2ONSA

Crystal structure of a. fulgidus periplasmic binding protein moda with bound tungstate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
GHMNVKLKVFHAGSLTEPMKAFKRAFEEKHPNVEVQTEAAGSAATIRKVTELGRKADVIATADYTLIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADEINSQNWYEILKRPDVRFGFSNPNDDPCGYRSLMAIQLAELYYNDPTIFDELVAKNSNLRFSEDNGSYVLRMPSSERIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVEIDLSSPDYAELYSKVKVVLANGKEVTGKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0100 protein AF_0094
publication title Structure of an ABC transporter in complex with its binding protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
molecule tags Ligand binding protein
total genus 110
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onsA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onsA02
4LONB 3TCGA 1BIYA 2P1SA 3MP1A 4JXIA 3VLUA 1EZPA 3RUMA 2UVJA 1B7UA 2O84X 1LAGE 4PP0A 1NMUA 5CBSA 5ICQA 4U1ZA 2R9JA 4MFIA 2UYEA 1DMBA 1Y9UA 3UORA 5I57A 5CC2A 1LB9A 1ZU0A 2VHAA 3MQ9A 3SEXA 4EF1A 2Q8JA 4AB6A 3O6HA 3K02A 3UA8A 4IY5A 3QK6A 4ZEFA 1BP5A 3VVFA 4PQJA 2XX9A 5TP9A 3EPEA 4JSDA 2DQVA 1B0HA 4N13A 4R72A 3K1PA 1LSTA 4OMBA 4R6HA 3B6WA 3G7WA 1KWHA 1FQAA 4YMAA 2V84A 4WEPA 4F3BA 2F7AA 1FQDA 3PPNA 2I0CA 2UVHA 4GXSB 4OFOA 3SEWA 4ZEIA 4G2ZA 1PEBA 5ITOA 1OMPA 2O7UA 1QKBA 1M5DA 2OZZA 5I59A 4IY6A 1UTHA 2F7BA 3KOSA 3MZ9A 2ANJA 4HS7A 3S9LC 4MH5A 4KI0E 5KDTA 3ECRA 4R6YA 1FTOA 3TZAA 2ALUA 1H76A 4DCXA 1UIVA 2X7PA 5FTHA 4ONYA 1NKXA 3O6GA 1B46A 4EXKA 4O3BA 5HPQA 1FW0A 4NEDA 4PFYA 1B6HA 5CBRA 1ANFA 3D4GA 4I9DA 2DSFA 2P2AA 4IO6A 2F6PA 3TCFA 3C33A 5HBCA 1OLCA 5A5XB 1Z7ME 4O3CA 5DEXB 3H7MA 2DVZA 3O6IA 4DXCA 5AA2D 1POY1 3K6WA 4ZE8A 3LSFB 5JK4A 4C1UA 5I58B 3HCQA 3HO7A 5HM4B 1UTBA 1B58A 2RC8A 4EF2A 5L9OA 1Y1MA 4FORA 1B5HA 1SYIA 3RPWA 1A8FA 1VFEA 1MQJA 3FJGA 3RGYA 1Q1KA 2O1MA 4GFRA 3P7IA 4JBZA 2GH9A 1JNFA 1YCJA 3CRBA 1HSLA 4OXVA 5I57B 1IXGA 1DPPA 1MY1A 4PETA 4QRZA 5BWJA 3VXCA 4R73A 3VVEA 1FTJA 3IOUA 5I84A 4JWYA 1USYE 1PBPA 3DLNA 3KBRA 3G3GA 3T22A 1Y3PA 5TP9B 2ZNUA 4EQ9A 2X26A 1OIBA 1RYOA 4MLQA 3O97A 3TTRA 3VLWA 4TLMB 2XXWA 2HZKA 2XXQA 3PMXA 4U1OA 5CI5A 4HTGA 1D9YA 1B52A 2I6EA 4DXBA 4R74A 1D9VA 3QXMA 4KD5A 2X7QA 4QF9A 3PUYE 1FQCA 2GFEA 1EZ9A 5B7DA 3E3KA 4PFWA 3DELB 2AL4A 5I59B 1LCTA 5ELVA 4F3SA 4QSCA 4XTCQ 3KZGA 5I56A 5FHOA 1URSA 2F34A 2OWTA 2DP8A 4OESA 1MH4A 4K3FA 3H06B 4HCWA 1NFTA 3SESA 4LATA 2DVCA 2ZYKA 3GXAA 2F35A 3T9XB 4X9TA 5EHSA 3PPQA 1A55A 4PFUA 3C32A 3Q26A 4RY1A 5J1DA 4ND9A 3SEVA 5KZTA 3G3FA 3KFMA 2ONRA 2OJTA 1MQDA 4G8MA 4BLAA 3L6HA 4NF6B 3DP8A 3VFJA 1FQFA 3OSRA 3U93A 4RNSA 3PUWE 1MXXA 2PMSA 4NTLA 3KJ7A 4H0WA 1AH5A 1LGBC 4Q30B 3ZKKA 2O6AA 3RTWB 4IO7A 1JVYA 2F5XA 5BUUA 1EZOA 2D21A 3KN8A 1NNKA 3KEIA 3FIRA 2KLFA 3M3FA 1PC3A 2DE2A 1AL3A 5AA1A 2XXYA 5H8NB 2OCUA 3OEKA 2Y7PA 4OETA 3H4ZA 3TCHA 2ZNTA 1SYHA 3MAMA 1I69A 4HW8A 3OO6A 1IUDA 4NF8A 3H6WA 1LCFA 3TUSA 1B4HA 4H5GA 1VFDA 4R2BA 4YMBA 1B3LA 4FATA 1N7WA 1JEVA 1IQ7A 2PVUA 3CIJA 3K6VA 4G8NA 4G68B 1MY4A 3EHUA 3FV1A 3PPPA 4P0GA 3EF7A 4NF5A 4YAHX 2QS2A 1MXUA 4H67A 1LFGA 1P1WA 4JWOA 1SW5A 3N6TA 1B05A 1QULA 4FEBA 3ILTB 4NF4A 2Y7IA 4LQ2A 4IGTA 5ITPA 3Q25A 3VV5A 1MPCA 1IEJA 2Z22A 2VGQA 5I56B 1P1OA 4LZ8A 2OWSA 5B70A 3DP4A 3MBPA 2Q89A 1MH3A 1D3KA 1B5JA 3EN3A 3D4CA 5CMBA 1M5EA 5K2XA 4IB2A 1B5IA 1IIWA 3HSTA 4GF8A 4JWXA 2Y7WA 3DP6A 1LBCA 1NH8A 3MC2A 3FJMA 1AMFA 1JETA 5A5XA 3R7XA 4P0IA 3DM0A 4F1UA 4JDFA 1SVXB 5I58A 3MPKA 4Q5TA 3O9PA 4LQ5A 5ISUA 4LP2B 1OQGA 3N5LA 3M8UA 3SERA 4ZEDA 4KPTA 2QS4A 3K0VA 5F7VA 3TELA 2I4BA 2GHAA 1P1UA 3UP9A 4ZE9A 3FASA 3OELA 4ELQA 2PBWA 1SQYA 3TQWA 4GLIA 3C34A 1B0LA 5DVIA 3TQLA 3CVGA 1MY3A 1B51A 5H8FA 4YKJA 1ZMGA 3IL1B 4M1VA 1T0KA 3MZ1A 4Z7EA 1USYH 1TFAA 1GVCA 2V93A 3QAXA 3ILUB 1N3WA 3TTKA 1H45A 1NNFA 3QUJA 3VLVA 4NF8B 4R9GA 1CB6A 2THIA 3H3GA 3MVYA 3LR1A 4U23A 1B3GA 4ELRA 4EDPA 1FCKA 4LA9A 1PBQA 1JW5A 4KFQA 3HHGA 3FVGA 4YZZA 2O51A 1IITA 2XXXA 1QW0A 1AIVA 4NF5B 5JEIA 1MS7A 4I8CA 4RK2A 2NWJA 3MVXA 1SI1A 1S9TA 2I3WA 3LSLA 1LAHE 3IB0A 3VE1B 4F18A 2UVIA 5AA2B 3RT6B 4IO3A 4NF4B 3JZJA 3G3IA 5I2KA 3FVKA 4RXLA 5EYFA 4YB5A 4U21A 1ZKBA 4EUOA 4FEDA 2V3UA 1TWYA 4U4SA 3AXFA 2XD2A 1PB7A 3TTNA 3U92A 3GLBA 2I0BA 4UA8A 3IOTA 3VVDA 1B1XA 4AQ4A 2XHDA 1GGGA 4M4GA 3U72A 3RTFB 2QMXA 4LZ5A 2G29A 4ZS9A 2F36A 1PB9A 4DLDA 1YPNA 4KYEA 1OVBA 3O66A 3VDFA 1FTKA 3FVOA 3OO8A 3IJOB 1MXYA 2FA7A 1XHYA 3KSXA 4BDOA 3EQ1A 4QFPA 1URDA 1JW4A 2F97A 3G3KA 1MXWA 1MXZA 1P1NA 4NF6A 1AOVA 1MPBA 1XVYA 3K1NA 3QSLA 4H1XA 2YLNA 4KQPA 2W7YA 4QFOA 4RPNA 1PB8A 2Z23A 3C9HA 3T96B 2OLBA 4MBPA 4TLLB 5JTYB 3R6UA 1XVXA 5H8FB 5FTIA 1NL5A 4OQOA 4DDDA 4KCCA 2NUVA 2QL3A 3UGWA 1MXVA 3FXUA 3MZBA 1R9QA 2ZYOA 2HXWA 1IXCA 3IORA 3JV9A 1WDNA 5H8NA 3KN7A 5CMCA 4GRKA 3QYTA 4FE8A 2XXUA 2XD3A 3RN8A 2QSXA 3CFXA 4F3GA 1B7HA 2I3VA 3PD9A 4HCYA 4NWDA 1B3FA 4H8IA 2ZYMA 3MWBA 3FD3A 1O64A 2XXIA 4G68A 3RY3A 4GD5A 3LSXA 1L5TA 4F2OA 5I2NA 4X1DA 2YPNA 3OSQA 3IJXB 1N0TA 5I2KB 5H8QB 4F3PA 4KYDA 1EH3A 4H65A 1JVXA 3U1OA 1M5BA 4FIMA 3SEUA 5FHNA 2QJEA 1TFDA 5TPAA 1R9LA 1N7XA 3EHSA 4YB7A 2OBGA 2QS1A 3FV2A 2NXOA 4DIGA 4G77A 3TODA 1FTLA 1VE4A 4O3AA 4DCYA 4GXAA 3LC8A 2O7IA 5FHMA 4C0RA 4DE8A 3JYRA 4YICA 3E13X 3W9VA 2I4CA 2P0SA 2H98A 1XOCA 2VOZA 4ESXA 3CI8A 3CSBA 4KHZE 5H8HB 4U2RA 5KCJB 3C4MA 5DVJA 5AA4B 3ONMA 1QUJA 3B6TA 1OQHA 3WAFA 1B3HA 4TQUQ 3CR9A 1HSEA 1ELJA 1Y4CA 3TTMA 4IO4A 1UQWA 3A3CA 2D3IA 4YKPA 1NNTA 5DYHA 3FXRA 4BDQA 4YB6A 4ZEKA 1LAFE 4FJPA 3T66A 2PYYA 2O68A 4Q8RA 2RCBA 5AA3A 2M8CA 3TFLA 1SW2A 4RJZA 4L17A 2XX7A 3LUYA 2V3QA 3SEYA 1DSNA 3C36A 1H43A 3N6UA 3O2AA 4R9FA 4WEDA 1B4ZA 4DZ1A 3Q28A 1YAEA 2PT1A 3KOTA 4LVQA 2XXRA 2O1LA 2Z8FA 3QIMA 2F7CA 2NOOA 3GBAA 2DE3A 2XXTA 1B3EA 3TKDA 1VR5A 2ZYNA 4OTEA 1S50A 2A5TA 3K1MA 5I2NB 1QUIA 4X1BA 4EQBA 3K4UA 3Q29A 1F9BA 4RA1A 2DWIA 1B2HA 4JSOA 3E9XA 3CG1A 4THIA 1PDAA 3USDA 3T9UA 5AA2A 2AYSA 1VSOA 1B9JA 4YU0A 5CMKA 1DOTA 1MQGA 3TAJA 3S9NC 5TPAB 4QSEA 2LAOA 2RINA 1ATGA 1CE2A 2HAVA 3H6UA 2IA4A 3MUQA 3BKIB 2B3BA 3Q27A 1FQEA 4QFLA 1N76A 4QFNA 2HAUA 5EHMA 1MY2A 4F29A 2DOJA 3HV1A 4P11A 1LFIA 3ZKLA 2WKYA 5L8DA 1RYXA 4E0WA 4LUBA 5H8SA 2RC7A 3CSGA 2I48A 3F11A 3K6XA 4GIZA 1N04A 1MQHA 5CMMA 4F1YA 1D4NA 3OEMA 4EQ7A 3RLFE 1LBBA 3S9EA 3MJNA 4PFTA 3IO4A 4MLVA 3L6GA 4KCDA 1N3XA 1A7LA 3K6UA 4H8JA 1LB8A 2Q2AA 5JTYA 2XXPA 3H03A 1ZBMA 3ZS6A 5AE4A 2V25A 1GTKA 1SBPA 1YTVA 3FGSA 4KR5A 2OK2A 4OVJA 2UYFA 2A5SA 2FYIA 3H6TA 3IOWA 2ABHA 2DXYA 3ODBA 5L9MA 3UN6A 2R6GE 4OENA 1ZIUA 1XC1A 5DT6A 3WAEA 1Y4TA 2DS9A 2RC9A 3V5AA 4POWA 1MDP1 4NWCA 3GBBA 2A5TB 5L9SA 4MF3A 1JW1A 4OFJA 1I6AA 3SETA 2DYXA 5CM6A 1B32A 4PE5B 3U8QA 3UIFA 4Q0CA 3G3HA 4H6DA 1M5FA 2AIXA 3I3VA 2QS3A 5H8QA 1I6BA 4U22A 2ONSA 2ZXTA 3OO9A 4F19A 3BFUA 3CG3A 4U4XA 1B1HA 2XXVA 3T9HB 1MQIA 3MVZA 4GOTA 2QMWA 1IZ1A 3FATA 1H44A 3T9VA 1XS5A 4OFLA 3S4UA 1MG1A 4WXJA 1IXHA 4POXA 3KGCA 1MRPA 1TT1A 3FVNA 4G68C 1LFHA 1IXIA 3K2DA 4XKPA 1Y3QA 4FECA 4RPOA 3S9MC 4ELOA 1BKAA 1P1QA 1Y1ZA 3PPRA 4NMYA 1URGA 1SW1A 1A40A 2IEEA 1NNPA 2B3FA 1NH7A 1MM7A 5H8HA 4OYVA 4GWOA 5KCJA 4XKRA 4F1VA 5AA4A 4TOZA 3KG2A 3U94A 3SKPA 4F31B 1Q35A 3G3JA 1BLFA 4ZEBA 1ZTYA 1H3DA 2XXHA 4G4PA 3TEPA 2H25A 2BJJX 3S2VA 4E0XA 3EHTA 1MM6A 2ZNSA 3A3UA 4ESWA 1Y3NA 2ESNA 2ONKE 1O63A 4QFKA 1US5A 3IB1A 2ZMBA 4FAJA 2Q2CA 1HSJA 3MVWA 2YJPA 4H5FA 1O7TA 2E1SA 3KSJA 1Z7NE 3K01A 3E4RA 1JEUA 3CFLA 1DTZA 4I1DA 3IAZA 2DXRA 1BTJA 4KYSA 1ZJLA 4F39A 3MP8A 2H99A 1ZLQA 3TYHA 3C31A 2NVUB 2H5YA 2AL5A 3IB2A 5IKBA 3PMVA 4C1TA 2REGA 4ELPA 3M3LA 1OLAA 3FZVA 4IO2A 1R6ZA 4IGRA 1DPEA 2G93A 3RQTA 3OO7A 4XKNA 2VD2A 1II5A 2Y84A 3PUXE 5LOMA 2DE4A 1A99A 4JB7A 1SW4A 4BDLA 4OEVA 1QKAA 4IO5A 2XX8A 2Y7RA 3PUVE 2H4IA 2DWAA 4XIGQ 2CZLA 2F6GA 4XKQA 3TPAA 5K2YA 1A54A 3TTLA 2B65A 2PX1A 4N07A 3PD8A 1XT8A 4GVOA 4ZZEA 1UTHB 4OEUA 3RNNA 1LAXA 2UXAA 2F78A 3M3KA 1WODA 3W9WA 5KDTB 4AB5A 2HCAA 2PT2A 3UK4A 4LZ7A 2VD3A 2HZLA 1GV8A 3OENA 3HHFA 1S7YA 2H9BA 4R75A 3PPOA 2FNCA 2O69A 2RKMA 4X48A 1MY0A 3VXBA 3IX1A 4GL8A 2DWJA 4I62A 3CFZA 2F8DA 3SDFA 1M5CA 3TMGA 3B6QA 1MDQA 3T93B 1UTBB 4ZECA 4BDMA 3OXNA 4N6PA 3I5OA 1MPDA 4YKIA 3IK6B 1SI0A 3V89B 5CRYA 2VP1A 3KN3A 3MP6A 5M2VA 4GQOA 2R71A 3N94A 2REJA 2V3TA 3OMBA 1GR2A 3MW0A 1P99A 3LSWA 2I58A 3N26A 2D5WA 3PMWA 2QPQA 1DTGA 4UACA 4BDRA 4RK9A 2HFBA 4XXUA 1QJMA 3HPIA 3LBSA 4OERA 2RCAA 1EU8A 2Z8EA 4F22A 1JQFA 1FTMA 1WVJA 2Z8DA 1OVTA 1A8EA 3O28A 4OWDA 3PUZE 1UIUA 3RT8A 4EXLA 3B7DA 3V8XB 1RKMA 3THIA 3PV0E 1POTA 1FQBA 4OZ9A 5DVFA 2HEUA 3W15C 1SDXA 2CMOA 1QUKA 3IOVA 1I6QA 3A09A 5IAIA 2GHBA 2Y7KA 1Y20A 3OD7A 3IR1A 4WKMA 2E0SA 3GZGA 3MPLA 3ZSFA 1QVSA 4RYAA 3R26A 3QUFA 2Q88A 4BDNA 3FJ7A 4YKKA 4ECFA 3I6VA 4QSDA 4QHQA 4OHNA 3BFTA 3FXQA 1J1NA 3KJTA 5TU0A 1LLSA 5DTBA 3PGFA 2UVGA 4ISUA 4ZDMA 1TXFA 3TDJA 1B7ZA 4Z0IA 4R6KA 2I49A 4R2FA 1SD3A 4ZZAA 4GL0A 3FUZA 4G8HA 3V83A 4NE4A 1US4A 3C35A 2RF1A 3O29A 2QRYA 3BBRA 3PU5A 2HQ0A 2Q9TA 3HN0A 3K00A 2DWHA 4F2QA 5DEXA 1R1NA 5ICTA 2GRVA 3IO6A 4DXUA 1N84A 3H6VA 1B40A 5F1QA 3OOAA
chains in the Genus database with same CATH superfamily
5IZ3B 4LONB 3TCGA 1BIYA 2P1SA 3MP1A 4JXIA 3VLUA 1EZPA 4N4UA 2VPNA 3RUMA 2UVJA 1B7UA 2O84X 2CEXA 1LAGE 4PP0A 1NMUA 5CBSA 5ICQA 4U1ZA 2R9JA 4MFIA 2UYEA 4I3YA 1DMBA 1Y9UA 3UORA 4GBWA 5I57A 5CC2A 1LB9A 1ZU0A 2VHAA 3MQ9A 3SEXA 4EF1A 2Q8JA 3SZPA 4AB6A 3O6HA 3K02A 3UA8A 4IY5A 3QK6A 5FBPA 5LDZA 4ZEFA 1BP5A 3VVFA 4XFEA 4PQJA 2XX9A 5TP9A 3EPEA 4JSDA 1FPGA 2DQVA 1B0HA 4N13A 4R72A 3K1PA 1LSTA 4OMBA 4R6HA 3B6WA 3G7WA 1KWHA 1FQAA 4YMAA 2V84A 4WEPA 4F3BA 4P56A 2F7AA 1FQDA 3PPNA 2I0CA 2UVHA 4GXSB 4OFOA 3SEWA 4ZEIA 4G2ZA 1PEBA 5ITOA 2Q8MA 4FBPA 3B50A 1OMPA 2O7UA 2PCRA 1QKBA 1M5DA 2OZZA 5I59A 1NV0A 4IY6A 1UTHA 2F7BA 3KOSA 3MZ9A 1NI9A 2ANJA 4HS7A 3S9LC 3IFAA 4MH5A 4KI0E 5KDTA 3ECRA 4R6YA 1FTOA 3TZAA 4OVRA 2ALUA 1H76A 4DCXA 1UIVA 2X7PA 5FTHA 2WYPA 4ONYA 1NKXA 3O6GA 1B46A 4EXKA 4O3BA 5HPQA 1FW0A 4NEDA 4PFYA 1B6HA 5CBRA 4KXPA 1ANFA 3D4GA 4I9DA 2DSFA 2P2AA 4IO6A 2F6PA 3TCFA 3C33A 4IR8A 5HBCA 1OLCA 5A5XB 1Z7ME 4O3CA 5DEXB 3H7MA 2DVZA 4NX1A 3O6IA 1NV4A 1INPA 4DXCA 5AA2D 4N91A 1POY1 3K6WA 4ZE8A 3LSFB 5JK4A 4C1UA 5I58B 3HCQA 3HO7A 5HM4B 1UTBA 1B58A 2RC8A 4EF2A 5L9OA 1Y1MA 4FORA 1B5HA 1FPDA 1SYIA 3RPWA 1A8FA 1VFEA 1MQJA 3FJGA 3RGYA 1Q1KA 2O1MA 4GFRA 3P7IA 4JBZA 2GH9A 1JNFA 3PTYA 1YCJA 3CRBA 1HSLA 4OXVA 5I57B 1IXGA 4PGPA 1DPPA 1FBHA 1MY1A 4PETA 3BIGA 2FBPA 4QRZA 5IZZA 5BWJA 1FTAA 3VXCA 4R73A 4DI3D 3VVEA 1FTJA 3IOUA 5I3SA 5I84A 3LV0A 4JWYA 1USYE 1PBPA 3DLNA 3KBRA 3G3GA 3T22A 1Y3PA 5TP9B 2ZNUA 5ET7A 4EQ9A 2X26A 1OIBA 1VDWA 4AS5A 1RYOA 4MLQA 3O97A 3TTRA 3VLWA 4TLMB 2XXWA 2HZKA 2XXQA 3MSTA 3PMXA 4U1OA 5CI5A 4HTGA 1NUZA 1D9YA 1B52A 2I6EA 4DXBA 4R74A 1D9VA 3QXMA 4KD5A 2X7QA 4QF9A 3PUYE 5IZ1A 1FJ9A 1FQCA 2GFEA 1EZ9A 5B7DA 4G61A 1LBXA 3E3KA 4PFWA 3DELB 2AL4A 5I59B 1LCTA 5ELVA 2Y5KA 1LBZA 4F3SA 2GQ1A 4QSCA 4NN3A 4XTCQ 3KZGA 5I56A 5FHOA 1URSA 2F34A 4PF8A 2F3BA 2OWTA 2DP8A 4OESA 1MH4A 4K3FA 2BJIA 4P9KA 3H06B 4HCWA 1NFTA 3SESA 2FHYA 4LATA 1BK4A 4N6DA 2DVCA 2ZYKA 3GXAA 2F35A 3T9XB 4X9TA 5EHSA 3PPQA 1A55A 2P3VA 4PFUA 3C32A 4PFBA 3Q26A 4RY1A 5J1DA 4ND9A 3SEVA 5KZTA 3G3FA 3KFMA 2ONRA 2OJTA 1MQDA 4G8MA 1FSAA 4BLAA 3L6HA 4HE2A 4NF6B 3DP8A 3VFJA 1FQFA 3OSRA 3U93A 4RNSA 3PUWE 1MXXA 2PMSA 4NTLA 3KJ7A 5IZ3A 4H0WA 1AH5A 1DCUA 1LGBC 3BIHA 4Q30B 3ZKKA 2O6AA 3RTWB 4IO7A 1JVYA 2F5XA 5BUUA 1EZOA 2D21A 3KN8A 1NNKA 3KEIA 4N81A 3FIRA 2KLFA 1D9QA 3M3FA 1PC3A 2DE2A 1AL3A 1NV6A 5AA1A 2XXYA 5H8NB 2OCUA 3OEKA 5LTCA 2Y7PA 4OETA 3H4ZA 3TCHA 2L5VA 2ZNTA 4P8BA 1SYHA 3MAMA 1I69A 4HW8A 3OO6A 4OVSA 4OA4A 1IUDA 4NF8A 3H6WA 1LCFA 1EYIA 2FVZA 1JP4A 3TUSA 1B4HA 4H5GA 1VFDA 5A5LA 1YYZA 2HHMA 3GYYA 4R2BA 4YMBA 1B3LA 4FATA 1N7WA 1IQ7A 1JEVA 4MNPA 2PVUA 3CIJA 3K6VA 4G8NA 4G68B 1MY4A 3EHUA 1FBCA 5ET6A 3FV1A 3PPPA 4P0GA 3EF7A 4NF5A 4YAHX 1Q9DA 2QS2A 1MXUA 4H67A 1LFGA 1P1WA 4MEVA 4JWOA 1SW5A 3N6TA 1B05A 2Y5LA 1QULA 4FEBA 3ILTB 4NF4A 4N8GA 2Y7IA 2F3DA 2OX3A 4LQ2A 4IGTA 5ITPA 3Q25A 3VV5A 1MPCA 1IEJA 2Z22A 4GWUA 2VGQA 5I56B 1P1OA 4LZ8A 2OWSA 5B70A 1FPBA 3DP4A 3MBPA 2Q89A 1MH3A 1D3KA 1B5JA 3EN3A 1IMCA 3D4CA 5CMBA 1M5EA 1FPFA 5K2XA 4IB2A 1IMFA 1B5IA 2XWVA 1IIWA 3HSTA 4GF8A 1LBVA 4JWXA 2Y7WA 1NV3A 3DP6A 4UABA 1LBCA 1NH8A 3MC2A 2PFZA 4GWZA 3FJMA 1AMFA 4N15A 1JETA 4GWYA 5A5XA 4P1EA 3R7XA 4P0IA 3DM0A 4F1UA 4JDFA 1SVXB 5I58A 3MPKA 4Q5TA 3O9PA 4LQ5A 3ROJA 5ISUA 4LP2B 3A29A 1OQGA 3N5LA 3M8UA 3SERA 4ZEDA 4KPTA 4OVTA 2QS4A 3K0VA 5F7VA 3TELA 2I4BA 2GHAA 1P1UA 3UP9A 4ZE9A 3FASA 3OELA 4ELQA 2PBWA 1SQYA 3TQWA 4GLIA 3C34A 5ESYA 1B0LA 1FBPA 5DVIA 3TQLA 3CVGA 1MY3A 1B51A 5H8FA 4YKJA 1ZMGA 3IL1B 4M1VA 2VPOA 1T0KA 5IM2A 3MZ1A 1LEVA 4Z7EA 4HE1A 1USYH 1TFAA 1GVCA 2V93A 1NUXA 3QAXA 3ILUB 1N3WA 3TTKA 1H45A 1NNFA 3QUJA 3VLVA 4NF8B 4R9GA 1CB6A 2THIA 3H3GA 3MVYA 3LR1A 4U23A 2ZZVA 3EKIA 1B3GA 3RPLB 5DW8A 4ELRA 4EDPA 1FCKA 4LA9A 1PBQA 1JW5A 4KFQA 3HHGA 3FVGA 4YZZA 2O51A 1IITA 4O94A 5ET8A 2XXXA 3KC1A 1QW0A 1AIVA 4NF5B 5JEIA 1MS7A 4I8CA 4RK2A 2NWJA 3MVXA 1SI1A 1S9TA 2I3WA 3LSLA 1FJ6A 1LAHE 3IB0A 4I3EA 3VE1B 4PBQA 4F18A 2UVIA 5AA2B 3RT6B 4IO3A 4NF4B 3JZJA 3G3IA 5I2KA 3FVKA 4RXLA 2DDKA 2XA5A 5EYFA 4YB5A 4U21A 1ZKBA 4EUOA 4FEDA 2Q74A 2V3UA 1TWYA 4U4SA 3AXFA 2XD2A 1PB7A 3TTNA 3U92A 3GLBA 2I0BA 4UA8A 3IOTA 3VVDA 1B1XA 4AQ4A 2XHDA 1GGGA 4M4GA 4QXDA 1FBEA 2B4MA 3U72A 3RTFB 2QMXA 4LZ5A 2G29A 4ZS9A 4GBVA 2F36A 1PB9A 4DLDA 1YPNA 4KYEA 1OVBA 3O66A 3VDFA 1FTKA 3FVOA 3OO8A 3IJOB 1MXYA 2FA7A 1XHYA 3KSXA 4BDOA 3EQ1A 4QFPA 1URDA 1JW4A 2F97A 3G3KA 1MXWA 1MXZA 4PFIA 4MAGA 1P1NA 1IMBA 4HE0A 4NF6A 4GWSA 1AOVA 1MPBA 1XVYA 3K1NA 3QSLA 4H1XA 2YLNA 4KQPA 2W7YA 4QFOA 4NAPA 4RPNA 1PB8A 2Z23A 3C9HA 3T96B 2OLBA 4MBPA 4TLLB 5JTYB 3R6UA 1XVXA 5H8FB 5FTIA 1NL5A 1NV1A 4OQOA 4DDDA 4NHBA 2HXRA 4KCCA 2NUVA 2QL3A 3UGWA 1MXVA 3FXUA 3MZBA 1R9QA 2ZYOA 2HXWA 1IXCA 4PDHA 3IORA 2WX9A 1WDNA 3JV9A 4PF6A 3KN7A 5H8NA 5CMCA 4GRKA 3QYTA 4FE8A 2XXUA 2XD3A 5EQ7A 3RN8A 4PE3A 2QSXA 3CFXA 4F3GA 1B7HA 2I3VA 3PD9A 4HCYA 4NWDA 1B3FA 4H8IA 2ZYMA 4MJOA 4MMPA 3FXBA 3MWBA 3FD3A 1KA0A 1O64A 2XXIA 4G68A 3RY3A 4GD5A 3LSXA 1L5TA 1FPKA 4F2OA 5I2NA 4X1DA 2YPNA 3OSQA 3IJXB 1N0TA 4X04A 1DBZA 5I2KB 1SPIA 5H8QB 4F3PA 4KYDA 1EH3A 4H65A 4PAIA 3KC0A 1FBFA 1JVXA 3U1OA 1M5BA 3ISPA 4FIMA 3SEUA 4NQ8A 4XEQA 5FHNA 2QJEA 1TFDA 5TPAA 1G0HA 1R9LA 1N7XA 3EHSA 4YB7A 2OBGA 2QS1A 3FV2A 2NXOA 4DIGA 4G77A 3TODA 1FTLA 1VE4A 4O3AA 4DCYA 4GXAA 3LC8A 1AWBA 1NUYA 2O7IA 5FHMA 4C0RA 4DE8A 3JYRA 2XWOA 4YICA 3E13X 3W9VA 2I4CA 4NF0A 2P0SA 5EQ9A 2H98A 1XOCA 2VOZA 4ESXA 3CI8A 3CSBA 1FRPA 4KHZE 5H8HB 4U2RA 5KCJB 3C4MA 5DVJA 5AA4B 3ONMA 1QUJA 3B6TA 1OQHA 3WAFA 1B3HA 4TQUQ 3CR9A 1HSEA 1ELJA 1Y4CA 1FBDA 2VT5A 3TTMA 4IO4A 1UQWA 3A3CA 3QMFA 1CNQA 4N8YA 2D3IA 4YKPA 3B8BA 1NNTA 5DYHA 4PFRA 3FXRA 4BDQA 1NV7A 4YB6A 4ZEKA 1LAFE 4FJPA 3T66A 2PYYA 2O68A 4MCOA 4Q8RA 1IMDA 2RCBA 5AA3A 2M8CA 1NV2A 3TFLA 1SW2A 4RJZA 2FIXA 3LUZA 4L17A 2XX7A 3LUYA 2V3QA 3SEYA 1DSNA 3C36A 2WEFA 1H43A 3N6UA 3O2AA 4R9FA 4WEDA 1B4ZA 4DZ1A 3Q28A 1YAEA 2PT1A 3KOTA 4LVQA 2XXRA 2O1LA 2Z8FA 3MYUA 3QIMA 2F7CA 2NOOA 4X8RA 3GBAA 1FPIA 2DE3A 4PBHA 2XXTA 5J16A 1B3EA 3RPLA 3TKDA 2XWIA 1VR5A 2ZYNA 4OTEA 1S50A 2A5TA 3K1MA 5I2NB 1QUIA 4X1BA 4EQBA 3K4UA 3Q29A 1F9BA 4RA1A 2DWIA 2PFYA 1B2HA 4JSOA 2JJKA 3E9XA 1NV5A 3CG1A 4THIA 1PDAA 3USDA 3T9UA 5AA2A 2AYSA 1VSOA 1B9JA 4YU0A 2MKZA 1XI6A 5CMKA 3CHGA 1DOTA 1MQGA 3TAJA 3S9NC 4DI4B 5TPAB 4QSEA 2LAOA 2RINA 1ATGA 1CE2A 2HAVA 3H6UA 2IA4A 2WYKA 3MUQA 3BKIB 2QVVA 4MX6A 2B3BA 3Q27A 4GX6A 5T3JA 1DK4A 1FQEA 4QFLA 1N76A 2R8TA 4QFNA 2HAUA 5EHMA 1MY2A 4F29A 2DOJA 4N6KA 4NGUA 3HV1A 4P11A 1LFIA 1K9YA 3ZKLA 2WKYA 5L8DA 1RYXA 4E0WA 4LUBA 1K9ZA 5H8SA 2RC7A 3CSGA 2I48A 3F11A 3K6XA 4GIZA 1N04A 1MQHA 5CMMA 4F1YA 1D4NA 3OEMA 2FIEA 4EQ7A 4GWWA 4H45A 3RLFE 1LBBA 4PGNA 3S9EA 3MJNA 4PFTA 2XXKA 3IO4A 4MLVA 3T0JA 3L6GA 4KCDA 1N3XA 1A7LA 3K6UA 3RYDA 4H8JA 1LB8A 2Q2AA 5JTYA 2XXPA 3H03A 1ZBMA 4P3LA 3ZS6A 5AE4A 2V25A 3E79A 1GTKA 1SBPA 1YTVA 3FGSA 4KR5A 4JVCA 2OK2A 4OVJA 2UYFA 1KZ8A 2A5SA 2FYIA 3H6TA 3IOWA 2ABHA 2DXYA 1FPLA 3ODBA 5L9MA 3UN6A 2R6GE 4PC9A 4OENA 1ZIUA 1XC1A 5DT6A 3WAEA 1Y4TA 4OVQA 2DS9A 2RC9A 3V5AA 4POWA 1MDP1 4NWCA 3GBBA 2A5TB 5L9SA 4MF3A 1JW1A 2ZZWA 4OFJA 1I6AA 3SETA 2DYXA 5CM6A 1B32A 4PE5B 3U8QA 4Q0CA 3G3HA 3UIFA 2WBDA 4H46A 4H6DA 1M5FA 5I5PA 2AIXA 3I3VA 2QS3A 5H8QA 1I6BA 4U22A 2ONSA 2ZXTA 3OO9A 4OANA 4F19A 3BFUA 3CG3A 4U4XA 1B1HA 2XXVA 3T9HB 1MQIA 4JVIA 3MVZA 4GOTA 4GX3A 2QMWA 1IZ1A 3FATA 1H44A 3T9VA 1XS5A 4OFLA 3S4UA 4AS4A 1MG1A 4WXJA 1IXHA 4POXA 3KGCA 1MRPA 1TT1A 3FVNA 1IMEA 4G68C 1LFHA 1IXIA 3K2DA 4XKPA 5EYHA 1Y3QA 4FECA 4RPOA 3S9MC 4ELOA 1BKAA 1P1QA 1Y1ZA 3PPRA 4NMYA 3T1BA 1URGA 1IMAA 1SW1A 1A40A 2HPGA 1NNPA 2IEEA 5EYGA 2B3FA 1NH7A 1MM7A 5H8HA 4OYVA 4GWOA 5KCJA 4XKRA 4F1VA 1EYJA 5AA4A 4I40A 4TOZA 4PDDA 3KG2A 3U94A 1KA1A 3SKPA 4F31B 1Q35A 3G3JA 1BLFA 4ZEBA 1ZTYA 1H3DA 2XXHA 4G4PA 3TEPA 1FPJA 2H25A 2BJJX 3S2VA 4E0XA 3EHTA 1MM6A 2XWKA 2ZNSA 3A3UA 4ESWA 1Y3NA 2ESNA 4HXVA 2ONKE 1O63A 4PCDA 2KQZA 4QFKA 1US5A 3IB1A 2ZMBA 4FAJA 2Q2CA 1HSJA 3MVWA 2YJPA 4H5FA 1O7TA 2E1SA 3KSJA 1Z7NE 3K01A 3E4RA 1JEUA 3CFLA 1DTZA 4I1DA 4JVDA 3IAZA 5ET5A 2DXRA 5IGAA 1BTJA 4KYSA 1ZJLA 4F39A 2CZIA 3MP8A 2P3NA 2H99A 1ZLQA 5F24A 3TYHA 3C31A 3HFUA 4P47A 2NVUB 4QBAA 2H5YA 2AL5A 3IB2A 4P1LA 5IKBA 3PMVA 1LBYA 4C1TA 1RDZA 1LBWA 2REGA 4MIJA 3D1RA 2B4LA 4ELPA 3M3LA 1OLAA 3FZVA 4IO2A 1R6ZA 4IGRA 1DPEA 2G93A 3RQTA 3OO7A 4XKNA 4MNIA 2VD2A 1II5A 4O7IA 4XF5A 2Y84A 1RDYA 3PUXE 5LOMA 2DE4A 1A99A 4JB7A 1SW4A 4BDLA 4OEVA 4N17A 1QKAA 4IO5A 2XX8A 2Y7RA 3PUVE 2H4IA 2DWAA 4XIGQ 2CZLA 3U65A 2F6GA 4XKQA 3TPAA 5K2YA 1A54A 2ZZXA 3TTLA 2B65A 2PX1A 4N07A 3PD8A 1XT8A 2QVUA 4GVOA 4ZZEA 2OWZA 1UTHB 4OEUA 3RNNA 1LAXA 2UXAA 2F78A 3M3KA 1WODA 4GWXA 3W9WA 5KDTB 4OVPA 4AB5A 2HCAA 2PT2A 3UK4A 4LZ7A 2VD3A 2HZLA 1NUWA 1GV8A 3OENA 3HHFA 1S7YA 2H9BA 3E78A 4R75A 3PPOA 2FNCA 2O69A 2RKMA 4X48A 1MY0A 2CZHA 3VXBA 3IX1A 4GL8A 2DWJA 4PAFA 3FBPA 2KR0A 4I62A 3CFZA 2F8DA 3SDFA 5EQ8A 1EYKA 1RDXA 1M5CA 3TMGA 3B6QA 4PAKA 1MDQA 3T93B 1UTBB 2QFLA 4ZECA 4BDMA 3OXNA 4N6PA 3I5OA 1YZ0A 1MPDA 4YKIA 3IFCA 3IK6B 1SI0A 5EQAA 3V89B 4O8MA 5CRYA 2WBBA 1FBGA 1YXIA 2VP1A 3KN3A 3MP6A 1QGXA 4GQOA 2R71A 5M2VA 3N94A 2REJA 2V3TA 3OMBA 4O7MA 1GR2A 2V4CA 1P99A 3MW0A 3LSWA 2I58A 3N26A 2D5WA 3PMWA 2QPQA 1DTGA 4UACA 4BDRA 4MNCA 4RK9A 2HFBA 4XXUA 1QJMA 3HPIA 3LBSA 4MHFA 4OERA 2RCAA 1EU8A 1FPEA 2Z8EA 4F22A 1JQFA 1FTMA 1WVJA 2Z8DA 1OVTA 1A8EA 3O28A 4OWDA 3PUZE 4PTKA 1UIUA 3RT8A 4EXLA 3B7DA 4NG7A 3V8XB 1RKMA 3THIA 3PV0E 1POTA 1FQBA 4OZ9A 5DVFA 2HEUA 3W15C 1SDXA 2CMOA 1QUKA 3IOVA 1I6QA 3A09A 5IAIA 2GHBA 2Y7KA 1Y20A 3OD7A 3IR1A 4WKMA 2E0SA 3GZGA 3MPLA 3ZSFA 1QVSA 4RYAA 3R26A 3QUFA 2Q88A 4LN5A 4BDNA 3FJ7A 4YKKA 4ECFA 3I6VA 4QSDA 1G0IA 5I7IA 4QHQA 4OHNA 3BFTA 3FXQA 1J1NA 2CZKA 3KJTA 5TU0A 1LLSA 5DTBA 3PGFA 2UVGA 4ISUA 4ZDMA 1TXFA 3TDJA 1B7ZA 4Z0IA 3NOHA 4R6KA 2QVRA 2I49A 4R2FA 1SD3A 4ZZAA 4GL0A 3FUZA 4G8HA 3V83A 4NE4A 1US4A 3KBZA 3C35A 3O29A 2RF1A 2QRYA 3BBRA 3PU5A 2HQ0A 2Q9TA 3HN0A 2CEYA 3K00A 2DWHA 4F2QA 5DEXA 1R1NA 5ICTA 2GRVA 3IO6A 4GX4A 4DXUA 1N84A 3H6VA 1B40A 5F1QA 3OOAA
chains in the Genus database with same CATH topology
4LONB 3TCGA 1BIYA 2P1SA 3MP1A 4JXIA 3VLUA 1EZPA 3RUMA 2UVJA 1B7UA 2O84X 1LAGE 4PP0A 1NMUA 5CBSA 5ICQA 4U1ZA 2R9JA 4MFIA 2UYEA 1DMBA 1Y9UA 3UORA 5I57A 5CC2A 1LB9A 1ZU0A 2VHAA 3MQ9A 3SEXA 4EF1A 2Q8JA 4AB6A 3O6HA 3K02A 3UA8A 4IY5A 3QK6A 4ZEFA 1BP5A 3VVFA 4PQJA 2XX9A 5TP9A 3EPEA 4JSDA 2DQVA 1B0HA 4N13A 4R72A 3K1PA 1LSTA 4OMBA 4R6HA 3B6WA 3G7WA 1KWHA 1FQAA 4YMAA 2V84A 4WEPA 4F3BA 2F7AA 1FQDA 3PPNA 2I0CA 2UVHA 4GXSB 4OFOA 3SEWA 4ZEIA 4G2ZA 1PEBA 5ITOA 1OMPA 2O7UA 1QKBA 1M5DA 2OZZA 5I59A 4IY6A 1UTHA 2F7BA 3KOSA 3MZ9A 2ANJA 4HS7A 3S9LC 4MH5A 4KI0E 5KDTA 3ECRA 4R6YA 1FTOA 3TZAA 2ALUA 1H76A 4DCXA 1UIVA 2X7PA 5FTHA 4ONYA 1NKXA 3O6GA 1B46A 4EXKA 4O3BA 5HPQA 1FW0A 4NEDA 4PFYA 1B6HA 5CBRA 1ANFA 3D4GA 4I9DA 2DSFA 2P2AA 4IO6A 2F6PA 3TCFA 3C33A 5HBCA 1OLCA 5A5XB 1Z7ME 4O3CA 5DEXB 3H7MA 2DVZA 3O6IA 4DXCA 5AA2D 1POY1 3K6WA 4ZE8A 3LSFB 5JK4A 4C1UA 5I58B 3HCQA 3HO7A 5HM4B 1UTBA 1B58A 2RC8A 4EF2A 5L9OA 1Y1MA 4FORA 1B5HA 1SYIA 3RPWA 1A8FA 1VFEA 1MQJA 3FJGA 3RGYA 1Q1KA 2O1MA 4GFRA 3P7IA 4JBZA 2GH9A 1JNFA 1YCJA 3CRBA 1HSLA 4OXVA 5I57B 1IXGA 1DPPA 1MY1A 4PETA 4QRZA 5BWJA 3VXCA 4R73A 3VVEA 1FTJA 3IOUA 5I84A 4JWYA 1USYE 1PBPA 3DLNA 3KBRA 3G3GA 3T22A 1Y3PA 5TP9B 2ZNUA 4EQ9A 2X26A 1OIBA 1RYOA 4MLQA 3O97A 3TTRA 3VLWA 4TLMB 2XXWA 2HZKA 2XXQA 3PMXA 4U1OA 5CI5A 4HTGA 1D9YA 1B52A 2I6EA 4DXBA 4R74A 1D9VA 3QXMA 4KD5A 2X7QA 4QF9A 3PUYE 1FQCA 2GFEA 1EZ9A 5B7DA 3E3KA 4PFWA 3DELB 2AL4A 5I59B 1LCTA 5ELVA 4F3SA 4QSCA 4XTCQ 3KZGA 5I56A 5FHOA 1URSA 2F34A 2OWTA 2DP8A 4OESA 1MH4A 4K3FA 3H06B 4HCWA 1NFTA 3SESA 4LATA 2DVCA 2ZYKA 3GXAA 2F35A 3T9XB 4X9TA 5EHSA 3PPQA 1A55A 4PFUA 3C32A 3Q26A 4RY1A 5J1DA 4ND9A 3SEVA 5KZTA 3G3FA 3KFMA 2ONRA 2OJTA 1MQDA 4G8MA 4BLAA 3L6HA 4NF6B 3DP8A 3VFJA 1FQFA 3OSRA 3U93A 4RNSA 3PUWE 1MXXA 2PMSA 4NTLA 3KJ7A 4H0WA 1AH5A 1LGBC 4Q30B 3ZKKA 2O6AA 3RTWB 4IO7A 1JVYA 2F5XA 5BUUA 1EZOA 2D21A 3KN8A 1NNKA 3KEIA 3FIRA 2KLFA 3M3FA 1PC3A 2DE2A 1AL3A 5AA1A 2XXYA 5H8NB 2OCUA 3OEKA 2Y7PA 4OETA 3H4ZA 3TCHA 2ZNTA 1SYHA 3MAMA 1I69A 4HW8A 3OO6A 1IUDA 4NF8A 3H6WA 1LCFA 3TUSA 1B4HA 4H5GA 1VFDA 4R2BA 4YMBA 1B3LA 4FATA 1N7WA 1JEVA 1IQ7A 2PVUA 3CIJA 3K6VA 4G8NA 4G68B 1MY4A 3EHUA 3FV1A 3PPPA 4P0GA 3EF7A 4NF5A 4YAHX 2QS2A 1MXUA 4H67A 1LFGA 1P1WA 4JWOA 1SW5A 3N6TA 1B05A 1QULA 4FEBA 3ILTB 4NF4A 2Y7IA 4LQ2A 4IGTA 5ITPA 3Q25A 3VV5A 1MPCA 1IEJA 2Z22A 2VGQA 5I56B 1P1OA 4LZ8A 2OWSA 5B70A 3DP4A 3MBPA 2Q89A 1MH3A 1D3KA 1B5JA 3EN3A 3D4CA 5CMBA 1M5EA 5K2XA 4IB2A 1B5IA 1IIWA 3HSTA 4GF8A 4JWXA 2Y7WA 3DP6A 1LBCA 1NH8A 3MC2A 3FJMA 1AMFA 1JETA 5A5XA 3R7XA 4P0IA 3DM0A 4F1UA 4JDFA 1SVXB 5I58A 3MPKA 4Q5TA 3O9PA 4LQ5A 5ISUA 4LP2B 1OQGA 3N5LA 3M8UA 3SERA 4ZEDA 4KPTA 2QS4A 3K0VA 5F7VA 3TELA 2I4BA 2GHAA 1P1UA 3UP9A 4ZE9A 3FASA 3OELA 4ELQA 2PBWA 1SQYA 3TQWA 4GLIA 3C34A 1B0LA 5DVIA 3TQLA 3CVGA 1MY3A 1B51A 5H8FA 4YKJA 1ZMGA 3IL1B 4M1VA 1T0KA 3MZ1A 4Z7EA 1USYH 1TFAA 1GVCA 2V93A 3QAXA 3ILUB 1N3WA 3TTKA 1H45A 1NNFA 3QUJA 3VLVA 4NF8B 4R9GA 1CB6A 2THIA 3H3GA 3MVYA 3LR1A 4U23A 1B3GA 4ELRA 4EDPA 1FCKA 4LA9A 1PBQA 1JW5A 4KFQA 3HHGA 3FVGA 4YZZA 2O51A 1IITA 2XXXA 1QW0A 1AIVA 4NF5B 5JEIA 1MS7A 4I8CA 4RK2A 2NWJA 3MVXA 1SI1A 1S9TA 2I3WA 3LSLA 1LAHE 3IB0A 3VE1B 4F18A 2UVIA 5AA2B 3RT6B 4IO3A 4NF4B 3JZJA 3G3IA 5I2KA 3FVKA 4RXLA 5EYFA 4YB5A 4U21A 1ZKBA 4EUOA 4FEDA 2V3UA 1TWYA 4U4SA 3AXFA 2XD2A 1PB7A 3TTNA 3U92A 3GLBA 2I0BA 4UA8A 3IOTA 3VVDA 1B1XA 4AQ4A 2XHDA 1GGGA 4M4GA 3U72A 3RTFB 2QMXA 4LZ5A 2G29A 4ZS9A 2F36A 1PB9A 4DLDA 1YPNA 4KYEA 1OVBA 3O66A 3VDFA 1FTKA 3FVOA 3OO8A 3IJOB 1MXYA 2FA7A 1XHYA 3KSXA 4BDOA 3EQ1A 4QFPA 1URDA 1JW4A 2F97A 3G3KA 1MXWA 1MXZA 1P1NA 4NF6A 1AOVA 1MPBA 1XVYA 3K1NA 3QSLA 4H1XA 2YLNA 4KQPA 2W7YA 4QFOA 4RPNA 1PB8A 2Z23A 3C9HA 3T96B 2OLBA 4MBPA 4TLLB 5JTYB 3R6UA 1XVXA 5H8FB 5FTIA 1NL5A 4OQOA 4DDDA 4KCCA 2NUVA 2QL3A 3UGWA 1MXVA 3FXUA 3MZBA 1R9QA 2ZYOA 2HXWA 1IXCA 3IORA 3JV9A 1WDNA 5H8NA 3KN7A 5CMCA 4GRKA 3QYTA 4FE8A 2XXUA 2XD3A 3RN8A 2QSXA 3CFXA 4F3GA 1B7HA 2I3VA 3PD9A 4HCYA 4NWDA 1B3FA 4H8IA 2ZYMA 3MWBA 3FD3A 1O64A 2XXIA 4G68A 3RY3A 4GD5A 3LSXA 1L5TA 4F2OA 5I2NA 4X1DA 2YPNA 3OSQA 3IJXB 1N0TA 5I2KB 5H8QB 4F3PA 4KYDA 1EH3A 4H65A 1JVXA 3U1OA 1M5BA 4FIMA 3SEUA 5FHNA 2QJEA 1TFDA 5TPAA 1R9LA 1N7XA 3EHSA 4YB7A 2OBGA 2QS1A 3FV2A 2NXOA 4DIGA 4G77A 3TODA 1FTLA 1VE4A 4O3AA 4DCYA 4GXAA 3LC8A 2O7IA 5FHMA 4C0RA 4DE8A 3JYRA 4YICA 3E13X 3W9VA 2I4CA 2P0SA 2H98A 1XOCA 2VOZA 4ESXA 3CI8A 3CSBA 4KHZE 5H8HB 4U2RA 5KCJB 3C4MA 5DVJA 5AA4B 3ONMA 1QUJA 3B6TA 1OQHA 3WAFA 1B3HA 4TQUQ 3CR9A 1HSEA 1ELJA 1Y4CA 3TTMA 4IO4A 1UQWA 3A3CA 2D3IA 4YKPA 1NNTA 5DYHA 3FXRA 4BDQA 4YB6A 4ZEKA 1LAFE 4FJPA 3T66A 2PYYA 2O68A 4Q8RA 2RCBA 5AA3A 2M8CA 3TFLA 1SW2A 4RJZA 4L17A 2XX7A 3LUYA 2V3QA 3SEYA 1DSNA 3C36A 1H43A 3N6UA 3O2AA 4R9FA 4WEDA 1B4ZA 4DZ1A 3Q28A 1YAEA 2PT1A 3KOTA 4LVQA 2XXRA 2O1LA 2Z8FA 3QIMA 2F7CA 2NOOA 3GBAA 2DE3A 2XXTA 1B3EA 3TKDA 1VR5A 2ZYNA 4OTEA 1S50A 2A5TA 3K1MA 5I2NB 1QUIA 4X1BA 4EQBA 3K4UA 3Q29A 1F9BA 4RA1A 2DWIA 1B2HA 4JSOA 3E9XA 3CG1A 4THIA 1PDAA 3USDA 3T9UA 5AA2A 2AYSA 1VSOA 1B9JA 4YU0A 5CMKA 1DOTA 1MQGA 3TAJA 3S9NC 5TPAB 4QSEA 2LAOA 2RINA 1ATGA 1CE2A 2HAVA 3H6UA 2IA4A 3MUQA 3BKIB 2B3BA 3Q27A 1FQEA 4QFLA 1N76A 4QFNA 2HAUA 5EHMA 1MY2A 4F29A 2DOJA 3HV1A 4P11A 1LFIA 3ZKLA 2WKYA 5L8DA 1RYXA 4E0WA 4LUBA 5H8SA 2RC7A 3CSGA 2I48A 3F11A 3K6XA 4GIZA 1N04A 1MQHA 5CMMA 4F1YA 1D4NA 3OEMA 4EQ7A 3RLFE 1LBBA 3S9EA 3MJNA 4PFTA 3IO4A 4MLVA 3L6GA 4KCDA 1N3XA 1A7LA 3K6UA 4H8JA 1LB8A 2Q2AA 5JTYA 2XXPA 3H03A 1ZBMA 3ZS6A 5AE4A 2V25A 1GTKA 1SBPA 1YTVA 3FGSA 4KR5A 2OK2A 4OVJA 2UYFA 2A5SA 2FYIA 3H6TA 3IOWA 2ABHA 2DXYA 3ODBA 5L9MA 3UN6A 2R6GE 4OENA 1ZIUA 1XC1A 5DT6A 3WAEA 1Y4TA 2DS9A 2RC9A 3V5AA 4POWA 1MDP1 4NWCA 3GBBA 2A5TB 5L9SA 4MF3A 1JW1A 4OFJA 1I6AA 3SETA 2DYXA 5CM6A 1B32A 4PE5B 3U8QA 3UIFA 4Q0CA 3G3HA 4H6DA 1M5FA 2AIXA 3I3VA 2QS3A 5H8QA 1I6BA 4U22A 2ONSA 2ZXTA 3OO9A 4F19A 3BFUA 3CG3A 4U4XA 1B1HA 2XXVA 3T9HB 1MQIA 3MVZA 4GOTA 2QMWA 1IZ1A 3FATA 1H44A 3T9VA 1XS5A 4OFLA 3S4UA 1MG1A 4WXJA 1IXHA 4POXA 3KGCA 1MRPA 1TT1A 3FVNA 4G68C 1LFHA 1IXIA 3K2DA 4XKPA 1Y3QA 4FECA 4RPOA 3S9MC 4ELOA 1BKAA 1P1QA 1Y1ZA 3PPRA 4NMYA 1URGA 1SW1A 1A40A 2IEEA 1NNPA 2B3FA 1NH7A 1MM7A 5H8HA 4OYVA 4GWOA 5KCJA 4XKRA 4F1VA 5AA4A 4TOZA 3KG2A 3U94A 3SKPA 4F31B 1Q35A 3G3JA 1BLFA 4ZEBA 1ZTYA 1H3DA 2XXHA 4G4PA 3TEPA 2H25A 2BJJX 3S2VA 4E0XA 3EHTA 1MM6A 2ZNSA 3A3UA 4ESWA 1Y3NA 2ESNA 2ONKE 1O63A 4QFKA 1US5A 3IB1A 2ZMBA 4FAJA 2Q2CA 1HSJA 3MVWA 2YJPA 4H5FA 1O7TA 2E1SA 3KSJA 1Z7NE 3K01A 3E4RA 1JEUA 3CFLA 1DTZA 4I1DA 3IAZA 2DXRA 1BTJA 4KYSA 1ZJLA 4F39A 3MP8A 2H99A 1ZLQA 3TYHA 3C31A 2NVUB 2H5YA 2AL5A 3IB2A 5IKBA 3PMVA 4C1TA 2REGA 4ELPA 3M3LA 1OLAA 3FZVA 4IO2A 1R6ZA 4IGRA 1DPEA 2G93A 3RQTA 3OO7A 4XKNA 2VD2A 1II5A 2Y84A 3PUXE 5LOMA 2DE4A 1A99A 4JB7A 1SW4A 4BDLA 4OEVA 1QKAA 4IO5A 2XX8A 2Y7RA 3PUVE 2H4IA 2DWAA 4XIGQ 2CZLA 2F6GA 4XKQA 3TPAA 5K2YA 1A54A 3TTLA 2B65A 2PX1A 4N07A 3PD8A 1XT8A 4GVOA 4ZZEA 1UTHB 4OEUA 3RNNA 1LAXA 2UXAA 2F78A 3M3KA 1WODA 3W9WA 5KDTB 4AB5A 2HCAA 2PT2A 3UK4A 4LZ7A 2VD3A 2HZLA 1GV8A 3OENA 3HHFA 1S7YA 2H9BA 4R75A 3PPOA 2FNCA 2O69A 2RKMA 4X48A 1MY0A 3VXBA 3IX1A 4GL8A 2DWJA 4I62A 3CFZA 2F8DA 3SDFA 1M5CA 3TMGA 3B6QA 1MDQA 3T93B 1UTBB 4ZECA 4BDMA 3OXNA 4N6PA 3I5OA 1MPDA 4YKIA 3IK6B 1SI0A 3V89B 5CRYA 2VP1A 3KN3A 3MP6A 5M2VA 4GQOA 2R71A 3N94A 2REJA 2V3TA 3OMBA 1GR2A 3MW0A 1P99A 3LSWA 2I58A 3N26A 2D5WA 3PMWA 2QPQA 1DTGA 4UACA 4BDRA 4RK9A 2HFBA 4XXUA 1QJMA 3HPIA 3LBSA 4OERA 2RCAA 1EU8A 2Z8EA 4F22A 1JQFA 1FTMA 1WVJA 2Z8DA 1OVTA 1A8EA 3O28A 4OWDA 3PUZE 1UIUA 3RT8A 4EXLA 3B7DA 3V8XB 1RKMA 3THIA 3PV0E 1POTA 1FQBA 4OZ9A 5DVFA 2HEUA 3W15C 1SDXA 2CMOA 1QUKA 3IOVA 1I6QA 3A09A 5IAIA 2GHBA 2Y7KA 1Y20A 3OD7A 3IR1A 4WKMA 2E0SA 3GZGA 3MPLA 3ZSFA 1QVSA 4RYAA 3R26A 3QUFA 2Q88A 4BDNA 3FJ7A 4YKKA 4ECFA 3I6VA 4QSDA 4QHQA 4OHNA 3BFTA 3FXQA 1J1NA 3KJTA 5TU0A 1LLSA 5DTBA 3PGFA 2UVGA 4ISUA 4ZDMA 1TXFA 3TDJA 1B7ZA 4Z0IA 4R6KA 2I49A 4R2FA 1SD3A 4ZZAA 4GL0A 3FUZA 4G8HA 3V83A 4NE4A 1US4A 3C35A 2RF1A 3O29A 2QRYA 3BBRA 3PU5A 2HQ0A 2Q9TA 3HN0A 3K00A 2DWHA 4F2QA 5DEXA 1R1NA 5ICTA 2GRVA 3IO6A 4DXUA 1N84A 3H6VA 1B40A 5F1QA 3OOAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LON B;  3TCG A;  1BIY A;  2P1S A;  3MP1 A;  4JXI A;  3VLU A;  1EZP A;  3RUM A;  2UVJ A;  1B7U A;  2O84 X;  1LAG E;  4PP0 A;  1NMU A;  5CBS A;  5ICQ A;  4U1Z A;  2R9J A;  4MFI A;  2UYE A;  1DMB A;  1Y9U A;  3UOR A;  5I57 A;  5CC2 A;  1LB9 A;  1ZU0 A;  2VHA A;  3MQ9 A;  3SEX A;  4EF1 A;  2Q8J A;  4AB6 A;  3O6H A;  3K02 A;  3UA8 A;  4IY5 A;  3QK6 A;  4ZEF A;  1BP5 A;  3VVF A;  4PQJ A;  2XX9 A;  5TP9 A;  3EPE A;  4JSD A;  2DQV A;  1B0H A;  4N13 A;  4R72 A;  3K1P A;  1LST A;  4OMB A;  4R6H A;  3B6W A;  3G7W A;  1KWH A;  1FQA A;  4YMA A;  2V84 A;  4WEP A;  4F3B A;  2F7A A;  1FQD A;  3PPN A;  2I0C A;  2UVH A;  4GXS B;  4OFO A;  3SEW A;  4ZEI A;  4G2Z A;  1PEB A;  5ITO A;  1OMP A;  2O7U A;  1QKB A;  1M5D A;  2OZZ A;  5I59 A;  4IY6 A;  1UTH A;  2F7B A;  3KOS A;  3MZ9 A;  2ANJ A;  4HS7 A;  3S9L C;  4MH5 A;  4KI0 E;  5KDT A;  3ECR A;  4R6Y A;  1FTO A;  3TZA A;  2ALU A;  1H76 A;  4DCX A;  1UIV A;  2X7P A;  5FTH A;  4ONY A;  1NKX A;  3O6G A;  1B46 A;  4EXK A;  4O3B A;  5HPQ A;  1FW0 A;  4NED A;  4PFY A;  1B6H A;  5CBR A;  1ANF A;  3D4G A;  4I9D A;  2DSF A;  2P2A A;  4IO6 A;  2F6P A;  3TCF A;  3C33 A;  5HBC A;  1OLC A;  5A5X B;  1Z7M E;  4O3C A;  5DEX B;  3H7M A;  2DVZ A;  3O6I A;  4DXC A;  5AA2 D;  1POY 1;  3K6W A;  4ZE8 A;  3LSF B;  5JK4 A;  4C1U A;  5I58 B;  3HCQ A;  3HO7 A;  5HM4 B;  1UTB A;  1B58 A;  2RC8 A;  4EF2 A;  5L9O A;  1Y1M A;  4FOR A;  1B5H A;  1SYI A;  3RPW A;  1A8F A;  1VFE A;  1MQJ A;  3FJG A;  3RGY A;  1Q1K A;  2O1M A;  4GFR A;  3P7I A;  4JBZ A;  2GH9 A;  1JNF A;  1YCJ A;  3CRB A;  1HSL A;  4OXV A;  5I57 B;  1IXG A;  1DPP A;  1MY1 A;  4PET A;  4QRZ A;  5BWJ A;  3VXC A;  4R73 A;  3VVE A;  1FTJ A;  3IOU A;  5I84 A;  4JWY A;  1USY E;  1PBP A;  3DLN A;  3KBR A;  3G3G A;  3T22 A;  1Y3P A;  5TP9 B;  2ZNU A;  4EQ9 A;  2X26 A;  1OIB A;  1RYO A;  4MLQ A;  3O97 A;  3TTR A;  3VLW A;  4TLM B;  2XXW A;  2HZK A;  2XXQ A;  3PMX A;  4U1O A;  5CI5 A;  4HTG A;  1D9Y A;  1B52 A;  2I6E A;  4DXB A;  4R74 A;  1D9V A;  3QXM A;  4KD5 A;  2X7Q A;  4QF9 A;  3PUY E;  1FQC A;  2GFE A;  1EZ9 A;  5B7D A;  3E3K A;  4PFW A;  3DEL B;  2AL4 A;  5I59 B;  1LCT A;  5ELV A;  4F3S A;  4QSC A;  4XTC Q;  3KZG A;  5I56 A;  5FHO A;  1URS A;  2F34 A;  2OWT A;  2DP8 A;  4OES A;  1MH4 A;  4K3F A;  3H06 B;  4HCW A;  1NFT A;  3SES A;  4LAT A;  2DVC A;  2ZYK A;  3GXA A;  2F35 A;  3T9X B;  4X9T A;  5EHS A;  3PPQ A;  1A55 A;  4PFU A;  3C32 A;  3Q26 A;  4RY1 A;  5J1D A;  4ND9 A;  3SEV A;  5KZT A;  3G3F A;  3KFM A;  2ONR A;  2OJT A;  1MQD A;  4G8M A;  4BLA A;  3L6H A;  4NF6 B;  3DP8 A;  3VFJ A;  1FQF A;  3OSR A;  3U93 A;  4RNS A;  3PUW E;  1MXX A;  2PMS A;  4NTL A;  3KJ7 A;  4H0W A;  1AH5 A;  1LGB C;  4Q30 B;  3ZKK A;  2O6A A;  3RTW B;  4IO7 A;  1JVY A;  2F5X A;  5BUU A;  1EZO A;  2D21 A;  3KN8 A;  1NNK A;  3KEI A;  3FIR A;  2KLF A;  3M3F A;  1PC3 A;  2DE2 A;  1AL3 A;  5AA1 A;  2XXY A;  5H8N B;  2OCU A;  3OEK A;  2Y7P A;  4OET A;  3H4Z A;  3TCH A;  2ZNT A;  1SYH A;  3MAM A;  1I69 A;  4HW8 A;  3OO6 A;  1IUD A;  4NF8 A;  3H6W A;  1LCF A;  3TUS A;  1B4H A;  4H5G A;  1VFD A;  4R2B A;  4YMB A;  1B3L A;  4FAT A;  1N7W A;  1JEV A;  1IQ7 A;  2PVU A;  3CIJ A;  3K6V A;  4G8N A;  4G68 B;  1MY4 A;  3EHU A;  3FV1 A;  3PPP A;  4P0G A;  3EF7 A;  4NF5 A;  4YAH X;  2QS2 A;  1MXU A;  4H67 A;  1LFG A;  1P1W A;  4JWO A;  1SW5 A;  3N6T A;  1B05 A;  1QUL A;  4FEB A;  3ILT B;  4NF4 A;  2Y7I A;  4LQ2 A;  4IGT A;  5ITP A;  3Q25 A;  3VV5 A;  1MPC A;  1IEJ A;  2Z22 A;  2VGQ A;  5I56 B;  1P1O A;  4LZ8 A;  2OWS A;  5B70 A;  3DP4 A;  3MBP A;  2Q89 A;  1MH3 A;  1D3K A;  1B5J A;  3EN3 A;  3D4C A;  5CMB A;  1M5E A;  5K2X A;  4IB2 A;  1B5I A;  1IIW A;  3HST A;  4GF8 A;  4JWX A;  2Y7W A;  3DP6 A;  1LBC A;  1NH8 A;  3MC2 A;  3FJM A;  1AMF A;  1JET A;  5A5X A;  3R7X A;  4P0I A;  3DM0 A;  4F1U A;  4JDF A;  1SVX B;  5I58 A;  3MPK A;  4Q5T A;  3O9P A;  4LQ5 A;  5ISU A;  4LP2 B;  1OQG A;  3N5L A;  3M8U A;  3SER A;  4ZED A;  4KPT A;  2QS4 A;  3K0V A;  5F7V A;  3TEL A;  2I4B A;  2GHA A;  1P1U A;  3UP9 A;  4ZE9 A;  3FAS A;  3OEL A;  4ELQ A;  2PBW A;  1SQY A;  3TQW A;  4GLI A;  3C34 A;  1B0L A;  5DVI A;  3TQL A;  3CVG A;  1MY3 A;  1B51 A;  5H8F A;  4YKJ A;  1ZMG A;  3IL1 B;  4M1V A;  1T0K A;  3MZ1 A;  4Z7E A;  1USY H;  1TFA A;  1GVC A;  2V93 A;  3QAX A;  3ILU B;  1N3W A;  3TTK A;  1H45 A;  1NNF A;  3QUJ A;  3VLV A;  4NF8 B;  4R9G A;  1CB6 A;  2THI A;  3H3G A;  3MVY A;  3LR1 A;  4U23 A;  1B3G A;  4ELR A;  4EDP A;  1FCK A;  4LA9 A;  1PBQ A;  1JW5 A;  4KFQ A;  3HHG A;  3FVG A;  4YZZ A;  2O51 A;  1IIT A;  2XXX A;  1QW0 A;  1AIV A;  4NF5 B;  5JEI A;  1MS7 A;  4I8C A;  4RK2 A;  2NWJ A;  3MVX A;  1SI1 A;  1S9T A;  2I3W A;  3LSL A;  1LAH E;  3IB0 A;  3VE1 B;  4F18 A;  2UVI A;  5AA2 B;  3RT6 B;  4IO3 A;  4NF4 B;  3JZJ A;  3G3I A;  5I2K A;  3FVK A;  4RXL A;  5EYF A;  4YB5 A;  4U21 A;  1ZKB A;  4EUO A;  4FED A;  2V3U A;  1TWY A;  4U4S A;  3AXF A;  2XD2 A;  1PB7 A;  3TTN A;  3U92 A;  3GLB A;  2I0B A;  4UA8 A;  3IOT A;  3VVD A;  1B1X A;  4AQ4 A;  2XHD A;  1GGG A;  4M4G A;  3U72 A;  3RTF B;  2QMX A;  4LZ5 A;  2G29 A;  4ZS9 A;  2F36 A;  1PB9 A;  4DLD A;  1YPN A;  4KYE A;  1OVB A;  3O66 A;  3VDF A;  1FTK A;  3FVO A;  3OO8 A;  3IJO B;  1MXY A;  2FA7 A;  1XHY A;  3KSX A;  4BDO A;  3EQ1 A;  4QFP A;  1URD A;  1JW4 A;  2F97 A;  3G3K A;  1MXW A;  1MXZ A;  1P1N A;  4NF6 A;  1AOV A;  1MPB A;  1XVY A;  3K1N A;  3QSL A;  4H1X A;  2YLN A;  4KQP A;  2W7Y A;  4QFO A;  4RPN A;  1PB8 A;  2Z23 A;  3C9H A;  3T96 B;  2OLB A;  4MBP A;  4TLL B;  5JTY B;  3R6U A;  1XVX A;  5H8F B;  5FTI A;  1NL5 A;  4OQO A;  4DDD A;  4KCC A;  2NUV A;  2QL3 A;  3UGW A;  1MXV A;  3FXU A;  3MZB A;  1R9Q A;  2ZYO A;  2HXW A;  1IXC A;  3IOR A;  3JV9 A;  1WDN A;  5H8N A;  3KN7 A;  5CMC A;  4GRK A;  3QYT A;  4FE8 A;  2XXU A;  2XD3 A;  3RN8 A;  2QSX A;  3CFX A;  4F3G A;  1B7H A;  2I3V A;  3PD9 A;  4HCY A;  4NWD A;  1B3F A;  4H8I A;  2ZYM A;  3MWB A;  3FD3 A;  1O64 A;  2XXI A;  4G68 A;  3RY3 A;  4GD5 A;  3LSX A;  1L5T A;  4F2O A;  5I2N A;  4X1D A;  2YPN A;  3OSQ A;  3IJX B;  1N0T A;  5I2K B;  5H8Q B;  4F3P A;  4KYD A;  1EH3 A;  4H65 A;  1JVX A;  3U1O A;  1M5B A;  4FIM A;  3SEU A;  5FHN A;  2QJE A;  1TFD A;  5TPA A;  1R9L A;  1N7X A;  3EHS A;  4YB7 A;  2OBG A;  2QS1 A;  3FV2 A;  2NXO A;  4DIG A;  4G77 A;  3TOD A;  1FTL A;  1VE4 A;  4O3A A;  4DCY A;  4GXA A;  3LC8 A;  2O7I A;  5FHM A;  4C0R A;  4DE8 A;  3JYR A;  4YIC A;  3E13 X;  3W9V A;  2I4C A;  2P0S A;  2H98 A;  1XOC A;  2VOZ A;  4ESX A;  3CI8 A;  3CSB A;  4KHZ E;  5H8H B;  4U2R A;  5KCJ B;  3C4M A;  5DVJ A;  5AA4 B;  3ONM A;  1QUJ A;  3B6T A;  1OQH A;  3WAF A;  1B3H A;  4TQU Q;  3CR9 A;  1HSE A;  1ELJ A;  1Y4C A;  3TTM A;  4IO4 A;  1UQW A;  3A3C A;  2D3I A;  4YKP A;  1NNT A;  5DYH A;  3FXR A;  4BDQ A;  4YB6 A;  4ZEK A;  1LAF E;  4FJP A;  3T66 A;  2PYY A;  2O68 A;  4Q8R A;  2RCB A;  5AA3 A;  2M8C A;  3TFL A;  1SW2 A;  4RJZ A;  4L17 A;  2XX7 A;  3LUY A;  2V3Q A;  3SEY A;  1DSN A;  3C36 A;  1H43 A;  3N6U A;  3O2A A;  4R9F A;  4WED A;  1B4Z A;  4DZ1 A;  3Q28 A;  1YAE A;  2PT1 A;  3KOT A;  4LVQ A;  2XXR A;  2O1L A;  2Z8F A;  3QIM A;  2F7C A;  2NOO A;  3GBA A;  2DE3 A;  2XXT A;  1B3E A;  3TKD A;  1VR5 A;  2ZYN A;  4OTE A;  1S50 A;  2A5T A;  3K1M A;  5I2N B;  1QUI A;  4X1B A;  4EQB A;  3K4U A;  3Q29 A;  1F9B A;  4RA1 A;  2DWI A;  1B2H A;  4JSO A;  3E9X A;  3CG1 A;  4THI A;  1PDA A;  3USD A;  3T9U A;  5AA2 A;  2AYS A;  1VSO A;  1B9J A;  4YU0 A;  5CMK A;  1DOT A;  1MQG A;  3TAJ A;  3S9N C;  5TPA B;  4QSE A;  2LAO A;  2RIN A;  1ATG A;  1CE2 A;  2HAV A;  3H6U A;  2IA4 A;  3MUQ A;  3BKI B;  2B3B A;  3Q27 A;  1FQE A;  4QFL A;  1N76 A;  4QFN A;  2HAU A;  5EHM A;  1MY2 A;  4F29 A;  2DOJ A;  3HV1 A;  4P11 A;  1LFI A;  3ZKL A;  2WKY A;  5L8D A;  1RYX A;  4E0W A;  4LUB A;  5H8S A;  2RC7 A;  3CSG A;  2I48 A;  3F11 A;  3K6X A;  4GIZ A;  1N04 A;  1MQH A;  5CMM A;  4F1Y A;  1D4N A;  3OEM A;  4EQ7 A;  3RLF E;  1LBB A;  3S9E A;  3MJN A;  4PFT A;  3IO4 A;  4MLV A;  3L6G A;  4KCD A;  1N3X A;  1A7L A;  3K6U A;  4H8J A;  1LB8 A;  2Q2A A;  5JTY A;  2XXP A;  3H03 A;  1ZBM A;  3ZS6 A;  5AE4 A;  2V25 A;  1GTK A;  1SBP A;  1YTV A;  3FGS A;  4KR5 A;  2OK2 A;  4OVJ A;  2UYF A;  2A5S A;  2FYI A;  3H6T A;  3IOW A;  2ABH A;  2DXY A;  3ODB A;  5L9M A;  3UN6 A;  2R6G E;  4OEN A;  1ZIU A;  1XC1 A;  5DT6 A;  3WAE A;  1Y4T A;  2DS9 A;  2RC9 A;  3V5A A;  4POW A;  1MDP 1;  4NWC A;  3GBB A;  2A5T B;  5L9S A;  4MF3 A;  1JW1 A;  4OFJ A;  1I6A A;  3SET A;  2DYX A;  5CM6 A;  1B32 A;  4PE5 B;  3U8Q A;  3UIF A;  4Q0C A;  3G3H A;  4H6D A;  1M5F A;  2AIX A;  3I3V A;  2QS3 A;  5H8Q A;  1I6B A;  4U22 A;  2ONS A;  2ZXT A;  3OO9 A;  4F19 A;  3BFU A;  3CG3 A;  4U4X A;  1B1H A;  2XXV A;  3T9H B;  1MQI A;  3MVZ A;  4GOT A;  2QMW A;  1IZ1 A;  3FAT A;  1H44 A;  3T9V A;  1XS5 A;  4OFL A;  3S4U A;  1MG1 A;  4WXJ A;  1IXH A;  4POX A;  3KGC A;  1MRP A;  1TT1 A;  3FVN A;  4G68 C;  1LFH A;  1IXI A;  3K2D A;  4XKP A;  1Y3Q A;  4FEC A;  4RPO A;  3S9M C;  4ELO A;  1BKA A;  1P1Q A;  1Y1Z A;  3PPR A;  4NMY A;  1URG A;  1SW1 A;  1A40 A;  2IEE A;  1NNP A;  2B3F A;  1NH7 A;  1MM7 A;  5H8H A;  4OYV A;  4GWO A;  5KCJ A;  4XKR A;  4F1V A;  5AA4 A;  4TOZ A;  3KG2 A;  3U94 A;  3SKP A;  4F31 B;  1Q35 A;  3G3J A;  1BLF A;  4ZEB A;  1ZTY A;  1H3D A;  2XXH A;  4G4P A;  3TEP A;  2H25 A;  2BJJ X;  3S2V A;  4E0X A;  3EHT A;  1MM6 A;  2ZNS A;  3A3U A;  4ESW A;  1Y3N A;  2ESN A;  2ONK E;  1O63 A;  4QFK A;  1US5 A;  3IB1 A;  2ZMB A;  4FAJ A;  2Q2C A;  1HSJ A;  3MVW A;  2YJP A;  4H5F A;  1O7T A;  2E1S A;  3KSJ A;  1Z7N E;  3K01 A;  3E4R A;  1JEU A;  3CFL A;  1DTZ A;  4I1D A;  3IAZ A;  2DXR A;  1BTJ A;  4KYS A;  1ZJL A;  4F39 A;  3MP8 A;  2H99 A;  1ZLQ A;  3TYH A;  3C31 A;  2NVU B;  2H5Y A;  2AL5 A;  3IB2 A;  5IKB A;  3PMV A;  4C1T A;  2REG A;  4ELP A;  3M3L A;  1OLA A;  3FZV A;  4IO2 A;  1R6Z A;  4IGR A;  1DPE A;  2G93 A;  3RQT A;  3OO7 A;  4XKN A;  2VD2 A;  1II5 A;  2Y84 A;  3PUX E;  5LOM A;  2DE4 A;  1A99 A;  4JB7 A;  1SW4 A;  4BDL A;  4OEV A;  1QKA A;  4IO5 A;  2XX8 A;  2Y7R A;  3PUV E;  2H4I A;  2DWA A;  4XIG Q;  2CZL A;  2F6G A;  4XKQ A;  3TPA A;  5K2Y A;  1A54 A;  3TTL A;  2B65 A;  2PX1 A;  4N07 A;  3PD8 A;  1XT8 A;  4GVO A;  4ZZE A;  1UTH B;  4OEU A;  3RNN A;  1LAX A;  2UXA A;  2F78 A;  3M3K A;  1WOD A;  3W9W A;  5KDT B;  4AB5 A;  2HCA A;  2PT2 A;  3UK4 A;  4LZ7 A;  2VD3 A;  2HZL A;  1GV8 A;  3OEN A;  3HHF A;  1S7Y A;  2H9B A;  4R75 A;  3PPO A;  2FNC A;  2O69 A;  2RKM A;  4X48 A;  1MY0 A;  3VXB A;  3IX1 A;  4GL8 A;  2DWJ A;  4I62 A;  3CFZ A;  2F8D A;  3SDF A;  1M5C A;  3TMG A;  3B6Q A;  1MDQ A;  3T93 B;  1UTB B;  4ZEC A;  4BDM A;  3OXN A;  4N6P A;  3I5O A;  1MPD A;  4YKI A;  3IK6 B;  1SI0 A;  3V89 B;  5CRY A;  2VP1 A;  3KN3 A;  3MP6 A;  5M2V A;  4GQO A;  2R71 A;  3N94 A;  2REJ A;  2V3T A;  3OMB A;  1GR2 A;  3MW0 A;  1P99 A;  3LSW A;  2I58 A;  3N26 A;  2D5W A;  3PMW A;  2QPQ A;  1DTG A;  4UAC A;  4BDR A;  4RK9 A;  2HFB A;  4XXU A;  1QJM A;  3HPI A;  3LBS A;  4OER A;  2RCA A;  1EU8 A;  2Z8E A;  4F22 A;  1JQF A;  1FTM A;  1WVJ A;  2Z8D A;  1OVT A;  1A8E A;  3O28 A;  4OWD A;  3PUZ E;  1UIU A;  3RT8 A;  4EXL A;  3B7D A;  3V8X B;  1RKM A;  3THI A;  3PV0 E;  1POT A;  1FQB A;  4OZ9 A;  5DVF A;  2HEU A;  3W15 C;  1SDX A;  2CMO A;  1QUK A;  3IOV A;  1I6Q A;  3A09 A;  5IAI A;  2GHB A;  2Y7K A;  1Y20 A;  3OD7 A;  3IR1 A;  4WKM A;  2E0S A;  3GZG A;  3MPL A;  3ZSF A;  1QVS A;  4RYA A;  3R26 A;  3QUF A;  2Q88 A;  4BDN A;  3FJ7 A;  4YKK A;  4ECF A;  3I6V A;  4QSD A;  4QHQ A;  4OHN A;  3BFT A;  3FXQ A;  1J1N A;  3KJT A;  5TU0 A;  1LLS A;  5DTB A;  3PGF A;  2UVG A;  4ISU A;  4ZDM A;  1TXF A;  3TDJ A;  1B7Z A;  4Z0I A;  4R6K A;  2I49 A;  4R2F A;  1SD3 A;  4ZZA A;  4GL0 A;  3FUZ A;  4G8H A;  3V83 A;  4NE4 A;  1US4 A;  3C35 A;  2RF1 A;  3O29 A;  2QRY A;  3BBR A;  3PU5 A;  2HQ0 A;  2Q9T A;  3HN0 A;  3K00 A;  2DWH A;  4F2Q A;  5DEX A;  1R1N A;  5ICT A;  2GRV A;  3IO6 A;  4DXU A;  1N84 A;  3H6V A;  1B40 A;  5F1Q A;  3OOA A; 
#chains in the Genus database with same CATH topology
 5IZ3 B;  4LON B;  3TCG A;  1BIY A;  2P1S A;  3MP1 A;  4JXI A;  3VLU A;  1EZP A;  4N4U A;  2VPN A;  3RUM A;  2UVJ A;  1B7U A;  2O84 X;  2CEX A;  1LAG E;  4PP0 A;  1NMU A;  5CBS A;  5ICQ A;  4U1Z A;  2R9J A;  4MFI A;  2UYE A;  4I3Y A;  1DMB A;  1Y9U A;  3UOR A;  4GBW A;  5I57 A;  5CC2 A;  1LB9 A;  1ZU0 A;  2VHA A;  3MQ9 A;  3SEX A;  4EF1 A;  2Q8J A;  3SZP A;  4AB6 A;  3O6H A;  3K02 A;  3UA8 A;  4IY5 A;  3QK6 A;  5FBP A;  5LDZ A;  4ZEF A;  1BP5 A;  3VVF A;  4XFE A;  4PQJ A;  2XX9 A;  5TP9 A;  3EPE A;  4JSD A;  1FPG A;  2DQV A;  1B0H A;  4N13 A;  4R72 A;  3K1P A;  1LST A;  4OMB A;  4R6H A;  3B6W A;  3G7W A;  1KWH A;  1FQA A;  4YMA A;  2V84 A;  4WEP A;  4F3B A;  4P56 A;  2F7A A;  1FQD A;  3PPN A;  2I0C A;  2UVH A;  4GXS B;  4OFO A;  3SEW A;  4ZEI A;  4G2Z A;  1PEB A;  5ITO A;  2Q8M A;  4FBP A;  3B50 A;  1OMP A;  2O7U A;  2PCR A;  1QKB A;  1M5D A;  2OZZ A;  5I59 A;  1NV0 A;  4IY6 A;  1UTH A;  2F7B A;  3KOS A;  3MZ9 A;  1NI9 A;  2ANJ A;  4HS7 A;  3S9L C;  3IFA A;  4MH5 A;  4KI0 E;  5KDT A;  3ECR A;  4R6Y A;  1FTO A;  3TZA A;  4OVR A;  2ALU A;  1H76 A;  4DCX A;  1UIV A;  2X7P A;  5FTH A;  2WYP A;  4ONY A;  1NKX A;  3O6G A;  1B46 A;  4EXK A;  4O3B A;  5HPQ A;  1FW0 A;  4NED A;  4PFY A;  1B6H A;  5CBR A;  4KXP A;  1ANF A;  3D4G A;  4I9D A;  2DSF A;  2P2A A;  4IO6 A;  2F6P A;  3TCF A;  3C33 A;  4IR8 A;  5HBC A;  1OLC A;  5A5X B;  1Z7M E;  4O3C A;  5DEX B;  3H7M A;  2DVZ A;  4NX1 A;  3O6I A;  1NV4 A;  1INP A;  4DXC A;  5AA2 D;  4N91 A;  1POY 1;  3K6W A;  4ZE8 A;  3LSF B;  5JK4 A;  4C1U A;  5I58 B;  3HCQ A;  3HO7 A;  5HM4 B;  1UTB A;  1B58 A;  2RC8 A;  4EF2 A;  5L9O A;  1Y1M A;  4FOR A;  1B5H A;  1FPD A;  1SYI A;  3RPW A;  1A8F A;  1VFE A;  1MQJ A;  3FJG A;  3RGY A;  1Q1K A;  2O1M A;  4GFR A;  3P7I A;  4JBZ A;  2GH9 A;  1JNF A;  3PTY A;  1YCJ A;  3CRB A;  1HSL A;  4OXV A;  5I57 B;  1IXG A;  4PGP A;  1DPP A;  1FBH A;  1MY1 A;  4PET A;  3BIG A;  2FBP A;  4QRZ A;  5IZZ A;  5BWJ A;  1FTA A;  3VXC A;  4R73 A;  4DI3 D;  3VVE A;  1FTJ A;  3IOU A;  5I3S A;  5I84 A;  3LV0 A;  4JWY A;  1USY E;  1PBP A;  3DLN A;  3KBR A;  3G3G A;  3T22 A;  1Y3P A;  5TP9 B;  2ZNU A;  5ET7 A;  4EQ9 A;  2X26 A;  1OIB A;  1VDW A;  4AS5 A;  1RYO A;  4MLQ A;  3O97 A;  3TTR A;  3VLW A;  4TLM B;  2XXW A;  2HZK A;  2XXQ A;  3MST A;  3PMX A;  4U1O A;  5CI5 A;  4HTG A;  1NUZ A;  1D9Y A;  1B52 A;  2I6E A;  4DXB A;  4R74 A;  1D9V A;  3QXM A;  4KD5 A;  2X7Q A;  4QF9 A;  3PUY E;  5IZ1 A;  1FJ9 A;  1FQC A;  2GFE A;  1EZ9 A;  5B7D A;  4G61 A;  1LBX A;  3E3K A;  4PFW A;  3DEL B;  2AL4 A;  5I59 B;  1LCT A;  5ELV A;  2Y5K A;  1LBZ A;  4F3S A;  2GQ1 A;  4QSC A;  4NN3 A;  4XTC Q;  3KZG A;  5I56 A;  5FHO A;  1URS A;  2F34 A;  4PF8 A;  2F3B A;  2OWT A;  2DP8 A;  4OES A;  1MH4 A;  4K3F A;  2BJI A;  4P9K A;  3H06 B;  4HCW A;  1NFT A;  3SES A;  2FHY A;  4LAT A;  1BK4 A;  4N6D A;  2DVC A;  2ZYK A;  3GXA A;  2F35 A;  3T9X B;  4X9T A;  5EHS A;  3PPQ A;  1A55 A;  2P3V A;  4PFU A;  3C32 A;  4PFB A;  3Q26 A;  4RY1 A;  5J1D A;  4ND9 A;  3SEV A;  5KZT A;  3G3F A;  3KFM A;  2ONR A;  2OJT A;  1MQD A;  4G8M A;  1FSA A;  4BLA A;  3L6H A;  4HE2 A;  4NF6 B;  3DP8 A;  3VFJ A;  1FQF A;  3OSR A;  3U93 A;  4RNS A;  3PUW E;  1MXX A;  2PMS A;  4NTL A;  3KJ7 A;  5IZ3 A;  4H0W A;  1AH5 A;  1DCU A;  1LGB C;  3BIH A;  4Q30 B;  3ZKK A;  2O6A A;  3RTW B;  4IO7 A;  1JVY A;  2F5X A;  5BUU A;  1EZO A;  2D21 A;  3KN8 A;  1NNK A;  3KEI A;  4N81 A;  3FIR A;  2KLF A;  1D9Q A;  3M3F A;  1PC3 A;  2DE2 A;  1AL3 A;  1NV6 A;  5AA1 A;  2XXY A;  5H8N B;  2OCU A;  3OEK A;  5LTC A;  2Y7P A;  4OET A;  3H4Z A;  3TCH A;  2L5V A;  2ZNT A;  4P8B A;  1SYH A;  3MAM A;  1I69 A;  4HW8 A;  3OO6 A;  4OVS A;  4OA4 A;  1IUD A;  4NF8 A;  3H6W A;  1LCF A;  1EYI A;  2FVZ A;  1JP4 A;  3TUS A;  1B4H A;  4H5G A;  1VFD A;  5A5L A;  1YYZ A;  2HHM A;  3GYY A;  4R2B A;  4YMB A;  1B3L A;  4FAT A;  1N7W A;  1IQ7 A;  1JEV A;  4MNP A;  2PVU A;  3CIJ A;  3K6V A;  4G8N A;  4G68 B;  1MY4 A;  3EHU A;  1FBC A;  5ET6 A;  3FV1 A;  3PPP A;  4P0G A;  3EF7 A;  4NF5 A;  4YAH X;  1Q9D A;  2QS2 A;  1MXU A;  4H67 A;  1LFG A;  1P1W A;  4MEV A;  4JWO A;  1SW5 A;  3N6T A;  1B05 A;  2Y5L A;  1QUL A;  4FEB A;  3ILT B;  4NF4 A;  4N8G A;  2Y7I A;  2F3D A;  2OX3 A;  4LQ2 A;  4IGT A;  5ITP A;  3Q25 A;  3VV5 A;  1MPC A;  1IEJ A;  2Z22 A;  4GWU A;  2VGQ A;  5I56 B;  1P1O A;  4LZ8 A;  2OWS A;  5B70 A;  1FPB A;  3DP4 A;  3MBP A;  2Q89 A;  1MH3 A;  1D3K A;  1B5J A;  3EN3 A;  1IMC A;  3D4C A;  5CMB A;  1M5E A;  1FPF A;  5K2X A;  4IB2 A;  1IMF A;  1B5I A;  2XWV A;  1IIW A;  3HST A;  4GF8 A;  1LBV A;  4JWX A;  2Y7W A;  1NV3 A;  3DP6 A;  4UAB A;  1LBC A;  1NH8 A;  3MC2 A;  2PFZ A;  4GWZ A;  3FJM A;  1AMF A;  4N15 A;  1JET A;  4GWY A;  5A5X A;  4P1E A;  3R7X A;  4P0I A;  3DM0 A;  4F1U A;  4JDF A;  1SVX B;  5I58 A;  3MPK A;  4Q5T A;  3O9P A;  4LQ5 A;  3ROJ A;  5ISU A;  4LP2 B;  3A29 A;  1OQG A;  3N5L A;  3M8U A;  3SER A;  4ZED A;  4KPT A;  4OVT A;  2QS4 A;  3K0V A;  5F7V A;  3TEL A;  2I4B A;  2GHA A;  1P1U A;  3UP9 A;  4ZE9 A;  3FAS A;  3OEL A;  4ELQ A;  2PBW A;  1SQY A;  3TQW A;  4GLI A;  3C34 A;  5ESY A;  1B0L A;  1FBP A;  5DVI A;  3TQL A;  3CVG A;  1MY3 A;  1B51 A;  5H8F A;  4YKJ A;  1ZMG A;  3IL1 B;  4M1V A;  2VPO A;  1T0K A;  5IM2 A;  3MZ1 A;  1LEV A;  4Z7E A;  4HE1 A;  1USY H;  1TFA A;  1GVC A;  2V93 A;  1NUX A;  3QAX A;  3ILU B;  1N3W A;  3TTK A;  1H45 A;  1NNF A;  3QUJ A;  3VLV A;  4NF8 B;  4R9G A;  1CB6 A;  2THI A;  3H3G A;  3MVY A;  3LR1 A;  4U23 A;  2ZZV A;  3EKI A;  1B3G A;  3RPL B;  5DW8 A;  4ELR A;  4EDP A;  1FCK A;  4LA9 A;  1PBQ A;  1JW5 A;  4KFQ A;  3HHG A;  3FVG A;  4YZZ A;  2O51 A;  1IIT A;  4O94 A;  5ET8 A;  2XXX A;  3KC1 A;  1QW0 A;  1AIV A;  4NF5 B;  5JEI A;  1MS7 A;  4I8C A;  4RK2 A;  2NWJ A;  3MVX A;  1SI1 A;  1S9T A;  2I3W A;  3LSL A;  1FJ6 A;  1LAH E;  3IB0 A;  4I3E A;  3VE1 B;  4PBQ A;  4F18 A;  2UVI A;  5AA2 B;  3RT6 B;  4IO3 A;  4NF4 B;  3JZJ A;  3G3I A;  5I2K A;  3FVK A;  4RXL A;  2DDK A;  2XA5 A;  5EYF A;  4YB5 A;  4U21 A;  1ZKB A;  4EUO A;  4FED A;  2Q74 A;  2V3U A;  1TWY A;  4U4S A;  3AXF A;  2XD2 A;  1PB7 A;  3TTN A;  3U92 A;  3GLB A;  2I0B A;  4UA8 A;  3IOT A;  3VVD A;  1B1X A;  4AQ4 A;  2XHD A;  1GGG A;  4M4G A;  4QXD A;  1FBE A;  2B4M A;  3U72 A;  3RTF B;  2QMX A;  4LZ5 A;  2G29 A;  4ZS9 A;  4GBV A;  2F36 A;  1PB9 A;  4DLD A;  1YPN A;  4KYE A;  1OVB A;  3O66 A;  3VDF A;  1FTK A;  3FVO A;  3OO8 A;  3IJO B;  1MXY A;  2FA7 A;  1XHY A;  3KSX A;  4BDO A;  3EQ1 A;  4QFP A;  1URD A;  1JW4 A;  2F97 A;  3G3K A;  1MXW A;  1MXZ A;  4PFI A;  4MAG A;  1P1N A;  1IMB A;  4HE0 A;  4NF6 A;  4GWS A;  1AOV A;  1MPB A;  1XVY A;  3K1N A;  3QSL A;  4H1X A;  2YLN A;  4KQP A;  2W7Y A;  4QFO A;  4NAP A;  4RPN A;  1PB8 A;  2Z23 A;  3C9H A;  3T96 B;  2OLB A;  4MBP A;  4TLL B;  5JTY B;  3R6U A;  1XVX A;  5H8F B;  5FTI A;  1NL5 A;  1NV1 A;  4OQO A;  4DDD A;  4NHB A;  2HXR A;  4KCC A;  2NUV A;  2QL3 A;  3UGW A;  1MXV A;  3FXU A;  3MZB A;  1R9Q A;  2ZYO A;  2HXW A;  1IXC A;  4PDH A;  3IOR A;  2WX9 A;  1WDN A;  3JV9 A;  4PF6 A;  3KN7 A;  5H8N A;  5CMC A;  4GRK A;  3QYT A;  4FE8 A;  2XXU A;  2XD3 A;  5EQ7 A;  3RN8 A;  4PE3 A;  2QSX A;  3CFX A;  4F3G A;  1B7H A;  2I3V A;  3PD9 A;  4HCY A;  4NWD A;  1B3F A;  4H8I A;  2ZYM A;  4MJO A;  4MMP A;  3FXB A;  3MWB A;  3FD3 A;  1KA0 A;  1O64 A;  2XXI A;  4G68 A;  3RY3 A;  4GD5 A;  3LSX A;  1L5T A;  1FPK A;  4F2O A;  5I2N A;  4X1D A;  2YPN A;  3OSQ A;  3IJX B;  1N0T A;  4X04 A;  1DBZ A;  5I2K B;  1SPI A;  5H8Q B;  4F3P A;  4KYD A;  1EH3 A;  4H65 A;  4PAI A;  3KC0 A;  1FBF A;  1JVX A;  3U1O A;  1M5B A;  3ISP A;  4FIM A;  3SEU A;  4NQ8 A;  4XEQ A;  5FHN A;  2QJE A;  1TFD A;  5TPA A;  1G0H A;  1R9L A;  1N7X A;  3EHS A;  4YB7 A;  2OBG A;  2QS1 A;  3FV2 A;  2NXO A;  4DIG A;  4G77 A;  3TOD A;  1FTL A;  1VE4 A;  4O3A A;  4DCY A;  4GXA A;  3LC8 A;  1AWB A;  1NUY A;  2O7I A;  5FHM A;  4C0R A;  4DE8 A;  3JYR A;  2XWO A;  4YIC A;  3E13 X;  3W9V A;  2I4C A;  4NF0 A;  2P0S A;  5EQ9 A;  2H98 A;  1XOC A;  2VOZ A;  4ESX A;  3CI8 A;  3CSB A;  1FRP A;  4KHZ E;  5H8H B;  4U2R A;  5KCJ B;  3C4M A;  5DVJ A;  5AA4 B;  3ONM A;  1QUJ A;  3B6T A;  1OQH A;  3WAF A;  1B3H A;  4TQU Q;  3CR9 A;  1HSE A;  1ELJ A;  1Y4C A;  1FBD A;  2VT5 A;  3TTM A;  4IO4 A;  1UQW A;  3A3C A;  3QMF A;  1CNQ A;  4N8Y A;  2D3I A;  4YKP A;  3B8B A;  1NNT A;  5DYH A;  4PFR A;  3FXR A;  4BDQ A;  1NV7 A;  4YB6 A;  4ZEK A;  1LAF E;  4FJP A;  3T66 A;  2PYY A;  2O68 A;  4MCO A;  4Q8R A;  1IMD A;  2RCB A;  5AA3 A;  2M8C A;  1NV2 A;  3TFL A;  1SW2 A;  4RJZ A;  2FIX A;  3LUZ A;  4L17 A;  2XX7 A;  3LUY A;  2V3Q A;  3SEY A;  1DSN A;  3C36 A;  2WEF A;  1H43 A;  3N6U A;  3O2A A;  4R9F A;  4WED A;  1B4Z A;  4DZ1 A;  3Q28 A;  1YAE A;  2PT1 A;  3KOT A;  4LVQ A;  2XXR A;  2O1L A;  2Z8F A;  3MYU A;  3QIM A;  2F7C A;  2NOO A;  4X8R A;  3GBA A;  1FPI A;  2DE3 A;  4PBH A;  2XXT A;  5J16 A;  1B3E A;  3RPL A;  3TKD A;  2XWI A;  1VR5 A;  2ZYN A;  4OTE A;  1S50 A;  2A5T A;  3K1M A;  5I2N B;  1QUI A;  4X1B A;  4EQB A;  3K4U A;  3Q29 A;  1F9B A;  4RA1 A;  2DWI A;  2PFY A;  1B2H A;  4JSO A;  2JJK A;  3E9X A;  1NV5 A;  3CG1 A;  4THI A;  1PDA A;  3USD A;  3T9U A;  5AA2 A;  2AYS A;  1VSO A;  1B9J A;  4YU0 A;  2MKZ A;  1XI6 A;  5CMK A;  3CHG A;  1DOT A;  1MQG A;  3TAJ A;  3S9N C;  4DI4 B;  5TPA B;  4QSE A;  2LAO A;  2RIN A;  1ATG A;  1CE2 A;  2HAV A;  3H6U A;  2IA4 A;  2WYK A;  3MUQ A;  3BKI B;  2QVV A;  4MX6 A;  2B3B A;  3Q27 A;  4GX6 A;  5T3J A;  1DK4 A;  1FQE A;  4QFL A;  1N76 A;  2R8T A;  4QFN A;  2HAU A;  5EHM A;  1MY2 A;  4F29 A;  2DOJ A;  4N6K A;  4NGU A;  3HV1 A;  4P11 A;  1LFI A;  1K9Y A;  3ZKL A;  2WKY A;  5L8D A;  1RYX A;  4E0W A;  4LUB A;  1K9Z A;  5H8S A;  2RC7 A;  3CSG A;  2I48 A;  3F11 A;  3K6X A;  4GIZ A;  1N04 A;  1MQH A;  5CMM A;  4F1Y A;  1D4N A;  3OEM A;  2FIE A;  4EQ7 A;  4GWW A;  4H45 A;  3RLF E;  1LBB A;  4PGN A;  3S9E A;  3MJN A;  4PFT A;  2XXK A;  3IO4 A;  4MLV A;  3T0J A;  3L6G A;  4KCD A;  1N3X A;  1A7L A;  3K6U A;  3RYD A;  4H8J A;  1LB8 A;  2Q2A A;  5JTY A;  2XXP A;  3H03 A;  1ZBM A;  4P3L A;  3ZS6 A;  5AE4 A;  2V25 A;  3E79 A;  1GTK A;  1SBP A;  1YTV A;  3FGS A;  4KR5 A;  4JVC A;  2OK2 A;  4OVJ A;  2UYF A;  1KZ8 A;  2A5S A;  2FYI A;  3H6T A;  3IOW A;  2ABH A;  2DXY A;  1FPL A;  3ODB A;  5L9M A;  3UN6 A;  2R6G E;  4PC9 A;  4OEN A;  1ZIU A;  1XC1 A;  5DT6 A;  3WAE A;  1Y4T A;  4OVQ A;  2DS9 A;  2RC9 A;  3V5A A;  4POW A;  1MDP 1;  4NWC A;  3GBB A;  2A5T B;  5L9S A;  4MF3 A;  1JW1 A;  2ZZW A;  4OFJ A;  1I6A A;  3SET A;  2DYX A;  5CM6 A;  1B32 A;  4PE5 B;  3U8Q A;  4Q0C A;  3G3H A;  3UIF A;  2WBD A;  4H46 A;  4H6D A;  1M5F A;  5I5P A;  2AIX A;  3I3V A;  2QS3 A;  5H8Q A;  1I6B A;  4U22 A;  2ONS A;  2ZXT A;  3OO9 A;  4OAN A;  4F19 A;  3BFU A;  3CG3 A;  4U4X A;  1B1H A;  2XXV A;  3T9H B;  1MQI A;  4JVI A;  3MVZ A;  4GOT A;  4GX3 A;  2QMW A;  1IZ1 A;  3FAT A;  1H44 A;  3T9V A;  1XS5 A;  4OFL A;  3S4U A;  4AS4 A;  1MG1 A;  4WXJ A;  1IXH A;  4POX A;  3KGC A;  1MRP A;  1TT1 A;  3FVN A;  1IME A;  4G68 C;  1LFH A;  1IXI A;  3K2D A;  4XKP A;  5EYH A;  1Y3Q A;  4FEC A;  4RPO A;  3S9M C;  4ELO A;  1BKA A;  1P1Q A;  1Y1Z A;  3PPR A;  4NMY A;  3T1B A;  1URG A;  1IMA A;  1SW1 A;  1A40 A;  2HPG A;  1NNP A;  2IEE A;  5EYG A;  2B3F A;  1NH7 A;  1MM7 A;  5H8H A;  4OYV A;  4GWO A;  5KCJ A;  4XKR A;  4F1V A;  1EYJ A;  5AA4 A;  4I40 A;  4TOZ A;  4PDD A;  3KG2 A;  3U94 A;  1KA1 A;  3SKP A;  4F31 B;  1Q35 A;  3G3J A;  1BLF A;  4ZEB A;  1ZTY A;  1H3D A;  2XXH A;  4G4P A;  3TEP A;  1FPJ A;  2H25 A;  2BJJ X;  3S2V A;  4E0X A;  3EHT A;  1MM6 A;  2XWK A;  2ZNS A;  3A3U A;  4ESW A;  1Y3N A;  2ESN A;  4HXV A;  2ONK E;  1O63 A;  4PCD A;  2KQZ A;  4QFK A;  1US5 A;  3IB1 A;  2ZMB A;  4FAJ A;  2Q2C A;  1HSJ A;  3MVW A;  2YJP A;  4H5F A;  1O7T A;  2E1S A;  3KSJ A;  1Z7N E;  3K01 A;  3E4R A;  1JEU A;  3CFL A;  1DTZ A;  4I1D A;  4JVD A;  3IAZ A;  5ET5 A;  2DXR A;  5IGA A;  1BTJ A;  4KYS A;  1ZJL A;  4F39 A;  2CZI A;  3MP8 A;  2P3N A;  2H99 A;  1ZLQ A;  5F24 A;  3TYH A;  3C31 A;  3HFU A;  4P47 A;  2NVU B;  4QBA A;  2H5Y A;  2AL5 A;  3IB2 A;  4P1L A;  5IKB A;  3PMV A;  1LBY A;  4C1T A;  1RDZ A;  1LBW A;  2REG A;  4MIJ A;  3D1R A;  2B4L A;  4ELP A;  3M3L A;  1OLA A;  3FZV A;  4IO2 A;  1R6Z A;  4IGR A;  1DPE A;  2G93 A;  3RQT A;  3OO7 A;  4XKN A;  4MNI A;  2VD2 A;  1II5 A;  4O7I A;  4XF5 A;  2Y84 A;  1RDY A;  3PUX E;  5LOM A;  2DE4 A;  1A99 A;  4JB7 A;  1SW4 A;  4BDL A;  4OEV A;  4N17 A;  1QKA A;  4IO5 A;  2XX8 A;  2Y7R A;  3PUV E;  2H4I A;  2DWA A;  4XIG Q;  2CZL A;  3U65 A;  2F6G A;  4XKQ A;  3TPA A;  5K2Y A;  1A54 A;  2ZZX A;  3TTL A;  2B65 A;  2PX1 A;  4N07 A;  3PD8 A;  1XT8 A;  2QVU A;  4GVO A;  4ZZE A;  2OWZ A;  1UTH B;  4OEU A;  3RNN A;  1LAX A;  2UXA A;  2F78 A;  3M3K A;  1WOD A;  4GWX A;  3W9W A;  5KDT B;  4OVP A;  4AB5 A;  2HCA A;  2PT2 A;  3UK4 A;  4LZ7 A;  2VD3 A;  2HZL A;  1NUW A;  1GV8 A;  3OEN A;  3HHF A;  1S7Y A;  2H9B A;  3E78 A;  4R75 A;  3PPO A;  2FNC A;  2O69 A;  2RKM A;  4X48 A;  1MY0 A;  2CZH A;  3VXB A;  3IX1 A;  4GL8 A;  2DWJ A;  4PAF A;  3FBP A;  2KR0 A;  4I62 A;  3CFZ A;  2F8D A;  3SDF A;  5EQ8 A;  1EYK A;  1RDX A;  1M5C A;  3TMG A;  3B6Q A;  4PAK A;  1MDQ A;  3T93 B;  1UTB B;  2QFL A;  4ZEC A;  4BDM A;  3OXN A;  4N6P A;  3I5O A;  1YZ0 A;  1MPD A;  4YKI A;  3IFC A;  3IK6 B;  1SI0 A;  5EQA A;  3V89 B;  4O8M A;  5CRY A;  2WBB A;  1FBG A;  1YXI A;  2VP1 A;  3KN3 A;  3MP6 A;  1QGX A;  4GQO A;  2R71 A;  5M2V A;  3N94 A;  2REJ A;  2V3T A;  3OMB A;  4O7M A;  1GR2 A;  2V4C A;  1P99 A;  3MW0 A;  3LSW A;  2I58 A;  3N26 A;  2D5W A;  3PMW A;  2QPQ A;  1DTG A;  4UAC A;  4BDR A;  4MNC A;  4RK9 A;  2HFB A;  4XXU A;  1QJM A;  3HPI A;  3LBS A;  4MHF A;  4OER A;  2RCA A;  1EU8 A;  1FPE A;  2Z8E A;  4F22 A;  1JQF A;  1FTM A;  1WVJ A;  2Z8D A;  1OVT A;  1A8E A;  3O28 A;  4OWD A;  3PUZ E;  4PTK A;  1UIU A;  3RT8 A;  4EXL A;  3B7D A;  4NG7 A;  3V8X B;  1RKM A;  3THI A;  3PV0 E;  1POT A;  1FQB A;  4OZ9 A;  5DVF A;  2HEU A;  3W15 C;  1SDX A;  2CMO A;  1QUK A;  3IOV A;  1I6Q A;  3A09 A;  5IAI A;  2GHB A;  2Y7K A;  1Y20 A;  3OD7 A;  3IR1 A;  4WKM A;  2E0S A;  3GZG A;  3MPL A;  3ZSF A;  1QVS A;  4RYA A;  3R26 A;  3QUF A;  2Q88 A;  4LN5 A;  4BDN A;  3FJ7 A;  4YKK A;  4ECF A;  3I6V A;  4QSD A;  1G0I A;  5I7I A;  4QHQ A;  4OHN A;  3BFT A;  3FXQ A;  1J1N A;  2CZK A;  3KJT A;  5TU0 A;  1LLS A;  5DTB A;  3PGF A;  2UVG A;  4ISU A;  4ZDM A;  1TXF A;  3TDJ A;  1B7Z A;  4Z0I A;  3NOH A;  4R6K A;  2QVR A;  2I49 A;  4R2F A;  1SD3 A;  4ZZA A;  4GL0 A;  3FUZ A;  4G8H A;  3V83 A;  4NE4 A;  1US4 A;  3KBZ A;  3C35 A;  3O29 A;  2RF1 A;  2QRY A;  3BBR A;  3PU5 A;  2HQ0 A;  2Q9T A;  3HN0 A;  2CEY A;  3K00 A;  2DWH A;  4F2Q A;  5DEX A;  1R1N A;  5ICT A;  2GRV A;  3IO6 A;  4GX4 A;  4DXU A;  1N84 A;  3H6V A;  1B40 A;  5F1Q A;  3OOA A; 
#chains in the Genus database with same CATH homology
 4LON B;  3TCG A;  1BIY A;  2P1S A;  3MP1 A;  4JXI A;  3VLU A;  1EZP A;  3RUM A;  2UVJ A;  1B7U A;  2O84 X;  1LAG E;  4PP0 A;  1NMU A;  5CBS A;  5ICQ A;  4U1Z A;  2R9J A;  4MFI A;  2UYE A;  1DMB A;  1Y9U A;  3UOR A;  5I57 A;  5CC2 A;  1LB9 A;  1ZU0 A;  2VHA A;  3MQ9 A;  3SEX A;  4EF1 A;  2Q8J A;  4AB6 A;  3O6H A;  3K02 A;  3UA8 A;  4IY5 A;  3QK6 A;  4ZEF A;  1BP5 A;  3VVF A;  4PQJ A;  2XX9 A;  5TP9 A;  3EPE A;  4JSD A;  2DQV A;  1B0H A;  4N13 A;  4R72 A;  3K1P A;  1LST A;  4OMB A;  4R6H A;  3B6W A;  3G7W A;  1KWH A;  1FQA A;  4YMA A;  2V84 A;  4WEP A;  4F3B A;  2F7A A;  1FQD A;  3PPN A;  2I0C A;  2UVH A;  4GXS B;  4OFO A;  3SEW A;  4ZEI A;  4G2Z A;  1PEB A;  5ITO A;  1OMP A;  2O7U A;  1QKB A;  1M5D A;  2OZZ A;  5I59 A;  4IY6 A;  1UTH A;  2F7B A;  3KOS A;  3MZ9 A;  2ANJ A;  4HS7 A;  3S9L C;  4MH5 A;  4KI0 E;  5KDT A;  3ECR A;  4R6Y A;  1FTO A;  3TZA A;  2ALU A;  1H76 A;  4DCX A;  1UIV A;  2X7P A;  5FTH A;  4ONY A;  1NKX A;  3O6G A;  1B46 A;  4EXK A;  4O3B A;  5HPQ A;  1FW0 A;  4NED A;  4PFY A;  1B6H A;  5CBR A;  1ANF A;  3D4G A;  4I9D A;  2DSF A;  2P2A A;  4IO6 A;  2F6P A;  3TCF A;  3C33 A;  5HBC A;  1OLC A;  5A5X B;  1Z7M E;  4O3C A;  5DEX B;  3H7M A;  2DVZ A;  3O6I A;  4DXC A;  5AA2 D;  1POY 1;  3K6W A;  4ZE8 A;  3LSF B;  5JK4 A;  4C1U A;  5I58 B;  3HCQ A;  3HO7 A;  5HM4 B;  1UTB A;  1B58 A;  2RC8 A;  4EF2 A;  5L9O A;  1Y1M A;  4FOR A;  1B5H A;  1SYI A;  3RPW A;  1A8F A;  1VFE A;  1MQJ A;  3FJG A;  3RGY A;  1Q1K A;  2O1M A;  4GFR A;  3P7I A;  4JBZ A;  2GH9 A;  1JNF A;  1YCJ A;  3CRB A;  1HSL A;  4OXV A;  5I57 B;  1IXG A;  1DPP A;  1MY1 A;  4PET A;  4QRZ A;  5BWJ A;  3VXC A;  4R73 A;  3VVE A;  1FTJ A;  3IOU A;  5I84 A;  4JWY A;  1USY E;  1PBP A;  3DLN A;  3KBR A;  3G3G A;  3T22 A;  1Y3P A;  5TP9 B;  2ZNU A;  4EQ9 A;  2X26 A;  1OIB A;  1RYO A;  4MLQ A;  3O97 A;  3TTR A;  3VLW A;  4TLM B;  2XXW A;  2HZK A;  2XXQ A;  3PMX A;  4U1O A;  5CI5 A;  4HTG A;  1D9Y A;  1B52 A;  2I6E A;  4DXB A;  4R74 A;  1D9V A;  3QXM A;  4KD5 A;  2X7Q A;  4QF9 A;  3PUY E;  1FQC A;  2GFE A;  1EZ9 A;  5B7D A;  3E3K A;  4PFW A;  3DEL B;  2AL4 A;  5I59 B;  1LCT A;  5ELV A;  4F3S A;  4QSC A;  4XTC Q;  3KZG A;  5I56 A;  5FHO A;  1URS A;  2F34 A;  2OWT A;  2DP8 A;  4OES A;  1MH4 A;  4K3F A;  3H06 B;  4HCW A;  1NFT A;  3SES A;  4LAT A;  2DVC A;  2ZYK A;  3GXA A;  2F35 A;  3T9X B;  4X9T A;  5EHS A;  3PPQ A;  1A55 A;  4PFU A;  3C32 A;  3Q26 A;  4RY1 A;  5J1D A;  4ND9 A;  3SEV A;  5KZT A;  3G3F A;  3KFM A;  2ONR A;  2OJT A;  1MQD A;  4G8M A;  4BLA A;  3L6H A;  4NF6 B;  3DP8 A;  3VFJ A;  1FQF A;  3OSR A;  3U93 A;  4RNS A;  3PUW E;  1MXX A;  2PMS A;  4NTL A;  3KJ7 A;  4H0W A;  1AH5 A;  1LGB C;  4Q30 B;  3ZKK A;  2O6A A;  3RTW B;  4IO7 A;  1JVY A;  2F5X A;  5BUU A;  1EZO A;  2D21 A;  3KN8 A;  1NNK A;  3KEI A;  3FIR A;  2KLF A;  3M3F A;  1PC3 A;  2DE2 A;  1AL3 A;  5AA1 A;  2XXY A;  5H8N B;  2OCU A;  3OEK A;  2Y7P A;  4OET A;  3H4Z A;  3TCH A;  2ZNT A;  1SYH A;  3MAM A;  1I69 A;  4HW8 A;  3OO6 A;  1IUD A;  4NF8 A;  3H6W A;  1LCF A;  3TUS A;  1B4H A;  4H5G A;  1VFD A;  4R2B A;  4YMB A;  1B3L A;  4FAT A;  1N7W A;  1JEV A;  1IQ7 A;  2PVU A;  3CIJ A;  3K6V A;  4G8N A;  4G68 B;  1MY4 A;  3EHU A;  3FV1 A;  3PPP A;  4P0G A;  3EF7 A;  4NF5 A;  4YAH X;  2QS2 A;  1MXU A;  4H67 A;  1LFG A;  1P1W A;  4JWO A;  1SW5 A;  3N6T A;  1B05 A;  1QUL A;  4FEB A;  3ILT B;  4NF4 A;  2Y7I A;  4LQ2 A;  4IGT A;  5ITP A;  3Q25 A;  3VV5 A;  1MPC A;  1IEJ A;  2Z22 A;  2VGQ A;  5I56 B;  1P1O A;  4LZ8 A;  2OWS A;  5B70 A;  3DP4 A;  3MBP A;  2Q89 A;  1MH3 A;  1D3K A;  1B5J A;  3EN3 A;  3D4C A;  5CMB A;  1M5E A;  5K2X A;  4IB2 A;  1B5I A;  1IIW A;  3HST A;  4GF8 A;  4JWX A;  2Y7W A;  3DP6 A;  1LBC A;  1NH8 A;  3MC2 A;  3FJM A;  1AMF A;  1JET A;  5A5X A;  3R7X A;  4P0I A;  3DM0 A;  4F1U A;  4JDF A;  1SVX B;  5I58 A;  3MPK A;  4Q5T A;  3O9P A;  4LQ5 A;  5ISU A;  4LP2 B;  1OQG A;  3N5L A;  3M8U A;  3SER A;  4ZED A;  4KPT A;  2QS4 A;  3K0V A;  5F7V A;  3TEL A;  2I4B A;  2GHA A;  1P1U A;  3UP9 A;  4ZE9 A;  3FAS A;  3OEL A;  4ELQ A;  2PBW A;  1SQY A;  3TQW A;  4GLI A;  3C34 A;  1B0L A;  5DVI A;  3TQL A;  3CVG A;  1MY3 A;  1B51 A;  5H8F A;  4YKJ A;  1ZMG A;  3IL1 B;  4M1V A;  1T0K A;  3MZ1 A;  4Z7E A;  1USY H;  1TFA A;  1GVC A;  2V93 A;  3QAX A;  3ILU B;  1N3W A;  3TTK A;  1H45 A;  1NNF A;  3QUJ A;  3VLV A;  4NF8 B;  4R9G A;  1CB6 A;  2THI A;  3H3G A;  3MVY A;  3LR1 A;  4U23 A;  1B3G A;  4ELR A;  4EDP A;  1FCK A;  4LA9 A;  1PBQ A;  1JW5 A;  4KFQ A;  3HHG A;  3FVG A;  4YZZ A;  2O51 A;  1IIT A;  2XXX A;  1QW0 A;  1AIV A;  4NF5 B;  5JEI A;  1MS7 A;  4I8C A;  4RK2 A;  2NWJ A;  3MVX A;  1SI1 A;  1S9T A;  2I3W A;  3LSL A;  1LAH E;  3IB0 A;  3VE1 B;  4F18 A;  2UVI A;  5AA2 B;  3RT6 B;  4IO3 A;  4NF4 B;  3JZJ A;  3G3I A;  5I2K A;  3FVK A;  4RXL A;  5EYF A;  4YB5 A;  4U21 A;  1ZKB A;  4EUO A;  4FED A;  2V3U A;  1TWY A;  4U4S A;  3AXF A;  2XD2 A;  1PB7 A;  3TTN A;  3U92 A;  3GLB A;  2I0B A;  4UA8 A;  3IOT A;  3VVD A;  1B1X A;  4AQ4 A;  2XHD A;  1GGG A;  4M4G A;  3U72 A;  3RTF B;  2QMX A;  4LZ5 A;  2G29 A;  4ZS9 A;  2F36 A;  1PB9 A;  4DLD A;  1YPN A;  4KYE A;  1OVB A;  3O66 A;  3VDF A;  1FTK A;  3FVO A;  3OO8 A;  3IJO B;  1MXY A;  2FA7 A;  1XHY A;  3KSX A;  4BDO A;  3EQ1 A;  4QFP A;  1URD A;  1JW4 A;  2F97 A;  3G3K A;  1MXW A;  1MXZ A;  1P1N A;  4NF6 A;  1AOV A;  1MPB A;  1XVY A;  3K1N A;  3QSL A;  4H1X A;  2YLN A;  4KQP A;  2W7Y A;  4QFO A;  4RPN A;  1PB8 A;  2Z23 A;  3C9H A;  3T96 B;  2OLB A;  4MBP A;  4TLL B;  5JTY B;  3R6U A;  1XVX A;  5H8F B;  5FTI A;  1NL5 A;  4OQO A;  4DDD A;  4KCC A;  2NUV A;  2QL3 A;  3UGW A;  1MXV A;  3FXU A;  3MZB A;  1R9Q A;  2ZYO A;  2HXW A;  1IXC A;  3IOR A;  3JV9 A;  1WDN A;  5H8N A;  3KN7 A;  5CMC A;  4GRK A;  3QYT A;  4FE8 A;  2XXU A;  2XD3 A;  3RN8 A;  2QSX A;  3CFX A;  4F3G A;  1B7H A;  2I3V A;  3PD9 A;  4HCY A;  4NWD A;  1B3F A;  4H8I A;  2ZYM A;  3MWB A;  3FD3 A;  1O64 A;  2XXI A;  4G68 A;  3RY3 A;  4GD5 A;  3LSX A;  1L5T A;  4F2O A;  5I2N A;  4X1D A;  2YPN A;  3OSQ A;  3IJX B;  1N0T A;  5I2K B;  5H8Q B;  4F3P A;  4KYD A;  1EH3 A;  4H65 A;  1JVX A;  3U1O A;  1M5B A;  4FIM A;  3SEU A;  5FHN A;  2QJE A;  1TFD A;  5TPA A;  1R9L A;  1N7X A;  3EHS A;  4YB7 A;  2OBG A;  2QS1 A;  3FV2 A;  2NXO A;  4DIG A;  4G77 A;  3TOD A;  1FTL A;  1VE4 A;  4O3A A;  4DCY A;  4GXA A;  3LC8 A;  2O7I A;  5FHM A;  4C0R A;  4DE8 A;  3JYR A;  4YIC A;  3E13 X;  3W9V A;  2I4C A;  2P0S A;  2H98 A;  1XOC A;  2VOZ A;  4ESX A;  3CI8 A;  3CSB A;  4KHZ E;  5H8H B;  4U2R A;  5KCJ B;  3C4M A;  5DVJ A;  5AA4 B;  3ONM A;  1QUJ A;  3B6T A;  1OQH A;  3WAF A;  1B3H A;  4TQU Q;  3CR9 A;  1HSE A;  1ELJ A;  1Y4C A;  3TTM A;  4IO4 A;  1UQW A;  3A3C A;  2D3I A;  4YKP A;  1NNT A;  5DYH A;  3FXR A;  4BDQ A;  4YB6 A;  4ZEK A;  1LAF E;  4FJP A;  3T66 A;  2PYY A;  2O68 A;  4Q8R A;  2RCB A;  5AA3 A;  2M8C A;  3TFL A;  1SW2 A;  4RJZ A;  4L17 A;  2XX7 A;  3LUY A;  2V3Q A;  3SEY A;  1DSN A;  3C36 A;  1H43 A;  3N6U A;  3O2A A;  4R9F A;  4WED A;  1B4Z A;  4DZ1 A;  3Q28 A;  1YAE A;  2PT1 A;  3KOT A;  4LVQ A;  2XXR A;  2O1L A;  2Z8F A;  3QIM A;  2F7C A;  2NOO A;  3GBA A;  2DE3 A;  2XXT A;  1B3E A;  3TKD A;  1VR5 A;  2ZYN A;  4OTE A;  1S50 A;  2A5T A;  3K1M A;  5I2N B;  1QUI A;  4X1B A;  4EQB A;  3K4U A;  3Q29 A;  1F9B A;  4RA1 A;  2DWI A;  1B2H A;  4JSO A;  3E9X A;  3CG1 A;  4THI A;  1PDA A;  3USD A;  3T9U A;  5AA2 A;  2AYS A;  1VSO A;  1B9J A;  4YU0 A;  5CMK A;  1DOT A;  1MQG A;  3TAJ A;  3S9N C;  5TPA B;  4QSE A;  2LAO A;  2RIN A;  1ATG A;  1CE2 A;  2HAV A;  3H6U A;  2IA4 A;  3MUQ A;  3BKI B;  2B3B A;  3Q27 A;  1FQE A;  4QFL A;  1N76 A;  4QFN A;  2HAU A;  5EHM A;  1MY2 A;  4F29 A;  2DOJ A;  3HV1 A;  4P11 A;  1LFI A;  3ZKL A;  2WKY A;  5L8D A;  1RYX A;  4E0W A;  4LUB A;  5H8S A;  2RC7 A;  3CSG A;  2I48 A;  3F11 A;  3K6X A;  4GIZ A;  1N04 A;  1MQH A;  5CMM A;  4F1Y A;  1D4N A;  3OEM A;  4EQ7 A;  3RLF E;  1LBB A;  3S9E A;  3MJN A;  4PFT A;  3IO4 A;  4MLV A;  3L6G A;  4KCD A;  1N3X A;  1A7L A;  3K6U A;  4H8J A;  1LB8 A;  2Q2A A;  5JTY A;  2XXP A;  3H03 A;  1ZBM A;  3ZS6 A;  5AE4 A;  2V25 A;  1GTK A;  1SBP A;  1YTV A;  3FGS A;  4KR5 A;  2OK2 A;  4OVJ A;  2UYF A;  2A5S A;  2FYI A;  3H6T A;  3IOW A;  2ABH A;  2DXY A;  3ODB A;  5L9M A;  3UN6 A;  2R6G E;  4OEN A;  1ZIU A;  1XC1 A;  5DT6 A;  3WAE A;  1Y4T A;  2DS9 A;  2RC9 A;  3V5A A;  4POW A;  1MDP 1;  4NWC A;  3GBB A;  2A5T B;  5L9S A;  4MF3 A;  1JW1 A;  4OFJ A;  1I6A A;  3SET A;  2DYX A;  5CM6 A;  1B32 A;  4PE5 B;  3U8Q A;  3UIF A;  4Q0C A;  3G3H A;  4H6D A;  1M5F A;  2AIX A;  3I3V A;  2QS3 A;  5H8Q A;  1I6B A;  4U22 A;  2ONS A;  2ZXT A;  3OO9 A;  4F19 A;  3BFU A;  3CG3 A;  4U4X A;  1B1H A;  2XXV A;  3T9H B;  1MQI A;  3MVZ A;  4GOT A;  2QMW A;  1IZ1 A;  3FAT A;  1H44 A;  3T9V A;  1XS5 A;  4OFL A;  3S4U A;  1MG1 A;  4WXJ A;  1IXH A;  4POX A;  3KGC A;  1MRP A;  1TT1 A;  3FVN A;  4G68 C;  1LFH A;  1IXI A;  3K2D A;  4XKP A;  1Y3Q A;  4FEC A;  4RPO A;  3S9M C;  4ELO A;  1BKA A;  1P1Q A;  1Y1Z A;  3PPR A;  4NMY A;  1URG A;  1SW1 A;  1A40 A;  2IEE A;  1NNP A;  2B3F A;  1NH7 A;  1MM7 A;  5H8H A;  4OYV A;  4GWO A;  5KCJ A;  4XKR A;  4F1V A;  5AA4 A;  4TOZ A;  3KG2 A;  3U94 A;  3SKP A;  4F31 B;  1Q35 A;  3G3J A;  1BLF A;  4ZEB A;  1ZTY A;  1H3D A;  2XXH A;  4G4P A;  3TEP A;  2H25 A;  2BJJ X;  3S2V A;  4E0X A;  3EHT A;  1MM6 A;  2ZNS A;  3A3U A;  4ESW A;  1Y3N A;  2ESN A;  2ONK E;  1O63 A;  4QFK A;  1US5 A;  3IB1 A;  2ZMB A;  4FAJ A;  2Q2C A;  1HSJ A;  3MVW A;  2YJP A;  4H5F A;  1O7T A;  2E1S A;  3KSJ A;  1Z7N E;  3K01 A;  3E4R A;  1JEU A;  3CFL A;  1DTZ A;  4I1D A;  3IAZ A;  2DXR A;  1BTJ A;  4KYS A;  1ZJL A;  4F39 A;  3MP8 A;  2H99 A;  1ZLQ A;  3TYH A;  3C31 A;  2NVU B;  2H5Y A;  2AL5 A;  3IB2 A;  5IKB A;  3PMV A;  4C1T A;  2REG A;  4ELP A;  3M3L A;  1OLA A;  3FZV A;  4IO2 A;  1R6Z A;  4IGR A;  1DPE A;  2G93 A;  3RQT A;  3OO7 A;  4XKN A;  2VD2 A;  1II5 A;  2Y84 A;  3PUX E;  5LOM A;  2DE4 A;  1A99 A;  4JB7 A;  1SW4 A;  4BDL A;  4OEV A;  1QKA A;  4IO5 A;  2XX8 A;  2Y7R A;  3PUV E;  2H4I A;  2DWA A;  4XIG Q;  2CZL A;  2F6G A;  4XKQ A;  3TPA A;  5K2Y A;  1A54 A;  3TTL A;  2B65 A;  2PX1 A;  4N07 A;  3PD8 A;  1XT8 A;  4GVO A;  4ZZE A;  1UTH B;  4OEU A;  3RNN A;  1LAX A;  2UXA A;  2F78 A;  3M3K A;  1WOD A;  3W9W A;  5KDT B;  4AB5 A;  2HCA A;  2PT2 A;  3UK4 A;  4LZ7 A;  2VD3 A;  2HZL A;  1GV8 A;  3OEN A;  3HHF A;  1S7Y A;  2H9B A;  4R75 A;  3PPO A;  2FNC A;  2O69 A;  2RKM A;  4X48 A;  1MY0 A;  3VXB A;  3IX1 A;  4GL8 A;  2DWJ A;  4I62 A;  3CFZ A;  2F8D A;  3SDF A;  1M5C A;  3TMG A;  3B6Q A;  1MDQ A;  3T93 B;  1UTB B;  4ZEC A;  4BDM A;  3OXN A;  4N6P A;  3I5O A;  1MPD A;  4YKI A;  3IK6 B;  1SI0 A;  3V89 B;  5CRY A;  2VP1 A;  3KN3 A;  3MP6 A;  5M2V A;  4GQO A;  2R71 A;  3N94 A;  2REJ A;  2V3T A;  3OMB A;  1GR2 A;  3MW0 A;  1P99 A;  3LSW A;  2I58 A;  3N26 A;  2D5W A;  3PMW A;  2QPQ A;  1DTG A;  4UAC A;  4BDR A;  4RK9 A;  2HFB A;  4XXU A;  1QJM A;  3HPI A;  3LBS A;  4OER A;  2RCA A;  1EU8 A;  2Z8E A;  4F22 A;  1JQF A;  1FTM A;  1WVJ A;  2Z8D A;  1OVT A;  1A8E A;  3O28 A;  4OWD A;  3PUZ E;  1UIU A;  3RT8 A;  4EXL A;  3B7D A;  3V8X B;  1RKM A;  3THI A;  3PV0 E;  1POT A;  1FQB A;  4OZ9 A;  5DVF A;  2HEU A;  3W15 C;  1SDX A;  2CMO A;  1QUK A;  3IOV A;  1I6Q A;  3A09 A;  5IAI A;  2GHB A;  2Y7K A;  1Y20 A;  3OD7 A;  3IR1 A;  4WKM A;  2E0S A;  3GZG A;  3MPL A;  3ZSF A;  1QVS A;  4RYA A;  3R26 A;  3QUF A;  2Q88 A;  4BDN A;  3FJ7 A;  4YKK A;  4ECF A;  3I6V A;  4QSD A;  4QHQ A;  4OHN A;  3BFT A;  3FXQ A;  1J1N A;  3KJT A;  5TU0 A;  1LLS A;  5DTB A;  3PGF A;  2UVG A;  4ISU A;  4ZDM A;  1TXF A;  3TDJ A;  1B7Z A;  4Z0I A;  4R6K A;  2I49 A;  4R2F A;  1SD3 A;  4ZZA A;  4GL0 A;  3FUZ A;  4G8H A;  3V83 A;  4NE4 A;  1US4 A;  3C35 A;  2RF1 A;  3O29 A;  2QRY A;  3BBR A;  3PU5 A;  2HQ0 A;  2Q9T A;  3HN0 A;  3K00 A;  2DWH A;  4F2Q A;  5DEX A;  1R1N A;  5ICT A;  2GRV A;  3IO6 A;  4DXU A;  1N84 A;  3H6V A;  1B40 A;  5F1Q A;  3OOA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...