4MHFA

Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
TEFRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIKVFNKQALGSEKETIDQVKIGALDFTRVNVGPMNAICPLTQVPTMPFLFSSIAHMRKSLDGPVGDEILKSCESAGFIGLAFYDSGARSIYAKKPIRTVADAKGLKIRVQQSDLWVALVSAMGANATPMPYGEVYTGLKTGLIDAAENNIPSFDTAKHVEAVKVYSKTEHSMAPEILVMSKIIYDKLPKAEQDMIRAAAKESVAFERQKWDEQEAKSLANVKAAGAEIVEVDKKSFQAVMGPVYDKFMTTPDMKRLVKAVQDTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Polaromonas
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
total genus 113
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mhfA00
4DI4B 4PDDA 4DI3D 4UABA 4LN5A 4XFEA 2WYPA 2XA5A 2ZZWA 4YZZA 4NAPA 4P9KA 2PFZA 4MIJA 4P56A 2HZLA 4O8MA 4NQ8A 4PGPA 4P3LA 2VPNA 2XWKA 4N6KA 4PF8A 4N8GA 4NN3A 4OVQA 4MX6A 4OVPA 5CM6A 4N6DA 4X8RA 4N17A 4X04A 4O94A 2XWOA 4PDHA 4PCDA 4PBHA 2HPGA 4O7MA 2XXKA 4P1LA 4PFIA 4MNCA 4NF0A 4MEVA 4P47A 3FXBA 3GYYA 2XWIA 4XF5A 2PFYA 4PFBA 4PFRA 4OVSA 2V4CA 2VPOA 4PE3A 4PAFA 4N8YA 4PAKA 4PAIA 4MMPA 2CEXA 5I5PA 4NX1A 4XEQA 3B50A 4OANA 4N91A 2WYKA 4MAGA 4NGUA 5IGAA 5LTCA 2ZZXA 4N15A 4PBQA 4NHBA 4N4UA 4MHFA 4PETA 2HZKA 4NG7A 3U65A 5I7IA 4OVTA 5IM2A 2ZZVA 4MCOA 4MNPA 4P8BA 2XWVA 4OVRA 2CEYA 4PGNA 2WX9A 4MNIA 4PF6A 5IZZA 4P1EA 4YICA 4OA4A 4PC9A
chains in the Genus database with same CATH superfamily
1RDZA 3BFUA 5FTIA 3VXBA 4XTCQ 4QFPA 2PYYA 4XFEA 2ZZWA 4KPTA 4GFRA 5KDTB 1B6HA 2Y7WA 4NWDA 2RINA 2Y7IA 3IOWA 1Y4TA 4RNSA 1XOCA 4P3LA 2V93A 3JYRA 3KC0A 2KQZA 1WODA 4F2OA 4LZ8A 4OVQA 3OO6A 3W9WA 2HAVA 3A29A 3EKIA 2GFEA 5A5LA 3Q26A 1N76A 2HQ0A 4QFLA 5DT6A 3S9EA 5EHSA 4NF6B 1B0HA 1NNKA 1FPLA 3I6VA 5DEXA 3IORA 4IO3A 3B6TA 3PD8A 1B51A 2XWIA 2B3FA 2QSXA 2V4CA 2YLNA 4NTLA 5TP9B 3B6QA 3ODBA 4ZEIA 4EUOA 1O64A 4GLIA 2A5TA 5I5PA 1B1XA 1NNPA 2DP8A 3B50A 4OANA 1XVYA 4THIA 4AB5A 4GX6A 1B4HA 2G29A 3E78A 1DOTA 3OENA 3C32A 3H03A 3RT8A 2YPNA 1GGGA 4GVOA 2VOZA 4ECFA 4POWA 1PB7A 3U65A 4QHQA 3FZVA 3RTWB 2HEUA 3SEVA 4NF5A 4OENA 1B3GA 1PB8A 5B70A 1Q9DA 3EQ1A 1LSTA 2DWAA 2F34A 1B05A 4YICA 3K00A 3O97A 2Y5KA 5FHNA 4MBPA 1B5IA 2P3VA 4TOZA 1BP5A 3A3UA 3DP4A 5B7DA 3WAEA 3FVGA 4I3EA 3TCGA 3ZKLA 1LBYA 1TWYA 3OEKA 2RCAA 1AMFA 2PT2A 3O6GA 3OO9A 1DCUA 4KR5A 4NN3A 1NI9A 1YXIA 3D4GA 3O66A 3MP1A 3FIRA 2HPGA 4O7MA 5DEXB 3TKDA 1LLSA 1QKAA 1IMBA 2Q88A 4L17A 1PB9A 1M5BA 2I58A 4P47A 2FHYA 3U8QA 2PFYA 1FPKA 2A5TB 1FCKA 4N8YA 1P1NA 3KOTA 1OLAA 2ONKE 3S4UA 2THIA 4FJPA 3V5AA 1A40A 1EH3A 2XD2A 4R75A 1B5JA 1A7LA 3SEYA 5IGAA 1KA0A 3C36A 4LONB 3MP6A 4IGTA 2H9BA 3C9HA 4N4UA 5AA3A 3KGCA 2NVUB 1JVXA 2QJEA 1UIVA 2X7PA 4OFJA 2UXAA 1LCFA 2DS9A 1NH8A 1NV2A 1B52A 1SD3A 5IZZA 3PUZE 4G8HA 2PVUA 2I3VA 2E0SA 1FQBA 2VT5A 1B2HA 4MLQA 3C34A 4OHNA 5DW8A 5H8SA 3T96B 2IEEA 1MXWA 3K1MA 5IAIA 4KCDA 4GQOA 4O8MA 5HBCA 4OWDA 3HPIA 2ZYMA 3CRBA 5J16A 1I69A 4PF8A 1B7UA 5EQAA 2Y7KA 1TXFA 2Q2AA 3E4RA 3IX1A 4PCDA 4PBHA 1ANFA 1N04A 5ET5A 1POY1 3MVXA 3OSRA 1D3KA 1MXXA 3JV9A 2R9JA 4GIZA 4GWUA 1VFEA 4GL8A 4PFBA 2GH9A 3FJ7A 4R2BA 2ZYOA 4IY6A 1MPDA 1EYJA 1UTBB 5AA4B 5FBPA 2DE4A 1OVBA 4OMBA 4ZZAA 4F31B 1MXVA 5EQ9A 3C33A 1FRPA 3E13X 3QUFA 2QL3A 4EQ9A 1YYZA 1Q35A 4ZEFA 4Q30B 4IO4A 1SW2A 3H6UA 3RNNA 3MYUA 1LFHA 1LAHE 4KYDA 1Y9UA 3TEPA 3RTFB 3BFTA 3PMVA 1JW4A 1EYIA 4R6YA 3O28A 5TPAB 3TELA 4DI3D 1HSJA 1N3WA 1FBFA 1MPCA 1RDXA 3CIJA 1BIYA 4ZS9A 2PFZA 3K1PA 1IXGA 4KI0E 4KYEA 5LOMA 2A5SA 2HZLA 3IB2A 1FBGA 2V25A 1UTHA 4HCWA 3PMXA 4F1YA 5HPQA 3OO7A 4X04A 1VE4A 2XWOA 3TODA 1H43A 1N7XA 4OEVA 4GX4A 3CSBA 3D4CA 1PBQA 1IZ1A 2XXKA 3HSTA 3V8XB 2RC9A 3HV1A 1NUZA 1QULA 4GL0A 1NMUA 3C4MA 4FE8A 3G3IA 1YTVA 3CSGA 3N6UA 4NWCA 3VVDA 4MMPA 3O2AA 2E1SA 1K9ZA 3QSLA 4RK2A 4R6HA 3CFZA 4U21A 1NV6A 4C0RA 2V84A 1SYIA 2HXWA 2DE3A 3C35A 1FPDA 4F19A 2XXXA 1FPJA 4G77A 1B5HA 4ESWA 4DCXA 3GXAA 2Y5LA 1GR2A 1FPEA 5CBSA 4X48A 1PDAA 3FGSA 2MKZA 2F7AA 4NF5B 1Y1ZA 1ZJLA 5BWJA 1NUYA 2WKYA 5KCJB 3K6XA 4Z0IA 4PDDA 4LP2B 3N26A 3ONMA 3SZPA 4XKQA 5A5XB 1SYHA 1USYE 1P1UA 4Q0CA 4BDNA 1Y3PA 1QW0A 4XIGQ 3Q27A 3M8UA 4N8GA 4E0WA 5AA2D 3HFUA 3KZGA 2DQVA 4N6DA 5M2VA 1R1NA 4RA1A 4JWXA 5H8FB 4YU0A 3RUMA 4ELRA 4JVDA 3SEWA 1MQGA 3H6TA 4MNCA 1NKXA 3V89B 1QVSA 1ZU0A 4XKRA 4YKJA 1QUIA 1MG1A 2IA4A 2XXQA 4PFRA 4H65A 2VPOA 3QIMA 1MH3A 5I58A 1FBHA 4F29A 2B65A 3LSFB 4H6DA 2DXRA 4ZEBA 1TFAA 2OWZA 4YAHX 3KSJA 3MZBA 2FIXA 2NOOA 3FATA 3U92A 3IR1A 3SDFA 2QMXA 4NGUA 4YB6A 4OESA 1OIBA 3U1OA 1D4NA 5EQ7A 1B3HA 4GBWA 3G3JA 5L9OA 5JK4A 3FV1A 1A8FA 3KN3A 3CVGA 1OQGA 2F3DA 3PGFA 3QXMA 4N07A 3QMFA 3PUVE 3VLWA 1AL3A 1II5A 4PF6A 5BUUA 4NEDA 2R6GE 3IL1B 4LN5A 4H1XA 3CHGA 4X1BA 5TP9A 3LUYA 4H5GA 1B32A 4QF9A 1MRPA 2Z23A 5I2KB 4I40A 1FPIA 3MVYA 4ZDMA 4ELPA 1DPEA 4N17A 1K9YA 1EZPA 1IXIA 3G3FA 2LAOA 5EYGA 1FTJA 4MFIA 2XHDA 1RKMA 1NUXA 1LBCA 5IZ1A 2XX8A 3FUZA 1FTAA 1Y3QA 3PTYA 3K2DA 3F11A 3GYYA 2H5YA 2O84X 4GWSA 3E9XA 3UK4A 4DZ1A 5I57B 5CMMA 3CG1A 3HO7A 3Q25A 4HS7A 4R9FA 4RXLA 2VD2A 2P1SA 1IQ7A 3PUWE 1R9LA 4KHZE 3RPWA 4Q5TA 4EF2A 3B6WA 5I2NA 3MC2A 2L5VA 5DTBA 3TDJA 4FEBA 1SBPA 1URSA 4I9DA 2XXVA 1FQEA 3OOAA 3TTRA 2PX1A 5ISUA 3TQLA 4N81A 2XWVA 3IB0A 1FBDA 4RY1A 4U1OA 3CFLA 1LGBC 1UTBA 1LBXA 1MM6A 3T9VA 2H98A 4OETA 3TZAA 2RF1A 2XA5A 5AA2A 3VFJA 5TPAA 4RPNA 5JTYB 1FBCA 3G3GA 4WKMA 1MXYA 4H8JA 2XXPA 4DIGA 5I56B 2REJA 1DPPA 1SI1A 2OX3A 2KR0A 3VLUA 3VVEA 4KYSA 3ILUB 4GRKA 4P1LA 1XHYA 4BLAA 3NOHA 4F2QA 2OJTA 4H0WA 2GHBA 3FXBA 3L6HA 1M5FA 4EXLA 1A54A 2X26A 4G2ZA 2ZNUA 4U4XA 1CNQA 1POTA 3IAZA 1JETA 1QUKA 4PFYA 5I84A 3ECRA 2HAUA 2O7IA 5HM4B 3KG2A 3QK6A 4DE8A 2Y7RA 1NNFA 5JEIA 4U4SA 4GX3A 3I3VA 2F78A 1FQFA 5EHMA 2XX9A 3KBRA 1LBZA 3TAJA 4PETA 5I56A 1O7TA 2OK2A 4EXKA 2XXWA 4P11A 1BK4A 4H45A 2UVHA 3GBAA 1FQDA 4TQUQ 3MWBA 4X1DA 4IY5A 2QPQA 1SI0A 3IOTA 2ANJA 2ABHA 3RN8A 4GF8A 4ONYA 3U72A 5ICTA 4P1EA 3IB1A 4I3YA 5EQ8A 4YB7A 1HSLA 4NF4A 1P1WA 3IK6B 1IMAA 1FQCA 5KCJA 3FVKA 4LQ5A 4PFWA 3SESA 2OLBA 1PC3A 2HHMA 5AA4A 5K2XA 3TUSA 3UN6A 3AXFA 2XWKA 3B7DA 1IITA 2UVGA 2V3TA 1IIWA 4O7IA 3B8BA 4G68B 3IFCA 2DYXA 2XD3A 3W15C 1QKBA 1MY0A 4LA9A 1JP4A 1MQDA 1H45A 4YMAA 4O3BA 3MP8A 1QUJA 2I0CA 3MVWA 5CMKA 2O7UA 1R9QA 4PFUA 4NF6A 3BIHA 1VDWA 3M3KA 1L5TA 1FTMA 4IGRA 1P1QA 3RLFE 3VDFA 1FW0A 2CEXA 3PPPA 1Z7NE 1Q1KA 5I58B 4N91A 1XI6A 3ZKKA 1MDP1 3DM0A 4JSOA 1OMPA 4ZECA 3TTKA 5LTCA 4QXDA 4GXSB 1JW1A 5H8FA 4TLMB 2FNCA 4JXIA 1B3FA 2CZIA 2QVRA 1XC1A 3K1NA 4Q8RA 3KSXA 2CEYA 2F35A 3Q29A 4ZZEA 1LCTA 2FIEA 1LAGE 3O6HA 3MVZA 4BDOA 4UA8A 3SKPA 1QGXA 3FJGA 2F97A 4I8CA 4JSDA 1DTZA 1XVXA 2F6GA 4IR8A 4N6KA 3BKIB 4M1VA 4X8RA 1AH5A 4FBPA 3FXQA 1BLFA 3BIGA 4HTGA 1IMCA 4N13A 1LB9A 4EDPA 3PPQA 5CI5A 4RPOA 3KBZA 3MPKA 2RC7A 3IO4A 4PE5B 2QMWA 4NMYA 4U23A 4C1UA 1S50A 4JDFA 3TFLA 4XKPA 1GV8A 1QJMA 4G61A 2O68A 2CMOA 2YJPA 5F24A 4WEDA 1KZ8A 4MLVA 5A5XA 3LC8A 3THIA 3OSQA 2HFBA 1SW1A 1IEJA 3MAMA 3KC1A 1M5CA 1KWHA 2XXYA 2O51A 3RPLA 4NG7A 5J1DA 5DVFA 1ZLQA 2PCRA 2Q74A 3EHSA 4ZEDA 5I59B 1CE2A 1OQHA 4R74A 2XXTA 4JVCA 4ZE8A 4I62A 4LVQA 1YZ0A 4MCOA 2GRVA 3O29A 3FVOA 2I0BA 2P2AA 3UGWA 3CR9A 2WX9A 4G68C 4MNIA 3RT6B 4QBAA 1S7YA 3R26A 1ZKBA 4E0XA 2RCBA 1FJ6A 2VGQA 3OMBA 4YZZA 2RKMA 4NAPA 2ZYKA 2Z8DA 4F3BA 2WBDA 1NV7A 5ITPA 2NUVA 5F7VA 3MUQA 1TFDA 2OWSA 2Q8JA 2KLFA 1US5A 3TPAA 3HCQA 3T1BA 2RC8A 4YKKA 2AYSA 1H44A 4NF8B 4HE1A 3CFXA 2VP1A 1B7ZA 3H4ZA 3Q28A 5IZ3A 1EZ9A 4OERA 4PFIA 4BDMA 2I6EA 4ELQA 3T9XB 1LAXA 3SEUA 2Q8MA 4DXCA 4PAFA 2I3WA 4PAKA 4DXUA 1AIVA 1Z7ME 1URDA 4K3FA 4OFLA 4XEQA 1LAFE 3KOSA 1YCJA 1AWBA 2BJJX 2QS4A 1WVJA 1PBPA 3TMGA 2FA7A 4GWXA 3PPNA 2GHAA 2PT1A 3LSWA 5CBRA 3R6UA 3GBBA 4LQ2A 1ZIUA 3A3CA 4MHFA 1Y20A 3K6WA 3H6WA 3SEXA 4GBVA 3S9LC 3EPEA 4OVTA 4P0GA 2I49A 1RDYA 2O1LA 1FQAA 2JJKA 1B3EA 2WBBA 4BDLA 2F6PA 3E3KA 4OYVA 3QYTA 4F3SA 4EF1A 4PC9A 1NV0A 4H5FA 4G8MA 4EQ7A 3KJTA 3T9UA 4FECA 1A55A 2XX7A 1JVYA 1DMBA 2ONRA 3MSTA 4P0IA 4ZEKA 4P56A 3V83A 1NV1A 4F18A 3IO6A 2Q2CA 3UORA 1VSOA 4AS5A 4OZ9A 4OVPA 5ITOA 3PUXE 3K4UA 5I2NB 3FASA 4O94A 2B4LA 2WEFA 4F1UA 1LBBA 4FAJA 2F36A 3L6GA 2DWIA 2Y7PA 3MBPA 4F3PA 1MY2A 4GWWA 2DWHA 3LBSA 2UYFA 1URGA 5I57A 2DVZA 2ONSA 1NL5A 4H67A 2HCAA 2QFLA 2Q9TA 4JVIA 4FEDA 5H8QB 1UIUA 1B0LA 1MM7A 3H3GA 4G4PA 1PEBA 1I6BA 1LBVA 2ZZXA 1BKAA 4NHBA 3D1RA 1O63A 1HSEA 4LZ5A 3T0JA 5IKBA 3S9MC 2DE2A 5IM2A 4GOTA 2XXIA 3FJMA 2OBGA 1N3XA 4QRZA 1CB6A 4H46A 4ISUA 4JBZA 4JWYA 4GWOA 1MY3A 4PFTA 2UVIA 4MJOA 2X7QA 4OTEA 1LBWA 4FIMA 1INPA 4MF3A 3K6VA 3RGYA 4O3AA 1MY1A 5CMCA 4PGPA 2M8CA 5L9SA 2ESNA 3EN3A 3C31A 2F7BA 2VPNA 3TCHA 1F9BA 2QS3A 4JB7A 1ELJA 5CM6A 1UQWA 1S9TA 3TTLA 1YAEA 1MQJA 3H06B 1FPFA 4DLDA 5L9MA 1FBPA 1I6QA 1SVXB 4NF0A 4QFOA 4OFOA 5ICQA 3FVNA 4F39A 4XF5A 5KDTA 4PE3A 3N5LA 2AL4A 3KFMA 2DVCA 4HE2A 1MS7A 2AL5A 4NX1A 2P3NA 4H8IA 3T9HB 3T93B 2H25A 1IXHA 3DP6A 3N94A 1FPBA 3IFAA 4KCCA 4U1ZA 1IMDA 4HCYA 5FHOA 5ESYA 3EHUA 4OQOA 3DELB 4QSCA 1SPIA 3T22A 1FTLA 3PPOA 2NWJA 3VLVA 4G8NA 2FYIA 3HHGA 3QUJA 3RPLB 3VV5A 1JNFA 1FTOA 4BDRA 3TCFA 4ESXA 2UYEA 3ISPA 3PPRA 4NF4B 5H8NB 2OWTA 4UABA 2WYPA 4HW8A 3KEIA 3OEMA 1GVCA 4F1VA 2Z8EA 3LUZA 4R73A 4UACA 3MZ9A 1A99A 3TTNA 3G3HA 2R71A 2O6AA 2R8TA 4EQBA 2CZHA 3H6VA 5I2KA 4XKNA 1MXUA 4M4GA 4R9GA 1P1OA 1N0TA 4U22A 3OELA 3U94A 2D3IA 1NFTA 4YKIA 3RQTA 4WEPA 3PMWA 4HE0A 5CC2A 1DK4A 1XT8A 4IB2A 1JW5A 1NV4A 4DCYA 4MEVA 5ET6A 2ZYNA 2OZZA 5EYHA 3O6IA 2O1MA 4OVSA 2REGA 3MZ1A 4PAIA 3KN8A 3O9PA 1RYOA 5AE4A 4PQJA 3FXRA 3GZGA 3SERA 2Z8FA 1BTJA 1SW5A 1VFDA 3LSLA 2G93A 1T0KA 1LEVA 1IMFA 1ZBMA 2PMSA 5EYFA 1JQFA 1FSAA 3E79A 1IXCA 4YB5A 4OEUA 3OXNA 3FV2A 1Y4CA 5I3SA 1FTKA 2ZZVA 4QSDA 4RK9A 5TU0A 3FBPA 3VXCA 1NUWA 5H8NA 3HN0A 4RYAA 4X9TA 3ILTB 1Y3NA 5AA1A 4HXVA 3TYHA 1GTKA 2B4MA 1J1NA 3PUYE 4GWZA 3UA8A 3KN7A 4P9KA 1EU8A 1D9QA 1Y1MA 5ET7A 3CG3A 2DSFA 4AS4A 1H3DA 4FATA 4RJZA 4Z7EA 1IMEA 2Y84A 4WXJA 5I59A 1H76A 3FXUA 4DDDA 3DP8A 4OVJA 3MQ9A 4BDQA 2ZXTA 2F5XA 4R6KA 1B58A 1A8EA 5ET8A 5H8HA 4JWOA 4NE4A 1MQIA 4PP0A 2B3BA 3EF7A 2AIXA 5F1QA 3DLNA 1LFGA 4KXPA 2WYKA 3ZSFA 2F3BA 4YKPA 1DSNA 1IUDA 2FVZA 2I48A 4XXUA 2CZKA 2ALUA 2HZKA 4KD5A 1JEUA 1R6ZA 5ELVA 5DYHA 4FORA 3FD3A 3PV0E 1DBZA 4NF8A 3G7WA 4P8BA 4ND9A 4POXA 4OVRA 1M5DA 2D5WA 4PGNA 2F8DA 2Q89A 3N6TA 3IOUA 3SETA 1KA1A 4DI4B 4LUBA 4AB6A 5H8HB 3JZJA 1FJ9A 3ROJA 3CI8A 1LB8A 1NV3A 1OVTA 4MIJA 1B1HA 4R2FA 1M5EA 2FBPA 2H4IA 2BJIA 2QVUA 3K02A 2NXOA 1NV5A 3LSXA 2HXRA 1RYXA 2Z22A 5LDZA 1D9VA 1SQYA 4GWYA 2UVJA 4PDHA 3OD7A 5IZ3B 2I4BA 2QVVA 4IO7A 5FTHA 1B46A 5DVIA 3LV0A 1VR5A 3T66A 1MDQA 2F7CA 2GQ1A 1DTGA 1B4ZA 4QSEA 4MH5A 4GD5A 4AQ4A 2CZLA 1ZTYA 3U93A 2D21A 3P7IA 3PU5A 3K6UA 4KQPA 3IOVA 4QFNA 5T3JA 1UTHB 1G0HA 4MAGA 1B40A 1XS5A 4KFQA 2QS1A 5JTYA 4G68A 1FBEA 4ELOA 2OCUA 2QS2A 4DXBA 4QFKA 4OXVA 3M3FA 2XXHA 1ATGA 1MQHA 3UP9A 5L8DA 2VD3A 2QRYA 3VVFA 3G3KA 3USDA 3UIFA 2PBWA 1USYH 2ZNSA 4IO6A 1MY4A 5KZTA 1NH7A 4LZ7A 4F22A 1TT1A 3BBRA 4OA4A 2H99A 5FHMA 5AA2B 3K01A 3A09A 1I6AA 2P0SA 1ZMGA 1US4A 3S9NC 1N7WA 4LATA 3GLBA 2DDKA 4NQ8A 3WAFA 1B3LA 1MXZA 2I4CA 3I5OA 3S2VA 1MH4A 1LFIA 2V3QA 1SW4A 4MX6A 3IJXB 5DVJA 3VE1B 3IJOB 3PD9A 2XXUA 3TTMA 1N84A 4GXAA 4C1TA 3ZS6A 3RY3A 2W7YA 4O3CA 2ZNTA 4YMBA 1D9YA 1OLCA 2V3UA 2VHAA 3KJ7A 3QAXA 4IO5A 3HHFA 3LR1A 1NNTA 3MW0A 4ZE9A 4PTKA 5H8QA 2DXYA 1P99A 4IO2A 1B9JA 4R72A 3OO8A 5K2YA 2DWJA 3H7MA 3M3LA 3RYDA 3R7XA 4F3GA 1EYKA 5CMBA 1B7HA 4TLLB 4N6PA 4N15A 4PBQA 1SDXA 2XXRA 4U2RA 3W9VA 2O69A 3K0VA 1AOVA 2DOJA 3MPLA 5CRYA 1G0IA 1MPBA 1WDNA 5I7IA 1FPGA 2ZMBA 3EHTA 3TQWA 4MNPA 1YPNA 1EZOA 1JEVA 4I1DA 3MJNA
chains in the Genus database with same CATH topology
1RDZA 1NV0A 2Y5KA 4I3YA 1KA1A 4MJOA 5EQ8A 4DI4B 4HXVA 1LBXA 2VT5A 2P3VA 4PDDA 4QBAA 4DI3D 4UABA 1IMAA 2B4MA 4LN5A 1LBWA 4GWZA 5DW8A 1INPA 1FBFA 1RDXA 2WYPA 1FJ6A 2XA5A 2ZZWA 3CHGA 4XFEA 3MSTA 3SZPA 4YZZA 1FJ9A 4NAPA 1QGXA 3ROJA 4P9KA 2HHMA 2PFZA 1NV3A 1FBCA 2DDKA 4I3EA 4MIJA 4P56A 4F1VA 3LUZA 2HZLA 1LBYA 2WBDA 5ESYA 4O8MA 1D9QA 1NV7A 4I40A 4NQ8A 4PGPA 1FBGA 4P3LA 1NV1A 2QVUA 2FBPA 1FPIA 2BJIA 2VPNA 2XWKA 4F18A 2R8TA 3KC0A 2CZHA 2KQZA 4IR8A 4N6KA 2V3QA 5ET7A 1NV5A 4O7IA 5J16A 4HCWA 4PF8A 1DCUA 3B8BA 4N8GA 2HXRA 4NN3A 3HFUA 3IFCA 4OVQA 4MX6A 4OVPA 3T1BA 4M1VA 4AS5A 5CM6A 4N6DA 4X8RA 4N17A 5EQAA 2OX3A 5LDZA 1K9YA 4AS4A 2KR0A 4FBPA 1NI9A 1YXIA 1JP4A 4X04A 4O94A 3W9WA 4GWYA 2XWOA 3BIGA 3A29A 1IMEA 3EKIA 4PDHA 2B4LA 1IMCA 4PCDA 2WEFA 4GX4A 4HE1A 4PBHA 4F1UA 5IZ3B 5A5LA 2HPGA 5EYGA 4O7MA 4HE0A 2QVVA 1FPFA 5ET5A 2XXKA 4JVDA 1NUXA 1IMBA 3KBZA 5IZ1A 1DK4A 4P1LA 1FPLA 3LV0A 4PFIA 5IZ3A 1FBPA 1NUZA 1NV4A 3NOHA 1FTAA 4GWWA 4MNCA 4NF0A 3PTYA 4MEVA 4F19A 3BIHA 2GQ1A 4P47A 1VDWA 5ET6A 4GWUA 3FXBA 3GYYA 2FHYA 5EYHA 2XWIA 4XF5A 2F5XA 2PFYA 4PFBA 1FPKA 2DVZA 2Q8MA 4PFRA 4GWSA 1CNQA 4OVSA 2V4CA 2VPOA 4PE3A 5ET8A 4PAFA 4G61A 4N8YA 4PAKA 4PTKA 1FBHA 4HE2A 1EYJA 4MMPA 4PAIA 2CEXA 1K9ZA 5I5PA 2QFLA 4NX1A 2Q9TA 5FBPA 4XEQA 4JVIA 3B50A 2DE4A 2OWZA 1KZ8A 2P3NA 1AWBA 4OANA 4KXPA 5F24A 5T3JA 4N91A 2WYKA 2FIXA 4GX6A 1XI6A 1G0HA 3RYDA 4MAGA 4NGUA 2F3BA 4GWXA 3E78A 1EYKA 1FPBA 1NV6A 3IFAA 1FBEA 5IGAA 1KA0A 4GX3A 2DE3A 5EQ7A 5EQ9A 1FRPA 5LTCA 1IMDA 2FVZA 2L5VA 1FPDA 1LEVA 3KC1A 1IMFA 1LBVA 2ZZXA 4HCYA 4N15A 4PBQA 4QXDA 1YYZA 1LBZA 4GBWA 4N4UA 4NHBA 3W9VA 2CZKA 1FSAA 1FPJA 3D1RA 1SPIA 2HZKA 4MHFA 4NG7A 4PETA 3E79A 3RPLA 3U65A 5J1DA 1BK4A 5JK4A 4H45A 1G0IA 2PCRA 3MYUA 2Q74A 3T0JA 5I7IA 2Y5LA 4GBVA 1FPGA 4OVTA 2DE2A 5IM2A 3RPLB 1RDYA 5I3SA 2ZZVA 2CZIA 4JVCA 1FPEA 1DBZA 2JJKA 1YZ0A 2F3DA 2QVRA 4MCOA 2QPQA 4MNPA 2WBBA 3FBPA 3QMFA 4N81A 2XWVA 2MKZA 1Q9DA 4P8BA 4OVRA 1NUWA 2CEYA 1FBDA 2WX9A 4PGNA 4H46A 1NUYA 1EYIA 1NV2A 4MNIA 4PF6A 4X9TA 2FIEA 3ISPA 4P1EA 5IZZA 4YICA 4OA4A 4PC9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DI4 B;  4PDD A;  4DI3 D;  4UAB A;  4LN5 A;  4XFE A;  2WYP A;  2XA5 A;  2ZZW A;  4YZZ A;  4NAP A;  4P9K A;  2PFZ A;  4MIJ A;  4P56 A;  2HZL A;  4O8M A;  4NQ8 A;  4PGP A;  4P3L A;  2VPN A;  2XWK A;  4N6K A;  4PF8 A;  4N8G A;  4NN3 A;  4OVQ A;  4MX6 A;  4OVP A;  5CM6 A;  4N6D A;  4X8R A;  4N17 A;  4X04 A;  4O94 A;  2XWO A;  4PDH A;  4PCD A;  4PBH A;  2HPG A;  4O7M A;  2XXK A;  4P1L A;  4PFI A;  4MNC A;  4NF0 A;  4MEV A;  4P47 A;  3FXB A;  3GYY A;  2XWI A;  4XF5 A;  2PFY A;  4PFB A;  4PFR A;  4OVS A;  2V4C A;  2VPO A;  4PE3 A;  4PAF A;  4N8Y A;  4PAK A;  4PAI A;  4MMP A;  2CEX A;  5I5P A;  4NX1 A;  4XEQ A;  3B50 A;  4OAN A;  4N91 A;  2WYK A;  4MAG A;  4NGU A;  5IGA A;  5LTC A;  2ZZX A;  4N15 A;  4PBQ A;  4NHB A;  4N4U A;  4MHF A;  4PET A;  2HZK A;  4NG7 A;  3U65 A;  5I7I A;  4OVT A;  5IM2 A;  2ZZV A;  4MCO A;  4MNP A;  4P8B A;  2XWV A;  4OVR A;  2CEY A;  4PGN A;  2WX9 A;  4MNI A;  4PF6 A;  5IZZ A;  4P1E A;  4YIC A;  4OA4 A;  4PC9 A; 
#chains in the Genus database with same CATH topology
 1RDZ A;  3BFU A;  5FTI A;  3VXB A;  4XTC Q;  4QFP A;  2PYY A;  4XFE A;  2ZZW A;  4KPT A;  4GFR A;  5KDT B;  1B6H A;  2Y7W A;  4NWD A;  2RIN A;  2Y7I A;  3IOW A;  1Y4T A;  4RNS A;  1XOC A;  4P3L A;  2V93 A;  3JYR A;  3KC0 A;  2KQZ A;  1WOD A;  4F2O A;  4LZ8 A;  4OVQ A;  3OO6 A;  3W9W A;  2HAV A;  3A29 A;  3EKI A;  2GFE A;  5A5L A;  3Q26 A;  1N76 A;  2HQ0 A;  4QFL A;  5DT6 A;  3S9E A;  5EHS A;  4NF6 B;  1B0H A;  1NNK A;  1FPL A;  3I6V A;  5DEX A;  3IOR A;  4IO3 A;  3B6T A;  3PD8 A;  1B51 A;  2XWI A;  2B3F A;  2QSX A;  2V4C A;  2YLN A;  4NTL A;  5TP9 B;  3B6Q A;  3ODB A;  4ZEI A;  4EUO A;  1O64 A;  4GLI A;  2A5T A;  5I5P A;  1B1X A;  1NNP A;  2DP8 A;  3B50 A;  4OAN A;  1XVY A;  4THI A;  4AB5 A;  4GX6 A;  1B4H A;  2G29 A;  3E78 A;  1DOT A;  3OEN A;  3C32 A;  3H03 A;  3RT8 A;  2YPN A;  1GGG A;  4GVO A;  2VOZ A;  4ECF A;  4POW A;  1PB7 A;  3U65 A;  4QHQ A;  3FZV A;  3RTW B;  2HEU A;  3SEV A;  4NF5 A;  4OEN A;  1B3G A;  1PB8 A;  5B70 A;  1Q9D A;  3EQ1 A;  1LST A;  2DWA A;  2F34 A;  1B05 A;  4YIC A;  3K00 A;  3O97 A;  2Y5K A;  5FHN A;  4MBP A;  1B5I A;  2P3V A;  4TOZ A;  1BP5 A;  3A3U A;  3DP4 A;  5B7D A;  3WAE A;  3FVG A;  4I3E A;  3TCG A;  3ZKL A;  1LBY A;  1TWY A;  3OEK A;  2RCA A;  1AMF A;  2PT2 A;  3O6G A;  3OO9 A;  1DCU A;  4KR5 A;  4NN3 A;  1NI9 A;  1YXI A;  3D4G A;  3O66 A;  3MP1 A;  3FIR A;  2HPG A;  4O7M A;  5DEX B;  3TKD A;  1LLS A;  1QKA A;  1IMB A;  2Q88 A;  4L17 A;  1PB9 A;  1M5B A;  2I58 A;  4P47 A;  2FHY A;  3U8Q A;  2PFY A;  1FPK A;  2A5T B;  1FCK A;  4N8Y A;  1P1N A;  3KOT A;  1OLA A;  2ONK E;  3S4U A;  2THI A;  4FJP A;  3V5A A;  1A40 A;  1EH3 A;  2XD2 A;  4R75 A;  1B5J A;  1A7L A;  3SEY A;  5IGA A;  1KA0 A;  3C36 A;  4LON B;  3MP6 A;  4IGT A;  2H9B A;  3C9H A;  4N4U A;  5AA3 A;  3KGC A;  2NVU B;  1JVX A;  2QJE A;  1UIV A;  2X7P A;  4OFJ A;  2UXA A;  1LCF A;  2DS9 A;  1NH8 A;  1NV2 A;  1B52 A;  1SD3 A;  5IZZ A;  3PUZ E;  4G8H A;  2PVU A;  2I3V A;  2E0S A;  1FQB A;  2VT5 A;  1B2H A;  4MLQ A;  3C34 A;  4OHN A;  5DW8 A;  5H8S A;  3T96 B;  2IEE A;  1MXW A;  3K1M A;  5IAI A;  4KCD A;  4GQO A;  4O8M A;  5HBC A;  4OWD A;  3HPI A;  2ZYM A;  3CRB A;  5J16 A;  1I69 A;  4PF8 A;  1B7U A;  5EQA A;  2Y7K A;  1TXF A;  2Q2A A;  3E4R A;  3IX1 A;  4PCD A;  4PBH A;  1ANF A;  1N04 A;  5ET5 A;  1POY 1;  3MVX A;  3OSR A;  1D3K A;  1MXX A;  3JV9 A;  2R9J A;  4GIZ A;  4GWU A;  1VFE A;  4GL8 A;  4PFB A;  2GH9 A;  3FJ7 A;  4R2B A;  2ZYO A;  4IY6 A;  1MPD A;  1EYJ A;  1UTB B;  5AA4 B;  5FBP A;  2DE4 A;  1OVB A;  4OMB A;  4ZZA A;  4F31 B;  1MXV A;  5EQ9 A;  3C33 A;  1FRP A;  3E13 X;  3QUF A;  2QL3 A;  4EQ9 A;  1YYZ A;  1Q35 A;  4ZEF A;  4Q30 B;  4IO4 A;  1SW2 A;  3H6U A;  3RNN A;  3MYU A;  1LFH A;  1LAH E;  4KYD A;  1Y9U A;  3TEP A;  3RTF B;  3BFT A;  3PMV A;  1JW4 A;  1EYI A;  4R6Y A;  3O28 A;  5TPA B;  3TEL A;  4DI3 D;  1HSJ A;  1N3W A;  1FBF A;  1MPC A;  1RDX A;  3CIJ A;  1BIY A;  4ZS9 A;  2PFZ A;  3K1P A;  1IXG A;  4KI0 E;  4KYE A;  5LOM A;  2A5S A;  2HZL A;  3IB2 A;  1FBG A;  2V25 A;  1UTH A;  4HCW A;  3PMX A;  4F1Y A;  5HPQ A;  3OO7 A;  4X04 A;  1VE4 A;  2XWO A;  3TOD A;  1H43 A;  1N7X A;  4OEV A;  4GX4 A;  3CSB A;  3D4C A;  1PBQ A;  1IZ1 A;  2XXK A;  3HST A;  3V8X B;  2RC9 A;  3HV1 A;  1NUZ A;  1QUL A;  4GL0 A;  1NMU A;  3C4M A;  4FE8 A;  3G3I A;  1YTV A;  3CSG A;  3N6U A;  4NWC A;  3VVD A;  4MMP A;  3O2A A;  2E1S A;  1K9Z A;  3QSL A;  4RK2 A;  4R6H A;  3CFZ A;  4U21 A;  1NV6 A;  4C0R A;  2V84 A;  1SYI A;  2HXW A;  2DE3 A;  3C35 A;  1FPD A;  4F19 A;  2XXX A;  1FPJ A;  4G77 A;  1B5H A;  4ESW A;  4DCX A;  3GXA A;  2Y5L A;  1GR2 A;  1FPE A;  5CBS A;  4X48 A;  1PDA A;  3FGS A;  2MKZ A;  2F7A A;  4NF5 B;  1Y1Z A;  1ZJL A;  5BWJ A;  1NUY A;  2WKY A;  5KCJ B;  3K6X A;  4Z0I A;  4PDD A;  4LP2 B;  3N26 A;  3ONM A;  3SZP A;  4XKQ A;  5A5X B;  1SYH A;  1USY E;  1P1U A;  4Q0C A;  4BDN A;  1Y3P A;  1QW0 A;  4XIG Q;  3Q27 A;  3M8U A;  4N8G A;  4E0W A;  5AA2 D;  3HFU A;  3KZG A;  2DQV A;  4N6D A;  5M2V A;  1R1N A;  4RA1 A;  4JWX A;  5H8F B;  4YU0 A;  3RUM A;  4ELR A;  4JVD A;  3SEW A;  1MQG A;  3H6T A;  4MNC A;  1NKX A;  3V89 B;  1QVS A;  1ZU0 A;  4XKR A;  4YKJ A;  1QUI A;  1MG1 A;  2IA4 A;  2XXQ A;  4PFR A;  4H65 A;  2VPO A;  3QIM A;  1MH3 A;  5I58 A;  1FBH A;  4F29 A;  2B65 A;  3LSF B;  4H6D A;  2DXR A;  4ZEB A;  1TFA A;  2OWZ A;  4YAH X;  3KSJ A;  3MZB A;  2FIX A;  2NOO A;  3FAT A;  3U92 A;  3IR1 A;  3SDF A;  2QMX A;  4NGU A;  4YB6 A;  4OES A;  1OIB A;  3U1O A;  1D4N A;  5EQ7 A;  1B3H A;  4GBW A;  3G3J A;  5L9O A;  5JK4 A;  3FV1 A;  1A8F A;  3KN3 A;  3CVG A;  1OQG A;  2F3D A;  3PGF A;  3QXM A;  4N07 A;  3QMF A;  3PUV E;  3VLW A;  1AL3 A;  1II5 A;  4PF6 A;  5BUU A;  4NED A;  2R6G E;  3IL1 B;  4LN5 A;  4H1X A;  3CHG A;  4X1B A;  5TP9 A;  3LUY A;  4H5G A;  1B32 A;  4QF9 A;  1MRP A;  2Z23 A;  5I2K B;  4I40 A;  1FPI A;  3MVY A;  4ZDM A;  4ELP A;  1DPE A;  4N17 A;  1K9Y A;  1EZP A;  1IXI A;  3G3F A;  2LAO A;  5EYG A;  1FTJ A;  4MFI A;  2XHD A;  1RKM A;  1NUX A;  1LBC A;  5IZ1 A;  2XX8 A;  3FUZ A;  1FTA A;  1Y3Q A;  3PTY A;  3K2D A;  3F11 A;  3GYY A;  2H5Y A;  2O84 X;  4GWS A;  3E9X A;  3UK4 A;  4DZ1 A;  5I57 B;  5CMM A;  3CG1 A;  3HO7 A;  3Q25 A;  4HS7 A;  4R9F A;  4RXL A;  2VD2 A;  2P1S A;  1IQ7 A;  3PUW E;  1R9L A;  4KHZ E;  3RPW A;  4Q5T A;  4EF2 A;  3B6W A;  5I2N A;  3MC2 A;  2L5V A;  5DTB A;  3TDJ A;  4FEB A;  1SBP A;  1URS A;  4I9D A;  2XXV A;  1FQE A;  3OOA A;  3TTR A;  2PX1 A;  5ISU A;  3TQL A;  4N81 A;  2XWV A;  3IB0 A;  1FBD A;  4RY1 A;  4U1O A;  3CFL A;  1LGB C;  1UTB A;  1LBX A;  1MM6 A;  3T9V A;  2H98 A;  4OET A;  3TZA A;  2RF1 A;  2XA5 A;  5AA2 A;  3VFJ A;  5TPA A;  4RPN A;  5JTY B;  1FBC A;  3G3G A;  4WKM A;  1MXY A;  4H8J A;  2XXP A;  4DIG A;  5I56 B;  2REJ A;  1DPP A;  1SI1 A;  2OX3 A;  2KR0 A;  3VLU A;  3VVE A;  4KYS A;  3ILU B;  4GRK A;  4P1L A;  1XHY A;  4BLA A;  3NOH A;  4F2Q A;  2OJT A;  4H0W A;  2GHB A;  3FXB A;  3L6H A;  1M5F A;  4EXL A;  1A54 A;  2X26 A;  4G2Z A;  2ZNU A;  4U4X A;  1CNQ A;  1POT A;  3IAZ A;  1JET A;  1QUK A;  4PFY A;  5I84 A;  3ECR A;  2HAU A;  2O7I A;  5HM4 B;  3KG2 A;  3QK6 A;  4DE8 A;  2Y7R A;  1NNF A;  5JEI A;  4U4S A;  4GX3 A;  3I3V A;  2F78 A;  1FQF A;  5EHM A;  2XX9 A;  3KBR A;  1LBZ A;  3TAJ A;  4PET A;  5I56 A;  1O7T A;  2OK2 A;  4EXK A;  2XXW A;  4P11 A;  1BK4 A;  4H45 A;  2UVH A;  3GBA A;  1FQD A;  4TQU Q;  3MWB A;  4X1D A;  4IY5 A;  2QPQ A;  1SI0 A;  3IOT A;  2ANJ A;  2ABH A;  3RN8 A;  4GF8 A;  4ONY A;  3U72 A;  5ICT A;  4P1E A;  3IB1 A;  4I3Y A;  5EQ8 A;  4YB7 A;  1HSL A;  4NF4 A;  1P1W A;  3IK6 B;  1IMA A;  1FQC A;  5KCJ A;  3FVK A;  4LQ5 A;  4PFW A;  3SES A;  2OLB A;  1PC3 A;  2HHM A;  5AA4 A;  5K2X A;  3TUS A;  3UN6 A;  3AXF A;  2XWK A;  3B7D A;  1IIT A;  2UVG A;  2V3T A;  1IIW A;  4O7I A;  3B8B A;  4G68 B;  3IFC A;  2DYX A;  2XD3 A;  3W15 C;  1QKB A;  1MY0 A;  4LA9 A;  1JP4 A;  1MQD A;  1H45 A;  4YMA A;  4O3B A;  3MP8 A;  1QUJ A;  2I0C A;  3MVW A;  5CMK A;  2O7U A;  1R9Q A;  4PFU A;  4NF6 A;  3BIH A;  1VDW A;  3M3K A;  1L5T A;  1FTM A;  4IGR A;  1P1Q A;  3RLF E;  3VDF A;  1FW0 A;  2CEX A;  3PPP A;  1Z7N E;  1Q1K A;  5I58 B;  4N91 A;  1XI6 A;  3ZKK A;  1MDP 1;  3DM0 A;  4JSO A;  1OMP A;  4ZEC A;  3TTK A;  5LTC A;  4QXD A;  4GXS B;  1JW1 A;  5H8F A;  4TLM B;  2FNC A;  4JXI A;  1B3F A;  2CZI A;  2QVR A;  1XC1 A;  3K1N A;  4Q8R A;  3KSX A;  2CEY A;  2F35 A;  3Q29 A;  4ZZE A;  1LCT A;  2FIE A;  1LAG E;  3O6H A;  3MVZ A;  4BDO A;  4UA8 A;  3SKP A;  1QGX A;  3FJG A;  2F97 A;  4I8C A;  4JSD A;  1DTZ A;  1XVX A;  2F6G A;  4IR8 A;  4N6K A;  3BKI B;  4M1V A;  4X8R A;  1AH5 A;  4FBP A;  3FXQ A;  1BLF A;  3BIG A;  4HTG A;  1IMC A;  4N13 A;  1LB9 A;  4EDP A;  3PPQ A;  5CI5 A;  4RPO A;  3KBZ A;  3MPK A;  2RC7 A;  3IO4 A;  4PE5 B;  2QMW A;  4NMY A;  4U23 A;  4C1U A;  1S50 A;  4JDF A;  3TFL A;  4XKP A;  1GV8 A;  1QJM A;  4G61 A;  2O68 A;  2CMO A;  2YJP A;  5F24 A;  4WED A;  1KZ8 A;  4MLV A;  5A5X A;  3LC8 A;  3THI A;  3OSQ A;  2HFB A;  1SW1 A;  1IEJ A;  3MAM A;  3KC1 A;  1M5C A;  1KWH A;  2XXY A;  2O51 A;  3RPL A;  4NG7 A;  5J1D A;  5DVF A;  1ZLQ A;  2PCR A;  2Q74 A;  3EHS A;  4ZED A;  5I59 B;  1CE2 A;  1OQH A;  4R74 A;  2XXT A;  4JVC A;  4ZE8 A;  4I62 A;  4LVQ A;  1YZ0 A;  4MCO A;  2GRV A;  3O29 A;  3FVO A;  2I0B A;  2P2A A;  3UGW A;  3CR9 A;  2WX9 A;  4G68 C;  4MNI A;  3RT6 B;  4QBA A;  1S7Y A;  3R26 A;  1ZKB A;  4E0X A;  2RCB A;  1FJ6 A;  2VGQ A;  3OMB A;  4YZZ A;  2RKM A;  4NAP A;  2ZYK A;  2Z8D A;  4F3B A;  2WBD A;  1NV7 A;  5ITP A;  2NUV A;  5F7V A;  3MUQ A;  1TFD A;  2OWS A;  2Q8J A;  2KLF A;  1US5 A;  3TPA A;  3HCQ A;  3T1B A;  2RC8 A;  4YKK A;  2AYS A;  1H44 A;  4NF8 B;  4HE1 A;  3CFX A;  2VP1 A;  1B7Z A;  3H4Z A;  3Q28 A;  5IZ3 A;  1EZ9 A;  4OER A;  4PFI A;  4BDM A;  2I6E A;  4ELQ A;  3T9X B;  1LAX A;  3SEU A;  2Q8M A;  4DXC A;  4PAF A;  2I3W A;  4PAK A;  4DXU A;  1AIV A;  1Z7M E;  1URD A;  4K3F A;  4OFL A;  4XEQ A;  1LAF E;  3KOS A;  1YCJ A;  1AWB A;  2BJJ X;  2QS4 A;  1WVJ A;  1PBP A;  3TMG A;  2FA7 A;  4GWX A;  3PPN A;  2GHA A;  2PT1 A;  3LSW A;  5CBR A;  3R6U A;  3GBB A;  4LQ2 A;  1ZIU A;  3A3C A;  4MHF A;  1Y20 A;  3K6W A;  3H6W A;  3SEX A;  4GBV A;  3S9L C;  3EPE A;  4OVT A;  4P0G A;  2I49 A;  1RDY A;  2O1L A;  1FQA A;  2JJK A;  1B3E A;  2WBB A;  4BDL A;  2F6P A;  3E3K A;  4OYV A;  3QYT A;  4F3S A;  4EF1 A;  4PC9 A;  1NV0 A;  4H5F A;  4G8M A;  4EQ7 A;  3KJT A;  3T9U A;  4FEC A;  1A55 A;  2XX7 A;  1JVY A;  1DMB A;  2ONR A;  3MST A;  4P0I A;  4ZEK A;  4P56 A;  3V83 A;  1NV1 A;  4F18 A;  3IO6 A;  2Q2C A;  3UOR A;  1VSO A;  4AS5 A;  4OZ9 A;  4OVP A;  5ITO A;  3PUX E;  3K4U A;  5I2N B;  3FAS A;  4O94 A;  2B4L A;  2WEF A;  4F1U A;  1LBB A;  4FAJ A;  2F36 A;  3L6G A;  2DWI A;  2Y7P A;  3MBP A;  4F3P A;  1MY2 A;  4GWW A;  2DWH A;  3LBS A;  2UYF A;  1URG A;  5I57 A;  2DVZ A;  2ONS A;  1NL5 A;  4H67 A;  2HCA A;  2QFL A;  2Q9T A;  4JVI A;  4FED A;  5H8Q B;  1UIU A;  1B0L A;  1MM7 A;  3H3G A;  4G4P A;  1PEB A;  1I6B A;  1LBV A;  2ZZX A;  1BKA A;  4NHB A;  3D1R A;  1O63 A;  1HSE A;  4LZ5 A;  3T0J A;  5IKB A;  3S9M C;  2DE2 A;  5IM2 A;  4GOT A;  2XXI A;  3FJM A;  2OBG A;  1N3X A;  4QRZ A;  1CB6 A;  4H46 A;  4ISU A;  4JBZ A;  4JWY A;  4GWO A;  1MY3 A;  4PFT A;  2UVI A;  4MJO A;  2X7Q A;  4OTE A;  1LBW A;  4FIM A;  1INP A;  4MF3 A;  3K6V A;  3RGY A;  4O3A A;  1MY1 A;  5CMC A;  4PGP A;  2M8C A;  5L9S A;  2ESN A;  3EN3 A;  3C31 A;  2F7B A;  2VPN A;  3TCH A;  1F9B A;  2QS3 A;  4JB7 A;  1ELJ A;  5CM6 A;  1UQW A;  1S9T A;  3TTL A;  1YAE A;  1MQJ A;  3H06 B;  1FPF A;  4DLD A;  5L9M A;  1FBP A;  1I6Q A;  1SVX B;  4NF0 A;  4QFO A;  4OFO A;  5ICQ A;  3FVN A;  4F39 A;  4XF5 A;  5KDT A;  4PE3 A;  3N5L A;  2AL4 A;  3KFM A;  2DVC A;  4HE2 A;  1MS7 A;  2AL5 A;  4NX1 A;  2P3N A;  4H8I A;  3T9H B;  3T93 B;  2H25 A;  1IXH A;  3DP6 A;  3N94 A;  1FPB A;  3IFA A;  4KCC A;  4U1Z A;  1IMD A;  4HCY A;  5FHO A;  5ESY A;  3EHU A;  4OQO A;  3DEL B;  4QSC A;  1SPI A;  3T22 A;  1FTL A;  3PPO A;  2NWJ A;  3VLV A;  4G8N A;  2FYI A;  3HHG A;  3QUJ A;  3RPL B;  3VV5 A;  1JNF A;  1FTO A;  4BDR A;  3TCF A;  4ESX A;  2UYE A;  3ISP A;  3PPR A;  4NF4 B;  5H8N B;  2OWT A;  4UAB A;  2WYP A;  4HW8 A;  3KEI A;  3OEM A;  1GVC A;  4F1V A;  2Z8E A;  3LUZ A;  4R73 A;  4UAC A;  3MZ9 A;  1A99 A;  3TTN A;  3G3H A;  2R71 A;  2O6A A;  2R8T A;  4EQB A;  2CZH A;  3H6V A;  5I2K A;  4XKN A;  1MXU A;  4M4G A;  4R9G A;  1P1O A;  1N0T A;  4U22 A;  3OEL A;  3U94 A;  2D3I A;  1NFT A;  4YKI A;  3RQT A;  4WEP A;  3PMW A;  4HE0 A;  5CC2 A;  1DK4 A;  1XT8 A;  4IB2 A;  1JW5 A;  1NV4 A;  4DCY A;  4MEV A;  5ET6 A;  2ZYN A;  2OZZ A;  5EYH A;  3O6I A;  2O1M A;  4OVS A;  2REG A;  3MZ1 A;  4PAI A;  3KN8 A;  3O9P A;  1RYO A;  5AE4 A;  4PQJ A;  3FXR A;  3GZG A;  3SER A;  2Z8F A;  1BTJ A;  1SW5 A;  1VFD A;  3LSL A;  2G93 A;  1T0K A;  1LEV A;  1IMF A;  1ZBM A;  2PMS A;  5EYF A;  1JQF A;  1FSA A;  3E79 A;  1IXC A;  4YB5 A;  4OEU A;  3OXN A;  3FV2 A;  1Y4C A;  5I3S A;  1FTK A;  2ZZV A;  4QSD A;  4RK9 A;  5TU0 A;  3FBP A;  3VXC A;  1NUW A;  5H8N A;  3HN0 A;  4RYA A;  4X9T A;  3ILT B;  1Y3N A;  5AA1 A;  4HXV A;  3TYH A;  1GTK A;  2B4M A;  1J1N A;  3PUY E;  4GWZ A;  3UA8 A;  3KN7 A;  4P9K A;  1EU8 A;  1D9Q A;  1Y1M A;  5ET7 A;  3CG3 A;  2DSF A;  4AS4 A;  1H3D A;  4FAT A;  4RJZ A;  4Z7E A;  1IME A;  2Y84 A;  4WXJ A;  5I59 A;  1H76 A;  3FXU A;  4DDD A;  3DP8 A;  4OVJ A;  3MQ9 A;  4BDQ A;  2ZXT A;  2F5X A;  4R6K A;  1B58 A;  1A8E A;  5ET8 A;  5H8H A;  4JWO A;  4NE4 A;  1MQI A;  4PP0 A;  2B3B A;  3EF7 A;  2AIX A;  5F1Q A;  3DLN A;  1LFG A;  4KXP A;  2WYK A;  3ZSF A;  2F3B A;  4YKP A;  1DSN A;  1IUD A;  2FVZ A;  2I48 A;  4XXU A;  2CZK A;  2ALU A;  2HZK A;  4KD5 A;  1JEU A;  1R6Z A;  5ELV A;  5DYH A;  4FOR A;  3FD3 A;  3PV0 E;  1DBZ A;  4NF8 A;  3G7W A;  4P8B A;  4ND9 A;  4POX A;  4OVR A;  1M5D A;  2D5W A;  4PGN A;  2F8D A;  2Q89 A;  3N6T A;  3IOU A;  3SET A;  1KA1 A;  4DI4 B;  4LUB A;  4AB6 A;  5H8H B;  3JZJ A;  1FJ9 A;  3ROJ A;  3CI8 A;  1LB8 A;  1NV3 A;  1OVT A;  4MIJ A;  1B1H A;  4R2F A;  1M5E A;  2FBP A;  2H4I A;  2BJI A;  2QVU A;  3K02 A;  2NXO A;  1NV5 A;  3LSX A;  2HXR A;  1RYX A;  2Z22 A;  5LDZ A;  1D9V A;  1SQY A;  4GWY A;  2UVJ A;  4PDH A;  3OD7 A;  5IZ3 B;  2I4B A;  2QVV A;  4IO7 A;  5FTH A;  1B46 A;  5DVI A;  3LV0 A;  1VR5 A;  3T66 A;  1MDQ A;  2F7C A;  2GQ1 A;  1DTG A;  1B4Z A;  4QSE A;  4MH5 A;  4GD5 A;  4AQ4 A;  2CZL A;  1ZTY A;  3U93 A;  2D21 A;  3P7I A;  3PU5 A;  3K6U A;  4KQP A;  3IOV A;  4QFN A;  5T3J A;  1UTH B;  1G0H A;  4MAG A;  1B40 A;  1XS5 A;  4KFQ A;  2QS1 A;  5JTY A;  4G68 A;  1FBE A;  4ELO A;  2OCU A;  2QS2 A;  4DXB A;  4QFK A;  4OXV A;  3M3F A;  2XXH A;  1ATG A;  1MQH A;  3UP9 A;  5L8D A;  2VD3 A;  2QRY A;  3VVF A;  3G3K A;  3USD A;  3UIF A;  2PBW A;  1USY H;  2ZNS A;  4IO6 A;  1MY4 A;  5KZT A;  1NH7 A;  4LZ7 A;  4F22 A;  1TT1 A;  3BBR A;  4OA4 A;  2H99 A;  5FHM A;  5AA2 B;  3K01 A;  3A09 A;  1I6A A;  2P0S A;  1ZMG A;  1US4 A;  3S9N C;  1N7W A;  4LAT A;  3GLB A;  2DDK A;  4NQ8 A;  3WAF A;  1B3L A;  1MXZ A;  2I4C A;  3I5O A;  3S2V A;  1MH4 A;  1LFI A;  2V3Q A;  1SW4 A;  4MX6 A;  3IJX B;  5DVJ A;  3VE1 B;  3IJO B;  3PD9 A;  2XXU A;  3TTM A;  1N84 A;  4GXA A;  4C1T A;  3ZS6 A;  3RY3 A;  2W7Y A;  4O3C A;  2ZNT A;  4YMB A;  1D9Y A;  1OLC A;  2V3U A;  2VHA A;  3KJ7 A;  3QAX A;  4IO5 A;  3HHF A;  3LR1 A;  1NNT A;  3MW0 A;  4ZE9 A;  4PTK A;  5H8Q A;  2DXY A;  1P99 A;  4IO2 A;  1B9J A;  4R72 A;  3OO8 A;  5K2Y A;  2DWJ A;  3H7M A;  3M3L A;  3RYD A;  3R7X A;  4F3G A;  1EYK A;  5CMB A;  1B7H A;  4TLL B;  4N6P A;  4N15 A;  4PBQ A;  1SDX A;  2XXR A;  4U2R A;  3W9V A;  2O69 A;  3K0V A;  1AOV A;  2DOJ A;  3MPL A;  5CRY A;  1G0I A;  1MPB A;  1WDN A;  5I7I A;  1FPG A;  2ZMB A;  3EHT A;  3TQW A;  4MNP A;  1YPN A;  1EZO A;  1JEV A;  4I1D A;  3MJN A; 
#chains in the Genus database with same CATH homology
 1RDZ A;  1NV0 A;  2Y5K A;  4I3Y A;  1KA1 A;  4MJO A;  5EQ8 A;  4DI4 B;  4HXV A;  1LBX A;  2VT5 A;  2P3V A;  4PDD A;  4QBA A;  4DI3 D;  4UAB A;  1IMA A;  2B4M A;  4LN5 A;  1LBW A;  4GWZ A;  5DW8 A;  1INP A;  1FBF A;  1RDX A;  2WYP A;  1FJ6 A;  2XA5 A;  2ZZW A;  3CHG A;  4XFE A;  3MST A;  3SZP A;  4YZZ A;  1FJ9 A;  4NAP A;  1QGX A;  3ROJ A;  4P9K A;  2HHM A;  2PFZ A;  1NV3 A;  1FBC A;  2DDK A;  4I3E A;  4MIJ A;  4P56 A;  4F1V A;  3LUZ A;  2HZL A;  1LBY A;  2WBD A;  5ESY A;  4O8M A;  1D9Q A;  1NV7 A;  4I40 A;  4NQ8 A;  4PGP A;  1FBG A;  4P3L A;  1NV1 A;  2QVU A;  2FBP A;  1FPI A;  2BJI A;  2VPN A;  2XWK A;  4F18 A;  2R8T A;  3KC0 A;  2CZH A;  2KQZ A;  4IR8 A;  4N6K A;  2V3Q A;  5ET7 A;  1NV5 A;  4O7I A;  5J16 A;  4HCW A;  4PF8 A;  1DCU A;  3B8B A;  4N8G A;  2HXR A;  4NN3 A;  3HFU A;  3IFC A;  4OVQ A;  4MX6 A;  4OVP A;  3T1B A;  4M1V A;  4AS5 A;  5CM6 A;  4N6D A;  4X8R A;  4N17 A;  5EQA A;  2OX3 A;  5LDZ A;  1K9Y A;  4AS4 A;  2KR0 A;  4FBP A;  1NI9 A;  1YXI A;  1JP4 A;  4X04 A;  4O94 A;  3W9W A;  4GWY A;  2XWO A;  3BIG A;  3A29 A;  1IME A;  3EKI A;  4PDH A;  2B4L A;  1IMC A;  4PCD A;  2WEF A;  4GX4 A;  4HE1 A;  4PBH A;  4F1U A;  5IZ3 B;  5A5L A;  2HPG A;  5EYG A;  4O7M A;  4HE0 A;  2QVV A;  1FPF A;  5ET5 A;  2XXK A;  4JVD A;  1NUX A;  1IMB A;  3KBZ A;  5IZ1 A;  1DK4 A;  4P1L A;  1FPL A;  3LV0 A;  4PFI A;  5IZ3 A;  1FBP A;  1NUZ A;  1NV4 A;  3NOH A;  1FTA A;  4GWW A;  4MNC A;  4NF0 A;  3PTY A;  4MEV A;  4F19 A;  3BIH A;  2GQ1 A;  4P47 A;  1VDW A;  5ET6 A;  4GWU A;  3FXB A;  3GYY A;  2FHY A;  5EYH A;  2XWI A;  4XF5 A;  2F5X A;  2PFY A;  4PFB A;  1FPK A;  2DVZ A;  2Q8M A;  4PFR A;  4GWS A;  1CNQ A;  4OVS A;  2V4C A;  2VPO A;  4PE3 A;  5ET8 A;  4PAF A;  4G61 A;  4N8Y A;  4PAK A;  4PTK A;  1FBH A;  4HE2 A;  1EYJ A;  4MMP A;  4PAI A;  2CEX A;  1K9Z A;  5I5P A;  2QFL A;  4NX1 A;  2Q9T A;  5FBP A;  4XEQ A;  4JVI A;  3B50 A;  2DE4 A;  2OWZ A;  1KZ8 A;  2P3N A;  1AWB A;  4OAN A;  4KXP A;  5F24 A;  5T3J A;  4N91 A;  2WYK A;  2FIX A;  4GX6 A;  1XI6 A;  1G0H A;  3RYD A;  4MAG A;  4NGU A;  2F3B A;  4GWX A;  3E78 A;  1EYK A;  1FPB A;  1NV6 A;  3IFA A;  1FBE A;  5IGA A;  1KA0 A;  4GX3 A;  2DE3 A;  5EQ7 A;  5EQ9 A;  1FRP A;  5LTC A;  1IMD A;  2FVZ A;  2L5V A;  1FPD A;  1LEV A;  3KC1 A;  1IMF A;  1LBV A;  2ZZX A;  4HCY A;  4N15 A;  4PBQ A;  4QXD A;  1YYZ A;  1LBZ A;  4GBW A;  4N4U A;  4NHB A;  3W9V A;  2CZK A;  1FSA A;  1FPJ A;  3D1R A;  1SPI A;  2HZK A;  4MHF A;  4NG7 A;  4PET A;  3E79 A;  3RPL A;  3U65 A;  5J1D A;  1BK4 A;  5JK4 A;  4H45 A;  1G0I A;  2PCR A;  3MYU A;  2Q74 A;  3T0J A;  5I7I A;  2Y5L A;  4GBV A;  1FPG A;  4OVT A;  2DE2 A;  5IM2 A;  3RPL B;  1RDY A;  5I3S A;  2ZZV A;  2CZI A;  4JVC A;  1FPE A;  1DBZ A;  2JJK A;  1YZ0 A;  2F3D A;  2QVR A;  4MCO A;  2QPQ A;  4MNP A;  2WBB A;  3FBP A;  3QMF A;  4N81 A;  2XWV A;  2MKZ A;  1Q9D A;  4P8B A;  4OVR A;  1NUW A;  2CEY A;  1FBD A;  2WX9 A;  4PGN A;  4H46 A;  1NUY A;  1EYI A;  1NV2 A;  4MNI A;  4PF6 A;  4X9T A;  2FIE A;  3ISP A;  4P1E A;  5IZZ A;  4YIC A;  4OA4 A;  4PC9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...