3KN8A

Crystal structure of haemophilus influenzae y196a mutant holo ferric ion-binding protein a
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
308
structure length
308
Chain Sequence
DITVYNGQHKEAATAVAKAFEQETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIQQTAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSGAFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYAWYNLAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEALVAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Metal binding protein
molecule keywords Iron-utilization periplasmic protein
publication title The role of vicinal tyrosine residues in the function of Haemophilus influenzae ferric binding protein A.
pubmed doi rcsb
source organism Haemophilus influenzae
total genus 114
structure length 308
sequence length 308
ec nomenclature
pdb deposition date 2009-11-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kn8A01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3kn8A02
4R6YA 5AE4A 3IL1B 4LZ5A 5AA2D 1GTKA 4O3CA 3EHUA 2HAUA 3JYRA 1SYHA 3G3KA 2RC7A 5I56B 2DXRA 4R9FA 4H65A 2QS1A 1LAGE 1R6ZA 3DP6A 4GF8A 1ZIUA 4OFJA 2I3VA 4FORA 5KDTB 1BLFA 2O51A 3TEPA 1SI0A 1DPPA 5DTBA 2OCUA 3K1MA 1OLCA 3T93B 1Y20A 3I3VA 2A5SA 3SERA 3MAMA 1VSOA 3CRBA 3RT6B 3TKDA 5ITOA 1SW5A 3K0VA 1M5DA 4R72A 3ONMA 4GLIA 3U72A 1I6AA 2DWHA 3BFTA 3N26A 4MF3A 1N7WA 3PUZE 5L8DA 3OMBA 3USDA 3IR1A 4JDFA 3D4GA 3KJ7A 4EXLA 1EZOA 3ZSFA 2OLBA 2HAVA 2I4CA 3IO4A 2O69A 1QKBA 5J1DA 3QAXA 3H7MA 4PP0A 4ND9A 4IB2A 3TODA 2I48A 4GXSB 3HCQA 3KJTA 3HPIA 4IO7A 3LBSA 2PYYA 4HS7A 2ONSA 2F97A 1MQGA 4EXKA 3H03A 1I6QA 1N3WA 2I6EA 1NMUA 1N04A 4BDMA 3N5LA 4NWDA 3MZ9A 3EQ1A 3TUSA 2GFEA 5JEIA 2UVGA 4FATA 4U21A 1QVSA 1B1HA 3C36A 3BKIB 2RC9A 2R6GE 1PB7A 3LSXA 1TWYA 2VD2A 4ZS9A 1SW1A 3GZGA 2ANJA 3B7DA 3MVZA 4JXIA 3SDFA 3T9VA 1LFHA 3RTFB 2NWJA 1EU8A 3W9VA 2F5XA 1FQFA 1NFTA 2DE4A 3VXBA 3S9EA 4N07A 5B7DA 5EYFA 4C0RA 4FJPA 5AA4B 2XXXA 1P1OA 2F7BA 3ILUB 1MPCA 3CG1A 2WKYA 5A5XA 1UTHB 4LATA 1IXCA 3EN3A 4OETA 1USYE 1DTGA 5AA3A 2YJPA 5KCJB 2B3FA 2O6AA 3Q28A 4P0GA 4Q0CA 2HCAA 4ZE8A 1B6HA 3RNNA 1Z7NE 2F8DA 3U93A 2UVIA 4Z7EA 4AB5A 4ZEDA 3A09A 5K2YA 5CMKA 3WAFA 4XIGQ 2H99A 3KG2A 4WEPA 2Q8JA 1FQAA 5ITPA 2G29A 3K6WA 1S9TA 4Z0IA 5I58A 1RKMA 4MBPA 1PBQA 3E3KA 3T9HB 3T96B 1SW4A 3FJMA 4FE8A 2NOOA 3O6IA 1WVJA 1J1NA 1FTKA 3GLBA 1H3DA 2QS2A 3PUYE 1MXZA 3FVNA 3IORA 1QUJA 3O6GA 2FA7A 3WAEA 3KOTA 1JNFA 4GVOA 2GHAA 1IZ1A 4OESA 3M8UA 1LBCA 3IX1A 2QS4A 2DYXA 2OBGA 3QIMA 3B6QA 4H0WA 4ZE9A 4U23A 5H8SA 1Y4TA 2Y7IA 2D3IA 1IIWA 3O66A 5L9OA 1IUDA 4P11A 3TFLA 3VVFA 3DELB 3JZJA 3U92A 1OQGA 3L6GA 4I9DA 5EHSA 4F29A 3SESA 4DDDA 3C32A 4TOZA 4KHZE 4OTEA 1B3FA 4ELRA 1NH7A 1M5FA 2XXQA 2I49A 5H8NB 5I57B 5HPQA 1B1XA 3EHSA 1B7HA 3VLVA 1FQBA 3TELA 2F6PA 3U94A 3O9PA 4X48A 4M1VA 3K1PA 1PBPA 1B58A 1N0TA 4NF8A 1M5CA 3FXRA 3TQLA 2B3BA 2X26A 1B52A 1TFAA 3OSQA 5DVFA 2YPNA 2XXUA 1MXYA 2OJTA 5AA2B 1II5A 2PT1A 4OFLA 2I0CA 4KCDA 3IOUA 2H98A 4MLVA 4OVJA 3GBBA 1LFGA 4MH5A 4R6HA 1ZLQA 3SEUA 4N6PA 1PC3A 4EUOA 5BUUA 4KYSA 4PETA 5L9MA 4H8JA 4NMYA 5H8HA 3MP1A 1XVXA 1R1NA 3PPPA 1P1UA 4YZZA 4QFNA 1LCTA 3PPQA 4HW8A 3LUYA 1B5HA 2ZNUA 3D4CA 2UVHA 2NUVA 5H8FB 1MPDA 4H1XA 2XX7A 3DLNA 4G77A 4Q8RA 4FEBA 1MRPA 4R2FA 3TCFA 1LAHE 3Q26A 2GRVA 3L6HA 1ELJA 4G68A 3IB2A 1OVTA 1Z7ME 3QUJA 2XXIA 4XKNA 4H5FA 1UTBB 5I2NA 2D21A 1EZ9A 5I56A 2HXWA 4RA1A 2DS9A 1B7UA 4K3FA 3MVXA 1Y9UA 4NE4A 2OWTA 1VFDA 3ZKLA 1FQEA 5I59A 1B3LA 3T66A 4U4SA 3MPLA 5IKBA 5TPAA 1DMBA 5EHMA 1TXFA 1LB8A 4IO3A 2A5TB 2XHDA 3BFUA 1VR5A 2ZNSA 1OMPA 4BLAA 3ILTB 2BJJX 4ELOA 4BDRA 2VGQA 1AH5A 4RK9A 3CFXA 1H45A 3N6UA 2B65A 3H6VA 1LGBC 4POXA 4R2BA 1D9VA 1PB9A 2ZYMA 5FHMA 4X9TA 1FTMA 1Q35A 4TLMB 1A54A 2OWSA 5DVIA 2DSFA 4GD5A 1FW0A 4NF6A 3R7XA 3FGSA 5CMBA 2I4BA 2Y7KA 3KBRA 4THIA 3CFLA 3MC2A 3C31A 4DZ1A 4MFIA 1MQIA 4RK2A 5F1QA 1JVYA 3BBRA 3FATA 4U22A 2CZLA 2M8CA 1URDA 2Y7WA 3OO6A 1SW2A 4YKIA 3C4MA 4U1OA 1GGGA 4RJZA 3UORA 1UQWA 3QSLA 3PMWA 5IAIA 2QS3A 3TTNA 2AL4A 2RC8A 4PE5B 1SVXB 3SKPA 4HTGA 5TP9B 4JWYA 3MWBA 1AOVA 2DWIA 3QK6A 3TTLA 4IO4A 1XVYA 2F34A 4MLQA 3KN7A 2P1SA 2AYSA 3KOSA 5AA4A 2XXWA 1DOTA 2ZMBA 1B46A 3OO7A 5B70A 1FQCA 3M3KA 1PEBA 1BIYA 4F1YA 4C1TA 3CR9A 3KFMA 4ISUA 4PQJA 4DXBA 3LSWA 3B6WA 2ZYKA 3G7WA 2IA4A 3FXQA 4O3BA 5CC2A 3CG3A 5HBCA 3VV5A 3W15C 4QSEA 1USYH 2I3WA 2HZLA 1D3KA 2XXPA 1LCFA 3TPAA 1YAEA 4I1DA 4ZZAA 1Q1KA 4KPTA 2X7QA 1P1WA 1MY3A 4YMBA 2GHBA 4R6KA 1NH8A 1JETA 4KYEA 4DLDA 4NWCA 3S2VA 1Y1ZA 1N7XA 3N94A 3K02A 3VVEA 2AL5A 3KZGA 4QFOA 1B0HA 5CBRA 4KYDA 4ZEBA 1TFDA 3CFZA 5CMCA 3HSTA 2DXYA 3IJOB 1LLSA 4JBZA 1LB9A 1B7ZA 3KN3A 4XKQA 1NNTA 2Z23A 3IJXB 3T9XB 1MXUA 3FUZA 4OQOA 1SQYA 5I2KA 4RXLA 4ESWA 3RY3A 5F7VA 2DVCA 2P0SA 4WEDA 4XKPA 2CMOA 1L5TA 3TYHA 1ZMGA 4P0IA 4NEDA 3PU5A 4L17A 4LQ2A 1M5BA 2ZXTA 4DXCA 3CSBA 2XX8A 3UIFA 3H6UA 5H8NA 3FVGA 2KLFA 4RYAA 3IO6A 3TQWA 2ZNTA 3U1OA 2O1LA 2VHAA 1QJMA 3RTWB 1B51A 4QFKA 4G4PA 3VFJA 1VE4A 2H4IA 2DOJA 1JVXA 3EHTA 3OELA 1ZU0A 1YPNA 4G8NA 1MY2A 3FVKA 4DXUA 3OEKA 2DWAA 2XXVA 3MVYA 3MZ1A 4G8MA 3V8XB 1HSEA 4OXVA 5CM6A 2PVUA 4LONB 4U2RA 1P1QA 3MBPA 3RT8A 3OO8A 4OWDA 1FTJA 3UGWA 1EH3A 4GRKA 1US4A 2XXYA 4F22A 2O7IA 2QMXA 2O68A 2QL3A 1EZPA 3CVGA 2QPQA 1GR2A 3SEXA 2ZYOA 1LAXA 1MG1A 1M5EA 5JTYA 3FD3A 3PUWE 2ABHA 1AMFA 4YKKA 3IAZA 4FAJA 4FIMA 3V89B 1A8EA 1YTVA 4ZZEA 5A5XB 1XS5A 5H8QA 1LSTA 4H6DA 4ONYA 1MY4A 2UXAA 1A99A 1HSJA 1O64A 2V3UA 5HM4B 4I62A 3AXFA 4GIZA 1AIVA 4TQUQ 2FNCA 2H9BA 4YMAA 5BWJA 2PT2A 4JB7A 3Q25A 1XOCA 5I58B 2UYEA 4NF5B 3EF7A 3K6XA 2NVUB 1MQJA 3O29A 3R26A 1MDP1 3MZBA 3RPWA 3FVOA 1LFIA 4LA9A 1OLAA 1QUKA 2DWJA 3K2DA 4GL0A 1GVCA 3KEIA 4YKPA 4FEDA 1PB8A 1FQDA 3SEWA 4BDNA 5DEXB 4YB6A 3K1NA 4M4GA 4YKJA 1URSA 2A5TA 4UA8A 2D5WA 4PFUA 2E1SA 4HCYA 3OSRA 4ZEIA 4OMBA 3Q29A 1PDAA 4NF4A 1B05A 3VXCA 4KQPA 2OZZA 2GH9A 1FCKA 3TMGA 5CI5A 3O97A 4F1VA 1B9JA 3T22A 3C33A 5FHOA 3UK4A 2F7AA 3S9LC 2RCAA 4GWOA 3E9XA 1IQ7A 1A7LA 2DP8A 2QRYA 3O28A 3EPEA 4WKMA 4QF9A 2Q9TA 1ZBMA 5M2VA 1B5JA 4R75A 4U1ZA 3TDJA 3HHGA 4OFOA 3TTMA 5KDTA 2HZKA 2DQVA 4O3AA 3N6TA 1IXGA 4DIGA 1P1NA 2VD3A 3UN6A 4XTCQ 3VLUA 3OD7A 1NNFA 3K01A 2V25A 3C34A 1H76A 3PD8A 1DSNA 3G3GA 1Y4CA 1NKXA 2F7CA 3GBAA 1AL3A 1NL5A 1B0LA 3KN8A 3TTKA 3HO7A 4DCXA 3UP9A 2RINA 5H8HB 1HSLA 2HEUA 2X7PA 1KWHA 3IB0A 3KGCA 1FTLA 2FYIA 2REGA 3OO9A 4KR5A 3LSFB 1NNKA 4GQOA 2OK2A 3B6TA 3QXMA 4XXUA 2O84X 1XHYA 1JEUA 2XD3A 2V93A 1QUIA 4KFQA 4Q5TA 2Y7RA 3S9MC 4QSDA 3MP6A 3Q27A 4QFLA 2AIXA 4NTLA 3W9WA 2I0BA 4ECFA 2NXOA 4OEUA 1MH4A 3JV9A 4G68B 2ONRA 3T9UA 1Y1MA 4ZEFA 4F2QA 1MY1A 1POTA 3M3FA 3IOTA 1MM7A 5I2NB 3DM0A 1SDXA 3VLWA 1LBBA 5ICTA 4GL8A 4RNSA 3VVDA 4EQ7A 1MXXA 3PGFA 1F9BA 5ISUA 4UACA 4E0WA 3FJGA 5I59B 3PD9A 5K2XA 4DE8A 4FECA 3H3GA 4QFPA 3LR1A 1I6BA 3GXAA 3IK6B 5TPAB 4E0XA 4R73A 4JWOA 3FV1A 4F31B 3G3HA 1UTHA 4BDLA 1CB6A 3RGYA 5FTIA 3UA8A 5KCJA 3IOVA 3QYTA 3VE1B 4RPNA 4F1UA 4ZECA 3A3UA 4R9GA 3KSJA 2Z8FA 5I84A 4LVQA 2RF1A 1ZKBA 3V5AA 4DCYA 4H5GA 3LC8A 1B3GA 4NF6B 3OOAA 3PUVE 2E0SA 2QJEA 3E4RA 4LZ7A 1MXWA 1QULA 4IO5A 3FIRA 5CRYA 3F11A 4JWXA 4Q30B 4F3PA 2QMWA 3KSXA 4F3BA 3FV2A 3PPOA 3O2AA 1S7YA 5FTHA 1TT1A 1JW1A 4C1UA 2LAOA 4EF2A 5FHNA 2XX9A 3O6HA 4F3SA 1US5A 2G93A 1O63A 1B40A 3MUQA 2IEEA 3CIJA 2Z22A 3IB1A 4QHQA 3ECRA 5TU0A 4IY6A 3RQTA 1ZTYA 3G3JA 2UYFA 3R6UA 3S4UA 1MXVA 2Q2AA 3PV0E 1DPEA 1BKAA 4H8IA 1A40A 5KZTA 5DT6A 1B2HA 1QW0A 4QRZA 2P2AA 5LOMA 4YB5A 4YICA 2V84A 2DE2A 2F78A 2XXHA 4EDPA 1MS7A 4X1BA 2I58A 3ZKKA 3PMXA 5I57A 4I8CA 1D9YA 2F35A 4ELPA 2Q2CA 4AB6A 1UIUA 3K6VA 5ICQA 5CBSA 2PMSA 4OHNA 2R9JA 4LZ8A 3MP8A 4HCWA 3A3CA 2Q88A 4LUBA 4NF5A 4JSOA 5AA2A 2V3TA 2H25A 2HQ0A 1MPBA 4PFTA 5CMMA 1O7TA 1IXHA 4KD5A 4ELQA 1B32A 4EQ9A 1S50A 1R9LA 2REJA 3CI8A 1MDQA 1URGA 2Q89A 1XT8A 3THIA 1N76A 1Y3PA 3HV1A 2F36A 5DEXA 3PPRA 3QUFA 4OZ9A 1B3EA 4YB7A 3OEMA 1MY0A 3H4ZA 5JK4A 1ZJLA 3MVWA 3E13X 1T0KA 5I2KB 1MH3A 4R74A 5DYHA 1IEJA 3FASA 5AA1A 1OIBA 4F3GA 1OVBA 2HFBA 3H6TA 5H8FA 2VP1A 1LAFE 4WXJA 1IITA 1XC1A 2RCBA 4OERA 4EF1A 1JW5A 3RN8A 4LQ5A 1H44A 3TCGA 3K4UA 1NNPA 1BP5A 4KCCA 4ESXA 5ELVA 2PX1A 3K6UA 2F6GA 1FTOA 2DVZA 1UTBA 4TLLB 3MPKA 4PFWA 4X1DA 4N13A 1WODA 1MQDA 3U8QA 1B4HA 1SYIA 2YLNA 3FXUA 3SEYA 2DE3A 1DTZA 1H43A 1OQHA 2XXTA 3K00A 3V83A 3TCHA 4IO6A 2R71A 1R9QA 1POY1 1Y3QA 2ALUA 3OXNA 3HN0A 1A55A 2XXRA 2O1MA 3VDFA 2QSXA 1JW4A 5JTYB 4XKRA 4BDOA 3I6VA 3ODBA 2W7YA 1I69A 1SD3A 3G3FA 2XD2A 5DVJA 1JQFA 3I5OA 4F19A 3DP8A 3H06B 5H8QB 1B4ZA 4AQ4A 3CSGA 1A8FA 4GOTA 5L9SA 3FJ7A 3MQ9A 3S9NC 4YAHX 2PBWA 3IOWA 4GFRA 1QKAA 1MQHA 1JEVA 2RKMA 1MM6A 3PUXE 3SEVA 4OENA 2V3QA 4IGTA 4NF8B 4LP2B 3HHFA 4POWA 4QSCA 1SI1A 3P7IA 4IO2A 1SBPA 2ONKE 2THIA 4YU0A 3H6WA 1WDNA 3RUMA 3OENA 3MJNA 3DP4A 2VOZA 3TTRA 1GV8A 1VFEA 4PFYA 1N3XA 2ZYNA 4GXAA 3LSLA 5TP9A 3RLFE 1B5IA 1RYXA 1YCJA 1RYOA 4G68C 3G3IA 3C9HA 4OEVA 4KI0E 4ZDMA 4F2OA 3M3LA 2O7UA 4BDQA 4RPOA 1P99A 3C35A 4U4XA 1D4NA 2Y84A 4RY1A 3MW0A 3ZS6A 4F39A 2ESNA 4ZEKA 1IXIA 2Z8EA 1B3HA 2Z8DA 4JSDA 1ATGA 1CE2A 1N84A 2H5YA 4NF4B 1UIVA 3TAJA 3TZAA 4F18A 4OYVA 1ANFA 3FZVA 4H67A 2Y7PA 4IGRA 4EQBA 3PMVA 2UVJA 4G8HA 4IY5A 1BTJA 1Y3NA 3PPNA 4G2ZA 3SETA
chains in the Genus database with same CATH superfamily
4R6YA 5AE4A 3IL1B 4LZ5A 5AA2D 1GTKA 2QVVA 4O3CA 3EHUA 3ISPA 2HAUA 3JYRA 1SYHA 2PFZA 3G3KA 2V4CA 3NOHA 2P3VA 4O94A 2RC7A 4GWXA 5I56B 3BIGA 2DXRA 4R9FA 1FBDA 4H65A 1LBWA 2QS1A 1LAGE 1R6ZA 3DP6A 4GF8A 4PFBA 1ZIUA 4OFJA 2I3VA 4FORA 5KDTB 1BLFA 2O51A 3TEPA 1SI0A 1DPPA 5DTBA 1NV3A 2OCUA 3K1MA 1OLCA 3T93B 1Y20A 3I3VA 1IMDA 4DI4B 2QVUA 2A5SA 3SERA 3MAMA 1VSOA 3CRBA 2FVZA 3RT6B 3TKDA 5ITOA 1SW5A 3K0VA 1M5DA 4R72A 3ONMA 4GLIA 3U72A 1I6AA 3MYUA 2DWHA 1IMCA 3BFTA 3N26A 4MF3A 1N7WA 3PUZE 5L8DA 3OMBA 3USDA 5LTCA 5ET7A 4MNCA 3IR1A 4JDFA 3D4GA 3KJ7A 4EXLA 1EZOA 2HXRA 3ZSFA 2OLBA 2HAVA 2XA5A 2I4CA 3IO4A 2O69A 1QKBA 5J1DA 3QAXA 3H7MA 4O8MA 4I40A 4PP0A 1Q9DA 4ND9A 4IB2A 3TODA 4PAFA 2I48A 4GXSB 3HCQA 3KJTA 3HPIA 4IO7A 3LBSA 3RPLB 2PYYA 4HS7A 2F3DA 2ONSA 3E78A 4JVCA 2F97A 4G61A 1MQGA 4EXKA 1NUXA 5IM2A 3H03A 1I6QA 1N3WA 2I6EA 1NMUA 1N04A 4BDMA 3N5LA 4NWDA 3MZ9A 3EQ1A 3TUSA 4MAGA 2FIXA 2GFEA 5JEIA 2UVGA 4GWWA 4FATA 4U21A 1QVSA 1B1HA 3C36A 4N17A 3BKIB 1IMFA 2RC9A 2R6GE 1PB7A 3LSXA 1TWYA 2VD2A 4ZS9A 5I3SA 1SW1A 3GZGA 2ANJA 3B7DA 5IZ3A 3MVZA 4JXIA 2WYPA 3SDFA 3T9VA 1LFHA 3RTFB 2NWJA 1EU8A 3W9VA 2F5XA 1FQFA 1NFTA 2DE4A 3VXBA 3S9EA 4N07A 5B7DA 5EYFA 4GBVA 4C0RA 4FJPA 5AA4B 2XXXA 1P1OA 2F7BA 3ILUB 1MPCA 3CG1A 2VPOA 4PGPA 2WKYA 5A5XA 1UTHB 4LATA 2BJIA 1IXCA 3EN3A 4OETA 1USYE 1RDYA 1DTGA 4OVSA 5AA3A 2YJPA 1QGXA 4PGNA 5KCJB 2B3FA 1SPIA 2O6AA 5FBPA 3Q28A 4P0GA 4Q0CA 2HCAA 4ZE8A 4GWZA 1B6HA 3RNNA 1Z7NE 2F8DA 3U93A 2UVIA 4Z7EA 4AB5A 4ZEDA 3A09A 5K2YA 5CMKA 1EYIA 3WAFA 4XIGQ 2H99A 3KG2A 4WEPA 2Q8JA 1FQAA 5ITPA 2G29A 3K6WA 1S9TA 4GX6A 4Z0IA 5I58A 1RKMA 4MBPA 1PBQA 3E3KA 3T9HB 3T96B 1SW4A 3FJMA 4FE8A 2NOOA 3O6IA 2KQZA 1WVJA 1J1NA 1IMAA 1FTKA 3GLBA 1H3DA 2QS2A 3PUYE 1MXZA 3FVNA 3IORA 1QUJA 3O6GA 2FA7A 3WAEA 3KOTA 1JNFA 4GVOA 2GHAA 1IZ1A 4P56A 4OESA 3M8UA 1LBCA 3IX1A 2QS4A 2DYXA 2OBGA 4N8GA 3QIMA 3B6QA 4H0WA 4ZE9A 4P1EA 4U23A 5H8SA 1Y4TA 4NAPA 2Y7IA 1NV6A 2D3IA 1IIWA 4H46A 4PBQA 3O66A 5L9OA 3CHGA 1IUDA 4P11A 3TFLA 3VVFA 3DELB 3JZJA 3U92A 5EQAA 1OQGA 3L6GA 1FJ9A 4I9DA 5EHSA 4F29A 3SESA 4DDDA 3C32A 4TOZA 4KHZE 4OTEA 2WBBA 1B3FA 4ELRA 1NH7A 1M5FA 2XXQA 2I49A 5H8NB 5I57B 5HPQA 3PTYA 1B1XA 3EHSA 4NX1A 1B7HA 4XFEA 3VLVA 1FQBA 3TELA 2F6PA 3U94A 3O9PA 5ESYA 4X48A 4M1VA 5ET6A 3K1PA 1PBPA 1B58A 4N4UA 1N0TA 4NF8A 1M5CA 3FXRA 3TQLA 2B3BA 2X26A 1B52A 1TFAA 3OSQA 5DVFA 2YPNA 1FJ6A 2XXUA 1MXYA 4P9KA 1LBZA 2OJTA 5AA2B 1II5A 4QXDA 2PT1A 3B8BA 4OFLA 2R8TA 2I0CA 4KCDA 3IOUA 2H98A 4MLVA 4OVJA 2HHMA 3GBBA 1LFGA 4MH5A 4R6HA 1ZLQA 3SEUA 4N6PA 3ROJA 1PC3A 5IGAA 5EYGA 4EUOA 5BUUA 4KYSA 2QFLA 4PETA 5L9MA 4PE3A 2PFYA 4H8JA 4NMYA 5H8HA 3MP1A 1XVXA 1R1NA 1NV2A 3PPPA 1P1UA 4YZZA 4QFNA 1NV4A 1LCTA 4NQ8A 3PPQA 4HW8A 3LUYA 1B5HA 2ZNUA 3D4CA 2UVHA 2NUVA 4AS5A 5H8FB 4X8RA 1MPDA 4H1XA 2XX7A 3DLNA 4G77A 4Q8RA 1FPBA 1DBZA 4FEBA 1MRPA 3MSTA 4R2FA 3TCFA 1LAHE 3Q26A 1K9ZA 2GRVA 3L6HA 1ELJA 4G68A 3IB2A 1KA1A 1LEVA 1OVTA 1Z7ME 3QUJA 2XXIA 1CNQA 4XKNA 4H5FA 1UTBB 4MCOA 5I2NA 2D21A 1EZ9A 5I56A 4MHFA 2HXWA 4RA1A 2DS9A 1B7UA 4K3FA 3MVXA 1Y9UA 4NE4A 2OWTA 1VFDA 3ZKLA 1FQEA 5I59A 1B3LA 2VPNA 3T66A 1INPA 5ET8A 4U4SA 3MPLA 5IKBA 1FBEA 5TPAA 1DMBA 5EHMA 1TXFA 1LB8A 4IO3A 2A5TB 2XHDA 3BFUA 1VR5A 2ZNSA 1OMPA 4BLAA 3ILTB 2BJJX 3KBZA 1FSAA 4ELOA 4BDRA 2VGQA 1AH5A 4RK9A 3CFXA 1H45A 3N6UA 2B65A 3H6VA 1LGBC 4POXA 4R2BA 1D9VA 1PB9A 4PTKA 2ZYMA 5FHMA 4X9TA 1FPDA 1FTMA 1Q35A 4PAIA 4TLMB 1A54A 2OWSA 5DVIA 2DSFA 4GD5A 1FW0A 4NF6A 3FGSA 3R7XA 5CMBA 2PCRA 2I4BA 3EKIA 2Y7KA 4NF0A 3KBRA 4THIA 3CFLA 3MC2A 3C31A 4DZ1A 5ET5A 4MFIA 1MQIA 4RK2A 5F1QA 1JVYA 3BBRA 4P47A 2B4LA 3FATA 4U22A 2CZLA 2M8CA 1YXIA 1URDA 4PAKA 2Y7WA 3OO6A 1SW2A 4YKIA 3C4MA 2QVRA 4U1OA 1GGGA 4RJZA 3UORA 1UQWA 5A5LA 3QSLA 3PMWA 5IAIA 2QS3A 3TTNA 2AL4A 2RC8A 2ZZWA 2XWKA 1NI9A 2WEFA 4PE5B 1K9YA 1SVXB 3SKPA 4HTGA 4MIJA 4FBPA 5TP9B 4JWYA 3MWBA 4MNIA 2DWIA 1AOVA 3QK6A 4QBAA 3TTLA 4IO4A 4GX3A 1XVYA 2F34A 4MLQA 3KN7A 2P1SA 5I5PA 2AYSA 3KOSA 5AA4A 2XXWA 1DOTA 2ZMBA 1B46A 3OO7A 5B70A 1FQCA 4N15A 4NHBA 3M3KA 1PEBA 1BIYA 4F1YA 4C1TA 3CR9A 5EQ9A 3KFMA 4ISUA 4PQJA 4DXBA 3LSWA 4PFIA 3B6WA 2ZYKA 3G7WA 2IA4A 3FXQA 2WBDA 4O3BA 5CC2A 3CG3A 5HBCA 3VV5A 3W15C 4QSEA 4PBHA 1USYH 4N6DA 2I3WA 2HZLA 1D3KA 2XXPA 1LCFA 3TPAA 1YAEA 4I1DA 4ZZAA 3KC1A 4IR8A 1VDWA 1Q1KA 2XWVA 4HE0A 4KPTA 2X7QA 1P1WA 1MY3A 4YMBA 4HE1A 2GHBA 4R6KA 1NH8A 1JETA 4KYEA 4DLDA 4NWCA 3S2VA 2CEXA 1Y1ZA 1N7XA 3N94A 3K02A 4JVIA 3VVEA 2AL5A 4O7IA 2CZKA 3KZGA 4QFOA 4P8BA 1B0HA 5CBRA 4KYDA 4ZEBA 1TFDA 3CFZA 5CMCA 3HSTA 2DXYA 4GBWA 3IJOB 3A29A 1LLSA 4JBZA 1LB9A 1B7ZA 2JJKA 3KN3A 4XKQA 1NNTA 2Z23A 3IJXB 5IZ1A 3T9XB 1MXUA 3FUZA 4OQOA 1SQYA 5I2KA 4RXLA 4ESWA 3RY3A 5F7VA 2DVCA 2P0SA 4WEDA 3SZPA 4XKPA 2CMOA 1L5TA 4UABA 3TYHA 1FRPA 4O7MA 1ZMGA 1NV5A 4P0IA 4NEDA 3PU5A 4L17A 4LQ2A 1M5BA 2ZXTA 4DXCA 1FPJA 3CSBA 5EQ8A 2XX8A 3UIFA 3H6UA 5H8NA 3FVGA 2KLFA 1NUWA 4RYAA 3IO6A 3TQWA 4GWUA 2ZNTA 3U1OA 4MMPA 2O1LA 2VHAA 1QJMA 3RTWB 1B51A 4QFKA 4G4PA 3VFJA 1VE4A 2H4IA 2DOJA 1JVXA 3EHTA 3OELA 1ZU0A 4PF6A 1EYJA 1YPNA 4G8NA 1MY2A 3FVKA 4DXUA 4PF8A 3OEKA 2DWAA 2XXVA 3MVYA 3MZ1A 4G8MA 3V8XB 1HSEA 4OXVA 5CM6A 2PVUA 4LONB 4U2RA 1P1QA 3MBPA 3RT8A 3OO8A 4OWDA 1FTJA 3UGWA 1EH3A 3LUZA 5IZ3B 4GRKA 1US4A 2XXYA 4F22A 2O7IA 2QMXA 2O68A 2QL3A 1EZPA 1LBVA 3CVGA 2QPQA 1GR2A 3SEXA 2ZYOA 3QMFA 1LAXA 1MG1A 1M5EA 5JTYA 3FD3A 3PUWE 2ABHA 1AMFA 2FBPA 4YKKA 4N6KA 3IAZA 4FAJA 4FIMA 3V89B 1A8EA 1YTVA 1FPIA 4ZZEA 5A5XB 1XS5A 5H8QA 1LSTA 4H6DA 4ONYA 1MY4A 2UXAA 1A99A 4GWYA 1HSJA 1O64A 2V3UA 5HM4B 4P1LA 4I62A 3AXFA 4GIZA 3IFAA 1AIVA 4TQUQ 2FNCA 2H9BA 4HXVA 4YMAA 2WX9A 5I7IA 5BWJA 1RDXA 1D9QA 2PT2A 4MX6A 4JB7A 3Q25A 1XOCA 5I58B 2UYEA 4NF5B 4DI3D 4JVDA 2B4MA 3EF7A 3K6XA 2NVUB 1YYZA 1MQJA 1NV0A 3O29A 3R26A 1MDP1 3MZBA 3RPWA 3FVOA 1LFIA 4LA9A 1OLAA 1QUKA 2DWJA 3K2DA 4GL0A 1GVCA 3KEIA 4YKPA 4FEDA 1PB8A 1FQDA 3SEWA 4AS4A 4BDNA 5DEXB 4YB6A 3K1NA 4M4GA 4YKJA 1LBXA 1URSA 2A5TA 4UA8A 2D5WA 4PFUA 4PCDA 2E1SA 4HCYA 3OSRA 4ZEIA 4OMBA 3Q29A 1PDAA 4NF4A 1B05A 2Q8MA 3VXCA 4KQPA 3BIHA 2OZZA 2GH9A 1FCKA 3TMGA 5CI5A 3O97A 4F1VA 1B9JA 3T22A 3C33A 5FHOA 3UK4A 2F7AA 3S9LC 2RCAA 3E79A 4GWOA 3E9XA 1IQ7A 2OWZA 1FBPA 1A7LA 2DP8A 4H45A 2QRYA 3O28A 4WKMA 3EPEA 4QF9A 2Q9TA 1ZBMA 5M2VA 1B5JA 3HFUA 4R75A 4U1ZA 3TDJA 1NV7A 4I3YA 3HHGA 4OFOA 3TTMA 3D1RA 5KDTA 2HZKA 2DQVA 2CZIA 4O3AA 3N6TA 1IXGA 4DIGA 1P1NA 2VD3A 3UN6A 4XTCQ 3VLUA 3OD7A 1NNFA 3K01A 2V25A 3C34A 1H76A 3PD8A 1DSNA 3G3GA 1Y4CA 4KXPA 1NKXA 2F7CA 3GBAA 4N8YA 1AL3A 1NL5A 1B0LA 3KN8A 1FPKA 3TTKA 3HO7A 4DCXA 3UP9A 2RINA 5H8HB 1HSLA 2HEUA 2X7PA 1KWHA 3IB0A 3KGCA 1FTLA 4I3EA 2FYIA 2REGA 3OO9A 4KR5A 3LSFB 1NNKA 4GQOA 2OK2A 3B6TA 2DDKA 3QXMA 4XXUA 2O84X 3RPLA 2XWOA 1XHYA 1JEUA 2XD3A 4OVPA 2V93A 1QUIA 4KFQA 4Q5TA 2Y7RA 3S9MC 4QSDA 3MP6A 3GYYA 1IMBA 3Q27A 4QFLA 2AIXA 4NTLA 3W9WA 2I0BA 4ECFA 2NXOA 4OEUA 1MH4A 3JV9A 4G68B 1JP4A 2ONRA 3T9UA 1Y1MA 4ZEFA 3RYDA 4MNPA 4F2QA 1MY1A 1POTA 3M3FA 3IOTA 1MM7A 5I2NB 3DM0A 1SDXA 3VLWA 1LBBA 5ICTA 4GL8A 4RNSA 3VVDA 5J16A 4EQ7A 1MXXA 4OVRA 3PGFA 1F9BA 5ISUA 4UACA 5IZZA 4E0WA 3U65A 3FJGA 5I59B 3PD9A 5K2XA 4DE8A 4FECA 3H3GA 4QFPA 3LR1A 1I6BA 3GXAA 3IK6B 5TPAB 4E0XA 4R73A 4JWOA 3FV1A 2ZZXA 4F31B 5F24A 3G3HA 1UTHA 4BDLA 1CB6A 3RGYA 5FTIA 1FBHA 3UA8A 5KCJA 1NUYA 3IOVA 3QYTA 3FBPA 4OA4A 3VE1B 4RPNA 4F1UA 2P3NA 4ZECA 3A3UA 4R9GA 3KSJA 2Z8FA 5I84A 4LVQA 2RF1A 1ZKBA 3V5AA 4DCYA 4H5GA 3LC8A 1B3GA 2FHYA 4NF6B 3OOAA 4OVQA 3PUVE 2E0SA 2QJEA 3E4RA 4LZ7A 1MXWA 1QULA 4OANA 4IO5A 3FIRA 5CRYA 3F11A 4JWXA 4Q30B 4F3PA 2QMWA 4GX4A 3KSXA 4F3BA 3FV2A 3PPOA 3O2AA 1S7YA 1BK4A 5FTHA 1TT1A 1JW1A 4C1UA 2LAOA 4EF2A 2XX9A 2Y5LA 5FHNA 2Y5KA 3O6HA 4F3SA 1US5A 2G93A 1O63A 1B40A 1DK4A 3MUQA 2IEEA 3CIJA 2Z22A 1DCUA 3IB1A 4QHQA 3ECRA 5TU0A 1YZ0A 4IY6A 3RQTA 1ZTYA 3G3JA 2UYFA 3R6UA 3S4UA 3FXBA 1MXVA 2Q2AA 3PV0E 1DPEA 1BKAA 4H8IA 1A40A 5KZTA 5DT6A 1B2HA 4MJOA 5T3JA 1QW0A 4QRZA 2XWIA 4XF5A 2P2AA 5LOMA 4YB5A 4YICA 2V84A 2DE2A 2F78A 2XXHA 1G0IA 4EDPA 1MS7A 4X1BA 2I58A 3ZKKA 3PMXA 5I57A 4I8CA 1D9YA 2F35A 4ELPA 2Q2CA 4AB6A 1UIUA 3T1BA 3K6VA 5ICQA 5CBSA 2PMSA 4OHNA 2R9JA 4LZ8A 1FTAA 3MP8A 4HCWA 3A3CA 2Q88A 4LUBA 4XEQA 2L5VA 4NF5A 4JSOA 1EYKA 5AA2A 2V3TA 2H25A 2HQ0A 1RDZA 1MPBA 4PFTA 5CMMA 1O7TA 1IXHA 2XXKA 4KD5A 4ELQA 1B32A 4EQ9A 1S50A 1R9LA 2REJA 4N91A 3CI8A 1MDQA 1URGA 2Q89A 1XT8A 3THIA 1N76A 1Y3PA 1FPLA 3HV1A 2F36A 4MEVA 5DEXA 3PPRA 1KA0A 3QUFA 4OZ9A 1B3EA 4YB7A 3OEMA 1MY0A 3H4ZA 5JK4A 1ZJLA 3MVWA 3E13X 1T0KA 5I2KB 1MH3A 4R74A 5DYHA 1FBCA 1IEJA 3FASA 5AA1A 1OIBA 4F3GA 1OVBA 2HFBA 3H6TA 5H8FA 2VP1A 2WYKA 1LAFE 4WXJA 1IITA 1XC1A 5LDZA 2RCBA 2HPGA 4OERA 4EF1A 1JW5A 3RN8A 4LQ5A 2F3BA 1H44A 3TCGA 3K4UA 1NNPA 1BP5A 4KCCA 4ESXA 1KZ8A 5ELVA 2PX1A 1FPGA 3K6UA 2F6GA 1FTOA 2DVZA 2CZHA 1UTBA 4TLLB 3B50A 3MPKA 4PFWA 1LBYA 1G0HA 4X1DA 4N13A 1WODA 1MQDA 3U8QA 4P3LA 1B4HA 1FBFA 1SYIA 2YLNA 3FXUA 3SEYA 1AWBA 3KC0A 2DE3A 1DTZA 4PDDA 4NGUA 1H43A 1OQHA 2XXTA 3K00A 3V83A 3TCHA 4IO6A 1IMEA 2R71A 1R9QA 1POY1 1FBGA 1Y3QA 2ALUA 3OXNA 3HN0A 4GWSA 1A55A 2XXRA 2O1MA 3VDFA 5EYHA 2QSXA 2KR0A 1JW4A 5JTYB 4XKRA 4BDOA 3I6VA 3ODBA 2W7YA 1I69A 2OX3A 1SD3A 1NUZA 3G3FA 2XD2A 5DVJA 1JQFA 3I5OA 4F19A 3DP8A 3H06B 5H8QB 1B4ZA 4AQ4A 3CSGA 2CEYA 1A8FA 4GOTA 5L9SA 3FJ7A 3MQ9A 3S9NC 4YAHX 2PBWA 3IOWA 4GFRA 1QKAA 2FIEA 5EQ7A 1MQHA 1JEVA 2RKMA 4NG7A 1FPFA 1MM6A 3PUXE 4N81A 3SEVA 4OENA 1XI6A 4OVTA 3IFCA 2V3QA 4IGTA 4HE2A 4NF8B 4LP2B 3HHFA 4POWA 4QSCA 1SI1A 3P7IA 4IO2A 1SBPA 2ONKE 2THIA 4YU0A 3H6WA 1WDNA 3RUMA 3OENA 4NN3A 3MJNA 3DP4A 2VOZA 4LN5A 3TTRA 1GV8A 1VFEA 4PFYA 1N3XA 2ZYNA 2Q74A 4GXAA 3LSLA 5TP9A 3RLFE 1B5IA 1RYXA 3LV0A 1YCJA 1RYOA 4G68C 3G3IA 3C9HA 4OEVA 4KI0E 4ZDMA 4F2OA 3M3LA 2O7UA 4BDQA 4RPOA 1P99A 3C35A 4U4XA 1D4NA 2Y84A 1FPEA 4RY1A 1NV1A 3MW0A 3ZS6A 4F39A 2ESNA 4ZEKA 4PC9A 1IXIA 2Z8EA 1B3HA 2Z8DA 4JSDA 5DW8A 2MKZA 4PFRA 1ATGA 1CE2A 1N84A 2GQ1A 2H5YA 4NF4B 1UIVA 3TAJA 3T0JA 3TZAA 4OYVA 4F18A 1ANFA 2VT5A 3FZVA 4H67A 2Y7PA 4IGRA 4EQBA 3PMVA 4PDHA 4X04A 2ZZVA 2UVJA 4G8HA 4IY5A 1BTJA 1Y3NA 3PPNA 4G2ZA 3SETA
chains in the Genus database with same CATH topology
4R6YA 5AE4A 3IL1B 4LZ5A 5AA2D 1GTKA 4O3CA 3EHUA 2HAUA 3JYRA 1SYHA 3G3KA 2RC7A 5I56B 2DXRA 4R9FA 4H65A 2QS1A 1LAGE 1R6ZA 3DP6A 4GF8A 1ZIUA 4OFJA 2I3VA 4FORA 5KDTB 1BLFA 2O51A 3TEPA 1SI0A 1DPPA 5DTBA 2OCUA 3K1MA 1OLCA 3T93B 1Y20A 3I3VA 2A5SA 3SERA 3MAMA 1VSOA 3CRBA 3RT6B 3TKDA 5ITOA 1SW5A 3K0VA 1M5DA 4R72A 3ONMA 4GLIA 3U72A 1I6AA 2DWHA 3BFTA 3N26A 4MF3A 1N7WA 3PUZE 5L8DA 3OMBA 3USDA 3IR1A 4JDFA 3D4GA 3KJ7A 4EXLA 1EZOA 3ZSFA 2OLBA 2HAVA 2I4CA 3IO4A 2O69A 1QKBA 5J1DA 3QAXA 3H7MA 4PP0A 4ND9A 4IB2A 3TODA 2I48A 4GXSB 3HCQA 3KJTA 3HPIA 4IO7A 3LBSA 2PYYA 4HS7A 2ONSA 2F97A 1MQGA 4EXKA 3H03A 1I6QA 1N3WA 2I6EA 1NMUA 1N04A 4BDMA 3N5LA 4NWDA 3MZ9A 3EQ1A 3TUSA 2GFEA 5JEIA 2UVGA 4FATA 4U21A 1QVSA 1B1HA 3C36A 3BKIB 2RC9A 2R6GE 1PB7A 3LSXA 1TWYA 2VD2A 4ZS9A 1SW1A 3GZGA 2ANJA 3B7DA 3MVZA 4JXIA 3SDFA 3T9VA 1LFHA 3RTFB 2NWJA 1EU8A 3W9VA 2F5XA 1FQFA 1NFTA 2DE4A 3VXBA 3S9EA 4N07A 5B7DA 5EYFA 4C0RA 4FJPA 5AA4B 2XXXA 1P1OA 2F7BA 3ILUB 1MPCA 3CG1A 2WKYA 5A5XA 1UTHB 4LATA 1IXCA 3EN3A 4OETA 1USYE 1DTGA 5AA3A 2YJPA 5KCJB 2B3FA 2O6AA 3Q28A 4P0GA 4Q0CA 2HCAA 4ZE8A 1B6HA 3RNNA 1Z7NE 2F8DA 3U93A 2UVIA 4Z7EA 4AB5A 4ZEDA 3A09A 5K2YA 5CMKA 3WAFA 4XIGQ 2H99A 3KG2A 4WEPA 2Q8JA 1FQAA 5ITPA 2G29A 3K6WA 1S9TA 4Z0IA 5I58A 1RKMA 4MBPA 1PBQA 3E3KA 3T9HB 3T96B 1SW4A 3FJMA 4FE8A 2NOOA 3O6IA 1WVJA 1J1NA 1FTKA 3GLBA 1H3DA 2QS2A 3PUYE 1MXZA 3FVNA 3IORA 1QUJA 3O6GA 2FA7A 3WAEA 3KOTA 1JNFA 4GVOA 2GHAA 1IZ1A 4OESA 3M8UA 1LBCA 3IX1A 2QS4A 2DYXA 2OBGA 3QIMA 3B6QA 4H0WA 4ZE9A 4U23A 5H8SA 1Y4TA 2Y7IA 2D3IA 1IIWA 3O66A 5L9OA 1IUDA 4P11A 3TFLA 3VVFA 3DELB 3JZJA 3U92A 1OQGA 3L6GA 4I9DA 5EHSA 4F29A 3SESA 4DDDA 3C32A 4TOZA 4KHZE 4OTEA 1B3FA 4ELRA 1NH7A 1M5FA 2XXQA 2I49A 5H8NB 5I57B 5HPQA 1B1XA 3EHSA 1B7HA 3VLVA 1FQBA 3TELA 2F6PA 3U94A 3O9PA 4X48A 4M1VA 3K1PA 1PBPA 1B58A 1N0TA 4NF8A 1M5CA 3FXRA 3TQLA 2B3BA 2X26A 1B52A 1TFAA 3OSQA 5DVFA 2YPNA 2XXUA 1MXYA 2OJTA 5AA2B 1II5A 2PT1A 4OFLA 2I0CA 4KCDA 3IOUA 2H98A 4MLVA 4OVJA 3GBBA 1LFGA 4MH5A 4R6HA 1ZLQA 3SEUA 4N6PA 1PC3A 4EUOA 5BUUA 4KYSA 4PETA 5L9MA 4H8JA 4NMYA 5H8HA 3MP1A 1XVXA 1R1NA 3PPPA 1P1UA 4YZZA 4QFNA 1LCTA 3PPQA 4HW8A 3LUYA 1B5HA 2ZNUA 3D4CA 2UVHA 2NUVA 5H8FB 1MPDA 4H1XA 2XX7A 3DLNA 4G77A 4Q8RA 4FEBA 1MRPA 4R2FA 3TCFA 1LAHE 3Q26A 2GRVA 3L6HA 1ELJA 4G68A 3IB2A 1OVTA 1Z7ME 3QUJA 2XXIA 4XKNA 4H5FA 1UTBB 5I2NA 2D21A 1EZ9A 5I56A 2HXWA 4RA1A 2DS9A 1B7UA 4K3FA 3MVXA 1Y9UA 4NE4A 2OWTA 1VFDA 3ZKLA 1FQEA 5I59A 1B3LA 3T66A 4U4SA 3MPLA 5IKBA 5TPAA 1DMBA 5EHMA 1TXFA 1LB8A 4IO3A 2A5TB 2XHDA 3BFUA 1VR5A 2ZNSA 1OMPA 4BLAA 3ILTB 2BJJX 4ELOA 4BDRA 2VGQA 1AH5A 4RK9A 3CFXA 1H45A 3N6UA 2B65A 3H6VA 1LGBC 4POXA 4R2BA 1D9VA 1PB9A 2ZYMA 5FHMA 4X9TA 1FTMA 1Q35A 4TLMB 1A54A 2OWSA 5DVIA 2DSFA 4GD5A 1FW0A 4NF6A 3R7XA 3FGSA 5CMBA 2I4BA 2Y7KA 3KBRA 4THIA 3CFLA 3MC2A 3C31A 4DZ1A 4MFIA 1MQIA 4RK2A 5F1QA 1JVYA 3BBRA 3FATA 4U22A 2CZLA 2M8CA 1URDA 2Y7WA 3OO6A 1SW2A 4YKIA 3C4MA 4U1OA 1GGGA 4RJZA 3UORA 1UQWA 3QSLA 3PMWA 5IAIA 2QS3A 3TTNA 2AL4A 2RC8A 4PE5B 1SVXB 3SKPA 4HTGA 5TP9B 4JWYA 3MWBA 1AOVA 2DWIA 3QK6A 3TTLA 4IO4A 1XVYA 2F34A 4MLQA 3KN7A 2P1SA 2AYSA 3KOSA 5AA4A 2XXWA 1DOTA 2ZMBA 1B46A 3OO7A 5B70A 1FQCA 3M3KA 1PEBA 1BIYA 4F1YA 4C1TA 3CR9A 3KFMA 4ISUA 4PQJA 4DXBA 3LSWA 3B6WA 2ZYKA 3G7WA 2IA4A 3FXQA 4O3BA 5CC2A 3CG3A 5HBCA 3VV5A 3W15C 4QSEA 1USYH 2I3WA 2HZLA 1D3KA 2XXPA 1LCFA 3TPAA 1YAEA 4I1DA 4ZZAA 1Q1KA 4KPTA 2X7QA 1P1WA 1MY3A 4YMBA 2GHBA 4R6KA 1NH8A 1JETA 4KYEA 4DLDA 4NWCA 3S2VA 1Y1ZA 1N7XA 3N94A 3K02A 3VVEA 2AL5A 3KZGA 4QFOA 1B0HA 5CBRA 4KYDA 4ZEBA 1TFDA 3CFZA 5CMCA 3HSTA 2DXYA 3IJOB 1LLSA 4JBZA 1LB9A 1B7ZA 3KN3A 4XKQA 1NNTA 2Z23A 3IJXB 3T9XB 1MXUA 3FUZA 4OQOA 1SQYA 5I2KA 4RXLA 4ESWA 3RY3A 5F7VA 2DVCA 2P0SA 4WEDA 4XKPA 2CMOA 1L5TA 3TYHA 1ZMGA 4P0IA 4NEDA 3PU5A 4L17A 4LQ2A 1M5BA 2ZXTA 4DXCA 3CSBA 2XX8A 3UIFA 3H6UA 5H8NA 3FVGA 2KLFA 4RYAA 3IO6A 3TQWA 2ZNTA 3U1OA 2O1LA 2VHAA 1QJMA 3RTWB 1B51A 4QFKA 4G4PA 3VFJA 1VE4A 2H4IA 2DOJA 1JVXA 3EHTA 3OELA 1ZU0A 1YPNA 4G8NA 1MY2A 3FVKA 4DXUA 3OEKA 2DWAA 2XXVA 3MVYA 3MZ1A 4G8MA 3V8XB 1HSEA 4OXVA 5CM6A 2PVUA 4LONB 4U2RA 1P1QA 3MBPA 3RT8A 3OO8A 4OWDA 1FTJA 3UGWA 1EH3A 4GRKA 1US4A 2XXYA 4F22A 2O7IA 2QMXA 2O68A 2QL3A 1EZPA 3CVGA 2QPQA 1GR2A 3SEXA 2ZYOA 1LAXA 1MG1A 1M5EA 5JTYA 3FD3A 3PUWE 2ABHA 1AMFA 4YKKA 3IAZA 4FAJA 4FIMA 3V89B 1A8EA 1YTVA 4ZZEA 5A5XB 1XS5A 5H8QA 1LSTA 4H6DA 4ONYA 1MY4A 2UXAA 1A99A 1HSJA 1O64A 2V3UA 5HM4B 4I62A 3AXFA 4GIZA 1AIVA 4TQUQ 2FNCA 2H9BA 4YMAA 5BWJA 2PT2A 4JB7A 3Q25A 1XOCA 5I58B 2UYEA 4NF5B 3EF7A 3K6XA 2NVUB 1MQJA 3O29A 3R26A 1MDP1 3MZBA 3RPWA 3FVOA 1LFIA 4LA9A 1OLAA 1QUKA 2DWJA 3K2DA 4GL0A 1GVCA 3KEIA 4YKPA 4FEDA 1PB8A 1FQDA 3SEWA 4BDNA 5DEXB 4YB6A 3K1NA 4M4GA 4YKJA 1URSA 2A5TA 4UA8A 2D5WA 4PFUA 2E1SA 4HCYA 3OSRA 4ZEIA 4OMBA 3Q29A 1PDAA 4NF4A 1B05A 3VXCA 4KQPA 2OZZA 2GH9A 1FCKA 3TMGA 5CI5A 3O97A 4F1VA 1B9JA 3T22A 3C33A 5FHOA 3UK4A 2F7AA 3S9LC 2RCAA 4GWOA 3E9XA 1IQ7A 1A7LA 2DP8A 2QRYA 3O28A 3EPEA 4WKMA 4QF9A 2Q9TA 1ZBMA 5M2VA 1B5JA 4R75A 4U1ZA 3TDJA 3HHGA 4OFOA 3TTMA 5KDTA 2HZKA 2DQVA 4O3AA 3N6TA 1IXGA 4DIGA 1P1NA 2VD3A 3UN6A 4XTCQ 3VLUA 3OD7A 1NNFA 3K01A 2V25A 3C34A 1H76A 3PD8A 1DSNA 3G3GA 1Y4CA 1NKXA 2F7CA 3GBAA 1AL3A 1NL5A 1B0LA 3KN8A 3TTKA 3HO7A 4DCXA 3UP9A 2RINA 5H8HB 1HSLA 2HEUA 2X7PA 1KWHA 3IB0A 3KGCA 1FTLA 2FYIA 2REGA 3OO9A 4KR5A 3LSFB 1NNKA 4GQOA 2OK2A 3B6TA 3QXMA 4XXUA 2O84X 1XHYA 1JEUA 2XD3A 2V93A 1QUIA 4KFQA 4Q5TA 2Y7RA 3S9MC 4QSDA 3MP6A 3Q27A 4QFLA 2AIXA 4NTLA 3W9WA 2I0BA 4ECFA 2NXOA 4OEUA 1MH4A 3JV9A 4G68B 2ONRA 3T9UA 1Y1MA 4ZEFA 4F2QA 1MY1A 1POTA 3M3FA 3IOTA 1MM7A 5I2NB 3DM0A 1SDXA 3VLWA 1LBBA 5ICTA 4GL8A 4RNSA 3VVDA 4EQ7A 1MXXA 3PGFA 1F9BA 5ISUA 4UACA 4E0WA 3FJGA 5I59B 3PD9A 5K2XA 4DE8A 4FECA 3H3GA 4QFPA 3LR1A 1I6BA 3GXAA 3IK6B 5TPAB 4E0XA 4R73A 4JWOA 3FV1A 4F31B 3G3HA 1UTHA 4BDLA 1CB6A 3RGYA 5FTIA 3UA8A 5KCJA 3IOVA 3QYTA 3VE1B 4RPNA 4F1UA 4ZECA 3A3UA 4R9GA 3KSJA 2Z8FA 5I84A 4LVQA 2RF1A 1ZKBA 3V5AA 4DCYA 4H5GA 3LC8A 1B3GA 4NF6B 3OOAA 3PUVE 2E0SA 2QJEA 3E4RA 4LZ7A 1MXWA 1QULA 4IO5A 3FIRA 5CRYA 3F11A 4JWXA 4Q30B 4F3PA 2QMWA 3KSXA 4F3BA 3FV2A 3PPOA 3O2AA 1S7YA 5FTHA 1TT1A 1JW1A 4C1UA 2LAOA 4EF2A 5FHNA 2XX9A 3O6HA 4F3SA 1US5A 2G93A 1O63A 1B40A 3MUQA 2IEEA 3CIJA 2Z22A 3IB1A 4QHQA 3ECRA 5TU0A 4IY6A 3RQTA 1ZTYA 3G3JA 2UYFA 3R6UA 3S4UA 1MXVA 2Q2AA 3PV0E 1DPEA 1BKAA 4H8IA 1A40A 5KZTA 5DT6A 1B2HA 1QW0A 4QRZA 2P2AA 5LOMA 4YB5A 4YICA 2V84A 2DE2A 2F78A 2XXHA 4EDPA 1MS7A 4X1BA 2I58A 3ZKKA 3PMXA 5I57A 4I8CA 1D9YA 2F35A 4ELPA 2Q2CA 4AB6A 1UIUA 3K6VA 5ICQA 5CBSA 2PMSA 4OHNA 2R9JA 4LZ8A 3MP8A 4HCWA 3A3CA 2Q88A 4LUBA 4NF5A 4JSOA 5AA2A 2V3TA 2H25A 2HQ0A 1MPBA 4PFTA 5CMMA 1O7TA 1IXHA 4KD5A 4ELQA 1B32A 4EQ9A 1S50A 1R9LA 2REJA 3CI8A 1MDQA 1URGA 2Q89A 1XT8A 3THIA 1N76A 1Y3PA 3HV1A 2F36A 5DEXA 3PPRA 3QUFA 4OZ9A 1B3EA 4YB7A 3OEMA 1MY0A 3H4ZA 5JK4A 1ZJLA 3MVWA 3E13X 1T0KA 5I2KB 1MH3A 4R74A 5DYHA 1IEJA 3FASA 5AA1A 1OIBA 4F3GA 1OVBA 2HFBA 3H6TA 5H8FA 2VP1A 1LAFE 4WXJA 1IITA 1XC1A 2RCBA 4OERA 4EF1A 1JW5A 3RN8A 4LQ5A 1H44A 3TCGA 3K4UA 1NNPA 1BP5A 4KCCA 4ESXA 5ELVA 2PX1A 3K6UA 2F6GA 1FTOA 2DVZA 1UTBA 4TLLB 3MPKA 4PFWA 4X1DA 4N13A 1WODA 1MQDA 3U8QA 1B4HA 1SYIA 2YLNA 3FXUA 3SEYA 2DE3A 1DTZA 1H43A 1OQHA 2XXTA 3K00A 3V83A 3TCHA 4IO6A 2R71A 1R9QA 1POY1 1Y3QA 2ALUA 3OXNA 3HN0A 1A55A 2XXRA 2O1MA 3VDFA 2QSXA 1JW4A 5JTYB 4XKRA 4BDOA 3I6VA 3ODBA 2W7YA 1I69A 1SD3A 3G3FA 2XD2A 5DVJA 1JQFA 3I5OA 4F19A 3DP8A 3H06B 5H8QB 1B4ZA 4AQ4A 3CSGA 1A8FA 4GOTA 5L9SA 3FJ7A 3MQ9A 3S9NC 4YAHX 2PBWA 3IOWA 4GFRA 1QKAA 1MQHA 1JEVA 2RKMA 1MM6A 3PUXE 3SEVA 4OENA 2V3QA 4IGTA 4NF8B 4LP2B 3HHFA 4POWA 4QSCA 1SI1A 3P7IA 4IO2A 1SBPA 2ONKE 2THIA 4YU0A 3H6WA 1WDNA 3RUMA 3OENA 3MJNA 3DP4A 2VOZA 3TTRA 1GV8A 1VFEA 4PFYA 1N3XA 2ZYNA 4GXAA 3LSLA 5TP9A 3RLFE 1B5IA 1RYXA 1YCJA 1RYOA 4G68C 3G3IA 3C9HA 4OEVA 4KI0E 4ZDMA 4F2OA 3M3LA 2O7UA 4BDQA 4RPOA 1P99A 3C35A 4U4XA 1D4NA 2Y84A 4RY1A 3MW0A 3ZS6A 4F39A 2ESNA 4ZEKA 1IXIA 2Z8EA 1B3HA 2Z8DA 4JSDA 1ATGA 1CE2A 1N84A 2H5YA 4NF4B 1UIVA 3TAJA 3TZAA 4F18A 4OYVA 1ANFA 3FZVA 4H67A 2Y7PA 4IGRA 4EQBA 3PMVA 2UVJA 4G8HA 4IY5A 1BTJA 1Y3NA 3PPNA 4G2ZA 3SETA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R6Y A;  5AE4 A;  3IL1 B;  4LZ5 A;  5AA2 D;  1GTK A;  4O3C A;  3EHU A;  2HAU A;  3JYR A;  1SYH A;  3G3K A;  2RC7 A;  5I56 B;  2DXR A;  4R9F A;  4H65 A;  2QS1 A;  1LAG E;  1R6Z A;  3DP6 A;  4GF8 A;  1ZIU A;  4OFJ A;  2I3V A;  4FOR A;  5KDT B;  1BLF A;  2O51 A;  3TEP A;  1SI0 A;  1DPP A;  5DTB A;  2OCU A;  3K1M A;  1OLC A;  3T93 B;  1Y20 A;  3I3V A;  2A5S A;  3SER A;  3MAM A;  1VSO A;  3CRB A;  3RT6 B;  3TKD A;  5ITO A;  1SW5 A;  3K0V A;  1M5D A;  4R72 A;  3ONM A;  4GLI A;  3U72 A;  1I6A A;  2DWH A;  3BFT A;  3N26 A;  4MF3 A;  1N7W A;  3PUZ E;  5L8D A;  3OMB A;  3USD A;  3IR1 A;  4JDF A;  3D4G A;  3KJ7 A;  4EXL A;  1EZO A;  3ZSF A;  2OLB A;  2HAV A;  2I4C A;  3IO4 A;  2O69 A;  1QKB A;  5J1D A;  3QAX A;  3H7M A;  4PP0 A;  4ND9 A;  4IB2 A;  3TOD A;  2I48 A;  4GXS B;  3HCQ A;  3KJT A;  3HPI A;  4IO7 A;  3LBS A;  2PYY A;  4HS7 A;  2ONS A;  2F97 A;  1MQG A;  4EXK A;  3H03 A;  1I6Q A;  1N3W A;  2I6E A;  1NMU A;  1N04 A;  4BDM A;  3N5L A;  4NWD A;  3MZ9 A;  3EQ1 A;  3TUS A;  2GFE A;  5JEI A;  2UVG A;  4FAT A;  4U21 A;  1QVS A;  1B1H A;  3C36 A;  3BKI B;  2RC9 A;  2R6G E;  1PB7 A;  3LSX A;  1TWY A;  2VD2 A;  4ZS9 A;  1SW1 A;  3GZG A;  2ANJ A;  3B7D A;  3MVZ A;  4JXI A;  3SDF A;  3T9V A;  1LFH A;  3RTF B;  2NWJ A;  1EU8 A;  3W9V A;  2F5X A;  1FQF A;  1NFT A;  2DE4 A;  3VXB A;  3S9E A;  4N07 A;  5B7D A;  5EYF A;  4C0R A;  4FJP A;  5AA4 B;  2XXX A;  1P1O A;  2F7B A;  3ILU B;  1MPC A;  3CG1 A;  2WKY A;  5A5X A;  1UTH B;  4LAT A;  1IXC A;  3EN3 A;  4OET A;  1USY E;  1DTG A;  5AA3 A;  2YJP A;  5KCJ B;  2B3F A;  2O6A A;  3Q28 A;  4P0G A;  4Q0C A;  2HCA A;  4ZE8 A;  1B6H A;  3RNN A;  1Z7N E;  2F8D A;  3U93 A;  2UVI A;  4Z7E A;  4AB5 A;  4ZED A;  3A09 A;  5K2Y A;  5CMK A;  3WAF A;  4XIG Q;  2H99 A;  3KG2 A;  4WEP A;  2Q8J A;  1FQA A;  5ITP A;  2G29 A;  3K6W A;  1S9T A;  4Z0I A;  5I58 A;  1RKM A;  4MBP A;  1PBQ A;  3E3K A;  3T9H B;  3T96 B;  1SW4 A;  3FJM A;  4FE8 A;  2NOO A;  3O6I A;  1WVJ A;  1J1N A;  1FTK A;  3GLB A;  1H3D A;  2QS2 A;  3PUY E;  1MXZ A;  3FVN A;  3IOR A;  1QUJ A;  3O6G A;  2FA7 A;  3WAE A;  3KOT A;  1JNF A;  4GVO A;  2GHA A;  1IZ1 A;  4OES A;  3M8U A;  1LBC A;  3IX1 A;  2QS4 A;  2DYX A;  2OBG A;  3QIM A;  3B6Q A;  4H0W A;  4ZE9 A;  4U23 A;  5H8S A;  1Y4T A;  2Y7I A;  2D3I A;  1IIW A;  3O66 A;  5L9O A;  1IUD A;  4P11 A;  3TFL A;  3VVF A;  3DEL B;  3JZJ A;  3U92 A;  1OQG A;  3L6G A;  4I9D A;  5EHS A;  4F29 A;  3SES A;  4DDD A;  3C32 A;  4TOZ A;  4KHZ E;  4OTE A;  1B3F A;  4ELR A;  1NH7 A;  1M5F A;  2XXQ A;  2I49 A;  5H8N B;  5I57 B;  5HPQ A;  1B1X A;  3EHS A;  1B7H A;  3VLV A;  1FQB A;  3TEL A;  2F6P A;  3U94 A;  3O9P A;  4X48 A;  4M1V A;  3K1P A;  1PBP A;  1B58 A;  1N0T A;  4NF8 A;  1M5C A;  3FXR A;  3TQL A;  2B3B A;  2X26 A;  1B52 A;  1TFA A;  3OSQ A;  5DVF A;  2YPN A;  2XXU A;  1MXY A;  2OJT A;  5AA2 B;  1II5 A;  2PT1 A;  4OFL A;  2I0C A;  4KCD A;  3IOU A;  2H98 A;  4MLV A;  4OVJ A;  3GBB A;  1LFG A;  4MH5 A;  4R6H A;  1ZLQ A;  3SEU A;  4N6P A;  1PC3 A;  4EUO A;  5BUU A;  4KYS A;  4PET A;  5L9M A;  4H8J A;  4NMY A;  5H8H A;  3MP1 A;  1XVX A;  1R1N A;  3PPP A;  1P1U A;  4YZZ A;  4QFN A;  1LCT A;  3PPQ A;  4HW8 A;  3LUY A;  1B5H A;  2ZNU A;  3D4C A;  2UVH A;  2NUV A;  5H8F B;  1MPD A;  4H1X A;  2XX7 A;  3DLN A;  4G77 A;  4Q8R A;  4FEB A;  1MRP A;  4R2F A;  3TCF A;  1LAH E;  3Q26 A;  2GRV A;  3L6H A;  1ELJ A;  4G68 A;  3IB2 A;  1OVT A;  1Z7M E;  3QUJ A;  2XXI A;  4XKN A;  4H5F A;  1UTB B;  5I2N A;  2D21 A;  1EZ9 A;  5I56 A;  2HXW A;  4RA1 A;  2DS9 A;  1B7U A;  4K3F A;  3MVX A;  1Y9U A;  4NE4 A;  2OWT A;  1VFD A;  3ZKL A;  1FQE A;  5I59 A;  1B3L A;  3T66 A;  4U4S A;  3MPL A;  5IKB A;  5TPA A;  1DMB A;  5EHM A;  1TXF A;  1LB8 A;  4IO3 A;  2A5T B;  2XHD A;  3BFU A;  1VR5 A;  2ZNS A;  1OMP A;  4BLA A;  3ILT B;  2BJJ X;  4ELO A;  4BDR A;  2VGQ A;  1AH5 A;  4RK9 A;  3CFX A;  1H45 A;  3N6U A;  2B65 A;  3H6V A;  1LGB C;  4POX A;  4R2B A;  1D9V A;  1PB9 A;  2ZYM A;  5FHM A;  4X9T A;  1FTM A;  1Q35 A;  4TLM B;  1A54 A;  2OWS A;  5DVI A;  2DSF A;  4GD5 A;  1FW0 A;  4NF6 A;  3R7X A;  3FGS A;  5CMB A;  2I4B A;  2Y7K A;  3KBR A;  4THI A;  3CFL A;  3MC2 A;  3C31 A;  4DZ1 A;  4MFI A;  1MQI A;  4RK2 A;  5F1Q A;  1JVY A;  3BBR A;  3FAT A;  4U22 A;  2CZL A;  2M8C A;  1URD A;  2Y7W A;  3OO6 A;  1SW2 A;  4YKI A;  3C4M A;  4U1O A;  1GGG A;  4RJZ A;  3UOR A;  1UQW A;  3QSL A;  3PMW A;  5IAI A;  2QS3 A;  3TTN A;  2AL4 A;  2RC8 A;  4PE5 B;  1SVX B;  3SKP A;  4HTG A;  5TP9 B;  4JWY A;  3MWB A;  1AOV A;  2DWI A;  3QK6 A;  3TTL A;  4IO4 A;  1XVY A;  2F34 A;  4MLQ A;  3KN7 A;  2P1S A;  2AYS A;  3KOS A;  5AA4 A;  2XXW A;  1DOT A;  2ZMB A;  1B46 A;  3OO7 A;  5B70 A;  1FQC A;  3M3K A;  1PEB A;  1BIY A;  4F1Y A;  4C1T A;  3CR9 A;  3KFM A;  4ISU A;  4PQJ A;  4DXB A;  3LSW A;  3B6W A;  2ZYK A;  3G7W A;  2IA4 A;  3FXQ A;  4O3B A;  5CC2 A;  3CG3 A;  5HBC A;  3VV5 A;  3W15 C;  4QSE A;  1USY H;  2I3W A;  2HZL A;  1D3K A;  2XXP A;  1LCF A;  3TPA A;  1YAE A;  4I1D A;  4ZZA A;  1Q1K A;  4KPT A;  2X7Q A;  1P1W A;  1MY3 A;  4YMB A;  2GHB A;  4R6K A;  1NH8 A;  1JET A;  4KYE A;  4DLD A;  4NWC A;  3S2V A;  1Y1Z A;  1N7X A;  3N94 A;  3K02 A;  3VVE A;  2AL5 A;  3KZG A;  4QFO A;  1B0H A;  5CBR A;  4KYD A;  4ZEB A;  1TFD A;  3CFZ A;  5CMC A;  3HST A;  2DXY A;  3IJO B;  1LLS A;  4JBZ A;  1LB9 A;  1B7Z A;  3KN3 A;  4XKQ A;  1NNT A;  2Z23 A;  3IJX B;  3T9X B;  1MXU A;  3FUZ A;  4OQO A;  1SQY A;  5I2K A;  4RXL A;  4ESW A;  3RY3 A;  5F7V A;  2DVC A;  2P0S A;  4WED A;  4XKP A;  2CMO A;  1L5T A;  3TYH A;  1ZMG A;  4P0I A;  4NED A;  3PU5 A;  4L17 A;  4LQ2 A;  1M5B A;  2ZXT A;  4DXC A;  3CSB A;  2XX8 A;  3UIF A;  3H6U A;  5H8N A;  3FVG A;  2KLF A;  4RYA A;  3IO6 A;  3TQW A;  2ZNT A;  3U1O A;  2O1L A;  2VHA A;  1QJM A;  3RTW B;  1B51 A;  4QFK A;  4G4P A;  3VFJ A;  1VE4 A;  2H4I A;  2DOJ A;  1JVX A;  3EHT A;  3OEL A;  1ZU0 A;  1YPN A;  4G8N A;  1MY2 A;  3FVK A;  4DXU A;  3OEK A;  2DWA A;  2XXV A;  3MVY A;  3MZ1 A;  4G8M A;  3V8X B;  1HSE A;  4OXV A;  5CM6 A;  2PVU A;  4LON B;  4U2R A;  1P1Q A;  3MBP A;  3RT8 A;  3OO8 A;  4OWD A;  1FTJ A;  3UGW A;  1EH3 A;  4GRK A;  1US4 A;  2XXY A;  4F22 A;  2O7I A;  2QMX A;  2O68 A;  2QL3 A;  1EZP A;  3CVG A;  2QPQ A;  1GR2 A;  3SEX A;  2ZYO A;  1LAX A;  1MG1 A;  1M5E A;  5JTY A;  3FD3 A;  3PUW E;  2ABH A;  1AMF A;  4YKK A;  3IAZ A;  4FAJ A;  4FIM A;  3V89 B;  1A8E A;  1YTV A;  4ZZE A;  5A5X B;  1XS5 A;  5H8Q A;  1LST A;  4H6D A;  4ONY A;  1MY4 A;  2UXA A;  1A99 A;  1HSJ A;  1O64 A;  2V3U A;  5HM4 B;  4I62 A;  3AXF A;  4GIZ A;  1AIV A;  4TQU Q;  2FNC A;  2H9B A;  4YMA A;  5BWJ A;  2PT2 A;  4JB7 A;  3Q25 A;  1XOC A;  5I58 B;  2UYE A;  4NF5 B;  3EF7 A;  3K6X A;  2NVU B;  1MQJ A;  3O29 A;  3R26 A;  1MDP 1;  3MZB A;  3RPW A;  3FVO A;  1LFI A;  4LA9 A;  1OLA A;  1QUK A;  2DWJ A;  3K2D A;  4GL0 A;  1GVC A;  3KEI A;  4YKP A;  4FED A;  1PB8 A;  1FQD A;  3SEW A;  4BDN A;  5DEX B;  4YB6 A;  3K1N A;  4M4G A;  4YKJ A;  1URS A;  2A5T A;  4UA8 A;  2D5W A;  4PFU A;  2E1S A;  4HCY A;  3OSR A;  4ZEI A;  4OMB A;  3Q29 A;  1PDA A;  4NF4 A;  1B05 A;  3VXC A;  4KQP A;  2OZZ A;  2GH9 A;  1FCK A;  3TMG A;  5CI5 A;  3O97 A;  4F1V A;  1B9J A;  3T22 A;  3C33 A;  5FHO A;  3UK4 A;  2F7A A;  3S9L C;  2RCA A;  4GWO A;  3E9X A;  1IQ7 A;  1A7L A;  2DP8 A;  2QRY A;  3O28 A;  3EPE A;  4WKM A;  4QF9 A;  2Q9T A;  1ZBM A;  5M2V A;  1B5J A;  4R75 A;  4U1Z A;  3TDJ A;  3HHG A;  4OFO A;  3TTM A;  5KDT A;  2HZK A;  2DQV A;  4O3A A;  3N6T A;  1IXG A;  4DIG A;  1P1N A;  2VD3 A;  3UN6 A;  4XTC Q;  3VLU A;  3OD7 A;  1NNF A;  3K01 A;  2V25 A;  3C34 A;  1H76 A;  3PD8 A;  1DSN A;  3G3G A;  1Y4C A;  1NKX A;  2F7C A;  3GBA A;  1AL3 A;  1NL5 A;  1B0L A;  3KN8 A;  3TTK A;  3HO7 A;  4DCX A;  3UP9 A;  2RIN A;  5H8H B;  1HSL A;  2HEU A;  2X7P A;  1KWH A;  3IB0 A;  3KGC A;  1FTL A;  2FYI A;  2REG A;  3OO9 A;  4KR5 A;  3LSF B;  1NNK A;  4GQO A;  2OK2 A;  3B6T A;  3QXM A;  4XXU A;  2O84 X;  1XHY A;  1JEU A;  2XD3 A;  2V93 A;  1QUI A;  4KFQ A;  4Q5T A;  2Y7R A;  3S9M C;  4QSD A;  3MP6 A;  3Q27 A;  4QFL A;  2AIX A;  4NTL A;  3W9W A;  2I0B A;  4ECF A;  2NXO A;  4OEU A;  1MH4 A;  3JV9 A;  4G68 B;  2ONR A;  3T9U A;  1Y1M A;  4ZEF A;  4F2Q A;  1MY1 A;  1POT A;  3M3F A;  3IOT A;  1MM7 A;  5I2N B;  3DM0 A;  1SDX A;  3VLW A;  1LBB A;  5ICT A;  4GL8 A;  4RNS A;  3VVD A;  4EQ7 A;  1MXX A;  3PGF A;  1F9B A;  5ISU A;  4UAC A;  4E0W A;  3FJG A;  5I59 B;  3PD9 A;  5K2X A;  4DE8 A;  4FEC A;  3H3G A;  4QFP A;  3LR1 A;  1I6B A;  3GXA A;  3IK6 B;  5TPA B;  4E0X A;  4R73 A;  4JWO A;  3FV1 A;  4F31 B;  3G3H A;  1UTH A;  4BDL A;  1CB6 A;  3RGY A;  5FTI A;  3UA8 A;  5KCJ A;  3IOV A;  3QYT A;  3VE1 B;  4RPN A;  4F1U A;  4ZEC A;  3A3U A;  4R9G A;  3KSJ A;  2Z8F A;  5I84 A;  4LVQ A;  2RF1 A;  1ZKB A;  3V5A A;  4DCY A;  4H5G A;  3LC8 A;  1B3G A;  4NF6 B;  3OOA A;  3PUV E;  2E0S A;  2QJE A;  3E4R A;  4LZ7 A;  1MXW A;  1QUL A;  4IO5 A;  3FIR A;  5CRY A;  3F11 A;  4JWX A;  4Q30 B;  4F3P A;  2QMW A;  3KSX A;  4F3B A;  3FV2 A;  3PPO A;  3O2A A;  1S7Y A;  5FTH A;  1TT1 A;  1JW1 A;  4C1U A;  2LAO A;  4EF2 A;  5FHN A;  2XX9 A;  3O6H A;  4F3S A;  1US5 A;  2G93 A;  1O63 A;  1B40 A;  3MUQ A;  2IEE A;  3CIJ A;  2Z22 A;  3IB1 A;  4QHQ A;  3ECR A;  5TU0 A;  4IY6 A;  3RQT A;  1ZTY A;  3G3J A;  2UYF A;  3R6U A;  3S4U A;  1MXV A;  2Q2A A;  3PV0 E;  1DPE A;  1BKA A;  4H8I A;  1A40 A;  5KZT A;  5DT6 A;  1B2H A;  1QW0 A;  4QRZ A;  2P2A A;  5LOM A;  4YB5 A;  4YIC A;  2V84 A;  2DE2 A;  2F78 A;  2XXH A;  4EDP A;  1MS7 A;  4X1B A;  2I58 A;  3ZKK A;  3PMX A;  5I57 A;  4I8C A;  1D9Y A;  2F35 A;  4ELP A;  2Q2C A;  4AB6 A;  1UIU A;  3K6V A;  5ICQ A;  5CBS A;  2PMS A;  4OHN A;  2R9J A;  4LZ8 A;  3MP8 A;  4HCW A;  3A3C A;  2Q88 A;  4LUB A;  4NF5 A;  4JSO A;  5AA2 A;  2V3T A;  2H25 A;  2HQ0 A;  1MPB A;  4PFT A;  5CMM A;  1O7T A;  1IXH A;  4KD5 A;  4ELQ A;  1B32 A;  4EQ9 A;  1S50 A;  1R9L A;  2REJ A;  3CI8 A;  1MDQ A;  1URG A;  2Q89 A;  1XT8 A;  3THI A;  1N76 A;  1Y3P A;  3HV1 A;  2F36 A;  5DEX A;  3PPR A;  3QUF A;  4OZ9 A;  1B3E A;  4YB7 A;  3OEM A;  1MY0 A;  3H4Z A;  5JK4 A;  1ZJL A;  3MVW A;  3E13 X;  1T0K A;  5I2K B;  1MH3 A;  4R74 A;  5DYH A;  1IEJ A;  3FAS A;  5AA1 A;  1OIB A;  4F3G A;  1OVB A;  2HFB A;  3H6T A;  5H8F A;  2VP1 A;  1LAF E;  4WXJ A;  1IIT A;  1XC1 A;  2RCB A;  4OER A;  4EF1 A;  1JW5 A;  3RN8 A;  4LQ5 A;  1H44 A;  3TCG A;  3K4U A;  1NNP A;  1BP5 A;  4KCC A;  4ESX A;  5ELV A;  2PX1 A;  3K6U A;  2F6G A;  1FTO A;  2DVZ A;  1UTB A;  4TLL B;  3MPK A;  4PFW A;  4X1D A;  4N13 A;  1WOD A;  1MQD A;  3U8Q A;  1B4H A;  1SYI A;  2YLN A;  3FXU A;  3SEY A;  2DE3 A;  1DTZ A;  1H43 A;  1OQH A;  2XXT A;  3K00 A;  3V83 A;  3TCH A;  4IO6 A;  2R71 A;  1R9Q A;  1POY 1;  1Y3Q A;  2ALU A;  3OXN A;  3HN0 A;  1A55 A;  2XXR A;  2O1M A;  3VDF A;  2QSX A;  1JW4 A;  5JTY B;  4XKR A;  4BDO A;  3I6V A;  3ODB A;  2W7Y A;  1I69 A;  1SD3 A;  3G3F A;  2XD2 A;  5DVJ A;  1JQF A;  3I5O A;  4F19 A;  3DP8 A;  3H06 B;  5H8Q B;  1B4Z A;  4AQ4 A;  3CSG A;  1A8F A;  4GOT A;  5L9S A;  3FJ7 A;  3MQ9 A;  3S9N C;  4YAH X;  2PBW A;  3IOW A;  4GFR A;  1QKA A;  1MQH A;  1JEV A;  2RKM A;  1MM6 A;  3PUX E;  3SEV A;  4OEN A;  2V3Q A;  4IGT A;  4NF8 B;  4LP2 B;  3HHF A;  4POW A;  4QSC A;  1SI1 A;  3P7I A;  4IO2 A;  1SBP A;  2ONK E;  2THI A;  4YU0 A;  3H6W A;  1WDN A;  3RUM A;  3OEN A;  3MJN A;  3DP4 A;  2VOZ A;  3TTR A;  1GV8 A;  1VFE A;  4PFY A;  1N3X A;  2ZYN A;  4GXA A;  3LSL A;  5TP9 A;  3RLF E;  1B5I A;  1RYX A;  1YCJ A;  1RYO A;  4G68 C;  3G3I A;  3C9H A;  4OEV A;  4KI0 E;  4ZDM A;  4F2O A;  3M3L A;  2O7U A;  4BDQ A;  4RPO A;  1P99 A;  3C35 A;  4U4X A;  1D4N A;  2Y84 A;  4RY1 A;  3MW0 A;  3ZS6 A;  4F39 A;  2ESN A;  4ZEK A;  1IXI A;  2Z8E A;  1B3H A;  2Z8D A;  4JSD A;  1ATG A;  1CE2 A;  1N84 A;  2H5Y A;  4NF4 B;  1UIV A;  3TAJ A;  3TZA A;  4F18 A;  4OYV A;  1ANF A;  3FZV A;  4H67 A;  2Y7P A;  4IGR A;  4EQB A;  3PMV A;  2UVJ A;  4G8H A;  4IY5 A;  1BTJ A;  1Y3N A;  3PPN A;  4G2Z A;  3SET A; 
#chains in the Genus database with same CATH topology
 4R6Y A;  5AE4 A;  3IL1 B;  4LZ5 A;  5AA2 D;  1GTK A;  2QVV A;  4O3C A;  3EHU A;  3ISP A;  2HAU A;  3JYR A;  1SYH A;  2PFZ A;  3G3K A;  2V4C A;  3NOH A;  2P3V A;  4O94 A;  2RC7 A;  4GWX A;  5I56 B;  3BIG A;  2DXR A;  4R9F A;  1FBD A;  4H65 A;  1LBW A;  2QS1 A;  1LAG E;  1R6Z A;  3DP6 A;  4GF8 A;  4PFB A;  1ZIU A;  4OFJ A;  2I3V A;  4FOR A;  5KDT B;  1BLF A;  2O51 A;  3TEP A;  1SI0 A;  1DPP A;  5DTB A;  1NV3 A;  2OCU A;  3K1M A;  1OLC A;  3T93 B;  1Y20 A;  3I3V A;  1IMD A;  4DI4 B;  2QVU A;  2A5S A;  3SER A;  3MAM A;  1VSO A;  3CRB A;  2FVZ A;  3RT6 B;  3TKD A;  5ITO A;  1SW5 A;  3K0V A;  1M5D A;  4R72 A;  3ONM A;  4GLI A;  3U72 A;  1I6A A;  3MYU A;  2DWH A;  1IMC A;  3BFT A;  3N26 A;  4MF3 A;  1N7W A;  3PUZ E;  5L8D A;  3OMB A;  3USD A;  5LTC A;  5ET7 A;  4MNC A;  3IR1 A;  4JDF A;  3D4G A;  3KJ7 A;  4EXL A;  1EZO A;  2HXR A;  3ZSF A;  2OLB A;  2HAV A;  2XA5 A;  2I4C A;  3IO4 A;  2O69 A;  1QKB A;  5J1D A;  3QAX A;  3H7M A;  4O8M A;  4I40 A;  4PP0 A;  1Q9D A;  4ND9 A;  4IB2 A;  3TOD A;  4PAF A;  2I48 A;  4GXS B;  3HCQ A;  3KJT A;  3HPI A;  4IO7 A;  3LBS A;  3RPL B;  2PYY A;  4HS7 A;  2F3D A;  2ONS A;  3E78 A;  4JVC A;  2F97 A;  4G61 A;  1MQG A;  4EXK A;  1NUX A;  5IM2 A;  3H03 A;  1I6Q A;  1N3W A;  2I6E A;  1NMU A;  1N04 A;  4BDM A;  3N5L A;  4NWD A;  3MZ9 A;  3EQ1 A;  3TUS A;  4MAG A;  2FIX A;  2GFE A;  5JEI A;  2UVG A;  4GWW A;  4FAT A;  4U21 A;  1QVS A;  1B1H A;  3C36 A;  4N17 A;  3BKI B;  1IMF A;  2RC9 A;  2R6G E;  1PB7 A;  3LSX A;  1TWY A;  2VD2 A;  4ZS9 A;  5I3S A;  1SW1 A;  3GZG A;  2ANJ A;  3B7D A;  5IZ3 A;  3MVZ A;  4JXI A;  2WYP A;  3SDF A;  3T9V A;  1LFH A;  3RTF B;  2NWJ A;  1EU8 A;  3W9V A;  2F5X A;  1FQF A;  1NFT A;  2DE4 A;  3VXB A;  3S9E A;  4N07 A;  5B7D A;  5EYF A;  4GBV A;  4C0R A;  4FJP A;  5AA4 B;  2XXX A;  1P1O A;  2F7B A;  3ILU B;  1MPC A;  3CG1 A;  2VPO A;  4PGP A;  2WKY A;  5A5X A;  1UTH B;  4LAT A;  2BJI A;  1IXC A;  3EN3 A;  4OET A;  1USY E;  1RDY A;  1DTG A;  4OVS A;  5AA3 A;  2YJP A;  1QGX A;  4PGN A;  5KCJ B;  2B3F A;  1SPI A;  2O6A A;  5FBP A;  3Q28 A;  4P0G A;  4Q0C A;  2HCA A;  4ZE8 A;  4GWZ A;  1B6H A;  3RNN A;  1Z7N E;  2F8D A;  3U93 A;  2UVI A;  4Z7E A;  4AB5 A;  4ZED A;  3A09 A;  5K2Y A;  5CMK A;  1EYI A;  3WAF A;  4XIG Q;  2H99 A;  3KG2 A;  4WEP A;  2Q8J A;  1FQA A;  5ITP A;  2G29 A;  3K6W A;  1S9T A;  4GX6 A;  4Z0I A;  5I58 A;  1RKM A;  4MBP A;  1PBQ A;  3E3K A;  3T9H B;  3T96 B;  1SW4 A;  3FJM A;  4FE8 A;  2NOO A;  3O6I A;  2KQZ A;  1WVJ A;  1J1N A;  1IMA A;  1FTK A;  3GLB A;  1H3D A;  2QS2 A;  3PUY E;  1MXZ A;  3FVN A;  3IOR A;  1QUJ A;  3O6G A;  2FA7 A;  3WAE A;  3KOT A;  1JNF A;  4GVO A;  2GHA A;  1IZ1 A;  4P56 A;  4OES A;  3M8U A;  1LBC A;  3IX1 A;  2QS4 A;  2DYX A;  2OBG A;  4N8G A;  3QIM A;  3B6Q A;  4H0W A;  4ZE9 A;  4P1E A;  4U23 A;  5H8S A;  1Y4T A;  4NAP A;  2Y7I A;  1NV6 A;  2D3I A;  1IIW A;  4H46 A;  4PBQ A;  3O66 A;  5L9O A;  3CHG A;  1IUD A;  4P11 A;  3TFL A;  3VVF A;  3DEL B;  3JZJ A;  3U92 A;  5EQA A;  1OQG A;  3L6G A;  1FJ9 A;  4I9D A;  5EHS A;  4F29 A;  3SES A;  4DDD A;  3C32 A;  4TOZ A;  4KHZ E;  4OTE A;  2WBB A;  1B3F A;  4ELR A;  1NH7 A;  1M5F A;  2XXQ A;  2I49 A;  5H8N B;  5I57 B;  5HPQ A;  3PTY A;  1B1X A;  3EHS A;  4NX1 A;  1B7H A;  4XFE A;  3VLV A;  1FQB A;  3TEL A;  2F6P A;  3U94 A;  3O9P A;  5ESY A;  4X48 A;  4M1V A;  5ET6 A;  3K1P A;  1PBP A;  1B58 A;  4N4U A;  1N0T A;  4NF8 A;  1M5C A;  3FXR A;  3TQL A;  2B3B A;  2X26 A;  1B52 A;  1TFA A;  3OSQ A;  5DVF A;  2YPN A;  1FJ6 A;  2XXU A;  1MXY A;  4P9K A;  1LBZ A;  2OJT A;  5AA2 B;  1II5 A;  4QXD A;  2PT1 A;  3B8B A;  4OFL A;  2R8T A;  2I0C A;  4KCD A;  3IOU A;  2H98 A;  4MLV A;  4OVJ A;  2HHM A;  3GBB A;  1LFG A;  4MH5 A;  4R6H A;  1ZLQ A;  3SEU A;  4N6P A;  3ROJ A;  1PC3 A;  5IGA A;  5EYG A;  4EUO A;  5BUU A;  4KYS A;  2QFL A;  4PET A;  5L9M A;  4PE3 A;  2PFY A;  4H8J A;  4NMY A;  5H8H A;  3MP1 A;  1XVX A;  1R1N A;  1NV2 A;  3PPP A;  1P1U A;  4YZZ A;  4QFN A;  1NV4 A;  1LCT A;  4NQ8 A;  3PPQ A;  4HW8 A;  3LUY A;  1B5H A;  2ZNU A;  3D4C A;  2UVH A;  2NUV A;  4AS5 A;  5H8F B;  4X8R A;  1MPD A;  4H1X A;  2XX7 A;  3DLN A;  4G77 A;  4Q8R A;  1FPB A;  1DBZ A;  4FEB A;  1MRP A;  3MST A;  4R2F A;  3TCF A;  1LAH E;  3Q26 A;  1K9Z A;  2GRV A;  3L6H A;  1ELJ A;  4G68 A;  3IB2 A;  1KA1 A;  1LEV A;  1OVT A;  1Z7M E;  3QUJ A;  2XXI A;  1CNQ A;  4XKN A;  4H5F A;  1UTB B;  4MCO A;  5I2N A;  2D21 A;  1EZ9 A;  5I56 A;  4MHF A;  2HXW A;  4RA1 A;  2DS9 A;  1B7U A;  4K3F A;  3MVX A;  1Y9U A;  4NE4 A;  2OWT A;  1VFD A;  3ZKL A;  1FQE A;  5I59 A;  1B3L A;  2VPN A;  3T66 A;  1INP A;  5ET8 A;  4U4S A;  3MPL A;  5IKB A;  1FBE A;  5TPA A;  1DMB A;  5EHM A;  1TXF A;  1LB8 A;  4IO3 A;  2A5T B;  2XHD A;  3BFU A;  1VR5 A;  2ZNS A;  1OMP A;  4BLA A;  3ILT B;  2BJJ X;  3KBZ A;  1FSA A;  4ELO A;  4BDR A;  2VGQ A;  1AH5 A;  4RK9 A;  3CFX A;  1H45 A;  3N6U A;  2B65 A;  3H6V A;  1LGB C;  4POX A;  4R2B A;  1D9V A;  1PB9 A;  4PTK A;  2ZYM A;  5FHM A;  4X9T A;  1FPD A;  1FTM A;  1Q35 A;  4PAI A;  4TLM B;  1A54 A;  2OWS A;  5DVI A;  2DSF A;  4GD5 A;  1FW0 A;  4NF6 A;  3FGS A;  3R7X A;  5CMB A;  2PCR A;  2I4B A;  3EKI A;  2Y7K A;  4NF0 A;  3KBR A;  4THI A;  3CFL A;  3MC2 A;  3C31 A;  4DZ1 A;  5ET5 A;  4MFI A;  1MQI A;  4RK2 A;  5F1Q A;  1JVY A;  3BBR A;  4P47 A;  2B4L A;  3FAT A;  4U22 A;  2CZL A;  2M8C A;  1YXI A;  1URD A;  4PAK A;  2Y7W A;  3OO6 A;  1SW2 A;  4YKI A;  3C4M A;  2QVR A;  4U1O A;  1GGG A;  4RJZ A;  3UOR A;  1UQW A;  5A5L A;  3QSL A;  3PMW A;  5IAI A;  2QS3 A;  3TTN A;  2AL4 A;  2RC8 A;  2ZZW A;  2XWK A;  1NI9 A;  2WEF A;  4PE5 B;  1K9Y A;  1SVX B;  3SKP A;  4HTG A;  4MIJ A;  4FBP A;  5TP9 B;  4JWY A;  3MWB A;  4MNI A;  2DWI A;  1AOV A;  3QK6 A;  4QBA A;  3TTL A;  4IO4 A;  4GX3 A;  1XVY A;  2F34 A;  4MLQ A;  3KN7 A;  2P1S A;  5I5P A;  2AYS A;  3KOS A;  5AA4 A;  2XXW A;  1DOT A;  2ZMB A;  1B46 A;  3OO7 A;  5B70 A;  1FQC A;  4N15 A;  4NHB A;  3M3K A;  1PEB A;  1BIY A;  4F1Y A;  4C1T A;  3CR9 A;  5EQ9 A;  3KFM A;  4ISU A;  4PQJ A;  4DXB A;  3LSW A;  4PFI A;  3B6W A;  2ZYK A;  3G7W A;  2IA4 A;  3FXQ A;  2WBD A;  4O3B A;  5CC2 A;  3CG3 A;  5HBC A;  3VV5 A;  3W15 C;  4QSE A;  4PBH A;  1USY H;  4N6D A;  2I3W A;  2HZL A;  1D3K A;  2XXP A;  1LCF A;  3TPA A;  1YAE A;  4I1D A;  4ZZA A;  3KC1 A;  4IR8 A;  1VDW A;  1Q1K A;  2XWV A;  4HE0 A;  4KPT A;  2X7Q A;  1P1W A;  1MY3 A;  4YMB A;  4HE1 A;  2GHB A;  4R6K A;  1NH8 A;  1JET A;  4KYE A;  4DLD A;  4NWC A;  3S2V A;  2CEX A;  1Y1Z A;  1N7X A;  3N94 A;  3K02 A;  4JVI A;  3VVE A;  2AL5 A;  4O7I A;  2CZK A;  3KZG A;  4QFO A;  4P8B A;  1B0H A;  5CBR A;  4KYD A;  4ZEB A;  1TFD A;  3CFZ A;  5CMC A;  3HST A;  2DXY A;  4GBW A;  3IJO B;  3A29 A;  1LLS A;  4JBZ A;  1LB9 A;  1B7Z A;  2JJK A;  3KN3 A;  4XKQ A;  1NNT A;  2Z23 A;  3IJX B;  5IZ1 A;  3T9X B;  1MXU A;  3FUZ A;  4OQO A;  1SQY A;  5I2K A;  4RXL A;  4ESW A;  3RY3 A;  5F7V A;  2DVC A;  2P0S A;  4WED A;  3SZP A;  4XKP A;  2CMO A;  1L5T A;  4UAB A;  3TYH A;  1FRP A;  4O7M A;  1ZMG A;  1NV5 A;  4P0I A;  4NED A;  3PU5 A;  4L17 A;  4LQ2 A;  1M5B A;  2ZXT A;  4DXC A;  1FPJ A;  3CSB A;  5EQ8 A;  2XX8 A;  3UIF A;  3H6U A;  5H8N A;  3FVG A;  2KLF A;  1NUW A;  4RYA A;  3IO6 A;  3TQW A;  4GWU A;  2ZNT A;  3U1O A;  4MMP A;  2O1L A;  2VHA A;  1QJM A;  3RTW B;  1B51 A;  4QFK A;  4G4P A;  3VFJ A;  1VE4 A;  2H4I A;  2DOJ A;  1JVX A;  3EHT A;  3OEL A;  1ZU0 A;  4PF6 A;  1EYJ A;  1YPN A;  4G8N A;  1MY2 A;  3FVK A;  4DXU A;  4PF8 A;  3OEK A;  2DWA A;  2XXV A;  3MVY A;  3MZ1 A;  4G8M A;  3V8X B;  1HSE A;  4OXV A;  5CM6 A;  2PVU A;  4LON B;  4U2R A;  1P1Q A;  3MBP A;  3RT8 A;  3OO8 A;  4OWD A;  1FTJ A;  3UGW A;  1EH3 A;  3LUZ A;  5IZ3 B;  4GRK A;  1US4 A;  2XXY A;  4F22 A;  2O7I A;  2QMX A;  2O68 A;  2QL3 A;  1EZP A;  1LBV A;  3CVG A;  2QPQ A;  1GR2 A;  3SEX A;  2ZYO A;  3QMF A;  1LAX A;  1MG1 A;  1M5E A;  5JTY A;  3FD3 A;  3PUW E;  2ABH A;  1AMF A;  2FBP A;  4YKK A;  4N6K A;  3IAZ A;  4FAJ A;  4FIM A;  3V89 B;  1A8E A;  1YTV A;  1FPI A;  4ZZE A;  5A5X B;  1XS5 A;  5H8Q A;  1LST A;  4H6D A;  4ONY A;  1MY4 A;  2UXA A;  1A99 A;  4GWY A;  1HSJ A;  1O64 A;  2V3U A;  5HM4 B;  4P1L A;  4I62 A;  3AXF A;  4GIZ A;  3IFA A;  1AIV A;  4TQU Q;  2FNC A;  2H9B A;  4HXV A;  4YMA A;  2WX9 A;  5I7I A;  5BWJ A;  1RDX A;  1D9Q A;  2PT2 A;  4MX6 A;  4JB7 A;  3Q25 A;  1XOC A;  5I58 B;  2UYE A;  4NF5 B;  4DI3 D;  4JVD A;  2B4M A;  3EF7 A;  3K6X A;  2NVU B;  1YYZ A;  1MQJ A;  1NV0 A;  3O29 A;  3R26 A;  1MDP 1;  3MZB A;  3RPW A;  3FVO A;  1LFI A;  4LA9 A;  1OLA A;  1QUK A;  2DWJ A;  3K2D A;  4GL0 A;  1GVC A;  3KEI A;  4YKP A;  4FED A;  1PB8 A;  1FQD A;  3SEW A;  4AS4 A;  4BDN A;  5DEX B;  4YB6 A;  3K1N A;  4M4G A;  4YKJ A;  1LBX A;  1URS A;  2A5T A;  4UA8 A;  2D5W A;  4PFU A;  4PCD A;  2E1S A;  4HCY A;  3OSR A;  4ZEI A;  4OMB A;  3Q29 A;  1PDA A;  4NF4 A;  1B05 A;  2Q8M A;  3VXC A;  4KQP A;  3BIH A;  2OZZ A;  2GH9 A;  1FCK A;  3TMG A;  5CI5 A;  3O97 A;  4F1V A;  1B9J A;  3T22 A;  3C33 A;  5FHO A;  3UK4 A;  2F7A A;  3S9L C;  2RCA A;  3E79 A;  4GWO A;  3E9X A;  1IQ7 A;  2OWZ A;  1FBP A;  1A7L A;  2DP8 A;  4H45 A;  2QRY A;  3O28 A;  4WKM A;  3EPE A;  4QF9 A;  2Q9T A;  1ZBM A;  5M2V A;  1B5J A;  3HFU A;  4R75 A;  4U1Z A;  3TDJ A;  1NV7 A;  4I3Y A;  3HHG A;  4OFO A;  3TTM A;  3D1R A;  5KDT A;  2HZK A;  2DQV A;  2CZI A;  4O3A A;  3N6T A;  1IXG A;  4DIG A;  1P1N A;  2VD3 A;  3UN6 A;  4XTC Q;  3VLU A;  3OD7 A;  1NNF A;  3K01 A;  2V25 A;  3C34 A;  1H76 A;  3PD8 A;  1DSN A;  3G3G A;  1Y4C A;  4KXP A;  1NKX A;  2F7C A;  3GBA A;  4N8Y A;  1AL3 A;  1NL5 A;  1B0L A;  3KN8 A;  1FPK A;  3TTK A;  3HO7 A;  4DCX A;  3UP9 A;  2RIN A;  5H8H B;  1HSL A;  2HEU A;  2X7P A;  1KWH A;  3IB0 A;  3KGC A;  1FTL A;  4I3E A;  2FYI A;  2REG A;  3OO9 A;  4KR5 A;  3LSF B;  1NNK A;  4GQO A;  2OK2 A;  3B6T A;  2DDK A;  3QXM A;  4XXU A;  2O84 X;  3RPL A;  2XWO A;  1XHY A;  1JEU A;  2XD3 A;  4OVP A;  2V93 A;  1QUI A;  4KFQ A;  4Q5T A;  2Y7R A;  3S9M C;  4QSD A;  3MP6 A;  3GYY A;  1IMB A;  3Q27 A;  4QFL A;  2AIX A;  4NTL A;  3W9W A;  2I0B A;  4ECF A;  2NXO A;  4OEU A;  1MH4 A;  3JV9 A;  4G68 B;  1JP4 A;  2ONR A;  3T9U A;  1Y1M A;  4ZEF A;  3RYD A;  4MNP A;  4F2Q A;  1MY1 A;  1POT A;  3M3F A;  3IOT A;  1MM7 A;  5I2N B;  3DM0 A;  1SDX A;  3VLW A;  1LBB A;  5ICT A;  4GL8 A;  4RNS A;  3VVD A;  5J16 A;  4EQ7 A;  1MXX A;  4OVR A;  3PGF A;  1F9B A;  5ISU A;  4UAC A;  5IZZ A;  4E0W A;  3U65 A;  3FJG A;  5I59 B;  3PD9 A;  5K2X A;  4DE8 A;  4FEC A;  3H3G A;  4QFP A;  3LR1 A;  1I6B A;  3GXA A;  3IK6 B;  5TPA B;  4E0X A;  4R73 A;  4JWO A;  3FV1 A;  2ZZX A;  4F31 B;  5F24 A;  3G3H A;  1UTH A;  4BDL A;  1CB6 A;  3RGY A;  5FTI A;  1FBH A;  3UA8 A;  5KCJ A;  1NUY A;  3IOV A;  3QYT A;  3FBP A;  4OA4 A;  3VE1 B;  4RPN A;  4F1U A;  2P3N A;  4ZEC A;  3A3U A;  4R9G A;  3KSJ A;  2Z8F A;  5I84 A;  4LVQ A;  2RF1 A;  1ZKB A;  3V5A A;  4DCY A;  4H5G A;  3LC8 A;  1B3G A;  2FHY A;  4NF6 B;  3OOA A;  4OVQ A;  3PUV E;  2E0S A;  2QJE A;  3E4R A;  4LZ7 A;  1MXW A;  1QUL A;  4OAN A;  4IO5 A;  3FIR A;  5CRY A;  3F11 A;  4JWX A;  4Q30 B;  4F3P A;  2QMW A;  4GX4 A;  3KSX A;  4F3B A;  3FV2 A;  3PPO A;  3O2A A;  1S7Y A;  1BK4 A;  5FTH A;  1TT1 A;  1JW1 A;  4C1U A;  2LAO A;  4EF2 A;  2XX9 A;  2Y5L A;  5FHN A;  2Y5K A;  3O6H A;  4F3S A;  1US5 A;  2G93 A;  1O63 A;  1B40 A;  1DK4 A;  3MUQ A;  2IEE A;  3CIJ A;  2Z22 A;  1DCU A;  3IB1 A;  4QHQ A;  3ECR A;  5TU0 A;  1YZ0 A;  4IY6 A;  3RQT A;  1ZTY A;  3G3J A;  2UYF A;  3R6U A;  3S4U A;  3FXB A;  1MXV A;  2Q2A A;  3PV0 E;  1DPE A;  1BKA A;  4H8I A;  1A40 A;  5KZT A;  5DT6 A;  1B2H A;  4MJO A;  5T3J A;  1QW0 A;  4QRZ A;  2XWI A;  4XF5 A;  2P2A A;  5LOM A;  4YB5 A;  4YIC A;  2V84 A;  2DE2 A;  2F78 A;  2XXH A;  1G0I A;  4EDP A;  1MS7 A;  4X1B A;  2I58 A;  3ZKK A;  3PMX A;  5I57 A;  4I8C A;  1D9Y A;  2F35 A;  4ELP A;  2Q2C A;  4AB6 A;  1UIU A;  3T1B A;  3K6V A;  5ICQ A;  5CBS A;  2PMS A;  4OHN A;  2R9J A;  4LZ8 A;  1FTA A;  3MP8 A;  4HCW A;  3A3C A;  2Q88 A;  4LUB A;  4XEQ A;  2L5V A;  4NF5 A;  4JSO A;  1EYK A;  5AA2 A;  2V3T A;  2H25 A;  2HQ0 A;  1RDZ A;  1MPB A;  4PFT A;  5CMM A;  1O7T A;  1IXH A;  2XXK A;  4KD5 A;  4ELQ A;  1B32 A;  4EQ9 A;  1S50 A;  1R9L A;  2REJ A;  4N91 A;  3CI8 A;  1MDQ A;  1URG A;  2Q89 A;  1XT8 A;  3THI A;  1N76 A;  1Y3P A;  1FPL A;  3HV1 A;  2F36 A;  4MEV A;  5DEX A;  3PPR A;  1KA0 A;  3QUF A;  4OZ9 A;  1B3E A;  4YB7 A;  3OEM A;  1MY0 A;  3H4Z A;  5JK4 A;  1ZJL A;  3MVW A;  3E13 X;  1T0K A;  5I2K B;  1MH3 A;  4R74 A;  5DYH A;  1FBC A;  1IEJ A;  3FAS A;  5AA1 A;  1OIB A;  4F3G A;  1OVB A;  2HFB A;  3H6T A;  5H8F A;  2VP1 A;  2WYK A;  1LAF E;  4WXJ A;  1IIT A;  1XC1 A;  5LDZ A;  2RCB A;  2HPG A;  4OER A;  4EF1 A;  1JW5 A;  3RN8 A;  4LQ5 A;  2F3B A;  1H44 A;  3TCG A;  3K4U A;  1NNP A;  1BP5 A;  4KCC A;  4ESX A;  1KZ8 A;  5ELV A;  2PX1 A;  1FPG A;  3K6U A;  2F6G A;  1FTO A;  2DVZ A;  2CZH A;  1UTB A;  4TLL B;  3B50 A;  3MPK A;  4PFW A;  1LBY A;  1G0H A;  4X1D A;  4N13 A;  1WOD A;  1MQD A;  3U8Q A;  4P3L A;  1B4H A;  1FBF A;  1SYI A;  2YLN A;  3FXU A;  3SEY A;  1AWB A;  3KC0 A;  2DE3 A;  1DTZ A;  4PDD A;  4NGU A;  1H43 A;  1OQH A;  2XXT A;  3K00 A;  3V83 A;  3TCH A;  4IO6 A;  1IME A;  2R71 A;  1R9Q A;  1POY 1;  1FBG A;  1Y3Q A;  2ALU A;  3OXN A;  3HN0 A;  4GWS A;  1A55 A;  2XXR A;  2O1M A;  3VDF A;  5EYH A;  2QSX A;  2KR0 A;  1JW4 A;  5JTY B;  4XKR A;  4BDO A;  3I6V A;  3ODB A;  2W7Y A;  1I69 A;  2OX3 A;  1SD3 A;  1NUZ A;  3G3F A;  2XD2 A;  5DVJ A;  1JQF A;  3I5O A;  4F19 A;  3DP8 A;  3H06 B;  5H8Q B;  1B4Z A;  4AQ4 A;  3CSG A;  2CEY A;  1A8F A;  4GOT A;  5L9S A;  3FJ7 A;  3MQ9 A;  3S9N C;  4YAH X;  2PBW A;  3IOW A;  4GFR A;  1QKA A;  2FIE A;  5EQ7 A;  1MQH A;  1JEV A;  2RKM A;  4NG7 A;  1FPF A;  1MM6 A;  3PUX E;  4N81 A;  3SEV A;  4OEN A;  1XI6 A;  4OVT A;  3IFC A;  2V3Q A;  4IGT A;  4HE2 A;  4NF8 B;  4LP2 B;  3HHF A;  4POW A;  4QSC A;  1SI1 A;  3P7I A;  4IO2 A;  1SBP A;  2ONK E;  2THI A;  4YU0 A;  3H6W A;  1WDN A;  3RUM A;  3OEN A;  4NN3 A;  3MJN A;  3DP4 A;  2VOZ A;  4LN5 A;  3TTR A;  1GV8 A;  1VFE A;  4PFY A;  1N3X A;  2ZYN A;  2Q74 A;  4GXA A;  3LSL A;  5TP9 A;  3RLF E;  1B5I A;  1RYX A;  3LV0 A;  1YCJ A;  1RYO A;  4G68 C;  3G3I A;  3C9H A;  4OEV A;  4KI0 E;  4ZDM A;  4F2O A;  3M3L A;  2O7U A;  4BDQ A;  4RPO A;  1P99 A;  3C35 A;  4U4X A;  1D4N A;  2Y84 A;  1FPE A;  4RY1 A;  1NV1 A;  3MW0 A;  3ZS6 A;  4F39 A;  2ESN A;  4ZEK A;  4PC9 A;  1IXI A;  2Z8E A;  1B3H A;  2Z8D A;  4JSD A;  5DW8 A;  2MKZ A;  4PFR A;  1ATG A;  1CE2 A;  1N84 A;  2GQ1 A;  2H5Y A;  4NF4 B;  1UIV A;  3TAJ A;  3T0J A;  3TZA A;  4OYV A;  4F18 A;  1ANF A;  2VT5 A;  3FZV A;  4H67 A;  2Y7P A;  4IGR A;  4EQB A;  3PMV A;  4PDH A;  4X04 A;  2ZZV A;  2UVJ A;  4G8H A;  4IY5 A;  1BTJ A;  1Y3N A;  3PPN A;  4G2Z A;  3SET A; 
#chains in the Genus database with same CATH homology
 4R6Y A;  5AE4 A;  3IL1 B;  4LZ5 A;  5AA2 D;  1GTK A;  4O3C A;  3EHU A;  2HAU A;  3JYR A;  1SYH A;  3G3K A;  2RC7 A;  5I56 B;  2DXR A;  4R9F A;  4H65 A;  2QS1 A;  1LAG E;  1R6Z A;  3DP6 A;  4GF8 A;  1ZIU A;  4OFJ A;  2I3V A;  4FOR A;  5KDT B;  1BLF A;  2O51 A;  3TEP A;  1SI0 A;  1DPP A;  5DTB A;  2OCU A;  3K1M A;  1OLC A;  3T93 B;  1Y20 A;  3I3V A;  2A5S A;  3SER A;  3MAM A;  1VSO A;  3CRB A;  3RT6 B;  3TKD A;  5ITO A;  1SW5 A;  3K0V A;  1M5D A;  4R72 A;  3ONM A;  4GLI A;  3U72 A;  1I6A A;  2DWH A;  3BFT A;  3N26 A;  4MF3 A;  1N7W A;  3PUZ E;  5L8D A;  3OMB A;  3USD A;  3IR1 A;  4JDF A;  3D4G A;  3KJ7 A;  4EXL A;  1EZO A;  3ZSF A;  2OLB A;  2HAV A;  2I4C A;  3IO4 A;  2O69 A;  1QKB A;  5J1D A;  3QAX A;  3H7M A;  4PP0 A;  4ND9 A;  4IB2 A;  3TOD A;  2I48 A;  4GXS B;  3HCQ A;  3KJT A;  3HPI A;  4IO7 A;  3LBS A;  2PYY A;  4HS7 A;  2ONS A;  2F97 A;  1MQG A;  4EXK A;  3H03 A;  1I6Q A;  1N3W A;  2I6E A;  1NMU A;  1N04 A;  4BDM A;  3N5L A;  4NWD A;  3MZ9 A;  3EQ1 A;  3TUS A;  2GFE A;  5JEI A;  2UVG A;  4FAT A;  4U21 A;  1QVS A;  1B1H A;  3C36 A;  3BKI B;  2RC9 A;  2R6G E;  1PB7 A;  3LSX A;  1TWY A;  2VD2 A;  4ZS9 A;  1SW1 A;  3GZG A;  2ANJ A;  3B7D A;  3MVZ A;  4JXI A;  3SDF A;  3T9V A;  1LFH A;  3RTF B;  2NWJ A;  1EU8 A;  3W9V A;  2F5X A;  1FQF A;  1NFT A;  2DE4 A;  3VXB A;  3S9E A;  4N07 A;  5B7D A;  5EYF A;  4C0R A;  4FJP A;  5AA4 B;  2XXX A;  1P1O A;  2F7B A;  3ILU B;  1MPC A;  3CG1 A;  2WKY A;  5A5X A;  1UTH B;  4LAT A;  1IXC A;  3EN3 A;  4OET A;  1USY E;  1DTG A;  5AA3 A;  2YJP A;  5KCJ B;  2B3F A;  2O6A A;  3Q28 A;  4P0G A;  4Q0C A;  2HCA A;  4ZE8 A;  1B6H A;  3RNN A;  1Z7N E;  2F8D A;  3U93 A;  2UVI A;  4Z7E A;  4AB5 A;  4ZED A;  3A09 A;  5K2Y A;  5CMK A;  3WAF A;  4XIG Q;  2H99 A;  3KG2 A;  4WEP A;  2Q8J A;  1FQA A;  5ITP A;  2G29 A;  3K6W A;  1S9T A;  4Z0I A;  5I58 A;  1RKM A;  4MBP A;  1PBQ A;  3E3K A;  3T9H B;  3T96 B;  1SW4 A;  3FJM A;  4FE8 A;  2NOO A;  3O6I A;  1WVJ A;  1J1N A;  1FTK A;  3GLB A;  1H3D A;  2QS2 A;  3PUY E;  1MXZ A;  3FVN A;  3IOR A;  1QUJ A;  3O6G A;  2FA7 A;  3WAE A;  3KOT A;  1JNF A;  4GVO A;  2GHA A;  1IZ1 A;  4OES A;  3M8U A;  1LBC A;  3IX1 A;  2QS4 A;  2DYX A;  2OBG A;  3QIM A;  3B6Q A;  4H0W A;  4ZE9 A;  4U23 A;  5H8S A;  1Y4T A;  2Y7I A;  2D3I A;  1IIW A;  3O66 A;  5L9O A;  1IUD A;  4P11 A;  3TFL A;  3VVF A;  3DEL B;  3JZJ A;  3U92 A;  1OQG A;  3L6G A;  4I9D A;  5EHS A;  4F29 A;  3SES A;  4DDD A;  3C32 A;  4TOZ A;  4KHZ E;  4OTE A;  1B3F A;  4ELR A;  1NH7 A;  1M5F A;  2XXQ A;  2I49 A;  5H8N B;  5I57 B;  5HPQ A;  1B1X A;  3EHS A;  1B7H A;  3VLV A;  1FQB A;  3TEL A;  2F6P A;  3U94 A;  3O9P A;  4X48 A;  4M1V A;  3K1P A;  1PBP A;  1B58 A;  1N0T A;  4NF8 A;  1M5C A;  3FXR A;  3TQL A;  2B3B A;  2X26 A;  1B52 A;  1TFA A;  3OSQ A;  5DVF A;  2YPN A;  2XXU A;  1MXY A;  2OJT A;  5AA2 B;  1II5 A;  2PT1 A;  4OFL A;  2I0C A;  4KCD A;  3IOU A;  2H98 A;  4MLV A;  4OVJ A;  3GBB A;  1LFG A;  4MH5 A;  4R6H A;  1ZLQ A;  3SEU A;  4N6P A;  1PC3 A;  4EUO A;  5BUU A;  4KYS A;  4PET A;  5L9M A;  4H8J A;  4NMY A;  5H8H A;  3MP1 A;  1XVX A;  1R1N A;  3PPP A;  1P1U A;  4YZZ A;  4QFN A;  1LCT A;  3PPQ A;  4HW8 A;  3LUY A;  1B5H A;  2ZNU A;  3D4C A;  2UVH A;  2NUV A;  5H8F B;  1MPD A;  4H1X A;  2XX7 A;  3DLN A;  4G77 A;  4Q8R A;  4FEB A;  1MRP A;  4R2F A;  3TCF A;  1LAH E;  3Q26 A;  2GRV A;  3L6H A;  1ELJ A;  4G68 A;  3IB2 A;  1OVT A;  1Z7M E;  3QUJ A;  2XXI A;  4XKN A;  4H5F A;  1UTB B;  5I2N A;  2D21 A;  1EZ9 A;  5I56 A;  2HXW A;  4RA1 A;  2DS9 A;  1B7U A;  4K3F A;  3MVX A;  1Y9U A;  4NE4 A;  2OWT A;  1VFD A;  3ZKL A;  1FQE A;  5I59 A;  1B3L A;  3T66 A;  4U4S A;  3MPL A;  5IKB A;  5TPA A;  1DMB A;  5EHM A;  1TXF A;  1LB8 A;  4IO3 A;  2A5T B;  2XHD A;  3BFU A;  1VR5 A;  2ZNS A;  1OMP A;  4BLA A;  3ILT B;  2BJJ X;  4ELO A;  4BDR A;  2VGQ A;  1AH5 A;  4RK9 A;  3CFX A;  1H45 A;  3N6U A;  2B65 A;  3H6V A;  1LGB C;  4POX A;  4R2B A;  1D9V A;  1PB9 A;  2ZYM A;  5FHM A;  4X9T A;  1FTM A;  1Q35 A;  4TLM B;  1A54 A;  2OWS A;  5DVI A;  2DSF A;  4GD5 A;  1FW0 A;  4NF6 A;  3R7X A;  3FGS A;  5CMB A;  2I4B A;  2Y7K A;  3KBR A;  4THI A;  3CFL A;  3MC2 A;  3C31 A;  4DZ1 A;  4MFI A;  1MQI A;  4RK2 A;  5F1Q A;  1JVY A;  3BBR A;  3FAT A;  4U22 A;  2CZL A;  2M8C A;  1URD A;  2Y7W A;  3OO6 A;  1SW2 A;  4YKI A;  3C4M A;  4U1O A;  1GGG A;  4RJZ A;  3UOR A;  1UQW A;  3QSL A;  3PMW A;  5IAI A;  2QS3 A;  3TTN A;  2AL4 A;  2RC8 A;  4PE5 B;  1SVX B;  3SKP A;  4HTG A;  5TP9 B;  4JWY A;  3MWB A;  1AOV A;  2DWI A;  3QK6 A;  3TTL A;  4IO4 A;  1XVY A;  2F34 A;  4MLQ A;  3KN7 A;  2P1S A;  2AYS A;  3KOS A;  5AA4 A;  2XXW A;  1DOT A;  2ZMB A;  1B46 A;  3OO7 A;  5B70 A;  1FQC A;  3M3K A;  1PEB A;  1BIY A;  4F1Y A;  4C1T A;  3CR9 A;  3KFM A;  4ISU A;  4PQJ A;  4DXB A;  3LSW A;  3B6W A;  2ZYK A;  3G7W A;  2IA4 A;  3FXQ A;  4O3B A;  5CC2 A;  3CG3 A;  5HBC A;  3VV5 A;  3W15 C;  4QSE A;  1USY H;  2I3W A;  2HZL A;  1D3K A;  2XXP A;  1LCF A;  3TPA A;  1YAE A;  4I1D A;  4ZZA A;  1Q1K A;  4KPT A;  2X7Q A;  1P1W A;  1MY3 A;  4YMB A;  2GHB A;  4R6K A;  1NH8 A;  1JET A;  4KYE A;  4DLD A;  4NWC A;  3S2V A;  1Y1Z A;  1N7X A;  3N94 A;  3K02 A;  3VVE A;  2AL5 A;  3KZG A;  4QFO A;  1B0H A;  5CBR A;  4KYD A;  4ZEB A;  1TFD A;  3CFZ A;  5CMC A;  3HST A;  2DXY A;  3IJO B;  1LLS A;  4JBZ A;  1LB9 A;  1B7Z A;  3KN3 A;  4XKQ A;  1NNT A;  2Z23 A;  3IJX B;  3T9X B;  1MXU A;  3FUZ A;  4OQO A;  1SQY A;  5I2K A;  4RXL A;  4ESW A;  3RY3 A;  5F7V A;  2DVC A;  2P0S A;  4WED A;  4XKP A;  2CMO A;  1L5T A;  3TYH A;  1ZMG A;  4P0I A;  4NED A;  3PU5 A;  4L17 A;  4LQ2 A;  1M5B A;  2ZXT A;  4DXC A;  3CSB A;  2XX8 A;  3UIF A;  3H6U A;  5H8N A;  3FVG A;  2KLF A;  4RYA A;  3IO6 A;  3TQW A;  2ZNT A;  3U1O A;  2O1L A;  2VHA A;  1QJM A;  3RTW B;  1B51 A;  4QFK A;  4G4P A;  3VFJ A;  1VE4 A;  2H4I A;  2DOJ A;  1JVX A;  3EHT A;  3OEL A;  1ZU0 A;  1YPN A;  4G8N A;  1MY2 A;  3FVK A;  4DXU A;  3OEK A;  2DWA A;  2XXV A;  3MVY A;  3MZ1 A;  4G8M A;  3V8X B;  1HSE A;  4OXV A;  5CM6 A;  2PVU A;  4LON B;  4U2R A;  1P1Q A;  3MBP A;  3RT8 A;  3OO8 A;  4OWD A;  1FTJ A;  3UGW A;  1EH3 A;  4GRK A;  1US4 A;  2XXY A;  4F22 A;  2O7I A;  2QMX A;  2O68 A;  2QL3 A;  1EZP A;  3CVG A;  2QPQ A;  1GR2 A;  3SEX A;  2ZYO A;  1LAX A;  1MG1 A;  1M5E A;  5JTY A;  3FD3 A;  3PUW E;  2ABH A;  1AMF A;  4YKK A;  3IAZ A;  4FAJ A;  4FIM A;  3V89 B;  1A8E A;  1YTV A;  4ZZE A;  5A5X B;  1XS5 A;  5H8Q A;  1LST A;  4H6D A;  4ONY A;  1MY4 A;  2UXA A;  1A99 A;  1HSJ A;  1O64 A;  2V3U A;  5HM4 B;  4I62 A;  3AXF A;  4GIZ A;  1AIV A;  4TQU Q;  2FNC A;  2H9B A;  4YMA A;  5BWJ A;  2PT2 A;  4JB7 A;  3Q25 A;  1XOC A;  5I58 B;  2UYE A;  4NF5 B;  3EF7 A;  3K6X A;  2NVU B;  1MQJ A;  3O29 A;  3R26 A;  1MDP 1;  3MZB A;  3RPW A;  3FVO A;  1LFI A;  4LA9 A;  1OLA A;  1QUK A;  2DWJ A;  3K2D A;  4GL0 A;  1GVC A;  3KEI A;  4YKP A;  4FED A;  1PB8 A;  1FQD A;  3SEW A;  4BDN A;  5DEX B;  4YB6 A;  3K1N A;  4M4G A;  4YKJ A;  1URS A;  2A5T A;  4UA8 A;  2D5W A;  4PFU A;  2E1S A;  4HCY A;  3OSR A;  4ZEI A;  4OMB A;  3Q29 A;  1PDA A;  4NF4 A;  1B05 A;  3VXC A;  4KQP A;  2OZZ A;  2GH9 A;  1FCK A;  3TMG A;  5CI5 A;  3O97 A;  4F1V A;  1B9J A;  3T22 A;  3C33 A;  5FHO A;  3UK4 A;  2F7A A;  3S9L C;  2RCA A;  4GWO A;  3E9X A;  1IQ7 A;  1A7L A;  2DP8 A;  2QRY A;  3O28 A;  3EPE A;  4WKM A;  4QF9 A;  2Q9T A;  1ZBM A;  5M2V A;  1B5J A;  4R75 A;  4U1Z A;  3TDJ A;  3HHG A;  4OFO A;  3TTM A;  5KDT A;  2HZK A;  2DQV A;  4O3A A;  3N6T A;  1IXG A;  4DIG A;  1P1N A;  2VD3 A;  3UN6 A;  4XTC Q;  3VLU A;  3OD7 A;  1NNF A;  3K01 A;  2V25 A;  3C34 A;  1H76 A;  3PD8 A;  1DSN A;  3G3G A;  1Y4C A;  1NKX A;  2F7C A;  3GBA A;  1AL3 A;  1NL5 A;  1B0L A;  3KN8 A;  3TTK A;  3HO7 A;  4DCX A;  3UP9 A;  2RIN A;  5H8H B;  1HSL A;  2HEU A;  2X7P A;  1KWH A;  3IB0 A;  3KGC A;  1FTL A;  2FYI A;  2REG A;  3OO9 A;  4KR5 A;  3LSF B;  1NNK A;  4GQO A;  2OK2 A;  3B6T A;  3QXM A;  4XXU A;  2O84 X;  1XHY A;  1JEU A;  2XD3 A;  2V93 A;  1QUI A;  4KFQ A;  4Q5T A;  2Y7R A;  3S9M C;  4QSD A;  3MP6 A;  3Q27 A;  4QFL A;  2AIX A;  4NTL A;  3W9W A;  2I0B A;  4ECF A;  2NXO A;  4OEU A;  1MH4 A;  3JV9 A;  4G68 B;  2ONR A;  3T9U A;  1Y1M A;  4ZEF A;  4F2Q A;  1MY1 A;  1POT A;  3M3F A;  3IOT A;  1MM7 A;  5I2N B;  3DM0 A;  1SDX A;  3VLW A;  1LBB A;  5ICT A;  4GL8 A;  4RNS A;  3VVD A;  4EQ7 A;  1MXX A;  3PGF A;  1F9B A;  5ISU A;  4UAC A;  4E0W A;  3FJG A;  5I59 B;  3PD9 A;  5K2X A;  4DE8 A;  4FEC A;  3H3G A;  4QFP A;  3LR1 A;  1I6B A;  3GXA A;  3IK6 B;  5TPA B;  4E0X A;  4R73 A;  4JWO A;  3FV1 A;  4F31 B;  3G3H A;  1UTH A;  4BDL A;  1CB6 A;  3RGY A;  5FTI A;  3UA8 A;  5KCJ A;  3IOV A;  3QYT A;  3VE1 B;  4RPN A;  4F1U A;  4ZEC A;  3A3U A;  4R9G A;  3KSJ A;  2Z8F A;  5I84 A;  4LVQ A;  2RF1 A;  1ZKB A;  3V5A A;  4DCY A;  4H5G A;  3LC8 A;  1B3G A;  4NF6 B;  3OOA A;  3PUV E;  2E0S A;  2QJE A;  3E4R A;  4LZ7 A;  1MXW A;  1QUL A;  4IO5 A;  3FIR A;  5CRY A;  3F11 A;  4JWX A;  4Q30 B;  4F3P A;  2QMW A;  3KSX A;  4F3B A;  3FV2 A;  3PPO A;  3O2A A;  1S7Y A;  5FTH A;  1TT1 A;  1JW1 A;  4C1U A;  2LAO A;  4EF2 A;  5FHN A;  2XX9 A;  3O6H A;  4F3S A;  1US5 A;  2G93 A;  1O63 A;  1B40 A;  3MUQ A;  2IEE A;  3CIJ A;  2Z22 A;  3IB1 A;  4QHQ A;  3ECR A;  5TU0 A;  4IY6 A;  3RQT A;  1ZTY A;  3G3J A;  2UYF A;  3R6U A;  3S4U A;  1MXV A;  2Q2A A;  3PV0 E;  1DPE A;  1BKA A;  4H8I A;  1A40 A;  5KZT A;  5DT6 A;  1B2H A;  1QW0 A;  4QRZ A;  2P2A A;  5LOM A;  4YB5 A;  4YIC A;  2V84 A;  2DE2 A;  2F78 A;  2XXH A;  4EDP A;  1MS7 A;  4X1B A;  2I58 A;  3ZKK A;  3PMX A;  5I57 A;  4I8C A;  1D9Y A;  2F35 A;  4ELP A;  2Q2C A;  4AB6 A;  1UIU A;  3K6V A;  5ICQ A;  5CBS A;  2PMS A;  4OHN A;  2R9J A;  4LZ8 A;  3MP8 A;  4HCW A;  3A3C A;  2Q88 A;  4LUB A;  4NF5 A;  4JSO A;  5AA2 A;  2V3T A;  2H25 A;  2HQ0 A;  1MPB A;  4PFT A;  5CMM A;  1O7T A;  1IXH A;  4KD5 A;  4ELQ A;  1B32 A;  4EQ9 A;  1S50 A;  1R9L A;  2REJ A;  3CI8 A;  1MDQ A;  1URG A;  2Q89 A;  1XT8 A;  3THI A;  1N76 A;  1Y3P A;  3HV1 A;  2F36 A;  5DEX A;  3PPR A;  3QUF A;  4OZ9 A;  1B3E A;  4YB7 A;  3OEM A;  1MY0 A;  3H4Z A;  5JK4 A;  1ZJL A;  3MVW A;  3E13 X;  1T0K A;  5I2K B;  1MH3 A;  4R74 A;  5DYH A;  1IEJ A;  3FAS A;  5AA1 A;  1OIB A;  4F3G A;  1OVB A;  2HFB A;  3H6T A;  5H8F A;  2VP1 A;  1LAF E;  4WXJ A;  1IIT A;  1XC1 A;  2RCB A;  4OER A;  4EF1 A;  1JW5 A;  3RN8 A;  4LQ5 A;  1H44 A;  3TCG A;  3K4U A;  1NNP A;  1BP5 A;  4KCC A;  4ESX A;  5ELV A;  2PX1 A;  3K6U A;  2F6G A;  1FTO A;  2DVZ A;  1UTB A;  4TLL B;  3MPK A;  4PFW A;  4X1D A;  4N13 A;  1WOD A;  1MQD A;  3U8Q A;  1B4H A;  1SYI A;  2YLN A;  3FXU A;  3SEY A;  2DE3 A;  1DTZ A;  1H43 A;  1OQH A;  2XXT A;  3K00 A;  3V83 A;  3TCH A;  4IO6 A;  2R71 A;  1R9Q A;  1POY 1;  1Y3Q A;  2ALU A;  3OXN A;  3HN0 A;  1A55 A;  2XXR A;  2O1M A;  3VDF A;  2QSX A;  1JW4 A;  5JTY B;  4XKR A;  4BDO A;  3I6V A;  3ODB A;  2W7Y A;  1I69 A;  1SD3 A;  3G3F A;  2XD2 A;  5DVJ A;  1JQF A;  3I5O A;  4F19 A;  3DP8 A;  3H06 B;  5H8Q B;  1B4Z A;  4AQ4 A;  3CSG A;  1A8F A;  4GOT A;  5L9S A;  3FJ7 A;  3MQ9 A;  3S9N C;  4YAH X;  2PBW A;  3IOW A;  4GFR A;  1QKA A;  1MQH A;  1JEV A;  2RKM A;  1MM6 A;  3PUX E;  3SEV A;  4OEN A;  2V3Q A;  4IGT A;  4NF8 B;  4LP2 B;  3HHF A;  4POW A;  4QSC A;  1SI1 A;  3P7I A;  4IO2 A;  1SBP A;  2ONK E;  2THI A;  4YU0 A;  3H6W A;  1WDN A;  3RUM A;  3OEN A;  3MJN A;  3DP4 A;  2VOZ A;  3TTR A;  1GV8 A;  1VFE A;  4PFY A;  1N3X A;  2ZYN A;  4GXA A;  3LSL A;  5TP9 A;  3RLF E;  1B5I A;  1RYX A;  1YCJ A;  1RYO A;  4G68 C;  3G3I A;  3C9H A;  4OEV A;  4KI0 E;  4ZDM A;  4F2O A;  3M3L A;  2O7U A;  4BDQ A;  4RPO A;  1P99 A;  3C35 A;  4U4X A;  1D4N A;  2Y84 A;  4RY1 A;  3MW0 A;  3ZS6 A;  4F39 A;  2ESN A;  4ZEK A;  1IXI A;  2Z8E A;  1B3H A;  2Z8D A;  4JSD A;  1ATG A;  1CE2 A;  1N84 A;  2H5Y A;  4NF4 B;  1UIV A;  3TAJ A;  3TZA A;  4F18 A;  4OYV A;  1ANF A;  3FZV A;  4H67 A;  2Y7P A;  4IGR A;  4EQB A;  3PMV A;  2UVJ A;  4G8H A;  4IY5 A;  1BTJ A;  1Y3N A;  3PPN A;  4G2Z A;  3SET A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...