4MHFA

Crystal structure of a trap periplasmic solute binding protein from polaromonas sp. js666 (bpro_3107), target efi-510173, with bound alpha/beta d-glucuronate, space group p21
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
301
structure length
301
Chain Sequence
TEFRSADTHNADDYPTVAAVKYMGELLEKKSGGKHKIKVFNKQALGSEKETIDQVKIGALDFTRVNVGPMNAICPLTQVPTMPFLFSSIAHMRKSLDGPVGDEILKSCESAGFIGLAFYDSGARSIYAKKPIRTVADAKGLKIRVQQSDLWVALVSAMGANATPMPYGEVYTGLKTGLIDAAENNIPSFDTAKHVEAVKVYSKTEHSMAPEILVMSKIIYDKLPKAEQDMIRAAAKESVAFERQKWDEQEAKSLANVKAAGAEIVEVDKKSFQAVMGPVYDKFMTTPDMKRLVKAVQDTKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords TRAP dicarboxylate transporter, DctP subunit
publication title Experimental strategies for functional annotation and metabolism discovery: targeted screening of solute binding proteins and unbiased panning of metabolomes.
pubmed doi rcsb
source organism Polaromonas
total genus 113
structure length 301
sequence length 301
ec nomenclature
pdb deposition date 2013-08-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03480 DctP Bacterial extracellular solute-binding protein, family 7
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.170 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 D-Maltodextrin-Binding Protein; domain 2 4mhfA00
2XWVA 4MHFA 2WYPA 4XFEA 4DI4B 4N8YA 2HPGA 4N8GA 4OVPA 4OANA 4PC9A 4OVTA 4PAFA 4MIJA 4DI3D 4MMPA 3U65A 4MNCA 4PDDA 4NQ8A 4O94A 4PF6A 4OA4A 5I5PA 4NN3A 2XWIA 4MX6A 4N91A 4P3LA 2WYKA 5IGAA 2XWKA 2ZZVA 4X04A 2CEXA 4X8RA 4PGNA 4PE3A 4MEVA 4NHBA 4PBHA 4N17A 4OVSA 2V4CA 4PBQA 4PFBA 4MAGA 4P9KA 4UABA 4PDHA 4N6DA 4MNIA 4O8MA 2PFZA 2VPOA 3B50A 4N6KA 5LTCA 4XEQA 4PFRA 4P8BA 2VPNA 2ZZXA 4N15A 4MNPA 4PETA 4YZZA 2WX9A 4P47A 2HZLA 4PAIA 4P1EA 2XWOA 4PAKA 5IM2A 4NG7A 4XF5A 4P56A 4OVQA 2CEYA 2HZKA 4PF8A 2ZZWA 3GYYA 4NGUA 4O7MA 4MCOA 4PGPA 5CM6A 4PFIA 4NF0A 4PCDA 5I7IA 3FXBA 4NX1A 4OVRA 4P1LA 4YICA 4LN5A 5IZZA 2XXKA 2XA5A 2PFYA 4NAPA 4N4UA
chains in the Genus database with same CATH superfamily
4I8CA 5DEXA 1B7HA 4MJOA 2X26A 4N8YA 5ET6A 1IXGA 2FIXA 3KN7A 1LLSA 2B4MA 1ZU0A 3RPWA 2AIXA 3B8BA 5IGAA 5L9MA 1YCJA 3SEXA 4HE0A 3A09A 5I2NA 3BFTA 4PGNA 2QS4A 5FTIA 3FV2A 3KJ7A 3VLWA 1BK4A 1FBPA 1MPDA 3FATA 5AA3A 4AS4A 3I3VA 4IO4A 3RNNA 4Q8RA 3RLFE 5KDTA 3K6XA 5BUUA 3F11A 1US4A 2O84X 2Z8EA 1SVXB 4ISUA 3IX1A 3L6GA 2XX9A 2F34A 3SEUA 4TQUQ 1MXXA 3TEPA 1NV7A 4HE2A 4XF5A 3CHGA 4GRKA 4ELRA 2ZZWA 5K2XA 3FXQA 2PVUA 3TELA 1I6QA 5AA2D 2F3DA 1MY1A 2R8TA 1FCKA 4F1UA 3T9VA 1S9TA 4XKPA 3O97A 3CFXA 4HCYA 4XKRA 4DXUA 4NF4B 4ZZEA 3Q26A 1JVYA 1BP5A 3HN0A 4GX3A 5I57B 1JQFA 5M2VA 5I58A 1B0HA 3G3IA 2FIEA 3C32A 1L5TA 5F7VA 5AA1A 1FTOA 1PBQA 4I40A 4OFOA 3ILTB 2OWTA 4O7IA 1FPKA 1MY4A 5JK4A 5J16A 3O6HA 2GRVA 4X8RA 1AMFA 4RXLA 1PDAA 4KFQA 4PBHA 2H98A 3DM0A 1K9YA 4OVSA 5I56B 1XS5A 3ECRA 4G2ZA 3KZGA 1FQEA 3FV1A 1NNPA 1NNKA 3RPLA 2NUVA 3ZS6A 2R9JA 4ONYA 5KCJB 4QFNA 2D5WA 2Z8FA 3SKPA 3IOVA 1GVCA 3VLUA 4P0GA 1H3DA 1NH7A 4GD5A 4AB5A 2B65A 4GIZA 4AQ4A 2DS9A 4QHQA 1B3HA 3M8UA 2OLBA 3K2DA 4QBAA 3TTKA 4OVQA 1SW1A 3PPQA 4GQOA 4NGUA 4Z0IA 4DE8A 3VVEA 1NH8A 4LVQA 4IGTA 1FQDA 1D3KA 1CB6A 2E1SA 1N04A 4GWWA 2CZHA 1P1OA 2CMOA 4EQBA 4QFLA 1MS7A 2A5TB 3M3LA 1LBCA 2M8CA 3BIGA 1SDXA 3H4ZA 5EYHA 4O3AA 1URSA 1QGXA 1FPLA 5H8FA 2CZIA 2R6GE 3UIFA 2DWHA 3OMBA 1G0IA 2OJTA 4U1ZA 1ZIUA 2F7AA 3TFLA 3LV0A 1OIBA 3GXAA 4ZEIA 1MG1A 2QVVA 3KSXA 2OBGA 2XXYA 4TLMB 5CBSA 5K2YA 5B7DA 5EYFA 2Q8JA 4YKJA 1FPEA 3TKDA 4LATA 2OX3A 3NOHA 4DDDA 4LONB 3K4UA 1YZ0A 3EQ1A 4HTGA 4PP0A 4NF8A 5DYHA 1PC3A 3FD3A 3LUZA 1QW0A 4OFLA 2ABHA 3IO4A 2V3QA 5H8SA 1CE2A 1LGBC 3TTNA 3KGCA 3K1MA 2F7CA 4X9TA 1NV1A 2Z22A 2CZKA 2UVGA 1RYXA 4YAHX 3QMFA 4PAIA 1NUXA 5EQ9A 2F6GA 4ZEBA 3PD8A 3FJ7A 1QKBA 4H8JA 5ET8A 1O63A 3WAEA 3IB2A 3EF7A 4PF8A 4XTCQ 2I0BA 1NL5A 3B6TA 4PCDA 3FXBA 3B7DA 1DTGA 2XA5A 3E9XA 4YKKA 3PPRA 2PFYA 1Y3NA 4NAPA 5CMCA 1ELJA 1NI9A 4ECFA 2F36A 5T3JA 3T96B 2O51A 2RC9A 3P7IA 3MPLA 2V3TA 2HPGA 4MH5A 3C34A 3U93A 2FA7A 4TLLB 2QVUA 1B05A 4H6DA 2I49A 2JJKA 1B2HA 4MX6A 1Y3PA 2F3BA 1JNFA 2V3UA 1NMUA 1SBPA 4PFYA 2CEXA 5JTYB 4MBPA 1KZ8A 2DWAA 2UYEA 4THIA 2V25A 5TU0A 4ZDMA 1FBDA 4F1YA 2HFBA 1FQCA 4LP2B 4GVOA 3KBZA 1GGGA 3VVFA 1KA0A 4R73A 2Q9TA 2QS3A 4QRZA 4MNIA 3C4MA 2A5SA 1OQHA 2O6AA 5ET7A 5ICTA 4ZE8A 3DELB 4GWUA 2P0SA 4Q5TA 5L8DA 3MWBA 4HS7A 3LSXA 2HZLA 1YAEA 1B51A 4YB6A 1N76A 2RCBA 4LUBA 2Z23A 3U94A 4N6PA 3KOTA 3RPLB 1LFHA 3IJXB 5CM6A 4F18A 2Y7KA 3TDJA 2GHAA 1LFIA 1B4HA 4GX4A 2Y7IA 3VLVA 1JW5A 4NF4A 4RK9A 3MVZA 3KEIA 4FEDA 4MHFA 4BDLA 3M3FA 4MLQA 2ZYKA 5CRYA 4U4SA 1XI6A 4DCXA 5I57A 4MF3A 4F19A 1YTVA 1B3EA 4PF6A 3E13X 2G29A 4R9GA 3HO7A 1Q9DA 2Y7WA 1Z7NE 3N26A 3IAZA 4KQPA 3IB0A 4LZ8A 3SEVA 2XXQA 3OSRA 3CIJA 4QFPA 4PE3A 4K3FA 5LDZA 1O64A 4JXIA 3H06B 4IY6A 2ZMBA 4QSDA 2XXHA 2HQ0A 3OEMA 5I56A 2ONSA 2E0SA 4R72A 3EN3A 1IMFA 5LTCA 2I3WA 1M5FA 1TT1A 5L9OA 3QSLA 3KJTA 2DE4A 2Q8MA 3FXUA 5KCJA 5CMKA 4OEVA 5FTHA 1MM7A 5CMMA 5EHSA 1PBPA 2KQZA 1B6HA 4POXA 3O6GA 3IOTA 3IFCA 5IKBA 1A99A 3K6WA 4KYDA 3OOAA 5ET5A 1UQWA 4O3BA 4RYAA 3VVDA 3W9WA 1B5JA 1YPNA 3IORA 4NX1A 4LN5A 4NTLA 5IZ1A 1FSAA 1MQGA 3GBAA 3C35A 3LSWA 3S9MC 3H6UA 3W15C 2WEFA 4F1VA 3IK6B 5I59B 1P99A 3CG1A 2A5TA 1FBFA 5JEIA 4U1OA 1BLFA 1US5A 4NQ8A 3ISPA 4OA4A 3PPPA 1A7LA 4NN3A 4YB5A 3KN8A 5EQ7A 1KA1A 4IO6A 2H5YA 3RN8A 3QK6A 1Y20A 4UACA 3E4RA 2XD3A 1B4ZA 4QFKA 4XKNA 4KPTA 4OHNA 1NKXA 3KBRA 1R1NA 4P9KA 3E78A 1JW1A 3HPIA 2UVHA 3GZGA 3L6HA 4N6DA 5H8QB 4I3EA 3N6UA 2PFZA 4LZ7A 1MH3A 1M5EA 1P1WA 4F3PA 2QVRA 4F22A 2XXVA 4IO3A 1IXCA 2Q89A 4PQJA 5FHMA 2HCAA 1RYOA 3CVGA 3FIRA 4NWDA 1VFEA 3FVOA 3G3HA 4HXVA 1SI1A 1N84A 4ELPA 4KXPA 4PGPA 3UN6A 2D21A 1OVTA 1M5DA 3A3CA 1LSTA 5ESYA 4OETA 2MKZA 2OWSA 4FIMA 4YKIA 1BIYA 1FPFA 4FEBA 3SESA 4WEPA 5CMBA 3MZBA 4RPOA 2O7IA 1B3FA 3PMXA 4DXBA 2GH9A 4F2OA 3V83A 2HEUA 5H8HB 5AA4B 4PAFA 3KSJA 2QSXA 2THIA 1FTLA 2ESNA 4JWYA 4RY1A 4N91A 5F24A 4ESXA 2P1SA 1ZLQA 4IO5A 3G3GA 3LUYA 1QJMA 4I62A 5JTYA 4G68C 2XXIA 4MEVA 1BTJA 2Q74A 4FAJA 3FXRA 3CSGA 1VSOA 1MY2A 3DLNA 3PUXE 1B1XA 1FQFA 5DVIA 2XX8A 4R75A 1QULA 2DWIA 2XXTA 4KYSA 4PDHA 3OO9A 2HXWA 3S9EA 2V84A 1FRPA 1N3WA 1PEBA 2ONKE 1N3XA 5ISUA 3KC1A 2F8DA 3E3KA 4BDOA 2IEEA 4ZZAA 3RYDA 5CC2A 4LQ2A 2F7BA 4P56A 4N81A 2CEYA 2O69A 3N94A 3EPEA 4G61A 1NV0A 1SW4A 1WDNA 4P1LA 3HSTA 1MPBA 1EYKA 3D4GA 4PFTA 4YMAA 4GBWA 1SD3A 3MZ1A 1LBYA 1YYZA 1QUIA 3MUQA 3TTMA 1SW5A 5A5LA 1MQJA 2WBBA 4Q0CA 3CSBA 1M5CA 2DSFA 5ITPA 1I6AA 4C1UA 4C1TA 4N8GA 1NUWA 1FTAA 4PDDA 3PPOA 3SEWA 3RT6B 3Q25A 1QVSA 5HBCA 1N7WA 4GWZA 4P3LA 4IY5A 3A3UA 3IL1B 3PTYA 4OERA 2R71A 3UP9A 1VR5A 1UTHB 2FHYA 2PCRA 4FECA 2QFLA 3USDA 4JBZA 1SQYA 4GL8A 3RQTA 1LAXA 3H7MA 1INPA 1SYHA 1MDP1 4KYEA 4PE5B 4M4GA 3RTFB 3QAXA 1EZPA 3KOSA 4PFRA 4X1DA 3FVKA 4FATA 1VFDA 5DT6A 1QUKA 3O6IA 4GWSA 5FBPA 2OK2A 1H43A 3FASA 4WEDA 1G0HA 1Q1KA 1Y4TA 4KCCA 1D9YA 3TCFA 3FVNA 1IMBA 3FJMA 3QUJA 4G77A 1ZTYA 2HZKA 4P0IA 2DWJA 3QIMA 3R26A 3T93B 2REJA 4GXSB 1Y9UA 1H45A 3MVWA 3VDFA 3TZAA 3PUVE 5IZZA 2XXKA 3EHUA 3CFZA 1B7UA 2XXPA 4L17A 1LAGE 5AA2A 2XWVA 5I59A 1ZMGA 5A5XA 3FUZA 2ZNTA 4H46A 1FBEA 5H8NB 4OANA 4OVTA 3OO6A 2QMWA 3UORA 2XHDA 2FBPA 3V89B 1IMCA 1QKAA 5CBRA 1FTJA 1NFTA 5I5PA 2G93A 4QSEA 3S9LC 1FTMA 1B46A 2WBDA 2HHMA 4C0RA 1T0KA 4X04A 3RT8A 4XKQA 2F97A 1KWHA 2I3VA 3TPAA 4F3GA 3BKIB 3U8QA 2Y5KA 4AS5A 1MXZA 2P2AA 3EKIA 4GXAA 4JSOA 1AOVA 4OESA 4GOTA 1EU8A 3K02A 2VT5A 4G4PA 5FHOA 3MJNA 3LC8A 2DVCA 5H8QA 4G8NA 2FNCA 4R6YA 4EF2A 4H0WA 1FBGA 2UXAA 3KC0A 1WODA 1DBZA 4PFWA 2ZZXA 1DTZA 1II5A 3TUSA 4P47A 4H8IA 1XT8A 1N0TA 3VV5A 3IFAA 5IM2A 5HPQA 5I84A 4RK2A 3C31A 4M1VA 1NV5A 1MH4A 4MCOA 3TTRA 2BJJX 4N13A 1DOTA 4RPNA 1FW0A 4F3BA 1HSEA 1Y1MA 2YJPA 3TQWA 2ALUA 4WXJA 3MYUA 4JDFA 1NV6A 1DPPA 4MLVA 3TYHA 1MQDA 1QUJA 1MM6A 1TFAA 4I1DA 4TOZA 4YB7A 1S50A 4OVPA 4PC9A 5H8HA 5AA4A 2DVZA 2ANJA 1MRPA 4O94A 1RKMA 3Q27A 3S9NC 1NUYA 1UTBB 3ZSFA 2O7UA 4KCDA 4EXLA 3PU5A 1D9QA 1P1NA 5L9SA 3OD7A 2L5VA 4NHBA 3K01A 1POTA 1SW2A 3TCGA 4PBQA 3PUYE 4FJPA 4MAGA 1CNQA 2DP8A 3BFUA 3CRBA 1M5BA 4R6KA 1USYH 3B50A 1TFDA 5TPAB 1RDYA 4ZEDA 1POY1 2FVZA 2ZXTA 3HHFA 4NEDA 2QMXA 1PB9A 2XXWA 3TQLA 4N15A 1FPBA 1TWYA 3O29A 4H67A 4OQOA 4BDMA 2KR0A 2CZLA 2XWOA 1MXVA 2PBWA 4R9FA 3SEYA 3T9UA 1SPIA 4QXDA 1PB7A 5EHMA 3DP4A 2O1MA 1A8EA 4EUOA 4EXKA 4PFIA 4QFOA 1R9QA 3MVXA 3UGWA 1GTKA 4IR8A 2V93A 2DOJA 1XC1A 5DW8A 3KG2A 4IO2A 3CG3A 3H6WA 3SETA 5CI5A 2BJIA 4X48A 2WYPA 3U1OA 2IA4A 3CR9A 1DMBA 4FE8A 1JP4A 2I58A 4Q30B 4EDPA 4ZEKA 3H03A 5EYGA 2XXXA 1LAHE 5AA2B 4O3CA 2FYIA 2QS1A 4ZS9A 4R2BA 2QJEA 1AWBA 1USYE 1I69A 3IO6A 1UTHA 5A5XB 3PUZE 4GBVA 4JWOA 5ITOA 4GFRA 2WKYA 1EH3A 4OWDA 1LB9A 3RTWB 3QXMA 1MPCA 4QF9A 4NF6B 3K0VA 1UIUA 3H3GA 1DPEA 1NV2A 5HM4B 4P8BA 2XX7A 4DLDA 1LBWA 2DQVA 3D4CA 2XXUA 1ZKBA 1URGA 2DXYA 3Q29A 4GWXA 3SERA 3K1NA 4G68B 3G3KA 3OSQA 4F29A 2DE3A 2PYYA 3MPKA 1VDWA 3KN3A 4F31B 4HCWA 4GL0A 3T9XB 1IUDA 5IZ3B 3G7WA 1EYJA 3UK4A 4EQ7A 5KZTA 4DIGA 1A40A 4BDQA 5B70A 5H8NA 2OCUA 4ZE9A 3TTLA 3R6UA 4ZECA 1ATGA 3PGFA 2XD2A 2ZYMA 3V5AA 1R6ZA 3O2AA 4R6HA 3MQ9A 1AL3A 2DDKA 2Y7PA 4NF5B 2AYSA 3HCQA 1LB8A 3S2VA 4WKMA 4U23A 4LZ5A 4FBPA 3VXBA 2HAUA 1AH5A 3SDFA 3A29A 3MAMA 4OXVA 1H76A 3IJOB 2V4CA 4GLIA 2X7PA 3ILUB 3JV9A 1LBVA 2W7YA 4GWOA 4O8MA 4ELQA 2VPOA 3D1RA 1JVXA 1FQAA 4XEQA 3O66A 1I6BA 2GQ1A 1Z7ME 3T0JA 3FVGA 3W9VA 4F39A 4IO7A 4YU0A 2QS2A 1OQGA 1FTKA 4EF1A 3MBPA 3FZVA 1DCUA 2UYFA 4NG7A 2GHBA 4JVDA 2I4BA 3RGYA 5I3SA 1FPDA 5ICQA 2NVUB 4BLAA 1NNTA 4OVRA 1MDQA 1JEVA 2F35A 2YLNA 4GX6A 1NNFA 3PD9A 1HSLA 3U92A 1GR2A 2NWJA 1N7XA 1EYIA 1EZ9A 3RUMA 2H9BA 1B40A 2NXOA 3PMWA 3R7XA 2PMSA 4DI4B 1FBCA 3DP8A 3ZKLA 2PT1A 3I5OA 5I2KB 3OEKA 1FPGA 1PB8A 1TXFA 2VD2A 5FHNA 2RKMA 2HAVA 3JYRA 3H6VA 3I6VA 1UTBA 5ELVA 5DVFA 1XHYA 2D3IA 1B1HA 4U21A 1LCFA 2XWKA 4HW8A 1S7YA 3DP6A 3K00A 3MW0A 2NOOA 3OELA 4F3SA 2H25A 1EZOA 3MSTA 2AL5A 4PFBA 4OFJA 3PV0E 4XXUA 1RDXA 1Y1ZA 4N6KA 2UVJA 5TPAA 3RY3A 4LA9A 3MP1A 5LOMA 3QUFA 5TP9B 3MP8A 4H5GA 1IXHA 2VD3A 3LBSA 2YPNA 1OMPA 4JSDA 3N6TA 3G3FA 3QYTA 4OYVA 1NV4A 1UIVA 2DE2A 1OVBA 3OENA 3BIHA 5EQ8A 1GV8A 4EQ9A 4LQ5A 3FJGA 1MY3A 4YMBA 1A54A 1XOCA 4JVCA 4NWCA 4RJZA 3O28A 4N4UA 3C33A 2Y7RA 1ZBMA 5DEXB 2X7QA 4IB2A 1B5IA 1B7ZA 5DVJA 4XFEA 2B3FA 4OVJA 3M3KA 2RCAA 3OXNA 4DI3D 3KFMA 1DK4A 1ANFA 4JB7A 3U65A 1NUZA 3MVYA 4UA8A 3C9HA 1FJ9A 1OLCA 2Q2CA 2XWIA 2H99A 1IMAA 2Y84A 1XVXA 2DXRA 5I2NB 1IMDA 1LEVA 2I6EA 2UVIA 4ND9A 1JETA 4JWXA 4KHZE 2B4LA 3T22A 4GWYA 1RDZA 1B58A 1IIWA 4RA1A 2LAOA 2P3NA 2HXRA 3MC2A 3GBBA 4NF6A 2F6PA 5KDTB 4ELOA 2B3BA 2Z8DA 1LBBA 2REGA 2VP1A 4GF8A 4AB6A 2QRYA 5AE4A 2F78A 4PTKA 4QSCA 1D4NA 4KI0E 4ZEFA 1K9ZA 4MNPA 3C36A 3U72A 3VFJA 1MXYA 2H4IA 2I48A 1B32A 2AL4A 1HSJA 4G8MA 4OEUA 1B5HA 4PAKA 3ODBA 1URDA 1WVJA 1IXIA 2VOZA 3GYYA 4PFUA 3T66A 2RF1A 3PMVA 4N07A 4NF0A 3B6WA 1AIVA 4G68A 3O9PA 1LBZA 5I7IA 3IB1A 5BWJA 4YICA 3IR1A 1B3GA 4H5FA 2Q88A 3EHTA 5IZ3A 4H1XA 1LAFE 1IZ1A 3G3JA 4R74A 4HE1A 2OWZA 4H65A 5I58B 1IMEA 3VXCA 1F9BA 4MMPA 4OTEA 1FBHA 2RC7A 2QPQA 1JW4A 4IGRA 4NF5A 1LBXA 3GLBA 1B9JA 1FJ6A 1J1NA 3Q28A 1LFGA 2ZZVA 4E0WA 1SI0A 4U22A 2O1LA 2O68A 3TODA 1JEUA 4ESWA 4DZ1A 1VE4A 2VGQA 3SZPA 1D9VA 4N17A 2F5XA 1BKAA 4I3YA 1B52A 1B0LA 1R9LA 3TAJA 4POWA 2ONRA 2ZNUA 3AXFA 4U4XA 5IAIA 1FPIA 4FORA 4NMYA 2I0CA 3V8XB 2VPNA 4R2FA 3S4UA 3UA8A 2ZYNA 1Y4CA 1MXWA 3FBPA 4PETA 1FQBA 3N5LA 3JZJA 4U2RA 2GFEA 3LSFB 4X1BA 1XVYA 1H44A 3IOWA 2RINA 1IQ7A 3TMGA 3VE1B 3ZKKA 3CFLA 2KLFA 2Q2AA 1A55A 2I4CA 2RC8A 5J1DA 5DTBA 3T9HB 3TCHA 4F2QA 1Y3QA 3PUWE 3K6UA 1IITA 3K6VA 1MY0A 2Y5LA 2ZNSA 2QL3A 1MXUA 3CI8A 4H45A 4MIJA 5I2KA 1DSNA 4I9DA 2VHAA 4MNCA 1IEJA 4E0XA 3MP6A 5H8FB 3MZ9A 1YXIA 2ZYOA 2WYKA 3EHSA 4OENA 5EQAA 4DCYA 3BBRA 2P3VA 3B6QA 4XIGQ 3E79A 1NV3A 1FPJA 4OMBA 1SYIA 1Q35A 3LSLA 4P11A 4BDRA 4UABA 4KR5A 3IOUA 1O7TA 4Z7EA 1MQIA 1OLAA 4NF8B 3T1BA 4MFIA 4DXCA 1MQHA 2OZZA 2PX1A 3OO8A 4RNSA 1P1QA 2PT2A 3LR1A 5TP9A 3PPNA 4YZZA 3ROJA 5F1QA 2WX9A 3K1PA 3HV1A 4P1EA 3HFUA 3ONMA 4YKPA 4G8HA 3FGSA 3WAFA 1P1UA 4O7MA 3H6TA 2DYXA 4BDNA 4KD5A 4OZ9A 3OO7A 1LCTA 4JVIA 1ZJLA 3THIA 1A8FA 1B3LA 2XXRA 4NE4A 3HHGA
chains in the Genus database with same CATH topology
2XWVA 1EYIA 4MHFA 4MJOA 4DI4B 1FBCA 4N8YA 1XI6A 5ET6A 4H46A 1FBEA 4OANA 2FIXA 4OVTA 4F19A 1FPGA 2FBPA 2B4MA 1IMCA 4PF6A 5I5PA 1Q9DA 3B8BA 5IGAA 4HE0A 2XWKA 2WBDA 2HHMA 4X04A 4PGNA 4PE3A 5LDZA 2Y5KA 4AS5A 3EKIA 3MSTA 1BK4A 4PFBA 1FBPA 2VT5A 4AS4A 1RDXA 4N6KA 1IMFA 5LTCA 1FBGA 2DE4A 3KC0A 2Q8MA 1DBZA 2ZZXA 4P47A 1NV7A 2KQZA 4HE2A 3IFAA 5IM2A 1NV4A 4XF5A 2DE2A 3CHGA 3IFCA 3BIHA 2ZZWA 4M1VA 1NV5A 5EQ8A 4MCOA 5ET5A 2F3DA 3W9WA 2R8TA 4F1UA 4NX1A 4JVCA 4LN5A 5IZ1A 4HCYA 1FSAA 4N4UA 3MYUA 1NV6A 2WEFA 4F1VA 4XFEA 4GX3A 1FBFA 4OVPA 4PC9A 2DVZA 4DI3D 2FIEA 1DK4A 3U65A 1NUZA 4NQ8A 4O94A 3ISPA 4OA4A 1FJ9A 1NUYA 4NN3A 2XWIA 4I40A 1IMAA 5EQ7A 4O7IA 1KA1A 1FPKA 5JK4A 5J16A 1IMDA 1D9QA 1LEVA 4X8RA 2L5VA 4NHBA 4PBHA 1K9YA 4OVSA 2B4LA 4GWYA 1RDZA 4PBQA 4MAGA 1CNQA 4P9KA 3E78A 2P3NA 2HXRA 4N6DA 4I3EA 2PFZA 3RPLA 3B50A 1RDYA 2FVZA 4PTKA 2QVRA 4N15A 1FPBA 1K9ZA 4MNPA 2KR0A 2XWOA 4PAKA 1SPIA 4QXDA 4HXVA 4QBAA 4OVQA 3GYYA 4NGUA 4KXPA 4PGPA 4PFIA 4NF0A 1LBZA 5I7IA 5ESYA 2MKZA 4IR8A 4YICA 5DW8A 4GWWA 1FPFA 2CZHA 5IZ3A 2BJIA 2WYPA 4HE1A 2OWZA 1JP4A 1IMEA 3BIGA 4PAFA 4MMPA 5EYHA 1FBHA 1QGXA 1FPLA 5EYGA 2QPQA 2CZIA 4N91A 5F24A 1G0IA 1LBXA 1FJ6A 2ZZVA 1AWBA 3LV0A 2QVVA 4GBVA 4MEVA 2Q74A 3SZPA 4N17A 2F5XA 4I3YA 1FPEA 2OX3A 3NOHA 1YZ0A 4PDHA 1FPIA 1NV2A 3LUZA 2V3QA 2VPNA 4P8BA 1FRPA 3KC1A 4X9TA 1LBWA 3FBPA 4PETA 1NV1A 2CZKA 3RYDA 3QMFA 4PAIA 1NUXA 5EQ9A 4P56A 4N81A 5ET8A 2CEYA 4PF8A 4GWXA 4G61A 1NV0A 5J1DA 4PCDA 3FXBA 4P1LA 2DE3A 1EYKA 4GBWA 2XA5A 1VDWA 1LBYA 1YYZA 2PFYA 4HCWA 4NAPA 1NI9A 2Y5LA 5IZ3B 5A5LA 5T3JA 2WBBA 1EYJA 4H45A 2HPGA 4N8GA 4MIJA 1NUWA 1FTAA 2QVUA 4MNCA 4PDDA 2JJKA 1YXIA 4GWZA 4MX6A 2DDKA 2WYKA 4P3LA 5EQAA 2F3BA 3PTYA 2P3VA 2CEXA 1KZ8A 2FHYA 4FBPA 3E79A 1NV3A 1FBDA 2PCRA 1FPJA 2QFLA 3A29A 3KBZA 1KA0A 2V4CA 1INPA 4UABA 2Q9TA 1LBVA 4MNIA 4O8MA 2VPOA 3D1RA 3T1BA 4XEQA 2GQ1A 3T0JA 5ET7A 4PFRA 3W9VA 4GWUA 4YZZA 3ROJA 2WX9A 4GWSA 5FBPA 2HZLA 4P1EA 1DCUA 1G0HA 3HFUA 4NG7A 1IMBA 3RPLB 2HZKA 4JVDA 4O7MA 5I3SA 5CM6A 4F18A 1FPDA 4GX4A 4OVRA 5IZZA 2XXKA 4JVIA 4GX6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XWV A;  4MHF A;  2WYP A;  4XFE A;  4DI4 B;  4N8Y A;  2HPG A;  4N8G A;  4OVP A;  4OAN A;  4PC9 A;  4OVT A;  4PAF A;  4MIJ A;  4DI3 D;  4MMP A;  3U65 A;  4MNC A;  4PDD A;  4NQ8 A;  4O94 A;  4PF6 A;  4OA4 A;  5I5P A;  4NN3 A;  2XWI A;  4MX6 A;  4N91 A;  4P3L A;  2WYK A;  5IGA A;  2XWK A;  2ZZV A;  4X04 A;  2CEX A;  4X8R A;  4PGN A;  4PE3 A;  4MEV A;  4NHB A;  4PBH A;  4N17 A;  4OVS A;  2V4C A;  4PBQ A;  4PFB A;  4MAG A;  4P9K A;  4UAB A;  4PDH A;  4N6D A;  4MNI A;  4O8M A;  2PFZ A;  2VPO A;  3B50 A;  4N6K A;  5LTC A;  4XEQ A;  4PFR A;  4P8B A;  2VPN A;  2ZZX A;  4N15 A;  4MNP A;  4PET A;  4YZZ A;  2WX9 A;  4P47 A;  2HZL A;  4PAI A;  4P1E A;  2XWO A;  4PAK A;  5IM2 A;  4NG7 A;  4XF5 A;  4P56 A;  4OVQ A;  2CEY A;  2HZK A;  4PF8 A;  2ZZW A;  3GYY A;  4NGU A;  4O7M A;  4MCO A;  4PGP A;  5CM6 A;  4PFI A;  4NF0 A;  4PCD A;  5I7I A;  3FXB A;  4NX1 A;  4OVR A;  4P1L A;  4YIC A;  4LN5 A;  5IZZ A;  2XXK A;  2XA5 A;  2PFY A;  4NAP A;  4N4U A; 
#chains in the Genus database with same CATH topology
 4I8C A;  5DEX A;  1B7H A;  4MJO A;  2X26 A;  4N8Y A;  5ET6 A;  1IXG A;  2FIX A;  3KN7 A;  1LLS A;  2B4M A;  1ZU0 A;  3RPW A;  2AIX A;  3B8B A;  5IGA A;  5L9M A;  1YCJ A;  3SEX A;  4HE0 A;  3A09 A;  5I2N A;  3BFT A;  4PGN A;  2QS4 A;  5FTI A;  3FV2 A;  3KJ7 A;  3VLW A;  1BK4 A;  1FBP A;  1MPD A;  3FAT A;  5AA3 A;  4AS4 A;  3I3V A;  4IO4 A;  3RNN A;  4Q8R A;  3RLF E;  5KDT A;  3K6X A;  5BUU A;  3F11 A;  1US4 A;  2O84 X;  2Z8E A;  1SVX B;  4ISU A;  3IX1 A;  3L6G A;  2XX9 A;  2F34 A;  3SEU A;  4TQU Q;  1MXX A;  3TEP A;  1NV7 A;  4HE2 A;  4XF5 A;  3CHG A;  4GRK A;  4ELR A;  2ZZW A;  5K2X A;  3FXQ A;  2PVU A;  3TEL A;  1I6Q A;  5AA2 D;  2F3D A;  1MY1 A;  2R8T A;  1FCK A;  4F1U A;  3T9V A;  1S9T A;  4XKP A;  3O97 A;  3CFX A;  4HCY A;  4XKR A;  4DXU A;  4NF4 B;  4ZZE A;  3Q26 A;  1JVY A;  1BP5 A;  3HN0 A;  4GX3 A;  5I57 B;  1JQF A;  5M2V A;  5I58 A;  1B0H A;  3G3I A;  2FIE A;  3C32 A;  1L5T A;  5F7V A;  5AA1 A;  1FTO A;  1PBQ A;  4I40 A;  4OFO A;  3ILT B;  2OWT A;  4O7I A;  1FPK A;  1MY4 A;  5JK4 A;  5J16 A;  3O6H A;  2GRV A;  4X8R A;  1AMF A;  4RXL A;  1PDA A;  4KFQ A;  4PBH A;  2H98 A;  3DM0 A;  1K9Y A;  4OVS A;  5I56 B;  1XS5 A;  3ECR A;  4G2Z A;  3KZG A;  1FQE A;  3FV1 A;  1NNP A;  1NNK A;  3RPL A;  2NUV A;  3ZS6 A;  2R9J A;  4ONY A;  5KCJ B;  4QFN A;  2D5W A;  2Z8F A;  3SKP A;  3IOV A;  1GVC A;  3VLU A;  4P0G A;  1H3D A;  1NH7 A;  4GD5 A;  4AB5 A;  2B65 A;  4GIZ A;  4AQ4 A;  2DS9 A;  4QHQ A;  1B3H A;  3M8U A;  2OLB A;  3K2D A;  4QBA A;  3TTK A;  4OVQ A;  1SW1 A;  3PPQ A;  4GQO A;  4NGU A;  4Z0I A;  4DE8 A;  3VVE A;  1NH8 A;  4LVQ A;  4IGT A;  1FQD A;  1D3K A;  1CB6 A;  2E1S A;  1N04 A;  4GWW A;  2CZH A;  1P1O A;  2CMO A;  4EQB A;  4QFL A;  1MS7 A;  2A5T B;  3M3L A;  1LBC A;  2M8C A;  3BIG A;  1SDX A;  3H4Z A;  5EYH A;  4O3A A;  1URS A;  1QGX A;  1FPL A;  5H8F A;  2CZI A;  2R6G E;  3UIF A;  2DWH A;  3OMB A;  1G0I A;  2OJT A;  4U1Z A;  1ZIU A;  2F7A A;  3TFL A;  3LV0 A;  1OIB A;  3GXA A;  4ZEI A;  1MG1 A;  2QVV A;  3KSX A;  2OBG A;  2XXY A;  4TLM B;  5CBS A;  5K2Y A;  5B7D A;  5EYF A;  2Q8J A;  4YKJ A;  1FPE A;  3TKD A;  4LAT A;  2OX3 A;  3NOH A;  4DDD A;  4LON B;  3K4U A;  1YZ0 A;  3EQ1 A;  4HTG A;  4PP0 A;  4NF8 A;  5DYH A;  1PC3 A;  3FD3 A;  3LUZ A;  1QW0 A;  4OFL A;  2ABH A;  3IO4 A;  2V3Q A;  5H8S A;  1CE2 A;  1LGB C;  3TTN A;  3KGC A;  3K1M A;  2F7C A;  4X9T A;  1NV1 A;  2Z22 A;  2CZK A;  2UVG A;  1RYX A;  4YAH X;  3QMF A;  4PAI A;  1NUX A;  5EQ9 A;  2F6G A;  4ZEB A;  3PD8 A;  3FJ7 A;  1QKB A;  4H8J A;  5ET8 A;  1O63 A;  3WAE A;  3IB2 A;  3EF7 A;  4PF8 A;  4XTC Q;  2I0B A;  1NL5 A;  3B6T A;  4PCD A;  3FXB A;  3B7D A;  1DTG A;  2XA5 A;  3E9X A;  4YKK A;  3PPR A;  2PFY A;  1Y3N A;  4NAP A;  5CMC A;  1ELJ A;  1NI9 A;  4ECF A;  2F36 A;  5T3J A;  3T96 B;  2O51 A;  2RC9 A;  3P7I A;  3MPL A;  2V3T A;  2HPG A;  4MH5 A;  3C34 A;  3U93 A;  2FA7 A;  4TLL B;  2QVU A;  1B05 A;  4H6D A;  2I49 A;  2JJK A;  1B2H A;  4MX6 A;  1Y3P A;  2F3B A;  1JNF A;  2V3U A;  1NMU A;  1SBP A;  4PFY A;  2CEX A;  5JTY B;  4MBP A;  1KZ8 A;  2DWA A;  2UYE A;  4THI A;  2V25 A;  5TU0 A;  4ZDM A;  1FBD A;  4F1Y A;  2HFB A;  1FQC A;  4LP2 B;  4GVO A;  3KBZ A;  1GGG A;  3VVF A;  1KA0 A;  4R73 A;  2Q9T A;  2QS3 A;  4QRZ A;  4MNI A;  3C4M A;  2A5S A;  1OQH A;  2O6A A;  5ET7 A;  5ICT A;  4ZE8 A;  3DEL B;  4GWU A;  2P0S A;  4Q5T A;  5L8D A;  3MWB A;  4HS7 A;  3LSX A;  2HZL A;  1YAE A;  1B51 A;  4YB6 A;  1N76 A;  2RCB A;  4LUB A;  2Z23 A;  3U94 A;  4N6P A;  3KOT A;  3RPL B;  1LFH A;  3IJX B;  5CM6 A;  4F18 A;  2Y7K A;  3TDJ A;  2GHA A;  1LFI A;  1B4H A;  4GX4 A;  2Y7I A;  3VLV A;  1JW5 A;  4NF4 A;  4RK9 A;  3MVZ A;  3KEI A;  4FED A;  4MHF A;  4BDL A;  3M3F A;  4MLQ A;  2ZYK A;  5CRY A;  4U4S A;  1XI6 A;  4DCX A;  5I57 A;  4MF3 A;  4F19 A;  1YTV A;  1B3E A;  4PF6 A;  3E13 X;  2G29 A;  4R9G A;  3HO7 A;  1Q9D A;  2Y7W A;  1Z7N E;  3N26 A;  3IAZ A;  4KQP A;  3IB0 A;  4LZ8 A;  3SEV A;  2XXQ A;  3OSR A;  3CIJ A;  4QFP A;  4PE3 A;  4K3F A;  5LDZ A;  1O64 A;  4JXI A;  3H06 B;  4IY6 A;  2ZMB A;  4QSD A;  2XXH A;  2HQ0 A;  3OEM A;  5I56 A;  2ONS A;  2E0S A;  4R72 A;  3EN3 A;  1IMF A;  5LTC A;  2I3W A;  1M5F A;  1TT1 A;  5L9O A;  3QSL A;  3KJT A;  2DE4 A;  2Q8M A;  3FXU A;  5KCJ A;  5CMK A;  4OEV A;  5FTH A;  1MM7 A;  5CMM A;  5EHS A;  1PBP A;  2KQZ A;  1B6H A;  4POX A;  3O6G A;  3IOT A;  3IFC A;  5IKB A;  1A99 A;  3K6W A;  4KYD A;  3OOA A;  5ET5 A;  1UQW A;  4O3B A;  4RYA A;  3VVD A;  3W9W A;  1B5J A;  1YPN A;  3IOR A;  4NX1 A;  4LN5 A;  4NTL A;  5IZ1 A;  1FSA A;  1MQG A;  3GBA A;  3C35 A;  3LSW A;  3S9M C;  3H6U A;  3W15 C;  2WEF A;  4F1V A;  3IK6 B;  5I59 B;  1P99 A;  3CG1 A;  2A5T A;  1FBF A;  5JEI A;  4U1O A;  1BLF A;  1US5 A;  4NQ8 A;  3ISP A;  4OA4 A;  3PPP A;  1A7L A;  4NN3 A;  4YB5 A;  3KN8 A;  5EQ7 A;  1KA1 A;  4IO6 A;  2H5Y A;  3RN8 A;  3QK6 A;  1Y20 A;  4UAC A;  3E4R A;  2XD3 A;  1B4Z A;  4QFK A;  4XKN A;  4KPT A;  4OHN A;  1NKX A;  3KBR A;  1R1N A;  4P9K A;  3E78 A;  1JW1 A;  3HPI A;  2UVH A;  3GZG A;  3L6H A;  4N6D A;  5H8Q B;  4I3E A;  3N6U A;  2PFZ A;  4LZ7 A;  1MH3 A;  1M5E A;  1P1W A;  4F3P A;  2QVR A;  4F22 A;  2XXV A;  4IO3 A;  1IXC A;  2Q89 A;  4PQJ A;  5FHM A;  2HCA A;  1RYO A;  3CVG A;  3FIR A;  4NWD A;  1VFE A;  3FVO A;  3G3H A;  4HXV A;  1SI1 A;  1N84 A;  4ELP A;  4KXP A;  4PGP A;  3UN6 A;  2D21 A;  1OVT A;  1M5D A;  3A3C A;  1LST A;  5ESY A;  4OET A;  2MKZ A;  2OWS A;  4FIM A;  4YKI A;  1BIY A;  1FPF A;  4FEB A;  3SES A;  4WEP A;  5CMB A;  3MZB A;  4RPO A;  2O7I A;  1B3F A;  3PMX A;  4DXB A;  2GH9 A;  4F2O A;  3V83 A;  2HEU A;  5H8H B;  5AA4 B;  4PAF A;  3KSJ A;  2QSX A;  2THI A;  1FTL A;  2ESN A;  4JWY A;  4RY1 A;  4N91 A;  5F24 A;  4ESX A;  2P1S A;  1ZLQ A;  4IO5 A;  3G3G A;  3LUY A;  1QJM A;  4I62 A;  5JTY A;  4G68 C;  2XXI A;  4MEV A;  1BTJ A;  2Q74 A;  4FAJ A;  3FXR A;  3CSG A;  1VSO A;  1MY2 A;  3DLN A;  3PUX E;  1B1X A;  1FQF A;  5DVI A;  2XX8 A;  4R75 A;  1QUL A;  2DWI A;  2XXT A;  4KYS A;  4PDH A;  3OO9 A;  2HXW A;  3S9E A;  2V84 A;  1FRP A;  1N3W A;  1PEB A;  2ONK E;  1N3X A;  5ISU A;  3KC1 A;  2F8D A;  3E3K A;  4BDO A;  2IEE A;  4ZZA A;  3RYD A;  5CC2 A;  4LQ2 A;  2F7B A;  4P56 A;  4N81 A;  2CEY A;  2O69 A;  3N94 A;  3EPE A;  4G61 A;  1NV0 A;  1SW4 A;  1WDN A;  4P1L A;  3HST A;  1MPB A;  1EYK A;  3D4G A;  4PFT A;  4YMA A;  4GBW A;  1SD3 A;  3MZ1 A;  1LBY A;  1YYZ A;  1QUI A;  3MUQ A;  3TTM A;  1SW5 A;  5A5L A;  1MQJ A;  2WBB A;  4Q0C A;  3CSB A;  1M5C A;  2DSF A;  5ITP A;  1I6A A;  4C1U A;  4C1T A;  4N8G A;  1NUW A;  1FTA A;  4PDD A;  3PPO A;  3SEW A;  3RT6 B;  3Q25 A;  1QVS A;  5HBC A;  1N7W A;  4GWZ A;  4P3L A;  4IY5 A;  3A3U A;  3IL1 B;  3PTY A;  4OER A;  2R71 A;  3UP9 A;  1VR5 A;  1UTH B;  2FHY A;  2PCR A;  4FEC A;  2QFL A;  3USD A;  4JBZ A;  1SQY A;  4GL8 A;  3RQT A;  1LAX A;  3H7M A;  1INP A;  1SYH A;  1MDP 1;  4KYE A;  4PE5 B;  4M4G A;  3RTF B;  3QAX A;  1EZP A;  3KOS A;  4PFR A;  4X1D A;  3FVK A;  4FAT A;  1VFD A;  5DT6 A;  1QUK A;  3O6I A;  4GWS A;  5FBP A;  2OK2 A;  1H43 A;  3FAS A;  4WED A;  1G0H A;  1Q1K A;  1Y4T A;  4KCC A;  1D9Y A;  3TCF A;  3FVN A;  1IMB A;  3FJM A;  3QUJ A;  4G77 A;  1ZTY A;  2HZK A;  4P0I A;  2DWJ A;  3QIM A;  3R26 A;  3T93 B;  2REJ A;  4GXS B;  1Y9U A;  1H45 A;  3MVW A;  3VDF A;  3TZA A;  3PUV E;  5IZZ A;  2XXK A;  3EHU A;  3CFZ A;  1B7U A;  2XXP A;  4L17 A;  1LAG E;  5AA2 A;  2XWV A;  5I59 A;  1ZMG A;  5A5X A;  3FUZ A;  2ZNT A;  4H46 A;  1FBE A;  5H8N B;  4OAN A;  4OVT A;  3OO6 A;  2QMW A;  3UOR A;  2XHD A;  2FBP A;  3V89 B;  1IMC A;  1QKA A;  5CBR A;  1FTJ A;  1NFT A;  5I5P A;  2G93 A;  4QSE A;  3S9L C;  1FTM A;  1B46 A;  2WBD A;  2HHM A;  4C0R A;  1T0K A;  4X04 A;  3RT8 A;  4XKQ A;  2F97 A;  1KWH A;  2I3V A;  3TPA A;  4F3G A;  3BKI B;  3U8Q A;  2Y5K A;  4AS5 A;  1MXZ A;  2P2A A;  3EKI A;  4GXA A;  4JSO A;  1AOV A;  4OES A;  4GOT A;  1EU8 A;  3K02 A;  2VT5 A;  4G4P A;  5FHO A;  3MJN A;  3LC8 A;  2DVC A;  5H8Q A;  4G8N A;  2FNC A;  4R6Y A;  4EF2 A;  4H0W A;  1FBG A;  2UXA A;  3KC0 A;  1WOD A;  1DBZ A;  4PFW A;  2ZZX A;  1DTZ A;  1II5 A;  3TUS A;  4P47 A;  4H8I A;  1XT8 A;  1N0T A;  3VV5 A;  3IFA A;  5IM2 A;  5HPQ A;  5I84 A;  4RK2 A;  3C31 A;  4M1V A;  1NV5 A;  1MH4 A;  4MCO A;  3TTR A;  2BJJ X;  4N13 A;  1DOT A;  4RPN A;  1FW0 A;  4F3B A;  1HSE A;  1Y1M A;  2YJP A;  3TQW A;  2ALU A;  4WXJ A;  3MYU A;  4JDF A;  1NV6 A;  1DPP A;  4MLV A;  3TYH A;  1MQD A;  1QUJ A;  1MM6 A;  1TFA A;  4I1D A;  4TOZ A;  4YB7 A;  1S50 A;  4OVP A;  4PC9 A;  5H8H A;  5AA4 A;  2DVZ A;  2ANJ A;  1MRP A;  4O94 A;  1RKM A;  3Q27 A;  3S9N C;  1NUY A;  1UTB B;  3ZSF A;  2O7U A;  4KCD A;  4EXL A;  3PU5 A;  1D9Q A;  1P1N A;  5L9S A;  3OD7 A;  2L5V A;  4NHB A;  3K01 A;  1POT A;  1SW2 A;  3TCG A;  4PBQ A;  3PUY E;  4FJP A;  4MAG A;  1CNQ A;  2DP8 A;  3BFU A;  3CRB A;  1M5B A;  4R6K A;  1USY H;  3B50 A;  1TFD A;  5TPA B;  1RDY A;  4ZED A;  1POY 1;  2FVZ A;  2ZXT A;  3HHF A;  4NED A;  2QMX A;  1PB9 A;  2XXW A;  3TQL A;  4N15 A;  1FPB A;  1TWY A;  3O29 A;  4H67 A;  4OQO A;  4BDM A;  2KR0 A;  2CZL A;  2XWO A;  1MXV A;  2PBW A;  4R9F A;  3SEY A;  3T9U A;  1SPI A;  4QXD A;  1PB7 A;  5EHM A;  3DP4 A;  2O1M A;  1A8E A;  4EUO A;  4EXK A;  4PFI A;  4QFO A;  1R9Q A;  3MVX A;  3UGW A;  1GTK A;  4IR8 A;  2V93 A;  2DOJ A;  1XC1 A;  5DW8 A;  3KG2 A;  4IO2 A;  3CG3 A;  3H6W A;  3SET A;  5CI5 A;  2BJI A;  4X48 A;  2WYP A;  3U1O A;  2IA4 A;  3CR9 A;  1DMB A;  4FE8 A;  1JP4 A;  2I58 A;  4Q30 B;  4EDP A;  4ZEK A;  3H03 A;  5EYG A;  2XXX A;  1LAH E;  5AA2 B;  4O3C A;  2FYI A;  2QS1 A;  4ZS9 A;  4R2B A;  2QJE A;  1AWB A;  1USY E;  1I69 A;  3IO6 A;  1UTH A;  5A5X B;  3PUZ E;  4GBV A;  4JWO A;  5ITO A;  4GFR A;  2WKY A;  1EH3 A;  4OWD A;  1LB9 A;  3RTW B;  3QXM A;  1MPC A;  4QF9 A;  4NF6 B;  3K0V A;  1UIU A;  3H3G A;  1DPE A;  1NV2 A;  5HM4 B;  4P8B A;  2XX7 A;  4DLD A;  1LBW A;  2DQV A;  3D4C A;  2XXU A;  1ZKB A;  1URG A;  2DXY A;  3Q29 A;  4GWX A;  3SER A;  3K1N A;  4G68 B;  3G3K A;  3OSQ A;  4F29 A;  2DE3 A;  2PYY A;  3MPK A;  1VDW A;  3KN3 A;  4F31 B;  4HCW A;  4GL0 A;  3T9X B;  1IUD A;  5IZ3 B;  3G7W A;  1EYJ A;  3UK4 A;  4EQ7 A;  5KZT A;  4DIG A;  1A40 A;  4BDQ A;  5B70 A;  5H8N A;  2OCU A;  4ZE9 A;  3TTL A;  3R6U A;  4ZEC A;  1ATG A;  3PGF A;  2XD2 A;  2ZYM A;  3V5A A;  1R6Z A;  3O2A A;  4R6H A;  3MQ9 A;  1AL3 A;  2DDK A;  2Y7P A;  4NF5 B;  2AYS A;  3HCQ A;  1LB8 A;  3S2V A;  4WKM A;  4U23 A;  4LZ5 A;  4FBP A;  3VXB A;  2HAU A;  1AH5 A;  3SDF A;  3A29 A;  3MAM A;  4OXV A;  1H76 A;  3IJO B;  2V4C A;  4GLI A;  2X7P A;  3ILU B;  3JV9 A;  1LBV A;  2W7Y A;  4GWO A;  4O8M A;  4ELQ A;  2VPO A;  3D1R A;  1JVX A;  1FQA A;  4XEQ A;  3O66 A;  1I6B A;  2GQ1 A;  1Z7M E;  3T0J A;  3FVG A;  3W9V A;  4F39 A;  4IO7 A;  4YU0 A;  2QS2 A;  1OQG A;  1FTK A;  4EF1 A;  3MBP A;  3FZV A;  1DCU A;  2UYF A;  4NG7 A;  2GHB A;  4JVD A;  2I4B A;  3RGY A;  5I3S A;  1FPD A;  5ICQ A;  2NVU B;  4BLA A;  1NNT A;  4OVR A;  1MDQ A;  1JEV A;  2F35 A;  2YLN A;  4GX6 A;  1NNF A;  3PD9 A;  1HSL A;  3U92 A;  1GR2 A;  2NWJ A;  1N7X A;  1EYI A;  1EZ9 A;  3RUM A;  2H9B A;  1B40 A;  2NXO A;  3PMW A;  3R7X A;  2PMS A;  4DI4 B;  1FBC A;  3DP8 A;  3ZKL A;  2PT1 A;  3I5O A;  5I2K B;  3OEK A;  1FPG A;  1PB8 A;  1TXF A;  2VD2 A;  5FHN A;  2RKM A;  2HAV A;  3JYR A;  3H6V A;  3I6V A;  1UTB A;  5ELV A;  5DVF A;  1XHY A;  2D3I A;  1B1H A;  4U21 A;  1LCF A;  2XWK A;  4HW8 A;  1S7Y A;  3DP6 A;  3K00 A;  3MW0 A;  2NOO A;  3OEL A;  4F3S A;  2H25 A;  1EZO A;  3MST A;  2AL5 A;  4PFB A;  4OFJ A;  3PV0 E;  4XXU A;  1RDX A;  1Y1Z A;  4N6K A;  2UVJ A;  5TPA A;  3RY3 A;  4LA9 A;  3MP1 A;  5LOM A;  3QUF A;  5TP9 B;  3MP8 A;  4H5G A;  1IXH A;  2VD3 A;  3LBS A;  2YPN A;  1OMP A;  4JSD A;  3N6T A;  3G3F A;  3QYT A;  4OYV A;  1NV4 A;  1UIV A;  2DE2 A;  1OVB A;  3OEN A;  3BIH A;  5EQ8 A;  1GV8 A;  4EQ9 A;  4LQ5 A;  3FJG A;  1MY3 A;  4YMB A;  1A54 A;  1XOC A;  4JVC A;  4NWC A;  4RJZ A;  3O28 A;  4N4U A;  3C33 A;  2Y7R A;  1ZBM A;  5DEX B;  2X7Q A;  4IB2 A;  1B5I A;  1B7Z A;  5DVJ A;  4XFE A;  2B3F A;  4OVJ A;  3M3K A;  2RCA A;  3OXN A;  4DI3 D;  3KFM A;  1DK4 A;  1ANF A;  4JB7 A;  3U65 A;  1NUZ A;  3MVY A;  4UA8 A;  3C9H A;  1FJ9 A;  1OLC A;  2Q2C A;  2XWI A;  2H99 A;  1IMA A;  2Y84 A;  1XVX A;  2DXR A;  5I2N B;  1IMD A;  1LEV A;  2I6E A;  2UVI A;  4ND9 A;  1JET A;  4JWX A;  4KHZ E;  2B4L A;  3T22 A;  4GWY A;  1RDZ A;  1B58 A;  1IIW A;  4RA1 A;  2LAO A;  2P3N A;  2HXR A;  3MC2 A;  3GBB A;  4NF6 A;  2F6P A;  5KDT B;  4ELO A;  2B3B A;  2Z8D A;  1LBB A;  2REG A;  2VP1 A;  4GF8 A;  4AB6 A;  2QRY A;  5AE4 A;  2F78 A;  4PTK A;  4QSC A;  1D4N A;  4KI0 E;  4ZEF A;  1K9Z A;  4MNP A;  3C36 A;  3U72 A;  3VFJ A;  1MXY A;  2H4I A;  2I48 A;  1B32 A;  2AL4 A;  1HSJ A;  4G8M A;  4OEU A;  1B5H A;  4PAK A;  3ODB A;  1URD A;  1WVJ A;  1IXI A;  2VOZ A;  3GYY A;  4PFU A;  3T66 A;  2RF1 A;  3PMV A;  4N07 A;  4NF0 A;  3B6W A;  1AIV A;  4G68 A;  3O9P A;  1LBZ A;  5I7I A;  3IB1 A;  5BWJ A;  4YIC A;  3IR1 A;  1B3G A;  4H5F A;  2Q88 A;  3EHT A;  5IZ3 A;  4H1X A;  1LAF E;  1IZ1 A;  3G3J A;  4R74 A;  4HE1 A;  2OWZ A;  4H65 A;  5I58 B;  1IME A;  3VXC A;  1F9B A;  4MMP A;  4OTE A;  1FBH A;  2RC7 A;  2QPQ A;  1JW4 A;  4IGR A;  4NF5 A;  1LBX A;  3GLB A;  1B9J A;  1FJ6 A;  1J1N A;  3Q28 A;  1LFG A;  2ZZV A;  4E0W A;  1SI0 A;  4U22 A;  2O1L A;  2O68 A;  3TOD A;  1JEU A;  4ESW A;  4DZ1 A;  1VE4 A;  2VGQ A;  3SZP A;  1D9V A;  4N17 A;  2F5X A;  1BKA A;  4I3Y A;  1B52 A;  1B0L A;  1R9L A;  3TAJ A;  4POW A;  2ONR A;  2ZNU A;  3AXF A;  4U4X A;  5IAI A;  1FPI A;  4FOR A;  4NMY A;  2I0C A;  3V8X B;  2VPN A;  4R2F A;  3S4U A;  3UA8 A;  2ZYN A;  1Y4C A;  1MXW A;  3FBP A;  4PET A;  1FQB A;  3N5L A;  3JZJ A;  4U2R A;  2GFE A;  3LSF B;  4X1B A;  1XVY A;  1H44 A;  3IOW A;  2RIN A;  1IQ7 A;  3TMG A;  3VE1 B;  3ZKK A;  3CFL A;  2KLF A;  2Q2A A;  1A55 A;  2I4C A;  2RC8 A;  5J1D A;  5DTB A;  3T9H B;  3TCH A;  4F2Q A;  1Y3Q A;  3PUW E;  3K6U A;  1IIT A;  3K6V A;  1MY0 A;  2Y5L A;  2ZNS A;  2QL3 A;  1MXU A;  3CI8 A;  4H45 A;  4MIJ A;  5I2K A;  1DSN A;  4I9D A;  2VHA A;  4MNC A;  1IEJ A;  4E0X A;  3MP6 A;  5H8F B;  3MZ9 A;  1YXI A;  2ZYO A;  2WYK A;  3EHS A;  4OEN A;  5EQA A;  4DCY A;  3BBR A;  2P3V A;  3B6Q A;  4XIG Q;  3E79 A;  1NV3 A;  1FPJ A;  4OMB A;  1SYI A;  1Q35 A;  3LSL A;  4P11 A;  4BDR A;  4UAB A;  4KR5 A;  3IOU A;  1O7T A;  4Z7E A;  1MQI A;  1OLA A;  4NF8 B;  3T1B A;  4MFI A;  4DXC A;  1MQH A;  2OZZ A;  2PX1 A;  3OO8 A;  4RNS A;  1P1Q A;  2PT2 A;  3LR1 A;  5TP9 A;  3PPN A;  4YZZ A;  3ROJ A;  5F1Q A;  2WX9 A;  3K1P A;  3HV1 A;  4P1E A;  3HFU A;  3ONM A;  4YKP A;  4G8H A;  3FGS A;  3WAF A;  1P1U A;  4O7M A;  3H6T A;  2DYX A;  4BDN A;  4KD5 A;  4OZ9 A;  3OO7 A;  1LCT A;  4JVI A;  1ZJL A;  3THI A;  1A8F A;  1B3L A;  2XXR A;  4NE4 A;  3HHG A; 
#chains in the Genus database with same CATH homology
 2XWV A;  1EYI A;  4MHF A;  4MJO A;  4DI4 B;  1FBC A;  4N8Y A;  1XI6 A;  5ET6 A;  4H46 A;  1FBE A;  4OAN A;  2FIX A;  4OVT A;  4F19 A;  1FPG A;  2FBP A;  2B4M A;  1IMC A;  4PF6 A;  5I5P A;  1Q9D A;  3B8B A;  5IGA A;  4HE0 A;  2XWK A;  2WBD A;  2HHM A;  4X04 A;  4PGN A;  4PE3 A;  5LDZ A;  2Y5K A;  4AS5 A;  3EKI A;  3MST A;  1BK4 A;  4PFB A;  1FBP A;  2VT5 A;  4AS4 A;  1RDX A;  4N6K A;  1IMF A;  5LTC A;  1FBG A;  2DE4 A;  3KC0 A;  2Q8M A;  1DBZ A;  2ZZX A;  4P47 A;  1NV7 A;  2KQZ A;  4HE2 A;  3IFA A;  5IM2 A;  1NV4 A;  4XF5 A;  2DE2 A;  3CHG A;  3IFC A;  3BIH A;  2ZZW A;  4M1V A;  1NV5 A;  5EQ8 A;  4MCO A;  5ET5 A;  2F3D A;  3W9W A;  2R8T A;  4F1U A;  4NX1 A;  4JVC A;  4LN5 A;  5IZ1 A;  4HCY A;  1FSA A;  4N4U A;  3MYU A;  1NV6 A;  2WEF A;  4F1V A;  4XFE A;  4GX3 A;  1FBF A;  4OVP A;  4PC9 A;  2DVZ A;  4DI3 D;  2FIE A;  1DK4 A;  3U65 A;  1NUZ A;  4NQ8 A;  4O94 A;  3ISP A;  4OA4 A;  1FJ9 A;  1NUY A;  4NN3 A;  2XWI A;  4I40 A;  1IMA A;  5EQ7 A;  4O7I A;  1KA1 A;  1FPK A;  5JK4 A;  5J16 A;  1IMD A;  1D9Q A;  1LEV A;  4X8R A;  2L5V A;  4NHB A;  4PBH A;  1K9Y A;  4OVS A;  2B4L A;  4GWY A;  1RDZ A;  4PBQ A;  4MAG A;  1CNQ A;  4P9K A;  3E78 A;  2P3N A;  2HXR A;  4N6D A;  4I3E A;  2PFZ A;  3RPL A;  3B50 A;  1RDY A;  2FVZ A;  4PTK A;  2QVR A;  4N15 A;  1FPB A;  1K9Z A;  4MNP A;  2KR0 A;  2XWO A;  4PAK A;  1SPI A;  4QXD A;  4HXV A;  4QBA A;  4OVQ A;  3GYY A;  4NGU A;  4KXP A;  4PGP A;  4PFI A;  4NF0 A;  1LBZ A;  5I7I A;  5ESY A;  2MKZ A;  4IR8 A;  4YIC A;  5DW8 A;  4GWW A;  1FPF A;  2CZH A;  5IZ3 A;  2BJI A;  2WYP A;  4HE1 A;  2OWZ A;  1JP4 A;  1IME A;  3BIG A;  4PAF A;  4MMP A;  5EYH A;  1FBH A;  1QGX A;  1FPL A;  5EYG A;  2QPQ A;  2CZI A;  4N91 A;  5F24 A;  1G0I A;  1LBX A;  1FJ6 A;  2ZZV A;  1AWB A;  3LV0 A;  2QVV A;  4GBV A;  4MEV A;  2Q74 A;  3SZP A;  4N17 A;  2F5X A;  4I3Y A;  1FPE A;  2OX3 A;  3NOH A;  1YZ0 A;  4PDH A;  1FPI A;  1NV2 A;  3LUZ A;  2V3Q A;  2VPN A;  4P8B A;  1FRP A;  3KC1 A;  4X9T A;  1LBW A;  3FBP A;  4PET A;  1NV1 A;  2CZK A;  3RYD A;  3QMF A;  4PAI A;  1NUX A;  5EQ9 A;  4P56 A;  4N81 A;  5ET8 A;  2CEY A;  4PF8 A;  4GWX A;  4G61 A;  1NV0 A;  5J1D A;  4PCD A;  3FXB A;  4P1L A;  2DE3 A;  1EYK A;  4GBW A;  2XA5 A;  1VDW A;  1LBY A;  1YYZ A;  2PFY A;  4HCW A;  4NAP A;  1NI9 A;  2Y5L A;  5IZ3 B;  5A5L A;  5T3J A;  2WBB A;  1EYJ A;  4H45 A;  2HPG A;  4N8G A;  4MIJ A;  1NUW A;  1FTA A;  2QVU A;  4MNC A;  4PDD A;  2JJK A;  1YXI A;  4GWZ A;  4MX6 A;  2DDK A;  2WYK A;  4P3L A;  5EQA A;  2F3B A;  3PTY A;  2P3V A;  2CEX A;  1KZ8 A;  2FHY A;  4FBP A;  3E79 A;  1NV3 A;  1FBD A;  2PCR A;  1FPJ A;  2QFL A;  3A29 A;  3KBZ A;  1KA0 A;  2V4C A;  1INP A;  4UAB A;  2Q9T A;  1LBV A;  4MNI A;  4O8M A;  2VPO A;  3D1R A;  3T1B A;  4XEQ A;  2GQ1 A;  3T0J A;  5ET7 A;  4PFR A;  3W9V A;  4GWU A;  4YZZ A;  3ROJ A;  2WX9 A;  4GWS A;  5FBP A;  2HZL A;  4P1E A;  1DCU A;  1G0H A;  3HFU A;  4NG7 A;  1IMB A;  3RPL B;  2HZK A;  4JVD A;  4O7M A;  5I3S A;  5CM6 A;  4F18 A;  1FPD A;  4GX4 A;  4OVR A;  5IZZ A;  2XXK A;  4JVI A;  4GX6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...