2AIX A;  4U4S A;  1ZIU A;  3QXM A;  1XVY A;  2DOJ A;  5A5X B;  4LAT A;  4DIG A;  1JW4 A;  4TQU Q;  1O7T A;  3TEP A;  4YIC A;  4OWD A;  4BDR A;  4RPN A;  4X1B A;  1URD A;  3T9X B;  1JW1 A;  5I3S A;  3JYR A;  1RDY A;  4G2Z A;  3LUZ A;  2HCA A;  4ELQ A;  4H5G A;  3FV2 A;  3EKI A;  2DXY A;  2ZNT A;  4O94 A;  1S7Y A;  3PUZ E;  1L5T A;  1NKX A;  2REG A;  3IOT A;  4EQ7 A;  3OD7 A;  3T9H B;  3TCH A;  3IB2 A;  2DP8 A;  4NQ8 A;  3O9P A;  4PGP A;  3D4G A;  4OEV A;  1DCU A;  1R1N A;  3USD A;  4ESX A;  4JSD A;  2HHM A;  2DWH A;  2G93 A;  4FED A;  3MVX A;  2XXX A;  3MW0 A;  3CFL A;  3TTN A;  4LZ5 A;  1AIV A;  2Y7R A;  4PC9 A;  4PFB A;  3RLF E;  3T66 A;  1VFE A;  2NOO A;  1GTK A;  1FJ9 A;  1NV6 A;  3FVK A;  3O2A A;  1MDP 1;  1MM6 A;  1MM7 A;  1SW2 A;  2V3T A;  3IFA A;  2OWT A;  4F2Q A;  2OBG A;  2ZXT A;  4F1U A;  2O1L A;  3TTM A;  4MX6 A;  1Q9D A;  3UGW A;  4EUO A;  1MQG A;  3K6U A;  3LSF B;  2WBD A;  3U93 A;  1FTL A;  2Y84 A;  4F3P A;  1TFA A;  3B6T A;  4N6P A;  2OWZ A;  3N6T A;  1JP4 A;  3O28 A;  4F22 A;  2VOZ A;  2OK2 A;  3C31 A;  1MXV A;  1A8E A;  1SDX A;  2V4C A;  3LSW A;  3MWB A;  4OVP A;  3MPK A;  1EYK A;  2XXK A;  2ZZV A;  3IOV A;  1US5 A;  3KBR A;  1YTV A;  2Q74 A;  2Q88 A;  3MP6 A;  2V25 A;  4NHB A;  2DE3 A;  5B7D A;  2AL5 A;  5EQ7 A;  3N5L A;  1HSJ A;  5HM4 B;  4P0G A;  1T0K A;  4OFJ A;  4KYE A;  2VGQ A;  3C32 A;  1NV3 A;  5CBS A;  4KXP A;  3KZG A;  1VE4 A;  3QK6 A;  2QL3 A;  1MXU A;  1Y9U A;  2ZYK A;  4GRK A;  1D4N A;  3IB1 A;  2B65 A;  2ALU A;  3CSG A;  4ELP A;  3A29 A;  4HS7 A;  3EPE A;  4MNC A;  4F18 A;  3FXR A;  3KEI A;  4IO4 A;  1B5I A;  5ISU A;  3CFX A;  1MRP A;  3SZP A;  2CEY A;  2G29 A;  2HXR A;  2X7Q A;  2JJK A;  4DDD A;  1SYI A;  5H8H A;  5AA4 A;  1K9Y A;  2V93 A;  1B0L A;  1SPI A;  3VXC A;  1N84 A;  3L6H A;  3O97 A;  3EF7 A;  2D21 A;  3T9U A;  3CIJ A;  1M5F A;  4PAK A;  1MQJ A;  1H45 A;  3LR1 A;  3E9X A;  1Y3P A;  4U2R A;  4NED A;  5L8D A;  5I57 B;  2HEU A;  3EN3 A;  3IB0 A;  3IOU A;  1IXH A;  4JBZ A;  4HCY A;  2R71 A;  5EQ8 A;  1S50 A;  1I6A A;  1FRP A;  4AB5 A;  1FBD A;  2Q2C A;  5H8S A;  2B3B A;  3IK6 B;  2Y7I A;  3NOH A;  4PTK A;  1SI0 A;  4NAP A;  1PBP A;  1N7W A;  4OES A;  3T1B A;  3V83 A;  4OET A;  3CG3 A;  1PEB A;  4PFW A;  3CI8 A;  3MUQ A;  3PUV E;  1PDA A;  4GX6 A;  2O6A A;  4OTE A;  1UTB B;  1P1W A;  3LSX A;  5ELV A;  1FQB A;  2F78 A;  3MP8 A;  1NUY A;  3MZ1 A;  5EHM A;  2Q89 A;  1TT1 A;  4PFY A;  4HW8 A;  2R6G E;  4NTL A;  3M3K A;  2I4C A;  2F7C A;  1Y3Q A;  2PMS A;  4XKN A;  3U72 A;  1MXY A;  4F2O A;  4DXC A;  3E4R A;  3LV0 A;  5F24 A;  2F3B A;  4X9T A;  4N13 A;  2ZZW A;  2PCR A;  1BTJ A;  3KSX A;  1B51 A;  3MC2 A;  3O6G A;  3GXA A;  2QMW A;  3R6U A;  2RC8 A;  3D4C A;  1OLC A;  1EU8 A;  2I4B A;  4JVI A;  4L17 A;  3TEL A;  3UA8 A;  1JW5 A;  4K3F A;  2UYE A;  5IZZ A;  1AOV A;  4E0X A;  4NF4 A;  2Q9T A;  1KA1 A;  2CZL A;  4IO6 A;  4EF2 A;  3W9W A;  4PP0 A;  4GWY A;  1B52 A;  5EQ9 A;  4OEU A;  3UP9 A;  2NUV A;  3FD3 A;  1FTO A;  1MPB A;  1DTZ A;  3QAX A;  3G3H A;  4R6Y A;  5L9O A;  4X1D A;  2GHA A;  2I0C A;  3Q26 A;  4DZ1 A;  4GD5 A;  3QSL A;  2DVZ A;  2P1S A;  1B3E A;  3KN8 A;  5TPA A;  1I6B A;  1D9Y A;  5EYF A;  1LEV A;  1XHY A;  3K0V A;  3G3K A;  1AL3 A;  4JWO A;  4ZEF A;  1FBC A;  4X8R A;  2Q8J A;  2CMO A;  4N4U A;  2MKZ A;  2DXR A;  3IJO B;  5B70 A;  2PT2 A;  5DEX A;  1QW0 A;  2YPN A;  1J1N A;  4KHZ E;  4YMB A;  3O29 A;  2OJT A;  3V89 B;  1UIV A;  5ET6 A;  4MAG A;  2O7I A;  3UOR A;  1AWB A;  3HO7 A;  4ONY A;  4ZEB A;  3KJ7 A;  2F36 A;  4LON B;  1LBW A;  1SBP A;  4GIZ A;  4Q5T A;  5JTY A;  4DCY A;  3E13 X;  4IO2 A;  2GFE A;  2R8T A;  2Y7K A;  4N6D A;  1D9Q A;  3PPN A;  1XVX A;  1NUW A;  2DWJ A;  4DI3 D;  1MQH A;  4PE3 A;  2BJI A;  4KCC A;  1B6H A;  3PGF A;  4FAJ A;  5JK4 A;  4ZEK A;  1DK4 A;  3IO4 A;  4ZZE A;  4POX A;  2I3W A;  1A40 A;  4GWW A;  4KR5 A;  4XKP A;  1B0H A;  4RK9 A;  1B3F A;  1VFD A;  1RDZ A;  3SEX A;  1GGG A;  1DTG A;  2F7A A;  1MY2 A;  3OEK A;  4U23 A;  1SI1 A;  4R6K A;  4QBA A;  3HST A;  4N17 A;  2Y5K A;  2QJE A;  4ISU A;  2QS1 A;  4PE5 B;  4QFN A;  3S9E A;  2XX7 A;  4H45 A;  1IMB A;  4AB6 A;  4X48 A;  3CVG A;  4GWU A;  1IUD A;  4PET A;  4I62 A;  1FQA A;  5BUU A;  1B2H A;  5IZ3 A;  4XXU A;  3RPL A;  4M1V A;  1UIU A;  3MYU A;  1NV0 A;  1FPG A;  1OMP A;  1IXG A;  1QKA A;  4RY1 A;  3ECR A;  3TPA A;  4XKR A;  1LAG E;  2XXR A;  3IOW A;  3LUY A;  3M3L A;  4LA9 A;  3P7I A;  2ZYN A;  3TTK A;  3KG2 A;  1QKB A;  4QSD A;  4BDQ A;  4IO5 A;  5I2N A;  4GWO A;  3T0J A;  3PTY A;  4ZEC A;  4MFI A;  2Z8F A;  4N8G A;  3BIG A;  4MLV A;  4G68 A;  2ANJ A;  5F7V A;  1I69 A;  4R9G A;  3VVD A;  4F31 B;  4PF8 A;  2O69 A;  4C1U A;  2FHY A;  1ZKB A;  1IME A;  2L5V A;  1N0T A;  5H8H B;  3KGC A;  5AA4 B;  1NUX A;  1OLA A;  2QVR A;  4ND9 A;  4P8B A;  3TZA A;  4MBP A;  3I3V A;  4YB5 A;  4DE8 A;  4HE0 A;  1IQ7 A;  1RKM A;  2XXI A;  3PU5 A;  1PBQ A;  4NF6 A;  4X04 A;  3MAM A;  3MVY A;  3PD9 A;  3IFC A;  3VE1 B;  4PFI A;  4F3G A;  4NX1 A;  2OCU A;  3H7M A;  1O64 A;  2CEX A;  2WKY A;  1EZO A;  5CMM A;  1O63 A;  1JEV A;  2XD2 A;  5AA2 A;  3T93 B;  1MY3 A;  3U65 A;  1LAF E;  5IZ1 A;  2QVU A;  2F3D A;  3ZKL A;  3FXU A;  1FTM A;  4NF5 A;  4KI0 E;  2GH9 A;  1WDN A;  1TWY A;  3D1R A;  1NV1 A;  2NVU B;  3C34 A;  2I6E A;  5K2Y A;  3U8Q A;  2I48 A;  1MH4 A;  4G61 A;  3R26 A;  3T9V A;  1FTJ A;  3KBZ A;  4EQB A;  5JEI A;  3H03 A;  1BP5 A;  3OSR A;  1WVJ A;  1EH3 A;  4OEN A;  2F35 A;  2W7Y A;  4IGR A;  5HBC A;  1IMA A;  2ZZX A;  1R6Z A;  3O6I A;  3E3K A;  2THI A;  2VD3 A;  1FBG A;  2ZYM A;  5I56 A;  1FBE A;  2XXY A;  2QRY A;  4F29 A;  3FJG A;  4H5F A;  5I7I A;  5L9S A;  4TOZ A;  3K4U A;  1LFH A;  5I2K A;  5I59 B;  2O84 X;  4ELO A;  2HFB A;  5H8F A;  3OMB A;  2HQ0 A;  2R9J A;  3TOD A;  4UA8 A;  3VDF A;  4G77 A;  4R6H A;  4P0I A;  3K01 A;  2KLF A;  4MLQ A;  3HCQ A;  5KCJ A;  1LFG A;  2PFZ A;  4FIM A;  2RC9 A;  4HCW A;  2NXO A;  4F19 A;  1QGX A;  1SW5 A;  4QF9 A;  1FPB A;  1N76 A;  4PBQ A;  3K6X A;  1SW1 A;  2QS4 A;  3DP4 A;  4PDD A;  3C9H A;  2QPQ A;  1PC3 A;  3U94 A;  5IAI A;  4KFQ A;  4AS5 A;  5AE4 A;  3ILU B;  4R2F A;  1ANF A;  2Z8D A;  3TQW A;  5KDT A;  5K2X A;  3THI A;  2HZL A;  4MNI A;  1ZJL A;  3EHU A;  1NV5 A;  2RCB A;  1XT8 A;  2FA7 A;  4H8I A;  1YAE A;  1JET A;  3IO6 A;  4OVJ A;  2H5Y A;  4XKQ A;  1Y1M A;  4MNP A;  3SET A;  4IGT A;  2PFY A;  3IX1 A;  4GL0 A;  5A5L A;  4GL8 A;  5TP9 A;  2GHB A;  2I3V A;  5H8Q B;  5DVF A;  1CB6 A;  2CZK A;  1S9T A;  1N3W A;  5I5P A;  5ICT A;  3G7W A;  4O7I A;  2DSF A;  4ZZA A;  4NWC A;  1LBC A;  4IO3 A;  5JTY B;  3C33 A;  4LQ5 A;  1POY 1;  2Y7W A;  4F39 A;  1UTH B;  4RNS A;  3BKI B;  1EYI A;  3WAE A;  1B7U A;  5DVI A;  4BDO A;  1DBZ A;  3AXF A;  2FVZ A;  4F1Y A;  3H4Z A;  4PBH A;  1NH7 A;  1DSN A;  3M3F A;  3OO6 A;  1K9Z A;  4XF5 A;  3JZJ A;  4JB7 A;  5LDZ A;  1QJM A;  2ABH A;  5IM2 A;  1NFT A;  1SYH A;  1BIY A;  2RF1 A;  4KD5 A;  4MEV A;  2UVG A;  1MY4 A;  5HPQ A;  1FPK A;  4YU0 A;  3SKP A;  1Y1Z A;  1QUK A;  1LBX A;  1H43 A;  3R7X A;  4U22 A;  3TAJ A;  1MH3 A;  3UK4 A;  2XD3 A;  2XXW A;  3H6W A;  4U1Z A;  3A09 A;  3BIH A;  4P1E A;  2VPN A;  1D3K A;  4JDF A;  1NH8 A;  5BWJ A;  1IXC A;  2YJP A;  3G3J A;  3MQ9 A;  4GWX A;  1FBF A;  3K00 A;  3Q27 A;  1Z7N E;  4H67 A;  4THI A;  4POW A;  4MF3 A;  5L9M A;  4AS4 A;  1QUI A;  2XA5 A;  2DS9 A;  3ZSF A;  2DVC A;  4M4G A;  3RPL B;  4HTG A;  2O68 A;  1YPN A;  4QRZ A;  1Y4C A;  5H8N B;  3RTW B;  1YCJ A;  3HFU A;  3KOS A;  3TCG A;  2XX9 A;  4ECF A;  1IXI A;  1GVC A;  4EXK A;  1MY1 A;  4LP2 B;  1ZU0 A;  3I6V A;  4FJP A;  1D9V A;  1A8F A;  1OQH A;  3TTR A;  1JQF A;  5I2N B;  1LBB A;  4H46 A;  2QSX A;  2FIE A;  1KZ8 A;  4O3C A;  4G8M A;  4AQ4 A;  1QUL A;  4ZDM A;  4JXI A;  4I3Y A;  3ILT B;  1Y20 A;  2Z8E A;  3GBB A;  3SER A;  4G4P A;  5FTI A;  3QUJ A;  4OFO A;  4GXA A;  4NF8 A;  2UXA A;  4H1X A;  4JWX A;  4PFU A;  3K02 A;  2V84 A;  5CMB A;  1XC1 A;  2ONK E;  2DYX A;  3FIR A;  5CMC A;  3OO7 A;  2ZNU A;  4OYV A;  4P3L A;  4OVR A;  3PPO A;  4OER A;  1EZP A;  3RNN A;  3A3U A;  4E0W A;  2F8D A;  1WOD A;  5KZT A;  1NI9 A;  1MDQ A;  4NF6 B;  4RPO A;  1IMD A;  5T3J A;  3WAF A;  2VP1 A;  4N8Y A;  3OSQ A;  1B1H A;  1AMF A;  2XXQ A;  5FHM A;  1DMB A;  4R2B A;  4QFL A;  4O3B A;  1IEJ A;  1URG A;  3HHG A;  4FE8 A;  4MHF A;  4HXV A;  5AA2 B;  4RK2 A;  4WEP A;  3B50 A;  1GV8 A;  1VR5 A;  3PUY E;  4U1O A;  3K6W A;  2WYP A;  3O6H A;  2XXH A;  2XXP A;  5DT6 A;  1B1X A;  5J16 A;  2ZMB A;  2DE2 A;  1NMU A;  2QMX A;  3H6U A;  4ZE9 A;  4N6K A;  3CR9 A;  1JNF A;  5EYG A;  4U4X A;  3QYT A;  5AA1 A;  2RIN A;  1JEU A;  1KA0 A;  2XHD A;  5CBR A;  2IA4 A;  3VVF A;  3VXB A;  3BBR A;  3TYH A;  3U92 A;  2QVV A;  2Q8M A;  4U21 A;  5DW8 A;  5EQA A;  1NUZ A;  4F3B A;  3TKD A;  2WYK A;  1OVT A;  5I56 B;  1BK4 A;  4G8N A;  3LC8 A;  4NGU A;  1Y4T A;  4Z7E A;  1B4Z A;  3RYD A;  3S4U A;  3FBP A;  4RYA A;  5TU0 A;  2OX3 A;  2E0S A;  2PYY A;  4YZZ A;  4P47 A;  2VHA A;  4PAF A;  2QS3 A;  1UTB A;  3IL1 B;  4N81 A;  1MY0 A;  4Q8R A;  3PPR A;  3O66 A;  4H65 A;  3B6W A;  2DWA A; 
#chains in the Genus database with same CATH homology
 3KBZ A;  1FPF A;  4NG7 A;  4GBW A;  3MST A;  4PAK A;  2WX9 A;  4P56 A;  2GQ1 A;  3W9V A;  4JVC A;  1FSA A;  2CZH A;  4UAB A;  4HCY A;  1IMA A;  2ZZX A;  5EQ8 A;  1FRP A;  3E78 A;  1FBG A;  1FBE A;  1FBD A;  1FPE A;  4OVQ A;  5I7I A;  2FBP A;  4I3E A;  1LBZ A;  5ET7 A;  5ET8 A;  4I40 A;  3NOH A;  4PTK A;  4N91 A;  3CHG A;  4NAP A;  3KC1 A;  2VT5 A;  3T1B A;  1CNQ A;  1FBH A;  1FPJ A;  1FTA A;  1FPL A;  2PFZ A;  4PAI A;  4HCW A;  4GX6 A;  1NV4 A;  4F19 A;  1QGX A;  4JVD A;  1NUY A;  3ISP A;  1FPB A;  4PBQ A;  4GX3 A;  4PDD A;  2QPQ A;  1FJ6 A;  2P3V A;  4PDH A;  4AS5 A;  1YXI A;  4MCO A;  4PFR A;  1EYJ A;  4HE2 A;  2HZL A;  4MNI A;  3LV0 A;  5F24 A;  1NV5 A;  2F3B A;  4MMP A;  4X9T A;  1FPD A;  3E79 A;  2ZZW A;  1G0I A;  2PCR A;  4N15 A;  5J1D A;  4MNP A;  1LBY A;  2B4L A;  2PFY A;  4JVI A;  4DI4 B;  5A5L A;  3FXB A;  5IZZ A;  2Q9T A;  2CZK A;  1KA1 A;  4NN3 A;  4OVT A;  4FBP A;  3W9W A;  5I5P A;  4GWY A;  2WEF A;  5EQ9 A;  4P9K A;  4O7I A;  2HPG A;  2VPO A;  2QFL A;  5CM6 A;  1YYZ A;  1EYI A;  1XI6 A;  2DVZ A;  4XEQ A;  1DBZ A;  2XWI A;  4XFE A;  1LEV A;  2HZK A;  2FVZ A;  4OVS A;  1FPI A;  2KR0 A;  5ET5 A;  4PBH A;  2V3Q A;  2Y5L A;  4IR8 A;  1FBC A;  4X8R A;  1K9Z A;  4XF5 A;  4N4U A;  2MKZ A;  1IMC A;  5LDZ A;  5LTC A;  5IM2 A;  4OAN A;  4QXD A;  4GX4 A;  3B8B A;  4HE1 A;  2XWO A;  4MEV A;  4LN5 A;  5EYH A;  2DDK A;  1INP A;  1FPK A;  5ET6 A;  4MAG A;  4PF6 A;  1AWB A;  1LBX A;  2CZI A;  1LBW A;  1RDX A;  4GWS A;  5IGA A;  4PGN A;  3BIH A;  4P1E A;  2VPN A;  1IMF A;  2XWK A;  1FBP A;  2R8T A;  4N6D A;  1D9Q A;  1NUW A;  4GWX A;  1FBF A;  4DI3 D;  4YIC A;  4PE3 A;  2BJI A;  4AS4 A;  1YZ0 A;  2XA5 A;  4O7M A;  3RPL B;  5I3S A;  5JK4 A;  1RDY A;  3LUZ A;  1DK4 A;  3GYY A;  4GWW A;  3HFU A;  3EKI A;  1RDZ A;  4O94 A;  5FBP A;  4QBA A;  4N17 A;  2Y5K A;  4NQ8 A;  4PGP A;  4OA4 A;  4H46 A;  1DCU A;  2FIE A;  1KZ8 A;  2HHM A;  5ESY A;  4I3Y A;  4H45 A;  4GBV A;  1IMB A;  4GWU A;  3KC0 A;  4PET A;  4PC9 A;  4PFB A;  1NV6 A;  1FJ9 A;  5IZ3 A;  3RPL A;  4M1V A;  3MYU A;  3IFA A;  4P3L A;  1NV0 A;  4OVR A;  1FPG A;  4F1U A;  4MX6 A;  1Q9D A;  4F1V A;  1NI9 A;  2WBD A;  1IMD A;  5T3J A;  4N8Y A;  2OWZ A;  1JP4 A;  2V4C A;  1G0H A;  3T0J A;  3PTY A;  4OVP A;  4HXV A;  4MHF A;  1EYK A;  2XXK A;  3B50 A;  2ZZV A;  4N8G A;  3BIG A;  2Q74 A;  2WYP A;  4NHB A;  4PCD A;  2P3N A;  4PF8 A;  5J16 A;  2FHY A;  2DE3 A;  2DE2 A;  5EQ7 A;  1IME A;  2L5V A;  4N6K A;  4P1L A;  1VDW A;  1NUX A;  2QVR A;  5EYG A;  4P8B A;  1NV3 A;  2F5X A;  4HE0 A;  5IZ3 B;  4KXP A;  1KA0 A;  4X04 A;  4GWZ A;  3QMF A;  3IFC A;  2QVV A;  2Q8M A;  4PFI A;  4NX1 A;  5DW8 A;  5EQA A;  1NUZ A;  4O8M A;  2CEX A;  1NV7 A;  2WYK A;  3A29 A;  1BK4 A;  3U65 A;  4NGU A;  4MNC A;  4F18 A;  5IZ1 A;  4NF0 A;  3RYD A;  3FBP A;  2OX3 A;  2QVU A;  2F3D A;  1LBV A;  4YZZ A;  4P47 A;  4PAF A;  2WBB A;  2DE4 A;  2B4M A;  3SZP A;  2CEY A;  2HXR A;  2JJK A;  2FIX A;  4MIJ A;  2KQZ A;  1NV2 A;  3D1R A;  3ROJ A;  1K9Y A;  1NV1 A;  4N81 A;  2XWV A;  1SPI A;  4G61 A;  4MJO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...