2ONSA

Crystal structure of a. fulgidus periplasmic binding protein moda with bound tungstate
Total Genus 110
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
110
sequence length
314
structure length
314
Chain Sequence
GHMNVKLKVFHAGSLTEPMKAFKRAFEEKHPNVEVQTEAAGSAATIRKVTELGRKADVIATADYTLIQKMMYPEFANWTIMFAKNQIVLAYRNDSRYADEINSQNWYEILKRPDVRFGFSNPNDDPCGYRSLMAIQLAELYYNDPTIFDELVAKNSNLRFSEDNGSYVLRMPSSERIEINKSKIMIRSMEMELIHLVESGELDYFFIYKSVAKQHGFNFVELPVEIDLSSPDYAELYSKVKVVLANGKEVTGKPIVYGITIPKNAENRELAVEFVKLVISEEGQEILRELGQEPLVPPRADTAVPSLKAMVEVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Ligand binding protein
molecule keywords UPF0100 protein AF_0094
publication title Structure of an ABC transporter in complex with its binding protein.
pubmed doi rcsb
source organism Archaeoglobus fulgidus dsm 4304
total genus 110
structure length 314
sequence length 314
ec nomenclature
pdb deposition date 2007-01-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onsA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2onsA02
2QPQA 2XD3A 4G2ZA 3U93A 3S9EA 2F8DA 3PPRA 5DEXA 2HZLA 3ZKKA 2DWHA 1B7UA 4LUBA 5BWJA 2UYFA 4OFOA 4X48A 3JV9A 3MJNA 3GBBA 1DPEA 3TUSA 3RY3A 1NL5A 4F39A 4R73A 3D4CA 4X9TA 1P1UA 1B0LA 3KGCA 4GXAA 4M4GA 2XXXA 1Y1MA 4O3BA 1A8FA 4NF8A 4MFIA 2XXUA 4GQOA 4N07A 1GTKA 4IO7A 3BFTA 4JSOA 1BP5A 3RLFE 2XXTA 4F3GA 4NF4A 3MP8A 1MXUA 2XXIA 1A8EA 5TPAA 5I56A 2B3FA 2UVHA 4I8CA 1N84A 5AA4B 4F2OA 5DEXB 2PT1A 1PDAA 3PUXE 1LFHA 3TPAA 1T0KA 5FHMA 1QW0A 5I58A 5DVIA 1B51A 1H76A 4ND9A 4XKNA 2THIA 1NMUA 3THIA 3HV1A 3DLNA 5K2XA 3UN6A 1SI1A 1MQJA 2XXHA 4OYVA 4JSDA 1MM7A 1UTHA 1SQYA 1YPNA 2ANJA 1Z7ME 3VV5A 1HSLA 4NF8B 1ANFA 3IB1A 2HFBA 4MBPA 4QFNA 4F1UA 3K02A 3MVZA 3TTLA 5CBSA 1JEVA 1R9QA 4LA9A 2PYYA 4YZZA 1DTZA 4FEBA 4NF4B 5H8QA 3RTWB 5DTBA 4YICA 1QUJA 3IJXB 3T66A 2VD3A 2DYXA 5A5XB 1OVBA 4IGRA 1SBPA 1M5BA 1IZ1A 3MBPA 4RYAA 1TXFA 2I0BA 4ZZEA 1JW4A 2I0CA 2F5XA 1XS5A 3VXCA 4YB7A 3FGSA 1I6QA 3TTMA 1LAFE 2V84A 3H6WA 3K00A 5ISUA 1PBPA 2I6EA 2F7CA 3IJOB 3TODA 4QRZA 3WAFA 1MXWA 2QMWA 4ELRA 5ITPA 3BFUA 1UTHB 2VD2A 3PPQA 3VDFA 4YKIA 4GOTA 4U1OA 3HSTA 4KPTA 5H8NA 3VE1B 3TTNA 3KJ7A 3VXBA 1DOTA 3FXUA 2RF1A 1MPCA 1BTJA 2OJTA 1VE4A 4H8JA 1EU8A 1DTGA 4OETA 3ILUB 3VFJA 3N6TA 3RGYA 3U72A 4EDPA 1MDP1 5FTHA 1MPDA 3C34A 1S9TA 3MZBA 3FUZA 1B4ZA 1ZTYA 3V8XB 4OENA 1GR2A 4OZ9A 3CSBA 4NWDA 2Y7PA 3QXMA 2X26A 3K6XA 3Q28A 1N0TA 1ZIUA 3MP6A 1MXVA 2E1SA 2X7QA 4PP0A 4ONYA 2ONSA 3KN3A 3N5LA 4FEDA 4JB7A 3FV1A 4BDOA 3TKDA 3T93B 3O29A 1N76A 3T22A 4MLVA 3CG1A 4LVQA 4WEDA 3G3FA 3E4RA 2PVUA 3VLWA 1QUIA 2RC7A 3IO4A 1MRPA 1MXXA 1MH4A 2OZZA 1URDA 1AIVA 1R9LA 1MG1A 1XVYA 1LB8A 4AB5A 3SERA 4ESXA 3PUZE 4OTEA 2HAVA 3KSJA 3PMXA 1VSOA 5FHOA 5EHMA 3IK6B 4I9DA 3IOTA 3LSXA 3SEWA 4UACA 3LBSA 1MY0A 4Q0CA 4FAJA 2P0SA 4F1VA 3KOTA 3UP9A 4NMYA 3DM0A 2IA4A 3K01A 4DZ1A 2A5TB 4I62A 4XKRA 3SEUA 1P1NA 3GBAA 3MZ9A 1JVYA 4JWYA 1EZOA 1QVSA 4Z7EA 4DXUA 4F3PA 4DLDA 4F19A 1R1NA 2VOZA 4EXLA 3G3KA 3L6HA 4H67A 4EF1A 5L9SA 2OWTA 1UTBA 3MPLA 1M5FA 2Q8JA 3WAEA 1N7WA 2V3QA 4G68B 5CRYA 3RQTA 2AL4A 4KYDA 4OHNA 2Q88A 2M8CA 5EHSA 4QSCA 4RXLA 3KJTA 3SEVA 4GVOA 5L9OA 3K1MA 1N04A 1OQGA 2Q9TA 5H8HA 2I58A 3K2DA 1FTJA 2G93A 4NF6A 2KLFA 5JTYA 1H3DA 4IO3A 1YTVA 5HBCA 3ODBA 4BDRA 4DIGA 1RYXA 3M3FA 2QMXA 1SVXB 5DYHA 3VLVA 2H25A 1FQAA 3FZVA 5CC2A 1XVXA 4YMAA 3S9MC 3U94A 1FQCA 4TQUQ 1MQHA 2RKMA 5TU0A 5I2KA 4H5FA 2O1MA 4F31B 3EQ1A 1NH7A 2UVGA 4BDMA 1WODA 1MH3A 1USYE 1XHYA 1H45A 1P1OA 4JWXA 4R6YA 1MQIA 3PV0E 4BDLA 1A99A 3HCQA 3LSLA 4LATA 4KQPA 1TFAA 2DSFA 4IO6A 2QS4A 3U1OA 2O6AA 1IXHA 2OCUA 3MP1A 3FJGA 1UIUA 3RT6B 2PX1A 5KDTA 1XT8A 1OMPA 4U23A 4NF6B 3O97A 1VFDA 3N6UA 3TZAA 4F3SA 1B4HA 1ZJLA 5JTYB 1Y4CA 1YCJA 3RT8A 3DP6A 3V5AA 5AA4A 2NXOA 4POXA 2XX9A 4C0RA 1O63A 1LBCA 5CBRA 2QL3A 3T9XB 4JBZA 5I2KB 3JZJA 4KHZE 1JNFA 3FJMA 3FVNA 1QKBA 1Y20A 5J1DA 3TAJA 3B6WA 1OVTA 3G3HA 2XXYA 2A5SA 4GIZA 3K1NA 1P99A 3S4UA 1P1WA 1A55A 1R6ZA 4X1BA 3UGWA 4F22A 4ELQA 2E0SA 1H43A 3PPNA 4KD5A 4QFOA 3OELA 4U4SA 3LSFB 3ZSFA 2PT2A 3PGFA 4OEVA 5KDTB 1ZKBA 5L9MA 3S2VA 4OQOA 1MY4A 4YU0A 3Q26A 2QS1A 3ZKLA 5A5XA 4DE8A 4PQJA 2ZYNA 2B65A 2ZNSA 4JXIA 5CM6A 4OFLA 4RK9A 1MY1A 5TP9B 2Y7WA 4AQ4A 2DQVA 2AYSA 3PD9A 3LSWA 3QUJA 1IIWA 2F7AA 3C31A 3E13X 3K1PA 3LR1A 4FECA 1US4A 5CI5A 3SKPA 1TWYA 2P1SA 1L5TA 4GD5A 1S7YA 1D9YA 3IB0A 4BDQA 3H6UA 4H6DA 3SETA 1OIBA 1JEUA 3IB2A 3CSGA 4ZEIA 2DWAA 1OQHA 2Q89A 3QK6A 2OK2A 4ZEFA 1WDNA 3G3GA 2DXYA 5JEIA 3Q25A 3TCGA 3U92A 4DCYA 2YPNA 1QULA 2HXWA 3CFZA 2OWSA 2QJEA 1CE2A 4X1DA 2O68A 1POTA 3CG3A 3IAZA 1LAXA 1URGA 4NEDA 1IITA 4F2QA 4OWDA 2PBWA 5DT6A 2V93A 5M2VA 5KZTA 1QUKA 3O6GA 1SW1A 5H8SA 4GXSB 2XD2A 3IOWA 2UYEA 3SEXA 2ZYKA 1NFTA 5AA1A 3FJ7A 4C1TA 1M5DA 3BKIB 3CR9A 3H06B 1SW5A 4DDDA 3K6WA 4TLMB 4IO5A 1B3GA 1JVXA 3TEPA 1SI0A 5B7DA 4R6HA 3MPKA 1J1NA 2Z22A 1FTKA 2V3UA 5FTIA 1F9BA 3EF7A 4IO4A 2ALUA 2Z23A 3QAXA 3CFLA 3KOSA 3OO7A 2I49A 1GGGA 2F35A 4ZEBA 2R71A 3M3KA 3A09A 4NF5A 4RPOA 4H5GA 4XIGQ 4EQ9A 1IXIA 2Q2AA 4U2RA 1MY3A 4EQBA 3MVWA 4H1XA 2ONKE 2YJPA 1SYHA 4FE8A 3VVEA 1LLSA 2H98A 2REGA 3MWBA 3UORA 2DWJA 3GXAA 3IL1B 2XX7A 3PUYE 3TFLA 1IUDA 5I2NB 1LFGA 1B6HA 3KEIA 4QFPA 4H0WA 2A5TA 4POWA 4NWCA 5H8FA 2V3TA 2W7YA 4R2FA 1UQWA 4ZEKA 3FIRA 1QJMA 4P0IA 3FVKA 4NE4A 4IO2A 4U4XA 2I3WA 2RCBA 1D4NA 1A7LA 4F1YA 4PE5B 1O7TA 1NKXA 1GV8A 1PB9A 4P0GA 3S9NC 2Y7KA 3MZ1A 4G68A 4Q5TA 5AA2A 2O69A 3OSRA 4NF5B 3V83A 2Y7IA 4HW8A 4OMBA 1N7XA 1WVJA 3OD7A 1FTMA 1B3LA 4RK2A 5F1QA 4OESA 4ZDMA 1N3WA 2R6GE 4KYSA 1IQ7A 2ZYMA 3GZGA 4TOZA 4QSEA 4DXBA 2QRYA 1A54A 4ZE8A 4G68C 4IY5A 3G7WA 5CMBA 1NNTA 5H8FB 4YAHX 1LB9A 2RC8A 4R74A 2O7UA 4LZ7A 1B0HA 3IX1A 1MDQA 1A40A 3T9UA 2DXRA 1NH8A 2VHAA 3PMWA 3C9HA 1OLAA 2O84X 1SYIA 3VVFA 1LAHE 4ELOA 4KCCA 3HO7A 3CRBA 3TCFA 5AA2B 3PD8A 4ZE9A 5BUUA 3IR1A 2ABHA 3QUFA 4MF3A 1P1QA 3Q29A 1URSA 2ZNUA 2Z8FA 2Z8EA 3O28A 1PB8A 3OO8A 3TTRA 2HQ0A 4XKPA 1H44A 3LUYA 2ONRA 4DXCA 3H7MA 4OXVA 4G8HA 4BLAA 3RUMA 3KG2A 3DP4A 4K3FA 5CMKA 1FCKA 3HHGA 2RCAA 5LOMA 1FTOA 4Q8RA 3S9LC 2Y84A 2WKYA 1LGBC 5B70A 5AE4A 4GLIA 4QF9A 3MAMA 3PPPA 2GRVA 4L17A 3RNNA 5JK4A 4XKQA 3DELB 2ZMBA 4C1UA 1AMFA 1PEBA 1HSEA 5EYFA 4FJPA 4LQ5A 3MVYA 4H65A 4MLQA 3PPOA 2OBGA 2F6GA 1MQGA 3L6GA 1KWHA 5CMMA 5I57B 1NNKA 5AA2D 4GF8A 1MPBA 3FD3A 5ICTA 4G8NA 4I1DA 4YKKA 5HPQA 3O6HA 2D5WA 2YLNA 4E0WA 3IOUA 1JW5A 3K0VA 2Q2CA 1B46A 2G29A 3H3GA 4ZECA 3OSQA 3DP8A 2PMSA 4PFTA 3FXQA 1Q35A 1SW4A 4KR5A 1FQEA 3OO6A 3QYTA 2OLBA 2AIXA 5TP9A 3GLBA 1AOVA 3G3IA 3A3UA 1MXZA 2Y7RA 1FW0A 1Y1ZA 2FYIA 4Z0IA 4FIMA 1I69A 1ZLQA 2B3BA 4GL0A 4MH5A 4U21A 3G3JA 4N6PA 4OVJA 3KBRA 4ZS9A 1B7ZA 4OERA 4G4PA 2ESNA 3FATA 4XTCQ 1PB7A 2DE4A 4YB5A 3KN8A 2QS3A 1B5IA 5DVFA 3K6VA 1NNFA 3HHFA 1B3FA 2XXVA 4LZ8A 3K4UA 3FVGA 3JYRA 2XXWA 3EN3A 4HCWA 2F6PA 1S50A 2I4CA 1D3KA 1RKMA 4H8IA 3TDJA 3TQWA 4ISUA 3RN8A 1M5CA 1MS7A 2NUVA 4UA8A 2XXRA 1USYH 3I6VA 4PFYA 2FNCA 2GFEA 1XC1A 3W9VA 4R2BA 3SEYA 5KCJA 3MQ9A 1SW2A 4LZ5A 3CIJA 3MW0A 4N13A 3O66A 3OXNA 3B6QA 4O3AA 4YB6A 3AXFA 5IKBA 1Y3QA 5ELVA 3TMGA 4EQ7A 1MXYA 3EHTA 2HEUA 2REJA 2CMOA 4PFWA 1MM6A 2F97A 4G8MA 3BBRA 3SDFA 4ESWA 2ZXTA 5FHNA 1MQDA 3KFMA 1IXGA 3MVXA 3CVGA 3H6VA 2H4IA 5K2YA 3TQLA 3Q27A 3OMBA 5TPAB 5I56B 3PMVA 1YAEA 2GH9A 2HCAA 3PUWE 1LAGE 3U8QA 4F29A 3IO6A 1MY2A 2I3VA 1Y3PA 1B40A 1B2HA 4HCYA 2DVZA 3KN7A 1TFDA 5IAIA 1Y9UA 1Y4TA 3H03A 3HPIA 5I2NA 3I5OA 5I58B 1EZ9A 2H99A 3C35A 3PUVE 4RJZA 5F7VA 3T96B 4KI0E 5L8DA 5I59A 4WEPA 3TCHA 5AA3A 5KCJB 2DVCA 1TT1A 1BKAA 4U1ZA 1PBQA 3RTFB 1XOCA 3SESA 3E3KA 4EF2A 2R9JA 2D3IA 1HSJA 3T9VA 3HN0A 4OEUA 4QSDA 3I3VA 4QFKA 3C32A 4LQ2A 3C36A 5ICQA 3EHUA 1ZU0A 4Q30B 4O3CA 4RPNA 2Z8DA 4IY6A 5H8QB 2ZNTA 4RNSA 3R6UA 2VGQA 3KZGA 1JQFA 2DP8A 4LP2B 3P7IA 1RYOA 1I6AA 2DE2A 3O2AA 3W15C 4R6KA 4RA1A 4HTGA 4GFRA 3PU5A 1DPPA 3CFXA 1D9VA 3EHSA 2BJJX 3OO9A 4KCDA 4THIA 2D21A 2QSXA 4PETA 3E9XA 4IGTA 5I59B 1Z7NE 1B5HA 3M8UA 1B3HA 3F11A 4E0XA 3TYHA 2P2AA 4XXUA 1LCFA 4FATA 3IORA 1FQDA 4R75A 5ITOA 2F34A 3FV2A 1N3XA 1B58A 4WXJA 1BIYA 3M3LA 4M1VA 4ELPA 5H8NB 2DE3A 3N94A 1GVCA 2H5YA 4GWOA 2F7BA 2DOJA 4JWOA 3FXRA 4FORA 3B7DA 2XXQA 2UXAA 1BLFA 4U22A 4YKPA 1SD3A 2I4BA 3QIMA 4IB2A 1NNPA 4AB6A 1Y3NA 3LC8A 1IXCA 4R9GA 4JDFA 4F3BA 4BDNA 1SDXA 2GHBA 2X7PA 3O9PA 2DS9A 3CI8A 3ILTB 4TLLB 4EXKA 1B5JA 4ZEDA 4RY1A 1ATGA 2UVJA 3ZS6A 3B6TA 3H6TA 1M5EA 4P11A 3W9WA 2NVUB 4QFLA 2XX8A 3USDA 1B7HA 2IEEA 2UVIA 5I57A 1ZMGA 4KFQA 1ZBMA 1VR5A 1JETA 3C33A 1LFIA 4WKMA 1B52A 2I48A 3A3CA 2V25A 3R26A 4GL8A 1FTLA 3FASA 3IOVA 2FA7A 3MC2A 2QS2A 4PFUA 1FQBA 4YKJA 1AL3A 5HM4B 1B3EA 1B9JA 1OLCA 4R72A 1LBBA 5DVJA 2NOOA 2RINA 1JW1A 2LAOA 3OOAA 2XXPA 2AL5A 3VVDA 3OENA 3K6UA 3TTKA 2O1LA 3C4MA 2NWJA 3OEKA 3QSLA 2CZLA 1US5A 1UIVA 1VFEA 1AH5A 1ELJA 1LCTA 3D4GA 4LONB 3V89B 1Q1KA 2O7IA 1I6BA 2GHAA 3VLUA 1B05A 2F78A 4DCXA 1B32A 3EPEA 3UK4A 2F36A 2H9BA 2O51A 1DSNA 4ZZAA 1DMBA 4G77A 3MUQA 3RPWA 4HS7A 3KSXA 2HAUA 1UTBB 5CMCA 4KYEA 4R9FA 1POY1 2ZYOA 3UA8A 1O64A 2VP1A 3N26A 3O6IA 3OEMA 5I84A 3H4ZA 2HZKA 1II5A 1EZPA 1B1HA 2XHDA 1LSTA 4GRKA 2RC9A 4OFJA 4QHQA 3ECRA 3UIFA 4ECFA 1B1XA 1EH3A 1FQFA 3FVOA 5H8HB 3T9HB 3TELA 1CB6A 3R7XA 4NTLA 4YMBA 3ONMA 4EUOA 1IEJA 1PC3A 1QKAA 2DWIA 4F18A
chains in the Genus database with same CATH superfamily
2QPQA 1IMBA 2XD3A 1NV6A 4G2ZA 3U93A 3S9EA 2F8DA 4NN3A 3PPRA 5DEXA 2HZLA 3ZKKA 2DWHA 2R8TA 1B7UA 4LUBA 5BWJA 2F3BA 2UYFA 4OFOA 4MNPA 4X48A 3JV9A 3MJNA 3GBBA 1DPEA 3TUSA 3RY3A 4P3LA 1NL5A 2FBPA 4F39A 4R73A 3D4CA 4X9TA 1P1UA 1B0LA 3KGCA 4GXAA 4M4GA 2XXXA 4NG7A 1Y1MA 4O3BA 1A8FA 4PBHA 4NF8A 4MFIA 2XXUA 4HE0A 1FJ6A 4GQOA 4N07A 1GTKA 4IO7A 3BFTA 4JSOA 1BP5A 3RLFE 2XXTA 3RYDA 3B8BA 4F3GA 4NF4A 3MP8A 1MXUA 4NGUA 2XXIA 1A8EA 5TPAA 5I56A 2B3FA 2UVHA 4MAGA 4I8CA 1N84A 1FBCA 5AA4B 4F2OA 5DEXB 2PT1A 4AS4A 2WEFA 1PDAA 3PUXE 1LFHA 3TPAA 1T0KA 5FHMA 1QW0A 5I58A 4NQ8A 4X8RA 1NUXA 3IFCA 5DVIA 1B51A 1H76A 4ND9A 4XKNA 2THIA 2HHMA 1NMUA 3THIA 3HV1A 2Y5LA 3DLNA 5K2XA 3UN6A 1SI1A 4LN5A 1MQJA 2XXHA 2QVRA 4OYVA 3U65A 4JSDA 1MM7A 1UTHA 1SQYA 1YPNA 5IZ3B 2ANJA 1Z7ME 3VV5A 1HSLA 4NF8B 1ANFA 3IB1A 2HFBA 4MBPA 4QFNA 4F1UA 3K02A 3MVZA 3TTLA 5CBSA 1RDZA 1KA1A 1JEVA 1FPGA 1R9QA 4LA9A 2PYYA 4YZZA 3B50A 1DTZA 4FEBA 4NF4B 5H8QA 3RTWB 5DTBA 1JP4A 4YICA 1QUJA 3IJXB 3T66A 2VD3A 2DYXA 5A5XB 4PFBA 1OVBA 4IGRA 1SBPA 1M5BA 1IZ1A 3MBPA 4RYAA 2B4MA 1TXFA 2I0BA 4ZZEA 1JW4A 2I0CA 2F5XA 1XS5A 3VXCA 4YB7A 3FGSA 1I6QA 3TTMA 1LAFE 2V84A 3H6WA 3K00A 5ISUA 1PBPA 2I6EA 2F7CA 3IJOB 3TODA 4QRZA 2P3VA 3WAFA 1MXWA 2QMWA 1FPLA 4ELRA 5ITPA 3BFUA 4P1EA 1UTHB 1NI9A 2VD2A 3PPQA 3VDFA 4YKIA 4GOTA 4U1OA 3HSTA 4KPTA 5H8NA 3VE1B 3TTNA 3KJ7A 3VXBA 1DOTA 3FXUA 2RF1A 1MPCA 1BTJA 2OJTA 1VE4A 4N4UA 4H8JA 1DBZA 4OVRA 1YZ0A 1EU8A 1DTGA 4OETA 5EQAA 3ILUB 3VFJA 3N6TA 4JVCA 3RGYA 3U72A 4EDPA 1MDP1 5FTHA 1MPDA 3C34A 1S9TA 3MZBA 1NV1A 3FUZA 1B4ZA 1ZTYA 3V8XB 4OENA 1GR2A 4OZ9A 3CSBA 4NWDA 1YYZA 2Y7PA 1FPEA 2B4LA 3QXMA 2X26A 3K6XA 3Q28A 1N0TA 1ZIUA 3MP6A 3QMFA 1MXVA 1SPIA 2E1SA 2X7QA 4PP0A 4GWSA 4ONYA 2ONSA 1KZ8A 4MNCA 5ET7A 3KN3A 3N5LA 4FEDA 5ESYA 4JB7A 3FV1A 4X04A 1NUYA 2F3DA 3TKDA 4BDOA 3T93B 3O29A 1N76A 4H46A 3A29A 1FBDA 3T22A 4MLVA 3CG1A 4LVQA 4WEDA 3G3FA 3E4RA 2QVVA 2PVUA 3VLWA 1QUIA 2RC7A 3IO4A 1MRPA 1MXXA 1MH4A 2OZZA 2ZZWA 1URDA 1AIVA 1R9LA 4G61A 1MG1A 2XWIA 1XVYA 1XI6A 1LB8A 4AB5A 3SERA 4ESXA 3PUZE 4OTEA 2HAVA 3KSJA 3PMXA 3EKIA 1VSOA 5FHOA 1EYJA 5EHMA 3IK6B 4PTKA 4I9DA 3IOTA 4MNIA 3LSXA 3SEWA 4UACA 3LBSA 1MY0A 4Q0CA 4FAJA 2P0SA 4F1VA 3KOTA 3UP9A 4NMYA 3DM0A 2IA4A 3K01A 4DZ1A 2A5TB 4I62A 4XKRA 3SEUA 1P1NA 3GBAA 3MZ9A 1JVYA 4JWYA 4PCDA 1EZOA 1QVSA 4Z7EA 4DXUA 1LBZA 4F3PA 4DLDA 4HE1A 4F19A 1R1NA 2VOZA 4EXLA 3G3KA 1LBWA 4PAIA 3L6HA 4H67A 4EF1A 5L9SA 2OWTA 1UTBA 4GBWA 3MPLA 1M5FA 2Q8JA 3WAEA 1N7WA 2V3QA 4G68B 5CRYA 3RQTA 2AL4A 4KYDA 4OHNA 4JVDA 1NV5A 5FBPA 2FHYA 2Q88A 1FPKA 2M8CA 4I40A 4QSCA 5EHSA 2VPNA 4RXLA 3KJTA 3SEVA 4GVOA 5L9OA 3K1MA 1N04A 1OQGA 2JJKA 2Q9TA 5H8HA 2I58A 3K2DA 1FTJA 2G93A 4NF6A 2KLFA 3GYYA 4DI3D 5JTYA 1H3DA 4IO3A 1YTVA 5HBCA 2XA5A 3ODBA 4BDRA 5I7IA 4DIGA 1RYXA 3M3FA 2QMXA 1K9ZA 4PE3A 1SVXB 5DYHA 3VLVA 2H25A 1FQAA 3FZVA 5CC2A 1XVXA 4YMAA 3S9MC 3U94A 1FQCA 4TQUQ 1MQHA 2RKMA 5TU0A 2KQZA 5I2KA 4H5FA 2O1MA 4F31B 3EQ1A 1NH7A 4OVQA 2UVGA 4BDMA 1WODA 1MH3A 1USYE 1XHYA 1H45A 1P1OA 4JWXA 4R6YA 2OWZA 1MQIA 3PV0E 4BDLA 1A99A 3HCQA 3LSLA 4LATA 4KQPA 1TFAA 4NAPA 2DSFA 4IO6A 1FPBA 2QS4A 3U1OA 3T0JA 2O6AA 1IXHA 2OCUA 1QGXA 3BIGA 3FJGA 1UIUA 3MP1A 3RT6B 2PX1A 5KDTA 1XT8A 1OMPA 4U23A 4NF6B 3O97A 1VFDA 3N6UA 3TZAA 4F3SA 1B4HA 1ZJLA 5JTYB 4GX3A 1NV3A 1LEVA 1Y4CA 1YCJA 3RT8A 3DP6A 3V5AA 5ET6A 5AA4A 2NXOA 4POXA 2XX9A 4C0RA 1O63A 1LBCA 3D1RA 5CBRA 2QL3A 3T9XB 1DCUA 4JBZA 5I2KB 3JZJA 4KHZE 1JNFA 3FJMA 3FVNA 1QKBA 1Y20A 5J1DA 3TAJA 3B6WA 1OVTA 3G3HA 2XXYA 2A5SA 4GWYA 4GIZA 3K1NA 5IGAA 5IZ3A 1P99A 3S4UA 1P1WA 1A55A 1R6ZA 4X1BA 3UGWA 4F22A 4ELQA 2E0SA 1H43A 1NV7A 3PPNA 3HFUA 4KD5A 2FVZA 4QFOA 2Y5KA 3OELA 4PF8A 4U4SA 3MSTA 3LSFB 3ZSFA 2PT2A 3PGFA 4OEVA 5KDTB 1ZKBA 2HXRA 5L9MA 3S2VA 4OQOA 1MY4A 4YU0A 3Q26A 2QS1A 3ZKLA 5A5XA 4DE8A 4PQJA 2ZYNA 4PF6A 2B65A 2ZNSA 4JXIA 5CM6A 4OFLA 5EQ7A 4RK9A 1MY1A 5TP9B 2Y7WA 4AQ4A 2DQVA 2AYSA 3PD9A 3LSWA 3QUJA 1IIWA 2F7AA 3C31A 4OANA 3E13X 3K1PA 3LR1A 3KBZA 4FECA 1US4A 5CI5A 3SKPA 1TWYA 1IMDA 2P1SA 2XWVA 1L5TA 4GD5A 5I5PA 1S7YA 2PCRA 1D9YA 3IB0A 5DW8A 4BDQA 3H6UA 4H6DA 3SETA 1OIBA 1KA0A 1JEUA 3IB2A 3CSGA 4ZEIA 2DWAA 1OQHA 2Q89A 3QK6A 2OK2A 4ZEFA 4MX6A 1WDNA 3G3GA 2DXYA 5JEIA 3Q25A 3TCGA 4N17A 4MHFA 3U92A 4DCYA 2YPNA 1QULA 2HXWA 3CFZA 1RDYA 2OWSA 2QJEA 1CE2A 4X1DA 2O68A 1POTA 3CG3A 3IAZA 1LAXA 1URGA 4NEDA 1IITA 4F2QA 4OWDA 1FSAA 2PBWA 5DT6A 2V93A 5M2VA 5KZTA 1QUKA 3O6GA 2WYKA 1SW1A 5H8SA 4GXSB 2XD2A 1G0IA 3IOWA 2WBDA 2UYEA 4XEQA 3SEXA 2ZYKA 1NFTA 4PGNA 5AA1A 3FJ7A 4C1TA 4N8GA 1M5DA 3IFAA 3BKIB 3CR9A 3H06B 1SW5A 4O94A 4DDDA 3K6WA 4TLMB 4IO5A 1NV0A 1B3GA 1JVXA 3TEPA 1SI0A 5B7DA 4R6HA 3MPKA 1J1NA 3FXBA 2Z22A 1FTKA 2V3UA 5FTIA 1F9BA 2HPGA 3EF7A 4IO4A 2ALUA 2Z23A 3QAXA 3CFLA 3KOSA 3OO7A 2I49A 1GGGA 2F35A 4ZEBA 5ET5A 2R71A 3M3KA 5EQ8A 3A09A 4NF5A 2GQ1A 4RPOA 4H5GA 4XIGQ 4EQ9A 1IXIA 2Q2AA 4U2RA 1MY3A 4EQBA 3MVWA 4H1XA 2ONKE 2YJPA 1SYHA 4FE8A 3VVEA 1LLSA 4N6DA 2H98A 2REGA 3MWBA 3UORA 2DWJA 3GXAA 3IL1B 2XX7A 4N8YA 3PUYE 4O7MA 3TFLA 1IUDA 5I2NB 1LFGA 1B6HA 3KEIA 4QFPA 4H0WA 1NUWA 2A5TA 4PFIA 4POWA 4NWCA 4QBAA 5H8FA 2V3TA 2VPOA 2W7YA 4R2FA 1UQWA 1FBFA 4ZEKA 4QXDA 3FIRA 1QJMA 4P0IA 3KC1A 3FVKA 4NE4A 4IO2A 4U4XA 2I3WA 2QVUA 2RCBA 2QFLA 1D4NA 1A7LA 4F1YA 4PE5B 1O7TA 2ZZXA 1NKXA 1GV8A 2MKZA 1PB9A 4P0GA 3S9NC 3LV0A 2Y7KA 2Q74A 3MZ1A 4G68A 4Q5TA 5AA2A 4PC9A 2O69A 2P3NA 3OSRA 4NF5B 3V83A 2Y7IA 4HW8A 2PFZA 4OMBA 1N7XA 1WVJA 3OD7A 1FTMA 1B3LA 2FIXA 4RK2A 5F1QA 4OESA 4ZDMA 1N3WA 2R6GE 1FTAA 4KYSA 1IQ7A 4PBQA 2ZYMA 3GZGA 4TOZA 2Q8MA 2VT5A 4QSEA 4DXBA 2QRYA 1A54A 4ZE8A 4G68C 4IY5A 3G7WA 5CMBA 1NNTA 5H8FB 4YAHX 1LB9A 2RC8A 3BIHA 4R74A 2O7UA 4LZ7A 1B0HA 3IX1A 1MDQA 1A40A 3T9UA 2DXRA 1AWBA 1NH8A 2VHAA 3PMWA 3C9HA 1OLAA 2O84X 1SYIA 3VVFA 1LAHE 4ELOA 4KCCA 3HO7A 3CRBA 3TCFA 5AA2B 4UABA 5ET8A 3PD8A 4ZE9A 5BUUA 3IR1A 1FRPA 2ABHA 4PGPA 3QUFA 4MF3A 1P1QA 3Q29A 1URSA 2ZNUA 1RDXA 4IR8A 2Z8FA 3SZPA 2Z8EA 4MCOA 3O28A 1PB8A 3OO8A 3TTRA 1Q9DA 3KC0A 2HQ0A 4XKPA 1H44A 3LUYA 2ONRA 4N81A 4DXCA 3H7MA 4OXVA 4G8HA 4BLAA 3RUMA 3KG2A 3DP4A 4K3FA 4I3YA 4JVIA 5CMKA 1FCKA 5J16A 2OX3A 3HHGA 4NX1A 2RCAA 5LOMA 1FTOA 4Q8RA 3S9LC 2Y84A 2WKYA 1LGBC 5B70A 5AE4A 4GLIA 4QF9A 1NV4A 3MAMA 3PPPA 2GRVA 4L17A 3RNNA 4FBPA 4XKQA 5JK4A 3DELB 2ZMBA 1DK4A 4XF5A 4C1UA 1AMFA 4GBVA 1FBPA 1PEBA 2CZHA 1HSEA 4XFEA 5EYFA 4FJPA 4GWUA 4LQ5A 3MVYA 4H65A 4MLQA 3RPLB 1LBYA 2DDKA 3PPOA 2OBGA 4P1LA 2F6GA 1IMAA 1MQGA 3L6GA 1KWHA 5CMMA 5I57B 1NNKA 5AA2D 4GF8A 1MPBA 3FD3A 5ICTA 5F24A 2WX9A 4G8NA 4I1DA 4YKKA 5HPQA 3O6HA 2D5WA 2YLNA 4E0WA 3IOUA 1JW5A 3K0VA 2Q2CA 5IZZA 1FBGA 1B46A 2G29A 3H3GA 4ZECA 3OSQA 3DP8A 2PMSA 4PFTA 3FXQA 1Q35A 1SW4A 2WYPA 4KR5A 1FQEA 3OO6A 4DI4B 3QYTA 2OLBA 1YXIA 2AIXA 5TP9A 3GLBA 3LUZA 1AOVA 3G3IA 3A3UA 1MXZA 2Y7RA 1FW0A 1Y1ZA 2FYIA 2KR0A 4Z0IA 4FIMA 2ZZVA 1I69A 1ZLQA 2B3BA 4GL0A 4MH5A 4U21A 3G3JA 4N6PA 3CHGA 4OVJA 2XWKA 4MJOA 3KBRA 4ZS9A 1B7ZA 4OERA 4G4PA 2ESNA 3FATA 4XTCQ 1PB7A 2DE4A 1FJ9A 1IMCA 4YB5A 3KN8A 2QS3A 1B5IA 5DVFA 3K6VA 1NNFA 3HHFA 4OVSA 1B3FA 3MYUA 1FPDA 2XXVA 4LZ8A 3K4UA 3FBPA 1FPIA 3FVGA 3JYRA 4GX6A 2XXWA 3EN3A 3E78A 4HCWA 4P9KA 2F6PA 4GWZA 1S50A 2I4CA 1D3KA 1RKMA 4H8IA 3TDJA 3TQWA 5LDZA 4ISUA 3RN8A 4P56A 1M5CA 1MS7A 4P8BA 3ROJA 2NUVA 4UA8A 2XXRA 1USYH 3I6VA 4PFYA 2FNCA 2GFEA 1XC1A 3W9VA 1FBEA 4R2BA 5IM2A 3SEYA 5KCJA 2CEYA 3MQ9A 1SW2A 4LZ5A 5I3SA 4PDDA 3CIJA 3MW0A 4N13A 3O66A 3OXNA 3B6QA 4O3AA 4YB6A 3AXFA 5IKBA 1Y3QA 5ELVA 3TMGA 4EQ7A 1MXYA 3EHTA 2HEUA 2REJA 2CMOA 4PFWA 1MM6A 2F97A 5EQ9A 3E79A 4G8MA 3BBRA 3SDFA 4ESWA 2ZXTA 4N6KA 5FHNA 1MQDA 3NOHA 4GX4A 3KFMA 1IXGA 3MVXA 3CVGA 3H6VA 2H4IA 5K2YA 3TQLA 3Q27A 3OMBA 5TPAB 5I56B 3PMVA 1VDWA 1YAEA 2GH9A 2HCAA 4PAFA 3PUWE 1LAGE 3U8QA 4F29A 3IO6A 1MY2A 2I3VA 1Y3PA 1B40A 1B2HA 4HCYA 4PAKA 2DVZA 3KN7A 1TFDA 5IAIA 1Y9UA 1Y4TA 4AS5A 3H03A 3HPIA 5I2NA 3I5OA 5I58B 1EZ9A 2H99A 3C35A 3PUVE 1NUZA 4RJZA 5F7VA 3T96B 4KI0E 5L8DA 5I59A 1IMEA 4WEPA 3TCHA 5AA3A 5KCJB 2DVCA 1TT1A 1BKAA 4U1ZA 1PBQA 3RTFB 4HXVA 1XOCA 3SESA 3E3KA 4EF2A 2R9JA 2D3IA 4OVPA 1HSJA 3T9VA 3HN0A 4OEUA 4QSDA 3I3VA 4QFKA 3C32A 4LQ2A 3C36A 5ICQA 1LBXA 4N91A 3EHUA 1ZU0A 4Q30B 4O3CA 4RPNA 2Z8DA 5EYGA 4IY6A 5H8QB 2ZNTA 4RNSA 3R6UA 2FIEA 2VGQA 3KZGA 1JQFA 2DP8A 4LP2B 3ISPA 3P7IA 1RYOA 1I6AA 2CZIA 2DE2A 3O2AA 3W15C 4R6KA 4RA1A 4HTGA 4GFRA 3PU5A 1DPPA 3CFXA 1D9VA 3EHSA 2BJJX 3OO9A 4KCDA 4THIA 2D21A 2XWOA 2QSXA 4PETA 3E9XA 4GWWA 4I3EA 4GWXA 4IGTA 1EYIA 5I59B 1Z7NE 1B5HA 3M8UA 1B3HA 3F11A 4E0XA 4OVTA 3TYHA 2P2AA 4XXUA 1LCFA 4FATA 3IORA 1FQDA 4R75A 5ITOA 2F34A 4HE2A 3FV2A 1N3XA 1B58A 2BJIA 4WXJA 1BIYA 3M3LA 4M1VA 4PFRA 4ELPA 5H8NB 5T3JA 5EYHA 2DE3A 3N94A 1GVCA 2H5YA 4GWOA 2F7BA 2DOJA 2XXKA 4JWOA 3FXRA 4NF0A 4FORA 3B7DA 2XXQA 2UXAA 4PDHA 1NV2A 1BLFA 4U22A 4YKPA 1SD3A 2I4BA 3QIMA 4IB2A 1NNPA 4AB6A 1K9YA 1Y3NA 3LC8A 1IXCA 1FPJA 4R9GA 4JDFA 1CNQA 4OA4A 4F3BA 4BDNA 1SDXA 2GHBA 2X7PA 3O9PA 2DS9A 1LBVA 3CI8A 3ILTB 4TLLB 4EXKA 1B5JA 3T1BA 4ZEDA 4RY1A 1ATGA 2UVJA 3ZS6A 3B6TA 3H6TA 1M5EA 4P11A 3W9WA 2NVUB 3RPLA 1EYKA 2XX8A 4MMPA 4QFLA 2CEXA 3USDA 1B7HA 2IEEA 2UVIA 5I57A 1ZMGA 4KFQA 3PTYA 1ZBMA 1VR5A 1JETA 3C33A 1LFIA 4WKMA 1B52A 2I48A 3A3CA 2V25A 3R26A 4GL8A 1FTLA 3FASA 3IOVA 2FA7A 3MC2A 2QS2A 4PFUA 1FQBA 4YKJA 1AL3A 5HM4B 1B3EA 2CZKA 4NHBA 1B9JA 1OLCA 4R72A 1LBBA 5DVJA 2NOOA 2RINA 1JW1A 2LAOA 3OOAA 2XXPA 2AL5A 4P47A 4KXPA 3VVDA 3OENA 3K6UA 3TTKA 2O1LA 3C4MA 1BK4A 2NWJA 4O7IA 3OEKA 3QSLA 2CZLA 1US5A 1UIVA 1VFEA 1AH5A 1INPA 1ELJA 1D9QA 1LCTA 2L5VA 3D4GA 4LONB 3V89B 1Q1KA 2O7IA 1I6BA 1G0HA 2GHAA 3VLUA 1B05A 2F78A 4DCXA 1B32A 3EPEA 3UK4A 2F36A 2H9BA 2O51A 1DSNA 5LTCA 4ZZAA 1DMBA 4G77A 3MUQA 3RPWA 4HS7A 3KSXA 2HAUA 1UTBB 5CMCA 4KYEA 4R9FA 1POY1 2ZYOA 5IZ1A 3UA8A 4MEVA 2PFYA 4N15A 1O64A 2V4CA 2VP1A 3N26A 3O6IA 3OEMA 4MIJA 5I84A 3H4ZA 2HZKA 1II5A 1EZPA 1B1HA 2XHDA 1LSTA 4GRKA 2RC9A 4OFJA 4O8MA 5A5LA 4QHQA 1FBHA 2WBBA 3ECRA 3UIFA 4ECFA 1B1XA 1EH3A 1FQFA 3FVOA 5H8HB 3T9HB 1IMFA 3TELA 1CB6A 3R7XA 4NTLA 4YMBA 1FPFA 3ONMA 4EUOA 1IEJA 1PC3A 1QKAA 2DWIA 4F18A 4H45A
chains in the Genus database with same CATH topology
2QPQA 2XD3A 4G2ZA 3U93A 3S9EA 2F8DA 3PPRA 5DEXA 2HZLA 3ZKKA 2DWHA 1B7UA 4LUBA 5BWJA 2UYFA 4OFOA 4X48A 3JV9A 3MJNA 3GBBA 1DPEA 3TUSA 3RY3A 1NL5A 4F39A 4R73A 3D4CA 4X9TA 1P1UA 1B0LA 3KGCA 4GXAA 4M4GA 2XXXA 1Y1MA 4O3BA 1A8FA 4NF8A 4MFIA 2XXUA 4GQOA 4N07A 1GTKA 4IO7A 3BFTA 4JSOA 1BP5A 3RLFE 2XXTA 4F3GA 4NF4A 3MP8A 1MXUA 2XXIA 1A8EA 5TPAA 5I56A 2B3FA 2UVHA 4I8CA 1N84A 5AA4B 4F2OA 5DEXB 2PT1A 1PDAA 3PUXE 1LFHA 3TPAA 1T0KA 5FHMA 1QW0A 5I58A 5DVIA 1B51A 1H76A 4ND9A 4XKNA 2THIA 1NMUA 3THIA 3HV1A 3DLNA 5K2XA 3UN6A 1SI1A 1MQJA 2XXHA 4OYVA 4JSDA 1MM7A 1UTHA 1SQYA 1YPNA 2ANJA 1Z7ME 3VV5A 1HSLA 4NF8B 1ANFA 3IB1A 2HFBA 4MBPA 4QFNA 4F1UA 3K02A 3MVZA 3TTLA 5CBSA 1JEVA 1R9QA 4LA9A 2PYYA 4YZZA 1DTZA 4FEBA 4NF4B 5H8QA 3RTWB 5DTBA 4YICA 1QUJA 3IJXB 3T66A 2VD3A 2DYXA 5A5XB 1OVBA 4IGRA 1SBPA 1M5BA 1IZ1A 3MBPA 4RYAA 1TXFA 2I0BA 4ZZEA 1JW4A 2I0CA 2F5XA 1XS5A 3VXCA 4YB7A 3FGSA 1I6QA 3TTMA 1LAFE 2V84A 3H6WA 3K00A 5ISUA 1PBPA 2I6EA 2F7CA 3IJOB 3TODA 4QRZA 3WAFA 1MXWA 2QMWA 4ELRA 5ITPA 3BFUA 1UTHB 2VD2A 3PPQA 3VDFA 4YKIA 4GOTA 4U1OA 3HSTA 4KPTA 5H8NA 3VE1B 3TTNA 3KJ7A 3VXBA 1DOTA 3FXUA 2RF1A 1MPCA 1BTJA 2OJTA 1VE4A 4H8JA 1EU8A 1DTGA 4OETA 3ILUB 3VFJA 3N6TA 3RGYA 3U72A 4EDPA 1MDP1 5FTHA 1MPDA 3C34A 1S9TA 3MZBA 3FUZA 1B4ZA 1ZTYA 3V8XB 4OENA 1GR2A 4OZ9A 3CSBA 4NWDA 2Y7PA 3QXMA 2X26A 3K6XA 3Q28A 1N0TA 1ZIUA 3MP6A 1MXVA 2E1SA 2X7QA 4PP0A 4ONYA 2ONSA 3KN3A 3N5LA 4FEDA 4JB7A 3FV1A 4BDOA 3TKDA 3T93B 3O29A 1N76A 3T22A 4MLVA 3CG1A 4LVQA 4WEDA 3G3FA 3E4RA 2PVUA 3VLWA 1QUIA 2RC7A 3IO4A 1MRPA 1MXXA 1MH4A 2OZZA 1URDA 1AIVA 1R9LA 1MG1A 1XVYA 1LB8A 4AB5A 3SERA 4ESXA 3PUZE 4OTEA 2HAVA 3KSJA 3PMXA 1VSOA 5FHOA 5EHMA 3IK6B 4I9DA 3IOTA 3LSXA 3SEWA 4UACA 3LBSA 1MY0A 4Q0CA 4FAJA 2P0SA 4F1VA 3KOTA 3UP9A 4NMYA 3DM0A 2IA4A 3K01A 4DZ1A 2A5TB 4I62A 4XKRA 3SEUA 1P1NA 3GBAA 3MZ9A 1JVYA 4JWYA 1EZOA 1QVSA 4Z7EA 4DXUA 4F3PA 4DLDA 4F19A 1R1NA 2VOZA 4EXLA 3G3KA 3L6HA 4H67A 4EF1A 5L9SA 2OWTA 1UTBA 3MPLA 1M5FA 2Q8JA 3WAEA 1N7WA 2V3QA 4G68B 5CRYA 3RQTA 2AL4A 4KYDA 4OHNA 2Q88A 2M8CA 5EHSA 4QSCA 4RXLA 3KJTA 3SEVA 4GVOA 5L9OA 3K1MA 1N04A 1OQGA 2Q9TA 5H8HA 2I58A 3K2DA 1FTJA 2G93A 4NF6A 2KLFA 5JTYA 1H3DA 4IO3A 1YTVA 5HBCA 3ODBA 4BDRA 4DIGA 1RYXA 3M3FA 2QMXA 1SVXB 5DYHA 3VLVA 2H25A 1FQAA 3FZVA 5CC2A 1XVXA 4YMAA 3S9MC 3U94A 1FQCA 4TQUQ 1MQHA 2RKMA 5TU0A 5I2KA 4H5FA 2O1MA 4F31B 3EQ1A 1NH7A 2UVGA 4BDMA 1WODA 1MH3A 1USYE 1XHYA 1H45A 1P1OA 4JWXA 4R6YA 1MQIA 3PV0E 4BDLA 1A99A 3HCQA 3LSLA 4LATA 4KQPA 1TFAA 2DSFA 4IO6A 2QS4A 3U1OA 2O6AA 1IXHA 2OCUA 3MP1A 3FJGA 1UIUA 3RT6B 2PX1A 5KDTA 1XT8A 1OMPA 4U23A 4NF6B 3O97A 1VFDA 3N6UA 3TZAA 4F3SA 1B4HA 1ZJLA 5JTYB 1Y4CA 1YCJA 3RT8A 3DP6A 3V5AA 5AA4A 2NXOA 4POXA 2XX9A 4C0RA 1O63A 1LBCA 5CBRA 2QL3A 3T9XB 4JBZA 5I2KB 3JZJA 4KHZE 1JNFA 3FJMA 3FVNA 1QKBA 1Y20A 5J1DA 3TAJA 3B6WA 1OVTA 3G3HA 2XXYA 2A5SA 4GIZA 3K1NA 1P99A 3S4UA 1P1WA 1A55A 1R6ZA 4X1BA 3UGWA 4F22A 4ELQA 2E0SA 1H43A 3PPNA 4KD5A 4QFOA 3OELA 4U4SA 3LSFB 3ZSFA 2PT2A 3PGFA 4OEVA 5KDTB 1ZKBA 5L9MA 3S2VA 4OQOA 1MY4A 4YU0A 3Q26A 2QS1A 3ZKLA 5A5XA 4DE8A 4PQJA 2ZYNA 2B65A 2ZNSA 4JXIA 5CM6A 4OFLA 4RK9A 1MY1A 5TP9B 2Y7WA 4AQ4A 2DQVA 2AYSA 3PD9A 3LSWA 3QUJA 1IIWA 2F7AA 3C31A 3E13X 3K1PA 3LR1A 4FECA 1US4A 5CI5A 3SKPA 1TWYA 2P1SA 1L5TA 4GD5A 1S7YA 1D9YA 3IB0A 4BDQA 3H6UA 4H6DA 3SETA 1OIBA 1JEUA 3IB2A 3CSGA 4ZEIA 2DWAA 1OQHA 2Q89A 3QK6A 2OK2A 4ZEFA 1WDNA 3G3GA 2DXYA 5JEIA 3Q25A 3TCGA 3U92A 4DCYA 2YPNA 1QULA 2HXWA 3CFZA 2OWSA 2QJEA 1CE2A 4X1DA 2O68A 1POTA 3CG3A 3IAZA 1LAXA 1URGA 4NEDA 1IITA 4F2QA 4OWDA 2PBWA 5DT6A 2V93A 5M2VA 5KZTA 1QUKA 3O6GA 1SW1A 5H8SA 4GXSB 2XD2A 3IOWA 2UYEA 3SEXA 2ZYKA 1NFTA 5AA1A 3FJ7A 4C1TA 1M5DA 3BKIB 3CR9A 3H06B 1SW5A 4DDDA 3K6WA 4TLMB 4IO5A 1B3GA 1JVXA 3TEPA 1SI0A 5B7DA 4R6HA 3MPKA 1J1NA 2Z22A 1FTKA 2V3UA 5FTIA 1F9BA 3EF7A 4IO4A 2ALUA 2Z23A 3QAXA 3CFLA 3KOSA 3OO7A 2I49A 1GGGA 2F35A 4ZEBA 2R71A 3M3KA 3A09A 4NF5A 4RPOA 4H5GA 4XIGQ 4EQ9A 1IXIA 2Q2AA 4U2RA 1MY3A 4EQBA 3MVWA 4H1XA 2ONKE 2YJPA 1SYHA 4FE8A 3VVEA 1LLSA 2H98A 2REGA 3MWBA 3UORA 2DWJA 3GXAA 3IL1B 2XX7A 3PUYE 3TFLA 1IUDA 5I2NB 1LFGA 1B6HA 3KEIA 4QFPA 4H0WA 2A5TA 4POWA 4NWCA 5H8FA 2V3TA 2W7YA 4R2FA 1UQWA 4ZEKA 3FIRA 1QJMA 4P0IA 3FVKA 4NE4A 4IO2A 4U4XA 2I3WA 2RCBA 1D4NA 1A7LA 4F1YA 4PE5B 1O7TA 1NKXA 1GV8A 1PB9A 4P0GA 3S9NC 2Y7KA 3MZ1A 4G68A 4Q5TA 5AA2A 2O69A 3OSRA 4NF5B 3V83A 2Y7IA 4HW8A 4OMBA 1N7XA 1WVJA 3OD7A 1FTMA 1B3LA 4RK2A 5F1QA 4OESA 4ZDMA 1N3WA 2R6GE 4KYSA 1IQ7A 2ZYMA 3GZGA 4TOZA 4QSEA 4DXBA 2QRYA 1A54A 4ZE8A 4G68C 4IY5A 3G7WA 5CMBA 1NNTA 5H8FB 4YAHX 1LB9A 2RC8A 4R74A 2O7UA 4LZ7A 1B0HA 3IX1A 1MDQA 1A40A 3T9UA 2DXRA 1NH8A 2VHAA 3PMWA 3C9HA 1OLAA 2O84X 1SYIA 3VVFA 1LAHE 4ELOA 4KCCA 3HO7A 3CRBA 3TCFA 5AA2B 3PD8A 4ZE9A 5BUUA 3IR1A 2ABHA 3QUFA 4MF3A 1P1QA 3Q29A 1URSA 2ZNUA 2Z8FA 2Z8EA 3O28A 1PB8A 3OO8A 3TTRA 2HQ0A 4XKPA 1H44A 3LUYA 2ONRA 4DXCA 3H7MA 4OXVA 4G8HA 4BLAA 3RUMA 3KG2A 3DP4A 4K3FA 5CMKA 1FCKA 3HHGA 2RCAA 5LOMA 1FTOA 4Q8RA 3S9LC 2Y84A 2WKYA 1LGBC 5B70A 5AE4A 4GLIA 4QF9A 3MAMA 3PPPA 2GRVA 4L17A 3RNNA 5JK4A 4XKQA 3DELB 2ZMBA 4C1UA 1AMFA 1PEBA 1HSEA 5EYFA 4FJPA 4LQ5A 3MVYA 4H65A 4MLQA 3PPOA 2OBGA 2F6GA 1MQGA 3L6GA 1KWHA 5CMMA 5I57B 1NNKA 5AA2D 4GF8A 1MPBA 3FD3A 5ICTA 4G8NA 4I1DA 4YKKA 5HPQA 3O6HA 2D5WA 2YLNA 4E0WA 3IOUA 1JW5A 3K0VA 2Q2CA 1B46A 2G29A 3H3GA 4ZECA 3OSQA 3DP8A 2PMSA 4PFTA 3FXQA 1Q35A 1SW4A 4KR5A 1FQEA 3OO6A 3QYTA 2OLBA 2AIXA 5TP9A 3GLBA 1AOVA 3G3IA 3A3UA 1MXZA 2Y7RA 1FW0A 1Y1ZA 2FYIA 4Z0IA 4FIMA 1I69A 1ZLQA 2B3BA 4GL0A 4MH5A 4U21A 3G3JA 4N6PA 4OVJA 3KBRA 4ZS9A 1B7ZA 4OERA 4G4PA 2ESNA 3FATA 4XTCQ 1PB7A 2DE4A 4YB5A 3KN8A 2QS3A 1B5IA 5DVFA 3K6VA 1NNFA 3HHFA 1B3FA 2XXVA 4LZ8A 3K4UA 3FVGA 3JYRA 2XXWA 3EN3A 4HCWA 2F6PA 1S50A 2I4CA 1D3KA 1RKMA 4H8IA 3TDJA 3TQWA 4ISUA 3RN8A 1M5CA 1MS7A 2NUVA 4UA8A 2XXRA 1USYH 3I6VA 4PFYA 2FNCA 2GFEA 1XC1A 3W9VA 4R2BA 3SEYA 5KCJA 3MQ9A 1SW2A 4LZ5A 3CIJA 3MW0A 4N13A 3O66A 3OXNA 3B6QA 4O3AA 4YB6A 3AXFA 5IKBA 1Y3QA 5ELVA 3TMGA 4EQ7A 1MXYA 3EHTA 2HEUA 2REJA 2CMOA 4PFWA 1MM6A 2F97A 4G8MA 3BBRA 3SDFA 4ESWA 2ZXTA 5FHNA 1MQDA 3KFMA 1IXGA 3MVXA 3CVGA 3H6VA 2H4IA 5K2YA 3TQLA 3Q27A 3OMBA 5TPAB 5I56B 3PMVA 1YAEA 2GH9A 2HCAA 3PUWE 1LAGE 3U8QA 4F29A 3IO6A 1MY2A 2I3VA 1Y3PA 1B40A 1B2HA 4HCYA 2DVZA 3KN7A 1TFDA 5IAIA 1Y9UA 1Y4TA 3H03A 3HPIA 5I2NA 3I5OA 5I58B 1EZ9A 2H99A 3C35A 3PUVE 4RJZA 5F7VA 3T96B 4KI0E 5L8DA 5I59A 4WEPA 3TCHA 5AA3A 5KCJB 2DVCA 1TT1A 1BKAA 4U1ZA 1PBQA 3RTFB 1XOCA 3SESA 3E3KA 4EF2A 2R9JA 2D3IA 1HSJA 3T9VA 3HN0A 4OEUA 4QSDA 3I3VA 4QFKA 3C32A 4LQ2A 3C36A 5ICQA 3EHUA 1ZU0A 4Q30B 4O3CA 4RPNA 2Z8DA 4IY6A 5H8QB 2ZNTA 4RNSA 3R6UA 2VGQA 3KZGA 1JQFA 2DP8A 4LP2B 3P7IA 1RYOA 1I6AA 2DE2A 3O2AA 3W15C 4R6KA 4RA1A 4HTGA 4GFRA 3PU5A 1DPPA 3CFXA 1D9VA 3EHSA 2BJJX 3OO9A 4KCDA 4THIA 2D21A 2QSXA 4PETA 3E9XA 4IGTA 5I59B 1Z7NE 1B5HA 3M8UA 1B3HA 3F11A 4E0XA 3TYHA 2P2AA 4XXUA 1LCFA 4FATA 3IORA 1FQDA 4R75A 5ITOA 2F34A 3FV2A 1N3XA 1B58A 4WXJA 1BIYA 3M3LA 4M1VA 4ELPA 5H8NB 2DE3A 3N94A 1GVCA 2H5YA 4GWOA 2F7BA 2DOJA 4JWOA 3FXRA 4FORA 3B7DA 2XXQA 2UXAA 1BLFA 4U22A 4YKPA 1SD3A 2I4BA 3QIMA 4IB2A 1NNPA 4AB6A 1Y3NA 3LC8A 1IXCA 4R9GA 4JDFA 4F3BA 4BDNA 1SDXA 2GHBA 2X7PA 3O9PA 2DS9A 3CI8A 3ILTB 4TLLB 4EXKA 1B5JA 4ZEDA 4RY1A 1ATGA 2UVJA 3ZS6A 3B6TA 3H6TA 1M5EA 4P11A 3W9WA 2NVUB 4QFLA 2XX8A 3USDA 1B7HA 2IEEA 2UVIA 5I57A 1ZMGA 4KFQA 1ZBMA 1VR5A 1JETA 3C33A 1LFIA 4WKMA 1B52A 2I48A 3A3CA 2V25A 3R26A 4GL8A 1FTLA 3FASA 3IOVA 2FA7A 3MC2A 2QS2A 4PFUA 1FQBA 4YKJA 1AL3A 5HM4B 1B3EA 1B9JA 1OLCA 4R72A 1LBBA 5DVJA 2NOOA 2RINA 1JW1A 2LAOA 3OOAA 2XXPA 2AL5A 3VVDA 3OENA 3K6UA 3TTKA 2O1LA 3C4MA 2NWJA 3OEKA 3QSLA 2CZLA 1US5A 1UIVA 1VFEA 1AH5A 1ELJA 1LCTA 3D4GA 4LONB 3V89B 1Q1KA 2O7IA 1I6BA 2GHAA 3VLUA 1B05A 2F78A 4DCXA 1B32A 3EPEA 3UK4A 2F36A 2H9BA 2O51A 1DSNA 4ZZAA 1DMBA 4G77A 3MUQA 3RPWA 4HS7A 3KSXA 2HAUA 1UTBB 5CMCA 4KYEA 4R9FA 1POY1 2ZYOA 3UA8A 1O64A 2VP1A 3N26A 3O6IA 3OEMA 5I84A 3H4ZA 2HZKA 1II5A 1EZPA 1B1HA 2XHDA 1LSTA 4GRKA 2RC9A 4OFJA 4QHQA 3ECRA 3UIFA 4ECFA 1B1XA 1EH3A 1FQFA 3FVOA 5H8HB 3T9HB 3TELA 1CB6A 3R7XA 4NTLA 4YMBA 3ONMA 4EUOA 1IEJA 1PC3A 1QKAA 2DWIA 4F18A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QPQ A;  2XD3 A;  4G2Z A;  3U93 A;  3S9E A;  2F8D A;  3PPR A;  5DEX A;  2HZL A;  3ZKK A;  2DWH A;  1B7U A;  4LUB A;  5BWJ A;  2UYF A;  4OFO A;  4X48 A;  3JV9 A;  3MJN A;  3GBB A;  1DPE A;  3TUS A;  3RY3 A;  1NL5 A;  4F39 A;  4R73 A;  3D4C A;  4X9T A;  1P1U A;  1B0L A;  3KGC A;  4GXA A;  4M4G A;  2XXX A;  1Y1M A;  4O3B A;  1A8F A;  4NF8 A;  4MFI A;  2XXU A;  4GQO A;  4N07 A;  1GTK A;  4IO7 A;  3BFT A;  4JSO A;  1BP5 A;  3RLF E;  2XXT A;  4F3G A;  4NF4 A;  3MP8 A;  1MXU A;  2XXI A;  1A8E A;  5TPA A;  5I56 A;  2B3F A;  2UVH A;  4I8C A;  1N84 A;  5AA4 B;  4F2O A;  5DEX B;  2PT1 A;  1PDA A;  3PUX E;  1LFH A;  3TPA A;  1T0K A;  5FHM A;  1QW0 A;  5I58 A;  5DVI A;  1B51 A;  1H76 A;  4ND9 A;  4XKN A;  2THI A;  1NMU A;  3THI A;  3HV1 A;  3DLN A;  5K2X A;  3UN6 A;  1SI1 A;  1MQJ A;  2XXH A;  4OYV A;  4JSD A;  1MM7 A;  1UTH A;  1SQY A;  1YPN A;  2ANJ A;  1Z7M E;  3VV5 A;  1HSL A;  4NF8 B;  1ANF A;  3IB1 A;  2HFB A;  4MBP A;  4QFN A;  4F1U A;  3K02 A;  3MVZ A;  3TTL A;  5CBS A;  1JEV A;  1R9Q A;  4LA9 A;  2PYY A;  4YZZ A;  1DTZ A;  4FEB A;  4NF4 B;  5H8Q A;  3RTW B;  5DTB A;  4YIC A;  1QUJ A;  3IJX B;  3T66 A;  2VD3 A;  2DYX A;  5A5X B;  1OVB A;  4IGR A;  1SBP A;  1M5B A;  1IZ1 A;  3MBP A;  4RYA A;  1TXF A;  2I0B A;  4ZZE A;  1JW4 A;  2I0C A;  2F5X A;  1XS5 A;  3VXC A;  4YB7 A;  3FGS A;  1I6Q A;  3TTM A;  1LAF E;  2V84 A;  3H6W A;  3K00 A;  5ISU A;  1PBP A;  2I6E A;  2F7C A;  3IJO B;  3TOD A;  4QRZ A;  3WAF A;  1MXW A;  2QMW A;  4ELR A;  5ITP A;  3BFU A;  1UTH B;  2VD2 A;  3PPQ A;  3VDF A;  4YKI A;  4GOT A;  4U1O A;  3HST A;  4KPT A;  5H8N A;  3VE1 B;  3TTN A;  3KJ7 A;  3VXB A;  1DOT A;  3FXU A;  2RF1 A;  1MPC A;  1BTJ A;  2OJT A;  1VE4 A;  4H8J A;  1EU8 A;  1DTG A;  4OET A;  3ILU B;  3VFJ A;  3N6T A;  3RGY A;  3U72 A;  4EDP A;  1MDP 1;  5FTH A;  1MPD A;  3C34 A;  1S9T A;  3MZB A;  3FUZ A;  1B4Z A;  1ZTY A;  3V8X B;  4OEN A;  1GR2 A;  4OZ9 A;  3CSB A;  4NWD A;  2Y7P A;  3QXM A;  2X26 A;  3K6X A;  3Q28 A;  1N0T A;  1ZIU A;  3MP6 A;  1MXV A;  2E1S A;  2X7Q A;  4PP0 A;  4ONY A;  2ONS A;  3KN3 A;  3N5L A;  4FED A;  4JB7 A;  3FV1 A;  4BDO A;  3TKD A;  3T93 B;  3O29 A;  1N76 A;  3T22 A;  4MLV A;  3CG1 A;  4LVQ A;  4WED A;  3G3F A;  3E4R A;  2PVU A;  3VLW A;  1QUI A;  2RC7 A;  3IO4 A;  1MRP A;  1MXX A;  1MH4 A;  2OZZ A;  1URD A;  1AIV A;  1R9L A;  1MG1 A;  1XVY A;  1LB8 A;  4AB5 A;  3SER A;  4ESX A;  3PUZ E;  4OTE A;  2HAV A;  3KSJ A;  3PMX A;  1VSO A;  5FHO A;  5EHM A;  3IK6 B;  4I9D A;  3IOT A;  3LSX A;  3SEW A;  4UAC A;  3LBS A;  1MY0 A;  4Q0C A;  4FAJ A;  2P0S A;  4F1V A;  3KOT A;  3UP9 A;  4NMY A;  3DM0 A;  2IA4 A;  3K01 A;  4DZ1 A;  2A5T B;  4I62 A;  4XKR A;  3SEU A;  1P1N A;  3GBA A;  3MZ9 A;  1JVY A;  4JWY A;  1EZO A;  1QVS A;  4Z7E A;  4DXU A;  4F3P A;  4DLD A;  4F19 A;  1R1N A;  2VOZ A;  4EXL A;  3G3K A;  3L6H A;  4H67 A;  4EF1 A;  5L9S A;  2OWT A;  1UTB A;  3MPL A;  1M5F A;  2Q8J A;  3WAE A;  1N7W A;  2V3Q A;  4G68 B;  5CRY A;  3RQT A;  2AL4 A;  4KYD A;  4OHN A;  2Q88 A;  2M8C A;  5EHS A;  4QSC A;  4RXL A;  3KJT A;  3SEV A;  4GVO A;  5L9O A;  3K1M A;  1N04 A;  1OQG A;  2Q9T A;  5H8H A;  2I58 A;  3K2D A;  1FTJ A;  2G93 A;  4NF6 A;  2KLF A;  5JTY A;  1H3D A;  4IO3 A;  1YTV A;  5HBC A;  3ODB A;  4BDR A;  4DIG A;  1RYX A;  3M3F A;  2QMX A;  1SVX B;  5DYH A;  3VLV A;  2H25 A;  1FQA A;  3FZV A;  5CC2 A;  1XVX A;  4YMA A;  3S9M C;  3U94 A;  1FQC A;  4TQU Q;  1MQH A;  2RKM A;  5TU0 A;  5I2K A;  4H5F A;  2O1M A;  4F31 B;  3EQ1 A;  1NH7 A;  2UVG A;  4BDM A;  1WOD A;  1MH3 A;  1USY E;  1XHY A;  1H45 A;  1P1O A;  4JWX A;  4R6Y A;  1MQI A;  3PV0 E;  4BDL A;  1A99 A;  3HCQ A;  3LSL A;  4LAT A;  4KQP A;  1TFA A;  2DSF A;  4IO6 A;  2QS4 A;  3U1O A;  2O6A A;  1IXH A;  2OCU A;  3MP1 A;  3FJG A;  1UIU A;  3RT6 B;  2PX1 A;  5KDT A;  1XT8 A;  1OMP A;  4U23 A;  4NF6 B;  3O97 A;  1VFD A;  3N6U A;  3TZA A;  4F3S A;  1B4H A;  1ZJL A;  5JTY B;  1Y4C A;  1YCJ A;  3RT8 A;  3DP6 A;  3V5A A;  5AA4 A;  2NXO A;  4POX A;  2XX9 A;  4C0R A;  1O63 A;  1LBC A;  5CBR A;  2QL3 A;  3T9X B;  4JBZ A;  5I2K B;  3JZJ A;  4KHZ E;  1JNF A;  3FJM A;  3FVN A;  1QKB A;  1Y20 A;  5J1D A;  3TAJ A;  3B6W A;  1OVT A;  3G3H A;  2XXY A;  2A5S A;  4GIZ A;  3K1N A;  1P99 A;  3S4U A;  1P1W A;  1A55 A;  1R6Z A;  4X1B A;  3UGW A;  4F22 A;  4ELQ A;  2E0S A;  1H43 A;  3PPN A;  4KD5 A;  4QFO A;  3OEL A;  4U4S A;  3LSF B;  3ZSF A;  2PT2 A;  3PGF A;  4OEV A;  5KDT B;  1ZKB A;  5L9M A;  3S2V A;  4OQO A;  1MY4 A;  4YU0 A;  3Q26 A;  2QS1 A;  3ZKL A;  5A5X A;  4DE8 A;  4PQJ A;  2ZYN A;  2B65 A;  2ZNS A;  4JXI A;  5CM6 A;  4OFL A;  4RK9 A;  1MY1 A;  5TP9 B;  2Y7W A;  4AQ4 A;  2DQV A;  2AYS A;  3PD9 A;  3LSW A;  3QUJ A;  1IIW A;  2F7A A;  3C31 A;  3E13 X;  3K1P A;  3LR1 A;  4FEC A;  1US4 A;  5CI5 A;  3SKP A;  1TWY A;  2P1S A;  1L5T A;  4GD5 A;  1S7Y A;  1D9Y A;  3IB0 A;  4BDQ A;  3H6U A;  4H6D A;  3SET A;  1OIB A;  1JEU A;  3IB2 A;  3CSG A;  4ZEI A;  2DWA A;  1OQH A;  2Q89 A;  3QK6 A;  2OK2 A;  4ZEF A;  1WDN A;  3G3G A;  2DXY A;  5JEI A;  3Q25 A;  3TCG A;  3U92 A;  4DCY A;  2YPN A;  1QUL A;  2HXW A;  3CFZ A;  2OWS A;  2QJE A;  1CE2 A;  4X1D A;  2O68 A;  1POT A;  3CG3 A;  3IAZ A;  1LAX A;  1URG A;  4NED A;  1IIT A;  4F2Q A;  4OWD A;  2PBW A;  5DT6 A;  2V93 A;  5M2V A;  5KZT A;  1QUK A;  3O6G A;  1SW1 A;  5H8S A;  4GXS B;  2XD2 A;  3IOW A;  2UYE A;  3SEX A;  2ZYK A;  1NFT A;  5AA1 A;  3FJ7 A;  4C1T A;  1M5D A;  3BKI B;  3CR9 A;  3H06 B;  1SW5 A;  4DDD A;  3K6W A;  4TLM B;  4IO5 A;  1B3G A;  1JVX A;  3TEP A;  1SI0 A;  5B7D A;  4R6H A;  3MPK A;  1J1N A;  2Z22 A;  1FTK A;  2V3U A;  5FTI A;  1F9B A;  3EF7 A;  4IO4 A;  2ALU A;  2Z23 A;  3QAX A;  3CFL A;  3KOS A;  3OO7 A;  2I49 A;  1GGG A;  2F35 A;  4ZEB A;  2R71 A;  3M3K A;  3A09 A;  4NF5 A;  4RPO A;  4H5G A;  4XIG Q;  4EQ9 A;  1IXI A;  2Q2A A;  4U2R A;  1MY3 A;  4EQB A;  3MVW A;  4H1X A;  2ONK E;  2YJP A;  1SYH A;  4FE8 A;  3VVE A;  1LLS A;  2H98 A;  2REG A;  3MWB A;  3UOR A;  2DWJ A;  3GXA A;  3IL1 B;  2XX7 A;  3PUY E;  3TFL A;  1IUD A;  5I2N B;  1LFG A;  1B6H A;  3KEI A;  4QFP A;  4H0W A;  2A5T A;  4POW A;  4NWC A;  5H8F A;  2V3T A;  2W7Y A;  4R2F A;  1UQW A;  4ZEK A;  3FIR A;  1QJM A;  4P0I A;  3FVK A;  4NE4 A;  4IO2 A;  4U4X A;  2I3W A;  2RCB A;  1D4N A;  1A7L A;  4F1Y A;  4PE5 B;  1O7T A;  1NKX A;  1GV8 A;  1PB9 A;  4P0G A;  3S9N C;  2Y7K A;  3MZ1 A;  4G68 A;  4Q5T A;  5AA2 A;  2O69 A;  3OSR A;  4NF5 B;  3V83 A;  2Y7I A;  4HW8 A;  4OMB A;  1N7X A;  1WVJ A;  3OD7 A;  1FTM A;  1B3L A;  4RK2 A;  5F1Q A;  4OES A;  4ZDM A;  1N3W A;  2R6G E;  4KYS A;  1IQ7 A;  2ZYM A;  3GZG A;  4TOZ A;  4QSE A;  4DXB A;  2QRY A;  1A54 A;  4ZE8 A;  4G68 C;  4IY5 A;  3G7W A;  5CMB A;  1NNT A;  5H8F B;  4YAH X;  1LB9 A;  2RC8 A;  4R74 A;  2O7U A;  4LZ7 A;  1B0H A;  3IX1 A;  1MDQ A;  1A40 A;  3T9U A;  2DXR A;  1NH8 A;  2VHA A;  3PMW A;  3C9H A;  1OLA A;  2O84 X;  1SYI A;  3VVF A;  1LAH E;  4ELO A;  4KCC A;  3HO7 A;  3CRB A;  3TCF A;  5AA2 B;  3PD8 A;  4ZE9 A;  5BUU A;  3IR1 A;  2ABH A;  3QUF A;  4MF3 A;  1P1Q A;  3Q29 A;  1URS A;  2ZNU A;  2Z8F A;  2Z8E A;  3O28 A;  1PB8 A;  3OO8 A;  3TTR A;  2HQ0 A;  4XKP A;  1H44 A;  3LUY A;  2ONR A;  4DXC A;  3H7M A;  4OXV A;  4G8H A;  4BLA A;  3RUM A;  3KG2 A;  3DP4 A;  4K3F A;  5CMK A;  1FCK A;  3HHG A;  2RCA A;  5LOM A;  1FTO A;  4Q8R A;  3S9L C;  2Y84 A;  2WKY A;  1LGB C;  5B70 A;  5AE4 A;  4GLI A;  4QF9 A;  3MAM A;  3PPP A;  2GRV A;  4L17 A;  3RNN A;  5JK4 A;  4XKQ A;  3DEL B;  2ZMB A;  4C1U A;  1AMF A;  1PEB A;  1HSE A;  5EYF A;  4FJP A;  4LQ5 A;  3MVY A;  4H65 A;  4MLQ A;  3PPO A;  2OBG A;  2F6G A;  1MQG A;  3L6G A;  1KWH A;  5CMM A;  5I57 B;  1NNK A;  5AA2 D;  4GF8 A;  1MPB A;  3FD3 A;  5ICT A;  4G8N A;  4I1D A;  4YKK A;  5HPQ A;  3O6H A;  2D5W A;  2YLN A;  4E0W A;  3IOU A;  1JW5 A;  3K0V A;  2Q2C A;  1B46 A;  2G29 A;  3H3G A;  4ZEC A;  3OSQ A;  3DP8 A;  2PMS A;  4PFT A;  3FXQ A;  1Q35 A;  1SW4 A;  4KR5 A;  1FQE A;  3OO6 A;  3QYT A;  2OLB A;  2AIX A;  5TP9 A;  3GLB A;  1AOV A;  3G3I A;  3A3U A;  1MXZ A;  2Y7R A;  1FW0 A;  1Y1Z A;  2FYI A;  4Z0I A;  4FIM A;  1I69 A;  1ZLQ A;  2B3B A;  4GL0 A;  4MH5 A;  4U21 A;  3G3J A;  4N6P A;  4OVJ A;  3KBR A;  4ZS9 A;  1B7Z A;  4OER A;  4G4P A;  2ESN A;  3FAT A;  4XTC Q;  1PB7 A;  2DE4 A;  4YB5 A;  3KN8 A;  2QS3 A;  1B5I A;  5DVF A;  3K6V A;  1NNF A;  3HHF A;  1B3F A;  2XXV A;  4LZ8 A;  3K4U A;  3FVG A;  3JYR A;  2XXW A;  3EN3 A;  4HCW A;  2F6P A;  1S50 A;  2I4C A;  1D3K A;  1RKM A;  4H8I A;  3TDJ A;  3TQW A;  4ISU A;  3RN8 A;  1M5C A;  1MS7 A;  2NUV A;  4UA8 A;  2XXR A;  1USY H;  3I6V A;  4PFY A;  2FNC A;  2GFE A;  1XC1 A;  3W9V A;  4R2B A;  3SEY A;  5KCJ A;  3MQ9 A;  1SW2 A;  4LZ5 A;  3CIJ A;  3MW0 A;  4N13 A;  3O66 A;  3OXN A;  3B6Q A;  4O3A A;  4YB6 A;  3AXF A;  5IKB A;  1Y3Q A;  5ELV A;  3TMG A;  4EQ7 A;  1MXY A;  3EHT A;  2HEU A;  2REJ A;  2CMO A;  4PFW A;  1MM6 A;  2F97 A;  4G8M A;  3BBR A;  3SDF A;  4ESW A;  2ZXT A;  5FHN A;  1MQD A;  3KFM A;  1IXG A;  3MVX A;  3CVG A;  3H6V A;  2H4I A;  5K2Y A;  3TQL A;  3Q27 A;  3OMB A;  5TPA B;  5I56 B;  3PMV A;  1YAE A;  2GH9 A;  2HCA A;  3PUW E;  1LAG E;  3U8Q A;  4F29 A;  3IO6 A;  1MY2 A;  2I3V A;  1Y3P A;  1B40 A;  1B2H A;  4HCY A;  2DVZ A;  3KN7 A;  1TFD A;  5IAI A;  1Y9U A;  1Y4T A;  3H03 A;  3HPI A;  5I2N A;  3I5O A;  5I58 B;  1EZ9 A;  2H99 A;  3C35 A;  3PUV E;  4RJZ A;  5F7V A;  3T96 B;  4KI0 E;  5L8D A;  5I59 A;  4WEP A;  3TCH A;  5AA3 A;  5KCJ B;  2DVC A;  1TT1 A;  1BKA A;  4U1Z A;  1PBQ A;  3RTF B;  1XOC A;  3SES A;  3E3K A;  4EF2 A;  2R9J A;  2D3I A;  1HSJ A;  3T9V A;  3HN0 A;  4OEU A;  4QSD A;  3I3V A;  4QFK A;  3C32 A;  4LQ2 A;  3C36 A;  5ICQ A;  3EHU A;  1ZU0 A;  4Q30 B;  4O3C A;  4RPN A;  2Z8D A;  4IY6 A;  5H8Q B;  2ZNT A;  4RNS A;  3R6U A;  2VGQ A;  3KZG A;  1JQF A;  2DP8 A;  4LP2 B;  3P7I A;  1RYO A;  1I6A A;  2DE2 A;  3O2A A;  3W15 C;  4R6K A;  4RA1 A;  4HTG A;  4GFR A;  3PU5 A;  1DPP A;  3CFX A;  1D9V A;  3EHS A;  2BJJ X;  3OO9 A;  4KCD A;  4THI A;  2D21 A;  2QSX A;  4PET A;  3E9X A;  4IGT A;  5I59 B;  1Z7N E;  1B5H A;  3M8U A;  1B3H A;  3F11 A;  4E0X A;  3TYH A;  2P2A A;  4XXU A;  1LCF A;  4FAT A;  3IOR A;  1FQD A;  4R75 A;  5ITO A;  2F34 A;  3FV2 A;  1N3X A;  1B58 A;  4WXJ A;  1BIY A;  3M3L A;  4M1V A;  4ELP A;  5H8N B;  2DE3 A;  3N94 A;  1GVC A;  2H5Y A;  4GWO A;  2F7B A;  2DOJ A;  4JWO A;  3FXR A;  4FOR A;  3B7D A;  2XXQ A;  2UXA A;  1BLF A;  4U22 A;  4YKP A;  1SD3 A;  2I4B A;  3QIM A;  4IB2 A;  1NNP A;  4AB6 A;  1Y3N A;  3LC8 A;  1IXC A;  4R9G A;  4JDF A;  4F3B A;  4BDN A;  1SDX A;  2GHB A;  2X7P A;  3O9P A;  2DS9 A;  3CI8 A;  3ILT B;  4TLL B;  4EXK A;  1B5J A;  4ZED A;  4RY1 A;  1ATG A;  2UVJ A;  3ZS6 A;  3B6T A;  3H6T A;  1M5E A;  4P11 A;  3W9W A;  2NVU B;  4QFL A;  2XX8 A;  3USD A;  1B7H A;  2IEE A;  2UVI A;  5I57 A;  1ZMG A;  4KFQ A;  1ZBM A;  1VR5 A;  1JET A;  3C33 A;  1LFI A;  4WKM A;  1B52 A;  2I48 A;  3A3C A;  2V25 A;  3R26 A;  4GL8 A;  1FTL A;  3FAS A;  3IOV A;  2FA7 A;  3MC2 A;  2QS2 A;  4PFU A;  1FQB A;  4YKJ A;  1AL3 A;  5HM4 B;  1B3E A;  1B9J A;  1OLC A;  4R72 A;  1LBB A;  5DVJ A;  2NOO A;  2RIN A;  1JW1 A;  2LAO A;  3OOA A;  2XXP A;  2AL5 A;  3VVD A;  3OEN A;  3K6U A;  3TTK A;  2O1L A;  3C4M A;  2NWJ A;  3OEK A;  3QSL A;  2CZL A;  1US5 A;  1UIV A;  1VFE A;  1AH5 A;  1ELJ A;  1LCT A;  3D4G A;  4LON B;  3V89 B;  1Q1K A;  2O7I A;  1I6B A;  2GHA A;  3VLU A;  1B05 A;  2F78 A;  4DCX A;  1B32 A;  3EPE A;  3UK4 A;  2F36 A;  2H9B A;  2O51 A;  1DSN A;  4ZZA A;  1DMB A;  4G77 A;  3MUQ A;  3RPW A;  4HS7 A;  3KSX A;  2HAU A;  1UTB B;  5CMC A;  4KYE A;  4R9F A;  1POY 1;  2ZYO A;  3UA8 A;  1O64 A;  2VP1 A;  3N26 A;  3O6I A;  3OEM A;  5I84 A;  3H4Z A;  2HZK A;  1II5 A;  1EZP A;  1B1H A;  2XHD A;  1LST A;  4GRK A;  2RC9 A;  4OFJ A;  4QHQ A;  3ECR A;  3UIF A;  4ECF A;  1B1X A;  1EH3 A;  1FQF A;  3FVO A;  5H8H B;  3T9H B;  3TEL A;  1CB6 A;  3R7X A;  4NTL A;  4YMB A;  3ONM A;  4EUO A;  1IEJ A;  1PC3 A;  1QKA A;  2DWI A;  4F18 A; 
#chains in the Genus database with same CATH topology
 2QPQ A;  1IMB A;  2XD3 A;  1NV6 A;  4G2Z A;  3U93 A;  3S9E A;  2F8D A;  4NN3 A;  3PPR A;  5DEX A;  2HZL A;  3ZKK A;  2DWH A;  2R8T A;  1B7U A;  4LUB A;  5BWJ A;  2F3B A;  2UYF A;  4OFO A;  4MNP A;  4X48 A;  3JV9 A;  3MJN A;  3GBB A;  1DPE A;  3TUS A;  3RY3 A;  4P3L A;  1NL5 A;  2FBP A;  4F39 A;  4R73 A;  3D4C A;  4X9T A;  1P1U A;  1B0L A;  3KGC A;  4GXA A;  4M4G A;  2XXX A;  4NG7 A;  1Y1M A;  4O3B A;  1A8F A;  4PBH A;  4NF8 A;  4MFI A;  2XXU A;  4HE0 A;  1FJ6 A;  4GQO A;  4N07 A;  1GTK A;  4IO7 A;  3BFT A;  4JSO A;  1BP5 A;  3RLF E;  2XXT A;  3RYD A;  3B8B A;  4F3G A;  4NF4 A;  3MP8 A;  1MXU A;  4NGU A;  2XXI A;  1A8E A;  5TPA A;  5I56 A;  2B3F A;  2UVH A;  4MAG A;  4I8C A;  1N84 A;  1FBC A;  5AA4 B;  4F2O A;  5DEX B;  2PT1 A;  4AS4 A;  2WEF A;  1PDA A;  3PUX E;  1LFH A;  3TPA A;  1T0K A;  5FHM A;  1QW0 A;  5I58 A;  4NQ8 A;  4X8R A;  1NUX A;  3IFC A;  5DVI A;  1B51 A;  1H76 A;  4ND9 A;  4XKN A;  2THI A;  2HHM A;  1NMU A;  3THI A;  3HV1 A;  2Y5L A;  3DLN A;  5K2X A;  3UN6 A;  1SI1 A;  4LN5 A;  1MQJ A;  2XXH A;  2QVR A;  4OYV A;  3U65 A;  4JSD A;  1MM7 A;  1UTH A;  1SQY A;  1YPN A;  5IZ3 B;  2ANJ A;  1Z7M E;  3VV5 A;  1HSL A;  4NF8 B;  1ANF A;  3IB1 A;  2HFB A;  4MBP A;  4QFN A;  4F1U A;  3K02 A;  3MVZ A;  3TTL A;  5CBS A;  1RDZ A;  1KA1 A;  1JEV A;  1FPG A;  1R9Q A;  4LA9 A;  2PYY A;  4YZZ A;  3B50 A;  1DTZ A;  4FEB A;  4NF4 B;  5H8Q A;  3RTW B;  5DTB A;  1JP4 A;  4YIC A;  1QUJ A;  3IJX B;  3T66 A;  2VD3 A;  2DYX A;  5A5X B;  4PFB A;  1OVB A;  4IGR A;  1SBP A;  1M5B A;  1IZ1 A;  3MBP A;  4RYA A;  2B4M A;  1TXF A;  2I0B A;  4ZZE A;  1JW4 A;  2I0C A;  2F5X A;  1XS5 A;  3VXC A;  4YB7 A;  3FGS A;  1I6Q A;  3TTM A;  1LAF E;  2V84 A;  3H6W A;  3K00 A;  5ISU A;  1PBP A;  2I6E A;  2F7C A;  3IJO B;  3TOD A;  4QRZ A;  2P3V A;  3WAF A;  1MXW A;  2QMW A;  1FPL A;  4ELR A;  5ITP A;  3BFU A;  4P1E A;  1UTH B;  1NI9 A;  2VD2 A;  3PPQ A;  3VDF A;  4YKI A;  4GOT A;  4U1O A;  3HST A;  4KPT A;  5H8N A;  3VE1 B;  3TTN A;  3KJ7 A;  3VXB A;  1DOT A;  3FXU A;  2RF1 A;  1MPC A;  1BTJ A;  2OJT A;  1VE4 A;  4N4U A;  4H8J A;  1DBZ A;  4OVR A;  1YZ0 A;  1EU8 A;  1DTG A;  4OET A;  5EQA A;  3ILU B;  3VFJ A;  3N6T A;  4JVC A;  3RGY A;  3U72 A;  4EDP A;  1MDP 1;  5FTH A;  1MPD A;  3C34 A;  1S9T A;  3MZB A;  1NV1 A;  3FUZ A;  1B4Z A;  1ZTY A;  3V8X B;  4OEN A;  1GR2 A;  4OZ9 A;  3CSB A;  4NWD A;  1YYZ A;  2Y7P A;  1FPE A;  2B4L A;  3QXM A;  2X26 A;  3K6X A;  3Q28 A;  1N0T A;  1ZIU A;  3MP6 A;  3QMF A;  1MXV A;  1SPI A;  2E1S A;  2X7Q A;  4PP0 A;  4GWS A;  4ONY A;  2ONS A;  1KZ8 A;  4MNC A;  5ET7 A;  3KN3 A;  3N5L A;  4FED A;  5ESY A;  4JB7 A;  3FV1 A;  4X04 A;  1NUY A;  2F3D A;  3TKD A;  4BDO A;  3T93 B;  3O29 A;  1N76 A;  4H46 A;  3A29 A;  1FBD A;  3T22 A;  4MLV A;  3CG1 A;  4LVQ A;  4WED A;  3G3F A;  3E4R A;  2QVV A;  2PVU A;  3VLW A;  1QUI A;  2RC7 A;  3IO4 A;  1MRP A;  1MXX A;  1MH4 A;  2OZZ A;  2ZZW A;  1URD A;  1AIV A;  1R9L A;  4G61 A;  1MG1 A;  2XWI A;  1XVY A;  1XI6 A;  1LB8 A;  4AB5 A;  3SER A;  4ESX A;  3PUZ E;  4OTE A;  2HAV A;  3KSJ A;  3PMX A;  3EKI A;  1VSO A;  5FHO A;  1EYJ A;  5EHM A;  3IK6 B;  4PTK A;  4I9D A;  3IOT A;  4MNI A;  3LSX A;  3SEW A;  4UAC A;  3LBS A;  1MY0 A;  4Q0C A;  4FAJ A;  2P0S A;  4F1V A;  3KOT A;  3UP9 A;  4NMY A;  3DM0 A;  2IA4 A;  3K01 A;  4DZ1 A;  2A5T B;  4I62 A;  4XKR A;  3SEU A;  1P1N A;  3GBA A;  3MZ9 A;  1JVY A;  4JWY A;  4PCD A;  1EZO A;  1QVS A;  4Z7E A;  4DXU A;  1LBZ A;  4F3P A;  4DLD A;  4HE1 A;  4F19 A;  1R1N A;  2VOZ A;  4EXL A;  3G3K A;  1LBW A;  4PAI A;  3L6H A;  4H67 A;  4EF1 A;  5L9S A;  2OWT A;  1UTB A;  4GBW A;  3MPL A;  1M5F A;  2Q8J A;  3WAE A;  1N7W A;  2V3Q A;  4G68 B;  5CRY A;  3RQT A;  2AL4 A;  4KYD A;  4OHN A;  4JVD A;  1NV5 A;  5FBP A;  2FHY A;  2Q88 A;  1FPK A;  2M8C A;  4I40 A;  4QSC A;  5EHS A;  2VPN A;  4RXL A;  3KJT A;  3SEV A;  4GVO A;  5L9O A;  3K1M A;  1N04 A;  1OQG A;  2JJK A;  2Q9T A;  5H8H A;  2I58 A;  3K2D A;  1FTJ A;  2G93 A;  4NF6 A;  2KLF A;  3GYY A;  4DI3 D;  5JTY A;  1H3D A;  4IO3 A;  1YTV A;  5HBC A;  2XA5 A;  3ODB A;  4BDR A;  5I7I A;  4DIG A;  1RYX A;  3M3F A;  2QMX A;  1K9Z A;  4PE3 A;  1SVX B;  5DYH A;  3VLV A;  2H25 A;  1FQA A;  3FZV A;  5CC2 A;  1XVX A;  4YMA A;  3S9M C;  3U94 A;  1FQC A;  4TQU Q;  1MQH A;  2RKM A;  5TU0 A;  2KQZ A;  5I2K A;  4H5F A;  2O1M A;  4F31 B;  3EQ1 A;  1NH7 A;  4OVQ A;  2UVG A;  4BDM A;  1WOD A;  1MH3 A;  1USY E;  1XHY A;  1H45 A;  1P1O A;  4JWX A;  4R6Y A;  2OWZ A;  1MQI A;  3PV0 E;  4BDL A;  1A99 A;  3HCQ A;  3LSL A;  4LAT A;  4KQP A;  1TFA A;  4NAP A;  2DSF A;  4IO6 A;  1FPB A;  2QS4 A;  3U1O A;  3T0J A;  2O6A A;  1IXH A;  2OCU A;  1QGX A;  3BIG A;  3FJG A;  1UIU A;  3MP1 A;  3RT6 B;  2PX1 A;  5KDT A;  1XT8 A;  1OMP A;  4U23 A;  4NF6 B;  3O97 A;  1VFD A;  3N6U A;  3TZA A;  4F3S A;  1B4H A;  1ZJL A;  5JTY B;  4GX3 A;  1NV3 A;  1LEV A;  1Y4C A;  1YCJ A;  3RT8 A;  3DP6 A;  3V5A A;  5ET6 A;  5AA4 A;  2NXO A;  4POX A;  2XX9 A;  4C0R A;  1O63 A;  1LBC A;  3D1R A;  5CBR A;  2QL3 A;  3T9X B;  1DCU A;  4JBZ A;  5I2K B;  3JZJ A;  4KHZ E;  1JNF A;  3FJM A;  3FVN A;  1QKB A;  1Y20 A;  5J1D A;  3TAJ A;  3B6W A;  1OVT A;  3G3H A;  2XXY A;  2A5S A;  4GWY A;  4GIZ A;  3K1N A;  5IGA A;  5IZ3 A;  1P99 A;  3S4U A;  1P1W A;  1A55 A;  1R6Z A;  4X1B A;  3UGW A;  4F22 A;  4ELQ A;  2E0S A;  1H43 A;  1NV7 A;  3PPN A;  3HFU A;  4KD5 A;  2FVZ A;  4QFO A;  2Y5K A;  3OEL A;  4PF8 A;  4U4S A;  3MST A;  3LSF B;  3ZSF A;  2PT2 A;  3PGF A;  4OEV A;  5KDT B;  1ZKB A;  2HXR A;  5L9M A;  3S2V A;  4OQO A;  1MY4 A;  4YU0 A;  3Q26 A;  2QS1 A;  3ZKL A;  5A5X A;  4DE8 A;  4PQJ A;  2ZYN A;  4PF6 A;  2B65 A;  2ZNS A;  4JXI A;  5CM6 A;  4OFL A;  5EQ7 A;  4RK9 A;  1MY1 A;  5TP9 B;  2Y7W A;  4AQ4 A;  2DQV A;  2AYS A;  3PD9 A;  3LSW A;  3QUJ A;  1IIW A;  2F7A A;  3C31 A;  4OAN A;  3E13 X;  3K1P A;  3LR1 A;  3KBZ A;  4FEC A;  1US4 A;  5CI5 A;  3SKP A;  1TWY A;  1IMD A;  2P1S A;  2XWV A;  1L5T A;  4GD5 A;  5I5P A;  1S7Y A;  2PCR A;  1D9Y A;  3IB0 A;  5DW8 A;  4BDQ A;  3H6U A;  4H6D A;  3SET A;  1OIB A;  1KA0 A;  1JEU A;  3IB2 A;  3CSG A;  4ZEI A;  2DWA A;  1OQH A;  2Q89 A;  3QK6 A;  2OK2 A;  4ZEF A;  4MX6 A;  1WDN A;  3G3G A;  2DXY A;  5JEI A;  3Q25 A;  3TCG A;  4N17 A;  4MHF A;  3U92 A;  4DCY A;  2YPN A;  1QUL A;  2HXW A;  3CFZ A;  1RDY A;  2OWS A;  2QJE A;  1CE2 A;  4X1D A;  2O68 A;  1POT A;  3CG3 A;  3IAZ A;  1LAX A;  1URG A;  4NED A;  1IIT A;  4F2Q A;  4OWD A;  1FSA A;  2PBW A;  5DT6 A;  2V93 A;  5M2V A;  5KZT A;  1QUK A;  3O6G A;  2WYK A;  1SW1 A;  5H8S A;  4GXS B;  2XD2 A;  1G0I A;  3IOW A;  2WBD A;  2UYE A;  4XEQ A;  3SEX A;  2ZYK A;  1NFT A;  4PGN A;  5AA1 A;  3FJ7 A;  4C1T A;  4N8G A;  1M5D A;  3IFA A;  3BKI B;  3CR9 A;  3H06 B;  1SW5 A;  4O94 A;  4DDD A;  3K6W A;  4TLM B;  4IO5 A;  1NV0 A;  1B3G A;  1JVX A;  3TEP A;  1SI0 A;  5B7D A;  4R6H A;  3MPK A;  1J1N A;  3FXB A;  2Z22 A;  1FTK A;  2V3U A;  5FTI A;  1F9B A;  2HPG A;  3EF7 A;  4IO4 A;  2ALU A;  2Z23 A;  3QAX A;  3CFL A;  3KOS A;  3OO7 A;  2I49 A;  1GGG A;  2F35 A;  4ZEB A;  5ET5 A;  2R71 A;  3M3K A;  5EQ8 A;  3A09 A;  4NF5 A;  2GQ1 A;  4RPO A;  4H5G A;  4XIG Q;  4EQ9 A;  1IXI A;  2Q2A A;  4U2R A;  1MY3 A;  4EQB A;  3MVW A;  4H1X A;  2ONK E;  2YJP A;  1SYH A;  4FE8 A;  3VVE A;  1LLS A;  4N6D A;  2H98 A;  2REG A;  3MWB A;  3UOR A;  2DWJ A;  3GXA A;  3IL1 B;  2XX7 A;  4N8Y A;  3PUY E;  4O7M A;  3TFL A;  1IUD A;  5I2N B;  1LFG A;  1B6H A;  3KEI A;  4QFP A;  4H0W A;  1NUW A;  2A5T A;  4PFI A;  4POW A;  4NWC A;  4QBA A;  5H8F A;  2V3T A;  2VPO A;  2W7Y A;  4R2F A;  1UQW A;  1FBF A;  4ZEK A;  4QXD A;  3FIR A;  1QJM A;  4P0I A;  3KC1 A;  3FVK A;  4NE4 A;  4IO2 A;  4U4X A;  2I3W A;  2QVU A;  2RCB A;  2QFL A;  1D4N A;  1A7L A;  4F1Y A;  4PE5 B;  1O7T A;  2ZZX A;  1NKX A;  1GV8 A;  2MKZ A;  1PB9 A;  4P0G A;  3S9N C;  3LV0 A;  2Y7K A;  2Q74 A;  3MZ1 A;  4G68 A;  4Q5T A;  5AA2 A;  4PC9 A;  2O69 A;  2P3N A;  3OSR A;  4NF5 B;  3V83 A;  2Y7I A;  4HW8 A;  2PFZ A;  4OMB A;  1N7X A;  1WVJ A;  3OD7 A;  1FTM A;  1B3L A;  2FIX A;  4RK2 A;  5F1Q A;  4OES A;  4ZDM A;  1N3W A;  2R6G E;  1FTA A;  4KYS A;  1IQ7 A;  4PBQ A;  2ZYM A;  3GZG A;  4TOZ A;  2Q8M A;  2VT5 A;  4QSE A;  4DXB A;  2QRY A;  1A54 A;  4ZE8 A;  4G68 C;  4IY5 A;  3G7W A;  5CMB A;  1NNT A;  5H8F B;  4YAH X;  1LB9 A;  2RC8 A;  3BIH A;  4R74 A;  2O7U A;  4LZ7 A;  1B0H A;  3IX1 A;  1MDQ A;  1A40 A;  3T9U A;  2DXR A;  1AWB A;  1NH8 A;  2VHA A;  3PMW A;  3C9H A;  1OLA A;  2O84 X;  1SYI A;  3VVF A;  1LAH E;  4ELO A;  4KCC A;  3HO7 A;  3CRB A;  3TCF A;  5AA2 B;  4UAB A;  5ET8 A;  3PD8 A;  4ZE9 A;  5BUU A;  3IR1 A;  1FRP A;  2ABH A;  4PGP A;  3QUF A;  4MF3 A;  1P1Q A;  3Q29 A;  1URS A;  2ZNU A;  1RDX A;  4IR8 A;  2Z8F A;  3SZP A;  2Z8E A;  4MCO A;  3O28 A;  1PB8 A;  3OO8 A;  3TTR A;  1Q9D A;  3KC0 A;  2HQ0 A;  4XKP A;  1H44 A;  3LUY A;  2ONR A;  4N81 A;  4DXC A;  3H7M A;  4OXV A;  4G8H A;  4BLA A;  3RUM A;  3KG2 A;  3DP4 A;  4K3F A;  4I3Y A;  4JVI A;  5CMK A;  1FCK A;  5J16 A;  2OX3 A;  3HHG A;  4NX1 A;  2RCA A;  5LOM A;  1FTO A;  4Q8R A;  3S9L C;  2Y84 A;  2WKY A;  1LGB C;  5B70 A;  5AE4 A;  4GLI A;  4QF9 A;  1NV4 A;  3MAM A;  3PPP A;  2GRV A;  4L17 A;  3RNN A;  4FBP A;  4XKQ A;  5JK4 A;  3DEL B;  2ZMB A;  1DK4 A;  4XF5 A;  4C1U A;  1AMF A;  4GBV A;  1FBP A;  1PEB A;  2CZH A;  1HSE A;  4XFE A;  5EYF A;  4FJP A;  4GWU A;  4LQ5 A;  3MVY A;  4H65 A;  4MLQ A;  3RPL B;  1LBY A;  2DDK A;  3PPO A;  2OBG A;  4P1L A;  2F6G A;  1IMA A;  1MQG A;  3L6G A;  1KWH A;  5CMM A;  5I57 B;  1NNK A;  5AA2 D;  4GF8 A;  1MPB A;  3FD3 A;  5ICT A;  5F24 A;  2WX9 A;  4G8N A;  4I1D A;  4YKK A;  5HPQ A;  3O6H A;  2D5W A;  2YLN A;  4E0W A;  3IOU A;  1JW5 A;  3K0V A;  2Q2C A;  5IZZ A;  1FBG A;  1B46 A;  2G29 A;  3H3G A;  4ZEC A;  3OSQ A;  3DP8 A;  2PMS A;  4PFT A;  3FXQ A;  1Q35 A;  1SW4 A;  2WYP A;  4KR5 A;  1FQE A;  3OO6 A;  4DI4 B;  3QYT A;  2OLB A;  1YXI A;  2AIX A;  5TP9 A;  3GLB A;  3LUZ A;  1AOV A;  3G3I A;  3A3U A;  1MXZ A;  2Y7R A;  1FW0 A;  1Y1Z A;  2FYI A;  2KR0 A;  4Z0I A;  4FIM A;  2ZZV A;  1I69 A;  1ZLQ A;  2B3B A;  4GL0 A;  4MH5 A;  4U21 A;  3G3J A;  4N6P A;  3CHG A;  4OVJ A;  2XWK A;  4MJO A;  3KBR A;  4ZS9 A;  1B7Z A;  4OER A;  4G4P A;  2ESN A;  3FAT A;  4XTC Q;  1PB7 A;  2DE4 A;  1FJ9 A;  1IMC A;  4YB5 A;  3KN8 A;  2QS3 A;  1B5I A;  5DVF A;  3K6V A;  1NNF A;  3HHF A;  4OVS A;  1B3F A;  3MYU A;  1FPD A;  2XXV A;  4LZ8 A;  3K4U A;  3FBP A;  1FPI A;  3FVG A;  3JYR A;  4GX6 A;  2XXW A;  3EN3 A;  3E78 A;  4HCW A;  4P9K A;  2F6P A;  4GWZ A;  1S50 A;  2I4C A;  1D3K A;  1RKM A;  4H8I A;  3TDJ A;  3TQW A;  5LDZ A;  4ISU A;  3RN8 A;  4P56 A;  1M5C A;  1MS7 A;  4P8B A;  3ROJ A;  2NUV A;  4UA8 A;  2XXR A;  1USY H;  3I6V A;  4PFY A;  2FNC A;  2GFE A;  1XC1 A;  3W9V A;  1FBE A;  4R2B A;  5IM2 A;  3SEY A;  5KCJ A;  2CEY A;  3MQ9 A;  1SW2 A;  4LZ5 A;  5I3S A;  4PDD A;  3CIJ A;  3MW0 A;  4N13 A;  3O66 A;  3OXN A;  3B6Q A;  4O3A A;  4YB6 A;  3AXF A;  5IKB A;  1Y3Q A;  5ELV A;  3TMG A;  4EQ7 A;  1MXY A;  3EHT A;  2HEU A;  2REJ A;  2CMO A;  4PFW A;  1MM6 A;  2F97 A;  5EQ9 A;  3E79 A;  4G8M A;  3BBR A;  3SDF A;  4ESW A;  2ZXT A;  4N6K A;  5FHN A;  1MQD A;  3NOH A;  4GX4 A;  3KFM A;  1IXG A;  3MVX A;  3CVG A;  3H6V A;  2H4I A;  5K2Y A;  3TQL A;  3Q27 A;  3OMB A;  5TPA B;  5I56 B;  3PMV A;  1VDW A;  1YAE A;  2GH9 A;  2HCA A;  4PAF A;  3PUW E;  1LAG E;  3U8Q A;  4F29 A;  3IO6 A;  1MY2 A;  2I3V A;  1Y3P A;  1B40 A;  1B2H A;  4HCY A;  4PAK A;  2DVZ A;  3KN7 A;  1TFD A;  5IAI A;  1Y9U A;  1Y4T A;  4AS5 A;  3H03 A;  3HPI A;  5I2N A;  3I5O A;  5I58 B;  1EZ9 A;  2H99 A;  3C35 A;  3PUV E;  1NUZ A;  4RJZ A;  5F7V A;  3T96 B;  4KI0 E;  5L8D A;  5I59 A;  1IME A;  4WEP A;  3TCH A;  5AA3 A;  5KCJ B;  2DVC A;  1TT1 A;  1BKA A;  4U1Z A;  1PBQ A;  3RTF B;  4HXV A;  1XOC A;  3SES A;  3E3K A;  4EF2 A;  2R9J A;  2D3I A;  4OVP A;  1HSJ A;  3T9V A;  3HN0 A;  4OEU A;  4QSD A;  3I3V A;  4QFK A;  3C32 A;  4LQ2 A;  3C36 A;  5ICQ A;  1LBX A;  4N91 A;  3EHU A;  1ZU0 A;  4Q30 B;  4O3C A;  4RPN A;  2Z8D A;  5EYG A;  4IY6 A;  5H8Q B;  2ZNT A;  4RNS A;  3R6U A;  2FIE A;  2VGQ A;  3KZG A;  1JQF A;  2DP8 A;  4LP2 B;  3ISP A;  3P7I A;  1RYO A;  1I6A A;  2CZI A;  2DE2 A;  3O2A A;  3W15 C;  4R6K A;  4RA1 A;  4HTG A;  4GFR A;  3PU5 A;  1DPP A;  3CFX A;  1D9V A;  3EHS A;  2BJJ X;  3OO9 A;  4KCD A;  4THI A;  2D21 A;  2XWO A;  2QSX A;  4PET A;  3E9X A;  4GWW A;  4I3E A;  4GWX A;  4IGT A;  1EYI A;  5I59 B;  1Z7N E;  1B5H A;  3M8U A;  1B3H A;  3F11 A;  4E0X A;  4OVT A;  3TYH A;  2P2A A;  4XXU A;  1LCF A;  4FAT A;  3IOR A;  1FQD A;  4R75 A;  5ITO A;  2F34 A;  4HE2 A;  3FV2 A;  1N3X A;  1B58 A;  2BJI A;  4WXJ A;  1BIY A;  3M3L A;  4M1V A;  4PFR A;  4ELP A;  5H8N B;  5T3J A;  5EYH A;  2DE3 A;  3N94 A;  1GVC A;  2H5Y A;  4GWO A;  2F7B A;  2DOJ A;  2XXK A;  4JWO A;  3FXR A;  4NF0 A;  4FOR A;  3B7D A;  2XXQ A;  2UXA A;  4PDH A;  1NV2 A;  1BLF A;  4U22 A;  4YKP A;  1SD3 A;  2I4B A;  3QIM A;  4IB2 A;  1NNP A;  4AB6 A;  1K9Y A;  1Y3N A;  3LC8 A;  1IXC A;  1FPJ A;  4R9G A;  4JDF A;  1CNQ A;  4OA4 A;  4F3B A;  4BDN A;  1SDX A;  2GHB A;  2X7P A;  3O9P A;  2DS9 A;  1LBV A;  3CI8 A;  3ILT B;  4TLL B;  4EXK A;  1B5J A;  3T1B A;  4ZED A;  4RY1 A;  1ATG A;  2UVJ A;  3ZS6 A;  3B6T A;  3H6T A;  1M5E A;  4P11 A;  3W9W A;  2NVU B;  3RPL A;  1EYK A;  2XX8 A;  4MMP A;  4QFL A;  2CEX A;  3USD A;  1B7H A;  2IEE A;  2UVI A;  5I57 A;  1ZMG A;  4KFQ A;  3PTY A;  1ZBM A;  1VR5 A;  1JET A;  3C33 A;  1LFI A;  4WKM A;  1B52 A;  2I48 A;  3A3C A;  2V25 A;  3R26 A;  4GL8 A;  1FTL A;  3FAS A;  3IOV A;  2FA7 A;  3MC2 A;  2QS2 A;  4PFU A;  1FQB A;  4YKJ A;  1AL3 A;  5HM4 B;  1B3E A;  2CZK A;  4NHB A;  1B9J A;  1OLC A;  4R72 A;  1LBB A;  5DVJ A;  2NOO A;  2RIN A;  1JW1 A;  2LAO A;  3OOA A;  2XXP A;  2AL5 A;  4P47 A;  4KXP A;  3VVD A;  3OEN A;  3K6U A;  3TTK A;  2O1L A;  3C4M A;  1BK4 A;  2NWJ A;  4O7I A;  3OEK A;  3QSL A;  2CZL A;  1US5 A;  1UIV A;  1VFE A;  1AH5 A;  1INP A;  1ELJ A;  1D9Q A;  1LCT A;  2L5V A;  3D4G A;  4LON B;  3V89 B;  1Q1K A;  2O7I A;  1I6B A;  1G0H A;  2GHA A;  3VLU A;  1B05 A;  2F78 A;  4DCX A;  1B32 A;  3EPE A;  3UK4 A;  2F36 A;  2H9B A;  2O51 A;  1DSN A;  5LTC A;  4ZZA A;  1DMB A;  4G77 A;  3MUQ A;  3RPW A;  4HS7 A;  3KSX A;  2HAU A;  1UTB B;  5CMC A;  4KYE A;  4R9F A;  1POY 1;  2ZYO A;  5IZ1 A;  3UA8 A;  4MEV A;  2PFY A;  4N15 A;  1O64 A;  2V4C A;  2VP1 A;  3N26 A;  3O6I A;  3OEM A;  4MIJ A;  5I84 A;  3H4Z A;  2HZK A;  1II5 A;  1EZP A;  1B1H A;  2XHD A;  1LST A;  4GRK A;  2RC9 A;  4OFJ A;  4O8M A;  5A5L A;  4QHQ A;  1FBH A;  2WBB A;  3ECR A;  3UIF A;  4ECF A;  1B1X A;  1EH3 A;  1FQF A;  3FVO A;  5H8H B;  3T9H B;  1IMF A;  3TEL A;  1CB6 A;  3R7X A;  4NTL A;  4YMB A;  1FPF A;  3ONM A;  4EUO A;  1IEJ A;  1PC3 A;  1QKA A;  2DWI A;  4F18 A;  4H45 A; 
#chains in the Genus database with same CATH homology
 2QPQ A;  2XD3 A;  4G2Z A;  3U93 A;  3S9E A;  2F8D A;  3PPR A;  5DEX A;  2HZL A;  3ZKK A;  2DWH A;  1B7U A;  4LUB A;  5BWJ A;  2UYF A;  4OFO A;  4X48 A;  3JV9 A;  3MJN A;  3GBB A;  1DPE A;  3TUS A;  3RY3 A;  1NL5 A;  4F39 A;  4R73 A;  3D4C A;  4X9T A;  1P1U A;  1B0L A;  3KGC A;  4GXA A;  4M4G A;  2XXX A;  1Y1M A;  4O3B A;  1A8F A;  4NF8 A;  4MFI A;  2XXU A;  4GQO A;  4N07 A;  1GTK A;  4IO7 A;  3BFT A;  4JSO A;  1BP5 A;  3RLF E;  2XXT A;  4F3G A;  4NF4 A;  3MP8 A;  1MXU A;  2XXI A;  1A8E A;  5TPA A;  5I56 A;  2B3F A;  2UVH A;  4I8C A;  1N84 A;  5AA4 B;  4F2O A;  5DEX B;  2PT1 A;  1PDA A;  3PUX E;  1LFH A;  3TPA A;  1T0K A;  5FHM A;  1QW0 A;  5I58 A;  5DVI A;  1B51 A;  1H76 A;  4ND9 A;  4XKN A;  2THI A;  1NMU A;  3THI A;  3HV1 A;  3DLN A;  5K2X A;  3UN6 A;  1SI1 A;  1MQJ A;  2XXH A;  4OYV A;  4JSD A;  1MM7 A;  1UTH A;  1SQY A;  1YPN A;  2ANJ A;  1Z7M E;  3VV5 A;  1HSL A;  4NF8 B;  1ANF A;  3IB1 A;  2HFB A;  4MBP A;  4QFN A;  4F1U A;  3K02 A;  3MVZ A;  3TTL A;  5CBS A;  1JEV A;  1R9Q A;  4LA9 A;  2PYY A;  4YZZ A;  1DTZ A;  4FEB A;  4NF4 B;  5H8Q A;  3RTW B;  5DTB A;  4YIC A;  1QUJ A;  3IJX B;  3T66 A;  2VD3 A;  2DYX A;  5A5X B;  1OVB A;  4IGR A;  1SBP A;  1M5B A;  1IZ1 A;  3MBP A;  4RYA A;  1TXF A;  2I0B A;  4ZZE A;  1JW4 A;  2I0C A;  2F5X A;  1XS5 A;  3VXC A;  4YB7 A;  3FGS A;  1I6Q A;  3TTM A;  1LAF E;  2V84 A;  3H6W A;  3K00 A;  5ISU A;  1PBP A;  2I6E A;  2F7C A;  3IJO B;  3TOD A;  4QRZ A;  3WAF A;  1MXW A;  2QMW A;  4ELR A;  5ITP A;  3BFU A;  1UTH B;  2VD2 A;  3PPQ A;  3VDF A;  4YKI A;  4GOT A;  4U1O A;  3HST A;  4KPT A;  5H8N A;  3VE1 B;  3TTN A;  3KJ7 A;  3VXB A;  1DOT A;  3FXU A;  2RF1 A;  1MPC A;  1BTJ A;  2OJT A;  1VE4 A;  4H8J A;  1EU8 A;  1DTG A;  4OET A;  3ILU B;  3VFJ A;  3N6T A;  3RGY A;  3U72 A;  4EDP A;  1MDP 1;  5FTH A;  1MPD A;  3C34 A;  1S9T A;  3MZB A;  3FUZ A;  1B4Z A;  1ZTY A;  3V8X B;  4OEN A;  1GR2 A;  4OZ9 A;  3CSB A;  4NWD A;  2Y7P A;  3QXM A;  2X26 A;  3K6X A;  3Q28 A;  1N0T A;  1ZIU A;  3MP6 A;  1MXV A;  2E1S A;  2X7Q A;  4PP0 A;  4ONY A;  2ONS A;  3KN3 A;  3N5L A;  4FED A;  4JB7 A;  3FV1 A;  4BDO A;  3TKD A;  3T93 B;  3O29 A;  1N76 A;  3T22 A;  4MLV A;  3CG1 A;  4LVQ A;  4WED A;  3G3F A;  3E4R A;  2PVU A;  3VLW A;  1QUI A;  2RC7 A;  3IO4 A;  1MRP A;  1MXX A;  1MH4 A;  2OZZ A;  1URD A;  1AIV A;  1R9L A;  1MG1 A;  1XVY A;  1LB8 A;  4AB5 A;  3SER A;  4ESX A;  3PUZ E;  4OTE A;  2HAV A;  3KSJ A;  3PMX A;  1VSO A;  5FHO A;  5EHM A;  3IK6 B;  4I9D A;  3IOT A;  3LSX A;  3SEW A;  4UAC A;  3LBS A;  1MY0 A;  4Q0C A;  4FAJ A;  2P0S A;  4F1V A;  3KOT A;  3UP9 A;  4NMY A;  3DM0 A;  2IA4 A;  3K01 A;  4DZ1 A;  2A5T B;  4I62 A;  4XKR A;  3SEU A;  1P1N A;  3GBA A;  3MZ9 A;  1JVY A;  4JWY A;  1EZO A;  1QVS A;  4Z7E A;  4DXU A;  4F3P A;  4DLD A;  4F19 A;  1R1N A;  2VOZ A;  4EXL A;  3G3K A;  3L6H A;  4H67 A;  4EF1 A;  5L9S A;  2OWT A;  1UTB A;  3MPL A;  1M5F A;  2Q8J A;  3WAE A;  1N7W A;  2V3Q A;  4G68 B;  5CRY A;  3RQT A;  2AL4 A;  4KYD A;  4OHN A;  2Q88 A;  2M8C A;  5EHS A;  4QSC A;  4RXL A;  3KJT A;  3SEV A;  4GVO A;  5L9O A;  3K1M A;  1N04 A;  1OQG A;  2Q9T A;  5H8H A;  2I58 A;  3K2D A;  1FTJ A;  2G93 A;  4NF6 A;  2KLF A;  5JTY A;  1H3D A;  4IO3 A;  1YTV A;  5HBC A;  3ODB A;  4BDR A;  4DIG A;  1RYX A;  3M3F A;  2QMX A;  1SVX B;  5DYH A;  3VLV A;  2H25 A;  1FQA A;  3FZV A;  5CC2 A;  1XVX A;  4YMA A;  3S9M C;  3U94 A;  1FQC A;  4TQU Q;  1MQH A;  2RKM A;  5TU0 A;  5I2K A;  4H5F A;  2O1M A;  4F31 B;  3EQ1 A;  1NH7 A;  2UVG A;  4BDM A;  1WOD A;  1MH3 A;  1USY E;  1XHY A;  1H45 A;  1P1O A;  4JWX A;  4R6Y A;  1MQI A;  3PV0 E;  4BDL A;  1A99 A;  3HCQ A;  3LSL A;  4LAT A;  4KQP A;  1TFA A;  2DSF A;  4IO6 A;  2QS4 A;  3U1O A;  2O6A A;  1IXH A;  2OCU A;  3MP1 A;  3FJG A;  1UIU A;  3RT6 B;  2PX1 A;  5KDT A;  1XT8 A;  1OMP A;  4U23 A;  4NF6 B;  3O97 A;  1VFD A;  3N6U A;  3TZA A;  4F3S A;  1B4H A;  1ZJL A;  5JTY B;  1Y4C A;  1YCJ A;  3RT8 A;  3DP6 A;  3V5A A;  5AA4 A;  2NXO A;  4POX A;  2XX9 A;  4C0R A;  1O63 A;  1LBC A;  5CBR A;  2QL3 A;  3T9X B;  4JBZ A;  5I2K B;  3JZJ A;  4KHZ E;  1JNF A;  3FJM A;  3FVN A;  1QKB A;  1Y20 A;  5J1D A;  3TAJ A;  3B6W A;  1OVT A;  3G3H A;  2XXY A;  2A5S A;  4GIZ A;  3K1N A;  1P99 A;  3S4U A;  1P1W A;  1A55 A;  1R6Z A;  4X1B A;  3UGW A;  4F22 A;  4ELQ A;  2E0S A;  1H43 A;  3PPN A;  4KD5 A;  4QFO A;  3OEL A;  4U4S A;  3LSF B;  3ZSF A;  2PT2 A;  3PGF A;  4OEV A;  5KDT B;  1ZKB A;  5L9M A;  3S2V A;  4OQO A;  1MY4 A;  4YU0 A;  3Q26 A;  2QS1 A;  3ZKL A;  5A5X A;  4DE8 A;  4PQJ A;  2ZYN A;  2B65 A;  2ZNS A;  4JXI A;  5CM6 A;  4OFL A;  4RK9 A;  1MY1 A;  5TP9 B;  2Y7W A;  4AQ4 A;  2DQV A;  2AYS A;  3PD9 A;  3LSW A;  3QUJ A;  1IIW A;  2F7A A;  3C31 A;  3E13 X;  3K1P A;  3LR1 A;  4FEC A;  1US4 A;  5CI5 A;  3SKP A;  1TWY A;  2P1S A;  1L5T A;  4GD5 A;  1S7Y A;  1D9Y A;  3IB0 A;  4BDQ A;  3H6U A;  4H6D A;  3SET A;  1OIB A;  1JEU A;  3IB2 A;  3CSG A;  4ZEI A;  2DWA A;  1OQH A;  2Q89 A;  3QK6 A;  2OK2 A;  4ZEF A;  1WDN A;  3G3G A;  2DXY A;  5JEI A;  3Q25 A;  3TCG A;  3U92 A;  4DCY A;  2YPN A;  1QUL A;  2HXW A;  3CFZ A;  2OWS A;  2QJE A;  1CE2 A;  4X1D A;  2O68 A;  1POT A;  3CG3 A;  3IAZ A;  1LAX A;  1URG A;  4NED A;  1IIT A;  4F2Q A;  4OWD A;  2PBW A;  5DT6 A;  2V93 A;  5M2V A;  5KZT A;  1QUK A;  3O6G A;  1SW1 A;  5H8S A;  4GXS B;  2XD2 A;  3IOW A;  2UYE A;  3SEX A;  2ZYK A;  1NFT A;  5AA1 A;  3FJ7 A;  4C1T A;  1M5D A;  3BKI B;  3CR9 A;  3H06 B;  1SW5 A;  4DDD A;  3K6W A;  4TLM B;  4IO5 A;  1B3G A;  1JVX A;  3TEP A;  1SI0 A;  5B7D A;  4R6H A;  3MPK A;  1J1N A;  2Z22 A;  1FTK A;  2V3U A;  5FTI A;  1F9B A;  3EF7 A;  4IO4 A;  2ALU A;  2Z23 A;  3QAX A;  3CFL A;  3KOS A;  3OO7 A;  2I49 A;  1GGG A;  2F35 A;  4ZEB A;  2R71 A;  3M3K A;  3A09 A;  4NF5 A;  4RPO A;  4H5G A;  4XIG Q;  4EQ9 A;  1IXI A;  2Q2A A;  4U2R A;  1MY3 A;  4EQB A;  3MVW A;  4H1X A;  2ONK E;  2YJP A;  1SYH A;  4FE8 A;  3VVE A;  1LLS A;  2H98 A;  2REG A;  3MWB A;  3UOR A;  2DWJ A;  3GXA A;  3IL1 B;  2XX7 A;  3PUY E;  3TFL A;  1IUD A;  5I2N B;  1LFG A;  1B6H A;  3KEI A;  4QFP A;  4H0W A;  2A5T A;  4POW A;  4NWC A;  5H8F A;  2V3T A;  2W7Y A;  4R2F A;  1UQW A;  4ZEK A;  3FIR A;  1QJM A;  4P0I A;  3FVK A;  4NE4 A;  4IO2 A;  4U4X A;  2I3W A;  2RCB A;  1D4N A;  1A7L A;  4F1Y A;  4PE5 B;  1O7T A;  1NKX A;  1GV8 A;  1PB9 A;  4P0G A;  3S9N C;  2Y7K A;  3MZ1 A;  4G68 A;  4Q5T A;  5AA2 A;  2O69 A;  3OSR A;  4NF5 B;  3V83 A;  2Y7I A;  4HW8 A;  4OMB A;  1N7X A;  1WVJ A;  3OD7 A;  1FTM A;  1B3L A;  4RK2 A;  5F1Q A;  4OES A;  4ZDM A;  1N3W A;  2R6G E;  4KYS A;  1IQ7 A;  2ZYM A;  3GZG A;  4TOZ A;  4QSE A;  4DXB A;  2QRY A;  1A54 A;  4ZE8 A;  4G68 C;  4IY5 A;  3G7W A;  5CMB A;  1NNT A;  5H8F B;  4YAH X;  1LB9 A;  2RC8 A;  4R74 A;  2O7U A;  4LZ7 A;  1B0H A;  3IX1 A;  1MDQ A;  1A40 A;  3T9U A;  2DXR A;  1NH8 A;  2VHA A;  3PMW A;  3C9H A;  1OLA A;  2O84 X;  1SYI A;  3VVF A;  1LAH E;  4ELO A;  4KCC A;  3HO7 A;  3CRB A;  3TCF A;  5AA2 B;  3PD8 A;  4ZE9 A;  5BUU A;  3IR1 A;  2ABH A;  3QUF A;  4MF3 A;  1P1Q A;  3Q29 A;  1URS A;  2ZNU A;  2Z8F A;  2Z8E A;  3O28 A;  1PB8 A;  3OO8 A;  3TTR A;  2HQ0 A;  4XKP A;  1H44 A;  3LUY A;  2ONR A;  4DXC A;  3H7M A;  4OXV A;  4G8H A;  4BLA A;  3RUM A;  3KG2 A;  3DP4 A;  4K3F A;  5CMK A;  1FCK A;  3HHG A;  2RCA A;  5LOM A;  1FTO A;  4Q8R A;  3S9L C;  2Y84 A;  2WKY A;  1LGB C;  5B70 A;  5AE4 A;  4GLI A;  4QF9 A;  3MAM A;  3PPP A;  2GRV A;  4L17 A;  3RNN A;  5JK4 A;  4XKQ A;  3DEL B;  2ZMB A;  4C1U A;  1AMF A;  1PEB A;  1HSE A;  5EYF A;  4FJP A;  4LQ5 A;  3MVY A;  4H65 A;  4MLQ A;  3PPO A;  2OBG A;  2F6G A;  1MQG A;  3L6G A;  1KWH A;  5CMM A;  5I57 B;  1NNK A;  5AA2 D;  4GF8 A;  1MPB A;  3FD3 A;  5ICT A;  4G8N A;  4I1D A;  4YKK A;  5HPQ A;  3O6H A;  2D5W A;  2YLN A;  4E0W A;  3IOU A;  1JW5 A;  3K0V A;  2Q2C A;  1B46 A;  2G29 A;  3H3G A;  4ZEC A;  3OSQ A;  3DP8 A;  2PMS A;  4PFT A;  3FXQ A;  1Q35 A;  1SW4 A;  4KR5 A;  1FQE A;  3OO6 A;  3QYT A;  2OLB A;  2AIX A;  5TP9 A;  3GLB A;  1AOV A;  3G3I A;  3A3U A;  1MXZ A;  2Y7R A;  1FW0 A;  1Y1Z A;  2FYI A;  4Z0I A;  4FIM A;  1I69 A;  1ZLQ A;  2B3B A;  4GL0 A;  4MH5 A;  4U21 A;  3G3J A;  4N6P A;  4OVJ A;  3KBR A;  4ZS9 A;  1B7Z A;  4OER A;  4G4P A;  2ESN A;  3FAT A;  4XTC Q;  1PB7 A;  2DE4 A;  4YB5 A;  3KN8 A;  2QS3 A;  1B5I A;  5DVF A;  3K6V A;  1NNF A;  3HHF A;  1B3F A;  2XXV A;  4LZ8 A;  3K4U A;  3FVG A;  3JYR A;  2XXW A;  3EN3 A;  4HCW A;  2F6P A;  1S50 A;  2I4C A;  1D3K A;  1RKM A;  4H8I A;  3TDJ A;  3TQW A;  4ISU A;  3RN8 A;  1M5C A;  1MS7 A;  2NUV A;  4UA8 A;  2XXR A;  1USY H;  3I6V A;  4PFY A;  2FNC A;  2GFE A;  1XC1 A;  3W9V A;  4R2B A;  3SEY A;  5KCJ A;  3MQ9 A;  1SW2 A;  4LZ5 A;  3CIJ A;  3MW0 A;  4N13 A;  3O66 A;  3OXN A;  3B6Q A;  4O3A A;  4YB6 A;  3AXF A;  5IKB A;  1Y3Q A;  5ELV A;  3TMG A;  4EQ7 A;  1MXY A;  3EHT A;  2HEU A;  2REJ A;  2CMO A;  4PFW A;  1MM6 A;  2F97 A;  4G8M A;  3BBR A;  3SDF A;  4ESW A;  2ZXT A;  5FHN A;  1MQD A;  3KFM A;  1IXG A;  3MVX A;  3CVG A;  3H6V A;  2H4I A;  5K2Y A;  3TQL A;  3Q27 A;  3OMB A;  5TPA B;  5I56 B;  3PMV A;  1YAE A;  2GH9 A;  2HCA A;  3PUW E;  1LAG E;  3U8Q A;  4F29 A;  3IO6 A;  1MY2 A;  2I3V A;  1Y3P A;  1B40 A;  1B2H A;  4HCY A;  2DVZ A;  3KN7 A;  1TFD A;  5IAI A;  1Y9U A;  1Y4T A;  3H03 A;  3HPI A;  5I2N A;  3I5O A;  5I58 B;  1EZ9 A;  2H99 A;  3C35 A;  3PUV E;  4RJZ A;  5F7V A;  3T96 B;  4KI0 E;  5L8D A;  5I59 A;  4WEP A;  3TCH A;  5AA3 A;  5KCJ B;  2DVC A;  1TT1 A;  1BKA A;  4U1Z A;  1PBQ A;  3RTF B;  1XOC A;  3SES A;  3E3K A;  4EF2 A;  2R9J A;  2D3I A;  1HSJ A;  3T9V A;  3HN0 A;  4OEU A;  4QSD A;  3I3V A;  4QFK A;  3C32 A;  4LQ2 A;  3C36 A;  5ICQ A;  3EHU A;  1ZU0 A;  4Q30 B;  4O3C A;  4RPN A;  2Z8D A;  4IY6 A;  5H8Q B;  2ZNT A;  4RNS A;  3R6U A;  2VGQ A;  3KZG A;  1JQF A;  2DP8 A;  4LP2 B;  3P7I A;  1RYO A;  1I6A A;  2DE2 A;  3O2A A;  3W15 C;  4R6K A;  4RA1 A;  4HTG A;  4GFR A;  3PU5 A;  1DPP A;  3CFX A;  1D9V A;  3EHS A;  2BJJ X;  3OO9 A;  4KCD A;  4THI A;  2D21 A;  2QSX A;  4PET A;  3E9X A;  4IGT A;  5I59 B;  1Z7N E;  1B5H A;  3M8U A;  1B3H A;  3F11 A;  4E0X A;  3TYH A;  2P2A A;  4XXU A;  1LCF A;  4FAT A;  3IOR A;  1FQD A;  4R75 A;  5ITO A;  2F34 A;  3FV2 A;  1N3X A;  1B58 A;  4WXJ A;  1BIY A;  3M3L A;  4M1V A;  4ELP A;  5H8N B;  2DE3 A;  3N94 A;  1GVC A;  2H5Y A;  4GWO A;  2F7B A;  2DOJ A;  4JWO A;  3FXR A;  4FOR A;  3B7D A;  2XXQ A;  2UXA A;  1BLF A;  4U22 A;  4YKP A;  1SD3 A;  2I4B A;  3QIM A;  4IB2 A;  1NNP A;  4AB6 A;  1Y3N A;  3LC8 A;  1IXC A;  4R9G A;  4JDF A;  4F3B A;  4BDN A;  1SDX A;  2GHB A;  2X7P A;  3O9P A;  2DS9 A;  3CI8 A;  3ILT B;  4TLL B;  4EXK A;  1B5J A;  4ZED A;  4RY1 A;  1ATG A;  2UVJ A;  3ZS6 A;  3B6T A;  3H6T A;  1M5E A;  4P11 A;  3W9W A;  2NVU B;  4QFL A;  2XX8 A;  3USD A;  1B7H A;  2IEE A;  2UVI A;  5I57 A;  1ZMG A;  4KFQ A;  1ZBM A;  1VR5 A;  1JET A;  3C33 A;  1LFI A;  4WKM A;  1B52 A;  2I48 A;  3A3C A;  2V25 A;  3R26 A;  4GL8 A;  1FTL A;  3FAS A;  3IOV A;  2FA7 A;  3MC2 A;  2QS2 A;  4PFU A;  1FQB A;  4YKJ A;  1AL3 A;  5HM4 B;  1B3E A;  1B9J A;  1OLC A;  4R72 A;  1LBB A;  5DVJ A;  2NOO A;  2RIN A;  1JW1 A;  2LAO A;  3OOA A;  2XXP A;  2AL5 A;  3VVD A;  3OEN A;  3K6U A;  3TTK A;  2O1L A;  3C4M A;  2NWJ A;  3OEK A;  3QSL A;  2CZL A;  1US5 A;  1UIV A;  1VFE A;  1AH5 A;  1ELJ A;  1LCT A;  3D4G A;  4LON B;  3V89 B;  1Q1K A;  2O7I A;  1I6B A;  2GHA A;  3VLU A;  1B05 A;  2F78 A;  4DCX A;  1B32 A;  3EPE A;  3UK4 A;  2F36 A;  2H9B A;  2O51 A;  1DSN A;  4ZZA A;  1DMB A;  4G77 A;  3MUQ A;  3RPW A;  4HS7 A;  3KSX A;  2HAU A;  1UTB B;  5CMC A;  4KYE A;  4R9F A;  1POY 1;  2ZYO A;  3UA8 A;  1O64 A;  2VP1 A;  3N26 A;  3O6I A;  3OEM A;  5I84 A;  3H4Z A;  2HZK A;  1II5 A;  1EZP A;  1B1H A;  2XHD A;  1LST A;  4GRK A;  2RC9 A;  4OFJ A;  4QHQ A;  3ECR A;  3UIF A;  4ECF A;  1B1X A;  1EH3 A;  1FQF A;  3FVO A;  5H8H B;  3T9H B;  3TEL A;  1CB6 A;  3R7X A;  4NTL A;  4YMB A;  3ONM A;  4EUO A;  1IEJ A;  1PC3 A;  1QKA A;  2DWI A;  4F18 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...