4MCOA

Crystal structure of a trap periplasmic solute binding protein from rhodoferax ferrireducens (rfer_1840), target efi-510211, with bound malonate
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
316
structure length
316
Chain Sequence
LKISHQFPGGTIKEGDFRDRLVRNFAAEVEKRSKGAMKFEIYPGSSLMKTNAQFSSMRKGALDMALIPLSYAGGEVPELNIGLMPGLVVSYEQAYSWKTKPVGIELTRVLQEKGIVLISWIWQAGGVASRGKPVVEPEDAKGMKIRGGSREMDMILKDAGAAVVSLPSNEIYAAMQTGAMDAAMTSSTSFISFRLEEVAKALTTGRTGAYWFMFEPLMMSKAIFDKLPKDQRDMLMTVGAEMEKFALEAAKKDDIDVAAVYQKAGAKVVDLSDGTIKKWQDIARKTAWKDYGAKNEGCAKLLALAQQTLAENLYFQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Rhodoferax ferrireducens
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter-DctP subunit
total genus 116
structure length 316
sequence length 316
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-08-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mcoA00
4MHFA 2WYKA 4N91A 2HZKA 5IGAA 2XXKA 2V4CA 2ZZWA 4N8GA 4N8YA 5IM2A 4MMPA 4PAIA 5I7IA 2XWIA 4N15A 4OVRA 2HZLA 4MNCA 4PF6A 2XWKA 2ZZXA 4OVTA 4P56A 4PAKA 4PFBA 2CEXA 4YICA 4OVSA 4P9KA 4PETA 4N17A 2XWVA 5CM6A 4OVPA 5LTCA 4NX1A 2WX9A 4P8BA 2VPNA 4N4UA 2XWOA 4DI3D 3FXBA 4NGUA 4MCOA 4O8MA 4X8RA 4LN5A 4NN3A 2PFYA 5I5PA 4PE3A 4PCDA 2VPOA 4MNPA 4OANA 4XEQA 4NHBA 4O7MA 4PFRA 4N6DA 4PAFA 4PC9A 4XFEA 4PBQA 4OA4A 4NAPA 4UABA 4NQ8A 3GYYA 5IZZA 4NG7A 2XA5A 4PDDA 4P1EA 4DI4B 2PFZA 4PFIA 2HPGA 2WYPA 4PF8A 3B50A 4OVQA 4PGNA 4O94A 4X04A 4XF5A 4P47A 4NF0A 4MNIA 2CEYA 2ZZVA 4MX6A 4P1LA 3U65A 4MIJA 4YZZA 4PGPA 4MAGA 4N6KA 4P3LA 4PBHA 4PDHA 4MEVA
chains in the Genus database with same CATH superfamily
5I2NB 3RYDA 3G3GA 1EYKA 3EF7A 3K6XA 2V3UA 2V3TA 4O3AA 4OVRA 3S2VA 2BJJX 2GHAA 5I3SA 2VGQA 2IEEA 4ZZAA 1Y3QA 1XVXA 5ET8A 2Y5LA 4YICA 4ONYA 3UORA 1T0KA 1AH5A 3E13X 4O7IA 1JEUA 3ILUB 2XXPA 3HSTA 4IY5A 1SDXA 3T0JA 3FXBA 3K6WA 1NV4A 4U4SA 3PMXA 2I49A 3CIJA 1SI0A 3UP9A 4PAFA 3O28A 3LV0A 3BBRA 1ZMGA 3EN3A 3H6UA 5DEXA 1MXZA 5K2YA 4YAHX 3JYRA 3UA8A 4GQOA 2GQ1A 4JVCA 1MPDA 2F7AA 4H5GA 5L9MA 1MM7A 2I4BA 2ESNA 4PGNA 4U21A 4WXJA 2RF1A 4NF0A 4MNIA 2CEYA 4MX6A 1PC3A 1RDXA 3LSLA 1DOTA 5ELVA 1MY3A 1SW2A 1WVJA 5I58B 3U8QA 4PGPA 2O68A 3DELB 3S9LC 4ZEIA 1AMFA 2UYEA 5I84A 2DWJA 3OOAA 1LBXA 5I7IA 4F2OA 1Y4CA 1HSJA 2H9BA 3IJXB 1II5A 4QBAA 2I3WA 2Y7IA 4GX3A 1TXFA 1MY0A 4QSEA 2XWVA 4XXUA 3HHGA 5LTCA 1SW4A 3MZ1A 2Z23A 4NF4A 4RYAA 1NUXA 3Q27A 4QSDA 4NGUA 1B40A 3WAEA 4OERA 3V89B 4PE3A 2Q2AA 4MNPA 2Y84A 2O7UA 1MQJA 4LZ5A 3S9NC 1VFEA 1NNPA 5DEXB 1LLSA 1NV5A 1LBBA 4JXIA 1FBFA 4Z7EA 4Q8RA 4R72A 2P1SA 2KR0A 4IO4A 4ESWA 1YAEA 2D21A 1B4ZA 1JVXA 3KN7A 3OMBA 4RA1A 5H8HA 1R9QA 4MF3A 3SKPA 4GF8A 1JETA 3MP8A 2H99A 3RNNA 1FPKA 1JEVA 3C34A 4R2FA 5ISUA 4ZEDA 1S7YA 1JNFA 3V5AA 4ZECA 4WKMA 4OQOA 4PFTA 4LQ5A 3MVYA 2GRVA 4N91A 4OEUA 1I6QA 1LBVA 4YB7A 1KWHA 4N8GA 2R71A 5IM2A 1MH4A 2F78A 3RT6B 2DWAA 4N15A 3Q25A 1CB6A 4X1DA 1UTBB 4IO3A 2LAOA 3O29A 3UN6A 5EQ9A 3OENA 3KOSA 2PT2A 3PPRA 4OVSA 1OIBA 1RDZA 3QXMA 1LBYA 2ONKE 1I6BA 4N4UA 1BTJA 1D3KA 1EYIA 2XX8A 1L5TA 3R6UA 1NL5A 4EDPA 4GIZA 4O8MA 1D9QA 5JTYA 4UACA 4PC9A 3KFMA 4U22A 4H8JA 4NEDA 3FXUA 4UABA 5FBPA 2DVZA 3DLNA 1CNQA 4OETA 1DSNA 1LAHE 1A40A 3H6VA 1EYJA 3RUMA 2FVZA 3UIFA 1B05A 2QVVA 2VHAA 4DI4B 2YPNA 5LOMA 3B50A 3KEIA 1TWYA 4ELOA 1H44A 3N5LA 5CBRA 5H8SA 5AA3A 4HE1A 1QUKA 1VE4A 2F5XA 3C31A 1LBWA 4EF2A 4HS7A 1WDNA 3CR9A 5BWJA 3PPQA 2O69A 2QSXA 3GXAA 2YJPA 3FJGA 4OVJA 1N7XA 3TTLA 2DXYA 2H98A 3IO6A 3CI8A 1OVTA 4BDOA 4GL0A 1GV8A 5I59A 3IFCA 4PF6A 1OQHA 2B3BA 4O3CA 1UQWA 3A3CA 4OVTA 5A5XA 4PFBA 3BIHA 5J1DA 3SZPA 1B9JA 1NV7A 4RPOA 1H3DA 2WX9A 1RDYA 1A54A 1FPBA 2W7YA 1US5A 2E0SA 1IXHA 4HW8A 3K2DA 3SEYA 5I56A 3Q29A 1NV2A 1FBPA 2OLBA 1ANFA 3R7XA 5CC2A 3CG3A 1FPIA 1LEVA 3GZGA 1QGXA 3RQTA 5AA2B 3PPOA 3OO9A 1FTKA 3TYHA 1UTBA 4NF8B 4O94A 4X48A 2KQZA 2GHBA 5A5XB 3MJNA 4XKPA 4LZ7A 4DCYA 3IOTA 2WBDA 1IXIA 1MM6A 3LUYA 2F3DA 2CZHA 3G3KA 4F3PA 4E0XA 3U94A 1OQGA 1FJ9A 4F22A 4MHFA 1FQFA 1MY2A 5TPAB 3LSWA 2FA7A 1FTLA 1SBPA 1P1OA 2XWIA 2Q9TA 3SESA 3VDFA 2X7PA 4QFKA 4MFIA 2NVUB 4LQ2A 4FATA 2OBGA 5AA2A 2V84A 2RKMA 1RKMA 3OEMA 5FTHA 2ZNUA 2HEUA 4GOTA 5H8QB 2FIEA 4N6PA 3JV9A 2O6AA 2PMSA 4MJOA 2QVRA 5JK4A 4TLLB 2NWJA 3HCQA 4X1BA 3TCHA 5ET6A 2X7QA 2QS1A 2XXTA 4POWA 3H03A 3W15C 1FJ6A 2RC9A 2ONSA 3TTRA 2XXVA 1B4HA 2QS4A 5ITOA 4PFIA 3C33A 2Z8EA 1XVYA 1D4NA 4F3SA 4GXAA 4HTGA 1PDAA 3U65A 4OFLA 1JW5A 3LBSA 3ODBA 4KD5A 3TFLA 1A7LA 2HHMA 4ZEKA 2O1MA 4OFJA 1PBQA 1FPJA 5ET7A 1WODA 4RK9A 4ELQA 2Q8MA 2Y7RA 5AA2D 1LAFE 5KCJB 1QJMA 3MVWA 4PQJA 1DPEA 1SYIA 5DTBA 3NOHA 4IR8A 1B0LA 1K9ZA 4JWYA 3IX1A 1NV0A 3C4MA 3C36A 5HPQA 1Y1ZA 4ECFA 5EHSA 2RC7A 1Z7NE 3SERA 3PUZE 3MVXA 1FTAA 4NE4A 3KOTA 3N94A 2OZZA 3KN3A 4OANA 3OEKA 4ZS9A 4XFEA 5I56B 2H4IA 4OESA 1OMPA 1YCJA 3T93B 1JW1A 2FIXA 3PGFA 5KDTB 5IZZA 1M5BA 3HPIA 2DP8A 4FIMA 3BIGA 5TPAA 1B3LA 1IMBA 1SYHA 4OZ9A 3ONMA 2ZNTA 3PV0E 1EU8A 2XXYA 3MWBA 3ZKLA 3HFUA 3IO4A 3HN0A 3FVGA 1IUDA 1EH3A 3OSQA 5CRYA 4BDRA 4NF5A 2DDKA 2DQVA 4MIJA 4U23A 4C1TA 4OEVA 2DXRA 5H8NB 4G77A 1DCUA 1FQBA 5DVJA 2A5SA 2HZKA 2CZKA 3O2AA 3CFLA 2F3BA 4OFOA 1G0IA 4FE8A 4MNCA 2D3IA 1Y4TA 2QPQA 4FORA 4X9TA 4M1VA 2Z8FA 5EYFA 3G7WA 2I3VA 1LBZA 2QRYA 2CZLA 3PUYE 3KSXA 4KYSA 1D9YA 2F97A 4G8NA 3EHTA 1B32A 4PP0A 1N84A 4PTKA 3B6QA 3VXBA 3H06B 5DW8A 3TODA 4IY6A 4P11A 4H45A 1QUJA 1J1NA 3MC2A 1URDA 1URGA 3LSFB 1HSLA 1TFDA 1SI1A 4GXSB 4U4XA 4QFPA 3BFUA 1B6HA 1H76A 1NH7A 1N04A 3IOWA 1PB8A 3FXRA 4H0WA 1IMFA 2FYIA 3K6UA 3B7DA 2X26A 2UVIA 3IL1B 4GD5A 4YKIA 3D4CA 1A99A 4U1OA 1GTKA 3TMGA 2XX9A 4QSCA 1OLCA 2FNCA 4OHNA 1H43A 3PUXE 5TP9A 3IORA 4JB7A 3PTYA 4R6HA 2HQ0A 3MQ9A 1P99A 2Z22A 2DWHA 4G68C 2G93A 1NMUA 2F7CA 2AYSA 4NWCA 4KXPA 3I3VA 4RPNA 3KG2A 3C32A 2HXWA 1LGBC 3H7MA 1AIVA 1DK4A 5M2VA 1DPPA 2I0CA 2XWKA 1UIVA 4JWXA 3M8UA 3RLFE 4F31B 5I57B 4PAKA 1B7HA 1AOVA 5I2KA 4N17A 4YKKA 1KA1A 3A29A 2WKYA 1AL3A 3H6TA 3OO6A 4P0IA 4F1YA 3FVOA 1O64A 1FTOA 1M5FA 3DP4A 3U92A 4F1VA 1JW4A 3CG1A 3T66A 4YMAA 3CSGA 4KYEA 1UTHB 2ANJA 1FBEA 3PU5A 2UVGA 1Y3PA 1NFTA 3QAXA 4NAPA 2Y7WA 4NQ8A 1BLFA 4LONB 3FV1A 1FPLA 1MPCA 1OLAA 4TLMB 2XD2A 3MP6A 5EQ7A 4QF9A 5B7DA 5CMBA 2PFZA 4BDNA 1MXXA 4K3FA 3PPNA 3UK4A 4H46A 1MS7A 1B0HA 4GX4A 3OXNA 1URSA 4JSOA 1SQYA 2UYFA 3O9PA 4RJZA 3LSXA 3I5OA 4R9GA 4OENA 3E78A 3KJ7A 4DXCA 2O84X 3VLUA 1CE2A 2DVCA 4ZZEA 3MUQA 5F7VA 4PBHA 2DSFA 3BKIB 4KQPA 1KZ8A 4KCDA 1P1WA 4TOZA 2XX7A 2WYKA 1B2HA 3SEXA 4DE8A 2QMXA 2XXKA 3OELA 1PBPA 1ELJA 5IZ3A 3TTKA 2OX3A 1NUZA 4THIA 4MMPA 2NUVA 3E9XA 1LSTA 1BIYA 2HZLA 3KGCA 2XD3A 4JVDA 2MKZA 4JVIA 1TFAA 3IB2A 1QULA 2QMWA 4H67A 4P9KA 3TQLA 1VDWA 3FIRA 1POY1 2BJIA 4NF5B 3KBRA 4JSDA 5CMKA 3I6VA 3O6HA 2ZXTA 2XWOA 3B8BA 3MVZA 3T22A 2VD3A 5TP9B 3A09A 2I48A 3W9WA 5L9OA 1B3HA 2O51A 4HCWA 4NHBA 3M3LA 1Y20A 1ZIUA 2F36A 2ZMBA 4KI0E 4OA4A 3FBPA 4G68A 4HE2A 4IGTA 4YB5A 2XXWA 2CMOA 4EUOA 1MQHA 1JQFA 1LAGE 1MRPA 4JBZA 4AB6A 4ELRA 3SEWA 4P47A 1P1UA 3MPLA 3PUWE 5H8QA 3TQWA 2Y7PA 3U72A 2HAVA 4KYDA 2QFLA 3FUZA 1XI6A 4XTCQ 4R2BA 2XXIA 2ABHA 1B7ZA 3SETA 3LC8A 5IGAA 3FGSA 4N8YA 3ECRA 1FPGA 2Y5KA 5F1QA 4IGRA 4G4PA 4QXDA 1I69A 2DOJA 2CEXA 4OMBA 2R9JA 1XS5A 3FZVA 1IMEA 2B4LA 1USYE 3FV2A 1BP5A 5BUUA 3K01A 1PEBA 3K00A 4WEPA 5ICTA 4GBVA 4R74A 4XKRA 4JWOA 3FXQA 1LCFA 3TKDA 3G3IA 4Q30B 4PE5B 2Q8JA 4FECA 2WEFA 3T9HB 4DXUA 1RYOA 4YKJA 3FVKA 4I3YA 1RYXA 3KC1A 5HM4B 2Z8DA 4H6DA 3MW0A 3IK6B 2VT5A 1YXIA 5EQ8A 5I2KB 3KZGA 4P1EA 4ELPA 4LZ8A 1Y9UA 4KR5A 4NF6B 4PF8A 1MXUA 5ESYA 5L9SA 3ZS6A 3PMWA 4NF8A 3B6TA 3TTNA 3GLBA 3FASA 1MXVA 1ZBMA 2QS3A 4GWOA 3RY3A 1NV3A 1O7TA 4LP2B 2HXRA 4LUBA 4R9FA 1ZKBA 1XHYA 1B5JA 2F35A 2UXAA 4C0RA 4P3LA 1MY4A 2A5TB 3D1RA 2CZIA 4OYVA 4EQ7A 4XKNA 1I6AA 1B5IA 3B6WA 2NOOA 2OWZA 3RTWB 2O7IA 4MH5A 1VSOA 1TT1A 2V3QA 4KPTA 3GBAA 1B58A 5IZ3B 1R1NA 2V93A 1PB9A 4U1ZA 2WBBA 3MAMA 4NTLA 3FD3A 4PETA 4WEDA 3S9MC 4G61A 1YTVA 5CM6A 1MXYA 3N26A 3OSRA 4QFLA 4P8BA 2XXUA 2AL5A 1B46A 4G2ZA 3E4RA 4BDQA 2OCUA 4MBPA 4I62A 5IKBA 3FVNA 4DIGA 4NN3A 3V83A 3TELA 2L5VA 4AS5A 1NNFA 2ZYKA 3P7IA 3VVFA 1A8EA 5AE4A 2YLNA 3USDA 2XXQA 4G8HA 1POTA 2DWIA 3E3KA 3S4UA 4ZEBA 2XA5A 2G29A 4GL8A 1BKAA 1M5EA 4BLAA 1N7WA 3FATA 3G3HA 4Q5TA 2UVJA 3CRBA 4G8MA 4DDDA 3RPLA 5HBCA 5H8FA 3K1NA 3Q28A 1FTJA 5IZ1A 3VLVA 4P1LA 2F7BA 1B1HA 3TAJA 1SPIA 1D9VA 4ZEFA 4LATA 3VXCA 3IR1A 1UIUA 4YU0A 3TZAA 4Z0IA 4DZ1A 4PFWA 3MPKA 1A55A 1MPBA 5K2XA 1YZ0A 3L6HA 2B3FA 1QW0A 4NWDA 2VD2A 4AQ4A 1FW0A 5F24A 3FJ7A 2DYXA 3KN8A 4Q0CA 2VP1A 3T9UA 4P56A 1M5DA 1A8FA 2THIA 1ZU0A 3OO7A 1LAXA 4GWXA 3VVEA 3PUVE 1EZ9A 5IAIA 3PPPA 4I3EA 3T1BA 2B65A 2PBWA 1KA0A 3T9VA 3ROJA 1FBHA 3TCGA 1DBZA 1VFDA 1LB8A 3KSJA 2UVHA 1MH3A 3VFJA 1MG1A 5L8DA 4O7MA 4RY1A 4POXA 1K9YA 5ITPA 3K1PA 3KJTA 3O97A 3RPWA 1NI9A 1HSEA 1P1QA 3IB0A 1S50A 2RINA 1LBCA 5KDTA 2PCRA 5FHMA 2I58A 4H5FA 5KZTA 4F3GA 3M3KA 4L17A 4N81A 1MDP1 1Q35A 4DXBA 3TTMA 1Y3NA 3O66A 1FBGA 4YB6A 5I57A 4ESXA 1GR2A 3EPEA 5EYGA 1FQCA 4IB2A 2P3NA 3QYTA 2HAUA 1IQ7A 3QIMA 4KHZE 4RNSA 1LCTA 4MAGA 2DE3A 4NMYA 2I4CA 2ZYNA 2VPNA 4F39A 5EYHA 2A5TA 2V4CA 1UTHA 2ZZWA 4N13A 1B3GA 3Q26A 4F2QA 1IXCA 4NF6A 2E1SA 2QVUA 4EF1A 2DE2A 1Y1MA 4R6YA 3RTFB 3MZBA 3BFTA 3N6TA 4HCYA 1SW1A 1IITA 3IFAA 3AXFA 3C9HA 1R6ZA 4RK2A 4H1XA 4LN5A 2P0SA 5AA4A 4I40A 1IXGA 4PCDA 1Q9DA 4R75A 1NUWA 3THIA 1FRPA 1S9TA 1P1NA 5J16A 1FQDA 1MY1A 2DS9A 5DYHA 3VLWA 4IO7A 2Y7KA 4O3BA 5DT6A 1IEJA 3K02A 2F34A 2M8CA 2VOZA 4R6KA 1QKBA 1IIWA 3GYYA 3DM0A 5FHNA 4DCXA 3FJMA 3TDJA 3ISPA 4F1UA 3F11A 2HPGA 1NV1A 2ZYOA 2I0BA 1F9BA 4X04A 4LVQA 3QUJA 4XF5A 3TUSA 5A5LA 2QJEA 1MQGA 1B51A 2GH9A 3QMFA 4GWSA 3A3UA 4RXLA 5TU0A 4GWYA 3TCFA 4FJPA 1B3EA 4YMBA 1EZOA 2F8DA 3ZKKA 1MDQA 1FPDA 4N6KA 3UGWA 1QUIA 3MSTA 2Q2CA 2XHDA 3HHFA 4IO5A 2Q89A 4AB5A 4EXLA 1B1XA 1OVBA 3VE1B 5I59B 1GVCA 3C35A 4PAIA 3IOUA 4GWZA 2JJKA 3U1OA 1IMAA 3PD8A 4BDMA 2ZNSA 2IA4A 3W9VA 3EHUA 4OTEA 3D4GA 2PT1A 1G0HA 2GFEA 1FPFA 2H25A 2PVUA 4M4GA 2V25A 3TEPA 5ET5A 4MLQA 3PMVA 2AL4A 3M3FA 1B7UA 1M5CA 4QFNA 2AIXA 4GWUA 1IZ1A 3R26A 4GVOA 1DMBA 3QSLA 4DI3D 1NV6A 4UA8A 3LUZA 3E79A 4QFOA 2OK2A 2RC8A 1JP4A 5EHMA 2VPOA 4I9DA 4F3BA 4XEQA 1FSAA 1MXWA 2F6GA 4PFRA 3IOVA 4N6DA 1B3FA 2FHYA 5I2NA 4U2RA 1NNTA 4TQUQ 1GGGA 3QK6A 2R8TA 2F6PA 2REJA 4NG7A 4FAJA 1FQEA 5ICQA 3KBZA 3IAZA 4PDDA 2HCAA 2XXRA 4OVQA 1IMDA 1FTMA 3O6IA 2QL3A 1Q1KA 3MYUA 2ZZVA 2KLFA 4ZE8A 3RPLB 4EXKA 5H8FB 3MP1A 3RN8A 2ONRA 4YZZA 4JDFA 3EHSA 4OWDA 3H4ZA 3IB1A 1N3XA 1LFHA 1FBCA 3CHGA 4LA9A 2OWSA 1XC1A 3OD7A 1B5HA 1MQDA 1LFIA 3V8XB 5CI5A 4I1DA 1Z7ME 4FEDA 5DVFA 5JEIA 4PFUA 3ILTB 3L6GA 3EQ1A 1XOCA 3G3FA 4OVPA 4BDLA 1SD3A 1R9LA 3ZSFA 1FBDA 3HO7A 1ATGA 4F19A 1PB7A 1FQAA 3T96B 3VV5A 4MCOA 4MLVA 2RCAA 2PFYA 5I5PA 2DE4A 2XXXA 4OXVA 4IO2A 3JZJA 1AWBA 3G3JA 1SVXB 3WAFA 1H45A 1ZJLA 2PYYA 3HV1A 4EQ9A 1FCKA 2HFBA 2NXOA 5EQAA 5CMCA 3CFXA 4HXVA 2P3VA 4F18A 5CBSA 1YYZA 4G68B 1MQIA 3CVGA 1EZPA 5LDZA 1YPNA 1USYH 5H8HB 4IO6A 4N07A 2RCBA 1DTGA 3RT8A 5FHOA 1NKXA 1QVSA 3EKIA 2R6GE 1QKAA 1US4A 3KC0A 5FTIA 1XT8A 4H65A 4ISUA 2H5YA 2OJTA 4QHQA 4AS4A 1JVYA 3GBBA 1NUYA 4PDHA 4R73A 1SW5A 4FBPA 1O63A 2O1LA 1ZTYA 3U93A 3K4UA 5CMMA 1FPEA 1N0TA 1ZLQA 3T9XB 3RGYA 3DP6A 5KCJA 1INPA 1N3WA 3K1MA 3CSBA 2D5WA 4HE0A 1N76A 2ZZXA 3K6VA 4ZE9A 3PD9A 3N6UA 4I8CA 4EQBA 4FEBA 5DVIA 2Q88A 3SDFA 4QRZA 4NX1A 1DTZA 4E0WA 4GBWA 1LB9A 5I58A 4X8RA 5JTYB 3MZ9A 2XXHA 4GRKA 3O6GA 5AA4B 4PFYA 4PBQA 4GLIA 4F29A 3SEVA 1VR5A 3OO8A 3SEUA 1BK4A 4GX6A 2P2AA 4GWWA 3TPAA 1IMCA 3DP8A 4P0GA 1NH8A 2ALUA 2I6EA 2QS2A 4ND9A 4DLDA 3S9EA 4C1UA 1NNKA 3H3GA 4KFQA 5AA1A 2WYPA 3H6WA 2B4MA 4GFRA 3IJOB 1B52A 2OWTA 4NF4B 2ZYMA 3VVDA 5T3JA 4XKQA 5H8NA 4H8IA 4ZDMA 4KCCA 2REGA 3CFZA 3QUFA 4YKPA 2FBPA 2PX1A 3LR1A 3MBPA 2Q74A 3K0VA 1LFGA 5B70A 4XIGQ 4MEVA
chains in the Genus database with same CATH topology
2HHMA 4MHFA 2CZIA 3RYDA 2WYKA 4N91A 2HZKA 1EYKA 5EYHA 2CZKA 4FBPA 5IGAA 1FBCA 1LBVA 2XXKA 2OWZA 3CHGA 1YZ0A 5IZ3A 2V4CA 2OX3A 2ZZWA 4KXPA 4N8GA 1NUZA 4N8YA 2V3QA 1LBXA 2F3BA 4MMPA 4PAIA 1FPJA 4GWZA 5IM2A 1FPEA 2JJKA 5ET7A 5I7IA 2XWIA 1IMAA 1FPGA 2Y5KA 4N15A 2Q9TA 4OVRA 5F24A 5IZ3B 1G0IA 5I3SA 2HZLA 3W9VA 4MNCA 4QBAA 1DK4A 2Q8MA 3IFCA 1INPA 2QPQA 4PF6A 2XWKA 2MKZA 4JVDA 1G0HA 4JVIA 1FPFA 2WBBA 4QXDA 5EQ9A 4X9TA 4GX3A 2QVUA 4M1VA 4HE0A 2ZZXA 2DE2A 4OVTA 4P56A 4PAKA 5ET8A 4PFBA 2Y5LA 2CEXA 4YICA 4OVSA 4P9KA 4PETA 1LBZA 3BIHA 4N17A 2XWVA 3NOHA 4G61A 4IR8A 3D1RA 5J1DA 5CM6A 1RDZA 1VDWA 3SZPA 4GWXA 1K9ZA 4O7IA 1NV7A 1KA1A 4HCYA 4OVPA 5ET5A 3A29A 1LBYA 1NV0A 2BJIA 5LTCA 2FIEA 3IFAA 1IMEA 2WX9A 4NX1A 1RDYA 4I3EA 1FBDA 2B4LA 4GBWA 4P8BA 3T1BA 4GWUA 1FPBA 4N4UA 1KA0A 3ROJA 1NUXA 1EYIA 3T0JA 4F19A 2XWOA 4GBVA 1FBHA 1NV6A 3B8BA 3FXBA 3LUZA 1NV4A 4NGUA 4PTKA 4DI3D 3E79A 4MCOA 4O8MA 4MJOA 4X8RA 1DBZA 4LN5A 4NN3A 1D9QA 2PFYA 1FTAA 2QVRA 4F1VA 2DE4A 5I5PA 5JK4A 2L5VA 5DW8A 4I40A 3W9WA 1JP4A 4PCDA 1Q9DA 4PE3A 1NUWA 1FRPA 2VPOA 4H45A 1NV2A 4AS5A 4MNPA 2WEFA 4MEVA 4OANA 4XEQA 5J16A 1FSAA 4HCWA 1AWBA 4NHBA 4O7MA 4PFRA 5ET6A 4N6DA 1FBEA 4PAFA 4PC9A 1K9YA 4PBQA 3LV0A 1FBPA 4XFEA 4I3YA 2FIXA 3KC1A 2FHYA 4OA4A 1NI9A 4NAPA 4UABA 5FBPA 4NQ8A 2DVZA 1NV5A 1FPIA 1LEVA 1FJ6A 3GYYA 1CNQA 1FBFA 1QGXA 2R8TA 5EQAA 3FBPA 4NG7A 5IZZA 1BK4A 1EYJA 1FPLA 4GX6A 3BIGA 4GWWA 2VT5A 1IMBA 4HE2A 4HXVA 2P3VA 2XA5A 4F18A 1IMCA 1YXIA 2FVZA 3ISPA 1IMFA 3KBZA 5EQ8A 4F1UA 1YYZA 2PCRA 2GQ1A 2QVVA 4JVCA 4PDDA 5EQ7A 4P1EA 4DI4B 2PFZA 2KR0A 2HPGA 4PFIA 5LDZA 4N81A 2WYPA 1NV1A 3B50A 2B4MA 4OVQA 4PF8A 3HFUA 4O94A 1IMDA 4PGNA 4X04A 1FBGA 5ESYA 4H46A 2KQZA 4XF5A 4P47A 3RPLA 4NF0A 4GX4A 5EYGA 4MNIA 3MYUA 2CEYA 2ZZVA 4HE1A 4MX6A 5A5LA 3EKIA 2P3NA 5T3JA 5IZ1A 1RDXA 2WBDA 3QMFA 4GWSA 4P1LA 3RPLB 2F5XA 1SPIA 1NV3A 3U65A 2DDKA 3KC0A 1FPKA 3E78A 2HXRA 2F3DA 2FBPA 4GWYA 4MIJA 1LBWA 2CZHA 2QFLA 4PGPA 4YZZA 1XI6A 2Q74A 4MAGA 2DE3A 3PTYA 1DCUA 4AS4A 1FPDA 4N6KA 4P3LA 4PBHA 1NUYA 3MSTA 1KZ8A 4PDHA 1FJ9A 2VPNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MHF A;  2WYK A;  4N91 A;  2HZK A;  5IGA A;  2XXK A;  2V4C A;  2ZZW A;  4N8G A;  4N8Y A;  5IM2 A;  4MMP A;  4PAI A;  5I7I A;  2XWI A;  4N15 A;  4OVR A;  2HZL A;  4MNC A;  4PF6 A;  2XWK A;  2ZZX A;  4OVT A;  4P56 A;  4PAK A;  4PFB A;  2CEX A;  4YIC A;  4OVS A;  4P9K A;  4PET A;  4N17 A;  2XWV A;  5CM6 A;  4OVP A;  5LTC A;  4NX1 A;  2WX9 A;  4P8B A;  2VPN A;  4N4U A;  2XWO A;  4DI3 D;  3FXB A;  4NGU A;  4MCO A;  4O8M A;  4X8R A;  4LN5 A;  4NN3 A;  2PFY A;  5I5P A;  4PE3 A;  4PCD A;  2VPO A;  4MNP A;  4OAN A;  4XEQ A;  4NHB A;  4O7M A;  4PFR A;  4N6D A;  4PAF A;  4PC9 A;  4XFE A;  4PBQ A;  4OA4 A;  4NAP A;  4UAB A;  4NQ8 A;  3GYY A;  5IZZ A;  4NG7 A;  2XA5 A;  4PDD A;  4P1E A;  4DI4 B;  2PFZ A;  4PFI A;  2HPG A;  2WYP A;  4PF8 A;  3B50 A;  4OVQ A;  4PGN A;  4O94 A;  4X04 A;  4XF5 A;  4P47 A;  4NF0 A;  4MNI A;  2CEY A;  2ZZV A;  4MX6 A;  4P1L A;  3U65 A;  4MIJ A;  4YZZ A;  4PGP A;  4MAG A;  4N6K A;  4P3L A;  4PBH A;  4PDH A;  4MEV A; 
#chains in the Genus database with same CATH topology
 5I2N B;  3RYD A;  3G3G A;  1EYK A;  3EF7 A;  3K6X A;  2V3U A;  2V3T A;  4O3A A;  4OVR A;  3S2V A;  2BJJ X;  2GHA A;  5I3S A;  2VGQ A;  2IEE A;  4ZZA A;  1Y3Q A;  1XVX A;  5ET8 A;  2Y5L A;  4YIC A;  4ONY A;  3UOR A;  1T0K A;  1AH5 A;  3E13 X;  4O7I A;  1JEU A;  3ILU B;  2XXP A;  3HST A;  4IY5 A;  1SDX A;  3T0J A;  3FXB A;  3K6W A;  1NV4 A;  4U4S A;  3PMX A;  2I49 A;  3CIJ A;  1SI0 A;  3UP9 A;  4PAF A;  3O28 A;  3LV0 A;  3BBR A;  1ZMG A;  3EN3 A;  3H6U A;  5DEX A;  1MXZ A;  5K2Y A;  4YAH X;  3JYR A;  3UA8 A;  4GQO A;  2GQ1 A;  4JVC A;  1MPD A;  2F7A A;  4H5G A;  5L9M A;  1MM7 A;  2I4B A;  2ESN A;  4PGN A;  4U21 A;  4WXJ A;  2RF1 A;  4NF0 A;  4MNI A;  2CEY A;  4MX6 A;  1PC3 A;  1RDX A;  3LSL A;  1DOT A;  5ELV A;  1MY3 A;  1SW2 A;  1WVJ A;  5I58 B;  3U8Q A;  4PGP A;  2O68 A;  3DEL B;  3S9L C;  4ZEI A;  1AMF A;  2UYE A;  5I84 A;  2DWJ A;  3OOA A;  1LBX A;  5I7I A;  4F2O A;  1Y4C A;  1HSJ A;  2H9B A;  3IJX B;  1II5 A;  4QBA A;  2I3W A;  2Y7I A;  4GX3 A;  1TXF A;  1MY0 A;  4QSE A;  2XWV A;  4XXU A;  3HHG A;  5LTC A;  1SW4 A;  3MZ1 A;  2Z23 A;  4NF4 A;  4RYA A;  1NUX A;  3Q27 A;  4QSD A;  4NGU A;  1B40 A;  3WAE A;  4OER A;  3V89 B;  4PE3 A;  2Q2A A;  4MNP A;  2Y84 A;  2O7U A;  1MQJ A;  4LZ5 A;  3S9N C;  1VFE A;  1NNP A;  5DEX B;  1LLS A;  1NV5 A;  1LBB A;  4JXI A;  1FBF A;  4Z7E A;  4Q8R A;  4R72 A;  2P1S A;  2KR0 A;  4IO4 A;  4ESW A;  1YAE A;  2D21 A;  1B4Z A;  1JVX A;  3KN7 A;  3OMB A;  4RA1 A;  5H8H A;  1R9Q A;  4MF3 A;  3SKP A;  4GF8 A;  1JET A;  3MP8 A;  2H99 A;  3RNN A;  1FPK A;  1JEV A;  3C34 A;  4R2F A;  5ISU A;  4ZED A;  1S7Y A;  1JNF A;  3V5A A;  4ZEC A;  4WKM A;  4OQO A;  4PFT A;  4LQ5 A;  3MVY A;  2GRV A;  4N91 A;  4OEU A;  1I6Q A;  1LBV A;  4YB7 A;  1KWH A;  4N8G A;  2R71 A;  5IM2 A;  1MH4 A;  2F78 A;  3RT6 B;  2DWA A;  4N15 A;  3Q25 A;  1CB6 A;  4X1D A;  1UTB B;  4IO3 A;  2LAO A;  3O29 A;  3UN6 A;  5EQ9 A;  3OEN A;  3KOS A;  2PT2 A;  3PPR A;  4OVS A;  1OIB A;  1RDZ A;  3QXM A;  1LBY A;  2ONK E;  1I6B A;  4N4U A;  1BTJ A;  1D3K A;  1EYI A;  2XX8 A;  1L5T A;  3R6U A;  1NL5 A;  4EDP A;  4GIZ A;  4O8M A;  1D9Q A;  5JTY A;  4UAC A;  4PC9 A;  3KFM A;  4U22 A;  4H8J A;  4NED A;  3FXU A;  4UAB A;  5FBP A;  2DVZ A;  3DLN A;  1CNQ A;  4OET A;  1DSN A;  1LAH E;  1A40 A;  3H6V A;  1EYJ A;  3RUM A;  2FVZ A;  3UIF A;  1B05 A;  2QVV A;  2VHA A;  4DI4 B;  2YPN A;  5LOM A;  3B50 A;  3KEI A;  1TWY A;  4ELO A;  1H44 A;  3N5L A;  5CBR A;  5H8S A;  5AA3 A;  4HE1 A;  1QUK A;  1VE4 A;  2F5X A;  3C31 A;  1LBW A;  4EF2 A;  4HS7 A;  1WDN A;  3CR9 A;  5BWJ A;  3PPQ A;  2O69 A;  2QSX A;  3GXA A;  2YJP A;  3FJG A;  4OVJ A;  1N7X A;  3TTL A;  2DXY A;  2H98 A;  3IO6 A;  3CI8 A;  1OVT A;  4BDO A;  4GL0 A;  1GV8 A;  5I59 A;  3IFC A;  4PF6 A;  1OQH A;  2B3B A;  4O3C A;  1UQW A;  3A3C A;  4OVT A;  5A5X A;  4PFB A;  3BIH A;  5J1D A;  3SZP A;  1B9J A;  1NV7 A;  4RPO A;  1H3D A;  2WX9 A;  1RDY A;  1A54 A;  1FPB A;  2W7Y A;  1US5 A;  2E0S A;  1IXH A;  4HW8 A;  3K2D A;  3SEY A;  5I56 A;  3Q29 A;  1NV2 A;  1FBP A;  2OLB A;  1ANF A;  3R7X A;  5CC2 A;  3CG3 A;  1FPI A;  1LEV A;  3GZG A;  1QGX A;  3RQT A;  5AA2 B;  3PPO A;  3OO9 A;  1FTK A;  3TYH A;  1UTB A;  4NF8 B;  4O94 A;  4X48 A;  2KQZ A;  2GHB A;  5A5X B;  3MJN A;  4XKP A;  4LZ7 A;  4DCY A;  3IOT A;  2WBD A;  1IXI A;  1MM6 A;  3LUY A;  2F3D A;  2CZH A;  3G3K A;  4F3P A;  4E0X A;  3U94 A;  1OQG A;  1FJ9 A;  4F22 A;  4MHF A;  1FQF A;  1MY2 A;  5TPA B;  3LSW A;  2FA7 A;  1FTL A;  1SBP A;  1P1O A;  2XWI A;  2Q9T A;  3SES A;  3VDF A;  2X7P A;  4QFK A;  4MFI A;  2NVU B;  4LQ2 A;  4FAT A;  2OBG A;  5AA2 A;  2V84 A;  2RKM A;  1RKM A;  3OEM A;  5FTH A;  2ZNU A;  2HEU A;  4GOT A;  5H8Q B;  2FIE A;  4N6P A;  3JV9 A;  2O6A A;  2PMS A;  4MJO A;  2QVR A;  5JK4 A;  4TLL B;  2NWJ A;  3HCQ A;  4X1B A;  3TCH A;  5ET6 A;  2X7Q A;  2QS1 A;  2XXT A;  4POW A;  3H03 A;  3W15 C;  1FJ6 A;  2RC9 A;  2ONS A;  3TTR A;  2XXV A;  1B4H A;  2QS4 A;  5ITO A;  4PFI A;  3C33 A;  2Z8E A;  1XVY A;  1D4N A;  4F3S A;  4GXA A;  4HTG A;  1PDA A;  3U65 A;  4OFL A;  1JW5 A;  3LBS A;  3ODB A;  4KD5 A;  3TFL A;  1A7L A;  2HHM A;  4ZEK A;  2O1M A;  4OFJ A;  1PBQ A;  1FPJ A;  5ET7 A;  1WOD A;  4RK9 A;  4ELQ A;  2Q8M A;  2Y7R A;  5AA2 D;  1LAF E;  5KCJ B;  1QJM A;  3MVW A;  4PQJ A;  1DPE A;  1SYI A;  5DTB A;  3NOH A;  4IR8 A;  1B0L A;  1K9Z A;  4JWY A;  3IX1 A;  1NV0 A;  3C4M A;  3C36 A;  5HPQ A;  1Y1Z A;  4ECF A;  5EHS A;  2RC7 A;  1Z7N E;  3SER A;  3PUZ E;  3MVX A;  1FTA A;  4NE4 A;  3KOT A;  3N94 A;  2OZZ A;  3KN3 A;  4OAN A;  3OEK A;  4ZS9 A;  4XFE A;  5I56 B;  2H4I A;  4OES A;  1OMP A;  1YCJ A;  3T93 B;  1JW1 A;  2FIX A;  3PGF A;  5KDT B;  5IZZ A;  1M5B A;  3HPI A;  2DP8 A;  4FIM A;  3BIG A;  5TPA A;  1B3L A;  1IMB A;  1SYH A;  4OZ9 A;  3ONM A;  2ZNT A;  3PV0 E;  1EU8 A;  2XXY A;  3MWB A;  3ZKL A;  3HFU A;  3IO4 A;  3HN0 A;  3FVG A;  1IUD A;  1EH3 A;  3OSQ A;  5CRY A;  4BDR A;  4NF5 A;  2DDK A;  2DQV A;  4MIJ A;  4U23 A;  4C1T A;  4OEV A;  2DXR A;  5H8N B;  4G77 A;  1DCU A;  1FQB A;  5DVJ A;  2A5S A;  2HZK A;  2CZK A;  3O2A A;  3CFL A;  2F3B A;  4OFO A;  1G0I A;  4FE8 A;  4MNC A;  2D3I A;  1Y4T A;  2QPQ A;  4FOR A;  4X9T A;  4M1V A;  2Z8F A;  5EYF A;  3G7W A;  2I3V A;  1LBZ A;  2QRY A;  2CZL A;  3PUY E;  3KSX A;  4KYS A;  1D9Y A;  2F97 A;  4G8N A;  3EHT A;  1B32 A;  4PP0 A;  1N84 A;  4PTK A;  3B6Q A;  3VXB A;  3H06 B;  5DW8 A;  3TOD A;  4IY6 A;  4P11 A;  4H45 A;  1QUJ A;  1J1N A;  3MC2 A;  1URD A;  1URG A;  3LSF B;  1HSL A;  1TFD A;  1SI1 A;  4GXS B;  4U4X A;  4QFP A;  3BFU A;  1B6H A;  1H76 A;  1NH7 A;  1N04 A;  3IOW A;  1PB8 A;  3FXR A;  4H0W A;  1IMF A;  2FYI A;  3K6U A;  3B7D A;  2X26 A;  2UVI A;  3IL1 B;  4GD5 A;  4YKI A;  3D4C A;  1A99 A;  4U1O A;  1GTK A;  3TMG A;  2XX9 A;  4QSC A;  1OLC A;  2FNC A;  4OHN A;  1H43 A;  3PUX E;  5TP9 A;  3IOR A;  4JB7 A;  3PTY A;  4R6H A;  2HQ0 A;  3MQ9 A;  1P99 A;  2Z22 A;  2DWH A;  4G68 C;  2G93 A;  1NMU A;  2F7C A;  2AYS A;  4NWC A;  4KXP A;  3I3V A;  4RPN A;  3KG2 A;  3C32 A;  2HXW A;  1LGB C;  3H7M A;  1AIV A;  1DK4 A;  5M2V A;  1DPP A;  2I0C A;  2XWK A;  1UIV A;  4JWX A;  3M8U A;  3RLF E;  4F31 B;  5I57 B;  4PAK A;  1B7H A;  1AOV A;  5I2K A;  4N17 A;  4YKK A;  1KA1 A;  3A29 A;  2WKY A;  1AL3 A;  3H6T A;  3OO6 A;  4P0I A;  4F1Y A;  3FVO A;  1O64 A;  1FTO A;  1M5F A;  3DP4 A;  3U92 A;  4F1V A;  1JW4 A;  3CG1 A;  3T66 A;  4YMA A;  3CSG A;  4KYE A;  1UTH B;  2ANJ A;  1FBE A;  3PU5 A;  2UVG A;  1Y3P A;  1NFT A;  3QAX A;  4NAP A;  2Y7W A;  4NQ8 A;  1BLF A;  4LON B;  3FV1 A;  1FPL A;  1MPC A;  1OLA A;  4TLM B;  2XD2 A;  3MP6 A;  5EQ7 A;  4QF9 A;  5B7D A;  5CMB A;  2PFZ A;  4BDN A;  1MXX A;  4K3F A;  3PPN A;  3UK4 A;  4H46 A;  1MS7 A;  1B0H A;  4GX4 A;  3OXN A;  1URS A;  4JSO A;  1SQY A;  2UYF A;  3O9P A;  4RJZ A;  3LSX A;  3I5O A;  4R9G A;  4OEN A;  3E78 A;  3KJ7 A;  4DXC A;  2O84 X;  3VLU A;  1CE2 A;  2DVC A;  4ZZE A;  3MUQ A;  5F7V A;  4PBH A;  2DSF A;  3BKI B;  4KQP A;  1KZ8 A;  4KCD A;  1P1W A;  4TOZ A;  2XX7 A;  2WYK A;  1B2H A;  3SEX A;  4DE8 A;  2QMX A;  2XXK A;  3OEL A;  1PBP A;  1ELJ A;  5IZ3 A;  3TTK A;  2OX3 A;  1NUZ A;  4THI A;  4MMP A;  2NUV A;  3E9X A;  1LST A;  1BIY A;  2HZL A;  3KGC A;  2XD3 A;  4JVD A;  2MKZ A;  4JVI A;  1TFA A;  3IB2 A;  1QUL A;  2QMW A;  4H67 A;  4P9K A;  3TQL A;  1VDW A;  3FIR A;  1POY 1;  2BJI A;  4NF5 B;  3KBR A;  4JSD A;  5CMK A;  3I6V A;  3O6H A;  2ZXT A;  2XWO A;  3B8B A;  3MVZ A;  3T22 A;  2VD3 A;  5TP9 B;  3A09 A;  2I48 A;  3W9W A;  5L9O A;  1B3H A;  2O51 A;  4HCW A;  4NHB A;  3M3L A;  1Y20 A;  1ZIU A;  2F36 A;  2ZMB A;  4KI0 E;  4OA4 A;  3FBP A;  4G68 A;  4HE2 A;  4IGT A;  4YB5 A;  2XXW A;  2CMO A;  4EUO A;  1MQH A;  1JQF A;  1LAG E;  1MRP A;  4JBZ A;  4AB6 A;  4ELR A;  3SEW A;  4P47 A;  1P1U A;  3MPL A;  3PUW E;  5H8Q A;  3TQW A;  2Y7P A;  3U72 A;  2HAV A;  4KYD A;  2QFL A;  3FUZ A;  1XI6 A;  4XTC Q;  4R2B A;  2XXI A;  2ABH A;  1B7Z A;  3SET A;  3LC8 A;  5IGA A;  3FGS A;  4N8Y A;  3ECR A;  1FPG A;  2Y5K A;  5F1Q A;  4IGR A;  4G4P A;  4QXD A;  1I69 A;  2DOJ A;  2CEX A;  4OMB A;  2R9J A;  1XS5 A;  3FZV A;  1IME A;  2B4L A;  1USY E;  3FV2 A;  1BP5 A;  5BUU A;  3K01 A;  1PEB A;  3K00 A;  4WEP A;  5ICT A;  4GBV A;  4R74 A;  4XKR A;  4JWO A;  3FXQ A;  1LCF A;  3TKD A;  3G3I A;  4Q30 B;  4PE5 B;  2Q8J A;  4FEC A;  2WEF A;  3T9H B;  4DXU A;  1RYO A;  4YKJ A;  3FVK A;  4I3Y A;  1RYX A;  3KC1 A;  5HM4 B;  2Z8D A;  4H6D A;  3MW0 A;  3IK6 B;  2VT5 A;  1YXI A;  5EQ8 A;  5I2K B;  3KZG A;  4P1E A;  4ELP A;  4LZ8 A;  1Y9U A;  4KR5 A;  4NF6 B;  4PF8 A;  1MXU A;  5ESY A;  5L9S A;  3ZS6 A;  3PMW A;  4NF8 A;  3B6T A;  3TTN A;  3GLB A;  3FAS A;  1MXV A;  1ZBM A;  2QS3 A;  4GWO A;  3RY3 A;  1NV3 A;  1O7T A;  4LP2 B;  2HXR A;  4LUB A;  4R9F A;  1ZKB A;  1XHY A;  1B5J A;  2F35 A;  2UXA A;  4C0R A;  4P3L A;  1MY4 A;  2A5T B;  3D1R A;  2CZI A;  4OYV A;  4EQ7 A;  4XKN A;  1I6A A;  1B5I A;  3B6W A;  2NOO A;  2OWZ A;  3RTW B;  2O7I A;  4MH5 A;  1VSO A;  1TT1 A;  2V3Q A;  4KPT A;  3GBA A;  1B58 A;  5IZ3 B;  1R1N A;  2V93 A;  1PB9 A;  4U1Z A;  2WBB A;  3MAM A;  4NTL A;  3FD3 A;  4PET A;  4WED A;  3S9M C;  4G61 A;  1YTV A;  5CM6 A;  1MXY A;  3N26 A;  3OSR A;  4QFL A;  4P8B A;  2XXU A;  2AL5 A;  1B46 A;  4G2Z A;  3E4R A;  4BDQ A;  2OCU A;  4MBP A;  4I62 A;  5IKB A;  3FVN A;  4DIG A;  4NN3 A;  3V83 A;  3TEL A;  2L5V A;  4AS5 A;  1NNF A;  2ZYK A;  3P7I A;  3VVF A;  1A8E A;  5AE4 A;  2YLN A;  3USD A;  2XXQ A;  4G8H A;  1POT A;  2DWI A;  3E3K A;  3S4U A;  4ZEB A;  2XA5 A;  2G29 A;  4GL8 A;  1BKA A;  1M5E A;  4BLA A;  1N7W A;  3FAT A;  3G3H A;  4Q5T A;  2UVJ A;  3CRB A;  4G8M A;  4DDD A;  3RPL A;  5HBC A;  5H8F A;  3K1N A;  3Q28 A;  1FTJ A;  5IZ1 A;  3VLV A;  4P1L A;  2F7B A;  1B1H A;  3TAJ A;  1SPI A;  1D9V A;  4ZEF A;  4LAT A;  3VXC A;  3IR1 A;  1UIU A;  4YU0 A;  3TZA A;  4Z0I A;  4DZ1 A;  4PFW A;  3MPK A;  1A55 A;  1MPB A;  5K2X A;  1YZ0 A;  3L6H A;  2B3F A;  1QW0 A;  4NWD A;  2VD2 A;  4AQ4 A;  1FW0 A;  5F24 A;  3FJ7 A;  2DYX A;  3KN8 A;  4Q0C A;  2VP1 A;  3T9U A;  4P56 A;  1M5D A;  1A8F A;  2THI A;  1ZU0 A;  3OO7 A;  1LAX A;  4GWX A;  3VVE A;  3PUV E;  1EZ9 A;  5IAI A;  3PPP A;  4I3E A;  3T1B A;  2B65 A;  2PBW A;  1KA0 A;  3T9V A;  3ROJ A;  1FBH A;  3TCG A;  1DBZ A;  1VFD A;  1LB8 A;  3KSJ A;  2UVH A;  1MH3 A;  3VFJ A;  1MG1 A;  5L8D A;  4O7M A;  4RY1 A;  4POX A;  1K9Y A;  5ITP A;  3K1P A;  3KJT A;  3O97 A;  3RPW A;  1NI9 A;  1HSE A;  1P1Q A;  3IB0 A;  1S50 A;  2RIN A;  1LBC A;  5KDT A;  2PCR A;  5FHM A;  2I58 A;  4H5F A;  5KZT A;  4F3G A;  3M3K A;  4L17 A;  4N81 A;  1MDP 1;  1Q35 A;  4DXB A;  3TTM A;  1Y3N A;  3O66 A;  1FBG A;  4YB6 A;  5I57 A;  4ESX A;  1GR2 A;  3EPE A;  5EYG A;  1FQC A;  4IB2 A;  2P3N A;  3QYT A;  2HAU A;  1IQ7 A;  3QIM A;  4KHZ E;  4RNS A;  1LCT A;  4MAG A;  2DE3 A;  4NMY A;  2I4C A;  2ZYN A;  2VPN A;  4F39 A;  5EYH A;  2A5T A;  2V4C A;  1UTH A;  2ZZW A;  4N13 A;  1B3G A;  3Q26 A;  4F2Q A;  1IXC A;  4NF6 A;  2E1S A;  2QVU A;  4EF1 A;  2DE2 A;  1Y1M A;  4R6Y A;  3RTF B;  3MZB A;  3BFT A;  3N6T A;  4HCY A;  1SW1 A;  1IIT A;  3IFA A;  3AXF A;  3C9H A;  1R6Z A;  4RK2 A;  4H1X A;  4LN5 A;  2P0S A;  5AA4 A;  4I40 A;  1IXG A;  4PCD A;  1Q9D A;  4R75 A;  1NUW A;  3THI A;  1FRP A;  1S9T A;  1P1N A;  5J16 A;  1FQD A;  1MY1 A;  2DS9 A;  5DYH A;  3VLW A;  4IO7 A;  2Y7K A;  4O3B A;  5DT6 A;  1IEJ A;  3K02 A;  2F34 A;  2M8C A;  2VOZ A;  4R6K A;  1QKB A;  1IIW A;  3GYY A;  3DM0 A;  5FHN A;  4DCX A;  3FJM A;  3TDJ A;  3ISP A;  4F1U A;  3F11 A;  2HPG A;  1NV1 A;  2ZYO A;  2I0B A;  1F9B A;  4X04 A;  4LVQ A;  3QUJ A;  4XF5 A;  3TUS A;  5A5L A;  2QJE A;  1MQG A;  1B51 A;  2GH9 A;  3QMF A;  4GWS A;  3A3U A;  4RXL A;  5TU0 A;  4GWY A;  3TCF A;  4FJP A;  1B3E A;  4YMB A;  1EZO A;  2F8D A;  3ZKK A;  1MDQ A;  1FPD A;  4N6K A;  3UGW A;  1QUI A;  3MST A;  2Q2C A;  2XHD A;  3HHF A;  4IO5 A;  2Q89 A;  4AB5 A;  4EXL A;  1B1X A;  1OVB A;  3VE1 B;  5I59 B;  1GVC A;  3C35 A;  4PAI A;  3IOU A;  4GWZ A;  2JJK A;  3U1O A;  1IMA A;  3PD8 A;  4BDM A;  2ZNS A;  2IA4 A;  3W9V A;  3EHU A;  4OTE A;  3D4G A;  2PT1 A;  1G0H A;  2GFE A;  1FPF A;  2H25 A;  2PVU A;  4M4G A;  2V25 A;  3TEP A;  5ET5 A;  4MLQ A;  3PMV A;  2AL4 A;  3M3F A;  1B7U A;  1M5C A;  4QFN A;  2AIX A;  4GWU A;  1IZ1 A;  3R26 A;  4GVO A;  1DMB A;  3QSL A;  4DI3 D;  1NV6 A;  4UA8 A;  3LUZ A;  3E79 A;  4QFO A;  2OK2 A;  2RC8 A;  1JP4 A;  5EHM A;  2VPO A;  4I9D A;  4F3B A;  4XEQ A;  1FSA A;  1MXW A;  2F6G A;  4PFR A;  3IOV A;  4N6D A;  1B3F A;  2FHY A;  5I2N A;  4U2R A;  1NNT A;  4TQU Q;  1GGG A;  3QK6 A;  2R8T A;  2F6P A;  2REJ A;  4NG7 A;  4FAJ A;  1FQE A;  5ICQ A;  3KBZ A;  3IAZ A;  4PDD A;  2HCA A;  2XXR A;  4OVQ A;  1IMD A;  1FTM A;  3O6I A;  2QL3 A;  1Q1K A;  3MYU A;  2ZZV A;  2KLF A;  4ZE8 A;  3RPL B;  4EXK A;  5H8F B;  3MP1 A;  3RN8 A;  2ONR A;  4YZZ A;  4JDF A;  3EHS A;  4OWD A;  3H4Z A;  3IB1 A;  1N3X A;  1LFH A;  1FBC A;  3CHG A;  4LA9 A;  2OWS A;  1XC1 A;  3OD7 A;  1B5H A;  1MQD A;  1LFI A;  3V8X B;  5CI5 A;  4I1D A;  1Z7M E;  4FED A;  5DVF A;  5JEI A;  4PFU A;  3ILT B;  3L6G A;  3EQ1 A;  1XOC A;  3G3F A;  4OVP A;  4BDL A;  1SD3 A;  1R9L A;  3ZSF A;  1FBD A;  3HO7 A;  1ATG A;  4F19 A;  1PB7 A;  1FQA A;  3T96 B;  3VV5 A;  4MCO A;  4MLV A;  2RCA A;  2PFY A;  5I5P A;  2DE4 A;  2XXX A;  4OXV A;  4IO2 A;  3JZJ A;  1AWB A;  3G3J A;  1SVX B;  3WAF A;  1H45 A;  1ZJL A;  2PYY A;  3HV1 A;  4EQ9 A;  1FCK A;  2HFB A;  2NXO A;  5EQA A;  5CMC A;  3CFX A;  4HXV A;  2P3V A;  4F18 A;  5CBS A;  1YYZ A;  4G68 B;  1MQI A;  3CVG A;  1EZP A;  5LDZ A;  1YPN A;  1USY H;  5H8H B;  4IO6 A;  4N07 A;  2RCB A;  1DTG A;  3RT8 A;  5FHO A;  1NKX A;  1QVS A;  3EKI A;  2R6G E;  1QKA A;  1US4 A;  3KC0 A;  5FTI A;  1XT8 A;  4H65 A;  4ISU A;  2H5Y A;  2OJT A;  4QHQ A;  4AS4 A;  1JVY A;  3GBB A;  1NUY A;  4PDH A;  4R73 A;  1SW5 A;  4FBP A;  1O63 A;  2O1L A;  1ZTY A;  3U93 A;  3K4U A;  5CMM A;  1FPE A;  1N0T A;  1ZLQ A;  3T9X B;  3RGY A;  3DP6 A;  5KCJ A;  1INP A;  1N3W A;  3K1M A;  3CSB A;  2D5W A;  4HE0 A;  1N76 A;  2ZZX A;  3K6V A;  4ZE9 A;  3PD9 A;  3N6U A;  4I8C A;  4EQB A;  4FEB A;  5DVI A;  2Q88 A;  3SDF A;  4QRZ A;  4NX1 A;  1DTZ A;  4E0W A;  4GBW A;  1LB9 A;  5I58 A;  4X8R A;  5JTY B;  3MZ9 A;  2XXH A;  4GRK A;  3O6G A;  5AA4 B;  4PFY A;  4PBQ A;  4GLI A;  4F29 A;  3SEV A;  1VR5 A;  3OO8 A;  3SEU A;  1BK4 A;  4GX6 A;  2P2A A;  4GWW A;  3TPA A;  1IMC A;  3DP8 A;  4P0G A;  1NH8 A;  2ALU A;  2I6E A;  2QS2 A;  4ND9 A;  4DLD A;  3S9E A;  4C1U A;  1NNK A;  3H3G A;  4KFQ A;  5AA1 A;  2WYP A;  3H6W A;  2B4M A;  4GFR A;  3IJO B;  1B52 A;  2OWT A;  4NF4 B;  2ZYM A;  3VVD A;  5T3J A;  4XKQ A;  5H8N A;  4H8I A;  4ZDM A;  4KCC A;  2REG A;  3CFZ A;  3QUF A;  4YKP A;  2FBP A;  2PX1 A;  3LR1 A;  3MBP A;  2Q74 A;  3K0V A;  1LFG A;  5B70 A;  4XIG Q;  4MEV A; 
#chains in the Genus database with same CATH homology
 2HHM A;  4MHF A;  2CZI A;  3RYD A;  2WYK A;  4N91 A;  2HZK A;  1EYK A;  5EYH A;  2CZK A;  4FBP A;  5IGA A;  1FBC A;  1LBV A;  2XXK A;  2OWZ A;  3CHG A;  1YZ0 A;  5IZ3 A;  2V4C A;  2OX3 A;  2ZZW A;  4KXP A;  4N8G A;  1NUZ A;  4N8Y A;  2V3Q A;  1LBX A;  2F3B A;  4MMP A;  4PAI A;  1FPJ A;  4GWZ A;  5IM2 A;  1FPE A;  2JJK A;  5ET7 A;  5I7I A;  2XWI A;  1IMA A;  1FPG A;  2Y5K A;  4N15 A;  2Q9T A;  4OVR A;  5F24 A;  5IZ3 B;  1G0I A;  5I3S A;  2HZL A;  3W9V A;  4MNC A;  4QBA A;  1DK4 A;  2Q8M A;  3IFC A;  1INP A;  2QPQ A;  4PF6 A;  2XWK A;  2MKZ A;  4JVD A;  1G0H A;  4JVI A;  1FPF A;  2WBB A;  4QXD A;  5EQ9 A;  4X9T A;  4GX3 A;  2QVU A;  4M1V A;  4HE0 A;  2ZZX A;  2DE2 A;  4OVT A;  4P56 A;  4PAK A;  5ET8 A;  4PFB A;  2Y5L A;  2CEX A;  4YIC A;  4OVS A;  4P9K A;  4PET A;  1LBZ A;  3BIH A;  4N17 A;  2XWV A;  3NOH A;  4G61 A;  4IR8 A;  3D1R A;  5J1D A;  5CM6 A;  1RDZ A;  1VDW A;  3SZP A;  4GWX A;  1K9Z A;  4O7I A;  1NV7 A;  1KA1 A;  4HCY A;  4OVP A;  5ET5 A;  3A29 A;  1LBY A;  1NV0 A;  2BJI A;  5LTC A;  2FIE A;  3IFA A;  1IME A;  2WX9 A;  4NX1 A;  1RDY A;  4I3E A;  1FBD A;  2B4L A;  4GBW A;  4P8B A;  3T1B A;  4GWU A;  1FPB A;  4N4U A;  1KA0 A;  3ROJ A;  1NUX A;  1EYI A;  3T0J A;  4F19 A;  2XWO A;  4GBV A;  1FBH A;  1NV6 A;  3B8B A;  3FXB A;  3LUZ A;  1NV4 A;  4NGU A;  4PTK A;  4DI3 D;  3E79 A;  4MCO A;  4O8M A;  4MJO A;  4X8R A;  1DBZ A;  4LN5 A;  4NN3 A;  1D9Q A;  2PFY A;  1FTA A;  2QVR A;  4F1V A;  2DE4 A;  5I5P A;  5JK4 A;  2L5V A;  5DW8 A;  4I40 A;  3W9W A;  1JP4 A;  4PCD A;  1Q9D A;  4PE3 A;  1NUW A;  1FRP A;  2VPO A;  4H45 A;  1NV2 A;  4AS5 A;  4MNP A;  2WEF A;  4MEV A;  4OAN A;  4XEQ A;  5J16 A;  1FSA A;  4HCW A;  1AWB A;  4NHB A;  4O7M A;  4PFR A;  5ET6 A;  4N6D A;  1FBE A;  4PAF A;  4PC9 A;  1K9Y A;  4PBQ A;  3LV0 A;  1FBP A;  4XFE A;  4I3Y A;  2FIX A;  3KC1 A;  2FHY A;  4OA4 A;  1NI9 A;  4NAP A;  4UAB A;  5FBP A;  4NQ8 A;  2DVZ A;  1NV5 A;  1FPI A;  1LEV A;  1FJ6 A;  3GYY A;  1CNQ A;  1FBF A;  1QGX A;  2R8T A;  5EQA A;  3FBP A;  4NG7 A;  5IZZ A;  1BK4 A;  1EYJ A;  1FPL A;  4GX6 A;  3BIG A;  4GWW A;  2VT5 A;  1IMB A;  4HE2 A;  4HXV A;  2P3V A;  2XA5 A;  4F18 A;  1IMC A;  1YXI A;  2FVZ A;  3ISP A;  1IMF A;  3KBZ A;  5EQ8 A;  4F1U A;  1YYZ A;  2PCR A;  2GQ1 A;  2QVV A;  4JVC A;  4PDD A;  5EQ7 A;  4P1E A;  4DI4 B;  2PFZ A;  2KR0 A;  2HPG A;  4PFI A;  5LDZ A;  4N81 A;  2WYP A;  1NV1 A;  3B50 A;  2B4M A;  4OVQ A;  4PF8 A;  3HFU A;  4O94 A;  1IMD A;  4PGN A;  4X04 A;  1FBG A;  5ESY A;  4H46 A;  2KQZ A;  4XF5 A;  4P47 A;  3RPL A;  4NF0 A;  4GX4 A;  5EYG A;  4MNI A;  3MYU A;  2CEY A;  2ZZV A;  4HE1 A;  4MX6 A;  5A5L A;  3EKI A;  2P3N A;  5T3J A;  5IZ1 A;  1RDX A;  2WBD A;  3QMF A;  4GWS A;  4P1L A;  3RPL B;  2F5X A;  1SPI A;  1NV3 A;  3U65 A;  2DDK A;  3KC0 A;  1FPK A;  3E78 A;  2HXR A;  2F3D A;  2FBP A;  4GWY A;  4MIJ A;  1LBW A;  2CZH A;  2QFL A;  4PGP A;  4YZZ A;  1XI6 A;  2Q74 A;  4MAG A;  2DE3 A;  3PTY A;  1DCU A;  4AS4 A;  1FPD A;  4N6K A;  4P3L A;  4PBH A;  1NUY A;  3MST A;  1KZ8 A;  4PDH A;  1FJ9 A;  2VPN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...