4KR5A

Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in open conformation
Total Genus 79
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
79
sequence length
229
structure length
229
Chain Sequence
GMATPKKDVYTIASDNSFAPFEFQNDDKQFTGIDVDLLNAIAKNQGFKLKWNFIGFQAAVDSVQSGHADGMMSGMSITDARKQVFDYGSPYYSSNLTIATSSTDDSIKSWKDLKGKTLGAKNGTASFDYLNAHAKEYGYTVKTFTDATTMYSSLNNGSINALMDDEPVIKYAIKQGQKFATPIKPIPDGQYGFAVKKGSNPELIEMFNNGLANLRANGEYDKIIDKYLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Glutamine ABC transporter permease and substrate binding pro
publication title Functional Diversity of Tandem Substrate-Binding Domains in ABC Transporters from Pathogenic Bacteria.
pubmed doi rcsb
source organism Lactococcus lactis subsp. lactis
total genus 79
structure length 229
sequence length 229
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kr5A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4kr5A02
1MM6A 4UACA 2DE2A 1M5CA 1DMBA 1NFTA 5L9MA 1B1XA 1MH4A 1XOCA 3KJ7A 4YKKA 4QRZA 2XX8A 2W7YA 2Q8JA 1VSOA 4R72A 4U1ZA 1QVSA 2ANJA 4N6PA 5I58A 4I9DA 1URSA 4LQ2A 3IL1B 4QSCA 1LFHA 3MPLA 4QSDA 4FEDA 2QMXA 1ZKBA 2OZZA 4KYEA 2YPNA 5TP9A 5KCJA 2CZLA 3VFJA 3SEVA 5F1QA 1MY3A 3N6TA 1URGA 4PQJA 2XXTA 1IXIA 4FECA 1EZPA 2Q88A 4NF8B 3SERA 3K01A 2I4CA 1O64A 3OMBA 4NWCA 3IJXB 4EF2A 1SW4A 1IXGA 1UIVA 2D3IA 1PC3A 4Z0IA 3KN3A 1UTBB 1M5DA 4RPOA 5FTHA 2FA7A 4ZECA 3OELA 3QUFA 2HCAA 3FV2A 3GXAA 1A54A 1JW1A 4JSOA 3IOVA 1OLCA 1Y3PA 4BDNA 3MZ1A 3RT6B 3USDA 4G8MA 1PBPA 3IOTA 3C32A 1ZU0A 3SDFA 1JNFA 5AA2A 4BDOA 3UORA 4YZZA 1JQFA 3TTRA 2XD3A 3VE1B 5I56B 2THIA 1YPNA 4EQ9A 3VLVA 2H25A 4TQUQ 3R26A 1EZOA 4NF4A 4H8JA 4ZEFA 3TMGA 3FIRA 5H8NA 3PMVA 3ZKLA 1BP5A 4GL0A 1MY1A 4O3AA 1FQCA 3S9NC 5FHOA 1B3FA 1SI1A 1B52A 2DOJA 4RYAA 3CFZA 5KZTA 3KOTA 4ONYA 1MQJA 2Y7IA 1LCFA 4LA9A 2RC7A 3IK6B 2V25A 5EYFA 2AIXA 3MW0A 4JWYA 1B4HA 2UVGA 3H6UA 5CMCA 4ND9A 3SKPA 3TTLA 3KFMA 1CE2A 3ILUB 3IR1A 4F19A 1RKMA 2F78A 4EQBA 4QFLA 3IB1A 4U23A 2HEUA 2ZYOA 1CB6A 2I6EA 5DVIA 2DP8A 5AA3A 1HSLA 1NMUA 3VVEA 4KD5A 3EHSA 3PPPA 1POY1 4R74A 1FTKA 4KYSA 2R71A 4P11A 2O7IA 4PP0A 5BWJA 4BLAA 1SW1A 2V93A 4PFYA 4NWDA 4F1VA 4RJZA 2B3BA 3SESA 4R6YA 3UGWA 4G2ZA 4DCXA 1LGBC 4C1TA 1A7LA 2HZLA 3HSTA 1SW5A 1UTHA 5L9OA 4ELOA 1D9YA 2M8CA 4LUBA 3K1MA 1MRPA 2QJEA 4OXVA 5H8SA 1USYH 1N7XA 2GHAA 4YKJA 1BLFA 2O1LA 2VOZA 4X1DA 4BDLA 3OO6A 1Y4TA 4C0RA 5I59A 3H3GA 1RYXA 3IOUA 2F97A 3PUWE 5I84A 5EHSA 4KYDA 1II5A 4OMBA 4H6DA 1LFGA 4KHZE 2O7UA 1MY2A 4U1OA 1Q1KA 5AA2B 3PD8A 3W15C 5AE4A 1OVTA 1H44A 4KQPA 3ZSFA 2RC8A 1P1UA 3CVGA 4IO2A 1B32A 1MQGA 2B65A 2PVUA 5H8HA 1VFDA 2O68A 1FQBA 1B2HA 4KCCA 3R7XA 4POWA 1N0TA 3OD7A 3K2DA 3M3LA 2Y7RA 2DXYA 4MFIA 1JEUA 3EHTA 3F11A 3PU5A 3GBAA 2I48A 4THIA 3RNNA 2QL3A 3CRBA 4YB7A 3RLFE 3MZ9A 1A55A 1B7UA 1XS5A 4PFWA 4ZEBA 3S9MC 3K00A 1BKAA 2DS9A 2DWAA 1SYHA 3ILTB 3TCHA 3TTKA 4F3SA 2O6AA 2DQVA 2XXWA 3DM0A 2RCBA 1AH5A 2QS3A 3G3KA 3T9XB 3C31A 1N76A 1H76A 1MXWA 4GFRA 1O63A 3QXMA 3PUYE 3T96B 4F2QA 3FZVA 1FTOA 3EHUA 2Y7PA 4HW8A 2KLFA 3FATA 4NF8A 2QRYA 1NL5A 5AA1A 3RGYA 1M5EA 4RPNA 4X1BA 1M5BA 5HM4B 3CG3A 1MDP1 2V3TA 4M1VA 1J1NA 2XXYA 3OSRA 2ZYMA 1FTLA 3DP6A 2GRVA 4LQ5A 3RT8A 4FAJA 2ZMBA 1DOTA 5I57B 5JK4A 1SI0A 2UXAA 3HHGA 2UYEA 4R2BA 5K2YA 3E9XA 3GLBA 4F29A 4F3GA 3O2AA 2DWHA 1QKBA 4QHQA 5DTBA 3C36A 3G3HA 4HTGA 3LC8A 4IO7A 3CSBA 4FIMA 2Z22A 3JYRA 3Q29A 1USYE 3H4ZA 1FW0A 3FD3A 1B46A 4DE8A 4OEVA 3HV1A 4ZDMA 3RPWA 3UA8A 4JWOA 5DEXB 2OBGA 4YB6A 1US4A 1YAEA 4XKQA 1MS7A 4H5GA 3JV9A 3IX1A 1S9TA 4OQOA 5HPQA 1A8EA 1LLSA 4YU0A 3VDFA 3C33A 3ONMA 4G4PA 2F6GA 4EQ7A 3FXQA 1B9JA 4FORA 1GTKA 2DWJA 4GRKA 2Z23A 3FJMA 5ICTA 4PE5B 4DCYA 4Q5TA 3PUZE 1ZBMA 1FTMA 1UQWA 3E3KA 3PMWA 4OERA 3QYTA 1GVCA 3FXRA 2XXHA 1QKAA 3A3UA 2VD3A 4IO6A 3S2VA 1B3HA 3I3VA 1MG1A 1TXFA 5CM6A 1AMFA 3MC2A 3TCFA 4F31B 3B6WA 3R6UA 2XXPA 2V3QA 4NF5B 3N6UA 3UK4A 1R6ZA 2I3VA 3RUMA 3T93B 1I6BA 2O84X 3KEIA 4H1XA 4KCDA 4P0GA 2FNCA 4WXJA 1JEVA 3HHFA 3VVFA 3PPOA 3CFLA 2ZNSA 4IY5A 2QPQA 3IAZA 3LSFB 1IIWA 2I49A 2ONKE 4U4XA 3S4UA 1GGGA 4ZEKA 4XTCQ 3G3GA 4GQOA 1HSJA 3KOSA 1OQGA 1SYIA 1N3WA 3IB2A 2PBWA 3PD9A 3MVWA 1MXUA 4OWDA 1QJMA 4KI0E 5CRYA 3MP8A 2DSFA 2ZYKA 4EDPA 1QUKA 2NUVA 1MY0A 1RYOA 1LAXA 4YMAA 3ZS6A 1S50A 3L6HA 1ELJA 1D3KA 1ZJLA 4RK2A 3HN0A 4F3BA 4FE8A 4RY1A 2F7AA 4AB5A 4KR5A 4U21A 2VHAA 3GBBA 1URDA 2H4IA 4QFOA 4OVJA 3OOAA 2P2AA 1JVYA 2H99A 5ICQA 4ZZEA 2HZKA 2XXQA 4KPTA 3K6VA 4WEPA 5H8FB 2O51A 4ELPA 1Z7NE 3BBRA 1P1WA 4IO3A 2H9BA 1AL3A 1OIBA 1N3XA 3ZKKA 4N07A 3OEMA 1IXCA 1FCKA 1LAGE 1PB9A 1NNKA 2XX9A 2NWJA 1B40A 4GL8A 5DT6A 1IQ7A 3PMXA 4FATA 2A5TB 1XHYA 1FQEA 3G3JA 4XKPA 3W9VA 4P0IA 5ITOA 4PETA 2E0SA 1VR5A 3RN8A 3KJTA 3MJNA 2ALUA 5ISUA 2IA4A 4X9TA 1ATGA 5JTYA 2REGA 1XVXA 3H03A 4BDQA 2NXOA 2LAOA 4MLVA 2XXVA 1MXVA 1IEJA 2RF1A 3QIMA 1FQAA 2AL5A 4U4SA 2E1SA 1DSNA 4E0XA 3ECRA 2D5WA 4LONB 4AB6A 4IB2A 2OCUA 3U94A 3O97A 3Q27A 4IGRA 1A99A 2UVJA 1ANFA 1P1QA 1I69A 3E4RA 3K0VA 1D4NA 1TFAA 3U1OA 4HCYA 1F9BA 3IO6A 5TU0A 3IO4A 5J1DA 3P7IA 4ZZAA 2Y7KA 1ZMGA 2G93A 3VVDA 5I57A 3KN7A 2IEEA 3K6WA 4G8HA 3C34A 4LVQA 3PPRA 1ZLQA 3TQWA 3UN6A 1A8FA 1MY4A 4DIGA 3KZGA 1QW0A 1PB7A 1HSEA 5AA2D 1B7ZA 4HS7A 5DEXA 2ESNA 2AL4A 1JETA 4OFLA 2Q89A 4N13A 3U92A 5FHMA 3WAEA 2UVHA 3CG1A 2ZYNA 2PX1A 3MUQA 4F2OA 3K1NA 2VP1A 1B05A 2AYSA 5I2NB 4MF3A 2UVIA 4JWXA 3THIA 3MP6A 3Q26A 3W9WA 5CBSA 3HCQA 4GVOA 2GHBA 1BIYA 3C4MA 4EF1A 3T9HB 4RNSA 3O9PA 3IOWA 4DDDA 2DWIA 3O6HA 1SD3A 3RQTA 2F5XA 3MBPA 2Z8EA 1TFDA 2Y84A 4RA1A 5L9SA 4NF5A 2OWTA 4F1UA 3FGSA 3PPQA 1L5TA 4LZ7A 1TT1A 1EH3A 4I62A 2Z8DA 2QSXA 1MXXA 4F1YA 3ODBA 4G68B 1MQHA 1N04A 5ELVA 5JTYB 3UIFA 3FJ7A 4XIGQ 4OFJA 2F36A 1LBCA 4GXAA 2XXUA 4DXUA 2PT1A 2OJTA 3MVXA 4ZE8A 1FQFA 3FVOA 3KSXA 2V3UA 4JXIA 3N5LA 4WKMA 5FHNA 1XVYA 1MM7A 2BJJX 2GH9A 1SW2A 1DPPA 1P1OA 1IUDA 4I8CA 1B0HA 3QUJA 1JVXA 3O28A 2RINA 4I1DA 4QFNA 2XXXA 5AA4B 5L8DA 4ZS9A 1GR2A 4L17A 2VGQA 4PFTA 3MP1A 3KBRA 3VXCA 1MXYA 5EHMA 4LZ5A 4WEDA 5DYHA 4OEUA 1LBBA 3K1PA 2I3WA 4H5FA 4ZE9A 2B3FA 3T9UA 2X26A 1MPBA 3VLUA 2Q2CA 1KWHA 1AIVA 1IXHA 3MZBA 4G8NA 1O7TA 4GWOA 2ZNUA 3C9HA 4NMYA 4POXA 4MH5A 2I0CA 4NF6B 1R9QA 3SEYA 1B3EA 3LSXA 4C1UA 4R75A 5H8FA 1Y3QA 1POTA 1PDAA 4R6KA 2V84A 3PUVE 1OLAA 3EQ1A 3VLWA 3FXUA 5K2XA 1Y1MA 4Q8RA 4R9GA 1WVJA 1SQYA 3A3CA 1XC1A 4IY6A 3SEXA 3I5OA 2I58A 4H0WA 3OENA 3OO8A 3CFXA 3IB0A 4LZ8A 2H98A 2A5TA 5JEIA 4NEDA 3L6GA 4R2FA 3TPAA 4PFUA 4DXBA 3I6VA 3SEWA 4IO4A 4RK9A 4JDFA 3TKDA 3H6TA 5A5XB 2PT2A 1NKXA 3B7DA 1M5FA 1LAFE 5KDTA 2XXIA 3FVKA 4IGTA 4Z7EA 3O29A 2QMWA 4YICA 1VFEA 1OMPA 4DXCA 5M2VA 2HAVA 5I2KB 4RXLA 4OETA 5CC2A 3H6VA 4O3CA 1UIUA 2XD2A 4G77A 3BFUA 3TQLA 3CIJA 3TFLA 1SDXA 1B5HA 1FTJA 1N84A 3LSWA 2OWSA 3G3IA 1P99A 1I6QA 1VE4A 2RCAA 3IJOB 3U8QA 5H8QB 1LB9A 4GF8A 4JSDA 1Y1ZA 1MXZA 4ZEIA 4YAHX 1LCTA 1MQDA 3C35A 1B5JA 1NNTA 1B3LA 5IAIA 3AXFA 2X7PA 3QK6A 4DLDA 3GZGA 1YCJA 4YKPA 4U2RA 1US5A 3OSQA 1MQIA 4YB5A 3S9EA 1NH7A 2GFEA 5I2NA 3LBSA 2HQ0A 4F39A 3MPKA 4BDMA 1IZ1A 1EZ9A 3E13X 4NE4A 4ESXA 1JW4A 1LFIA 3SETA 4QFKA 3B6TA 1DTZA 2OLBA 2NOOA 3FVGA 2QS1A 2O69A 4LP2B 4QSEA 3RTFB 2WKYA 2ZNTA 2RC9A 3FASA 4DZ1A 3PPNA 4K3FA 4NTLA 3U93A 2F34A 3TYHA 1Z7ME 2R6GE 2ONSA 4OFOA 4GD5A 2DE3A 4EXKA 4FEBA 3PUXE 1LSTA 2H5YA 1AOVA 3PGFA 4G68A 5CI5A 4BDRA 3N94A 2Z8FA 3QAXA 1T0KA 4E0WA 2DVCA 2R9JA 5KDTB 3B6QA 3G7WA 1PEBA 3TEPA 4OENA 3MVYA 3WAFA 2QS4A 1DPEA 3JZJA 4Q0CA 2Q2AA 2D21A 3S9LC 1LB8A 4OZ9A 5DVJA 4F22A 3K6XA 3T22A 5I58B 1ZTYA 4Q30B 3EN3A 4M4GA 4ELRA 5TPAA 5FTIA 1Y20A 5AA4A 1N7WA 3V83A 3U72A 1OVBA 1B7HA 2O1MA 1MH3A 2FYIA 3G3FA 1FQDA 4JB7A 5ITPA 2DVZA 5TP9B 1MDQA 5KCJB 4G68C 3N26A 1SVXB 1DTGA 5BUUA 4KFQA 3TAJA 1B0LA 2HXWA 2DXRA 3IORA 2HFBA 3K02A 5F7VA 4TLLB 1S7YA 3LR1A 4ESWA 3K6UA 3TELA 3FV1A 1B6HA 2A5SA 1QUJA 2F8DA 3A09A 4O3BA 4NF6A 2HAUA 4OTEA 4GXSB 3VV5A 3RTWB 3M3KA 4JBZA 1P1NA 1H45A 1YTVA 2QS2A 4XXUA 3Q28A 1QULA 1NNPA 3OXNA 4AQ4A 1I6AA 1B5IA 1OQHA 4H8IA 3Q25A 3CR9A 1NNFA 4R9FA 2YLNA 3HO7A 3V89B 4LATA 5B70A 3CI8A 4R73A 1H43A 1Y3NA 3LUYA 3SEUA 1GV8A 4QF9A 4NF4B 4TOZA 4F3PA 2XXRA 3KG2A 3H7MA 3H06B 4ISUA 3K4UA 1B1HA 5H8NB 5LOMA 2RKMA 4ECFA 3TTNA 4QFPA 3TCGA 3PV0E 4TLMB 3V8XB 5A5XA 5CMKA 1R1NA 3FVNA 3M3FA 4EUOA 1B58A 2I4BA 1MPDA 1Y4CA 3HPIA 4EXLA 5HBCA 4OESA 1IITA 2CMOA 1H3DA 1BTJA 2PMSA 1B3GA 3O6IA 5CMBA 3MWBA 2NVUB 4YKIA 1Q35A 1EU8A 5I2KA 3EF7A 2XHDA 3D4GA 3TTMA 3MQ9A 3OO7A 4OHNA 3FUZA 2ONRA 4GIZA 1NH8A 1JW5A 2P1SA 4X48A 2DYXA 1ZIUA 4R6HA 3BFTA 2X7QA 3MVZA 5TPAB 4HCWA 5H8QA 2REJA 4F18A 4XKRA 3DP8A 5CBRA 2ABHA 3EPEA 3T66A 3KN8A 4U22A 4FJPA 5IKBA 2PYYA 1B4ZA 3LSLA 5B7DA 2OK2A 4ELQA 3DELB 3TUSA 1D9VA 2Q9TA 1UTBA 2I0BA 4H67A 3RY3A 1SBPA 1UTHB 3MAMA 3OO9A 2Y7WA 1A40A 3D4CA 5CMMA 4MBPA 3T9VA 3M8UA 1WDNA 4IO5A 2F35A 4XKNA 4GOTA 1LAHE 5I59B 2DE4A 3TDJA 3KSJA 5I56A 3O66A 1XT8A 1MPCA 1R9LA 2F6PA 2VD2A 3KGCA 2ZXTA 3UP9A 3CSGA 2P0SA 3DLNA 2XX7A 3V5AA 1PBQA 3OEKA 4GLIA 3TODA 2UYFA 1Y9UA 3H6WA 3QSLA 1B51A 1TWYA 4ZEDA 5H8HB 4YMBA 2YJPA 3DP4A 4MLQA 3VXBA 1QUIA 1PB8A 4UA8A 2G29A 4OYVA 3BKIB 4H65A 1WODA 2F7BA 5DVFA 2F7CA 3O6GA 3TZAA 3FJGA
chains in the Genus database with same CATH superfamily
1MM6A 4UACA 2DE2A 1M5CA 1DMBA 1NFTA 2FIXA 5L9MA 1B1XA 1MH4A 1XOCA 3KJ7A 4YKKA 4QRZA 2XX8A 2W7YA 2Q8JA 2Q8MA 1VSOA 4R72A 4U1ZA 1QVSA 2ANJA 4N6PA 5I58A 4I9DA 1URSA 4LQ2A 3IL1B 4QSCA 1LFHA 4QSDA 3MPLA 4FEDA 2PFZA 4PFRA 2QMXA 1AWBA 1ZKBA 1FBEA 2OZZA 3NOHA 2FVZA 4KYEA 2YPNA 5TP9A 4PBHA 5KCJA 4PDDA 2CZLA 3VFJA 3SEVA 4GBWA 5F1QA 1MY3A 1DCUA 3N6TA 1URGA 4PQJA 2XXTA 1IXIA 4FECA 1EZPA 2Q88A 2B4MA 4NF8B 3SERA 3K01A 2I4CA 1O64A 3OMBA 4NWCA 3IJXB 4EF2A 4NF0A 1SW4A 4I3YA 1IXGA 4PAIA 1UIVA 2D3IA 1PC3A 4Z0IA 3KN3A 1UTBB 4NN3A 1M5DA 4HE1A 4RPOA 5FTHA 2FA7A 4ZECA 3OELA 5LTCA 4GWZA 3QUFA 2HCAA 3FV2A 3GXAA 1A54A 1JW1A 4JSOA 3IOVA 1OLCA 4NX1A 1Y3PA 4BDNA 3MZ1A 3RT6B 3USDA 4G8MA 1PBPA 3IOTA 3C32A 1ZU0A 3SDFA 1JNFA 5AA2A 4BDOA 1RDZA 3UORA 4YZZA 1JQFA 3TTRA 2XD3A 3VE1B 5I56B 2THIA 1YPNA 1IMFA 4EQ9A 3VLVA 2H25A 4TQUQ 3R26A 1EZOA 4NF4A 4H8JA 4ZEFA 3TMGA 3FIRA 5H8NA 3PMVA 3ZKLA 1BP5A 1FJ9A 1MY1A 4GL0A 4O3AA 1FQCA 3S9NC 3BIGA 5FHOA 1B3FA 1SI1A 2F3DA 1B52A 2DOJA 4RYAA 3CFZA 5KZTA 3KOTA 4MCOA 4ONYA 1MQJA 2Y7IA 1LCFA 4LA9A 2RC7A 3IK6B 2V25A 5EYFA 2AIXA 3MW0A 4JWYA 1B4HA 1G0HA 2UVGA 3H6UA 5LDZA 5CMCA 4ND9A 3SKPA 3TTLA 3KFMA 1CE2A 3ILUB 3IR1A 2OWZA 4F19A 1RKMA 2F78A 4EQBA 4PDHA 2FIEA 4QFLA 3IB1A 4X8RA 4U23A 2HEUA 2ZYOA 1CB6A 2I6EA 5DVIA 2VT5A 2DP8A 2GQ1A 5AA3A 1HSLA 1NMUA 3VVEA 4KD5A 3EHSA 3PPPA 1POY1 4OVPA 4R74A 1FTKA 4KYSA 2R71A 3PTYA 4P11A 5EYGA 2O7IA 4PP0A 5BWJA 4BLAA 1SW1A 5ET7A 2V93A 4PFYA 4NWDA 4F1VA 4RJZA 2B3BA 2WBDA 3MYUA 3SESA 4R6YA 2HXRA 3UGWA 4G2ZA 1EYKA 4DCXA 1LGBC 4C1TA 2ZZWA 1A7LA 2HZLA 3HSTA 1SW5A 5DW8A 1UTHA 5L9OA 4ELOA 2CZKA 1D9YA 2M8CA 4LUBA 3K1MA 1MRPA 2QJEA 4OXVA 5H8SA 1USYH 1N7XA 2GHAA 4YKJA 1BLFA 2O1LA 2VOZA 4X1DA 4BDLA 3OO6A 1Y4TA 1NV0A 4C0RA 5I59A 3H3GA 1RYXA 3IOUA 3QMFA 4O7IA 2F97A 3PUWE 5I84A 5EHSA 4KYDA 1II5A 4OMBA 4H6DA 4PF8A 1LFGA 4KHZE 2O7UA 1MY2A 1KA1A 4U1OA 1Q1KA 5AA2B 2Y5LA 3PD8A 3W15C 5AE4A 1OVTA 4MNIA 1H44A 4KQPA 1KA0A 3ZSFA 1YYZA 2RC8A 1P1UA 3CVGA 4IO2A 1B32A 1MQGA 2B65A 2PVUA 5H8HA 1VFDA 2O68A 1FQBA 1B2HA 4KCCA 3R7XA 4POWA 2WBBA 1N0TA 3OD7A 1LBYA 3K2DA 3M3LA 2Y7RA 4G61A 2DXYA 4MFIA 1JEUA 3EHTA 3F11A 1EYIA 4HE0A 3PU5A 4NAPA 1YXIA 3GBAA 2I48A 4THIA 3RNNA 2QL3A 3CRBA 2XWVA 4YB7A 3MZ9A 3RLFE 1A55A 1B7UA 1XS5A 4PFWA 4ZEBA 3S9MC 3K00A 1BKAA 2DS9A 2DWAA 4AS4A 1SYHA 3ILTB 1NUZA 3TCHA 3TTKA 3CHGA 4F3SA 2O6AA 2DQVA 2XXWA 3DM0A 3T0JA 2RCBA 1AH5A 2QS3A 3G3KA 3FXBA 1DK4A 4P1EA 5EQ7A 3T9XB 3C31A 1N76A 1H76A 1MXWA 1QGXA 4GFRA 4JVCA 1O63A 4N8GA 2WYPA 3QXMA 3PUYE 3T96B 4N17A 4F2QA 4GX3A 4NGUA 3FZVA 1FTOA 3EHUA 2Y7PA 4HW8A 4MX6A 2KLFA 3FATA 4MAGA 4NF8A 2QRYA 4OVRA 1NL5A 5AA1A 3RGYA 1M5EA 2XWKA 4RPNA 4X1BA 1LBVA 1M5BA 5HM4B 3CG3A 1MDP1 2V3TA 4M1VA 1J1NA 2XXYA 3OSRA 1RDYA 2ZYMA 1FTLA 3DP6A 2GRVA 4LQ5A 3RT8A 4FAJA 2ZMBA 1DOTA 5I57B 5JK4A 1SI0A 2UXAA 3HHGA 2UYEA 3D1RA 4R2BA 5K2YA 3E9XA 3GLBA 4F29A 2FBPA 4F3GA 1FBDA 3O2AA 2DWHA 1QKBA 4QHQA 5DTBA 3C36A 3G3HA 4HTGA 2XA5A 3LC8A 4IO7A 3KC1A 3CSBA 4FIMA 2Z22A 2CEXA 3JYRA 3Q29A 1USYE 3H4ZA 2HPGA 1FW0A 3FD3A 1B46A 2L5VA 4DE8A 4OEVA 3HV1A 4ZDMA 3RPWA 3UA8A 4JWOA 5DEXB 2OBGA 4YB6A 1US4A 1YAEA 4XKQA 1MS7A 4H5GA 3JV9A 3IX1A 1S9TA 4OQOA 1FBHA 4NQ8A 5HPQA 1A8EA 1LLSA 4P56A 4YU0A 3VDFA 1FTAA 2QVVA 3C33A 1FPDA 3ONMA 2F6GA 4G4PA 4EQ7A 3FXQA 1B9JA 4FORA 4XEQA 1GTKA 1XI6A 2DWJA 4N4UA 4GRKA 2Z23A 3FJMA 5ICTA 4PE5B 4DCYA 1FBCA 4Q5TA 3PUZE 1ZBMA 1FTMA 1UQWA 3E3KA 5EQ9A 3PMWA 4OERA 3QYTA 1GVCA 3FXRA 2XXHA 3LV0A 1QKAA 3A3UA 2VD3A 4IO6A 3S2VA 1B3HA 3I3VA 1MG1A 1TXFA 5CM6A 1AMFA 3MC2A 3TCFA 4F31B 3B6WA 3R6UA 2XXPA 2V3QA 4NF5B 3N6UA 3UK4A 4H46A 1FBPA 1R6ZA 2I3VA 3RUMA 3T93B 1I6BA 1LBZA 5I7IA 2O84X 3KEIA 1IMDA 4H1XA 4KCDA 4P0GA 2FNCA 4WXJA 1JEVA 3HHFA 1RDXA 3VVFA 2XWOA 3PPOA 3CFLA 2ZNSA 4IY5A 4O8MA 2QPQA 3IAZA 3LSFB 1IIWA 2I49A 2ONKE 4P3LA 4U4XA 3S4UA 4MMPA 3B8BA 2Y5KA 2KQZA 1GGGA 4ZEKA 4XTCQ 3G3GA 4GQOA 2VPNA 1HSJA 3KOSA 4XFEA 1OQGA 1SYIA 1N3WA 3IB2A 2Q74A 2PBWA 4NHBA 3PD9A 4OVQA 3MVWA 1MXUA 4OWDA 1QJMA 4KI0E 3ROJA 5CRYA 3MP8A 2DSFA 2ZYKA 4EDPA 1QUKA 2BJIA 4N8YA 2NUVA 1MY0A 1RYOA 1LAXA 4YMAA 3ZS6A 1S50A 3IFCA 3L6HA 1ELJA 4OVSA 1D3KA 1ZJLA 4RK2A 3HN0A 4F3BA 4FE8A 4RY1A 2F7AA 4AB5A 4KR5A 4U21A 2VHAA 4OANA 3GBBA 1URDA 4GWUA 1VDWA 2H4IA 4QFOA 4OVJA 3OOAA 2P2AA 1JVYA 2H99A 5ICQA 4ZZEA 4PTKA 2HZKA 2XXQA 4KPTA 3K6VA 4WEPA 5H8FB 2O51A 4ELPA 1Z7NE 3BBRA 1P1WA 4IO3A 2H9BA 1AL3A 1OIBA 3HFUA 1N3XA 3ZKKA 4N07A 3OEMA 1IXCA 1FCKA 1LAGE 1PB9A 4OA4A 1NNKA 2XX9A 2NWJA 1B40A 2MKZA 4GL8A 5DT6A 1IQ7A 3PMXA 4FATA 2A5TB 1XHYA 1FQEA 3G3JA 4XKPA 3W9VA 4P0IA 1NI9A 5ITOA 4PETA 2E0SA 1VR5A 3RN8A 1FPKA 3KJTA 3MJNA 2ALUA 5ISUA 2IA4A 4X9TA 1ATGA 5JTYA 2REGA 1XVXA 3H03A 4BDQA 2NXOA 2LAOA 4MLVA 2XXVA 1MXVA 1IEJA 2RF1A 3QIMA 1FQAA 2AL5A 4JVDA 4U4SA 2E1SA 1DSNA 4E0XA 3ECRA 3E78A 2D5WA 1NV5A 1DBZA 4LONB 4AB6A 4IB2A 2OCUA 4MNPA 3U94A 3O97A 3Q27A 5EYHA 4IGRA 5IZ1A 1A99A 2UVJA 1ANFA 1P1QA 1I69A 3E4RA 3K0VA 1FPBA 1D4NA 1TFAA 3U1OA 4KXPA 4HCYA 4O7MA 1F9BA 1FSAA 3IO6A 2CEYA 5TU0A 1BK4A 3IO4A 5J1DA 3P7IA 4ZZAA 2Y7KA 1ZMGA 2G93A 3LUZA 3VVDA 4OVTA 5I57A 3KN7A 2IEEA 3K6WA 4G8HA 3C34A 4LVQA 3PPRA 1ZLQA 3TQWA 1NUYA 3UN6A 1A8FA 1MY4A 4MHFA 4DIGA 3KZGA 1QW0A 1PB7A 1HSEA 4I40A 5AA2D 5IM2A 1B7ZA 4HS7A 1FRPA 5DEXA 2ESNA 2AL4A 1JETA 4OFLA 2Q89A 4N13A 3U92A 5FHMA 3WAEA 2UVHA 3CG1A 4GX6A 2ZYNA 5I3SA 2PX1A 3MUQA 4F2OA 3K1NA 2VP1A 4GBVA 1B05A 2AYSA 5I2NB 4MF3A 2UVIA 4JWXA 3THIA 3MP6A 3Q26A 3W9WA 5CBSA 3HCQA 4GVOA 2JJKA 2GHBA 1BIYA 3C4MA 4EF1A 4PAFA 3T9HB 4RNSA 3O9PA 3IOWA 4DDDA 2DWIA 3O6HA 1SD3A 3RQTA 2F5XA 3MBPA 2Z8EA 1TFDA 2Y84A 4RA1A 1Q9DA 4GWYA 5L9SA 4NF5A 2DDKA 2OWTA 4F1UA 3FGSA 3PPQA 1L5TA 4LZ7A 1TT1A 1EH3A 5IZZA 4I62A 2Z8DA 2QSXA 1MXXA 4F1YA 3ODBA 4G68B 1MQHA 1N04A 4PC9A 5ELVA 5JTYB 3UIFA 3FJ7A 4XIGQ 4OFJA 3RPLB 2F36A 1LBCA 4GXAA 2XXUA 4DXUA 2PT1A 2OJTA 3MVXA 1FPFA 2FHYA 4ZE8A 2XXKA 4GX4A 1FQFA 3FVOA 3KSXA 5IZ3B 2V3UA 4JXIA 3N5LA 4WKMA 5FHNA 1XVYA 1MM7A 2BJJX 2GH9A 1SW2A 1DPPA 1P1OA 4N91A 1IUDA 4I8CA 1B0HA 1EYJA 1JVXA 3QUJA 1JP4A 3O28A 2RINA 4I1DA 2XWIA 4P47A 4QFNA 2XXXA 4P9KA 5AA4B 5L8DA 4ZS9A 1GR2A 3ISPA 4HE2A 4L17A 2VGQA 4PFTA 3U65A 2B4LA 3MP1A 3KBRA 4N6DA 1FJ6A 3VXCA 1MXYA 5EHMA 4LZ5A 4WEDA 5DYHA 4HXVA 2HHMA 4OEUA 1LBBA 4O94A 3K1PA 2I3WA 4H5FA 4ZE9A 2B3FA 3T9UA 2X26A 1MPBA 3VLUA 2Q2CA 1KWHA 1AIVA 1IXHA 3MZBA 4G8NA 1O7TA 4GWOA 2ZNUA 3C9HA 4NMYA 4P8BA 4POXA 4MH5A 2I0CA 4GWXA 4NF6B 1R9QA 3SEYA 3T1BA 1B3EA 3LSXA 4C1UA 4R75A 2F3BA 5H8FA 1Y3QA 2V4CA 1POTA 1PDAA 4R6KA 1K9YA 2V84A 3PUVE 1OLAA 3EQ1A 3VLWA 3FXUA 5K2XA 1Y1MA 4Q8RA 4R9GA 4UABA 2QVUA 1WVJA 1SQYA 3A3CA 1XC1A 5ESYA 3A29A 4DI3D 4IY6A 1LBXA 3SEXA 3I5OA 2I58A 4H0WA 3OENA 3OO8A 3CFXA 3IB0A 4LZ8A 2H98A 2A5TA 5JEIA 4NEDA 3L6GA 4R2FA 3TPAA 1D9QA 1NUWA 4PFUA 4DXBA 3I6VA 3SEWA 4IO4A 4RK9A 2CZIA 1IMAA 4JDFA 3TKDA 5J16A 3H6TA 5A5XB 2PT2A 1NKXA 3B7DA 1M5FA 1LAFE 5KDTA 2WX9A 2XXIA 3FVKA 4IGTA 4Z7EA 5ET6A 3O29A 2QMWA 3FBPA 4AS5A 4YICA 1VFEA 1OMPA 3SZPA 4DXCA 5M2VA 2HAVA 1FBFA 1FPLA 5I2KB 4RXLA 4OETA 5CC2A 4GWSA 3H6VA 4O3CA 4IR8A 1UIUA 2XD2A 4G77A 3BFUA 3TQLA 4N6KA 3CIJA 3TFLA 1SDXA 2OX3A 1B5HA 1FTJA 1N84A 3LSWA 4NG7A 4XF5A 5IGAA 2OWSA 3G3IA 1P99A 1I6QA 3KC0A 1VE4A 2RCAA 3IJOB 3U8QA 1INPA 5H8QB 4MNCA 1LB9A 1NV7A 4GF8A 4JSDA 1Y1ZA 1MXZA 4LN5A 4ZEIA 1NV2A 4YAHX 1LCTA 1MQDA 1NV4A 3C35A 1B5JA 1NNTA 1B3LA 1KZ8A 5IAIA 3AXFA 2X7PA 3QK6A 4DLDA 3GZGA 1YCJA 4YKPA 4U2RA 1US5A 3OSQA 1MQIA 4YB5A 3S9EA 1NH7A 2WEFA 4GWWA 4PFBA 2GFEA 1IMEA 5I2NA 3EKIA 3LBSA 2HQ0A 4F39A 3MPKA 4BDMA 1IZ1A 1EZ9A 3E13X 4NE4A 4ESXA 1JW4A 4MEVA 1LFIA 3SETA 4QFKA 1IMCA 3B6TA 1DTZA 2OLBA 2NOOA 3FVGA 2QS1A 2O69A 1NUXA 4LP2B 4QSEA 3RTFB 2WKYA 2ZNTA 2RC9A 1CNQA 2QFLA 3FASA 4DZ1A 3PPNA 4K3FA 4NTLA 3U93A 5I5PA 2F34A 3TYHA 1Z7ME 5A5LA 2R6GE 2ONSA 2CZHA 4OFOA 4GD5A 3E79A 2DE3A 1YZ0A 4EXKA 4FEBA 3PUXE 1LSTA 2H5YA 1AOVA 2VPOA 3PGFA 4G68A 5CI5A 4BDRA 3N94A 2Z8FA 3QAXA 1T0KA 4E0WA 2DVCA 3RPLA 2R9JA 4H45A 5KDTB 3B6QA 1K9ZA 3G7WA 1PEBA 3TEPA 4MJOA 4OENA 3MVYA 3WAFA 2QS4A 5IZ3A 1DPEA 3JZJA 4Q0CA 2Q2AA 2D21A 4MIJA 3S9LC 1LB8A 4OZ9A 5DVJA 4F22A 3K6XA 3T22A 5I58B 1ZTYA 1FBGA 3EN3A 4Q30B 4M4GA 4ELRA 5TPAA 5FTIA 1Y20A 2PFYA 5AA4A 1N7WA 4FBPA 3V83A 3U72A 1OVBA 1B7HA 2O1MA 1MH3A 2PCRA 2QVRA 2FYIA 3G3FA 1FQDA 4JB7A 5ITPA 2DVZA 5TP9B 1MDQA 5KCJB 4G68C 5ET5A 3N26A 1SVXB 3B50A 1DTGA 1NV1A 5BUUA 4KFQA 3TAJA 1B0LA 2HXWA 5FBPA 2DXRA 3BIHA 3IORA 2HFBA 3RYDA 3K02A 3MSTA 5F7VA 4TLLB 1S7YA 3LR1A 4ESWA 3K6UA 1IMBA 4PBQA 3TELA 3FV1A 1B6HA 2A5SA 1SPIA 1QUJA 2F8DA 4PCDA 3A09A 4X04A 4O3BA 4NF6A 2HAUA 4OTEA 4GXSB 5EQ8A 3VV5A 4QBAA 3RTWB 3M3KA 4JBZA 1P1NA 1H45A 1YTVA 2QS2A 4XXUA 3Q28A 3GYYA 1QULA 1NNPA 3OXNA 4AQ4A 1LEVA 1I6AA 1FPGA 4PE3A 1B5IA 1OQHA 4H8IA 3Q25A 3CR9A 1NNFA 4R9FA 2YLNA 3HO7A 3V89B 4LATA 5B70A 1NV3A 3CI8A 4R73A 1H43A 4JVIA 1Y3NA 3LUYA 3SEUA 1GV8A 4QF9A 5F24A 4NF4B 4TOZA 4F3PA 2XXRA 3KG2A 3H7MA 3H06B 4ISUA 3K4UA 1B1HA 5H8NB 5LOMA 2RKMA 1NV6A 4ECFA 3TTNA 2R8TA 4QFPA 3TCGA 3PV0E 4TLMB 3V8XB 5A5XA 5CMKA 1R1NA 3FVNA 3M3FA 4EUOA 1B58A 2I4BA 1MPDA 1Y4CA 3HPIA 4EXLA 5HBCA 2P3VA 3KBZA 4OESA 1IITA 4PFIA 4QXDA 2CMOA 1H3DA 1BTJA 1G0IA 2PMSA 1B3GA 3O6IA 5CMBA 3MWBA 5EQAA 2NVUB 4YKIA 1Q35A 1EU8A 5ET8A 5I2KA 3EF7A 2XHDA 3D4GA 2KR0A 3TTMA 3MQ9A 3OO7A 4OHNA 4PGPA 3FUZA 1LBWA 2ONRA 4GIZA 1NH8A 4PGNA 1JW5A 2P1SA 4X48A 2DYXA 1ZIUA 4R6HA 3BFTA 2WYKA 2X7QA 3MVZA 5TPAB 4HCWA 5H8QA 2REJA 4F18A 4XKRA 3DP8A 5CBRA 2ABHA 3EPEA 4N15A 3T66A 3KN8A 4U22A 4N81A 4PAKA 4FJPA 5IKBA 2P3NA 2PYYA 1B4ZA 4P1LA 3LSLA 5B7DA 2OK2A 4ELQA 1FPJA 3DELB 3TUSA 2ZZVA 1D9VA 5T3JA 2Q9TA 1UTBA 2I0BA 4H67A 4PF6A 2ZZXA 3RY3A 1SBPA 1UTHB 3MAMA 3OO9A 2Y7WA 1A40A 3D4CA 1FPIA 5CMMA 4MBPA 3T9VA 3M8UA 1WDNA 4IO5A 2F35A 4XKNA 4GOTA 1LAHE 5I59B 2DE4A 3TDJA 3KSJA 5I56A 4DI4B 3O66A 1XT8A 1MPCA 1R9LA 2F6PA 2VD2A 3KGCA 2ZXTA 4I3EA 3UP9A 3CSGA 2P0SA 3DLNA 2XX7A 3V5AA 1PBQA 3OEKA 4GLIA 1FPEA 3TODA 2UYFA 1Y9UA 3H6WA 3QSLA 1B51A 1TWYA 4ZEDA 5H8HB 4YMBA 2YJPA 3DP4A 4MLQA 3VXBA 1QUIA 1PB8A 4UA8A 2G29A 4OYVA 3BKIB 4H65A 1WODA 2F7BA 3IFAA 5DVFA 2F7CA 3O6GA 3TZAA 3FJGA
chains in the Genus database with same CATH topology
1MM6A 4UACA 2DE2A 1M5CA 1DMBA 1NFTA 5L9MA 1B1XA 1MH4A 1XOCA 3KJ7A 4YKKA 4QRZA 2XX8A 2W7YA 2Q8JA 1VSOA 4R72A 4U1ZA 1QVSA 2ANJA 4N6PA 5I58A 4I9DA 1URSA 4LQ2A 3IL1B 4QSCA 1LFHA 3MPLA 4QSDA 4FEDA 2QMXA 1ZKBA 2OZZA 4KYEA 2YPNA 5TP9A 5KCJA 2CZLA 3VFJA 3SEVA 5F1QA 1MY3A 3N6TA 1URGA 4PQJA 2XXTA 1IXIA 4FECA 1EZPA 2Q88A 4NF8B 3SERA 3K01A 2I4CA 1O64A 3OMBA 4NWCA 3IJXB 4EF2A 1SW4A 1IXGA 1UIVA 2D3IA 1PC3A 4Z0IA 3KN3A 1UTBB 1M5DA 4RPOA 5FTHA 2FA7A 4ZECA 3OELA 3QUFA 2HCAA 3FV2A 3GXAA 1A54A 1JW1A 4JSOA 3IOVA 1OLCA 1Y3PA 4BDNA 3MZ1A 3RT6B 3USDA 4G8MA 1PBPA 3IOTA 3C32A 1ZU0A 3SDFA 1JNFA 5AA2A 4BDOA 3UORA 4YZZA 1JQFA 3TTRA 2XD3A 3VE1B 5I56B 2THIA 1YPNA 4EQ9A 3VLVA 2H25A 4TQUQ 3R26A 1EZOA 4NF4A 4H8JA 4ZEFA 3TMGA 3FIRA 5H8NA 3PMVA 3ZKLA 1BP5A 4GL0A 1MY1A 4O3AA 1FQCA 3S9NC 5FHOA 1B3FA 1SI1A 1B52A 2DOJA 4RYAA 3CFZA 5KZTA 3KOTA 4ONYA 1MQJA 2Y7IA 1LCFA 4LA9A 2RC7A 3IK6B 2V25A 5EYFA 2AIXA 3MW0A 4JWYA 1B4HA 2UVGA 3H6UA 5CMCA 4ND9A 3SKPA 3TTLA 3KFMA 1CE2A 3ILUB 3IR1A 4F19A 1RKMA 2F78A 4EQBA 4QFLA 3IB1A 4U23A 2HEUA 2ZYOA 1CB6A 2I6EA 5DVIA 2DP8A 5AA3A 1HSLA 1NMUA 3VVEA 4KD5A 3EHSA 3PPPA 1POY1 4R74A 1FTKA 4KYSA 2R71A 4P11A 2O7IA 4PP0A 5BWJA 4BLAA 1SW1A 2V93A 4PFYA 4NWDA 4F1VA 4RJZA 2B3BA 3SESA 4R6YA 3UGWA 4G2ZA 4DCXA 1LGBC 4C1TA 1A7LA 2HZLA 3HSTA 1SW5A 1UTHA 5L9OA 4ELOA 1D9YA 2M8CA 4LUBA 3K1MA 1MRPA 2QJEA 4OXVA 5H8SA 1USYH 1N7XA 2GHAA 4YKJA 1BLFA 2O1LA 2VOZA 4X1DA 4BDLA 3OO6A 1Y4TA 4C0RA 5I59A 3H3GA 1RYXA 3IOUA 2F97A 3PUWE 5I84A 5EHSA 4KYDA 1II5A 4OMBA 4H6DA 1LFGA 4KHZE 2O7UA 1MY2A 4U1OA 1Q1KA 5AA2B 3PD8A 3W15C 5AE4A 1OVTA 1H44A 4KQPA 3ZSFA 2RC8A 1P1UA 3CVGA 4IO2A 1B32A 1MQGA 2B65A 2PVUA 5H8HA 1VFDA 2O68A 1FQBA 1B2HA 4KCCA 3R7XA 4POWA 1N0TA 3OD7A 3K2DA 3M3LA 2Y7RA 2DXYA 4MFIA 1JEUA 3EHTA 3F11A 3PU5A 3GBAA 2I48A 4THIA 3RNNA 2QL3A 3CRBA 4YB7A 3RLFE 3MZ9A 1A55A 1B7UA 1XS5A 4PFWA 4ZEBA 3S9MC 3K00A 1BKAA 2DS9A 2DWAA 1SYHA 3ILTB 3TCHA 3TTKA 4F3SA 2O6AA 2DQVA 2XXWA 3DM0A 2RCBA 1AH5A 2QS3A 3G3KA 3T9XB 3C31A 1N76A 1H76A 1MXWA 4GFRA 1O63A 3QXMA 3PUYE 3T96B 4F2QA 3FZVA 1FTOA 3EHUA 2Y7PA 4HW8A 2KLFA 3FATA 4NF8A 2QRYA 1NL5A 5AA1A 3RGYA 1M5EA 4RPNA 4X1BA 1M5BA 5HM4B 3CG3A 1MDP1 2V3TA 4M1VA 1J1NA 2XXYA 3OSRA 2ZYMA 1FTLA 3DP6A 2GRVA 4LQ5A 3RT8A 4FAJA 2ZMBA 1DOTA 5I57B 5JK4A 1SI0A 2UXAA 3HHGA 2UYEA 4R2BA 5K2YA 3E9XA 3GLBA 4F29A 4F3GA 3O2AA 2DWHA 1QKBA 4QHQA 5DTBA 3C36A 3G3HA 4HTGA 3LC8A 4IO7A 3CSBA 4FIMA 2Z22A 3JYRA 3Q29A 1USYE 3H4ZA 1FW0A 3FD3A 1B46A 4DE8A 4OEVA 3HV1A 4ZDMA 3RPWA 3UA8A 4JWOA 5DEXB 2OBGA 4YB6A 1US4A 1YAEA 4XKQA 1MS7A 4H5GA 3JV9A 3IX1A 1S9TA 4OQOA 5HPQA 1A8EA 1LLSA 4YU0A 3VDFA 3C33A 3ONMA 4G4PA 2F6GA 4EQ7A 3FXQA 1B9JA 4FORA 1GTKA 2DWJA 4GRKA 2Z23A 3FJMA 5ICTA 4PE5B 4DCYA 4Q5TA 3PUZE 1ZBMA 1FTMA 1UQWA 3E3KA 3PMWA 4OERA 3QYTA 1GVCA 3FXRA 2XXHA 1QKAA 3A3UA 2VD3A 4IO6A 3S2VA 1B3HA 3I3VA 1MG1A 1TXFA 5CM6A 1AMFA 3MC2A 3TCFA 4F31B 3B6WA 3R6UA 2XXPA 2V3QA 4NF5B 3N6UA 3UK4A 1R6ZA 2I3VA 3RUMA 3T93B 1I6BA 2O84X 3KEIA 4H1XA 4KCDA 4P0GA 2FNCA 4WXJA 1JEVA 3HHFA 3VVFA 3PPOA 3CFLA 2ZNSA 4IY5A 2QPQA 3IAZA 3LSFB 1IIWA 2I49A 2ONKE 4U4XA 3S4UA 1GGGA 4ZEKA 4XTCQ 3G3GA 4GQOA 1HSJA 3KOSA 1OQGA 1SYIA 1N3WA 3IB2A 2PBWA 3PD9A 3MVWA 1MXUA 4OWDA 1QJMA 4KI0E 5CRYA 3MP8A 2DSFA 2ZYKA 4EDPA 1QUKA 2NUVA 1MY0A 1RYOA 1LAXA 4YMAA 3ZS6A 1S50A 3L6HA 1ELJA 1D3KA 1ZJLA 4RK2A 3HN0A 4F3BA 4FE8A 4RY1A 2F7AA 4AB5A 4KR5A 4U21A 2VHAA 3GBBA 1URDA 2H4IA 4QFOA 4OVJA 3OOAA 2P2AA 1JVYA 2H99A 5ICQA 4ZZEA 2HZKA 2XXQA 4KPTA 3K6VA 4WEPA 5H8FB 2O51A 4ELPA 1Z7NE 3BBRA 1P1WA 4IO3A 2H9BA 1AL3A 1OIBA 1N3XA 3ZKKA 4N07A 3OEMA 1IXCA 1FCKA 1LAGE 1PB9A 1NNKA 2XX9A 2NWJA 1B40A 4GL8A 5DT6A 1IQ7A 3PMXA 4FATA 2A5TB 1XHYA 1FQEA 3G3JA 4XKPA 3W9VA 4P0IA 5ITOA 4PETA 2E0SA 1VR5A 3RN8A 3KJTA 3MJNA 2ALUA 5ISUA 2IA4A 4X9TA 1ATGA 5JTYA 2REGA 1XVXA 3H03A 4BDQA 2NXOA 2LAOA 4MLVA 2XXVA 1MXVA 1IEJA 2RF1A 3QIMA 1FQAA 2AL5A 4U4SA 2E1SA 1DSNA 4E0XA 3ECRA 2D5WA 4LONB 4AB6A 4IB2A 2OCUA 3U94A 3O97A 3Q27A 4IGRA 1A99A 2UVJA 1ANFA 1P1QA 1I69A 3E4RA 3K0VA 1D4NA 1TFAA 3U1OA 4HCYA 1F9BA 3IO6A 5TU0A 3IO4A 5J1DA 3P7IA 4ZZAA 2Y7KA 1ZMGA 2G93A 3VVDA 5I57A 3KN7A 2IEEA 3K6WA 4G8HA 3C34A 4LVQA 3PPRA 1ZLQA 3TQWA 3UN6A 1A8FA 1MY4A 4DIGA 3KZGA 1QW0A 1PB7A 1HSEA 5AA2D 1B7ZA 4HS7A 5DEXA 2ESNA 2AL4A 1JETA 4OFLA 2Q89A 4N13A 3U92A 5FHMA 3WAEA 2UVHA 3CG1A 2ZYNA 2PX1A 3MUQA 4F2OA 3K1NA 2VP1A 1B05A 2AYSA 5I2NB 4MF3A 2UVIA 4JWXA 3THIA 3MP6A 3Q26A 3W9WA 5CBSA 3HCQA 4GVOA 2GHBA 1BIYA 3C4MA 4EF1A 3T9HB 4RNSA 3O9PA 3IOWA 4DDDA 2DWIA 3O6HA 1SD3A 3RQTA 2F5XA 3MBPA 2Z8EA 1TFDA 2Y84A 4RA1A 5L9SA 4NF5A 2OWTA 4F1UA 3FGSA 3PPQA 1L5TA 4LZ7A 1TT1A 1EH3A 4I62A 2Z8DA 2QSXA 1MXXA 4F1YA 3ODBA 4G68B 1MQHA 1N04A 5ELVA 5JTYB 3UIFA 3FJ7A 4XIGQ 4OFJA 2F36A 1LBCA 4GXAA 2XXUA 4DXUA 2PT1A 2OJTA 3MVXA 4ZE8A 1FQFA 3FVOA 3KSXA 2V3UA 4JXIA 3N5LA 4WKMA 5FHNA 1XVYA 1MM7A 2BJJX 2GH9A 1SW2A 1DPPA 1P1OA 1IUDA 4I8CA 1B0HA 3QUJA 1JVXA 3O28A 2RINA 4I1DA 4QFNA 2XXXA 5AA4B 5L8DA 4ZS9A 1GR2A 4L17A 2VGQA 4PFTA 3MP1A 3KBRA 3VXCA 1MXYA 5EHMA 4LZ5A 4WEDA 5DYHA 4OEUA 1LBBA 3K1PA 2I3WA 4H5FA 4ZE9A 2B3FA 3T9UA 2X26A 1MPBA 3VLUA 2Q2CA 1KWHA 1AIVA 1IXHA 3MZBA 4G8NA 1O7TA 4GWOA 2ZNUA 3C9HA 4NMYA 4POXA 4MH5A 2I0CA 4NF6B 1R9QA 3SEYA 1B3EA 3LSXA 4C1UA 4R75A 5H8FA 1Y3QA 1POTA 1PDAA 4R6KA 2V84A 3PUVE 1OLAA 3EQ1A 3VLWA 3FXUA 5K2XA 1Y1MA 4Q8RA 4R9GA 1WVJA 1SQYA 3A3CA 1XC1A 4IY6A 3SEXA 3I5OA 2I58A 4H0WA 3OENA 3OO8A 3CFXA 3IB0A 4LZ8A 2H98A 2A5TA 5JEIA 4NEDA 3L6GA 4R2FA 3TPAA 4PFUA 4DXBA 3I6VA 3SEWA 4IO4A 4RK9A 4JDFA 3TKDA 3H6TA 5A5XB 2PT2A 1NKXA 3B7DA 1M5FA 1LAFE 5KDTA 2XXIA 3FVKA 4IGTA 4Z7EA 3O29A 2QMWA 4YICA 1VFEA 1OMPA 4DXCA 5M2VA 2HAVA 5I2KB 4RXLA 4OETA 5CC2A 3H6VA 4O3CA 1UIUA 2XD2A 4G77A 3BFUA 3TQLA 3CIJA 3TFLA 1SDXA 1B5HA 1FTJA 1N84A 3LSWA 2OWSA 3G3IA 1P99A 1I6QA 1VE4A 2RCAA 3IJOB 3U8QA 5H8QB 1LB9A 4GF8A 4JSDA 1Y1ZA 1MXZA 4ZEIA 4YAHX 1LCTA 1MQDA 3C35A 1B5JA 1NNTA 1B3LA 5IAIA 3AXFA 2X7PA 3QK6A 4DLDA 3GZGA 1YCJA 4YKPA 4U2RA 1US5A 3OSQA 1MQIA 4YB5A 3S9EA 1NH7A 2GFEA 5I2NA 3LBSA 2HQ0A 4F39A 3MPKA 4BDMA 1IZ1A 1EZ9A 3E13X 4NE4A 4ESXA 1JW4A 1LFIA 3SETA 4QFKA 3B6TA 1DTZA 2OLBA 2NOOA 3FVGA 2QS1A 2O69A 4LP2B 4QSEA 3RTFB 2WKYA 2ZNTA 2RC9A 3FASA 4DZ1A 3PPNA 4K3FA 4NTLA 3U93A 2F34A 3TYHA 1Z7ME 2R6GE 2ONSA 4OFOA 4GD5A 2DE3A 4EXKA 4FEBA 3PUXE 1LSTA 2H5YA 1AOVA 3PGFA 4G68A 5CI5A 4BDRA 3N94A 2Z8FA 3QAXA 1T0KA 4E0WA 2DVCA 2R9JA 5KDTB 3B6QA 3G7WA 1PEBA 3TEPA 4OENA 3MVYA 3WAFA 2QS4A 1DPEA 3JZJA 4Q0CA 2Q2AA 2D21A 3S9LC 1LB8A 4OZ9A 5DVJA 4F22A 3K6XA 3T22A 5I58B 1ZTYA 4Q30B 3EN3A 4M4GA 4ELRA 5TPAA 5FTIA 1Y20A 5AA4A 1N7WA 3V83A 3U72A 1OVBA 1B7HA 2O1MA 1MH3A 2FYIA 3G3FA 1FQDA 4JB7A 5ITPA 2DVZA 5TP9B 1MDQA 5KCJB 4G68C 3N26A 1SVXB 1DTGA 5BUUA 4KFQA 3TAJA 1B0LA 2HXWA 2DXRA 3IORA 2HFBA 3K02A 5F7VA 4TLLB 1S7YA 3LR1A 4ESWA 3K6UA 3TELA 3FV1A 1B6HA 2A5SA 1QUJA 2F8DA 3A09A 4O3BA 4NF6A 2HAUA 4OTEA 4GXSB 3VV5A 3RTWB 3M3KA 4JBZA 1P1NA 1H45A 1YTVA 2QS2A 4XXUA 3Q28A 1QULA 1NNPA 3OXNA 4AQ4A 1I6AA 1B5IA 1OQHA 4H8IA 3Q25A 3CR9A 1NNFA 4R9FA 2YLNA 3HO7A 3V89B 4LATA 5B70A 3CI8A 4R73A 1H43A 1Y3NA 3LUYA 3SEUA 1GV8A 4QF9A 4NF4B 4TOZA 4F3PA 2XXRA 3KG2A 3H7MA 3H06B 4ISUA 3K4UA 1B1HA 5H8NB 5LOMA 2RKMA 4ECFA 3TTNA 4QFPA 3TCGA 3PV0E 4TLMB 3V8XB 5A5XA 5CMKA 1R1NA 3FVNA 3M3FA 4EUOA 1B58A 2I4BA 1MPDA 1Y4CA 3HPIA 4EXLA 5HBCA 4OESA 1IITA 2CMOA 1H3DA 1BTJA 2PMSA 1B3GA 3O6IA 5CMBA 3MWBA 2NVUB 4YKIA 1Q35A 1EU8A 5I2KA 3EF7A 2XHDA 3D4GA 3TTMA 3MQ9A 3OO7A 4OHNA 3FUZA 2ONRA 4GIZA 1NH8A 1JW5A 2P1SA 4X48A 2DYXA 1ZIUA 4R6HA 3BFTA 2X7QA 3MVZA 5TPAB 4HCWA 5H8QA 2REJA 4F18A 4XKRA 3DP8A 5CBRA 2ABHA 3EPEA 3T66A 3KN8A 4U22A 4FJPA 5IKBA 2PYYA 1B4ZA 3LSLA 5B7DA 2OK2A 4ELQA 3DELB 3TUSA 1D9VA 2Q9TA 1UTBA 2I0BA 4H67A 3RY3A 1SBPA 1UTHB 3MAMA 3OO9A 2Y7WA 1A40A 3D4CA 5CMMA 4MBPA 3T9VA 3M8UA 1WDNA 4IO5A 2F35A 4XKNA 4GOTA 1LAHE 5I59B 2DE4A 3TDJA 3KSJA 5I56A 3O66A 1XT8A 1MPCA 1R9LA 2F6PA 2VD2A 3KGCA 2ZXTA 3UP9A 3CSGA 2P0SA 3DLNA 2XX7A 3V5AA 1PBQA 3OEKA 4GLIA 3TODA 2UYFA 1Y9UA 3H6WA 3QSLA 1B51A 1TWYA 4ZEDA 5H8HB 4YMBA 2YJPA 3DP4A 4MLQA 3VXBA 1QUIA 1PB8A 4UA8A 2G29A 4OYVA 3BKIB 4H65A 1WODA 2F7BA 5DVFA 2F7CA 3O6GA 3TZAA 3FJGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MM6 A;  4UAC A;  2DE2 A;  1M5C A;  1DMB A;  1NFT A;  5L9M A;  1B1X A;  1MH4 A;  1XOC A;  3KJ7 A;  4YKK A;  4QRZ A;  2XX8 A;  2W7Y A;  2Q8J A;  1VSO A;  4R72 A;  4U1Z A;  1QVS A;  2ANJ A;  4N6P A;  5I58 A;  4I9D A;  1URS A;  4LQ2 A;  3IL1 B;  4QSC A;  1LFH A;  3MPL A;  4QSD A;  4FED A;  2QMX A;  1ZKB A;  2OZZ A;  4KYE A;  2YPN A;  5TP9 A;  5KCJ A;  2CZL A;  3VFJ A;  3SEV A;  5F1Q A;  1MY3 A;  3N6T A;  1URG A;  4PQJ A;  2XXT A;  1IXI A;  4FEC A;  1EZP A;  2Q88 A;  4NF8 B;  3SER A;  3K01 A;  2I4C A;  1O64 A;  3OMB A;  4NWC A;  3IJX B;  4EF2 A;  1SW4 A;  1IXG A;  1UIV A;  2D3I A;  1PC3 A;  4Z0I A;  3KN3 A;  1UTB B;  1M5D A;  4RPO A;  5FTH A;  2FA7 A;  4ZEC A;  3OEL A;  3QUF A;  2HCA A;  3FV2 A;  3GXA A;  1A54 A;  1JW1 A;  4JSO A;  3IOV A;  1OLC A;  1Y3P A;  4BDN A;  3MZ1 A;  3RT6 B;  3USD A;  4G8M A;  1PBP A;  3IOT A;  3C32 A;  1ZU0 A;  3SDF A;  1JNF A;  5AA2 A;  4BDO A;  3UOR A;  4YZZ A;  1JQF A;  3TTR A;  2XD3 A;  3VE1 B;  5I56 B;  2THI A;  1YPN A;  4EQ9 A;  3VLV A;  2H25 A;  4TQU Q;  3R26 A;  1EZO A;  4NF4 A;  4H8J A;  4ZEF A;  3TMG A;  3FIR A;  5H8N A;  3PMV A;  3ZKL A;  1BP5 A;  4GL0 A;  1MY1 A;  4O3A A;  1FQC A;  3S9N C;  5FHO A;  1B3F A;  1SI1 A;  1B52 A;  2DOJ A;  4RYA A;  3CFZ A;  5KZT A;  3KOT A;  4ONY A;  1MQJ A;  2Y7I A;  1LCF A;  4LA9 A;  2RC7 A;  3IK6 B;  2V25 A;  5EYF A;  2AIX A;  3MW0 A;  4JWY A;  1B4H A;  2UVG A;  3H6U A;  5CMC A;  4ND9 A;  3SKP A;  3TTL A;  3KFM A;  1CE2 A;  3ILU B;  3IR1 A;  4F19 A;  1RKM A;  2F78 A;  4EQB A;  4QFL A;  3IB1 A;  4U23 A;  2HEU A;  2ZYO A;  1CB6 A;  2I6E A;  5DVI A;  2DP8 A;  5AA3 A;  1HSL A;  1NMU A;  3VVE A;  4KD5 A;  3EHS A;  3PPP A;  1POY 1;  4R74 A;  1FTK A;  4KYS A;  2R71 A;  4P11 A;  2O7I A;  4PP0 A;  5BWJ A;  4BLA A;  1SW1 A;  2V93 A;  4PFY A;  4NWD A;  4F1V A;  4RJZ A;  2B3B A;  3SES A;  4R6Y A;  3UGW A;  4G2Z A;  4DCX A;  1LGB C;  4C1T A;  1A7L A;  2HZL A;  3HST A;  1SW5 A;  1UTH A;  5L9O A;  4ELO A;  1D9Y A;  2M8C A;  4LUB A;  3K1M A;  1MRP A;  2QJE A;  4OXV A;  5H8S A;  1USY H;  1N7X A;  2GHA A;  4YKJ A;  1BLF A;  2O1L A;  2VOZ A;  4X1D A;  4BDL A;  3OO6 A;  1Y4T A;  4C0R A;  5I59 A;  3H3G A;  1RYX A;  3IOU A;  2F97 A;  3PUW E;  5I84 A;  5EHS A;  4KYD A;  1II5 A;  4OMB A;  4H6D A;  1LFG A;  4KHZ E;  2O7U A;  1MY2 A;  4U1O A;  1Q1K A;  5AA2 B;  3PD8 A;  3W15 C;  5AE4 A;  1OVT A;  1H44 A;  4KQP A;  3ZSF A;  2RC8 A;  1P1U A;  3CVG A;  4IO2 A;  1B32 A;  1MQG A;  2B65 A;  2PVU A;  5H8H A;  1VFD A;  2O68 A;  1FQB A;  1B2H A;  4KCC A;  3R7X A;  4POW A;  1N0T A;  3OD7 A;  3K2D A;  3M3L A;  2Y7R A;  2DXY A;  4MFI A;  1JEU A;  3EHT A;  3F11 A;  3PU5 A;  3GBA A;  2I48 A;  4THI A;  3RNN A;  2QL3 A;  3CRB A;  4YB7 A;  3RLF E;  3MZ9 A;  1A55 A;  1B7U A;  1XS5 A;  4PFW A;  4ZEB A;  3S9M C;  3K00 A;  1BKA A;  2DS9 A;  2DWA A;  1SYH A;  3ILT B;  3TCH A;  3TTK A;  4F3S A;  2O6A A;  2DQV A;  2XXW A;  3DM0 A;  2RCB A;  1AH5 A;  2QS3 A;  3G3K A;  3T9X B;  3C31 A;  1N76 A;  1H76 A;  1MXW A;  4GFR A;  1O63 A;  3QXM A;  3PUY E;  3T96 B;  4F2Q A;  3FZV A;  1FTO A;  3EHU A;  2Y7P A;  4HW8 A;  2KLF A;  3FAT A;  4NF8 A;  2QRY A;  1NL5 A;  5AA1 A;  3RGY A;  1M5E A;  4RPN A;  4X1B A;  1M5B A;  5HM4 B;  3CG3 A;  1MDP 1;  2V3T A;  4M1V A;  1J1N A;  2XXY A;  3OSR A;  2ZYM A;  1FTL A;  3DP6 A;  2GRV A;  4LQ5 A;  3RT8 A;  4FAJ A;  2ZMB A;  1DOT A;  5I57 B;  5JK4 A;  1SI0 A;  2UXA A;  3HHG A;  2UYE A;  4R2B A;  5K2Y A;  3E9X A;  3GLB A;  4F29 A;  4F3G A;  3O2A A;  2DWH A;  1QKB A;  4QHQ A;  5DTB A;  3C36 A;  3G3H A;  4HTG A;  3LC8 A;  4IO7 A;  3CSB A;  4FIM A;  2Z22 A;  3JYR A;  3Q29 A;  1USY E;  3H4Z A;  1FW0 A;  3FD3 A;  1B46 A;  4DE8 A;  4OEV A;  3HV1 A;  4ZDM A;  3RPW A;  3UA8 A;  4JWO A;  5DEX B;  2OBG A;  4YB6 A;  1US4 A;  1YAE A;  4XKQ A;  1MS7 A;  4H5G A;  3JV9 A;  3IX1 A;  1S9T A;  4OQO A;  5HPQ A;  1A8E A;  1LLS A;  4YU0 A;  3VDF A;  3C33 A;  3ONM A;  4G4P A;  2F6G A;  4EQ7 A;  3FXQ A;  1B9J A;  4FOR A;  1GTK A;  2DWJ A;  4GRK A;  2Z23 A;  3FJM A;  5ICT A;  4PE5 B;  4DCY A;  4Q5T A;  3PUZ E;  1ZBM A;  1FTM A;  1UQW A;  3E3K A;  3PMW A;  4OER A;  3QYT A;  1GVC A;  3FXR A;  2XXH A;  1QKA A;  3A3U A;  2VD3 A;  4IO6 A;  3S2V A;  1B3H A;  3I3V A;  1MG1 A;  1TXF A;  5CM6 A;  1AMF A;  3MC2 A;  3TCF A;  4F31 B;  3B6W A;  3R6U A;  2XXP A;  2V3Q A;  4NF5 B;  3N6U A;  3UK4 A;  1R6Z A;  2I3V A;  3RUM A;  3T93 B;  1I6B A;  2O84 X;  3KEI A;  4H1X A;  4KCD A;  4P0G A;  2FNC A;  4WXJ A;  1JEV A;  3HHF A;  3VVF A;  3PPO A;  3CFL A;  2ZNS A;  4IY5 A;  2QPQ A;  3IAZ A;  3LSF B;  1IIW A;  2I49 A;  2ONK E;  4U4X A;  3S4U A;  1GGG A;  4ZEK A;  4XTC Q;  3G3G A;  4GQO A;  1HSJ A;  3KOS A;  1OQG A;  1SYI A;  1N3W A;  3IB2 A;  2PBW A;  3PD9 A;  3MVW A;  1MXU A;  4OWD A;  1QJM A;  4KI0 E;  5CRY A;  3MP8 A;  2DSF A;  2ZYK A;  4EDP A;  1QUK A;  2NUV A;  1MY0 A;  1RYO A;  1LAX A;  4YMA A;  3ZS6 A;  1S50 A;  3L6H A;  1ELJ A;  1D3K A;  1ZJL A;  4RK2 A;  3HN0 A;  4F3B A;  4FE8 A;  4RY1 A;  2F7A A;  4AB5 A;  4KR5 A;  4U21 A;  2VHA A;  3GBB A;  1URD A;  2H4I A;  4QFO A;  4OVJ A;  3OOA A;  2P2A A;  1JVY A;  2H99 A;  5ICQ A;  4ZZE A;  2HZK A;  2XXQ A;  4KPT A;  3K6V A;  4WEP A;  5H8F B;  2O51 A;  4ELP A;  1Z7N E;  3BBR A;  1P1W A;  4IO3 A;  2H9B A;  1AL3 A;  1OIB A;  1N3X A;  3ZKK A;  4N07 A;  3OEM A;  1IXC A;  1FCK A;  1LAG E;  1PB9 A;  1NNK A;  2XX9 A;  2NWJ A;  1B40 A;  4GL8 A;  5DT6 A;  1IQ7 A;  3PMX A;  4FAT A;  2A5T B;  1XHY A;  1FQE A;  3G3J A;  4XKP A;  3W9V A;  4P0I A;  5ITO A;  4PET A;  2E0S A;  1VR5 A;  3RN8 A;  3KJT A;  3MJN A;  2ALU A;  5ISU A;  2IA4 A;  4X9T A;  1ATG A;  5JTY A;  2REG A;  1XVX A;  3H03 A;  4BDQ A;  2NXO A;  2LAO A;  4MLV A;  2XXV A;  1MXV A;  1IEJ A;  2RF1 A;  3QIM A;  1FQA A;  2AL5 A;  4U4S A;  2E1S A;  1DSN A;  4E0X A;  3ECR A;  2D5W A;  4LON B;  4AB6 A;  4IB2 A;  2OCU A;  3U94 A;  3O97 A;  3Q27 A;  4IGR A;  1A99 A;  2UVJ A;  1ANF A;  1P1Q A;  1I69 A;  3E4R A;  3K0V A;  1D4N A;  1TFA A;  3U1O A;  4HCY A;  1F9B A;  3IO6 A;  5TU0 A;  3IO4 A;  5J1D A;  3P7I A;  4ZZA A;  2Y7K A;  1ZMG A;  2G93 A;  3VVD A;  5I57 A;  3KN7 A;  2IEE A;  3K6W A;  4G8H A;  3C34 A;  4LVQ A;  3PPR A;  1ZLQ A;  3TQW A;  3UN6 A;  1A8F A;  1MY4 A;  4DIG A;  3KZG A;  1QW0 A;  1PB7 A;  1HSE A;  5AA2 D;  1B7Z A;  4HS7 A;  5DEX A;  2ESN A;  2AL4 A;  1JET A;  4OFL A;  2Q89 A;  4N13 A;  3U92 A;  5FHM A;  3WAE A;  2UVH A;  3CG1 A;  2ZYN A;  2PX1 A;  3MUQ A;  4F2O A;  3K1N A;  2VP1 A;  1B05 A;  2AYS A;  5I2N B;  4MF3 A;  2UVI A;  4JWX A;  3THI A;  3MP6 A;  3Q26 A;  3W9W A;  5CBS A;  3HCQ A;  4GVO A;  2GHB A;  1BIY A;  3C4M A;  4EF1 A;  3T9H B;  4RNS A;  3O9P A;  3IOW A;  4DDD A;  2DWI A;  3O6H A;  1SD3 A;  3RQT A;  2F5X A;  3MBP A;  2Z8E A;  1TFD A;  2Y84 A;  4RA1 A;  5L9S A;  4NF5 A;  2OWT A;  4F1U A;  3FGS A;  3PPQ A;  1L5T A;  4LZ7 A;  1TT1 A;  1EH3 A;  4I62 A;  2Z8D A;  2QSX A;  1MXX A;  4F1Y A;  3ODB A;  4G68 B;  1MQH A;  1N04 A;  5ELV A;  5JTY B;  3UIF A;  3FJ7 A;  4XIG Q;  4OFJ A;  2F36 A;  1LBC A;  4GXA A;  2XXU A;  4DXU A;  2PT1 A;  2OJT A;  3MVX A;  4ZE8 A;  1FQF A;  3FVO A;  3KSX A;  2V3U A;  4JXI A;  3N5L A;  4WKM A;  5FHN A;  1XVY A;  1MM7 A;  2BJJ X;  2GH9 A;  1SW2 A;  1DPP A;  1P1O A;  1IUD A;  4I8C A;  1B0H A;  3QUJ A;  1JVX A;  3O28 A;  2RIN A;  4I1D A;  4QFN A;  2XXX A;  5AA4 B;  5L8D A;  4ZS9 A;  1GR2 A;  4L17 A;  2VGQ A;  4PFT A;  3MP1 A;  3KBR A;  3VXC A;  1MXY A;  5EHM A;  4LZ5 A;  4WED A;  5DYH A;  4OEU A;  1LBB A;  3K1P A;  2I3W A;  4H5F A;  4ZE9 A;  2B3F A;  3T9U A;  2X26 A;  1MPB A;  3VLU A;  2Q2C A;  1KWH A;  1AIV A;  1IXH A;  3MZB A;  4G8N A;  1O7T A;  4GWO A;  2ZNU A;  3C9H A;  4NMY A;  4POX A;  4MH5 A;  2I0C A;  4NF6 B;  1R9Q A;  3SEY A;  1B3E A;  3LSX A;  4C1U A;  4R75 A;  5H8F A;  1Y3Q A;  1POT A;  1PDA A;  4R6K A;  2V84 A;  3PUV E;  1OLA A;  3EQ1 A;  3VLW A;  3FXU A;  5K2X A;  1Y1M A;  4Q8R A;  4R9G A;  1WVJ A;  1SQY A;  3A3C A;  1XC1 A;  4IY6 A;  3SEX A;  3I5O A;  2I58 A;  4H0W A;  3OEN A;  3OO8 A;  3CFX A;  3IB0 A;  4LZ8 A;  2H98 A;  2A5T A;  5JEI A;  4NED A;  3L6G A;  4R2F A;  3TPA A;  4PFU A;  4DXB A;  3I6V A;  3SEW A;  4IO4 A;  4RK9 A;  4JDF A;  3TKD A;  3H6T A;  5A5X B;  2PT2 A;  1NKX A;  3B7D A;  1M5F A;  1LAF E;  5KDT A;  2XXI A;  3FVK A;  4IGT A;  4Z7E A;  3O29 A;  2QMW A;  4YIC A;  1VFE A;  1OMP A;  4DXC A;  5M2V A;  2HAV A;  5I2K B;  4RXL A;  4OET A;  5CC2 A;  3H6V A;  4O3C A;  1UIU A;  2XD2 A;  4G77 A;  3BFU A;  3TQL A;  3CIJ A;  3TFL A;  1SDX A;  1B5H A;  1FTJ A;  1N84 A;  3LSW A;  2OWS A;  3G3I A;  1P99 A;  1I6Q A;  1VE4 A;  2RCA A;  3IJO B;  3U8Q A;  5H8Q B;  1LB9 A;  4GF8 A;  4JSD A;  1Y1Z A;  1MXZ A;  4ZEI A;  4YAH X;  1LCT A;  1MQD A;  3C35 A;  1B5J A;  1NNT A;  1B3L A;  5IAI A;  3AXF A;  2X7P A;  3QK6 A;  4DLD A;  3GZG A;  1YCJ A;  4YKP A;  4U2R A;  1US5 A;  3OSQ A;  1MQI A;  4YB5 A;  3S9E A;  1NH7 A;  2GFE A;  5I2N A;  3LBS A;  2HQ0 A;  4F39 A;  3MPK A;  4BDM A;  1IZ1 A;  1EZ9 A;  3E13 X;  4NE4 A;  4ESX A;  1JW4 A;  1LFI A;  3SET A;  4QFK A;  3B6T A;  1DTZ A;  2OLB A;  2NOO A;  3FVG A;  2QS1 A;  2O69 A;  4LP2 B;  4QSE A;  3RTF B;  2WKY A;  2ZNT A;  2RC9 A;  3FAS A;  4DZ1 A;  3PPN A;  4K3F A;  4NTL A;  3U93 A;  2F34 A;  3TYH A;  1Z7M E;  2R6G E;  2ONS A;  4OFO A;  4GD5 A;  2DE3 A;  4EXK A;  4FEB A;  3PUX E;  1LST A;  2H5Y A;  1AOV A;  3PGF A;  4G68 A;  5CI5 A;  4BDR A;  3N94 A;  2Z8F A;  3QAX A;  1T0K A;  4E0W A;  2DVC A;  2R9J A;  5KDT B;  3B6Q A;  3G7W A;  1PEB A;  3TEP A;  4OEN A;  3MVY A;  3WAF A;  2QS4 A;  1DPE A;  3JZJ A;  4Q0C A;  2Q2A A;  2D21 A;  3S9L C;  1LB8 A;  4OZ9 A;  5DVJ A;  4F22 A;  3K6X A;  3T22 A;  5I58 B;  1ZTY A;  4Q30 B;  3EN3 A;  4M4G A;  4ELR A;  5TPA A;  5FTI A;  1Y20 A;  5AA4 A;  1N7W A;  3V83 A;  3U72 A;  1OVB A;  1B7H A;  2O1M A;  1MH3 A;  2FYI A;  3G3F A;  1FQD A;  4JB7 A;  5ITP A;  2DVZ A;  5TP9 B;  1MDQ A;  5KCJ B;  4G68 C;  3N26 A;  1SVX B;  1DTG A;  5BUU A;  4KFQ A;  3TAJ A;  1B0L A;  2HXW A;  2DXR A;  3IOR A;  2HFB A;  3K02 A;  5F7V A;  4TLL B;  1S7Y A;  3LR1 A;  4ESW A;  3K6U A;  3TEL A;  3FV1 A;  1B6H A;  2A5S A;  1QUJ A;  2F8D A;  3A09 A;  4O3B A;  4NF6 A;  2HAU A;  4OTE A;  4GXS B;  3VV5 A;  3RTW B;  3M3K A;  4JBZ A;  1P1N A;  1H45 A;  1YTV A;  2QS2 A;  4XXU A;  3Q28 A;  1QUL A;  1NNP A;  3OXN A;  4AQ4 A;  1I6A A;  1B5I A;  1OQH A;  4H8I A;  3Q25 A;  3CR9 A;  1NNF A;  4R9F A;  2YLN A;  3HO7 A;  3V89 B;  4LAT A;  5B70 A;  3CI8 A;  4R73 A;  1H43 A;  1Y3N A;  3LUY A;  3SEU A;  1GV8 A;  4QF9 A;  4NF4 B;  4TOZ A;  4F3P A;  2XXR A;  3KG2 A;  3H7M A;  3H06 B;  4ISU A;  3K4U A;  1B1H A;  5H8N B;  5LOM A;  2RKM A;  4ECF A;  3TTN A;  4QFP A;  3TCG A;  3PV0 E;  4TLM B;  3V8X B;  5A5X A;  5CMK A;  1R1N A;  3FVN A;  3M3F A;  4EUO A;  1B58 A;  2I4B A;  1MPD A;  1Y4C A;  3HPI A;  4EXL A;  5HBC A;  4OES A;  1IIT A;  2CMO A;  1H3D A;  1BTJ A;  2PMS A;  1B3G A;  3O6I A;  5CMB A;  3MWB A;  2NVU B;  4YKI A;  1Q35 A;  1EU8 A;  5I2K A;  3EF7 A;  2XHD A;  3D4G A;  3TTM A;  3MQ9 A;  3OO7 A;  4OHN A;  3FUZ A;  2ONR A;  4GIZ A;  1NH8 A;  1JW5 A;  2P1S A;  4X48 A;  2DYX A;  1ZIU A;  4R6H A;  3BFT A;  2X7Q A;  3MVZ A;  5TPA B;  4HCW A;  5H8Q A;  2REJ A;  4F18 A;  4XKR A;  3DP8 A;  5CBR A;  2ABH A;  3EPE A;  3T66 A;  3KN8 A;  4U22 A;  4FJP A;  5IKB A;  2PYY A;  1B4Z A;  3LSL A;  5B7D A;  2OK2 A;  4ELQ A;  3DEL B;  3TUS A;  1D9V A;  2Q9T A;  1UTB A;  2I0B A;  4H67 A;  3RY3 A;  1SBP A;  1UTH B;  3MAM A;  3OO9 A;  2Y7W A;  1A40 A;  3D4C A;  5CMM A;  4MBP A;  3T9V A;  3M8U A;  1WDN A;  4IO5 A;  2F35 A;  4XKN A;  4GOT A;  1LAH E;  5I59 B;  2DE4 A;  3TDJ A;  3KSJ A;  5I56 A;  3O66 A;  1XT8 A;  1MPC A;  1R9L A;  2F6P A;  2VD2 A;  3KGC A;  2ZXT A;  3UP9 A;  3CSG A;  2P0S A;  3DLN A;  2XX7 A;  3V5A A;  1PBQ A;  3OEK A;  4GLI A;  3TOD A;  2UYF A;  1Y9U A;  3H6W A;  3QSL A;  1B51 A;  1TWY A;  4ZED A;  5H8H B;  4YMB A;  2YJP A;  3DP4 A;  4MLQ A;  3VXB A;  1QUI A;  1PB8 A;  4UA8 A;  2G29 A;  4OYV A;  3BKI B;  4H65 A;  1WOD A;  2F7B A;  5DVF A;  2F7C A;  3O6G A;  3TZA A;  3FJG A; 
#chains in the Genus database with same CATH topology
 1MM6 A;  4UAC A;  2DE2 A;  1M5C A;  1DMB A;  1NFT A;  2FIX A;  5L9M A;  1B1X A;  1MH4 A;  1XOC A;  3KJ7 A;  4YKK A;  4QRZ A;  2XX8 A;  2W7Y A;  2Q8J A;  2Q8M A;  1VSO A;  4R72 A;  4U1Z A;  1QVS A;  2ANJ A;  4N6P A;  5I58 A;  4I9D A;  1URS A;  4LQ2 A;  3IL1 B;  4QSC A;  1LFH A;  4QSD A;  3MPL A;  4FED A;  2PFZ A;  4PFR A;  2QMX A;  1AWB A;  1ZKB A;  1FBE A;  2OZZ A;  3NOH A;  2FVZ A;  4KYE A;  2YPN A;  5TP9 A;  4PBH A;  5KCJ A;  4PDD A;  2CZL A;  3VFJ A;  3SEV A;  4GBW A;  5F1Q A;  1MY3 A;  1DCU A;  3N6T A;  1URG A;  4PQJ A;  2XXT A;  1IXI A;  4FEC A;  1EZP A;  2Q88 A;  2B4M A;  4NF8 B;  3SER A;  3K01 A;  2I4C A;  1O64 A;  3OMB A;  4NWC A;  3IJX B;  4EF2 A;  4NF0 A;  1SW4 A;  4I3Y A;  1IXG A;  4PAI A;  1UIV A;  2D3I A;  1PC3 A;  4Z0I A;  3KN3 A;  1UTB B;  4NN3 A;  1M5D A;  4HE1 A;  4RPO A;  5FTH A;  2FA7 A;  4ZEC A;  3OEL A;  5LTC A;  4GWZ A;  3QUF A;  2HCA A;  3FV2 A;  3GXA A;  1A54 A;  1JW1 A;  4JSO A;  3IOV A;  1OLC A;  4NX1 A;  1Y3P A;  4BDN A;  3MZ1 A;  3RT6 B;  3USD A;  4G8M A;  1PBP A;  3IOT A;  3C32 A;  1ZU0 A;  3SDF A;  1JNF A;  5AA2 A;  4BDO A;  1RDZ A;  3UOR A;  4YZZ A;  1JQF A;  3TTR A;  2XD3 A;  3VE1 B;  5I56 B;  2THI A;  1YPN A;  1IMF A;  4EQ9 A;  3VLV A;  2H25 A;  4TQU Q;  3R26 A;  1EZO A;  4NF4 A;  4H8J A;  4ZEF A;  3TMG A;  3FIR A;  5H8N A;  3PMV A;  3ZKL A;  1BP5 A;  1FJ9 A;  1MY1 A;  4GL0 A;  4O3A A;  1FQC A;  3S9N C;  3BIG A;  5FHO A;  1B3F A;  1SI1 A;  2F3D A;  1B52 A;  2DOJ A;  4RYA A;  3CFZ A;  5KZT A;  3KOT A;  4MCO A;  4ONY A;  1MQJ A;  2Y7I A;  1LCF A;  4LA9 A;  2RC7 A;  3IK6 B;  2V25 A;  5EYF A;  2AIX A;  3MW0 A;  4JWY A;  1B4H A;  1G0H A;  2UVG A;  3H6U A;  5LDZ A;  5CMC A;  4ND9 A;  3SKP A;  3TTL A;  3KFM A;  1CE2 A;  3ILU B;  3IR1 A;  2OWZ A;  4F19 A;  1RKM A;  2F78 A;  4EQB A;  4PDH A;  2FIE A;  4QFL A;  3IB1 A;  4X8R A;  4U23 A;  2HEU A;  2ZYO A;  1CB6 A;  2I6E A;  5DVI A;  2VT5 A;  2DP8 A;  2GQ1 A;  5AA3 A;  1HSL A;  1NMU A;  3VVE A;  4KD5 A;  3EHS A;  3PPP A;  1POY 1;  4OVP A;  4R74 A;  1FTK A;  4KYS A;  2R71 A;  3PTY A;  4P11 A;  5EYG A;  2O7I A;  4PP0 A;  5BWJ A;  4BLA A;  1SW1 A;  5ET7 A;  2V93 A;  4PFY A;  4NWD A;  4F1V A;  4RJZ A;  2B3B A;  2WBD A;  3MYU A;  3SES A;  4R6Y A;  2HXR A;  3UGW A;  4G2Z A;  1EYK A;  4DCX A;  1LGB C;  4C1T A;  2ZZW A;  1A7L A;  2HZL A;  3HST A;  1SW5 A;  5DW8 A;  1UTH A;  5L9O A;  4ELO A;  2CZK A;  1D9Y A;  2M8C A;  4LUB A;  3K1M A;  1MRP A;  2QJE A;  4OXV A;  5H8S A;  1USY H;  1N7X A;  2GHA A;  4YKJ A;  1BLF A;  2O1L A;  2VOZ A;  4X1D A;  4BDL A;  3OO6 A;  1Y4T A;  1NV0 A;  4C0R A;  5I59 A;  3H3G A;  1RYX A;  3IOU A;  3QMF A;  4O7I A;  2F97 A;  3PUW E;  5I84 A;  5EHS A;  4KYD A;  1II5 A;  4OMB A;  4H6D A;  4PF8 A;  1LFG A;  4KHZ E;  2O7U A;  1MY2 A;  1KA1 A;  4U1O A;  1Q1K A;  5AA2 B;  2Y5L A;  3PD8 A;  3W15 C;  5AE4 A;  1OVT A;  4MNI A;  1H44 A;  4KQP A;  1KA0 A;  3ZSF A;  1YYZ A;  2RC8 A;  1P1U A;  3CVG A;  4IO2 A;  1B32 A;  1MQG A;  2B65 A;  2PVU A;  5H8H A;  1VFD A;  2O68 A;  1FQB A;  1B2H A;  4KCC A;  3R7X A;  4POW A;  2WBB A;  1N0T A;  3OD7 A;  1LBY A;  3K2D A;  3M3L A;  2Y7R A;  4G61 A;  2DXY A;  4MFI A;  1JEU A;  3EHT A;  3F11 A;  1EYI A;  4HE0 A;  3PU5 A;  4NAP A;  1YXI A;  3GBA A;  2I48 A;  4THI A;  3RNN A;  2QL3 A;  3CRB A;  2XWV A;  4YB7 A;  3MZ9 A;  3RLF E;  1A55 A;  1B7U A;  1XS5 A;  4PFW A;  4ZEB A;  3S9M C;  3K00 A;  1BKA A;  2DS9 A;  2DWA A;  4AS4 A;  1SYH A;  3ILT B;  1NUZ A;  3TCH A;  3TTK A;  3CHG A;  4F3S A;  2O6A A;  2DQV A;  2XXW A;  3DM0 A;  3T0J A;  2RCB A;  1AH5 A;  2QS3 A;  3G3K A;  3FXB A;  1DK4 A;  4P1E A;  5EQ7 A;  3T9X B;  3C31 A;  1N76 A;  1H76 A;  1MXW A;  1QGX A;  4GFR A;  4JVC A;  1O63 A;  4N8G A;  2WYP A;  3QXM A;  3PUY E;  3T96 B;  4N17 A;  4F2Q A;  4GX3 A;  4NGU A;  3FZV A;  1FTO A;  3EHU A;  2Y7P A;  4HW8 A;  4MX6 A;  2KLF A;  3FAT A;  4MAG A;  4NF8 A;  2QRY A;  4OVR A;  1NL5 A;  5AA1 A;  3RGY A;  1M5E A;  2XWK A;  4RPN A;  4X1B A;  1LBV A;  1M5B A;  5HM4 B;  3CG3 A;  1MDP 1;  2V3T A;  4M1V A;  1J1N A;  2XXY A;  3OSR A;  1RDY A;  2ZYM A;  1FTL A;  3DP6 A;  2GRV A;  4LQ5 A;  3RT8 A;  4FAJ A;  2ZMB A;  1DOT A;  5I57 B;  5JK4 A;  1SI0 A;  2UXA A;  3HHG A;  2UYE A;  3D1R A;  4R2B A;  5K2Y A;  3E9X A;  3GLB A;  4F29 A;  2FBP A;  4F3G A;  1FBD A;  3O2A A;  2DWH A;  1QKB A;  4QHQ A;  5DTB A;  3C36 A;  3G3H A;  4HTG A;  2XA5 A;  3LC8 A;  4IO7 A;  3KC1 A;  3CSB A;  4FIM A;  2Z22 A;  2CEX A;  3JYR A;  3Q29 A;  1USY E;  3H4Z A;  2HPG A;  1FW0 A;  3FD3 A;  1B46 A;  2L5V A;  4DE8 A;  4OEV A;  3HV1 A;  4ZDM A;  3RPW A;  3UA8 A;  4JWO A;  5DEX B;  2OBG A;  4YB6 A;  1US4 A;  1YAE A;  4XKQ A;  1MS7 A;  4H5G A;  3JV9 A;  3IX1 A;  1S9T A;  4OQO A;  1FBH A;  4NQ8 A;  5HPQ A;  1A8E A;  1LLS A;  4P56 A;  4YU0 A;  3VDF A;  1FTA A;  2QVV A;  3C33 A;  1FPD A;  3ONM A;  2F6G A;  4G4P A;  4EQ7 A;  3FXQ A;  1B9J A;  4FOR A;  4XEQ A;  1GTK A;  1XI6 A;  2DWJ A;  4N4U A;  4GRK A;  2Z23 A;  3FJM A;  5ICT A;  4PE5 B;  4DCY A;  1FBC A;  4Q5T A;  3PUZ E;  1ZBM A;  1FTM A;  1UQW A;  3E3K A;  5EQ9 A;  3PMW A;  4OER A;  3QYT A;  1GVC A;  3FXR A;  2XXH A;  3LV0 A;  1QKA A;  3A3U A;  2VD3 A;  4IO6 A;  3S2V A;  1B3H A;  3I3V A;  1MG1 A;  1TXF A;  5CM6 A;  1AMF A;  3MC2 A;  3TCF A;  4F31 B;  3B6W A;  3R6U A;  2XXP A;  2V3Q A;  4NF5 B;  3N6U A;  3UK4 A;  4H46 A;  1FBP A;  1R6Z A;  2I3V A;  3RUM A;  3T93 B;  1I6B A;  1LBZ A;  5I7I A;  2O84 X;  3KEI A;  1IMD A;  4H1X A;  4KCD A;  4P0G A;  2FNC A;  4WXJ A;  1JEV A;  3HHF A;  1RDX A;  3VVF A;  2XWO A;  3PPO A;  3CFL A;  2ZNS A;  4IY5 A;  4O8M A;  2QPQ A;  3IAZ A;  3LSF B;  1IIW A;  2I49 A;  2ONK E;  4P3L A;  4U4X A;  3S4U A;  4MMP A;  3B8B A;  2Y5K A;  2KQZ A;  1GGG A;  4ZEK A;  4XTC Q;  3G3G A;  4GQO A;  2VPN A;  1HSJ A;  3KOS A;  4XFE A;  1OQG A;  1SYI A;  1N3W A;  3IB2 A;  2Q74 A;  2PBW A;  4NHB A;  3PD9 A;  4OVQ A;  3MVW A;  1MXU A;  4OWD A;  1QJM A;  4KI0 E;  3ROJ A;  5CRY A;  3MP8 A;  2DSF A;  2ZYK A;  4EDP A;  1QUK A;  2BJI A;  4N8Y A;  2NUV A;  1MY0 A;  1RYO A;  1LAX A;  4YMA A;  3ZS6 A;  1S50 A;  3IFC A;  3L6H A;  1ELJ A;  4OVS A;  1D3K A;  1ZJL A;  4RK2 A;  3HN0 A;  4F3B A;  4FE8 A;  4RY1 A;  2F7A A;  4AB5 A;  4KR5 A;  4U21 A;  2VHA A;  4OAN A;  3GBB A;  1URD A;  4GWU A;  1VDW A;  2H4I A;  4QFO A;  4OVJ A;  3OOA A;  2P2A A;  1JVY A;  2H99 A;  5ICQ A;  4ZZE A;  4PTK A;  2HZK A;  2XXQ A;  4KPT A;  3K6V A;  4WEP A;  5H8F B;  2O51 A;  4ELP A;  1Z7N E;  3BBR A;  1P1W A;  4IO3 A;  2H9B A;  1AL3 A;  1OIB A;  3HFU A;  1N3X A;  3ZKK A;  4N07 A;  3OEM A;  1IXC A;  1FCK A;  1LAG E;  1PB9 A;  4OA4 A;  1NNK A;  2XX9 A;  2NWJ A;  1B40 A;  2MKZ A;  4GL8 A;  5DT6 A;  1IQ7 A;  3PMX A;  4FAT A;  2A5T B;  1XHY A;  1FQE A;  3G3J A;  4XKP A;  3W9V A;  4P0I A;  1NI9 A;  5ITO A;  4PET A;  2E0S A;  1VR5 A;  3RN8 A;  1FPK A;  3KJT A;  3MJN A;  2ALU A;  5ISU A;  2IA4 A;  4X9T A;  1ATG A;  5JTY A;  2REG A;  1XVX A;  3H03 A;  4BDQ A;  2NXO A;  2LAO A;  4MLV A;  2XXV A;  1MXV A;  1IEJ A;  2RF1 A;  3QIM A;  1FQA A;  2AL5 A;  4JVD A;  4U4S A;  2E1S A;  1DSN A;  4E0X A;  3ECR A;  3E78 A;  2D5W A;  1NV5 A;  1DBZ A;  4LON B;  4AB6 A;  4IB2 A;  2OCU A;  4MNP A;  3U94 A;  3O97 A;  3Q27 A;  5EYH A;  4IGR A;  5IZ1 A;  1A99 A;  2UVJ A;  1ANF A;  1P1Q A;  1I69 A;  3E4R A;  3K0V A;  1FPB A;  1D4N A;  1TFA A;  3U1O A;  4KXP A;  4HCY A;  4O7M A;  1F9B A;  1FSA A;  3IO6 A;  2CEY A;  5TU0 A;  1BK4 A;  3IO4 A;  5J1D A;  3P7I A;  4ZZA A;  2Y7K A;  1ZMG A;  2G93 A;  3LUZ A;  3VVD A;  4OVT A;  5I57 A;  3KN7 A;  2IEE A;  3K6W A;  4G8H A;  3C34 A;  4LVQ A;  3PPR A;  1ZLQ A;  3TQW A;  1NUY A;  3UN6 A;  1A8F A;  1MY4 A;  4MHF A;  4DIG A;  3KZG A;  1QW0 A;  1PB7 A;  1HSE A;  4I40 A;  5AA2 D;  5IM2 A;  1B7Z A;  4HS7 A;  1FRP A;  5DEX A;  2ESN A;  2AL4 A;  1JET A;  4OFL A;  2Q89 A;  4N13 A;  3U92 A;  5FHM A;  3WAE A;  2UVH A;  3CG1 A;  4GX6 A;  2ZYN A;  5I3S A;  2PX1 A;  3MUQ A;  4F2O A;  3K1N A;  2VP1 A;  4GBV A;  1B05 A;  2AYS A;  5I2N B;  4MF3 A;  2UVI A;  4JWX A;  3THI A;  3MP6 A;  3Q26 A;  3W9W A;  5CBS A;  3HCQ A;  4GVO A;  2JJK A;  2GHB A;  1BIY A;  3C4M A;  4EF1 A;  4PAF A;  3T9H B;  4RNS A;  3O9P A;  3IOW A;  4DDD A;  2DWI A;  3O6H A;  1SD3 A;  3RQT A;  2F5X A;  3MBP A;  2Z8E A;  1TFD A;  2Y84 A;  4RA1 A;  1Q9D A;  4GWY A;  5L9S A;  4NF5 A;  2DDK A;  2OWT A;  4F1U A;  3FGS A;  3PPQ A;  1L5T A;  4LZ7 A;  1TT1 A;  1EH3 A;  5IZZ A;  4I62 A;  2Z8D A;  2QSX A;  1MXX A;  4F1Y A;  3ODB A;  4G68 B;  1MQH A;  1N04 A;  4PC9 A;  5ELV A;  5JTY B;  3UIF A;  3FJ7 A;  4XIG Q;  4OFJ A;  3RPL B;  2F36 A;  1LBC A;  4GXA A;  2XXU A;  4DXU A;  2PT1 A;  2OJT A;  3MVX A;  1FPF A;  2FHY A;  4ZE8 A;  2XXK A;  4GX4 A;  1FQF A;  3FVO A;  3KSX A;  5IZ3 B;  2V3U A;  4JXI A;  3N5L A;  4WKM A;  5FHN A;  1XVY A;  1MM7 A;  2BJJ X;  2GH9 A;  1SW2 A;  1DPP A;  1P1O A;  4N91 A;  1IUD A;  4I8C A;  1B0H A;  1EYJ A;  1JVX A;  3QUJ A;  1JP4 A;  3O28 A;  2RIN A;  4I1D A;  2XWI A;  4P47 A;  4QFN A;  2XXX A;  4P9K A;  5AA4 B;  5L8D A;  4ZS9 A;  1GR2 A;  3ISP A;  4HE2 A;  4L17 A;  2VGQ A;  4PFT A;  3U65 A;  2B4L A;  3MP1 A;  3KBR A;  4N6D A;  1FJ6 A;  3VXC A;  1MXY A;  5EHM A;  4LZ5 A;  4WED A;  5DYH A;  4HXV A;  2HHM A;  4OEU A;  1LBB A;  4O94 A;  3K1P A;  2I3W A;  4H5F A;  4ZE9 A;  2B3F A;  3T9U A;  2X26 A;  1MPB A;  3VLU A;  2Q2C A;  1KWH A;  1AIV A;  1IXH A;  3MZB A;  4G8N A;  1O7T A;  4GWO A;  2ZNU A;  3C9H A;  4NMY A;  4P8B A;  4POX A;  4MH5 A;  2I0C A;  4GWX A;  4NF6 B;  1R9Q A;  3SEY A;  3T1B A;  1B3E A;  3LSX A;  4C1U A;  4R75 A;  2F3B A;  5H8F A;  1Y3Q A;  2V4C A;  1POT A;  1PDA A;  4R6K A;  1K9Y A;  2V84 A;  3PUV E;  1OLA A;  3EQ1 A;  3VLW A;  3FXU A;  5K2X A;  1Y1M A;  4Q8R A;  4R9G A;  4UAB A;  2QVU A;  1WVJ A;  1SQY A;  3A3C A;  1XC1 A;  5ESY A;  3A29 A;  4DI3 D;  4IY6 A;  1LBX A;  3SEX A;  3I5O A;  2I58 A;  4H0W A;  3OEN A;  3OO8 A;  3CFX A;  3IB0 A;  4LZ8 A;  2H98 A;  2A5T A;  5JEI A;  4NED A;  3L6G A;  4R2F A;  3TPA A;  1D9Q A;  1NUW A;  4PFU A;  4DXB A;  3I6V A;  3SEW A;  4IO4 A;  4RK9 A;  2CZI A;  1IMA A;  4JDF A;  3TKD A;  5J16 A;  3H6T A;  5A5X B;  2PT2 A;  1NKX A;  3B7D A;  1M5F A;  1LAF E;  5KDT A;  2WX9 A;  2XXI A;  3FVK A;  4IGT A;  4Z7E A;  5ET6 A;  3O29 A;  2QMW A;  3FBP A;  4AS5 A;  4YIC A;  1VFE A;  1OMP A;  3SZP A;  4DXC A;  5M2V A;  2HAV A;  1FBF A;  1FPL A;  5I2K B;  4RXL A;  4OET A;  5CC2 A;  4GWS A;  3H6V A;  4O3C A;  4IR8 A;  1UIU A;  2XD2 A;  4G77 A;  3BFU A;  3TQL A;  4N6K A;  3CIJ A;  3TFL A;  1SDX A;  2OX3 A;  1B5H A;  1FTJ A;  1N84 A;  3LSW A;  4NG7 A;  4XF5 A;  5IGA A;  2OWS A;  3G3I A;  1P99 A;  1I6Q A;  3KC0 A;  1VE4 A;  2RCA A;  3IJO B;  3U8Q A;  1INP A;  5H8Q B;  4MNC A;  1LB9 A;  1NV7 A;  4GF8 A;  4JSD A;  1Y1Z A;  1MXZ A;  4LN5 A;  4ZEI A;  1NV2 A;  4YAH X;  1LCT A;  1MQD A;  1NV4 A;  3C35 A;  1B5J A;  1NNT A;  1B3L A;  1KZ8 A;  5IAI A;  3AXF A;  2X7P A;  3QK6 A;  4DLD A;  3GZG A;  1YCJ A;  4YKP A;  4U2R A;  1US5 A;  3OSQ A;  1MQI A;  4YB5 A;  3S9E A;  1NH7 A;  2WEF A;  4GWW A;  4PFB A;  2GFE A;  1IME A;  5I2N A;  3EKI A;  3LBS A;  2HQ0 A;  4F39 A;  3MPK A;  4BDM A;  1IZ1 A;  1EZ9 A;  3E13 X;  4NE4 A;  4ESX A;  1JW4 A;  4MEV A;  1LFI A;  3SET A;  4QFK A;  1IMC A;  3B6T A;  1DTZ A;  2OLB A;  2NOO A;  3FVG A;  2QS1 A;  2O69 A;  1NUX A;  4LP2 B;  4QSE A;  3RTF B;  2WKY A;  2ZNT A;  2RC9 A;  1CNQ A;  2QFL A;  3FAS A;  4DZ1 A;  3PPN A;  4K3F A;  4NTL A;  3U93 A;  5I5P A;  2F34 A;  3TYH A;  1Z7M E;  5A5L A;  2R6G E;  2ONS A;  2CZH A;  4OFO A;  4GD5 A;  3E79 A;  2DE3 A;  1YZ0 A;  4EXK A;  4FEB A;  3PUX E;  1LST A;  2H5Y A;  1AOV A;  2VPO A;  3PGF A;  4G68 A;  5CI5 A;  4BDR A;  3N94 A;  2Z8F A;  3QAX A;  1T0K A;  4E0W A;  2DVC A;  3RPL A;  2R9J A;  4H45 A;  5KDT B;  3B6Q A;  1K9Z A;  3G7W A;  1PEB A;  3TEP A;  4MJO A;  4OEN A;  3MVY A;  3WAF A;  2QS4 A;  5IZ3 A;  1DPE A;  3JZJ A;  4Q0C A;  2Q2A A;  2D21 A;  4MIJ A;  3S9L C;  1LB8 A;  4OZ9 A;  5DVJ A;  4F22 A;  3K6X A;  3T22 A;  5I58 B;  1ZTY A;  1FBG A;  3EN3 A;  4Q30 B;  4M4G A;  4ELR A;  5TPA A;  5FTI A;  1Y20 A;  2PFY A;  5AA4 A;  1N7W A;  4FBP A;  3V83 A;  3U72 A;  1OVB A;  1B7H A;  2O1M A;  1MH3 A;  2PCR A;  2QVR A;  2FYI A;  3G3F A;  1FQD A;  4JB7 A;  5ITP A;  2DVZ A;  5TP9 B;  1MDQ A;  5KCJ B;  4G68 C;  5ET5 A;  3N26 A;  1SVX B;  3B50 A;  1DTG A;  1NV1 A;  5BUU A;  4KFQ A;  3TAJ A;  1B0L A;  2HXW A;  5FBP A;  2DXR A;  3BIH A;  3IOR A;  2HFB A;  3RYD A;  3K02 A;  3MST A;  5F7V A;  4TLL B;  1S7Y A;  3LR1 A;  4ESW A;  3K6U A;  1IMB A;  4PBQ A;  3TEL A;  3FV1 A;  1B6H A;  2A5S A;  1SPI A;  1QUJ A;  2F8D A;  4PCD A;  3A09 A;  4X04 A;  4O3B A;  4NF6 A;  2HAU A;  4OTE A;  4GXS B;  5EQ8 A;  3VV5 A;  4QBA A;  3RTW B;  3M3K A;  4JBZ A;  1P1N A;  1H45 A;  1YTV A;  2QS2 A;  4XXU A;  3Q28 A;  3GYY A;  1QUL A;  1NNP A;  3OXN A;  4AQ4 A;  1LEV A;  1I6A A;  1FPG A;  4PE3 A;  1B5I A;  1OQH A;  4H8I A;  3Q25 A;  3CR9 A;  1NNF A;  4R9F A;  2YLN A;  3HO7 A;  3V89 B;  4LAT A;  5B70 A;  1NV3 A;  3CI8 A;  4R73 A;  1H43 A;  4JVI A;  1Y3N A;  3LUY A;  3SEU A;  1GV8 A;  4QF9 A;  5F24 A;  4NF4 B;  4TOZ A;  4F3P A;  2XXR A;  3KG2 A;  3H7M A;  3H06 B;  4ISU A;  3K4U A;  1B1H A;  5H8N B;  5LOM A;  2RKM A;  1NV6 A;  4ECF A;  3TTN A;  2R8T A;  4QFP A;  3TCG A;  3PV0 E;  4TLM B;  3V8X B;  5A5X A;  5CMK A;  1R1N A;  3FVN A;  3M3F A;  4EUO A;  1B58 A;  2I4B A;  1MPD A;  1Y4C A;  3HPI A;  4EXL A;  5HBC A;  2P3V A;  3KBZ A;  4OES A;  1IIT A;  4PFI A;  4QXD A;  2CMO A;  1H3D A;  1BTJ A;  1G0I A;  2PMS A;  1B3G A;  3O6I A;  5CMB A;  3MWB A;  5EQA A;  2NVU B;  4YKI A;  1Q35 A;  1EU8 A;  5ET8 A;  5I2K A;  3EF7 A;  2XHD A;  3D4G A;  2KR0 A;  3TTM A;  3MQ9 A;  3OO7 A;  4OHN A;  4PGP A;  3FUZ A;  1LBW A;  2ONR A;  4GIZ A;  1NH8 A;  4PGN A;  1JW5 A;  2P1S A;  4X48 A;  2DYX A;  1ZIU A;  4R6H A;  3BFT A;  2WYK A;  2X7Q A;  3MVZ A;  5TPA B;  4HCW A;  5H8Q A;  2REJ A;  4F18 A;  4XKR A;  3DP8 A;  5CBR A;  2ABH A;  3EPE A;  4N15 A;  3T66 A;  3KN8 A;  4U22 A;  4N81 A;  4PAK A;  4FJP A;  5IKB A;  2P3N A;  2PYY A;  1B4Z A;  4P1L A;  3LSL A;  5B7D A;  2OK2 A;  4ELQ A;  1FPJ A;  3DEL B;  3TUS A;  2ZZV A;  1D9V A;  5T3J A;  2Q9T A;  1UTB A;  2I0B A;  4H67 A;  4PF6 A;  2ZZX A;  3RY3 A;  1SBP A;  1UTH B;  3MAM A;  3OO9 A;  2Y7W A;  1A40 A;  3D4C A;  1FPI A;  5CMM A;  4MBP A;  3T9V A;  3M8U A;  1WDN A;  4IO5 A;  2F35 A;  4XKN A;  4GOT A;  1LAH E;  5I59 B;  2DE4 A;  3TDJ A;  3KSJ A;  5I56 A;  4DI4 B;  3O66 A;  1XT8 A;  1MPC A;  1R9L A;  2F6P A;  2VD2 A;  3KGC A;  2ZXT A;  4I3E A;  3UP9 A;  3CSG A;  2P0S A;  3DLN A;  2XX7 A;  3V5A A;  1PBQ A;  3OEK A;  4GLI A;  1FPE A;  3TOD A;  2UYF A;  1Y9U A;  3H6W A;  3QSL A;  1B51 A;  1TWY A;  4ZED A;  5H8H B;  4YMB A;  2YJP A;  3DP4 A;  4MLQ A;  3VXB A;  1QUI A;  1PB8 A;  4UA8 A;  2G29 A;  4OYV A;  3BKI B;  4H65 A;  1WOD A;  2F7B A;  3IFA A;  5DVF A;  2F7C A;  3O6G A;  3TZA A;  3FJG A; 
#chains in the Genus database with same CATH homology
 1MM6 A;  4UAC A;  2DE2 A;  1M5C A;  1DMB A;  1NFT A;  5L9M A;  1B1X A;  1MH4 A;  1XOC A;  3KJ7 A;  4YKK A;  4QRZ A;  2XX8 A;  2W7Y A;  2Q8J A;  1VSO A;  4R72 A;  4U1Z A;  1QVS A;  2ANJ A;  4N6P A;  5I58 A;  4I9D A;  1URS A;  4LQ2 A;  3IL1 B;  4QSC A;  1LFH A;  3MPL A;  4QSD A;  4FED A;  2QMX A;  1ZKB A;  2OZZ A;  4KYE A;  2YPN A;  5TP9 A;  5KCJ A;  2CZL A;  3VFJ A;  3SEV A;  5F1Q A;  1MY3 A;  3N6T A;  1URG A;  4PQJ A;  2XXT A;  1IXI A;  4FEC A;  1EZP A;  2Q88 A;  4NF8 B;  3SER A;  3K01 A;  2I4C A;  1O64 A;  3OMB A;  4NWC A;  3IJX B;  4EF2 A;  1SW4 A;  1IXG A;  1UIV A;  2D3I A;  1PC3 A;  4Z0I A;  3KN3 A;  1UTB B;  1M5D A;  4RPO A;  5FTH A;  2FA7 A;  4ZEC A;  3OEL A;  3QUF A;  2HCA A;  3FV2 A;  3GXA A;  1A54 A;  1JW1 A;  4JSO A;  3IOV A;  1OLC A;  1Y3P A;  4BDN A;  3MZ1 A;  3RT6 B;  3USD A;  4G8M A;  1PBP A;  3IOT A;  3C32 A;  1ZU0 A;  3SDF A;  1JNF A;  5AA2 A;  4BDO A;  3UOR A;  4YZZ A;  1JQF A;  3TTR A;  2XD3 A;  3VE1 B;  5I56 B;  2THI A;  1YPN A;  4EQ9 A;  3VLV A;  2H25 A;  4TQU Q;  3R26 A;  1EZO A;  4NF4 A;  4H8J A;  4ZEF A;  3TMG A;  3FIR A;  5H8N A;  3PMV A;  3ZKL A;  1BP5 A;  4GL0 A;  1MY1 A;  4O3A A;  1FQC A;  3S9N C;  5FHO A;  1B3F A;  1SI1 A;  1B52 A;  2DOJ A;  4RYA A;  3CFZ A;  5KZT A;  3KOT A;  4ONY A;  1MQJ A;  2Y7I A;  1LCF A;  4LA9 A;  2RC7 A;  3IK6 B;  2V25 A;  5EYF A;  2AIX A;  3MW0 A;  4JWY A;  1B4H A;  2UVG A;  3H6U A;  5CMC A;  4ND9 A;  3SKP A;  3TTL A;  3KFM A;  1CE2 A;  3ILU B;  3IR1 A;  4F19 A;  1RKM A;  2F78 A;  4EQB A;  4QFL A;  3IB1 A;  4U23 A;  2HEU A;  2ZYO A;  1CB6 A;  2I6E A;  5DVI A;  2DP8 A;  5AA3 A;  1HSL A;  1NMU A;  3VVE A;  4KD5 A;  3EHS A;  3PPP A;  1POY 1;  4R74 A;  1FTK A;  4KYS A;  2R71 A;  4P11 A;  2O7I A;  4PP0 A;  5BWJ A;  4BLA A;  1SW1 A;  2V93 A;  4PFY A;  4NWD A;  4F1V A;  4RJZ A;  2B3B A;  3SES A;  4R6Y A;  3UGW A;  4G2Z A;  4DCX A;  1LGB C;  4C1T A;  1A7L A;  2HZL A;  3HST A;  1SW5 A;  1UTH A;  5L9O A;  4ELO A;  1D9Y A;  2M8C A;  4LUB A;  3K1M A;  1MRP A;  2QJE A;  4OXV A;  5H8S A;  1USY H;  1N7X A;  2GHA A;  4YKJ A;  1BLF A;  2O1L A;  2VOZ A;  4X1D A;  4BDL A;  3OO6 A;  1Y4T A;  4C0R A;  5I59 A;  3H3G A;  1RYX A;  3IOU A;  2F97 A;  3PUW E;  5I84 A;  5EHS A;  4KYD A;  1II5 A;  4OMB A;  4H6D A;  1LFG A;  4KHZ E;  2O7U A;  1MY2 A;  4U1O A;  1Q1K A;  5AA2 B;  3PD8 A;  3W15 C;  5AE4 A;  1OVT A;  1H44 A;  4KQP A;  3ZSF A;  2RC8 A;  1P1U A;  3CVG A;  4IO2 A;  1B32 A;  1MQG A;  2B65 A;  2PVU A;  5H8H A;  1VFD A;  2O68 A;  1FQB A;  1B2H A;  4KCC A;  3R7X A;  4POW A;  1N0T A;  3OD7 A;  3K2D A;  3M3L A;  2Y7R A;  2DXY A;  4MFI A;  1JEU A;  3EHT A;  3F11 A;  3PU5 A;  3GBA A;  2I48 A;  4THI A;  3RNN A;  2QL3 A;  3CRB A;  4YB7 A;  3RLF E;  3MZ9 A;  1A55 A;  1B7U A;  1XS5 A;  4PFW A;  4ZEB A;  3S9M C;  3K00 A;  1BKA A;  2DS9 A;  2DWA A;  1SYH A;  3ILT B;  3TCH A;  3TTK A;  4F3S A;  2O6A A;  2DQV A;  2XXW A;  3DM0 A;  2RCB A;  1AH5 A;  2QS3 A;  3G3K A;  3T9X B;  3C31 A;  1N76 A;  1H76 A;  1MXW A;  4GFR A;  1O63 A;  3QXM A;  3PUY E;  3T96 B;  4F2Q A;  3FZV A;  1FTO A;  3EHU A;  2Y7P A;  4HW8 A;  2KLF A;  3FAT A;  4NF8 A;  2QRY A;  1NL5 A;  5AA1 A;  3RGY A;  1M5E A;  4RPN A;  4X1B A;  1M5B A;  5HM4 B;  3CG3 A;  1MDP 1;  2V3T A;  4M1V A;  1J1N A;  2XXY A;  3OSR A;  2ZYM A;  1FTL A;  3DP6 A;  2GRV A;  4LQ5 A;  3RT8 A;  4FAJ A;  2ZMB A;  1DOT A;  5I57 B;  5JK4 A;  1SI0 A;  2UXA A;  3HHG A;  2UYE A;  4R2B A;  5K2Y A;  3E9X A;  3GLB A;  4F29 A;  4F3G A;  3O2A A;  2DWH A;  1QKB A;  4QHQ A;  5DTB A;  3C36 A;  3G3H A;  4HTG A;  3LC8 A;  4IO7 A;  3CSB A;  4FIM A;  2Z22 A;  3JYR A;  3Q29 A;  1USY E;  3H4Z A;  1FW0 A;  3FD3 A;  1B46 A;  4DE8 A;  4OEV A;  3HV1 A;  4ZDM A;  3RPW A;  3UA8 A;  4JWO A;  5DEX B;  2OBG A;  4YB6 A;  1US4 A;  1YAE A;  4XKQ A;  1MS7 A;  4H5G A;  3JV9 A;  3IX1 A;  1S9T A;  4OQO A;  5HPQ A;  1A8E A;  1LLS A;  4YU0 A;  3VDF A;  3C33 A;  3ONM A;  4G4P A;  2F6G A;  4EQ7 A;  3FXQ A;  1B9J A;  4FOR A;  1GTK A;  2DWJ A;  4GRK A;  2Z23 A;  3FJM A;  5ICT A;  4PE5 B;  4DCY A;  4Q5T A;  3PUZ E;  1ZBM A;  1FTM A;  1UQW A;  3E3K A;  3PMW A;  4OER A;  3QYT A;  1GVC A;  3FXR A;  2XXH A;  1QKA A;  3A3U A;  2VD3 A;  4IO6 A;  3S2V A;  1B3H A;  3I3V A;  1MG1 A;  1TXF A;  5CM6 A;  1AMF A;  3MC2 A;  3TCF A;  4F31 B;  3B6W A;  3R6U A;  2XXP A;  2V3Q A;  4NF5 B;  3N6U A;  3UK4 A;  1R6Z A;  2I3V A;  3RUM A;  3T93 B;  1I6B A;  2O84 X;  3KEI A;  4H1X A;  4KCD A;  4P0G A;  2FNC A;  4WXJ A;  1JEV A;  3HHF A;  3VVF A;  3PPO A;  3CFL A;  2ZNS A;  4IY5 A;  2QPQ A;  3IAZ A;  3LSF B;  1IIW A;  2I49 A;  2ONK E;  4U4X A;  3S4U A;  1GGG A;  4ZEK A;  4XTC Q;  3G3G A;  4GQO A;  1HSJ A;  3KOS A;  1OQG A;  1SYI A;  1N3W A;  3IB2 A;  2PBW A;  3PD9 A;  3MVW A;  1MXU A;  4OWD A;  1QJM A;  4KI0 E;  5CRY A;  3MP8 A;  2DSF A;  2ZYK A;  4EDP A;  1QUK A;  2NUV A;  1MY0 A;  1RYO A;  1LAX A;  4YMA A;  3ZS6 A;  1S50 A;  3L6H A;  1ELJ A;  1D3K A;  1ZJL A;  4RK2 A;  3HN0 A;  4F3B A;  4FE8 A;  4RY1 A;  2F7A A;  4AB5 A;  4KR5 A;  4U21 A;  2VHA A;  3GBB A;  1URD A;  2H4I A;  4QFO A;  4OVJ A;  3OOA A;  2P2A A;  1JVY A;  2H99 A;  5ICQ A;  4ZZE A;  2HZK A;  2XXQ A;  4KPT A;  3K6V A;  4WEP A;  5H8F B;  2O51 A;  4ELP A;  1Z7N E;  3BBR A;  1P1W A;  4IO3 A;  2H9B A;  1AL3 A;  1OIB A;  1N3X A;  3ZKK A;  4N07 A;  3OEM A;  1IXC A;  1FCK A;  1LAG E;  1PB9 A;  1NNK A;  2XX9 A;  2NWJ A;  1B40 A;  4GL8 A;  5DT6 A;  1IQ7 A;  3PMX A;  4FAT A;  2A5T B;  1XHY A;  1FQE A;  3G3J A;  4XKP A;  3W9V A;  4P0I A;  5ITO A;  4PET A;  2E0S A;  1VR5 A;  3RN8 A;  3KJT A;  3MJN A;  2ALU A;  5ISU A;  2IA4 A;  4X9T A;  1ATG A;  5JTY A;  2REG A;  1XVX A;  3H03 A;  4BDQ A;  2NXO A;  2LAO A;  4MLV A;  2XXV A;  1MXV A;  1IEJ A;  2RF1 A;  3QIM A;  1FQA A;  2AL5 A;  4U4S A;  2E1S A;  1DSN A;  4E0X A;  3ECR A;  2D5W A;  4LON B;  4AB6 A;  4IB2 A;  2OCU A;  3U94 A;  3O97 A;  3Q27 A;  4IGR A;  1A99 A;  2UVJ A;  1ANF A;  1P1Q A;  1I69 A;  3E4R A;  3K0V A;  1D4N A;  1TFA A;  3U1O A;  4HCY A;  1F9B A;  3IO6 A;  5TU0 A;  3IO4 A;  5J1D A;  3P7I A;  4ZZA A;  2Y7K A;  1ZMG A;  2G93 A;  3VVD A;  5I57 A;  3KN7 A;  2IEE A;  3K6W A;  4G8H A;  3C34 A;  4LVQ A;  3PPR A;  1ZLQ A;  3TQW A;  3UN6 A;  1A8F A;  1MY4 A;  4DIG A;  3KZG A;  1QW0 A;  1PB7 A;  1HSE A;  5AA2 D;  1B7Z A;  4HS7 A;  5DEX A;  2ESN A;  2AL4 A;  1JET A;  4OFL A;  2Q89 A;  4N13 A;  3U92 A;  5FHM A;  3WAE A;  2UVH A;  3CG1 A;  2ZYN A;  2PX1 A;  3MUQ A;  4F2O A;  3K1N A;  2VP1 A;  1B05 A;  2AYS A;  5I2N B;  4MF3 A;  2UVI A;  4JWX A;  3THI A;  3MP6 A;  3Q26 A;  3W9W A;  5CBS A;  3HCQ A;  4GVO A;  2GHB A;  1BIY A;  3C4M A;  4EF1 A;  3T9H B;  4RNS A;  3O9P A;  3IOW A;  4DDD A;  2DWI A;  3O6H A;  1SD3 A;  3RQT A;  2F5X A;  3MBP A;  2Z8E A;  1TFD A;  2Y84 A;  4RA1 A;  5L9S A;  4NF5 A;  2OWT A;  4F1U A;  3FGS A;  3PPQ A;  1L5T A;  4LZ7 A;  1TT1 A;  1EH3 A;  4I62 A;  2Z8D A;  2QSX A;  1MXX A;  4F1Y A;  3ODB A;  4G68 B;  1MQH A;  1N04 A;  5ELV A;  5JTY B;  3UIF A;  3FJ7 A;  4XIG Q;  4OFJ A;  2F36 A;  1LBC A;  4GXA A;  2XXU A;  4DXU A;  2PT1 A;  2OJT A;  3MVX A;  4ZE8 A;  1FQF A;  3FVO A;  3KSX A;  2V3U A;  4JXI A;  3N5L A;  4WKM A;  5FHN A;  1XVY A;  1MM7 A;  2BJJ X;  2GH9 A;  1SW2 A;  1DPP A;  1P1O A;  1IUD A;  4I8C A;  1B0H A;  3QUJ A;  1JVX A;  3O28 A;  2RIN A;  4I1D A;  4QFN A;  2XXX A;  5AA4 B;  5L8D A;  4ZS9 A;  1GR2 A;  4L17 A;  2VGQ A;  4PFT A;  3MP1 A;  3KBR A;  3VXC A;  1MXY A;  5EHM A;  4LZ5 A;  4WED A;  5DYH A;  4OEU A;  1LBB A;  3K1P A;  2I3W A;  4H5F A;  4ZE9 A;  2B3F A;  3T9U A;  2X26 A;  1MPB A;  3VLU A;  2Q2C A;  1KWH A;  1AIV A;  1IXH A;  3MZB A;  4G8N A;  1O7T A;  4GWO A;  2ZNU A;  3C9H A;  4NMY A;  4POX A;  4MH5 A;  2I0C A;  4NF6 B;  1R9Q A;  3SEY A;  1B3E A;  3LSX A;  4C1U A;  4R75 A;  5H8F A;  1Y3Q A;  1POT A;  1PDA A;  4R6K A;  2V84 A;  3PUV E;  1OLA A;  3EQ1 A;  3VLW A;  3FXU A;  5K2X A;  1Y1M A;  4Q8R A;  4R9G A;  1WVJ A;  1SQY A;  3A3C A;  1XC1 A;  4IY6 A;  3SEX A;  3I5O A;  2I58 A;  4H0W A;  3OEN A;  3OO8 A;  3CFX A;  3IB0 A;  4LZ8 A;  2H98 A;  2A5T A;  5JEI A;  4NED A;  3L6G A;  4R2F A;  3TPA A;  4PFU A;  4DXB A;  3I6V A;  3SEW A;  4IO4 A;  4RK9 A;  4JDF A;  3TKD A;  3H6T A;  5A5X B;  2PT2 A;  1NKX A;  3B7D A;  1M5F A;  1LAF E;  5KDT A;  2XXI A;  3FVK A;  4IGT A;  4Z7E A;  3O29 A;  2QMW A;  4YIC A;  1VFE A;  1OMP A;  4DXC A;  5M2V A;  2HAV A;  5I2K B;  4RXL A;  4OET A;  5CC2 A;  3H6V A;  4O3C A;  1UIU A;  2XD2 A;  4G77 A;  3BFU A;  3TQL A;  3CIJ A;  3TFL A;  1SDX A;  1B5H A;  1FTJ A;  1N84 A;  3LSW A;  2OWS A;  3G3I A;  1P99 A;  1I6Q A;  1VE4 A;  2RCA A;  3IJO B;  3U8Q A;  5H8Q B;  1LB9 A;  4GF8 A;  4JSD A;  1Y1Z A;  1MXZ A;  4ZEI A;  4YAH X;  1LCT A;  1MQD A;  3C35 A;  1B5J A;  1NNT A;  1B3L A;  5IAI A;  3AXF A;  2X7P A;  3QK6 A;  4DLD A;  3GZG A;  1YCJ A;  4YKP A;  4U2R A;  1US5 A;  3OSQ A;  1MQI A;  4YB5 A;  3S9E A;  1NH7 A;  2GFE A;  5I2N A;  3LBS A;  2HQ0 A;  4F39 A;  3MPK A;  4BDM A;  1IZ1 A;  1EZ9 A;  3E13 X;  4NE4 A;  4ESX A;  1JW4 A;  1LFI A;  3SET A;  4QFK A;  3B6T A;  1DTZ A;  2OLB A;  2NOO A;  3FVG A;  2QS1 A;  2O69 A;  4LP2 B;  4QSE A;  3RTF B;  2WKY A;  2ZNT A;  2RC9 A;  3FAS A;  4DZ1 A;  3PPN A;  4K3F A;  4NTL A;  3U93 A;  2F34 A;  3TYH A;  1Z7M E;  2R6G E;  2ONS A;  4OFO A;  4GD5 A;  2DE3 A;  4EXK A;  4FEB A;  3PUX E;  1LST A;  2H5Y A;  1AOV A;  3PGF A;  4G68 A;  5CI5 A;  4BDR A;  3N94 A;  2Z8F A;  3QAX A;  1T0K A;  4E0W A;  2DVC A;  2R9J A;  5KDT B;  3B6Q A;  3G7W A;  1PEB A;  3TEP A;  4OEN A;  3MVY A;  3WAF A;  2QS4 A;  1DPE A;  3JZJ A;  4Q0C A;  2Q2A A;  2D21 A;  3S9L C;  1LB8 A;  4OZ9 A;  5DVJ A;  4F22 A;  3K6X A;  3T22 A;  5I58 B;  1ZTY A;  4Q30 B;  3EN3 A;  4M4G A;  4ELR A;  5TPA A;  5FTI A;  1Y20 A;  5AA4 A;  1N7W A;  3V83 A;  3U72 A;  1OVB A;  1B7H A;  2O1M A;  1MH3 A;  2FYI A;  3G3F A;  1FQD A;  4JB7 A;  5ITP A;  2DVZ A;  5TP9 B;  1MDQ A;  5KCJ B;  4G68 C;  3N26 A;  1SVX B;  1DTG A;  5BUU A;  4KFQ A;  3TAJ A;  1B0L A;  2HXW A;  2DXR A;  3IOR A;  2HFB A;  3K02 A;  5F7V A;  4TLL B;  1S7Y A;  3LR1 A;  4ESW A;  3K6U A;  3TEL A;  3FV1 A;  1B6H A;  2A5S A;  1QUJ A;  2F8D A;  3A09 A;  4O3B A;  4NF6 A;  2HAU A;  4OTE A;  4GXS B;  3VV5 A;  3RTW B;  3M3K A;  4JBZ A;  1P1N A;  1H45 A;  1YTV A;  2QS2 A;  4XXU A;  3Q28 A;  1QUL A;  1NNP A;  3OXN A;  4AQ4 A;  1I6A A;  1B5I A;  1OQH A;  4H8I A;  3Q25 A;  3CR9 A;  1NNF A;  4R9F A;  2YLN A;  3HO7 A;  3V89 B;  4LAT A;  5B70 A;  3CI8 A;  4R73 A;  1H43 A;  1Y3N A;  3LUY A;  3SEU A;  1GV8 A;  4QF9 A;  4NF4 B;  4TOZ A;  4F3P A;  2XXR A;  3KG2 A;  3H7M A;  3H06 B;  4ISU A;  3K4U A;  1B1H A;  5H8N B;  5LOM A;  2RKM A;  4ECF A;  3TTN A;  4QFP A;  3TCG A;  3PV0 E;  4TLM B;  3V8X B;  5A5X A;  5CMK A;  1R1N A;  3FVN A;  3M3F A;  4EUO A;  1B58 A;  2I4B A;  1MPD A;  1Y4C A;  3HPI A;  4EXL A;  5HBC A;  4OES A;  1IIT A;  2CMO A;  1H3D A;  1BTJ A;  2PMS A;  1B3G A;  3O6I A;  5CMB A;  3MWB A;  2NVU B;  4YKI A;  1Q35 A;  1EU8 A;  5I2K A;  3EF7 A;  2XHD A;  3D4G A;  3TTM A;  3MQ9 A;  3OO7 A;  4OHN A;  3FUZ A;  2ONR A;  4GIZ A;  1NH8 A;  1JW5 A;  2P1S A;  4X48 A;  2DYX A;  1ZIU A;  4R6H A;  3BFT A;  2X7Q A;  3MVZ A;  5TPA B;  4HCW A;  5H8Q A;  2REJ A;  4F18 A;  4XKR A;  3DP8 A;  5CBR A;  2ABH A;  3EPE A;  3T66 A;  3KN8 A;  4U22 A;  4FJP A;  5IKB A;  2PYY A;  1B4Z A;  3LSL A;  5B7D A;  2OK2 A;  4ELQ A;  3DEL B;  3TUS A;  1D9V A;  2Q9T A;  1UTB A;  2I0B A;  4H67 A;  3RY3 A;  1SBP A;  1UTH B;  3MAM A;  3OO9 A;  2Y7W A;  1A40 A;  3D4C A;  5CMM A;  4MBP A;  3T9V A;  3M8U A;  1WDN A;  4IO5 A;  2F35 A;  4XKN A;  4GOT A;  1LAH E;  5I59 B;  2DE4 A;  3TDJ A;  3KSJ A;  5I56 A;  3O66 A;  1XT8 A;  1MPC A;  1R9L A;  2F6P A;  2VD2 A;  3KGC A;  2ZXT A;  3UP9 A;  3CSG A;  2P0S A;  3DLN A;  2XX7 A;  3V5A A;  1PBQ A;  3OEK A;  4GLI A;  3TOD A;  2UYF A;  1Y9U A;  3H6W A;  3QSL A;  1B51 A;  1TWY A;  4ZED A;  5H8H B;  4YMB A;  2YJP A;  3DP4 A;  4MLQ A;  3VXB A;  1QUI A;  1PB8 A;  4UA8 A;  2G29 A;  4OYV A;  3BKI B;  4H65 A;  1WOD A;  2F7B A;  5DVF A;  2F7C A;  3O6G A;  3TZA A;  3FJG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...