1LSTA

Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
publication title Three-dimensional structures of the periplasmic lysine/arginine/ornithine-binding protein with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Amino-acid binding protein
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA02
3PV0E 3D4CA 1POTA 2H5YA 5JTYB 4UACA 1Y3PA 1HSEA 3E3KA 4H5FA 1GR2A 3CFZA 4R6YA 4H65A 1O63A 5KDTA 4U21A 1HSLA 1P1WA 1DMBA 3FASA 1WODA 4POWA 3RPWA 5HM4B 3CVGA 3KOTA 4R2FA 4OFLA 2OBGA 3VDFA 4DCYA 1ATGA 1I6QA 4XIGQ 2DWJA 3G3GA 1MXVA 2HXWA 1IITA 2OWSA 3OO9A 3OEMA 4IO6A 3T66A 3M8UA 3EHUA 1WVJA 1Z7NE 3M3FA 5KDTB 1P99A 3EHSA 3TODA 1MXXA 2DXRA 4OVJA 2P1SA 4ZE8A 3OO6A 3PUXE 3V5AA 4F2OA 1D3KA 4THIA 4U22A 3KBRA 4YKIA 1DTZA 3EN3A 1Y4CA 4G8NA 1B3GA 2Y7RA 4IO3A 3ZSFA 4RY1A 3OO8A 1XVYA 4G8HA 3HSTA 4LP2B 1USYE 4YKKA 1ZMGA 4KHZE 1EZPA 4GVOA 2O84X 1MPBA 2F78A 5I84A 3G7WA 4JWXA 1PC3A 3Q26A 3OOAA 1MM7A 4U4XA 1FCKA 1B1HA 4U23A 2I4CA 1QW0A 3SETA 1FQDA 1QUIA 3U94A 2DVCA 4X48A 1UQWA 2DE3A 3RLFE 1ZU0A 1MQDA 1GGGA 4YMBA 2ZYOA 3C4MA 4GL8A 4X1BA 3S9NC 1NNPA 3EF7A 4NF8A 5ISUA 3T22A 3KGCA 3TTMA 2V93A 2DWHA 3T9HB 1B2HA 1M5BA 2QS3A 4XXUA 3N94A 4MLQA 3TZAA 1VR5A 1A54A 1NNFA 1JEVA 2Y7IA 1R9LA 1FTJA 5TPAA 3B7DA 4QHQA 3U92A 3M3LA 2XXQA 2D3IA 3IOUA 2IA4A 2HQ0A 5AA4A 4ELQA 3TDJA 1N3XA 5FTHA 1NNKA 3IL1B 3I6VA 3IX1A 4U1ZA 3G3FA 3LUYA 2DS9A 4QFKA 3G3HA 4YAHX 4ELOA 2F5XA 4EXKA 4ND9A 4I1DA 2OLBA 1FQEA 2HZLA 4NWDA 3KZGA 1FQBA 1R1NA 5ICQA 1II5A 2CMOA 2R71A 4GFRA 5I56A 2AL5A 1Z7ME 4OHNA 1N84A 4FJPA 5CBSA 5I2NA 3E9XA 5TPAB 1TWYA 4JDFA 4Z7EA 3O29A 1BTJA 4KR5A 1P1NA 5ELVA 3UP9A 3FJGA 1QULA 2I58A 3TTKA 2NVUB 3MPLA 4U2RA 1IXHA 1JETA 2GHBA 5AA4B 2FNCA 2RC9A 4HCWA 3H6TA 4XKPA 4AQ4A 1HSJA 4Q8RA 2Z23A 3TQWA 1A99A 5AA2A 4DXBA 3S9LC 4Z0IA 1MXUA 3P7IA 1Q1KA 1XVXA 5I56B 2Y7PA 3B6TA 4F3PA 5I2NB 2G29A 4R9FA 3KN7A 1N04A 4LQ5A 2Q8JA 4EQBA 1MY3A 1MDQA 5IKBA 2P0SA 4GRKA 3H4ZA 4XTCQ 1LAXA 4BDLA 2NWJA 3FGSA 2I49A 1MPCA 2H9BA 2PT2A 1AIVA 4C1TA 1NMUA 4QSDA 5AA2B 3PPRA 2XXPA 3OXNA 1P1QA 1UTBA 4GD5A 2F7CA 3UORA 4YMAA 1B3EA 3MP6A 4MLVA 5H8HA 4QFOA 3W9VA 3K02A 4KCDA 5DVFA 2Q2AA 4ZEKA 3S4UA 4PE5B 3T9VA 1B46A 3LSWA 4XKRA 3TYHA 2GH9A 3DP8A 3CIJA 2PX1A 5DTBA 2V25A 3QSLA 3GLBA 3B6QA 2DE2A 2QSXA 2F36A 3KFMA 2IEEA 2F8DA 1Y3QA 1IEJA 3WAFA 3C9HA 1UTBB 2Z8DA 1B0LA 4QFNA 3E13X 1B7UA 2Z8FA 4JWYA 1O64A 3K2DA 2QS2A 3L6GA 1D4NA 1SW4A 4RK9A 4YU0A 3HCQA 4JBZA 1UIUA 5ICTA 3PMXA 5L8DA 3VXCA 2DYXA 1ZLQA 4ELPA 3TPAA 3N26A 2ZNTA 4X9TA 4H6DA 2O51A 1JEUA 2P2AA 2XXTA 3MVXA 1B4ZA 4FECA 3O6IA 1UTHA 1QUJA 3OD7A 2RINA 1B0HA 2DWAA 3GXAA 1B4HA 2OWTA 1N3WA 3F11A 1DOTA 3QK6A 3RUMA 4PFWA 1CB6A 5L9OA 5JTYA 1LLSA 3H6UA 1IXIA 3SEXA 3IOWA 1EH3A 4EQ9A 3O9PA 2UXAA 4ISUA 3DP4A 2O7IA 4E0XA 4R6HA 3H7MA 2XX9A 4ZZAA 1B7ZA 5H8SA 4R75A 4P0IA 3TTLA 3IJXB 1UTHB 4KYSA 1QVSA 4OTEA 4ZDMA 3K1PA 3OENA 2HCAA 5B7DA 1BP5A 1MY1A 3T96B 4IO2A 5DT6A 1DSNA 3OO7A 3PMWA 1LAHE 1TFDA 4OMBA 3QYTA 4YZZA 2DXYA 4LVQA 3MZ1A 3PPPA 2DOJA 2F7BA 4F1VA 1EU8A 2D21A 3IO6A 3TELA 1TXFA 3DP6A 3ZKKA 3SEYA 4JSOA 3BKIB 2O68A 3LR1A 2X26A 3FXUA 3U1OA 3MJNA 3A09A 4NTLA 2Q9TA 1EZOA 5I2KA 1S9TA 4KYDA 2X7PA 2NUVA 4NEDA 2E1SA 3UGWA 3G3IA 4XKNA 3OMBA 3IOTA 1SYIA 4O3CA 3VVFA 2B3FA 3SEUA 1PB8A 4OXVA 1H3DA 1ANFA 1BLFA 5B70A 3FV1A 4YICA 5H8QA 3K6XA 2I0CA 4M1VA 1URGA 1IXCA 1LFIA 4R9GA 1FQAA 4DDDA 3VXBA 3U8QA 3H6WA 2GFEA 1DPPA 2A5TB 2H4IA 1XOCA 5I2KB 1TFAA 2B65A 4I9DA 4K3FA 5DYHA 3KN8A 4MFIA 4FE8A 3OEKA 2VHAA 3MWBA 3K1NA 4YKJA 1JQFA 2R6GE 4FEDA 2F35A 2AIXA 3ILTB 1Y9UA 3RN8A 2REJA 3FVGA 4P0GA 4F19A 4F3GA 2OZZA 1H44A 5BWJA 1ZKBA 2VD2A 4RPOA 1AL3A 3E4RA 1Q35A 5H8QB 1PB7A 1POY1 3HPIA 4EQ7A 3Q27A 4LZ5A 3GZGA 2XX8A 4ZECA 4ZS9A 2Q89A 3MAMA 4H67A 3KSJA 4P11A 4MBPA 2ZNUA 3VLWA 5TU0A 4HW8A 3I3VA 1QKAA 2XX7A 4BDRA 2OK2A 4GXSB 2WKYA 1A8FA 5AA2D 1VFEA 1GVCA 1LFHA 1B1XA 5CMBA 5A5XB 4JSDA 4ZE9A 4ZEIA 2DSFA 3K6VA 5H8NA 1B05A 3MUQA 4NF5B 1A55A 4WKMA 1A40A 3TCHA 3CG1A 3UIFA 4ELRA 3PPQA 2PVUA 1SW1A 3TAJA 3HO7A 3N6TA 1M5DA 1S7YA 4HTGA 2ABHA 1Y1MA 2KLFA 3PD8A 2THIA 2ZNSA 2RKMA 2UVJA 2REGA 1B3HA 4QSCA 1OMPA 2R9JA 4NWCA 4PFUA 1PEBA 3ONMA 1OVBA 4NMYA 1B7HA 2Y84A 5H8NB 1OIBA 3TEPA 2M8CA 1USYH 5J1DA 1CE2A 4Q0CA 5EYFA 2RCBA 3ECRA 2DP8A 3G3JA 2V84A 3Q28A 1VE4A 5HPQA 3RT6B 2XXUA 3WAEA 3PD9A 3FD3A 4MF3A 3EPEA 4RYAA 1SVXB 5FHOA 3FATA 1NNTA 1ELJA 4ESWA 1A7LA 1AMFA 2I3VA 1LBCA 2RF1A 3FJMA 1MM6A 3OSQA 4H0WA 2PT1A 1S50A 2RC8A 4QFLA 3CRBA 2BJJX 4OESA 4DIGA 1I6BA 4JB7A 3OSRA 3R7XA 2HAVA 5ITOA 2YJPA 3BFTA 2XD2A 3LBSA 1B5IA 4GLIA 2XXYA 1MY4A 3HN0A 1SI1A 3BFUA 4F3BA 2Y7WA 2ONKE 3OELA 4F18A 5KCJB 4POXA 1I6AA 3KEIA 1MXZA 1PBPA 2QMXA 3V83A 4HS7A 4KCCA 4OENA 2W7YA 1SI0A 3IB2A 2ESNA 5M2VA 3CFLA 1N0TA 2VGQA 4IY6A 3UA8A 3PUYE 2O69A 1OQHA 4YB6A 2Y7KA 5CM6A 3M3KA 4JXIA 3IAZA 4DZ1A 4F1YA 1EZ9A 3PPOA 4EF1A 3W15C 1SDXA 5IAIA 4GWOA 3EQ1A 4OEUA 4PQJA 4F29A 3C31A 1B3LA 1ZTYA 2XXXA 4FORA 4RK2A 4WEDA 1SQYA 4PFYA 4EDPA 5I57A 2RC7A 1NFTA 4C0RA 3MVYA 5EHSA 4H8JA 1IQ7A 1B40A 4BDQA 3SESA 3O6GA 1FTMA 2AYSA 4Q5TA 1MQIA 4GQOA 3MW0A 2O1LA 1PDAA 2RCAA 2QJEA 4RXLA 1D9YA 1M5EA 4TLMB 1LFGA 2H98A 4C1UA 1JNFA 3RTFB 5AA1A 3ZKLA 5CMMA 1D9VA 2PYYA 3ODBA 4QRZA 1L5TA 3R26A 3KN3A 5I57B 3G3KA 4IGTA 2Z22A 1R6ZA 3Q25A 3QXMA 3QUFA 1B52A 2CZLA 2I6EA 1B58A 1A8EA 1SW5A 2GHAA 3FXRA 2QS1A 3MVZA 3CSGA 1LAGE 4KYEA 1URDA 4U1OA 3GBBA 3Q29A 3TKDA 1H43A 4HCYA 2ZYMA 4OETA 1VFDA 3PUVE 2QS4A 4R72A 1LSTA 4YKPA 3K01A 2Q88A 4G8MA 1NH7A 1MY2A 4IB2A 1MG1A 1VSOA 3MQ9A 3T9XB 3QUJA 3IJOB 1BIYA 4FEBA 1SYHA 3K0VA 2XXRA 1GV8A 2H99A 3IORA 1FTOA 5K2YA 1YTVA 3JV9A 5L9MA 3A3UA 1TT1A 2G93A 1AH5A 1MPDA 1OLCA 2Q2CA 4G4PA 2ONSA 4DLDA 3FVOA 4ECFA 2XD3A 1DPEA 1QKBA 5FTIA 3UK4A 1H76A 3PMVA 3HHFA 3O66A 4G68C 3K6WA 3ZS6A 1JVYA 3MZ9A 4GIZA 1JW4A 2A5TA 2H25A 2HEUA 3FUZA 4OQOA 5TP9A 3PUWE 5F7VA 1P1OA 4RNSA 4F2QA 2UYEA 3V89B 1OVTA 5I58A 3VLVA 4BDNA 1I69A 4LATA 2B3BA 4IY5A 3LSXA 3TTNA 1FTLA 3KOSA 3CSBA 3KJ7A 3SEVA 4N6PA 3FXQA 1OQGA 1OLAA 4JWOA 2FYIA 3O2AA 1B5HA 1YCJA 5F1QA 2XXVA 1MY0A 3GBAA 1LCFA 4O3AA 2DQVA 4AB6A 5TP9B 3RTWB 2AL4A 3MVWA 1DTGA 1YAEA 2V3UA 5HBCA 4BLAA 2XXWA 1BKAA 1P1UA 5I58B 4GL0A 3L6HA 2ALUA 2QPQA 1H45A 5A5XA 3KSXA 4FAJA 3B6WA 1ZIUA 5FHNA 3N6UA 1IXGA 2NOOA 4RPNA 1RKMA 4NF5A 1MDP1 3CR9A 4QSEA 5CC2A 4NF4A 4KD5A 3BBRA 3PUZE 3H06B 1XT8A 5KZTA 4N13A 4DXCA 5CMKA 5DEXA 3H6VA 1NH8A 4BDMA 1Y3NA 1F9BA 5H8FA 2XXIA 3TMGA 4OWDA 1SW2A 2VOZA 3C35A 3MC2A 3MBPA 4OFJA 5AA3A 4F22A 4ZEDA 4DCXA 2ONRA 3H3GA 5FHMA 4OZ9A 3N5LA 5EHMA 5I59A 3IR1A 4ZEBA 5CMCA 3PU5A 1M5CA 2OJTA 2I0BA 2UVGA 2E0SA 4TQUQ 3JZJA 2I4BA 4IGRA 3K6UA 3PPNA 4I8CA 4NF4B 2YLNA 3TTRA 4H1XA 3VFJA 1N7XA 1AOVA 1WDNA 1B6HA 5DEXB 3IK6B 2FA7A 1RYXA 3U93A 5H8FB 4F39A 3SERA 2QRYA 3HV1A 3MP8A 3EHTA 5CRYA 1PBQA 4RJZA 2O7UA 5AE4A 3LSFB 1MQJA 3FIRA 3O28A 3TCFA 3TCGA 1Y4TA 4R73A 2UYFA 3JYRA 3IB0A 3K4UA 3O6HA 5I59B 4ESXA 3QIMA 3RY3A 4QF9A 3S2VA 1MXYA 3HHGA 3RQTA 1MQHA 5ITPA 2V3TA 3DLNA 1XS5A 2UVIA 1QJMA 1YPNA 1MXWA 2ZXTA 3MZBA 2X7QA 4OYVA 2PMSA 4NF8B 1XHYA 4NE4A 3AXFA 2O1MA 1URSA 4IO7A 2LAOA 1LGBC 4LZ8A 4OERA 2ANJA 1Y1ZA 4L17A 3S9EA 3S9MC 5BUUA 1Y20A 1MS7A 4WXJA 4F1UA 3T9UA 4GF8A 1QUKA 1JW5A 4F3SA 2I48A 4QFPA 4TOZA 2DWIA 5KCJA 3V8XB 3MP1A 3A3CA 4Q30B 4KQPA 1J1NA 1IIWA 1SBPA 1JW1A 2DVZA 2UVHA 1LB9A 4YB7A 4R2BA 3ILUB 4MH5A 1IUDA 2VD3A 3TUSA 3FVNA 2QMWA 4EUOA 1XC1A 3C36A 2VP1A 3R6UA 3CG3A 4DXUA 1FQFA 4H8IA 1MH4A 1B32A 2XHDA 4EF2A 1NKXA 4RA1A 4N07A 4PP0A 1MH3A 4OFOA 1R9QA 3LSLA 3VE1B 4GXAA 3C34A 2YPNA 4YB5A 2F6GA 4U4SA 4GOTA 4WEPA 3VLUA 3FZVA 1LB8A 3CFXA 4FATA 1NL5A 2V3QA 1US5A 3QAXA 1IZ1A 1ZBMA 4ZEFA 3FV2A 2HAUA 3DELB 3RGYA 4TLLB 3THIA 3DM0A 1SD3A 1RYOA 4KI0E 1KWHA 4R6KA 4I62A 5JEIA 2F97A 1B51A 3KG2A 3VVDA 3SDFA 3TQLA 4NF6A 4PFTA 1B9JA 4EXLA 1GTKA 3MPKA 2ZYKA 3USDA 3O97A 4IO5A 2OCUA 3RT8A 2PBWA 1O7TA 4G68A 3C33A 4LQ2A 1B3FA 4R74A 5CBRA 2F7AA 2F6PA 5L9SA 2GRVA 3FJ7A 1JVXA 2ZMBA 3RNNA 3T93B 4PETA 1T0KA 5CI5A 2ZYNA 3SKPA 3K00A 3VVEA 5H8HB 2D5WA 2O6AA 3UN6A 1LBBA 4NF6B 1N7WA 1PB9A 1US4A 4ONYA 4G77A 4G68B 1FQCA 4F31B 3IOVA 4OEVA 3K1MA 2A5SA 1FW0A 1UIVA 4FIMA 4LA9A 4KFQA 2NXOA 1N76A 4AB5A 4LZ7A 2I3WA 5DVJA 4BDOA 3IO4A 4XKQA 5JK4A 2XXHA 3FVKA 2HFBA 3C32A 2Z8EA 5DVIA 3U72A 3SEWA 1ZJLA 4G2ZA 1FTKA 3TFLA 4X1DA 1M5FA 3H03A 2DE4A 2QL3A 3I5OA 4DE8A 1B5JA 4M4GA 3D4GA 1LAFE 4LONB 3KJTA 4H5GA 4KPTA 3IB1A 2HZKA 1MRPA 3VV5A 3W9WA 4IO4A 3PGFA 4UA8A 4ZZEA 5K2XA 4E0WA 5LOMA 4LUBA 2F34A 3LC8A 4O3BA 1LCTA 1MQGA 3CI8A
chains in the Genus database with same CATH superfamily
3PV0E 3D4CA 2B4MA 1POTA 2VPNA 2H5YA 5JTYB 4UACA 1Y3PA 1HSEA 3E3KA 4OA4A 4H5FA 1GR2A 3CFZA 4R6YA 4H65A 1O63A 5KDTA 4U21A 1HSLA 1P1WA 3MYUA 1DMBA 3FASA 1WODA 4POWA 3RPWA 5HM4B 1NV7A 3CVGA 3KOTA 4R2FA 4OFLA 2OBGA 3VDFA 4DCYA 1ATGA 1I6QA 4XIGQ 2DWJA 3G3GA 4IR8A 1MXVA 2HXWA 1IITA 2F3BA 2OWSA 3OO9A 3OEMA 4IO6A 3T66A 3M8UA 4OANA 3EHUA 1WVJA 1IMFA 1Z7NE 3M3FA 5KDTB 1P99A 3EHSA 3FBPA 3TODA 1MXXA 2DXRA 4OVJA 2P1SA 4ZE8A 3OO6A 3PUXE 1XI6A 3V5AA 5F24A 4F2OA 1D3KA 3PTYA 2F3DA 4THIA 4U22A 3KBRA 4YKIA 1DTZA 3EN3A 1Y4CA 1FPFA 4G8NA 2XWIA 1B3GA 2Y7RA 4IO3A 3ZSFA 4RY1A 2CEYA 3OO8A 1XVYA 2KR0A 3HSTA 4G8HA 4LP2B 1USYE 4YKKA 1ZMGA 4KHZE 2MKZA 1EZPA 4GVOA 4O8MA 2O84X 1MPBA 2F78A 5I84A 3G7WA 4JWXA 1PC3A 3Q26A 3T0JA 3OOAA 1MM7A 4U4XA 1FCKA 4QBAA 4PAFA 1B1HA 4U23A 2I4CA 1QW0A 3SETA 1FQDA 1QUIA 3U94A 2DVCA 4X48A 2FIEA 1UQWA 2DE3A 3RLFE 1ZU0A 1MQDA 1GGGA 4YMBA 2ZYOA 3C4MA 4GL8A 4X1BA 3S9NC 1NNPA 3EF7A 3IFCA 5EYGA 4OVQA 4NF8A 5ISUA 3T22A 3KGCA 3TTMA 2V93A 2DWHA 3T9HB 1B2HA 1M5BA 2QS3A 4XXUA 4N4UA 3N94A 4MLQA 3TZAA 1VR5A 5IZ3A 1A54A 1NNFA 1JEVA 2Y7IA 1R9LA 1FTJA 5TPAA 3B7DA 4QHQA 3U92A 3M3LA 1KA1A 2XXQA 4NQ8A 2D3IA 4MNIA 3IOUA 2WEFA 2IA4A 2HQ0A 4DI3D 5ESYA 5AA4A 4ELQA 3TDJA 1N3XA 5FTHA 1NNKA 3IL1B 1FPDA 3I6VA 3IX1A 2ZZXA 4U1ZA 3G3FA 3LUYA 2DS9A 4QFKA 3G3HA 4YAHX 4ELOA 2F5XA 4EXKA 4ND9A 4I1DA 2OLBA 1FQEA 2HZLA 4NWDA 3KZGA 1FQBA 1R1NA 5ICQA 1II5A 4GBVA 2CMOA 2R71A 4GFRA 5I56A 2AL5A 1Z7ME 4OHNA 1N84A 4FJPA 5CBSA 2CZIA 5I2NA 3E9XA 2CEXA 5TPAB 1TWYA 4JDFA 4Z7EA 3O29A 1BTJA 4KR5A 1P1NA 5ELVA 3UP9A 3FJGA 1QULA 2I58A 3TTKA 4NN3A 2NVUB 3MPLA 4U2RA 1IXHA 1JETA 2GHBA 5AA4B 2FNCA 4GWUA 2RC9A 4HCWA 3H6TA 1G0HA 4XKPA 2XWOA 5EQAA 4AQ4A 1HSJA 4Q8RA 2Z23A 3TQWA 1A99A 5AA2A 4DXBA 3S9LC 4O7MA 4Z0IA 1MXUA 3P7IA 1Q1KA 1XVXA 1FBFA 2WBBA 5I56B 2Y7PA 3B6TA 4F3PA 5I2NB 2G29A 4R9FA 3KN7A 1N04A 4LQ5A 2Q8JA 4EQBA 1MY3A 1MDQA 5IKBA 2P0SA 4GRKA 3H4ZA 4XTCQ 1LAXA 4BDLA 2QVUA 2WYKA 2NWJA 3FGSA 2I49A 4JVCA 1MPCA 2H9BA 2PT2A 1AIVA 4C1TA 1NMUA 4PFIA 4QSDA 5AA2B 3PPRA 2XXPA 5LDZA 1FBDA 3OXNA 3RPLA 1P1QA 1UTBA 4GD5A 2F7CA 3UORA 4YMAA 1B3EA 3MP6A 4MLVA 1FBPA 5H8HA 4QFOA 3W9VA 3K02A 4KCDA 5DVFA 2WBDA 2Q2AA 4ZEKA 3S4UA 4PE5B 3T9VA 1B46A 3LSWA 4XKRA 3RYDA 3TYHA 2GH9A 3DP8A 3CIJA 2PX1A 5DTBA 2V25A 3QSLA 1FBEA 3GLBA 3B6QA 2DE2A 2QSXA 2F36A 3KFMA 2IEEA 2F8DA 4MX6A 1Y3QA 2PFYA 3RPLB 1IMBA 1IEJA 3WAFA 3C9HA 1UTBB 2Z8DA 1B0LA 4QFNA 3E13X 1B7UA 2Z8FA 4JWYA 1O64A 3K2DA 2QS2A 3L6GA 4AS4A 4PTKA 3U65A 3CHGA 1D4NA 1SW4A 4RK9A 4YU0A 3HCQA 4JBZA 1UIUA 1AWBA 5ICTA 1FBGA 1K9YA 4GWZA 3PMXA 5L8DA 3VXCA 2DYXA 1ZLQA 4ELPA 2Q8MA 3TPAA 1DCUA 1FSAA 2FBPA 3N26A 2ZNTA 4H46A 4X9TA 4H6DA 2O51A 4QXDA 1JEUA 2P2AA 1JP4A 2XXTA 3MVXA 1B4ZA 5EYHA 4O94A 4FECA 3O6IA 1UTHA 1QUJA 2VT5A 3OD7A 2HHMA 5I5PA 2RINA 1B0HA 2DWAA 3GXAA 4AS5A 1B4HA 2OWTA 1IMEA 1N3WA 3F11A 1DOTA 3QK6A 2B4LA 3RUMA 4PFWA 1CB6A 5L9OA 5JTYA 1LLSA 3H6UA 1IXIA 3SEXA 4NX1A 3IOWA 1EH3A 4GBWA 4EQ9A 3O9PA 2UXAA 4ISUA 3DP4A 4GWXA 2O7IA 4R6HA 4E0XA 4P9KA 2OX3A 3H7MA 2XX9A 4ZZAA 1B7ZA 5H8SA 4N8YA 4R75A 4P0IA 3TTLA 3IJXB 1UTHB 4KYSA 1FPBA 1QVSA 4OTEA 5FBPA 4ZDMA 3K1PA 1QGXA 3OENA 2HCAA 5B7DA 1BP5A 1MY1A 3T96B 1FPIA 4IO2A 5DT6A 1DSNA 3OO7A 3PMWA 1LAHE 1TFDA 1FBHA 2WYPA 3LUZA 4OMBA 3QYTA 4YZZA 2DXYA 4LVQA 3MZ1A 4HXVA 3PPPA 2DOJA 2F7BA 2XWVA 4F1VA 2P3NA 1EU8A 2D21A 3IO6A 3TELA 1TXFA 3DP6A 3ZKKA 5A5LA 3SEYA 4JSOA 3BKIB 2O68A 3LR1A 1YZ0A 2X26A 3FXUA 3U1OA 3MJNA 3A09A 4NTLA 1KZ8A 2Q9TA 1EZOA 5I2KA 1S9TA 4KYDA 2CZHA 2X7PA 2NUVA 4NEDA 4NF0A 2E1SA 1VDWA 3UGWA 3G3IA 4XKNA 3OMBA 3IOTA 1SYIA 4O3CA 3VVFA 2B3FA 4NHBA 3SEUA 4MEVA 1PB8A 4OXVA 4XEQA 1H3DA 1ANFA 1BLFA 5B70A 3FV1A 4YICA 5H8QA 3K6XA 2I0CA 4M1VA 3D1RA 1URGA 2V4CA 4KXPA 1IXCA 1LFIA 4R9GA 1FQAA 4DDDA 3VXBA 3U8QA 3H6WA 2GFEA 2BJIA 1DPPA 2A5TB 2H4IA 1XOCA 5I2KB 1TFAA 2B65A 4I9DA 4K3FA 5DYHA 3KN8A 4MFIA 4HE1A 4FE8A 3OEKA 4HE2A 2VHAA 1FJ6A 3MWBA 3K1NA 4YKJA 1JQFA 2R6GE 5ET6A 2HPGA 4FEDA 2F35A 2AIXA 3ILTB 1Y9UA 3RN8A 2REJA 3FVGA 4P0GA 4F19A 1NI9A 4F3GA 2OZZA 1H44A 5BWJA 1ZKBA 2VD2A 4RPOA 1AL3A 3E4RA 1FRPA 1Q35A 5H8QB 1PB7A 1POY1 3HPIA 4EQ7A 3Q27A 4LZ5A 3GZGA 4G61A 2XX8A 4ZECA 4ZS9A 2Q89A 3MAMA 4H67A 3KSJA 4P11A 4PAKA 4MBPA 2ZNUA 3VLWA 1LBWA 5TU0A 4HW8A 3I3VA 1QKAA 2XX7A 3A29A 4BDRA 2OK2A 4GXSB 2WKYA 1A8FA 4MMPA 5AA2D 1VFEA 1GVCA 1LFHA 1B1XA 5CMBA 1LBZA 5A5XB 2JJKA 4JSDA 4ZE9A 4ZEIA 2DSFA 3K6VA 5H8NA 1B05A 3MUQA 4XF5A 4NF5B 1A55A 4WKMA 1A40A 3TCHA 3E78A 3CG1A 3UIFA 4ELRA 3PPQA 2PVUA 1SW1A 3TAJA 3HO7A 3N6TA 1M5DA 1S7YA 1FPEA 4HTGA 2ABHA 1Y1MA 2KLFA 5I7IA 3PD8A 2THIA 2ZNSA 2RKMA 4PE3A 2UVJA 2REGA 1B3HA 4QSCA 1OMPA 2R9JA 4NWCA 4PFUA 2XWKA 1PEBA 3ONMA 1OVBA 4NMYA 1B7HA 2Y84A 5H8NB 1OIBA 3TEPA 2M8CA 1USYH 3ROJA 5J1DA 1CE2A 4Q0CA 4N17A 4PFRA 5EYFA 2RCBA 3ECRA 4OVTA 2DP8A 3G3JA 2V84A 3Q28A 1VE4A 5HPQA 2PFZA 3RT6B 2XXUA 3WAEA 3PD9A 3FD3A 4MF3A 3EPEA 4RYAA 1SVXB 5FHOA 3FATA 1NNTA 1ELJA 4ESWA 1A7LA 1AMFA 1FPJA 2I3VA 4GWYA 4PBQA 1LBCA 2R8TA 2RF1A 1EYIA 3FJMA 1EYJA 1MM6A 3OSQA 4H0WA 5LTCA 2PT1A 1S50A 2RC8A 2QFLA 4N6KA 4QFLA 3CRBA 4PDDA 2BJJX 4OESA 4DIGA 1I6BA 4JB7A 4OVSA 1LEVA 3OSRA 2GQ1A 3R7XA 1NV5A 2HAVA 5ITOA 2XA5A 2YJPA 3BFTA 2KQZA 2XD2A 3LBSA 3MSTA 1B5IA 1RDYA 4GLIA 2XXYA 1MY4A 3HN0A 1DBZA 1SI1A 3BFUA 4F3BA 2Y7WA 2L5VA 2ONKE 3OELA 4UABA 4XFEA 4F18A 4O7IA 4POXA 5KCJB 1I6AA 3KEIA 1MXZA 1PBPA 3B50A 1NV2A 2QMXA 3V83A 4HS7A 4KCCA 4OENA 2W7YA 1SI0A 3IB2A 2ESNA 5M2VA 3CFLA 3BIGA 1N0TA 2VGQA 4IY6A 3UA8A 3PUYE 2O69A 1NV6A 1FPLA 1OQHA 4YB6A 2Y7KA 5CM6A 3M3KA 4JXIA 3IAZA 4DZ1A 4F1YA 1EZ9A 3PPOA 4MNPA 4JVIA 4EF1A 3W15C 1SDXA 1IMCA 5IAIA 4GWOA 1BK4A 3EQ1A 4PQJA 4OEUA 4F29A 3C31A 1B3LA 1ZTYA 2XXXA 4FORA 3SZPA 4RK2A 4WEDA 1SQYA 4PFYA 4DI4B 4EDPA 5I57A 2RC7A 1NFTA 4C0RA 3MVYA 5EHSA 4H8JA 1IQ7A 1B40A 4BDQA 2ZZVA 3SESA 3O6GA 1FTMA 4PAIA 2AYSA 4Q5TA 1MQIA 4GQOA 1CNQA 3MW0A 2O1LA 1FBCA 4I40A 1PDAA 2RCAA 2QJEA 4RXLA 1D9YA 4N6DA 1M5EA 4TLMB 4I3EA 1G0IA 1LFGA 2H98A 4C1UA 1JNFA 3RTFB 1FPGA 4PF6A 5AA1A 3ZKLA 4N8GA 5CMMA 1D9VA 2PYYA 3ODBA 4QRZA 1L5TA 4HE0A 3R26A 4X04A 3KN3A 5I57B 3KBZA 3G3KA 4IGTA 2Z22A 1R6ZA 3Q25A 3QXMA 3QUFA 1B52A 2CZLA 2I6EA 1NUZA 1B58A 1A8EA 1SW5A 4N91A 1KA0A 2Q74A 4GWSA 2GHAA 3FXRA 2QS1A 3MVZA 4P3LA 4X8RA 3CSGA 1LAGE 4KYEA 1URDA 4U1OA 3GBBA 4MHFA 2XXKA 3Q29A 3TKDA 1H43A 4HCYA 2ZYMA 4JVDA 4OETA 1VFDA 2P3VA 3PUVE 2QS4A 4PGPA 4R72A 1EYKA 1LSTA 4YKPA 3K01A 2Q88A 4G8MA 1NH7A 1MY2A 4IB2A 1MG1A 4PBHA 2OWZA 1VSOA 3MQ9A 3T9XB 3QUJA 3IJOB 1BIYA 4FEBA 1SYHA 3K0VA 2XXRA 4NGUA 1GV8A 2H99A 3IORA 1FTOA 5K2YA 1YTVA 3JV9A 5L9MA 3A3UA 1TT1A 2G93A 1AH5A 1MPDA 1OLCA 2Q2CA 4G4PA 1IMAA 4NAPA 2ONSA 2DDKA 4DLDA 3FVOA 2XD3A 4ECFA 1DPEA 1QKBA 5FTIA 3UK4A 1H76A 3PMVA 3HHFA 3O66A 4G68C 3K6WA 4PC9A 3ZS6A 1JVYA 3MZ9A 4GIZA 3FXBA 1JW4A 2A5TA 2H25A 4GWWA 2HEUA 3FUZA 4OQOA 5TP9A 3PUWE 1K9ZA 5F7VA 1P1OA 4RNSA 4F2QA 2UYEA 3V89B 3QMFA 1OVTA 5I58A 3VLVA 4BDNA 1I69A 4LATA 3E79A 2B3BA 4IY5A 3LSXA 3TTNA 1FTLA 3KOSA 3CSBA 3KJ7A 3SEVA 4N6PA 3FXQA 1NUYA 1OQGA 1OLAA 4JWOA 4MJOA 2FYIA 3O2AA 1B5HA 1YCJA 5F1QA 2XXVA 1MY0A 3GBAA 1LCFA 4O3AA 2DQVA 4AB6A 1NUXA 1LBVA 1D9QA 5TP9B 3RTWB 2AL4A 3MVWA 1NV4A 5ET7A 1DTGA 1YAEA 2V3UA 5HBCA 3B8BA 4BLAA 1NV3A 2XXWA 1BKAA 4P56A 1P1UA 5I58B 4GL0A 3L6HA 2ALUA 2QPQA 1H45A 5A5XA 3KSXA 4FAJA 3B6WA 1ZIUA 5FHNA 3N6UA 1IXGA 3KC0A 2NOOA 5IZZA 4RPNA 1RKMA 4NF5A 1MDP1 4N15A 3CR9A 4QSEA 5CC2A 4NF4A 4KD5A 3BBRA 3PUZE 3H06B 1XT8A 2QVVA 5KZTA 4N13A 4DXCA 4PF8A 5CMKA 1INPA 5IZ1A 4PDHA 5DEXA 3H6VA 1NH8A 4BDMA 1Y3NA 4MIJA 1F9BA 5H8FA 1YXIA 2XXIA 3TMGA 4OWDA 5IM2A 1SW2A 2VOZA 3C35A 3MC2A 3MBPA 4OFJA 5AA3A 4F22A 4ZEDA 3ISPA 4DCXA 2ONRA 3H3GA 3T1BA 5ET5A 5FHMA 4OZ9A 3N5LA 5EHMA 5I59A 3IR1A 4ZEBA 5CMCA 3PU5A 1M5CA 2OJTA 2I0BA 2UVGA 2E0SA 3KC1A 4TQUQ 3JZJA 2I4BA 4IGRA 3K6UA 3PPNA 4I8CA 4NF4B 2YLNA 3TTRA 4H1XA 3VFJA 1N7XA 2ZZWA 1AOVA 1WDNA 1B6HA 5DEXB 3IK6B 2FA7A 1RYXA 3U93A 5H8FB 4F39A 3SERA 2QRYA 3HV1A 3MP8A 3EHTA 5CRYA 1PBQA 4RJZA 3GYYA 2O7UA 5AE4A 3LSFB 1MQJA 3FIRA 3O28A 4MCOA 3TCFA 3TCGA 1Y4TA 1DK4A 4R73A 2UYFA 3JYRA 3IB0A 3K4UA 3O6HA 5I59B 4ESXA 3QIMA 3RY3A 4QF9A 3S2VA 1MXYA 3HHGA 4P1EA 3RQTA 1MQHA 5ITPA 2V3TA 3DLNA 1XS5A 2UVIA 1QJMA 1YPNA 1MXWA 2ZXTA 3MZBA 2X7QA 4OYVA 2PMSA 4NF8B 1XHYA 4NE4A 3AXFA 2O1MA 1URSA 4IO7A 3NOHA 2LAOA 4OVPA 1LGBC 4LZ8A 4OERA 5EQ9A 2ANJA 1Y1ZA 4L17A 3S9EA 3S9MC 5IZ3B 5BUUA 1Y20A 1MS7A 4WXJA 4F1UA 2QVRA 3T9UA 4GF8A 1QUKA 1JW5A 4F3SA 2I48A 5DW8A 1RDZA 4QFPA 4TOZA 2DWIA 5KCJA 3V8XB 3MP1A 4GX6A 4H45A 3A3CA 4Q30B 4KQPA 1J1NA 1IIWA 1SBPA 1JW1A 4NG7A 1RDXA 2DVZA 2UVHA 1LB9A 4LN5A 4YB7A 4R2BA 3ILUB 4MH5A 1IUDA 2VD3A 3TUSA 1FPKA 3FVNA 2FIXA 2QMWA 4EUOA 4FBPA 1XC1A 3C36A 2VP1A 3R6UA 2VPOA 3CG3A 4DXUA 1FQFA 4H8IA 4OVRA 1MH4A 1YYZA 1B32A 2XHDA 4EF2A 1NKXA 4RA1A 4N07A 5ET8A 4PP0A 1MH3A 4OFOA 3HFUA 1R9QA 2CZKA 3LSLA 3VE1B 4GXAA 1NV1A 3C34A 2YPNA 4YB5A 1FTAA 2F6GA 4U4SA 2FVZA 4GOTA 1IMDA 4WEPA 3VLUA 3FZVA 1LB8A 3CFXA 4FATA 1NL5A 2V3QA 1US5A 3QAXA 1IZ1A 1ZBMA 4P47A 4ZEFA 4PGNA 3FV2A 2HAUA 4GX4A 3DELB 3RGYA 4TLLB 5J16A 3THIA 2PCRA 3DM0A 1SD3A 1RYOA 4KI0E 1KWHA 4R6KA 4I62A 5JEIA 2F97A 1B51A 4MAGA 3KG2A 3VVDA 3SDFA 3TQLA 4NF6A 4PFTA 1B9JA 4EXLA 1GTKA 3MPKA 2ZYKA 3USDA 3O97A 4IO5A 2OCUA 3RT8A 2PBWA 1O7TA 4G68A 3C33A 4LQ2A 1B3FA 4R74A 4GX3A 5CBRA 2F7AA 2F6PA 4P1LA 1LBYA 5L9SA 1NUWA 2GRVA 3FJ7A 1JVXA 2ZMBA 3RNNA 3T93B 4PETA 1T0KA 4N81A 5CI5A 2ZYNA 3SKPA 2Y5LA 4PCDA 3K00A 3VVEA 5H8HB 2D5WA 5I3SA 4MNCA 3LV0A 2O6AA 3UN6A 5IGAA 1LBBA 4NF6B 5EQ7A 1Q9DA 1N7WA 3EKIA 1PB9A 1FJ9A 5EQ8A 1US4A 4ONYA 4G77A 4G68B 2WX9A 1FQCA 4F31B 3IOVA 2FHYA 4OEVA 3K1MA 2A5SA 4I3YA 1FW0A 1UIVA 4FIMA 4LA9A 4KFQA 2NXOA 4P8BA 1N76A 4AB5A 4LZ7A 2I3WA 5DVJA 4BDOA 3IO4A 4XKQA 5JK4A 2XXHA 3FVKA 2HFBA 5T3JA 3C32A 3IFAA 2Z8EA 5DVIA 3U72A 3SEWA 1ZJLA 4G2ZA 1FTKA 3TFLA 4X1DA 1M5FA 3H03A 2DE4A 2QL3A 3I5OA 4DE8A 1B5JA 4PFBA 4M4GA 1LBXA 3D4GA 1LAFE 4LONB 3KJTA 4H5GA 4KPTA 3IB1A 2HXRA 2HZKA 1MRPA 3VV5A 3W9WA 3BIHA 4IO4A 3PGFA 4UA8A 4ZZEA 5K2XA 1NV0A 4E0WA 2Y5KA 1SPIA 5LOMA 4LUBA 2F34A 3LC8A 4O3BA 1LCTA 1MQGA 3CI8A
chains in the Genus database with same CATH topology
3PV0E 3D4CA 1POTA 2H5YA 5JTYB 4UACA 1Y3PA 1HSEA 3E3KA 4H5FA 1GR2A 3CFZA 4R6YA 4H65A 1O63A 5KDTA 4U21A 1HSLA 1P1WA 1DMBA 3FASA 1WODA 4POWA 3RPWA 5HM4B 3CVGA 3KOTA 4R2FA 4OFLA 2OBGA 3VDFA 4DCYA 1ATGA 1I6QA 4XIGQ 2DWJA 3G3GA 1MXVA 2HXWA 1IITA 2OWSA 3OO9A 3OEMA 4IO6A 3T66A 3M8UA 3EHUA 1WVJA 1Z7NE 3M3FA 5KDTB 1P99A 3EHSA 3TODA 1MXXA 2DXRA 4OVJA 2P1SA 4ZE8A 3OO6A 3PUXE 3V5AA 4F2OA 1D3KA 4THIA 4U22A 3KBRA 4YKIA 1DTZA 3EN3A 1Y4CA 4G8NA 1B3GA 2Y7RA 4IO3A 3ZSFA 4RY1A 3OO8A 1XVYA 4G8HA 3HSTA 4LP2B 1USYE 4YKKA 1ZMGA 4KHZE 1EZPA 4GVOA 2O84X 1MPBA 2F78A 5I84A 3G7WA 4JWXA 1PC3A 3Q26A 3OOAA 1MM7A 4U4XA 1FCKA 1B1HA 4U23A 2I4CA 1QW0A 3SETA 1FQDA 1QUIA 3U94A 2DVCA 4X48A 1UQWA 2DE3A 3RLFE 1ZU0A 1MQDA 1GGGA 4YMBA 2ZYOA 3C4MA 4GL8A 4X1BA 3S9NC 1NNPA 3EF7A 4NF8A 5ISUA 3T22A 3KGCA 3TTMA 2V93A 2DWHA 3T9HB 1B2HA 1M5BA 2QS3A 4XXUA 3N94A 4MLQA 3TZAA 1VR5A 1A54A 1NNFA 1JEVA 2Y7IA 1R9LA 1FTJA 5TPAA 3B7DA 4QHQA 3U92A 3M3LA 2XXQA 2D3IA 3IOUA 2IA4A 2HQ0A 5AA4A 4ELQA 3TDJA 1N3XA 5FTHA 1NNKA 3IL1B 3I6VA 3IX1A 4U1ZA 3G3FA 3LUYA 2DS9A 4QFKA 3G3HA 4YAHX 4ELOA 2F5XA 4EXKA 4ND9A 4I1DA 2OLBA 1FQEA 2HZLA 4NWDA 3KZGA 1FQBA 1R1NA 5ICQA 1II5A 2CMOA 2R71A 4GFRA 5I56A 2AL5A 1Z7ME 4OHNA 1N84A 4FJPA 5CBSA 5I2NA 3E9XA 5TPAB 1TWYA 4JDFA 4Z7EA 3O29A 1BTJA 4KR5A 1P1NA 5ELVA 3UP9A 3FJGA 1QULA 2I58A 3TTKA 2NVUB 3MPLA 4U2RA 1IXHA 1JETA 2GHBA 5AA4B 2FNCA 2RC9A 4HCWA 3H6TA 4XKPA 4AQ4A 1HSJA 4Q8RA 2Z23A 3TQWA 1A99A 5AA2A 4DXBA 3S9LC 4Z0IA 1MXUA 3P7IA 1Q1KA 1XVXA 5I56B 2Y7PA 3B6TA 4F3PA 5I2NB 2G29A 4R9FA 3KN7A 1N04A 4LQ5A 2Q8JA 4EQBA 1MY3A 1MDQA 5IKBA 2P0SA 4GRKA 3H4ZA 4XTCQ 1LAXA 4BDLA 2NWJA 3FGSA 2I49A 1MPCA 2H9BA 2PT2A 1AIVA 4C1TA 1NMUA 4QSDA 5AA2B 3PPRA 2XXPA 3OXNA 1P1QA 1UTBA 4GD5A 2F7CA 3UORA 4YMAA 1B3EA 3MP6A 4MLVA 5H8HA 4QFOA 3W9VA 3K02A 4KCDA 5DVFA 2Q2AA 4ZEKA 3S4UA 4PE5B 3T9VA 1B46A 3LSWA 4XKRA 3TYHA 2GH9A 3DP8A 3CIJA 2PX1A 5DTBA 2V25A 3QSLA 3GLBA 3B6QA 2DE2A 2QSXA 2F36A 3KFMA 2IEEA 2F8DA 1Y3QA 1IEJA 3WAFA 3C9HA 1UTBB 2Z8DA 1B0LA 4QFNA 3E13X 1B7UA 2Z8FA 4JWYA 1O64A 3K2DA 2QS2A 3L6GA 1D4NA 1SW4A 4RK9A 4YU0A 3HCQA 4JBZA 1UIUA 5ICTA 3PMXA 5L8DA 3VXCA 2DYXA 1ZLQA 4ELPA 3TPAA 3N26A 2ZNTA 4X9TA 4H6DA 2O51A 1JEUA 2P2AA 2XXTA 3MVXA 1B4ZA 4FECA 3O6IA 1UTHA 1QUJA 3OD7A 2RINA 1B0HA 2DWAA 3GXAA 1B4HA 2OWTA 1N3WA 3F11A 1DOTA 3QK6A 3RUMA 4PFWA 1CB6A 5L9OA 5JTYA 1LLSA 3H6UA 1IXIA 3SEXA 3IOWA 1EH3A 4EQ9A 3O9PA 2UXAA 4ISUA 3DP4A 2O7IA 4E0XA 4R6HA 3H7MA 2XX9A 4ZZAA 1B7ZA 5H8SA 4R75A 4P0IA 3TTLA 3IJXB 1UTHB 4KYSA 1QVSA 4OTEA 4ZDMA 3K1PA 3OENA 2HCAA 5B7DA 1BP5A 1MY1A 3T96B 4IO2A 5DT6A 1DSNA 3OO7A 3PMWA 1LAHE 1TFDA 4OMBA 3QYTA 4YZZA 2DXYA 4LVQA 3MZ1A 3PPPA 2DOJA 2F7BA 4F1VA 1EU8A 2D21A 3IO6A 3TELA 1TXFA 3DP6A 3ZKKA 3SEYA 4JSOA 3BKIB 2O68A 3LR1A 2X26A 3FXUA 3U1OA 3MJNA 3A09A 4NTLA 2Q9TA 1EZOA 5I2KA 1S9TA 4KYDA 2X7PA 2NUVA 4NEDA 2E1SA 3UGWA 3G3IA 4XKNA 3OMBA 3IOTA 1SYIA 4O3CA 3VVFA 2B3FA 3SEUA 1PB8A 4OXVA 1H3DA 1ANFA 1BLFA 5B70A 3FV1A 4YICA 5H8QA 3K6XA 2I0CA 4M1VA 1URGA 1IXCA 1LFIA 4R9GA 1FQAA 4DDDA 3VXBA 3U8QA 3H6WA 2GFEA 1DPPA 2A5TB 2H4IA 1XOCA 5I2KB 1TFAA 2B65A 4I9DA 4K3FA 5DYHA 3KN8A 4MFIA 4FE8A 3OEKA 2VHAA 3MWBA 3K1NA 4YKJA 1JQFA 2R6GE 4FEDA 2F35A 2AIXA 3ILTB 1Y9UA 3RN8A 2REJA 3FVGA 4P0GA 4F19A 4F3GA 2OZZA 1H44A 5BWJA 1ZKBA 2VD2A 4RPOA 1AL3A 3E4RA 1Q35A 5H8QB 1PB7A 1POY1 3HPIA 4EQ7A 3Q27A 4LZ5A 3GZGA 2XX8A 4ZECA 4ZS9A 2Q89A 3MAMA 4H67A 3KSJA 4P11A 4MBPA 2ZNUA 3VLWA 5TU0A 4HW8A 3I3VA 1QKAA 2XX7A 4BDRA 2OK2A 4GXSB 2WKYA 1A8FA 5AA2D 1VFEA 1GVCA 1LFHA 1B1XA 5CMBA 5A5XB 4JSDA 4ZE9A 4ZEIA 2DSFA 3K6VA 5H8NA 1B05A 3MUQA 4NF5B 1A55A 4WKMA 1A40A 3TCHA 3CG1A 3UIFA 4ELRA 3PPQA 2PVUA 1SW1A 3TAJA 3HO7A 3N6TA 1M5DA 1S7YA 4HTGA 2ABHA 1Y1MA 2KLFA 3PD8A 2THIA 2ZNSA 2RKMA 2UVJA 2REGA 1B3HA 4QSCA 1OMPA 2R9JA 4NWCA 4PFUA 1PEBA 3ONMA 1OVBA 4NMYA 1B7HA 2Y84A 5H8NB 1OIBA 3TEPA 2M8CA 1USYH 5J1DA 1CE2A 4Q0CA 5EYFA 2RCBA 3ECRA 2DP8A 3G3JA 2V84A 3Q28A 1VE4A 5HPQA 3RT6B 2XXUA 3WAEA 3PD9A 3FD3A 4MF3A 3EPEA 4RYAA 1SVXB 5FHOA 3FATA 1NNTA 1ELJA 4ESWA 1A7LA 1AMFA 2I3VA 1LBCA 2RF1A 3FJMA 1MM6A 3OSQA 4H0WA 2PT1A 1S50A 2RC8A 4QFLA 3CRBA 2BJJX 4OESA 4DIGA 1I6BA 4JB7A 3OSRA 3R7XA 2HAVA 5ITOA 2YJPA 3BFTA 2XD2A 3LBSA 1B5IA 4GLIA 2XXYA 1MY4A 3HN0A 1SI1A 3BFUA 4F3BA 2Y7WA 2ONKE 3OELA 4F18A 5KCJB 4POXA 1I6AA 3KEIA 1MXZA 1PBPA 2QMXA 3V83A 4HS7A 4KCCA 4OENA 2W7YA 1SI0A 3IB2A 2ESNA 5M2VA 3CFLA 1N0TA 2VGQA 4IY6A 3UA8A 3PUYE 2O69A 1OQHA 4YB6A 2Y7KA 5CM6A 3M3KA 4JXIA 3IAZA 4DZ1A 4F1YA 1EZ9A 3PPOA 4EF1A 3W15C 1SDXA 5IAIA 4GWOA 3EQ1A 4OEUA 4PQJA 4F29A 3C31A 1B3LA 1ZTYA 2XXXA 4FORA 4RK2A 4WEDA 1SQYA 4PFYA 4EDPA 5I57A 2RC7A 1NFTA 4C0RA 3MVYA 5EHSA 4H8JA 1IQ7A 1B40A 4BDQA 3SESA 3O6GA 1FTMA 2AYSA 4Q5TA 1MQIA 4GQOA 3MW0A 2O1LA 1PDAA 2RCAA 2QJEA 4RXLA 1D9YA 1M5EA 4TLMB 1LFGA 2H98A 4C1UA 1JNFA 3RTFB 5AA1A 3ZKLA 5CMMA 1D9VA 2PYYA 3ODBA 4QRZA 1L5TA 3R26A 3KN3A 5I57B 3G3KA 4IGTA 2Z22A 1R6ZA 3Q25A 3QXMA 3QUFA 1B52A 2CZLA 2I6EA 1B58A 1A8EA 1SW5A 2GHAA 3FXRA 2QS1A 3MVZA 3CSGA 1LAGE 4KYEA 1URDA 4U1OA 3GBBA 3Q29A 3TKDA 1H43A 4HCYA 2ZYMA 4OETA 1VFDA 3PUVE 2QS4A 4R72A 1LSTA 4YKPA 3K01A 2Q88A 4G8MA 1NH7A 1MY2A 4IB2A 1MG1A 1VSOA 3MQ9A 3T9XB 3QUJA 3IJOB 1BIYA 4FEBA 1SYHA 3K0VA 2XXRA 1GV8A 2H99A 3IORA 1FTOA 5K2YA 1YTVA 3JV9A 5L9MA 3A3UA 1TT1A 2G93A 1AH5A 1MPDA 1OLCA 2Q2CA 4G4PA 2ONSA 4DLDA 3FVOA 4ECFA 2XD3A 1DPEA 1QKBA 5FTIA 3UK4A 1H76A 3PMVA 3HHFA 3O66A 4G68C 3K6WA 3ZS6A 1JVYA 3MZ9A 4GIZA 1JW4A 2A5TA 2H25A 2HEUA 3FUZA 4OQOA 5TP9A 3PUWE 5F7VA 1P1OA 4RNSA 4F2QA 2UYEA 3V89B 1OVTA 5I58A 3VLVA 4BDNA 1I69A 4LATA 2B3BA 4IY5A 3LSXA 3TTNA 1FTLA 3KOSA 3CSBA 3KJ7A 3SEVA 4N6PA 3FXQA 1OQGA 1OLAA 4JWOA 2FYIA 3O2AA 1B5HA 1YCJA 5F1QA 2XXVA 1MY0A 3GBAA 1LCFA 4O3AA 2DQVA 4AB6A 5TP9B 3RTWB 2AL4A 3MVWA 1DTGA 1YAEA 2V3UA 5HBCA 4BLAA 2XXWA 1BKAA 1P1UA 5I58B 4GL0A 3L6HA 2ALUA 2QPQA 1H45A 5A5XA 3KSXA 4FAJA 3B6WA 1ZIUA 5FHNA 3N6UA 1IXGA 2NOOA 4RPNA 1RKMA 4NF5A 1MDP1 3CR9A 4QSEA 5CC2A 4NF4A 4KD5A 3BBRA 3PUZE 3H06B 1XT8A 5KZTA 4N13A 4DXCA 5CMKA 5DEXA 3H6VA 1NH8A 4BDMA 1Y3NA 1F9BA 5H8FA 2XXIA 3TMGA 4OWDA 1SW2A 2VOZA 3C35A 3MC2A 3MBPA 4OFJA 5AA3A 4F22A 4ZEDA 4DCXA 2ONRA 3H3GA 5FHMA 4OZ9A 3N5LA 5EHMA 5I59A 3IR1A 4ZEBA 5CMCA 3PU5A 1M5CA 2OJTA 2I0BA 2UVGA 2E0SA 4TQUQ 3JZJA 2I4BA 4IGRA 3K6UA 3PPNA 4I8CA 4NF4B 2YLNA 3TTRA 4H1XA 3VFJA 1N7XA 1AOVA 1WDNA 1B6HA 5DEXB 3IK6B 2FA7A 1RYXA 3U93A 5H8FB 4F39A 3SERA 2QRYA 3HV1A 3MP8A 3EHTA 5CRYA 1PBQA 4RJZA 2O7UA 5AE4A 3LSFB 1MQJA 3FIRA 3O28A 3TCFA 3TCGA 1Y4TA 4R73A 2UYFA 3JYRA 3IB0A 3K4UA 3O6HA 5I59B 4ESXA 3QIMA 3RY3A 4QF9A 3S2VA 1MXYA 3HHGA 3RQTA 1MQHA 5ITPA 2V3TA 3DLNA 1XS5A 2UVIA 1QJMA 1YPNA 1MXWA 2ZXTA 3MZBA 2X7QA 4OYVA 2PMSA 4NF8B 1XHYA 4NE4A 3AXFA 2O1MA 1URSA 4IO7A 2LAOA 1LGBC 4LZ8A 4OERA 2ANJA 1Y1ZA 4L17A 3S9EA 3S9MC 5BUUA 1Y20A 1MS7A 4WXJA 4F1UA 3T9UA 4GF8A 1QUKA 1JW5A 4F3SA 2I48A 4QFPA 4TOZA 2DWIA 5KCJA 3V8XB 3MP1A 3A3CA 4Q30B 4KQPA 1J1NA 1IIWA 1SBPA 1JW1A 2DVZA 2UVHA 1LB9A 4YB7A 4R2BA 3ILUB 4MH5A 1IUDA 2VD3A 3TUSA 3FVNA 2QMWA 4EUOA 1XC1A 3C36A 2VP1A 3R6UA 3CG3A 4DXUA 1FQFA 4H8IA 1MH4A 1B32A 2XHDA 4EF2A 1NKXA 4RA1A 4N07A 4PP0A 1MH3A 4OFOA 1R9QA 3LSLA 3VE1B 4GXAA 3C34A 2YPNA 4YB5A 2F6GA 4U4SA 4GOTA 4WEPA 3VLUA 3FZVA 1LB8A 3CFXA 4FATA 1NL5A 2V3QA 1US5A 3QAXA 1IZ1A 1ZBMA 4ZEFA 3FV2A 2HAUA 3DELB 3RGYA 4TLLB 3THIA 3DM0A 1SD3A 1RYOA 4KI0E 1KWHA 4R6KA 4I62A 5JEIA 2F97A 1B51A 3KG2A 3VVDA 3SDFA 3TQLA 4NF6A 4PFTA 1B9JA 4EXLA 1GTKA 3MPKA 2ZYKA 3USDA 3O97A 4IO5A 2OCUA 3RT8A 2PBWA 1O7TA 4G68A 3C33A 4LQ2A 1B3FA 4R74A 5CBRA 2F7AA 2F6PA 5L9SA 2GRVA 3FJ7A 1JVXA 2ZMBA 3RNNA 3T93B 4PETA 1T0KA 5CI5A 2ZYNA 3SKPA 3K00A 3VVEA 5H8HB 2D5WA 2O6AA 3UN6A 1LBBA 4NF6B 1N7WA 1PB9A 1US4A 4ONYA 4G77A 4G68B 1FQCA 4F31B 3IOVA 4OEVA 3K1MA 2A5SA 1FW0A 1UIVA 4FIMA 4LA9A 4KFQA 2NXOA 1N76A 4AB5A 4LZ7A 2I3WA 5DVJA 4BDOA 3IO4A 4XKQA 5JK4A 2XXHA 3FVKA 2HFBA 3C32A 2Z8EA 5DVIA 3U72A 3SEWA 1ZJLA 4G2ZA 1FTKA 3TFLA 4X1DA 1M5FA 3H03A 2DE4A 2QL3A 3I5OA 4DE8A 1B5JA 4M4GA 3D4GA 1LAFE 4LONB 3KJTA 4H5GA 4KPTA 3IB1A 2HZKA 1MRPA 3VV5A 3W9WA 4IO4A 3PGFA 4UA8A 4ZZEA 5K2XA 4E0WA 5LOMA 4LUBA 2F34A 3LC8A 4O3BA 1LCTA 1MQGA 3CI8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PV0 E;  3D4C A;  1POT A;  2H5Y A;  5JTY B;  4UAC A;  1Y3P A;  1HSE A;  3E3K A;  4H5F A;  1GR2 A;  3CFZ A;  4R6Y A;  4H65 A;  1O63 A;  5KDT A;  4U21 A;  1HSL A;  1P1W A;  1DMB A;  3FAS A;  1WOD A;  4POW A;  3RPW A;  5HM4 B;  3CVG A;  3KOT A;  4R2F A;  4OFL A;  2OBG A;  3VDF A;  4DCY A;  1ATG A;  1I6Q A;  4XIG Q;  2DWJ A;  3G3G A;  1MXV A;  2HXW A;  1IIT A;  2OWS A;  3OO9 A;  3OEM A;  4IO6 A;  3T66 A;  3M8U A;  3EHU A;  1WVJ A;  1Z7N E;  3M3F A;  5KDT B;  1P99 A;  3EHS A;  3TOD A;  1MXX A;  2DXR A;  4OVJ A;  2P1S A;  4ZE8 A;  3OO6 A;  3PUX E;  3V5A A;  4F2O A;  1D3K A;  4THI A;  4U22 A;  3KBR A;  4YKI A;  1DTZ A;  3EN3 A;  1Y4C A;  4G8N A;  1B3G A;  2Y7R A;  4IO3 A;  3ZSF A;  4RY1 A;  3OO8 A;  1XVY A;  4G8H A;  3HST A;  4LP2 B;  1USY E;  4YKK A;  1ZMG A;  4KHZ E;  1EZP A;  4GVO A;  2O84 X;  1MPB A;  2F78 A;  5I84 A;  3G7W A;  4JWX A;  1PC3 A;  3Q26 A;  3OOA A;  1MM7 A;  4U4X A;  1FCK A;  1B1H A;  4U23 A;  2I4C A;  1QW0 A;  3SET A;  1FQD A;  1QUI A;  3U94 A;  2DVC A;  4X48 A;  1UQW A;  2DE3 A;  3RLF E;  1ZU0 A;  1MQD A;  1GGG A;  4YMB A;  2ZYO A;  3C4M A;  4GL8 A;  4X1B A;  3S9N C;  1NNP A;  3EF7 A;  4NF8 A;  5ISU A;  3T22 A;  3KGC A;  3TTM A;  2V93 A;  2DWH A;  3T9H B;  1B2H A;  1M5B A;  2QS3 A;  4XXU A;  3N94 A;  4MLQ A;  3TZA A;  1VR5 A;  1A54 A;  1NNF A;  1JEV A;  2Y7I A;  1R9L A;  1FTJ A;  5TPA A;  3B7D A;  4QHQ A;  3U92 A;  3M3L A;  2XXQ A;  2D3I A;  3IOU A;  2IA4 A;  2HQ0 A;  5AA4 A;  4ELQ A;  3TDJ A;  1N3X A;  5FTH A;  1NNK A;  3IL1 B;  3I6V A;  3IX1 A;  4U1Z A;  3G3F A;  3LUY A;  2DS9 A;  4QFK A;  3G3H A;  4YAH X;  4ELO A;  2F5X A;  4EXK A;  4ND9 A;  4I1D A;  2OLB A;  1FQE A;  2HZL A;  4NWD A;  3KZG A;  1FQB A;  1R1N A;  5ICQ A;  1II5 A;  2CMO A;  2R71 A;  4GFR A;  5I56 A;  2AL5 A;  1Z7M E;  4OHN A;  1N84 A;  4FJP A;  5CBS A;  5I2N A;  3E9X A;  5TPA B;  1TWY A;  4JDF A;  4Z7E A;  3O29 A;  1BTJ A;  4KR5 A;  1P1N A;  5ELV A;  3UP9 A;  3FJG A;  1QUL A;  2I58 A;  3TTK A;  2NVU B;  3MPL A;  4U2R A;  1IXH A;  1JET A;  2GHB A;  5AA4 B;  2FNC A;  2RC9 A;  4HCW A;  3H6T A;  4XKP A;  4AQ4 A;  1HSJ A;  4Q8R A;  2Z23 A;  3TQW A;  1A99 A;  5AA2 A;  4DXB A;  3S9L C;  4Z0I A;  1MXU A;  3P7I A;  1Q1K A;  1XVX A;  5I56 B;  2Y7P A;  3B6T A;  4F3P A;  5I2N B;  2G29 A;  4R9F A;  3KN7 A;  1N04 A;  4LQ5 A;  2Q8J A;  4EQB A;  1MY3 A;  1MDQ A;  5IKB A;  2P0S A;  4GRK A;  3H4Z A;  4XTC Q;  1LAX A;  4BDL A;  2NWJ A;  3FGS A;  2I49 A;  1MPC A;  2H9B A;  2PT2 A;  1AIV A;  4C1T A;  1NMU A;  4QSD A;  5AA2 B;  3PPR A;  2XXP A;  3OXN A;  1P1Q A;  1UTB A;  4GD5 A;  2F7C A;  3UOR A;  4YMA A;  1B3E A;  3MP6 A;  4MLV A;  5H8H A;  4QFO A;  3W9V A;  3K02 A;  4KCD A;  5DVF A;  2Q2A A;  4ZEK A;  3S4U A;  4PE5 B;  3T9V A;  1B46 A;  3LSW A;  4XKR A;  3TYH A;  2GH9 A;  3DP8 A;  3CIJ A;  2PX1 A;  5DTB A;  2V25 A;  3QSL A;  3GLB A;  3B6Q A;  2DE2 A;  2QSX A;  2F36 A;  3KFM A;  2IEE A;  2F8D A;  1Y3Q A;  1IEJ A;  3WAF A;  3C9H A;  1UTB B;  2Z8D A;  1B0L A;  4QFN A;  3E13 X;  1B7U A;  2Z8F A;  4JWY A;  1O64 A;  3K2D A;  2QS2 A;  3L6G A;  1D4N A;  1SW4 A;  4RK9 A;  4YU0 A;  3HCQ A;  4JBZ A;  1UIU A;  5ICT A;  3PMX A;  5L8D A;  3VXC A;  2DYX A;  1ZLQ A;  4ELP A;  3TPA A;  3N26 A;  2ZNT A;  4X9T A;  4H6D A;  2O51 A;  1JEU A;  2P2A A;  2XXT A;  3MVX A;  1B4Z A;  4FEC A;  3O6I A;  1UTH A;  1QUJ A;  3OD7 A;  2RIN A;  1B0H A;  2DWA A;  3GXA A;  1B4H A;  2OWT A;  1N3W A;  3F11 A;  1DOT A;  3QK6 A;  3RUM A;  4PFW A;  1CB6 A;  5L9O A;  5JTY A;  1LLS A;  3H6U A;  1IXI A;  3SEX A;  3IOW A;  1EH3 A;  4EQ9 A;  3O9P A;  2UXA A;  4ISU A;  3DP4 A;  2O7I A;  4E0X A;  4R6H A;  3H7M A;  2XX9 A;  4ZZA A;  1B7Z A;  5H8S A;  4R75 A;  4P0I A;  3TTL A;  3IJX B;  1UTH B;  4KYS A;  1QVS A;  4OTE A;  4ZDM A;  3K1P A;  3OEN A;  2HCA A;  5B7D A;  1BP5 A;  1MY1 A;  3T96 B;  4IO2 A;  5DT6 A;  1DSN A;  3OO7 A;  3PMW A;  1LAH E;  1TFD A;  4OMB A;  3QYT A;  4YZZ A;  2DXY A;  4LVQ A;  3MZ1 A;  3PPP A;  2DOJ A;  2F7B A;  4F1V A;  1EU8 A;  2D21 A;  3IO6 A;  3TEL A;  1TXF A;  3DP6 A;  3ZKK A;  3SEY A;  4JSO A;  3BKI B;  2O68 A;  3LR1 A;  2X26 A;  3FXU A;  3U1O A;  3MJN A;  3A09 A;  4NTL A;  2Q9T A;  1EZO A;  5I2K A;  1S9T A;  4KYD A;  2X7P A;  2NUV A;  4NED A;  2E1S A;  3UGW A;  3G3I A;  4XKN A;  3OMB A;  3IOT A;  1SYI A;  4O3C A;  3VVF A;  2B3F A;  3SEU A;  1PB8 A;  4OXV A;  1H3D A;  1ANF A;  1BLF A;  5B70 A;  3FV1 A;  4YIC A;  5H8Q A;  3K6X A;  2I0C A;  4M1V A;  1URG A;  1IXC A;  1LFI A;  4R9G A;  1FQA A;  4DDD A;  3VXB A;  3U8Q A;  3H6W A;  2GFE A;  1DPP A;  2A5T B;  2H4I A;  1XOC A;  5I2K B;  1TFA A;  2B65 A;  4I9D A;  4K3F A;  5DYH A;  3KN8 A;  4MFI A;  4FE8 A;  3OEK A;  2VHA A;  3MWB A;  3K1N A;  4YKJ A;  1JQF A;  2R6G E;  4FED A;  2F35 A;  2AIX A;  3ILT B;  1Y9U A;  3RN8 A;  2REJ A;  3FVG A;  4P0G A;  4F19 A;  4F3G A;  2OZZ A;  1H44 A;  5BWJ A;  1ZKB A;  2VD2 A;  4RPO A;  1AL3 A;  3E4R A;  1Q35 A;  5H8Q B;  1PB7 A;  1POY 1;  3HPI A;  4EQ7 A;  3Q27 A;  4LZ5 A;  3GZG A;  2XX8 A;  4ZEC A;  4ZS9 A;  2Q89 A;  3MAM A;  4H67 A;  3KSJ A;  4P11 A;  4MBP A;  2ZNU A;  3VLW A;  5TU0 A;  4HW8 A;  3I3V A;  1QKA A;  2XX7 A;  4BDR A;  2OK2 A;  4GXS B;  2WKY A;  1A8F A;  5AA2 D;  1VFE A;  1GVC A;  1LFH A;  1B1X A;  5CMB A;  5A5X B;  4JSD A;  4ZE9 A;  4ZEI A;  2DSF A;  3K6V A;  5H8N A;  1B05 A;  3MUQ A;  4NF5 B;  1A55 A;  4WKM A;  1A40 A;  3TCH A;  3CG1 A;  3UIF A;  4ELR A;  3PPQ A;  2PVU A;  1SW1 A;  3TAJ A;  3HO7 A;  3N6T A;  1M5D A;  1S7Y A;  4HTG A;  2ABH A;  1Y1M A;  2KLF A;  3PD8 A;  2THI A;  2ZNS A;  2RKM A;  2UVJ A;  2REG A;  1B3H A;  4QSC A;  1OMP A;  2R9J A;  4NWC A;  4PFU A;  1PEB A;  3ONM A;  1OVB A;  4NMY A;  1B7H A;  2Y84 A;  5H8N B;  1OIB A;  3TEP A;  2M8C A;  1USY H;  5J1D A;  1CE2 A;  4Q0C A;  5EYF A;  2RCB A;  3ECR A;  2DP8 A;  3G3J A;  2V84 A;  3Q28 A;  1VE4 A;  5HPQ A;  3RT6 B;  2XXU A;  3WAE A;  3PD9 A;  3FD3 A;  4MF3 A;  3EPE A;  4RYA A;  1SVX B;  5FHO A;  3FAT A;  1NNT A;  1ELJ A;  4ESW A;  1A7L A;  1AMF A;  2I3V A;  1LBC A;  2RF1 A;  3FJM A;  1MM6 A;  3OSQ A;  4H0W A;  2PT1 A;  1S50 A;  2RC8 A;  4QFL A;  3CRB A;  2BJJ X;  4OES A;  4DIG A;  1I6B A;  4JB7 A;  3OSR A;  3R7X A;  2HAV A;  5ITO A;  2YJP A;  3BFT A;  2XD2 A;  3LBS A;  1B5I A;  4GLI A;  2XXY A;  1MY4 A;  3HN0 A;  1SI1 A;  3BFU A;  4F3B A;  2Y7W A;  2ONK E;  3OEL A;  4F18 A;  5KCJ B;  4POX A;  1I6A A;  3KEI A;  1MXZ A;  1PBP A;  2QMX A;  3V83 A;  4HS7 A;  4KCC A;  4OEN A;  2W7Y A;  1SI0 A;  3IB2 A;  2ESN A;  5M2V A;  3CFL A;  1N0T A;  2VGQ A;  4IY6 A;  3UA8 A;  3PUY E;  2O69 A;  1OQH A;  4YB6 A;  2Y7K A;  5CM6 A;  3M3K A;  4JXI A;  3IAZ A;  4DZ1 A;  4F1Y A;  1EZ9 A;  3PPO A;  4EF1 A;  3W15 C;  1SDX A;  5IAI A;  4GWO A;  3EQ1 A;  4OEU A;  4PQJ A;  4F29 A;  3C31 A;  1B3L A;  1ZTY A;  2XXX A;  4FOR A;  4RK2 A;  4WED A;  1SQY A;  4PFY A;  4EDP A;  5I57 A;  2RC7 A;  1NFT A;  4C0R A;  3MVY A;  5EHS A;  4H8J A;  1IQ7 A;  1B40 A;  4BDQ A;  3SES A;  3O6G A;  1FTM A;  2AYS A;  4Q5T A;  1MQI A;  4GQO A;  3MW0 A;  2O1L A;  1PDA A;  2RCA A;  2QJE A;  4RXL A;  1D9Y A;  1M5E A;  4TLM B;  1LFG A;  2H98 A;  4C1U A;  1JNF A;  3RTF B;  5AA1 A;  3ZKL A;  5CMM A;  1D9V A;  2PYY A;  3ODB A;  4QRZ A;  1L5T A;  3R26 A;  3KN3 A;  5I57 B;  3G3K A;  4IGT A;  2Z22 A;  1R6Z A;  3Q25 A;  3QXM A;  3QUF A;  1B52 A;  2CZL A;  2I6E A;  1B58 A;  1A8E A;  1SW5 A;  2GHA A;  3FXR A;  2QS1 A;  3MVZ A;  3CSG A;  1LAG E;  4KYE A;  1URD A;  4U1O A;  3GBB A;  3Q29 A;  3TKD A;  1H43 A;  4HCY A;  2ZYM A;  4OET A;  1VFD A;  3PUV E;  2QS4 A;  4R72 A;  1LST A;  4YKP A;  3K01 A;  2Q88 A;  4G8M A;  1NH7 A;  1MY2 A;  4IB2 A;  1MG1 A;  1VSO A;  3MQ9 A;  3T9X B;  3QUJ A;  3IJO B;  1BIY A;  4FEB A;  1SYH A;  3K0V A;  2XXR A;  1GV8 A;  2H99 A;  3IOR A;  1FTO A;  5K2Y A;  1YTV A;  3JV9 A;  5L9M A;  3A3U A;  1TT1 A;  2G93 A;  1AH5 A;  1MPD A;  1OLC A;  2Q2C A;  4G4P A;  2ONS A;  4DLD A;  3FVO A;  4ECF A;  2XD3 A;  1DPE A;  1QKB A;  5FTI A;  3UK4 A;  1H76 A;  3PMV A;  3HHF A;  3O66 A;  4G68 C;  3K6W A;  3ZS6 A;  1JVY A;  3MZ9 A;  4GIZ A;  1JW4 A;  2A5T A;  2H25 A;  2HEU A;  3FUZ A;  4OQO A;  5TP9 A;  3PUW E;  5F7V A;  1P1O A;  4RNS A;  4F2Q A;  2UYE A;  3V89 B;  1OVT A;  5I58 A;  3VLV A;  4BDN A;  1I69 A;  4LAT A;  2B3B A;  4IY5 A;  3LSX A;  3TTN A;  1FTL A;  3KOS A;  3CSB A;  3KJ7 A;  3SEV A;  4N6P A;  3FXQ A;  1OQG A;  1OLA A;  4JWO A;  2FYI A;  3O2A A;  1B5H A;  1YCJ A;  5F1Q A;  2XXV A;  1MY0 A;  3GBA A;  1LCF A;  4O3A A;  2DQV A;  4AB6 A;  5TP9 B;  3RTW B;  2AL4 A;  3MVW A;  1DTG A;  1YAE A;  2V3U A;  5HBC A;  4BLA A;  2XXW A;  1BKA A;  1P1U A;  5I58 B;  4GL0 A;  3L6H A;  2ALU A;  2QPQ A;  1H45 A;  5A5X A;  3KSX A;  4FAJ A;  3B6W A;  1ZIU A;  5FHN A;  3N6U A;  1IXG A;  2NOO A;  4RPN A;  1RKM A;  4NF5 A;  1MDP 1;  3CR9 A;  4QSE A;  5CC2 A;  4NF4 A;  4KD5 A;  3BBR A;  3PUZ E;  3H06 B;  1XT8 A;  5KZT A;  4N13 A;  4DXC A;  5CMK A;  5DEX A;  3H6V A;  1NH8 A;  4BDM A;  1Y3N A;  1F9B A;  5H8F A;  2XXI A;  3TMG A;  4OWD A;  1SW2 A;  2VOZ A;  3C35 A;  3MC2 A;  3MBP A;  4OFJ A;  5AA3 A;  4F22 A;  4ZED A;  4DCX A;  2ONR A;  3H3G A;  5FHM A;  4OZ9 A;  3N5L A;  5EHM A;  5I59 A;  3IR1 A;  4ZEB A;  5CMC A;  3PU5 A;  1M5C A;  2OJT A;  2I0B A;  2UVG A;  2E0S A;  4TQU Q;  3JZJ A;  2I4B A;  4IGR A;  3K6U A;  3PPN A;  4I8C A;  4NF4 B;  2YLN A;  3TTR A;  4H1X A;  3VFJ A;  1N7X A;  1AOV A;  1WDN A;  1B6H A;  5DEX B;  3IK6 B;  2FA7 A;  1RYX A;  3U93 A;  5H8F B;  4F39 A;  3SER A;  2QRY A;  3HV1 A;  3MP8 A;  3EHT A;  5CRY A;  1PBQ A;  4RJZ A;  2O7U A;  5AE4 A;  3LSF B;  1MQJ A;  3FIR A;  3O28 A;  3TCF A;  3TCG A;  1Y4T A;  4R73 A;  2UYF A;  3JYR A;  3IB0 A;  3K4U A;  3O6H A;  5I59 B;  4ESX A;  3QIM A;  3RY3 A;  4QF9 A;  3S2V A;  1MXY A;  3HHG A;  3RQT A;  1MQH A;  5ITP A;  2V3T A;  3DLN A;  1XS5 A;  2UVI A;  1QJM A;  1YPN A;  1MXW A;  2ZXT A;  3MZB A;  2X7Q A;  4OYV A;  2PMS A;  4NF8 B;  1XHY A;  4NE4 A;  3AXF A;  2O1M A;  1URS A;  4IO7 A;  2LAO A;  1LGB C;  4LZ8 A;  4OER A;  2ANJ A;  1Y1Z A;  4L17 A;  3S9E A;  3S9M C;  5BUU A;  1Y20 A;  1MS7 A;  4WXJ A;  4F1U A;  3T9U A;  4GF8 A;  1QUK A;  1JW5 A;  4F3S A;  2I48 A;  4QFP A;  4TOZ A;  2DWI A;  5KCJ A;  3V8X B;  3MP1 A;  3A3C A;  4Q30 B;  4KQP A;  1J1N A;  1IIW A;  1SBP A;  1JW1 A;  2DVZ A;  2UVH A;  1LB9 A;  4YB7 A;  4R2B A;  3ILU B;  4MH5 A;  1IUD A;  2VD3 A;  3TUS A;  3FVN A;  2QMW A;  4EUO A;  1XC1 A;  3C36 A;  2VP1 A;  3R6U A;  3CG3 A;  4DXU A;  1FQF A;  4H8I A;  1MH4 A;  1B32 A;  2XHD A;  4EF2 A;  1NKX A;  4RA1 A;  4N07 A;  4PP0 A;  1MH3 A;  4OFO A;  1R9Q A;  3LSL A;  3VE1 B;  4GXA A;  3C34 A;  2YPN A;  4YB5 A;  2F6G A;  4U4S A;  4GOT A;  4WEP A;  3VLU A;  3FZV A;  1LB8 A;  3CFX A;  4FAT A;  1NL5 A;  2V3Q A;  1US5 A;  3QAX A;  1IZ1 A;  1ZBM A;  4ZEF A;  3FV2 A;  2HAU A;  3DEL B;  3RGY A;  4TLL B;  3THI A;  3DM0 A;  1SD3 A;  1RYO A;  4KI0 E;  1KWH A;  4R6K A;  4I62 A;  5JEI A;  2F97 A;  1B51 A;  3KG2 A;  3VVD A;  3SDF A;  3TQL A;  4NF6 A;  4PFT A;  1B9J A;  4EXL A;  1GTK A;  3MPK A;  2ZYK A;  3USD A;  3O97 A;  4IO5 A;  2OCU A;  3RT8 A;  2PBW A;  1O7T A;  4G68 A;  3C33 A;  4LQ2 A;  1B3F A;  4R74 A;  5CBR A;  2F7A A;  2F6P A;  5L9S A;  2GRV A;  3FJ7 A;  1JVX A;  2ZMB A;  3RNN A;  3T93 B;  4PET A;  1T0K A;  5CI5 A;  2ZYN A;  3SKP A;  3K00 A;  3VVE A;  5H8H B;  2D5W A;  2O6A A;  3UN6 A;  1LBB A;  4NF6 B;  1N7W A;  1PB9 A;  1US4 A;  4ONY A;  4G77 A;  4G68 B;  1FQC A;  4F31 B;  3IOV A;  4OEV A;  3K1M A;  2A5S A;  1FW0 A;  1UIV A;  4FIM A;  4LA9 A;  4KFQ A;  2NXO A;  1N76 A;  4AB5 A;  4LZ7 A;  2I3W A;  5DVJ A;  4BDO A;  3IO4 A;  4XKQ A;  5JK4 A;  2XXH A;  3FVK A;  2HFB A;  3C32 A;  2Z8E A;  5DVI A;  3U72 A;  3SEW A;  1ZJL A;  4G2Z A;  1FTK A;  3TFL A;  4X1D A;  1M5F A;  3H03 A;  2DE4 A;  2QL3 A;  3I5O A;  4DE8 A;  1B5J A;  4M4G A;  3D4G A;  1LAF E;  4LON B;  3KJT A;  4H5G A;  4KPT A;  3IB1 A;  2HZK A;  1MRP A;  3VV5 A;  3W9W A;  4IO4 A;  3PGF A;  4UA8 A;  4ZZE A;  5K2X A;  4E0W A;  5LOM A;  4LUB A;  2F34 A;  3LC8 A;  4O3B A;  1LCT A;  1MQG A;  3CI8 A; 
#chains in the Genus database with same CATH topology
 3PV0 E;  3D4C A;  2B4M A;  1POT A;  2VPN A;  2H5Y A;  5JTY B;  4UAC A;  1Y3P A;  1HSE A;  3E3K A;  4OA4 A;  4H5F A;  1GR2 A;  3CFZ A;  4R6Y A;  4H65 A;  1O63 A;  5KDT A;  4U21 A;  1HSL A;  1P1W A;  3MYU A;  1DMB A;  3FAS A;  1WOD A;  4POW A;  3RPW A;  5HM4 B;  1NV7 A;  3CVG A;  3KOT A;  4R2F A;  4OFL A;  2OBG A;  3VDF A;  4DCY A;  1ATG A;  1I6Q A;  4XIG Q;  2DWJ A;  3G3G A;  4IR8 A;  1MXV A;  2HXW A;  1IIT A;  2F3B A;  2OWS A;  3OO9 A;  3OEM A;  4IO6 A;  3T66 A;  3M8U A;  4OAN A;  3EHU A;  1WVJ A;  1IMF A;  1Z7N E;  3M3F A;  5KDT B;  1P99 A;  3EHS A;  3FBP A;  3TOD A;  1MXX A;  2DXR A;  4OVJ A;  2P1S A;  4ZE8 A;  3OO6 A;  3PUX E;  1XI6 A;  3V5A A;  5F24 A;  4F2O A;  1D3K A;  3PTY A;  2F3D A;  4THI A;  4U22 A;  3KBR A;  4YKI A;  1DTZ A;  3EN3 A;  1Y4C A;  1FPF A;  4G8N A;  2XWI A;  1B3G A;  2Y7R A;  4IO3 A;  3ZSF A;  4RY1 A;  2CEY A;  3OO8 A;  1XVY A;  2KR0 A;  3HST A;  4G8H A;  4LP2 B;  1USY E;  4YKK A;  1ZMG A;  4KHZ E;  2MKZ A;  1EZP A;  4GVO A;  4O8M A;  2O84 X;  1MPB A;  2F78 A;  5I84 A;  3G7W A;  4JWX A;  1PC3 A;  3Q26 A;  3T0J A;  3OOA A;  1MM7 A;  4U4X A;  1FCK A;  4QBA A;  4PAF A;  1B1H A;  4U23 A;  2I4C A;  1QW0 A;  3SET A;  1FQD A;  1QUI A;  3U94 A;  2DVC A;  4X48 A;  2FIE A;  1UQW A;  2DE3 A;  3RLF E;  1ZU0 A;  1MQD A;  1GGG A;  4YMB A;  2ZYO A;  3C4M A;  4GL8 A;  4X1B A;  3S9N C;  1NNP A;  3EF7 A;  3IFC A;  5EYG A;  4OVQ A;  4NF8 A;  5ISU A;  3T22 A;  3KGC A;  3TTM A;  2V93 A;  2DWH A;  3T9H B;  1B2H A;  1M5B A;  2QS3 A;  4XXU A;  4N4U A;  3N94 A;  4MLQ A;  3TZA A;  1VR5 A;  5IZ3 A;  1A54 A;  1NNF A;  1JEV A;  2Y7I A;  1R9L A;  1FTJ A;  5TPA A;  3B7D A;  4QHQ A;  3U92 A;  3M3L A;  1KA1 A;  2XXQ A;  4NQ8 A;  2D3I A;  4MNI A;  3IOU A;  2WEF A;  2IA4 A;  2HQ0 A;  4DI3 D;  5ESY A;  5AA4 A;  4ELQ A;  3TDJ A;  1N3X A;  5FTH A;  1NNK A;  3IL1 B;  1FPD A;  3I6V A;  3IX1 A;  2ZZX A;  4U1Z A;  3G3F A;  3LUY A;  2DS9 A;  4QFK A;  3G3H A;  4YAH X;  4ELO A;  2F5X A;  4EXK A;  4ND9 A;  4I1D A;  2OLB A;  1FQE A;  2HZL A;  4NWD A;  3KZG A;  1FQB A;  1R1N A;  5ICQ A;  1II5 A;  4GBV A;  2CMO A;  2R71 A;  4GFR A;  5I56 A;  2AL5 A;  1Z7M E;  4OHN A;  1N84 A;  4FJP A;  5CBS A;  2CZI A;  5I2N A;  3E9X A;  2CEX A;  5TPA B;  1TWY A;  4JDF A;  4Z7E A;  3O29 A;  1BTJ A;  4KR5 A;  1P1N A;  5ELV A;  3UP9 A;  3FJG A;  1QUL A;  2I58 A;  3TTK A;  4NN3 A;  2NVU B;  3MPL A;  4U2R A;  1IXH A;  1JET A;  2GHB A;  5AA4 B;  2FNC A;  4GWU A;  2RC9 A;  4HCW A;  3H6T A;  1G0H A;  4XKP A;  2XWO A;  5EQA A;  4AQ4 A;  1HSJ A;  4Q8R A;  2Z23 A;  3TQW A;  1A99 A;  5AA2 A;  4DXB A;  3S9L C;  4O7M A;  4Z0I A;  1MXU A;  3P7I A;  1Q1K A;  1XVX A;  1FBF A;  2WBB A;  5I56 B;  2Y7P A;  3B6T A;  4F3P A;  5I2N B;  2G29 A;  4R9F A;  3KN7 A;  1N04 A;  4LQ5 A;  2Q8J A;  4EQB A;  1MY3 A;  1MDQ A;  5IKB A;  2P0S A;  4GRK A;  3H4Z A;  4XTC Q;  1LAX A;  4BDL A;  2QVU A;  2WYK A;  2NWJ A;  3FGS A;  2I49 A;  4JVC A;  1MPC A;  2H9B A;  2PT2 A;  1AIV A;  4C1T A;  1NMU A;  4PFI A;  4QSD A;  5AA2 B;  3PPR A;  2XXP A;  5LDZ A;  1FBD A;  3OXN A;  3RPL A;  1P1Q A;  1UTB A;  4GD5 A;  2F7C A;  3UOR A;  4YMA A;  1B3E A;  3MP6 A;  4MLV A;  1FBP A;  5H8H A;  4QFO A;  3W9V A;  3K02 A;  4KCD A;  5DVF A;  2WBD A;  2Q2A A;  4ZEK A;  3S4U A;  4PE5 B;  3T9V A;  1B46 A;  3LSW A;  4XKR A;  3RYD A;  3TYH A;  2GH9 A;  3DP8 A;  3CIJ A;  2PX1 A;  5DTB A;  2V25 A;  3QSL A;  1FBE A;  3GLB A;  3B6Q A;  2DE2 A;  2QSX A;  2F36 A;  3KFM A;  2IEE A;  2F8D A;  4MX6 A;  1Y3Q A;  2PFY A;  3RPL B;  1IMB A;  1IEJ A;  3WAF A;  3C9H A;  1UTB B;  2Z8D A;  1B0L A;  4QFN A;  3E13 X;  1B7U A;  2Z8F A;  4JWY A;  1O64 A;  3K2D A;  2QS2 A;  3L6G A;  4AS4 A;  4PTK A;  3U65 A;  3CHG A;  1D4N A;  1SW4 A;  4RK9 A;  4YU0 A;  3HCQ A;  4JBZ A;  1UIU A;  1AWB A;  5ICT A;  1FBG A;  1K9Y A;  4GWZ A;  3PMX A;  5L8D A;  3VXC A;  2DYX A;  1ZLQ A;  4ELP A;  2Q8M A;  3TPA A;  1DCU A;  1FSA A;  2FBP A;  3N26 A;  2ZNT A;  4H46 A;  4X9T A;  4H6D A;  2O51 A;  4QXD A;  1JEU A;  2P2A A;  1JP4 A;  2XXT A;  3MVX A;  1B4Z A;  5EYH A;  4O94 A;  4FEC A;  3O6I A;  1UTH A;  1QUJ A;  2VT5 A;  3OD7 A;  2HHM A;  5I5P A;  2RIN A;  1B0H A;  2DWA A;  3GXA A;  4AS5 A;  1B4H A;  2OWT A;  1IME A;  1N3W A;  3F11 A;  1DOT A;  3QK6 A;  2B4L A;  3RUM A;  4PFW A;  1CB6 A;  5L9O A;  5JTY A;  1LLS A;  3H6U A;  1IXI A;  3SEX A;  4NX1 A;  3IOW A;  1EH3 A;  4GBW A;  4EQ9 A;  3O9P A;  2UXA A;  4ISU A;  3DP4 A;  4GWX A;  2O7I A;  4R6H A;  4E0X A;  4P9K A;  2OX3 A;  3H7M A;  2XX9 A;  4ZZA A;  1B7Z A;  5H8S A;  4N8Y A;  4R75 A;  4P0I A;  3TTL A;  3IJX B;  1UTH B;  4KYS A;  1FPB A;  1QVS A;  4OTE A;  5FBP A;  4ZDM A;  3K1P A;  1QGX A;  3OEN A;  2HCA A;  5B7D A;  1BP5 A;  1MY1 A;  3T96 B;  1FPI A;  4IO2 A;  5DT6 A;  1DSN A;  3OO7 A;  3PMW A;  1LAH E;  1TFD A;  1FBH A;  2WYP A;  3LUZ A;  4OMB A;  3QYT A;  4YZZ A;  2DXY A;  4LVQ A;  3MZ1 A;  4HXV A;  3PPP A;  2DOJ A;  2F7B A;  2XWV A;  4F1V A;  2P3N A;  1EU8 A;  2D21 A;  3IO6 A;  3TEL A;  1TXF A;  3DP6 A;  3ZKK A;  5A5L A;  3SEY A;  4JSO A;  3BKI B;  2O68 A;  3LR1 A;  1YZ0 A;  2X26 A;  3FXU A;  3U1O A;  3MJN A;  3A09 A;  4NTL A;  1KZ8 A;  2Q9T A;  1EZO A;  5I2K A;  1S9T A;  4KYD A;  2CZH A;  2X7P A;  2NUV A;  4NED A;  4NF0 A;  2E1S A;  1VDW A;  3UGW A;  3G3I A;  4XKN A;  3OMB A;  3IOT A;  1SYI A;  4O3C A;  3VVF A;  2B3F A;  4NHB A;  3SEU A;  4MEV A;  1PB8 A;  4OXV A;  4XEQ A;  1H3D A;  1ANF A;  1BLF A;  5B70 A;  3FV1 A;  4YIC A;  5H8Q A;  3K6X A;  2I0C A;  4M1V A;  3D1R A;  1URG A;  2V4C A;  4KXP A;  1IXC A;  1LFI A;  4R9G A;  1FQA A;  4DDD A;  3VXB A;  3U8Q A;  3H6W A;  2GFE A;  2BJI A;  1DPP A;  2A5T B;  2H4I A;  1XOC A;  5I2K B;  1TFA A;  2B65 A;  4I9D A;  4K3F A;  5DYH A;  3KN8 A;  4MFI A;  4HE1 A;  4FE8 A;  3OEK A;  4HE2 A;  2VHA A;  1FJ6 A;  3MWB A;  3K1N A;  4YKJ A;  1JQF A;  2R6G E;  5ET6 A;  2HPG A;  4FED A;  2F35 A;  2AIX A;  3ILT B;  1Y9U A;  3RN8 A;  2REJ A;  3FVG A;  4P0G A;  4F19 A;  1NI9 A;  4F3G A;  2OZZ A;  1H44 A;  5BWJ A;  1ZKB A;  2VD2 A;  4RPO A;  1AL3 A;  3E4R A;  1FRP A;  1Q35 A;  5H8Q B;  1PB7 A;  1POY 1;  3HPI A;  4EQ7 A;  3Q27 A;  4LZ5 A;  3GZG A;  4G61 A;  2XX8 A;  4ZEC A;  4ZS9 A;  2Q89 A;  3MAM A;  4H67 A;  3KSJ A;  4P11 A;  4PAK A;  4MBP A;  2ZNU A;  3VLW A;  1LBW A;  5TU0 A;  4HW8 A;  3I3V A;  1QKA A;  2XX7 A;  3A29 A;  4BDR A;  2OK2 A;  4GXS B;  2WKY A;  1A8F A;  4MMP A;  5AA2 D;  1VFE A;  1GVC A;  1LFH A;  1B1X A;  5CMB A;  1LBZ A;  5A5X B;  2JJK A;  4JSD A;  4ZE9 A;  4ZEI A;  2DSF A;  3K6V A;  5H8N A;  1B05 A;  3MUQ A;  4XF5 A;  4NF5 B;  1A55 A;  4WKM A;  1A40 A;  3TCH A;  3E78 A;  3CG1 A;  3UIF A;  4ELR A;  3PPQ A;  2PVU A;  1SW1 A;  3TAJ A;  3HO7 A;  3N6T A;  1M5D A;  1S7Y A;  1FPE A;  4HTG A;  2ABH A;  1Y1M A;  2KLF A;  5I7I A;  3PD8 A;  2THI A;  2ZNS A;  2RKM A;  4PE3 A;  2UVJ A;  2REG A;  1B3H A;  4QSC A;  1OMP A;  2R9J A;  4NWC A;  4PFU A;  2XWK A;  1PEB A;  3ONM A;  1OVB A;  4NMY A;  1B7H A;  2Y84 A;  5H8N B;  1OIB A;  3TEP A;  2M8C A;  1USY H;  3ROJ A;  5J1D A;  1CE2 A;  4Q0C A;  4N17 A;  4PFR A;  5EYF A;  2RCB A;  3ECR A;  4OVT A;  2DP8 A;  3G3J A;  2V84 A;  3Q28 A;  1VE4 A;  5HPQ A;  2PFZ A;  3RT6 B;  2XXU A;  3WAE A;  3PD9 A;  3FD3 A;  4MF3 A;  3EPE A;  4RYA A;  1SVX B;  5FHO A;  3FAT A;  1NNT A;  1ELJ A;  4ESW A;  1A7L A;  1AMF A;  1FPJ A;  2I3V A;  4GWY A;  4PBQ A;  1LBC A;  2R8T A;  2RF1 A;  1EYI A;  3FJM A;  1EYJ A;  1MM6 A;  3OSQ A;  4H0W A;  5LTC A;  2PT1 A;  1S50 A;  2RC8 A;  2QFL A;  4N6K A;  4QFL A;  3CRB A;  4PDD A;  2BJJ X;  4OES A;  4DIG A;  1I6B A;  4JB7 A;  4OVS A;  1LEV A;  3OSR A;  2GQ1 A;  3R7X A;  1NV5 A;  2HAV A;  5ITO A;  2XA5 A;  2YJP A;  3BFT A;  2KQZ A;  2XD2 A;  3LBS A;  3MST A;  1B5I A;  1RDY A;  4GLI A;  2XXY A;  1MY4 A;  3HN0 A;  1DBZ A;  1SI1 A;  3BFU A;  4F3B A;  2Y7W A;  2L5V A;  2ONK E;  3OEL A;  4UAB A;  4XFE A;  4F18 A;  4O7I A;  4POX A;  5KCJ B;  1I6A A;  3KEI A;  1MXZ A;  1PBP A;  3B50 A;  1NV2 A;  2QMX A;  3V83 A;  4HS7 A;  4KCC A;  4OEN A;  2W7Y A;  1SI0 A;  3IB2 A;  2ESN A;  5M2V A;  3CFL A;  3BIG A;  1N0T A;  2VGQ A;  4IY6 A;  3UA8 A;  3PUY E;  2O69 A;  1NV6 A;  1FPL A;  1OQH A;  4YB6 A;  2Y7K A;  5CM6 A;  3M3K A;  4JXI A;  3IAZ A;  4DZ1 A;  4F1Y A;  1EZ9 A;  3PPO A;  4MNP A;  4JVI A;  4EF1 A;  3W15 C;  1SDX A;  1IMC A;  5IAI A;  4GWO A;  1BK4 A;  3EQ1 A;  4PQJ A;  4OEU A;  4F29 A;  3C31 A;  1B3L A;  1ZTY A;  2XXX A;  4FOR A;  3SZP A;  4RK2 A;  4WED A;  1SQY A;  4PFY A;  4DI4 B;  4EDP A;  5I57 A;  2RC7 A;  1NFT A;  4C0R A;  3MVY A;  5EHS A;  4H8J A;  1IQ7 A;  1B40 A;  4BDQ A;  2ZZV A;  3SES A;  3O6G A;  1FTM A;  4PAI A;  2AYS A;  4Q5T A;  1MQI A;  4GQO A;  1CNQ A;  3MW0 A;  2O1L A;  1FBC A;  4I40 A;  1PDA A;  2RCA A;  2QJE A;  4RXL A;  1D9Y A;  4N6D A;  1M5E A;  4TLM B;  4I3E A;  1G0I A;  1LFG A;  2H98 A;  4C1U A;  1JNF A;  3RTF B;  1FPG A;  4PF6 A;  5AA1 A;  3ZKL A;  4N8G A;  5CMM A;  1D9V A;  2PYY A;  3ODB A;  4QRZ A;  1L5T A;  4HE0 A;  3R26 A;  4X04 A;  3KN3 A;  5I57 B;  3KBZ A;  3G3K A;  4IGT A;  2Z22 A;  1R6Z A;  3Q25 A;  3QXM A;  3QUF A;  1B52 A;  2CZL A;  2I6E A;  1NUZ A;  1B58 A;  1A8E A;  1SW5 A;  4N91 A;  1KA0 A;  2Q74 A;  4GWS A;  2GHA A;  3FXR A;  2QS1 A;  3MVZ A;  4P3L A;  4X8R A;  3CSG A;  1LAG E;  4KYE A;  1URD A;  4U1O A;  3GBB A;  4MHF A;  2XXK A;  3Q29 A;  3TKD A;  1H43 A;  4HCY A;  2ZYM A;  4JVD A;  4OET A;  1VFD A;  2P3V A;  3PUV E;  2QS4 A;  4PGP A;  4R72 A;  1EYK A;  1LST A;  4YKP A;  3K01 A;  2Q88 A;  4G8M A;  1NH7 A;  1MY2 A;  4IB2 A;  1MG1 A;  4PBH A;  2OWZ A;  1VSO A;  3MQ9 A;  3T9X B;  3QUJ A;  3IJO B;  1BIY A;  4FEB A;  1SYH A;  3K0V A;  2XXR A;  4NGU A;  1GV8 A;  2H99 A;  3IOR A;  1FTO A;  5K2Y A;  1YTV A;  3JV9 A;  5L9M A;  3A3U A;  1TT1 A;  2G93 A;  1AH5 A;  1MPD A;  1OLC A;  2Q2C A;  4G4P A;  1IMA A;  4NAP A;  2ONS A;  2DDK A;  4DLD A;  3FVO A;  2XD3 A;  4ECF A;  1DPE A;  1QKB A;  5FTI A;  3UK4 A;  1H76 A;  3PMV A;  3HHF A;  3O66 A;  4G68 C;  3K6W A;  4PC9 A;  3ZS6 A;  1JVY A;  3MZ9 A;  4GIZ A;  3FXB A;  1JW4 A;  2A5T A;  2H25 A;  4GWW A;  2HEU A;  3FUZ A;  4OQO A;  5TP9 A;  3PUW E;  1K9Z A;  5F7V A;  1P1O A;  4RNS A;  4F2Q A;  2UYE A;  3V89 B;  3QMF A;  1OVT A;  5I58 A;  3VLV A;  4BDN A;  1I69 A;  4LAT A;  3E79 A;  2B3B A;  4IY5 A;  3LSX A;  3TTN A;  1FTL A;  3KOS A;  3CSB A;  3KJ7 A;  3SEV A;  4N6P A;  3FXQ A;  1NUY A;  1OQG A;  1OLA A;  4JWO A;  4MJO A;  2FYI A;  3O2A A;  1B5H A;  1YCJ A;  5F1Q A;  2XXV A;  1MY0 A;  3GBA A;  1LCF A;  4O3A A;  2DQV A;  4AB6 A;  1NUX A;  1LBV A;  1D9Q A;  5TP9 B;  3RTW B;  2AL4 A;  3MVW A;  1NV4 A;  5ET7 A;  1DTG A;  1YAE A;  2V3U A;  5HBC A;  3B8B A;  4BLA A;  1NV3 A;  2XXW A;  1BKA A;  4P56 A;  1P1U A;  5I58 B;  4GL0 A;  3L6H A;  2ALU A;  2QPQ A;  1H45 A;  5A5X A;  3KSX A;  4FAJ A;  3B6W A;  1ZIU A;  5FHN A;  3N6U A;  1IXG A;  3KC0 A;  2NOO A;  5IZZ A;  4RPN A;  1RKM A;  4NF5 A;  1MDP 1;  4N15 A;  3CR9 A;  4QSE A;  5CC2 A;  4NF4 A;  4KD5 A;  3BBR A;  3PUZ E;  3H06 B;  1XT8 A;  2QVV A;  5KZT A;  4N13 A;  4DXC A;  4PF8 A;  5CMK A;  1INP A;  5IZ1 A;  4PDH A;  5DEX A;  3H6V A;  1NH8 A;  4BDM A;  1Y3N A;  4MIJ A;  1F9B A;  5H8F A;  1YXI A;  2XXI A;  3TMG A;  4OWD A;  5IM2 A;  1SW2 A;  2VOZ A;  3C35 A;  3MC2 A;  3MBP A;  4OFJ A;  5AA3 A;  4F22 A;  4ZED A;  3ISP A;  4DCX A;  2ONR A;  3H3G A;  3T1B A;  5ET5 A;  5FHM A;  4OZ9 A;  3N5L A;  5EHM A;  5I59 A;  3IR1 A;  4ZEB A;  5CMC A;  3PU5 A;  1M5C A;  2OJT A;  2I0B A;  2UVG A;  2E0S A;  3KC1 A;  4TQU Q;  3JZJ A;  2I4B A;  4IGR A;  3K6U A;  3PPN A;  4I8C A;  4NF4 B;  2YLN A;  3TTR A;  4H1X A;  3VFJ A;  1N7X A;  2ZZW A;  1AOV A;  1WDN A;  1B6H A;  5DEX B;  3IK6 B;  2FA7 A;  1RYX A;  3U93 A;  5H8F B;  4F39 A;  3SER A;  2QRY A;  3HV1 A;  3MP8 A;  3EHT A;  5CRY A;  1PBQ A;  4RJZ A;  3GYY A;  2O7U A;  5AE4 A;  3LSF B;  1MQJ A;  3FIR A;  3O28 A;  4MCO A;  3TCF A;  3TCG A;  1Y4T A;  1DK4 A;  4R73 A;  2UYF A;  3JYR A;  3IB0 A;  3K4U A;  3O6H A;  5I59 B;  4ESX A;  3QIM A;  3RY3 A;  4QF9 A;  3S2V A;  1MXY A;  3HHG A;  4P1E A;  3RQT A;  1MQH A;  5ITP A;  2V3T A;  3DLN A;  1XS5 A;  2UVI A;  1QJM A;  1YPN A;  1MXW A;  2ZXT A;  3MZB A;  2X7Q A;  4OYV A;  2PMS A;  4NF8 B;  1XHY A;  4NE4 A;  3AXF A;  2O1M A;  1URS A;  4IO7 A;  3NOH A;  2LAO A;  4OVP A;  1LGB C;  4LZ8 A;  4OER A;  5EQ9 A;  2ANJ A;  1Y1Z A;  4L17 A;  3S9E A;  3S9M C;  5IZ3 B;  5BUU A;  1Y20 A;  1MS7 A;  4WXJ A;  4F1U A;  2QVR A;  3T9U A;  4GF8 A;  1QUK A;  1JW5 A;  4F3S A;  2I48 A;  5DW8 A;  1RDZ A;  4QFP A;  4TOZ A;  2DWI A;  5KCJ A;  3V8X B;  3MP1 A;  4GX6 A;  4H45 A;  3A3C A;  4Q30 B;  4KQP A;  1J1N A;  1IIW A;  1SBP A;  1JW1 A;  4NG7 A;  1RDX A;  2DVZ A;  2UVH A;  1LB9 A;  4LN5 A;  4YB7 A;  4R2B A;  3ILU B;  4MH5 A;  1IUD A;  2VD3 A;  3TUS A;  1FPK A;  3FVN A;  2FIX A;  2QMW A;  4EUO A;  4FBP A;  1XC1 A;  3C36 A;  2VP1 A;  3R6U A;  2VPO A;  3CG3 A;  4DXU A;  1FQF A;  4H8I A;  4OVR A;  1MH4 A;  1YYZ A;  1B32 A;  2XHD A;  4EF2 A;  1NKX A;  4RA1 A;  4N07 A;  5ET8 A;  4PP0 A;  1MH3 A;  4OFO A;  3HFU A;  1R9Q A;  2CZK A;  3LSL A;  3VE1 B;  4GXA A;  1NV1 A;  3C34 A;  2YPN A;  4YB5 A;  1FTA A;  2F6G A;  4U4S A;  2FVZ A;  4GOT A;  1IMD A;  4WEP A;  3VLU A;  3FZV A;  1LB8 A;  3CFX A;  4FAT A;  1NL5 A;  2V3Q A;  1US5 A;  3QAX A;  1IZ1 A;  1ZBM A;  4P47 A;  4ZEF A;  4PGN A;  3FV2 A;  2HAU A;  4GX4 A;  3DEL B;  3RGY A;  4TLL B;  5J16 A;  3THI A;  2PCR A;  3DM0 A;  1SD3 A;  1RYO A;  4KI0 E;  1KWH A;  4R6K A;  4I62 A;  5JEI A;  2F97 A;  1B51 A;  4MAG A;  3KG2 A;  3VVD A;  3SDF A;  3TQL A;  4NF6 A;  4PFT A;  1B9J A;  4EXL A;  1GTK A;  3MPK A;  2ZYK A;  3USD A;  3O97 A;  4IO5 A;  2OCU A;  3RT8 A;  2PBW A;  1O7T A;  4G68 A;  3C33 A;  4LQ2 A;  1B3F A;  4R74 A;  4GX3 A;  5CBR A;  2F7A A;  2F6P A;  4P1L A;  1LBY A;  5L9S A;  1NUW A;  2GRV A;  3FJ7 A;  1JVX A;  2ZMB A;  3RNN A;  3T93 B;  4PET A;  1T0K A;  4N81 A;  5CI5 A;  2ZYN A;  3SKP A;  2Y5L A;  4PCD A;  3K00 A;  3VVE A;  5H8H B;  2D5W A;  5I3S A;  4MNC A;  3LV0 A;  2O6A A;  3UN6 A;  5IGA A;  1LBB A;  4NF6 B;  5EQ7 A;  1Q9D A;  1N7W A;  3EKI A;  1PB9 A;  1FJ9 A;  5EQ8 A;  1US4 A;  4ONY A;  4G77 A;  4G68 B;  2WX9 A;  1FQC A;  4F31 B;  3IOV A;  2FHY A;  4OEV A;  3K1M A;  2A5S A;  4I3Y A;  1FW0 A;  1UIV A;  4FIM A;  4LA9 A;  4KFQ A;  2NXO A;  4P8B A;  1N76 A;  4AB5 A;  4LZ7 A;  2I3W A;  5DVJ A;  4BDO A;  3IO4 A;  4XKQ A;  5JK4 A;  2XXH A;  3FVK A;  2HFB A;  5T3J A;  3C32 A;  3IFA A;  2Z8E A;  5DVI A;  3U72 A;  3SEW A;  1ZJL A;  4G2Z A;  1FTK A;  3TFL A;  4X1D A;  1M5F A;  3H03 A;  2DE4 A;  2QL3 A;  3I5O A;  4DE8 A;  1B5J A;  4PFB A;  4M4G A;  1LBX A;  3D4G A;  1LAF E;  4LON B;  3KJT A;  4H5G A;  4KPT A;  3IB1 A;  2HXR A;  2HZK A;  1MRP A;  3VV5 A;  3W9W A;  3BIH A;  4IO4 A;  3PGF A;  4UA8 A;  4ZZE A;  5K2X A;  1NV0 A;  4E0W A;  2Y5K A;  1SPI A;  5LOM A;  4LUB A;  2F34 A;  3LC8 A;  4O3B A;  1LCT A;  1MQG A;  3CI8 A; 
#chains in the Genus database with same CATH homology
 3PV0 E;  3D4C A;  1POT A;  2H5Y A;  5JTY B;  4UAC A;  1Y3P A;  1HSE A;  3E3K A;  4H5F A;  1GR2 A;  3CFZ A;  4R6Y A;  4H65 A;  1O63 A;  5KDT A;  4U21 A;  1HSL A;  1P1W A;  1DMB A;  3FAS A;  1WOD A;  4POW A;  3RPW A;  5HM4 B;  3CVG A;  3KOT A;  4R2F A;  4OFL A;  2OBG A;  3VDF A;  4DCY A;  1ATG A;  1I6Q A;  4XIG Q;  2DWJ A;  3G3G A;  1MXV A;  2HXW A;  1IIT A;  2OWS A;  3OO9 A;  3OEM A;  4IO6 A;  3T66 A;  3M8U A;  3EHU A;  1WVJ A;  1Z7N E;  3M3F A;  5KDT B;  1P99 A;  3EHS A;  3TOD A;  1MXX A;  2DXR A;  4OVJ A;  2P1S A;  4ZE8 A;  3OO6 A;  3PUX E;  3V5A A;  4F2O A;  1D3K A;  4THI A;  4U22 A;  3KBR A;  4YKI A;  1DTZ A;  3EN3 A;  1Y4C A;  4G8N A;  1B3G A;  2Y7R A;  4IO3 A;  3ZSF A;  4RY1 A;  3OO8 A;  1XVY A;  4G8H A;  3HST A;  4LP2 B;  1USY E;  4YKK A;  1ZMG A;  4KHZ E;  1EZP A;  4GVO A;  2O84 X;  1MPB A;  2F78 A;  5I84 A;  3G7W A;  4JWX A;  1PC3 A;  3Q26 A;  3OOA A;  1MM7 A;  4U4X A;  1FCK A;  1B1H A;  4U23 A;  2I4C A;  1QW0 A;  3SET A;  1FQD A;  1QUI A;  3U94 A;  2DVC A;  4X48 A;  1UQW A;  2DE3 A;  3RLF E;  1ZU0 A;  1MQD A;  1GGG A;  4YMB A;  2ZYO A;  3C4M A;  4GL8 A;  4X1B A;  3S9N C;  1NNP A;  3EF7 A;  4NF8 A;  5ISU A;  3T22 A;  3KGC A;  3TTM A;  2V93 A;  2DWH A;  3T9H B;  1B2H A;  1M5B A;  2QS3 A;  4XXU A;  3N94 A;  4MLQ A;  3TZA A;  1VR5 A;  1A54 A;  1NNF A;  1JEV A;  2Y7I A;  1R9L A;  1FTJ A;  5TPA A;  3B7D A;  4QHQ A;  3U92 A;  3M3L A;  2XXQ A;  2D3I A;  3IOU A;  2IA4 A;  2HQ0 A;  5AA4 A;  4ELQ A;  3TDJ A;  1N3X A;  5FTH A;  1NNK A;  3IL1 B;  3I6V A;  3IX1 A;  4U1Z A;  3G3F A;  3LUY A;  2DS9 A;  4QFK A;  3G3H A;  4YAH X;  4ELO A;  2F5X A;  4EXK A;  4ND9 A;  4I1D A;  2OLB A;  1FQE A;  2HZL A;  4NWD A;  3KZG A;  1FQB A;  1R1N A;  5ICQ A;  1II5 A;  2CMO A;  2R71 A;  4GFR A;  5I56 A;  2AL5 A;  1Z7M E;  4OHN A;  1N84 A;  4FJP A;  5CBS A;  5I2N A;  3E9X A;  5TPA B;  1TWY A;  4JDF A;  4Z7E A;  3O29 A;  1BTJ A;  4KR5 A;  1P1N A;  5ELV A;  3UP9 A;  3FJG A;  1QUL A;  2I58 A;  3TTK A;  2NVU B;  3MPL A;  4U2R A;  1IXH A;  1JET A;  2GHB A;  5AA4 B;  2FNC A;  2RC9 A;  4HCW A;  3H6T A;  4XKP A;  4AQ4 A;  1HSJ A;  4Q8R A;  2Z23 A;  3TQW A;  1A99 A;  5AA2 A;  4DXB A;  3S9L C;  4Z0I A;  1MXU A;  3P7I A;  1Q1K A;  1XVX A;  5I56 B;  2Y7P A;  3B6T A;  4F3P A;  5I2N B;  2G29 A;  4R9F A;  3KN7 A;  1N04 A;  4LQ5 A;  2Q8J A;  4EQB A;  1MY3 A;  1MDQ A;  5IKB A;  2P0S A;  4GRK A;  3H4Z A;  4XTC Q;  1LAX A;  4BDL A;  2NWJ A;  3FGS A;  2I49 A;  1MPC A;  2H9B A;  2PT2 A;  1AIV A;  4C1T A;  1NMU A;  4QSD A;  5AA2 B;  3PPR A;  2XXP A;  3OXN A;  1P1Q A;  1UTB A;  4GD5 A;  2F7C A;  3UOR A;  4YMA A;  1B3E A;  3MP6 A;  4MLV A;  5H8H A;  4QFO A;  3W9V A;  3K02 A;  4KCD A;  5DVF A;  2Q2A A;  4ZEK A;  3S4U A;  4PE5 B;  3T9V A;  1B46 A;  3LSW A;  4XKR A;  3TYH A;  2GH9 A;  3DP8 A;  3CIJ A;  2PX1 A;  5DTB A;  2V25 A;  3QSL A;  3GLB A;  3B6Q A;  2DE2 A;  2QSX A;  2F36 A;  3KFM A;  2IEE A;  2F8D A;  1Y3Q A;  1IEJ A;  3WAF A;  3C9H A;  1UTB B;  2Z8D A;  1B0L A;  4QFN A;  3E13 X;  1B7U A;  2Z8F A;  4JWY A;  1O64 A;  3K2D A;  2QS2 A;  3L6G A;  1D4N A;  1SW4 A;  4RK9 A;  4YU0 A;  3HCQ A;  4JBZ A;  1UIU A;  5ICT A;  3PMX A;  5L8D A;  3VXC A;  2DYX A;  1ZLQ A;  4ELP A;  3TPA A;  3N26 A;  2ZNT A;  4X9T A;  4H6D A;  2O51 A;  1JEU A;  2P2A A;  2XXT A;  3MVX A;  1B4Z A;  4FEC A;  3O6I A;  1UTH A;  1QUJ A;  3OD7 A;  2RIN A;  1B0H A;  2DWA A;  3GXA A;  1B4H A;  2OWT A;  1N3W A;  3F11 A;  1DOT A;  3QK6 A;  3RUM A;  4PFW A;  1CB6 A;  5L9O A;  5JTY A;  1LLS A;  3H6U A;  1IXI A;  3SEX A;  3IOW A;  1EH3 A;  4EQ9 A;  3O9P A;  2UXA A;  4ISU A;  3DP4 A;  2O7I A;  4E0X A;  4R6H A;  3H7M A;  2XX9 A;  4ZZA A;  1B7Z A;  5H8S A;  4R75 A;  4P0I A;  3TTL A;  3IJX B;  1UTH B;  4KYS A;  1QVS A;  4OTE A;  4ZDM A;  3K1P A;  3OEN A;  2HCA A;  5B7D A;  1BP5 A;  1MY1 A;  3T96 B;  4IO2 A;  5DT6 A;  1DSN A;  3OO7 A;  3PMW A;  1LAH E;  1TFD A;  4OMB A;  3QYT A;  4YZZ A;  2DXY A;  4LVQ A;  3MZ1 A;  3PPP A;  2DOJ A;  2F7B A;  4F1V A;  1EU8 A;  2D21 A;  3IO6 A;  3TEL A;  1TXF A;  3DP6 A;  3ZKK A;  3SEY A;  4JSO A;  3BKI B;  2O68 A;  3LR1 A;  2X26 A;  3FXU A;  3U1O A;  3MJN A;  3A09 A;  4NTL A;  2Q9T A;  1EZO A;  5I2K A;  1S9T A;  4KYD A;  2X7P A;  2NUV A;  4NED A;  2E1S A;  3UGW A;  3G3I A;  4XKN A;  3OMB A;  3IOT A;  1SYI A;  4O3C A;  3VVF A;  2B3F A;  3SEU A;  1PB8 A;  4OXV A;  1H3D A;  1ANF A;  1BLF A;  5B70 A;  3FV1 A;  4YIC A;  5H8Q A;  3K6X A;  2I0C A;  4M1V A;  1URG A;  1IXC A;  1LFI A;  4R9G A;  1FQA A;  4DDD A;  3VXB A;  3U8Q A;  3H6W A;  2GFE A;  1DPP A;  2A5T B;  2H4I A;  1XOC A;  5I2K B;  1TFA A;  2B65 A;  4I9D A;  4K3F A;  5DYH A;  3KN8 A;  4MFI A;  4FE8 A;  3OEK A;  2VHA A;  3MWB A;  3K1N A;  4YKJ A;  1JQF A;  2R6G E;  4FED A;  2F35 A;  2AIX A;  3ILT B;  1Y9U A;  3RN8 A;  2REJ A;  3FVG A;  4P0G A;  4F19 A;  4F3G A;  2OZZ A;  1H44 A;  5BWJ A;  1ZKB A;  2VD2 A;  4RPO A;  1AL3 A;  3E4R A;  1Q35 A;  5H8Q B;  1PB7 A;  1POY 1;  3HPI A;  4EQ7 A;  3Q27 A;  4LZ5 A;  3GZG A;  2XX8 A;  4ZEC A;  4ZS9 A;  2Q89 A;  3MAM A;  4H67 A;  3KSJ A;  4P11 A;  4MBP A;  2ZNU A;  3VLW A;  5TU0 A;  4HW8 A;  3I3V A;  1QKA A;  2XX7 A;  4BDR A;  2OK2 A;  4GXS B;  2WKY A;  1A8F A;  5AA2 D;  1VFE A;  1GVC A;  1LFH A;  1B1X A;  5CMB A;  5A5X B;  4JSD A;  4ZE9 A;  4ZEI A;  2DSF A;  3K6V A;  5H8N A;  1B05 A;  3MUQ A;  4NF5 B;  1A55 A;  4WKM A;  1A40 A;  3TCH A;  3CG1 A;  3UIF A;  4ELR A;  3PPQ A;  2PVU A;  1SW1 A;  3TAJ A;  3HO7 A;  3N6T A;  1M5D A;  1S7Y A;  4HTG A;  2ABH A;  1Y1M A;  2KLF A;  3PD8 A;  2THI A;  2ZNS A;  2RKM A;  2UVJ A;  2REG A;  1B3H A;  4QSC A;  1OMP A;  2R9J A;  4NWC A;  4PFU A;  1PEB A;  3ONM A;  1OVB A;  4NMY A;  1B7H A;  2Y84 A;  5H8N B;  1OIB A;  3TEP A;  2M8C A;  1USY H;  5J1D A;  1CE2 A;  4Q0C A;  5EYF A;  2RCB A;  3ECR A;  2DP8 A;  3G3J A;  2V84 A;  3Q28 A;  1VE4 A;  5HPQ A;  3RT6 B;  2XXU A;  3WAE A;  3PD9 A;  3FD3 A;  4MF3 A;  3EPE A;  4RYA A;  1SVX B;  5FHO A;  3FAT A;  1NNT A;  1ELJ A;  4ESW A;  1A7L A;  1AMF A;  2I3V A;  1LBC A;  2RF1 A;  3FJM A;  1MM6 A;  3OSQ A;  4H0W A;  2PT1 A;  1S50 A;  2RC8 A;  4QFL A;  3CRB A;  2BJJ X;  4OES A;  4DIG A;  1I6B A;  4JB7 A;  3OSR A;  3R7X A;  2HAV A;  5ITO A;  2YJP A;  3BFT A;  2XD2 A;  3LBS A;  1B5I A;  4GLI A;  2XXY A;  1MY4 A;  3HN0 A;  1SI1 A;  3BFU A;  4F3B A;  2Y7W A;  2ONK E;  3OEL A;  4F18 A;  5KCJ B;  4POX A;  1I6A A;  3KEI A;  1MXZ A;  1PBP A;  2QMX A;  3V83 A;  4HS7 A;  4KCC A;  4OEN A;  2W7Y A;  1SI0 A;  3IB2 A;  2ESN A;  5M2V A;  3CFL A;  1N0T A;  2VGQ A;  4IY6 A;  3UA8 A;  3PUY E;  2O69 A;  1OQH A;  4YB6 A;  2Y7K A;  5CM6 A;  3M3K A;  4JXI A;  3IAZ A;  4DZ1 A;  4F1Y A;  1EZ9 A;  3PPO A;  4EF1 A;  3W15 C;  1SDX A;  5IAI A;  4GWO A;  3EQ1 A;  4OEU A;  4PQJ A;  4F29 A;  3C31 A;  1B3L A;  1ZTY A;  2XXX A;  4FOR A;  4RK2 A;  4WED A;  1SQY A;  4PFY A;  4EDP A;  5I57 A;  2RC7 A;  1NFT A;  4C0R A;  3MVY A;  5EHS A;  4H8J A;  1IQ7 A;  1B40 A;  4BDQ A;  3SES A;  3O6G A;  1FTM A;  2AYS A;  4Q5T A;  1MQI A;  4GQO A;  3MW0 A;  2O1L A;  1PDA A;  2RCA A;  2QJE A;  4RXL A;  1D9Y A;  1M5E A;  4TLM B;  1LFG A;  2H98 A;  4C1U A;  1JNF A;  3RTF B;  5AA1 A;  3ZKL A;  5CMM A;  1D9V A;  2PYY A;  3ODB A;  4QRZ A;  1L5T A;  3R26 A;  3KN3 A;  5I57 B;  3G3K A;  4IGT A;  2Z22 A;  1R6Z A;  3Q25 A;  3QXM A;  3QUF A;  1B52 A;  2CZL A;  2I6E A;  1B58 A;  1A8E A;  1SW5 A;  2GHA A;  3FXR A;  2QS1 A;  3MVZ A;  3CSG A;  1LAG E;  4KYE A;  1URD A;  4U1O A;  3GBB A;  3Q29 A;  3TKD A;  1H43 A;  4HCY A;  2ZYM A;  4OET A;  1VFD A;  3PUV E;  2QS4 A;  4R72 A;  1LST A;  4YKP A;  3K01 A;  2Q88 A;  4G8M A;  1NH7 A;  1MY2 A;  4IB2 A;  1MG1 A;  1VSO A;  3MQ9 A;  3T9X B;  3QUJ A;  3IJO B;  1BIY A;  4FEB A;  1SYH A;  3K0V A;  2XXR A;  1GV8 A;  2H99 A;  3IOR A;  1FTO A;  5K2Y A;  1YTV A;  3JV9 A;  5L9M A;  3A3U A;  1TT1 A;  2G93 A;  1AH5 A;  1MPD A;  1OLC A;  2Q2C A;  4G4P A;  2ONS A;  4DLD A;  3FVO A;  4ECF A;  2XD3 A;  1DPE A;  1QKB A;  5FTI A;  3UK4 A;  1H76 A;  3PMV A;  3HHF A;  3O66 A;  4G68 C;  3K6W A;  3ZS6 A;  1JVY A;  3MZ9 A;  4GIZ A;  1JW4 A;  2A5T A;  2H25 A;  2HEU A;  3FUZ A;  4OQO A;  5TP9 A;  3PUW E;  5F7V A;  1P1O A;  4RNS A;  4F2Q A;  2UYE A;  3V89 B;  1OVT A;  5I58 A;  3VLV A;  4BDN A;  1I69 A;  4LAT A;  2B3B A;  4IY5 A;  3LSX A;  3TTN A;  1FTL A;  3KOS A;  3CSB A;  3KJ7 A;  3SEV A;  4N6P A;  3FXQ A;  1OQG A;  1OLA A;  4JWO A;  2FYI A;  3O2A A;  1B5H A;  1YCJ A;  5F1Q A;  2XXV A;  1MY0 A;  3GBA A;  1LCF A;  4O3A A;  2DQV A;  4AB6 A;  5TP9 B;  3RTW B;  2AL4 A;  3MVW A;  1DTG A;  1YAE A;  2V3U A;  5HBC A;  4BLA A;  2XXW A;  1BKA A;  1P1U A;  5I58 B;  4GL0 A;  3L6H A;  2ALU A;  2QPQ A;  1H45 A;  5A5X A;  3KSX A;  4FAJ A;  3B6W A;  1ZIU A;  5FHN A;  3N6U A;  1IXG A;  2NOO A;  4RPN A;  1RKM A;  4NF5 A;  1MDP 1;  3CR9 A;  4QSE A;  5CC2 A;  4NF4 A;  4KD5 A;  3BBR A;  3PUZ E;  3H06 B;  1XT8 A;  5KZT A;  4N13 A;  4DXC A;  5CMK A;  5DEX A;  3H6V A;  1NH8 A;  4BDM A;  1Y3N A;  1F9B A;  5H8F A;  2XXI A;  3TMG A;  4OWD A;  1SW2 A;  2VOZ A;  3C35 A;  3MC2 A;  3MBP A;  4OFJ A;  5AA3 A;  4F22 A;  4ZED A;  4DCX A;  2ONR A;  3H3G A;  5FHM A;  4OZ9 A;  3N5L A;  5EHM A;  5I59 A;  3IR1 A;  4ZEB A;  5CMC A;  3PU5 A;  1M5C A;  2OJT A;  2I0B A;  2UVG A;  2E0S A;  4TQU Q;  3JZJ A;  2I4B A;  4IGR A;  3K6U A;  3PPN A;  4I8C A;  4NF4 B;  2YLN A;  3TTR A;  4H1X A;  3VFJ A;  1N7X A;  1AOV A;  1WDN A;  1B6H A;  5DEX B;  3IK6 B;  2FA7 A;  1RYX A;  3U93 A;  5H8F B;  4F39 A;  3SER A;  2QRY A;  3HV1 A;  3MP8 A;  3EHT A;  5CRY A;  1PBQ A;  4RJZ A;  2O7U A;  5AE4 A;  3LSF B;  1MQJ A;  3FIR A;  3O28 A;  3TCF A;  3TCG A;  1Y4T A;  4R73 A;  2UYF A;  3JYR A;  3IB0 A;  3K4U A;  3O6H A;  5I59 B;  4ESX A;  3QIM A;  3RY3 A;  4QF9 A;  3S2V A;  1MXY A;  3HHG A;  3RQT A;  1MQH A;  5ITP A;  2V3T A;  3DLN A;  1XS5 A;  2UVI A;  1QJM A;  1YPN A;  1MXW A;  2ZXT A;  3MZB A;  2X7Q A;  4OYV A;  2PMS A;  4NF8 B;  1XHY A;  4NE4 A;  3AXF A;  2O1M A;  1URS A;  4IO7 A;  2LAO A;  1LGB C;  4LZ8 A;  4OER A;  2ANJ A;  1Y1Z A;  4L17 A;  3S9E A;  3S9M C;  5BUU A;  1Y20 A;  1MS7 A;  4WXJ A;  4F1U A;  3T9U A;  4GF8 A;  1QUK A;  1JW5 A;  4F3S A;  2I48 A;  4QFP A;  4TOZ A;  2DWI A;  5KCJ A;  3V8X B;  3MP1 A;  3A3C A;  4Q30 B;  4KQP A;  1J1N A;  1IIW A;  1SBP A;  1JW1 A;  2DVZ A;  2UVH A;  1LB9 A;  4YB7 A;  4R2B A;  3ILU B;  4MH5 A;  1IUD A;  2VD3 A;  3TUS A;  3FVN A;  2QMW A;  4EUO A;  1XC1 A;  3C36 A;  2VP1 A;  3R6U A;  3CG3 A;  4DXU A;  1FQF A;  4H8I A;  1MH4 A;  1B32 A;  2XHD A;  4EF2 A;  1NKX A;  4RA1 A;  4N07 A;  4PP0 A;  1MH3 A;  4OFO A;  1R9Q A;  3LSL A;  3VE1 B;  4GXA A;  3C34 A;  2YPN A;  4YB5 A;  2F6G A;  4U4S A;  4GOT A;  4WEP A;  3VLU A;  3FZV A;  1LB8 A;  3CFX A;  4FAT A;  1NL5 A;  2V3Q A;  1US5 A;  3QAX A;  1IZ1 A;  1ZBM A;  4ZEF A;  3FV2 A;  2HAU A;  3DEL B;  3RGY A;  4TLL B;  3THI A;  3DM0 A;  1SD3 A;  1RYO A;  4KI0 E;  1KWH A;  4R6K A;  4I62 A;  5JEI A;  2F97 A;  1B51 A;  3KG2 A;  3VVD A;  3SDF A;  3TQL A;  4NF6 A;  4PFT A;  1B9J A;  4EXL A;  1GTK A;  3MPK A;  2ZYK A;  3USD A;  3O97 A;  4IO5 A;  2OCU A;  3RT8 A;  2PBW A;  1O7T A;  4G68 A;  3C33 A;  4LQ2 A;  1B3F A;  4R74 A;  5CBR A;  2F7A A;  2F6P A;  5L9S A;  2GRV A;  3FJ7 A;  1JVX A;  2ZMB A;  3RNN A;  3T93 B;  4PET A;  1T0K A;  5CI5 A;  2ZYN A;  3SKP A;  3K00 A;  3VVE A;  5H8H B;  2D5W A;  2O6A A;  3UN6 A;  1LBB A;  4NF6 B;  1N7W A;  1PB9 A;  1US4 A;  4ONY A;  4G77 A;  4G68 B;  1FQC A;  4F31 B;  3IOV A;  4OEV A;  3K1M A;  2A5S A;  1FW0 A;  1UIV A;  4FIM A;  4LA9 A;  4KFQ A;  2NXO A;  1N76 A;  4AB5 A;  4LZ7 A;  2I3W A;  5DVJ A;  4BDO A;  3IO4 A;  4XKQ A;  5JK4 A;  2XXH A;  3FVK A;  2HFB A;  3C32 A;  2Z8E A;  5DVI A;  3U72 A;  3SEW A;  1ZJL A;  4G2Z A;  1FTK A;  3TFL A;  4X1D A;  1M5F A;  3H03 A;  2DE4 A;  2QL3 A;  3I5O A;  4DE8 A;  1B5J A;  4M4G A;  3D4G A;  1LAF E;  4LON B;  3KJT A;  4H5G A;  4KPT A;  3IB1 A;  2HZK A;  1MRP A;  3VV5 A;  3W9W A;  4IO4 A;  3PGF A;  4UA8 A;  4ZZE A;  5K2X A;  4E0W A;  5LOM A;  4LUB A;  2F34 A;  3LC8 A;  4O3B A;  1LCT A;  1MQG A;  3CI8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...