1LSTA

Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
b'ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
publication title Three-dimensional structures of the periplasmic lysine/arginine/ornithine-binding protein with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Amino-acid binding protein
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA02
3A3CA 3CFLA 4ND9A 1RYOA 4MFIA 2NOOA 3Q26A 1VFEA 5M2VA 3WAFA 1A40A 4K3FA 2XXVA 2REJA 5A5XA 3RY3A 3Q28A 2Q2CA 2F36A 1USYH 4ZE9A 2DWAA 3MZ9A 2DS9A 3PPPA 3C36A 2DVCA 3KBRA 2ONKE 3CFZA 4IGTA 2F97A 4LZ8A 3EPEA 3LUYA 5I58A 1ZU0A 1ATGA 2XXPA 3RPWA 2PT1A 1UTBA 1D9YA 3FXUA 3K00A 4JDFA 1B5HA 3GBAA 5EHMA 2ABHA 4OEUA 1LLSA 4NF4B 1UIUA 4HCWA 2LAOA 5H8SA 4U1OA 1O64A 3V89B 2Q89A 5FHNA 4PFTA 3KSJA 5I2KA 3RNNA 3DP6A 4EF2A 1UTHA 3G3KA 3FJGA 3OEMA 1EU8A 1I6QA 1Y3PA 4C0RA 3QK6A 4DCXA 4OEVA 5H8FA 4E0XA 1ZMGA 3O9PA 4I62A 3O6GA 2PVUA 2V3QA 4PFUA 1MQHA 1I6AA 1GR2A 5JTYB 1B7UA 2OBGA 3L6GA 3CSBA 4PE5B 4TQUQ 4THIA 2Z8DA 3R26A 5FHMA 3T66A 3TQLA 4IO2A 3USDA 3Q25A 2Q9TA 4KPTA 3O6HA 2VD3A 4F18A 2ZYNA 3CIJA 4QF9A 4F3GA 3ZKKA 1B7ZA 1SW1A 4YB6A 2XXYA 1B5IA 3OELA 1L5TA 3MUQA 3R6UA 2F8DA 4ISUA 3FV2A 5CMMA 2UXAA 3UK4A 1MDP1 4U23A 4KD5A 3TUSA 1EZ9A 1BKAA 5DTBA 2XD2A 2D3IA 2G93A 4U21A 1FQEA 4QFLA 1P1OA 4XIGQ 1A54A 3PU5A 3FATA 1D9VA 3PUWE 4QFNA 1R6ZA 2QJEA 1DPEA 4EXKA 2KLFA 4YAHX 1RKMA 1Q1KA 3E13X 1S9TA 4FECA 1BIYA 4R72A 1N84A 2RCBA 3KOSA 3SESA 1SI1A 1IXGA 1QUJA 4G8HA 2VHAA 2VOZA 3N5LA 5CMKA 4KYDA 3K01A 3FUZA 5H8QA 4EDPA 3U1OA 4LA9A 2PX1A 1JNFA 3KJTA 1LAXA 3LBSA 1IXCA 5KDTA 2H5YA 3U93A 5TU0A 3RGYA 3F11A 3CG1A 3TELA 1HSEA 3GLBA 1H45A 3IB2A 1A99A 5IKBA 2XXIA 3PD9A 2XXRA 3QIMA 4IY6A 1MH3A 3IO6A 1PBPA 1H3DA 2QS4A 2ALUA 2V3UA 2I6EA 4YKPA 4G68A 5LOMA 3E4RA 3FZVA 5I56B 4EQ7A 1Y3NA 3T93B 2RCAA 1Y9UA 2Y7IA 3G3FA 4G68C 1LFHA 3VLUA 3V83A 2I48A 2O7IA 5ICTA 5AA4B 1N3WA 4M4GA 2Z8EA 2R9JA 3OEKA 1SYIA 3PV0E 3MBPA 2B65A 3VVEA 3PPOA 1DOTA 3VE1B 1LBCA 2P0SA 5I59B 1FCKA 4OWDA 4QFOA 1B1HA 2XXWA 4QHQA 1NH7A 1ZKBA 3OO8A 2PT2A 4LQ5A 3Q27A 1IEJA 3L6HA 4F3BA 1NKXA 3HN0A 1N7WA 4OTEA 3O66A 3EF7A 4NF5A 2Y7KA 4R2BA 1JEVA 1B2HA 1LB8A 2H9BA 1II5A 3MJNA 3PUVE 4F2OA 4POXA 3MP6A 2O1LA 3OO6A 2QRYA 4RNSA 4FEBA 4FATA 1OMPA 4UA8A 4NF6A 1WODA 2V93A 3VVFA 3MVZA 4F3PA 4YZZA 1QVSA 3PMVA 1B6HA 4TLMB 3T96B 3S2VA 1JW4A 3V8XB 5H8NA 1FTMA 3TTRA 1OVBA 4OERA 3SDFA 3D4CA 4GXAA 3RQTA 4EXLA 1LAGE 4NF8A 2F7AA 1PC3A 1ZLQA 3KOTA 3LSWA 4N07A 1JW5A 2VD2A 1VFDA 2QSXA 2XX8A 1P1QA 4FJPA 2NWJA 2DE4A 1CB6A 1SVXB 1M5FA 3I3VA 4MLQA 5ISUA 3IB1A 4JWYA 4IB2A 3K0VA 2Q2AA 3E3KA 3CRBA 3QXMA 1B7HA 1S50A 1M5EA 1P1UA 4GIZA 4BDRA 1MY3A 1JVYA 4IO7A 4U4SA 5FHOA 1OLAA 3MPKA 3FVKA 2DE3A 1KWHA 3MAMA 3CI8A 2H98A 1QW0A 3I6VA 3W9VA 1OVTA 1B9JA 4BDNA 1AMFA 2O69A 4ELQA 1JQFA 2I3WA 2XXHA 4EQ9A 1TXFA 1R1NA 3C4MA 2ZYMA 4MH5A 4H8IA 3MC2A 5K2XA 2G29A 3TTKA 2UVHA 2A5TB 4P11A 1OLCA 2HAUA 4RYAA 3H6WA 1PB7A 1MXVA 2ZNSA 4GOTA 1A7LA 4FIMA 3AXFA 5FTHA 1MY1A 1P1NA 3CFXA 3SEWA 1TWYA 1T0KA 3OMBA 4NWDA 3K6XA 1NFTA 3LC8A 4M1VA 1A55A 5KCJB 1VSOA 1MXZA 4GWOA 3IO4A 4QSEA 3K1MA 3HCQA 4NWCA 3VLWA 3LR1A 1MPBA 4OFJA 1FQAA 3TODA 3H6UA 3ODBA 1PB9A 4NF4A 3G3GA 3MPLA 3JV9A 3OO7A 4X1BA 4IGRA 4BDMA 1LB9A 3VVDA 4LATA 4ESXA 3C33A 4PETA 4OFLA 3R7XA 3KN7A 3PUZE 3DP4A 5DYHA 4C1UA 2DOJA 2P2AA 5CRYA 3SEYA 1YTVA 4XTCQ 1FW0A 2OK2A 4YB5A 4QSDA 1BTJA 4Z7EA 1JVXA 2XX9A 3RT6B 2H99A 1IXIA 3O29A 1NNKA 4HS7A 2REGA 3TCHA 4QRZA 3VLVA 3JZJA 2F5XA 5JTYA 5ITOA 3KN8A 4F22A 3OSQA 5I2NB 4R2FA 4XKQA 4ELRA 1BLFA 1Z7NE 2XXUA 1JEUA 1IXHA 5BWJA 3H3GA 3HSTA 3H4ZA 2NVUB 2F34A 2M8CA 3OD7A 3RTFB 1MM7A 3H6VA 3EN3A 1FTKA 2NXOA 3M3LA 3P7IA 3TFLA 4I8CA 1XOCA 3RTWB 1M5CA 1SI0A 4ELPA 5B7DA 2HCAA 4GL8A 2DP8A 3H03A 1MM6A 1SQYA 2YLNA 1US4A 2VP1A 1ZBMA 2UVIA 5CBRA 1Y3QA 2PYYA 1N7XA 1QUKA 4OFOA 3K1NA 1XVXA 3BFUA 1WVJA 4NTLA 4YU0A 5CC2A 1B3FA 3OOAA 4I9DA 2Q88A 4JXIA 4Q8RA 4DCYA 4IY5A 2NUVA 3DM0A 4DZ1A 4H0WA 4WEPA 4GFRA 4PFYA 5H8HA 5L9MA 3HO7A 3RLFE 1LAHE 1JETA 3M3KA 3PGFA 1SW4A 3OSRA 1HSJA 5CBSA 1MY4A 3GBBA 1FQFA 1NNTA 1ZTYA 3DP8A 4LVQA 4Q5TA 5CM6A 3TKDA 5TPAB 1CE2A 3KJ7A 4F1UA 4PFWA 1MDQA 4RPOA 5AA2B 4LZ7A 5HM4B 1I69A 4OQOA 3LSXA 1UIVA 3O28A 3H06B 3N94A 4OXVA 2Y7WA 3M8UA 3TCGA 4ZZEA 3IL1B 2I4CA 1YPNA 1LSTA 3ILUB 3IK6B 2O1MA 2F35A 2UVGA 4DXCA 4F2QA 3RUMA 4GQOA 3TPAA 4OESA 3VXCA 3UGWA 4H65A 4RA1A 5AA2D 4Q30B 3KN3A 3TZAA 1MG1A 1M5DA 5ICQA 4KYEA 3KSXA 1LCFA 3FV1A 1AOVA 2UYEA 4HCYA 4XKPA 1GVCA 5FTIA 3PUYE 3IB0A 3TQWA 1Y20A 3ILTB 1DSNA 1MQDA 1TFAA 2FYIA 1SYHA 2ONSA 4NMYA 4YB7A 1J1NA 3MVWA 2P1SA 4AB5A 3S9NC 3KZGA 2X26A 1US5A 4R6KA 4G8NA 4H1XA 5EYFA 4Z0IA 1XVYA 1XS5A 1IITA 2W7YA 4F31B 2AYSA 2HQ0A 2OWTA 2ONRA 1TFDA 5I59A 1MQGA 1OQHA 4F1VA 5DEXB 2F7BA 3GZGA 4PP0A 3T9XB 2GHAA 1VR5A 4YMAA 4NE4A 3FVGA 1XT8A 4ZS9A 1B4HA 2O6AA 1QUIA 4IO6A 2DXRA 2I0BA 3K2DA 3TCFA 3CVGA 2V3TA 4JSOA 3FIRA 2PMSA 2DXYA 1Q35A 4X9TA 5TP9A 2QMWA 4DLDA 1NNPA 3EHTA 3K6VA 1NL5A 2OWSA 4GL0A 3U8QA 4ZZAA 2O84X 3BBRA 5I57B 4JB7A 1LGBC 4ELOA 4G8MA 2HEUA 5J1DA 4N6PA 1S7YA 1Y4CA 1WDNA 2XHDA 2GH9A 4YICA 1B3GA 3OENA 1PBQA 4R75A 3H7MA 2UVJA 1P99A 3ZSFA 2F6GA 4OENA 3Q29A 4YKKA 4O3AA 3UIFA 2XX7A 3BFTA 3FD3A 3PPRA 2WKYA 3QSLA 1Z7ME 4KI0E 4H5FA 1XHYA 2I58A 2QS1A 5AA1A 3UA8A 2H25A 3LSFB 3M3FA 4ESWA 2Z23A 1FTJA 2ESNA 1R9QA 4RK9A 4H6DA 3WAEA 3FVNA 4DXBA 1N76A 4LQ2A 1IZ1A 3B6TA 2DSFA 4QFKA 4HTGA 1F9BA 2QMXA 3FGSA 2E1SA 3TAJA 1H43A 1LCTA 1BP5A 3MVXA 4R9GA 3PMXA 1ELJA 3DLNA 3IOUA 4ZEBA 4LONB 3PPQA 3C35A 1I6BA 3B6WA 2HZLA 1B46A 3IJOB 1AIVA 4F19A 3S9LC 3T9HB 3EQ1A 3MQ9A 4UACA 5AE4A 3PPNA 4R9FA 5DVIA 3IR1A 4HW8A 2Y84A 2A5TA 2R6GE 2DYXA 1MPDA 2YPNA 3K6UA 5DVFA 1ZIUA 3UN6A 2HZKA 4R6YA 1ZJLA 3PUXE 4PQJA 4RXLA 4IO5A 4FORA 3QAXA 1GGGA 2GHBA 2I49A 4LUBA 2UYFA 2B3BA 1MPCA 5KCJA 4RJZA 3FVOA 3TMGA 1EH3A 4POWA 4RY1A 5A5XB 4OETA 4OHNA 3DELB 1O63A 2O68A 4U22A 2QPQA 4KYSA 4ONYA 2THIA 4LZ5A 1MXUA 2X7QA 2FNCA 3C32A 4C1TA 4U2RA 1XC1A 1MS7A 2Y7PA 4L17A 3C9HA 1H76A 2DWIA 3HHGA 4JSDA 4ECFA 5I58B 1SBPA 2DE2A 1NNFA 1B3LA 3TYHA 1B05A 2F7CA 1UTBB 1GTKA 2XXXA 4JWXA 2AIXA 4I1DA 2ZNTA 3IOVA 2RC9A 2E0SA 4WEDA 2AL5A 3B6QA 4KR5A 3W15C 5CMBA 3O97A 2RKMA 3G7WA 1URGA 1Y1MA 4ZEKA 5K2YA 3T9VA 1OIBA 1HSLA 5L9SA 3A3UA 2RINA 5I2KB 4BDLA 4QSCA 3FJMA 3PD8A 4EQBA 1UTHB 3FXRA 3SETA 1M5BA 1P1WA 3PMWA 5I2NA 3THIA 4U1ZA 4P0GA 1URSA 3HV1A 4R73A 5H8FB 2IA4A 1AL3A 3MW0A 4XXUA 3IORA 3FXQA 3K1PA 4QFPA 3IX1A 2O7UA 4RK2A 2V25A 2DVZA 4TOZA 3VXBA 3I5OA 2GFEA 2QS2A 1ANFA 1OQGA 3K6WA 3SEXA 3H6TA 2ZMBA 1EZPA 1N3XA 3RT8A 3N6TA 1MRPA 1USYE 1YCJA 1MXYA 3O6IA 2YJPA 2IEEA 5KZTA 3U72A 4FEDA 1TT1A 3G3HA 4F29A 4O3CA 4GLIA 3S4UA 3IAZA 2CZLA 3CG3A 2D5WA 3E9XA 3OXNA 2D21A 1B40A 5HPQA 4ZEFA 2ANJA 4ZDMA 1B58A 4E0WA 1FQBA 4WKMA 4AB6A 3TTNA 3S9EA 1FTOA 3EHUA 5CMCA 1B1XA 2DQVA 1QJMA 1FTLA 3TTMA 2RC7A 4XKRA 4H8JA 4H5GA 4EF1A 3HHFA 1A8EA 3W9WA 2Q8JA 3MZBA 5L8DA 1NH8A 1Y4TA 4WXJA 2Y7RA 5ITPA 4YKIA 4R6HA 2ZNUA 2OLBA 5DVJA 2VGQA 3UORA 5TPAA 1IQ7A 2DWHA 4DXUA 5B70A 3T9UA 2I3VA 5AA2A 3N6UA 4TLLB 4O3BA 5H8HB 4GXSB 1PEBA 1PDAA 1Y1ZA 1LFIA 3QUJA 2I0CA 4DDDA 1VE4A 3ZKLA 1B3EA 5H8QB 5JK4A 3C31A 2Z22A 1B52A 2XD3A 3TTLA 4FAJA 4YMBA 1B32A 3MP8A 5KDTB 1QKAA 1N04A 1DTGA 1RYXA 5F7VA 5I56A 1H44A 4BDQA 1URDA 2X7PA 3ECRA 4XKNA 2HXWA 4U4XA 2QS3A 3FJ7A 4KHZE 4BDOA 1SD3A 4DE8A 5AA4A 3IOWA 1B5JA 2R71A 1B0HA 3HPIA 3CR9A 1B3HA 5F1QA 3V5AA 3MZ1A 3C34A 4OYVA 4JWOA 3B7DA 4G68B 3ONMA 1DPPA 5EHSA 4F39A 5ELVA 2ZYKA 1EZOA 2ZYOA 3IOTA 2ZXTA 1MY0A 1D3KA 4OZ9A 5L9OA 2B3FA 2H4IA 3SERA 2BJJX 3TEPA 3LSLA 1DMBA 4NEDA 3S9MC 2F6PA 1A8FA 5DEXA 1LBBA 1GV8A 4ZEIA 3JYRA 3BKIB 4F1YA 3SEUA 3T22A 2OJTA 3SEVA 5JEIA 4KCDA 2OZZA 3G3IA 3MP1A 1MQJA 4KQPA 4G4PA 2XXQA 1MXWA 3K4UA 3G3JA 2RC8A 2HAVA 1MQIA 5AA3A 3OO9A 2PBWA 2XXTA 1O7TA 4GVOA 1QKBA 4JBZA 4RPNA 1SW5A 1JW1A 3VV5A 1R9LA 3VFJA 3KGCA 4N13A 4R74A 5IAIA 3QYTA 3GXAA 3CSGA 2CMOA 5I57A 3A09A 3MVYA 4IO4A 1B4ZA 4P0IA 4LP2B 1N0TA 3ZS6A 5BUUA 1LFGA 4GRKA 1D4NA 4OMBA 5TP9B 4X48A 1NMUA 1FQCA 1MY2A 3QUFA 4NF5B 4DIGA 2I4BA 1UQWA 1POY1 2GRVA 4X1DA 1PB8A 4G2ZA 3KFMA 4GF8A 3D4GA 2QL3A 2OCUA 2RF1A 4MF3A 1IIWA 3IJXB 4NF6B 4BLAA 3VDFA 4FE8A 5I84A 2A5SA 3KEIA 5H8NB 1SDXA 3RN8A 1IUDA 1YAEA 4ZE8A 4YKJA 2AL4A 4GD5A 1AH5A 4ZECA 4H67A 4NF8B 1MH4A 1QULA 4IO3A 3FASA 3TDJA 3U94A 3N26A 5DT6A 1B0LA 2FA7A 3EHSA 3K02A 4OVJA 2O51A 1DTZA 2DWJA 4F3SA 4MLVA 1B51A 4ZEDA 5HBCA 5CI5A 4Q0CA 3MWBA 3SKPA 1POTA 4MBPA 1LAFE 3KG2A 4G77A 3U92A 3UP9A 1MXXA 2Z8FA 4KFQA 4EUOA 4AQ4A 1FQDA 2HFBA 1SW2A 2F78A 4KCCA 2V84A 3O2AA
chains in the Genus database with same CATH superfamily
3A3CA 3CFLA 4ND9A 1RYOA 4MFIA 3LV0A 2NOOA 3Q26A 4MCOA 1VFEA 4NN3A 5M2VA 3WAFA 1A40A 4K3FA 2XXVA 2REJA 4N4UA 1KA1A 5A5XA 3RY3A 3Q28A 2Q2CA 1DCUA 2F36A 1USYH 4ZE9A 2DWAA 3MZ9A 2DS9A 4PF8A 3PPPA 3C36A 1Q9DA 2DDKA 2DVCA 3KBRA 2ONKE 3CFZA 4IGTA 2F97A 4LZ8A 3EPEA 3LUYA 3E78A 5I58A 1ZU0A 1ATGA 2XXPA 3RPWA 2XWKA 2PT1A 1UTBA 1D9YA 3FXUA 3K00A 4JDFA 1B5HA 3GBAA 3FBPA 2JJKA 2WBDA 5EHMA 5ET8A 4OVPA 4PAIA 2ABHA 4OEUA 4DI3D 1LLSA 4NF4B 1NV7A 1UIUA 3MYUA 4HCWA 2LAOA 5ET6A 5H8SA 4U1OA 1O64A 3V89B 2Q89A 5FHNA 4PFTA 3KSJA 3HFUA 5I2KA 3RNNA 3DP6A 4EF2A 1UTHA 3BIGA 3G3KA 3FJGA 3OEMA 4QXDA 1EU8A 1I6QA 1Y3PA 1NV2A 4C0RA 3QK6A 4DCXA 4OEVA 5H8FA 4E0XA 1ZMGA 3O9PA 4I62A 3O6GA 4GWSA 2PVUA 2V3QA 4PFUA 1MQHA 4PCDA 1I6AA 1GR2A 1FBPA 2P3VA 5JTYB 1B7UA 2OBGA 5EQ7A 3L6GA 3CSBA 4PE5B 4TQUQ 5I3SA 4PE3A 4THIA 2Z8DA 3R26A 4LN5A 4MNIA 5FHMA 3T66A 3TQLA 4IO2A 3USDA 3Q25A 2Q9TA 4KPTA 3O6HA 2VD3A 4F18A 1FPEA 2ZYNA 3CIJA 4QF9A 4F3GA 3ZKKA 1B7ZA 1SW1A 2FVZA 4GWUA 4YB6A 1FJ9A 2XXYA 1B5IA 3OELA 1L5TA 3MUQA 3QMFA 3R6UA 2F8DA 4ISUA 3FV2A 1LEVA 3T1BA 5CMMA 3EKIA 2UXAA 3UK4A 1MDP1 4GX3A 4U23A 4KD5A 3TUSA 1EZ9A 1BKAA 1FBDA 5DTBA 2XD2A 2D3IA 2G93A 1VDWA 4U21A 1FQEA 4QFLA 1P1OA 4XIGQ 1A54A 3PU5A 3E79A 3FATA 1D9VA 3PUWE 4QFNA 1R6ZA 2QJEA 1DPEA 5ET7A 4EXKA 2KLFA 4GBWA 4YAHX 1QGXA 1RKMA 1Q1KA 3E13X 1S9TA 4FECA 1BIYA 4R72A 1N84A 2RCBA 1FPGA 3KOSA 3SESA 1SI1A 1IXGA 1QUJA 5I5PA 2FHYA 4G8HA 4I3EA 2VHAA 2VOZA 3ROJA 3N5LA 5CMKA 4KYDA 2ZZWA 3K01A 4HXVA 3FUZA 1KA0A 5H8QA 4EDPA 1CNQA 3U1OA 4LA9A 1NUZA 2PX1A 1JNFA 3KJTA 1LAXA 3LBSA 4HE1A 1IXCA 5KDTA 2H5YA 3U93A 5TU0A 3RGYA 3F11A 3CG1A 5IM2A 3TELA 1HSEA 3GLBA 3ISPA 1H45A 3IB2A 1A99A 5IKBA 2XXIA 3PD9A 2XXRA 3QIMA 4IY6A 1MH3A 4PBQA 3IO6A 1PBPA 1H3DA 3SZPA 2QS4A 2ALUA 2V3UA 2I6EA 4YKPA 2Y5LA 4G68A 5LOMA 4N81A 3E4RA 2XWOA 3FZVA 5I56B 4P9KA 4EQ7A 1Y3NA 3T93B 2RCAA 1Y9UA 1NV6A 2Y7IA 3G3FA 4G68C 1LFHA 3VLUA 3V83A 2I48A 2O7IA 5ICTA 5AA4B 1N3WA 4M4GA 2Z8EA 2R9JA 2ZZVA 2QVRA 3OEKA 1NV5A 1SYIA 3PV0E 3MBPA 2B65A 3VVEA 1NUWA 3PPOA 1DOTA 4OA4A 4GX6A 3VE1B 1LBCA 2P0SA 5I59B 4JVCA 1FCKA 4OWDA 4QFOA 1B1HA 2QFLA 2XXWA 1IMFA 4QHQA 1NH7A 1ZKBA 3OO8A 2PT2A 4LQ5A 2FIEA 3Q27A 1IEJA 3L6HA 4F3BA 1FSAA 3GYYA 1NKXA 3A29A 3HN0A 1N7WA 4OTEA 3O66A 4N8GA 4P47A 3B50A 3EF7A 4NF5A 2Y7KA 3RPLA 1NV0A 4R2BA 4N8YA 1JEVA 4AS4A 1B2HA 1LB8A 2H9BA 4MNPA 1II5A 3MJNA 3PUVE 4F2OA 4POXA 3MP6A 1RDZA 2O1LA 3OO6A 2QRYA 4RNSA 4FEBA 4FATA 1OMPA 4UA8A 4NF6A 1WODA 2V93A 3VVFA 3MVZA 4F3PA 4YZZA 1QVSA 3PMVA 1B6HA 4TLMB 3T96B 3S2VA 1JW4A 4I40A 3V8XB 5H8NA 1G0IA 1FTMA 3TTRA 2HHMA 1OVBA 4OERA 3SDFA 3D4CA 4GXAA 3RQTA 4PFIA 4EXLA 1LAGE 4NF8A 5EYGA 2F7AA 1PC3A 1ZLQA 3KOTA 1LBYA 2HXRA 3LSWA 4N07A 1JW5A 2VD2A 1VFDA 2QSXA 2XX8A 1P1QA 4PC9A 4FJPA 2NWJA 2DE4A 1CB6A 1SVXB 1M5FA 3I3VA 3IFCA 4MLQA 5ISUA 3IB1A 4JWYA 4GX4A 4IB2A 3K0VA 2Q2AA 3E3KA 3CRBA 3QXMA 1B7HA 4MHFA 1S50A 1M5EA 1P1UA 4GIZA 4BDRA 2V4CA 1MY3A 4X8RA 4O7IA 1JVYA 4IO7A 1FPLA 4U4SA 5FHOA 1OLAA 3MPKA 3FVKA 1K9ZA 2P3NA 2DE3A 1KWHA 3MAMA 3CI8A 2H98A 1QW0A 3I6VA 3W9VA 1OVTA 1B9JA 1JP4A 1YZ0A 4BDNA 1AMFA 2O69A 4ELQA 1JQFA 2I3WA 2XXHA 2Y5KA 4EQ9A 1TXFA 4PGPA 1R1NA 3C4MA 2ZYMA 4N6KA 3MSTA 4MH5A 1FPBA 4H8IA 3MC2A 5K2XA 2G29A 2QVUA 3TTKA 2UVHA 2A5TB 4NG7A 4P11A 1OLCA 3RYDA 2HAUA 4RYAA 3H6WA 2BJIA 1BK4A 1MXVA 1PB7A 2MKZA 2ZNSA 2L5VA 4GOTA 1A7LA 4FIMA 3AXFA 5FTHA 1MY1A 1P1NA 2PFZA 3CFXA 3SEWA 1FPIA 1TWYA 1T0KA 3OMBA 4NWDA 1NI9A 5EQ8A 3K6XA 1NFTA 3LC8A 4M1VA 1AWBA 1A55A 5KCJB 4P1EA 1VSOA 4GWYA 1MXZA 4GWOA 3IO4A 4QSEA 3K1MA 5A5LA 3HCQA 4NWCA 3VLWA 3LR1A 1MPBA 4OFJA 1FQAA 3TODA 3H6UA 3ODBA 1IMDA 1PB9A 4NF4A 3G3GA 3MPLA 4HE2A 3JV9A 3OO7A 4X1BA 4IGRA 4BDMA 1LB9A 4N91A 3VVDA 4LATA 4ESXA 3C33A 4PETA 4PDDA 4OFLA 3R7XA 3KN7A 3PUZE 3DP4A 5DYHA 4C1UA 2DOJA 2P2AA 5CRYA 3SEYA 1YTVA 4XTCQ 1FW0A 2ZZXA 2OK2A 4YB5A 5IZ1A 4QSDA 1BTJA 4Z7EA 1JVXA 2XX9A 3RT6B 1YXIA 2H99A 1IXIA 3O29A 1NNKA 4HS7A 2REGA 4MMPA 4OVSA 3TCHA 4QRZA 3VLVA 3JZJA 2F5XA 5JTYA 5ITOA 3KN8A 4F22A 3OSQA 5I2NB 4R2FA 4XKQA 4ELRA 1BLFA 1Z7NE 2XXUA 1JEUA 1IXHA 5BWJA 3H3GA 3HSTA 3H4ZA 2F34A 2M8CA 3OD7A 2NVUB 3RTFB 1MM7A 3H6VA 3EN3A 4O7MA 1FTKA 2NXOA 3M3LA 3P7IA 3TFLA 4I8CA 1XOCA 3RTWB 1M5CA 1SI0A 4ELPA 5B7DA 2HCAA 4GL8A 2DP8A 2CZKA 3H03A 5IZ3B 1MM6A 1SQYA 2YLNA 1US4A 2VP1A 1ZBMA 2UVIA 5CBRA 4MEVA 1Y3QA 2PYYA 1N7XA 1QUKA 4GWXA 4OFOA 4NHBA 3K1NA 1XVXA 3BFUA 1WVJA 4NTLA 2KR0A 4YU0A 5CC2A 1B3FA 3OOAA 4I9DA 2Q88A 3KBZA 1FBCA 4JXIA 4Q8RA 1FPKA 4HE0A 4DCYA 4GWZA 4IY5A 2NUVA 2CZHA 3DM0A 4DZ1A 4H0WA 4WEPA 4GFRA 4PFYA 5H8HA 5L9MA 1KZ8A 3HO7A 3RLFE 1LAHE 4UABA 1JETA 3M3KA 3PGFA 3LUZA 2XWIA 1SW4A 3OSRA 1HSJA 4DI4B 5CBSA 1MY4A 1IMBA 3GBBA 2XXKA 1FQFA 1NNTA 1ZTYA 3DP8A 4LVQA 4Q5TA 5CM6A 3TKDA 5TPAB 1CE2A 3KJ7A 4F1UA 4PFWA 1MDQA 2OWZA 4RPOA 4LZ7A 5AA2B 5HM4B 5I7IA 1I69A 4OQOA 4NAPA 3LSXA 4MIJA 1UIVA 3O28A 3H06B 3N94A 4OXVA 2Y7WA 3M8UA 1EYJA 3TCGA 4ZZEA 3IL1B 2I4CA 1YPNA 1LSTA 3ILUB 3IK6B 2O1MA 2F35A 2UVGA 4DXCA 4F2QA 3RUMA 4GQOA 3TPAA 4OESA 3VXCA 3UGWA 4H65A 4RA1A 5AA2D 4Q30B 3KN3A 3TZAA 1NV4A 1MG1A 1M5DA 5T3JA 5ICQA 4KYEA 3KSXA 4O8MA 1LCFA 3FV1A 1AOVA 2UYEA 1EYKA 4HCYA 4XKPA 1GVCA 5FTIA 3PUYE 3IB0A 3TQWA 1Y20A 3ILTB 1DSNA 1MQDA 1TFAA 2FYIA 1SYHA 2B4LA 2ONSA 4NMYA 1EYIA 4YB7A 2FBPA 5EQAA 1J1NA 3MVWA 2P1SA 4AB5A 3IFAA 3S9NC 2F3BA 2OX3A 2X26A 3KZGA 1US5A 4R6KA 4G8NA 4H1XA 5EYFA 4Z0IA 1XVYA 4OANA 1XS5A 1IITA 4XEQA 2W7YA 4F31B 2AYSA 2HQ0A 2OWTA 2ONRA 1DK4A 1TFDA 5I59A 1MQGA 1OQHA 4F1VA 5DEXB 2F7BA 3GZGA 2VPOA 4PP0A 3T9XB 4X04A 1G0HA 2GHAA 1VR5A 4YMAA 4NE4A 3FVGA 1XT8A 4ZS9A 1B4HA 2O6AA 1QUIA 4IO6A 2DXRA 2I0BA 3K2DA 3TCFA 3CVGA 2V3TA 4JSOA 4H46A 3FIRA 2PMSA 2DXYA 1Q35A 4X9TA 1RDYA 5TP9A 4GBVA 1NV1A 2QMWA 4DLDA 5ET5A 1NNPA 3EHTA 3K6VA 1NL5A 2OWSA 4GL0A 3U8QA 4ZZAA 2O84X 3BBRA 5I57B 4JB7A 1LGBC 4ELOA 4G8MA 2HEUA 5J1DA 4N6PA 1S7YA 1Y4CA 1WDNA 2XHDA 2GH9A 4YICA 2WEFA 1B3GA 3OENA 1PBQA 1LBWA 4R75A 3H7MA 2UVJA 2Q8MA 1P99A 3ZSFA 2F6GA 4OENA 3Q29A 4YKKA 4O3AA 3UIFA 2XX7A 3BFTA 4PGNA 3FD3A 4N15A 3PPRA 2QVVA 2WKYA 3QSLA 1Z7ME 4KI0E 3U65A 4H5FA 1XHYA 2I58A 3BIHA 2QS1A 5AA1A 3UA8A 2H25A 3LSFB 3M3FA 4ESWA 2Z23A 1FTJA 2ESNA 1R9QA 4RK9A 4H6DA 3WAEA 3FVNA 4DXBA 4OVQA 4XFEA 1N76A 2R8TA 4LQ2A 1IZ1A 1XI6A 3B6TA 2DSFA 4QFKA 1FRPA 4HTGA 1F9BA 1NUYA 2QMXA 4JVDA 3FGSA 2E1SA 4OVTA 3TAJA 1H43A 1LCTA 1BP5A 4R9GA 3MVXA 3PMXA 1ELJA 3DLNA 3IOUA 4ZEBA 4LONB 4P1LA 3PPQA 3C35A 1I6BA 1LBZA 3B6WA 2HZLA 1B46A 3IJOB 1AIVA 4F19A 3S9LC 3T9HB 3EQ1A 3MQ9A 4UACA 5AE4A 3PPNA 4R9FA 1YYZA 3IR1A 5DVIA 4HW8A 2Y84A 2A5TA 2R6GE 2DYXA 1MPDA 3KC1A 2YPNA 2F3DA 3K6UA 5DVFA 1ZIUA 3UN6A 2HZKA 4R6YA 1LBVA 4MX6A 1ZJLA 3PUXE 4PQJA 4RXLA 4MNCA 4IO5A 4FORA 3QAXA 1GGGA 2GHBA 2I49A 4LUBA 2UYFA 2B3BA 1MPCA 5KCJA 4RJZA 1IMCA 3FVOA 3TMGA 1EH3A 4POWA 4RY1A 5A5XB 4OETA 4OHNA 3DELB 1O63A 2O68A 4U22A 2QPQA 4KYSA 4ONYA 2THIA 4LZ5A 1MXUA 2X7QA 2FNCA 3C32A 4C1TA 4U2RA 1XC1A 1MS7A 2Y7PA 4L17A 3C9HA 1H76A 2DWIA 3HHGA 4JSDA 4PFRA 5IZZA 4ECFA 5EQ9A 5I58B 1SBPA 2DE2A 5DW8A 4H45A 1NNFA 1B3LA 3TYHA 1B05A 2F7CA 1UTBB 1GTKA 2XXXA 4JWXA 2AIXA 4I3YA 4I1DA 2ZNTA 3IOVA 2RC9A 2E0SA 3NOHA 4WEDA 2AL5A 3B6QA 4KR5A 3W15C 4NQ8A 4PTKA 5CMBA 5FBPA 1NV3A 3O97A 2RKMA 3G7WA 1FPJA 1URGA 1Y1MA 4ZEKA 5K2YA 3T9VA 1OIBA 1HSLA 5L9SA 3A3UA 2RINA 5I2KB 4BDLA 1FBGA 4QSCA 4PAKA 3FJMA 3PD8A 4EQBA 1UTHB 3FXRA 3SETA 1M5BA 1P1WA 3PMWA 5I2NA 2HPGA 3THIA 4U1ZA 4P0GA 1URSA 3HV1A 4R73A 5H8FB 2IA4A 1AL3A 3MW0A 1IMEA 3IORA 4XXUA 3FXQA 3K1PA 4QFPA 3IX1A 2O7UA 4RK2A 2V25A 2DVZA 4TOZA 3VXBA 3I5OA 2GFEA 5LDZA 2QS2A 1ANFA 1OQGA 3K6WA 4PDHA 3SEXA 3H6TA 2ZMBA 1EZPA 1N3XA 3RT8A 3N6TA 1MRPA 2CZIA 1USYE 1YCJA 1MXYA 3O6IA 1NUXA 2YJPA 5F24A 2IEEA 5KZTA 3U72A 4FEDA 1TT1A 2PFYA 3G3HA 4F29A 4O3CA 2VT5A 4GLIA 5IZ3A 3S4UA 3IAZA 2CZLA 3CG3A 3KC0A 2D5WA 4MJOA 3E9XA 3OXNA 2D21A 1B40A 5HPQA 4ZEFA 1FBEA 2ANJA 5EYHA 4ZDMA 1B58A 4E0WA 2PCRA 1FQBA 4WKMA 4AB6A 3TTNA 3S9EA 1FTOA 2WBBA 3EHUA 5CMCA 1B1XA 4XF5A 2DQVA 1QJMA 1FTLA 3TTMA 2RC7A 4PAFA 4XKRA 4H8JA 1INPA 3PTYA 2XWVA 4H5GA 4EF1A 3HHFA 1A8EA 3W9WA 4P3LA 2Q8JA 3MZBA 5L8DA 1K9YA 1NH8A 1Y4TA 4WXJA 2Y7RA 5ITPA 4YKIA 4R6HA 2ZNUA 2OLBA 5DVJA 2VGQA 3UORA 2WX9A 5TPAA 1IQ7A 2DWHA 4DXUA 5B70A 3T9UA 2I3VA 5AA2A 3N6UA 4PBHA 4TLLB 1D9QA 4O3BA 5H8HB 2CEXA 1PEBA 4GXSB 1PDAA 1Y1ZA 1LFIA 3QUJA 2WYKA 2I0CA 4DDDA 1VE4A 3ZKLA 1B3EA 5H8QB 5JK4A 3C31A 2CEYA 2Z22A 1B52A 2XD3A 3TTLA 4FAJA 4YMBA 1B32A 3MP8A 5KDTB 1QKAA 1N04A 5ESYA 4PFBA 1DTGA 4AS5A 1RYXA 5F7VA 5I56A 1H44A 4BDQA 1URDA 2X7PA 3ECRA 4XKNA 2HXWA 4MAGA 4U4XA 2QS3A 3FJ7A 4KHZE 4BDOA 1SD3A 4DE8A 5AA4A 3IOWA 1B5JA 2R71A 1B0HA 3HPIA 3CR9A 1B3HA 1LBXA 5F1QA 3V5AA 2Q74A 3MZ1A 3C34A 4OYVA 4JWOA 1SPIA 3B7DA 4G68B 3ONMA 1DPPA 5EHSA 4F39A 5ELVA 2ZYKA 1EZOA 2ZYOA 3IOTA 2ZXTA 1MY0A 1D3KA 4OZ9A 5L9OA 2B3FA 4N17A 2H4IA 3SERA 2BJJX 4FBPA 3TEPA 3LSLA 1DMBA 3T0JA 4NEDA 3S9MC 2F6PA 1A8FA 5DEXA 1LBBA 1FJ6A 1GV8A 4ZEIA 3JYRA 2GQ1A 3BKIB 4F1YA 3SEUA 3T22A 4PF6A 2OJTA 3SEVA 5JEIA 4KCDA 2OZZA 3G3IA 1FBFA 4IR8A 3MP1A 1MQJA 4KQPA 4G4PA 2XXQA 1MXWA 4JVIA 3K4UA 3G3JA 2RC8A 2HAVA 1MQIA 3D1RA 1FBHA 5AA3A 3OO9A 2PBWA 2XXTA 1O7TA 4GVOA 1QKBA 4JBZA 4OVRA 4RPNA 1SW5A 4KXPA 1JW1A 3VV5A 1R9LA 3VFJA 3KGCA 4N13A 4R74A 5IAIA 4P8BA 3QYTA 3GXAA 3CSGA 2CMOA 5I57A 3A09A 3MVYA 4IO4A 2B4MA 1B4ZA 4P0IA 1FTAA 4LP2B 1N0TA 3ZS6A 5BUUA 1LFGA 4GRKA 1D4NA 4OMBA 3B8BA 5TP9B 4X48A 1NMUA 1FQCA 4N6DA 1MY2A 3QUFA 2WYPA 1DBZA 4NF5B 4DIGA 2I4BA 1UQWA 3RPLB 4NF0A 1POY1 2GRVA 4X1DA 1PB8A 4G2ZA 3KFMA 4GF8A 3D4GA 1FPDA 4QBAA 2QL3A 2OCUA 3FXBA 2RF1A 4MF3A 1IIWA 3IJXB 4NF6B 4BLAA 1RDXA 4GWWA 3VDFA 4FE8A 5I84A 2A5SA 3KEIA 4NX1A 5H8NB 1SDXA 2XA5A 3RN8A 1IUDA 1YAEA 4ZE8A 4YKJA 2AL4A 4GD5A 1AH5A 4ZECA 2VPNA 5LTCA 4H67A 4NF8B 3CHGA 1MH4A 1QULA 4IO3A 3FASA 3TDJA 3U94A 4O94A 3N26A 5DT6A 2KQZA 1B0LA 2FA7A 3EHSA 3K02A 4OVJA 2O51A 1DTZA 2DWJA 4F3SA 4MLVA 1B51A 4ZEDA 4P56A 5HBCA 5CI5A 4Q0CA 3MWBA 3SKPA 1POTA 4MBPA 1LAFE 3KG2A 4G77A 1IMAA 4G61A 3U92A 5J16A 5IGAA 3UP9A 1MXXA 2Z8FA 4NGUA 4KFQA 4EUOA 2FIXA 4AQ4A 1FQDA 2HFBA 1SW2A 2F78A 4KCCA 1FPFA 3O2AA 2V84A
chains in the Genus database with same CATH topology
3A3CA 3CFLA 4ND9A 1RYOA 4MFIA 2NOOA 3Q26A 1VFEA 5M2VA 3WAFA 1A40A 4K3FA 2XXVA 2REJA 5A5XA 3RY3A 3Q28A 2Q2CA 2F36A 1USYH 4ZE9A 2DWAA 3MZ9A 2DS9A 3PPPA 3C36A 2DVCA 3KBRA 2ONKE 3CFZA 4IGTA 2F97A 4LZ8A 3EPEA 3LUYA 5I58A 1ZU0A 1ATGA 2XXPA 3RPWA 2PT1A 1UTBA 1D9YA 3FXUA 3K00A 4JDFA 1B5HA 3GBAA 5EHMA 2ABHA 4OEUA 1LLSA 4NF4B 1UIUA 4HCWA 2LAOA 5H8SA 4U1OA 1O64A 3V89B 2Q89A 5FHNA 4PFTA 3KSJA 5I2KA 3RNNA 3DP6A 4EF2A 1UTHA 3G3KA 3FJGA 3OEMA 1EU8A 1I6QA 1Y3PA 4C0RA 3QK6A 4DCXA 4OEVA 5H8FA 4E0XA 1ZMGA 3O9PA 4I62A 3O6GA 2PVUA 2V3QA 4PFUA 1MQHA 1I6AA 1GR2A 5JTYB 1B7UA 2OBGA 3L6GA 3CSBA 4PE5B 4TQUQ 4THIA 2Z8DA 3R26A 5FHMA 3T66A 3TQLA 4IO2A 3USDA 3Q25A 2Q9TA 4KPTA 3O6HA 2VD3A 4F18A 2ZYNA 3CIJA 4QF9A 4F3GA 3ZKKA 1B7ZA 1SW1A 4YB6A 2XXYA 1B5IA 3OELA 1L5TA 3MUQA 3R6UA 2F8DA 4ISUA 3FV2A 5CMMA 2UXAA 3UK4A 1MDP1 4U23A 4KD5A 3TUSA 1EZ9A 1BKAA 5DTBA 2XD2A 2D3IA 2G93A 4U21A 1FQEA 4QFLA 1P1OA 4XIGQ 1A54A 3PU5A 3FATA 1D9VA 3PUWE 4QFNA 1R6ZA 2QJEA 1DPEA 4EXKA 2KLFA 4YAHX 1RKMA 1Q1KA 3E13X 1S9TA 4FECA 1BIYA 4R72A 1N84A 2RCBA 3KOSA 3SESA 1SI1A 1IXGA 1QUJA 4G8HA 2VHAA 2VOZA 3N5LA 5CMKA 4KYDA 3K01A 3FUZA 5H8QA 4EDPA 3U1OA 4LA9A 2PX1A 1JNFA 3KJTA 1LAXA 3LBSA 1IXCA 5KDTA 2H5YA 3U93A 5TU0A 3RGYA 3F11A 3CG1A 3TELA 1HSEA 3GLBA 1H45A 3IB2A 1A99A 5IKBA 2XXIA 3PD9A 2XXRA 3QIMA 4IY6A 1MH3A 3IO6A 1PBPA 1H3DA 2QS4A 2ALUA 2V3UA 2I6EA 4YKPA 4G68A 5LOMA 3E4RA 3FZVA 5I56B 4EQ7A 1Y3NA 3T93B 2RCAA 1Y9UA 2Y7IA 3G3FA 4G68C 1LFHA 3VLUA 3V83A 2I48A 2O7IA 5ICTA 5AA4B 1N3WA 4M4GA 2Z8EA 2R9JA 3OEKA 1SYIA 3PV0E 3MBPA 2B65A 3VVEA 3PPOA 1DOTA 3VE1B 1LBCA 2P0SA 5I59B 1FCKA 4OWDA 4QFOA 1B1HA 2XXWA 4QHQA 1NH7A 1ZKBA 3OO8A 2PT2A 4LQ5A 3Q27A 1IEJA 3L6HA 4F3BA 1NKXA 3HN0A 1N7WA 4OTEA 3O66A 3EF7A 4NF5A 2Y7KA 4R2BA 1JEVA 1B2HA 1LB8A 2H9BA 1II5A 3MJNA 3PUVE 4F2OA 4POXA 3MP6A 2O1LA 3OO6A 2QRYA 4RNSA 4FEBA 4FATA 1OMPA 4UA8A 4NF6A 1WODA 2V93A 3VVFA 3MVZA 4F3PA 4YZZA 1QVSA 3PMVA 1B6HA 4TLMB 3T96B 3S2VA 1JW4A 3V8XB 5H8NA 1FTMA 3TTRA 1OVBA 4OERA 3SDFA 3D4CA 4GXAA 3RQTA 4EXLA 1LAGE 4NF8A 2F7AA 1PC3A 1ZLQA 3KOTA 3LSWA 4N07A 1JW5A 2VD2A 1VFDA 2QSXA 2XX8A 1P1QA 4FJPA 2NWJA 2DE4A 1CB6A 1SVXB 1M5FA 3I3VA 4MLQA 5ISUA 3IB1A 4JWYA 4IB2A 3K0VA 2Q2AA 3E3KA 3CRBA 3QXMA 1B7HA 1S50A 1M5EA 1P1UA 4GIZA 4BDRA 1MY3A 1JVYA 4IO7A 4U4SA 5FHOA 1OLAA 3MPKA 3FVKA 2DE3A 1KWHA 3MAMA 3CI8A 2H98A 1QW0A 3I6VA 3W9VA 1OVTA 1B9JA 4BDNA 1AMFA 2O69A 4ELQA 1JQFA 2I3WA 2XXHA 4EQ9A 1TXFA 1R1NA 3C4MA 2ZYMA 4MH5A 4H8IA 3MC2A 5K2XA 2G29A 3TTKA 2UVHA 2A5TB 4P11A 1OLCA 2HAUA 4RYAA 3H6WA 1PB7A 1MXVA 2ZNSA 4GOTA 1A7LA 4FIMA 3AXFA 5FTHA 1MY1A 1P1NA 3CFXA 3SEWA 1TWYA 1T0KA 3OMBA 4NWDA 3K6XA 1NFTA 3LC8A 4M1VA 1A55A 5KCJB 1VSOA 1MXZA 4GWOA 3IO4A 4QSEA 3K1MA 3HCQA 4NWCA 3VLWA 3LR1A 1MPBA 4OFJA 1FQAA 3TODA 3H6UA 3ODBA 1PB9A 4NF4A 3G3GA 3MPLA 3JV9A 3OO7A 4X1BA 4IGRA 4BDMA 1LB9A 3VVDA 4LATA 4ESXA 3C33A 4PETA 4OFLA 3R7XA 3KN7A 3PUZE 3DP4A 5DYHA 4C1UA 2DOJA 2P2AA 5CRYA 3SEYA 1YTVA 4XTCQ 1FW0A 2OK2A 4YB5A 4QSDA 1BTJA 4Z7EA 1JVXA 2XX9A 3RT6B 2H99A 1IXIA 3O29A 1NNKA 4HS7A 2REGA 3TCHA 4QRZA 3VLVA 3JZJA 2F5XA 5JTYA 5ITOA 3KN8A 4F22A 3OSQA 5I2NB 4R2FA 4XKQA 4ELRA 1BLFA 1Z7NE 2XXUA 1JEUA 1IXHA 5BWJA 3H3GA 3HSTA 3H4ZA 2NVUB 2F34A 2M8CA 3OD7A 3RTFB 1MM7A 3H6VA 3EN3A 1FTKA 2NXOA 3M3LA 3P7IA 3TFLA 4I8CA 1XOCA 3RTWB 1M5CA 1SI0A 4ELPA 5B7DA 2HCAA 4GL8A 2DP8A 3H03A 1MM6A 1SQYA 2YLNA 1US4A 2VP1A 1ZBMA 2UVIA 5CBRA 1Y3QA 2PYYA 1N7XA 1QUKA 4OFOA 3K1NA 1XVXA 3BFUA 1WVJA 4NTLA 4YU0A 5CC2A 1B3FA 3OOAA 4I9DA 2Q88A 4JXIA 4Q8RA 4DCYA 4IY5A 2NUVA 3DM0A 4DZ1A 4H0WA 4WEPA 4GFRA 4PFYA 5H8HA 5L9MA 3HO7A 3RLFE 1LAHE 1JETA 3M3KA 3PGFA 1SW4A 3OSRA 1HSJA 5CBSA 1MY4A 3GBBA 1FQFA 1NNTA 1ZTYA 3DP8A 4LVQA 4Q5TA 5CM6A 3TKDA 5TPAB 1CE2A 3KJ7A 4F1UA 4PFWA 1MDQA 4RPOA 5AA2B 4LZ7A 5HM4B 1I69A 4OQOA 3LSXA 1UIVA 3O28A 3H06B 3N94A 4OXVA 2Y7WA 3M8UA 3TCGA 4ZZEA 3IL1B 2I4CA 1YPNA 1LSTA 3ILUB 3IK6B 2O1MA 2F35A 2UVGA 4DXCA 4F2QA 3RUMA 4GQOA 3TPAA 4OESA 3VXCA 3UGWA 4H65A 4RA1A 5AA2D 4Q30B 3KN3A 3TZAA 1MG1A 1M5DA 5ICQA 4KYEA 3KSXA 1LCFA 3FV1A 1AOVA 2UYEA 4HCYA 4XKPA 1GVCA 5FTIA 3PUYE 3IB0A 3TQWA 1Y20A 3ILTB 1DSNA 1MQDA 1TFAA 2FYIA 1SYHA 2ONSA 4NMYA 4YB7A 1J1NA 3MVWA 2P1SA 4AB5A 3S9NC 3KZGA 2X26A 1US5A 4R6KA 4G8NA 4H1XA 5EYFA 4Z0IA 1XVYA 1XS5A 1IITA 2W7YA 4F31B 2AYSA 2HQ0A 2OWTA 2ONRA 1TFDA 5I59A 1MQGA 1OQHA 4F1VA 5DEXB 2F7BA 3GZGA 4PP0A 3T9XB 2GHAA 1VR5A 4YMAA 4NE4A 3FVGA 1XT8A 4ZS9A 1B4HA 2O6AA 1QUIA 4IO6A 2DXRA 2I0BA 3K2DA 3TCFA 3CVGA 2V3TA 4JSOA 3FIRA 2PMSA 2DXYA 1Q35A 4X9TA 5TP9A 2QMWA 4DLDA 1NNPA 3EHTA 3K6VA 1NL5A 2OWSA 4GL0A 3U8QA 4ZZAA 2O84X 3BBRA 5I57B 4JB7A 1LGBC 4ELOA 4G8MA 2HEUA 5J1DA 4N6PA 1S7YA 1Y4CA 1WDNA 2XHDA 2GH9A 4YICA 1B3GA 3OENA 1PBQA 4R75A 3H7MA 2UVJA 1P99A 3ZSFA 2F6GA 4OENA 3Q29A 4YKKA 4O3AA 3UIFA 2XX7A 3BFTA 3FD3A 3PPRA 2WKYA 3QSLA 1Z7ME 4KI0E 4H5FA 1XHYA 2I58A 2QS1A 5AA1A 3UA8A 2H25A 3LSFB 3M3FA 4ESWA 2Z23A 1FTJA 2ESNA 1R9QA 4RK9A 4H6DA 3WAEA 3FVNA 4DXBA 1N76A 4LQ2A 1IZ1A 3B6TA 2DSFA 4QFKA 4HTGA 1F9BA 2QMXA 3FGSA 2E1SA 3TAJA 1H43A 1LCTA 1BP5A 3MVXA 4R9GA 3PMXA 1ELJA 3DLNA 3IOUA 4ZEBA 4LONB 3PPQA 3C35A 1I6BA 3B6WA 2HZLA 1B46A 3IJOB 1AIVA 4F19A 3S9LC 3T9HB 3EQ1A 3MQ9A 4UACA 5AE4A 3PPNA 4R9FA 5DVIA 3IR1A 4HW8A 2Y84A 2A5TA 2R6GE 2DYXA 1MPDA 2YPNA 3K6UA 5DVFA 1ZIUA 3UN6A 2HZKA 4R6YA 1ZJLA 3PUXE 4PQJA 4RXLA 4IO5A 4FORA 3QAXA 1GGGA 2GHBA 2I49A 4LUBA 2UYFA 2B3BA 1MPCA 5KCJA 4RJZA 3FVOA 3TMGA 1EH3A 4POWA 4RY1A 5A5XB 4OETA 4OHNA 3DELB 1O63A 2O68A 4U22A 2QPQA 4KYSA 4ONYA 2THIA 4LZ5A 1MXUA 2X7QA 2FNCA 3C32A 4C1TA 4U2RA 1XC1A 1MS7A 2Y7PA 4L17A 3C9HA 1H76A 2DWIA 3HHGA 4JSDA 4ECFA 5I58B 1SBPA 2DE2A 1NNFA 1B3LA 3TYHA 1B05A 2F7CA 1UTBB 1GTKA 2XXXA 4JWXA 2AIXA 4I1DA 2ZNTA 3IOVA 2RC9A 2E0SA 4WEDA 2AL5A 3B6QA 4KR5A 3W15C 5CMBA 3O97A 2RKMA 3G7WA 1URGA 1Y1MA 4ZEKA 5K2YA 3T9VA 1OIBA 1HSLA 5L9SA 3A3UA 2RINA 5I2KB 4BDLA 4QSCA 3FJMA 3PD8A 4EQBA 1UTHB 3FXRA 3SETA 1M5BA 1P1WA 3PMWA 5I2NA 3THIA 4U1ZA 4P0GA 1URSA 3HV1A 4R73A 5H8FB 2IA4A 1AL3A 3MW0A 4XXUA 3IORA 3FXQA 3K1PA 4QFPA 3IX1A 2O7UA 4RK2A 2V25A 2DVZA 4TOZA 3VXBA 3I5OA 2GFEA 2QS2A 1ANFA 1OQGA 3K6WA 3SEXA 3H6TA 2ZMBA 1EZPA 1N3XA 3RT8A 3N6TA 1MRPA 1USYE 1YCJA 1MXYA 3O6IA 2YJPA 2IEEA 5KZTA 3U72A 4FEDA 1TT1A 3G3HA 4F29A 4O3CA 4GLIA 3S4UA 3IAZA 2CZLA 3CG3A 2D5WA 3E9XA 3OXNA 2D21A 1B40A 5HPQA 4ZEFA 2ANJA 4ZDMA 1B58A 4E0WA 1FQBA 4WKMA 4AB6A 3TTNA 3S9EA 1FTOA 3EHUA 5CMCA 1B1XA 2DQVA 1QJMA 1FTLA 3TTMA 2RC7A 4XKRA 4H8JA 4H5GA 4EF1A 3HHFA 1A8EA 3W9WA 2Q8JA 3MZBA 5L8DA 1NH8A 1Y4TA 4WXJA 2Y7RA 5ITPA 4YKIA 4R6HA 2ZNUA 2OLBA 5DVJA 2VGQA 3UORA 5TPAA 1IQ7A 2DWHA 4DXUA 5B70A 3T9UA 2I3VA 5AA2A 3N6UA 4TLLB 4O3BA 5H8HB 4GXSB 1PEBA 1PDAA 1Y1ZA 1LFIA 3QUJA 2I0CA 4DDDA 1VE4A 3ZKLA 1B3EA 5H8QB 5JK4A 3C31A 2Z22A 1B52A 2XD3A 3TTLA 4FAJA 4YMBA 1B32A 3MP8A 5KDTB 1QKAA 1N04A 1DTGA 1RYXA 5F7VA 5I56A 1H44A 4BDQA 1URDA 2X7PA 3ECRA 4XKNA 2HXWA 4U4XA 2QS3A 3FJ7A 4KHZE 4BDOA 1SD3A 4DE8A 5AA4A 3IOWA 1B5JA 2R71A 1B0HA 3HPIA 3CR9A 1B3HA 5F1QA 3V5AA 3MZ1A 3C34A 4OYVA 4JWOA 3B7DA 4G68B 3ONMA 1DPPA 5EHSA 4F39A 5ELVA 2ZYKA 1EZOA 2ZYOA 3IOTA 2ZXTA 1MY0A 1D3KA 4OZ9A 5L9OA 2B3FA 2H4IA 3SERA 2BJJX 3TEPA 3LSLA 1DMBA 4NEDA 3S9MC 2F6PA 1A8FA 5DEXA 1LBBA 1GV8A 4ZEIA 3JYRA 3BKIB 4F1YA 3SEUA 3T22A 2OJTA 3SEVA 5JEIA 4KCDA 2OZZA 3G3IA 3MP1A 1MQJA 4KQPA 4G4PA 2XXQA 1MXWA 3K4UA 3G3JA 2RC8A 2HAVA 1MQIA 5AA3A 3OO9A 2PBWA 2XXTA 1O7TA 4GVOA 1QKBA 4JBZA 4RPNA 1SW5A 1JW1A 3VV5A 1R9LA 3VFJA 3KGCA 4N13A 4R74A 5IAIA 3QYTA 3GXAA 3CSGA 2CMOA 5I57A 3A09A 3MVYA 4IO4A 1B4ZA 4P0IA 4LP2B 1N0TA 3ZS6A 5BUUA 1LFGA 4GRKA 1D4NA 4OMBA 5TP9B 4X48A 1NMUA 1FQCA 1MY2A 3QUFA 4NF5B 4DIGA 2I4BA 1UQWA 1POY1 2GRVA 4X1DA 1PB8A 4G2ZA 3KFMA 4GF8A 3D4GA 2QL3A 2OCUA 2RF1A 4MF3A 1IIWA 3IJXB 4NF6B 4BLAA 3VDFA 4FE8A 5I84A 2A5SA 3KEIA 5H8NB 1SDXA 3RN8A 1IUDA 1YAEA 4ZE8A 4YKJA 2AL4A 4GD5A 1AH5A 4ZECA 4H67A 4NF8B 1MH4A 1QULA 4IO3A 3FASA 3TDJA 3U94A 3N26A 5DT6A 1B0LA 2FA7A 3EHSA 3K02A 4OVJA 2O51A 1DTZA 2DWJA 4F3SA 4MLVA 1B51A 4ZEDA 5HBCA 5CI5A 4Q0CA 3MWBA 3SKPA 1POTA 4MBPA 1LAFE 3KG2A 4G77A 3U92A 3UP9A 1MXXA 2Z8FA 4KFQA 4EUOA 4AQ4A 1FQDA 2HFBA 1SW2A 2F78A 4KCCA 2V84A 3O2AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A3C A;  3CFL A;  4ND9 A;  1RYO A;  4MFI A;  2NOO A;  3Q26 A;  1VFE A;  5M2V A;  3WAF A;  1A40 A;  4K3F A;  2XXV A;  2REJ A;  5A5X A;  3RY3 A;  3Q28 A;  2Q2C A;  2F36 A;  1USY H;  4ZE9 A;  2DWA A;  3MZ9 A;  2DS9 A;  3PPP A;  3C36 A;  2DVC A;  3KBR A;  2ONK E;  3CFZ A;  4IGT A;  2F97 A;  4LZ8 A;  3EPE A;  3LUY A;  5I58 A;  1ZU0 A;  1ATG A;  2XXP A;  3RPW A;  2PT1 A;  1UTB A;  1D9Y A;  3FXU A;  3K00 A;  4JDF A;  1B5H A;  3GBA A;  5EHM A;  2ABH A;  4OEU A;  1LLS A;  4NF4 B;  1UIU A;  4HCW A;  2LAO A;  5H8S A;  4U1O A;  1O64 A;  3V89 B;  2Q89 A;  5FHN A;  4PFT A;  3KSJ A;  5I2K A;  3RNN A;  3DP6 A;  4EF2 A;  1UTH A;  3G3K A;  3FJG A;  3OEM A;  1EU8 A;  1I6Q A;  1Y3P A;  4C0R A;  3QK6 A;  4DCX A;  4OEV A;  5H8F A;  4E0X A;  1ZMG A;  3O9P A;  4I62 A;  3O6G A;  2PVU A;  2V3Q A;  4PFU A;  1MQH A;  1I6A A;  1GR2 A;  5JTY B;  1B7U A;  2OBG A;  3L6G A;  3CSB A;  4PE5 B;  4TQU Q;  4THI A;  2Z8D A;  3R26 A;  5FHM A;  3T66 A;  3TQL A;  4IO2 A;  3USD A;  3Q25 A;  2Q9T A;  4KPT A;  3O6H A;  2VD3 A;  4F18 A;  2ZYN A;  3CIJ A;  4QF9 A;  4F3G A;  3ZKK A;  1B7Z A;  1SW1 A;  4YB6 A;  2XXY A;  1B5I A;  3OEL A;  1L5T A;  3MUQ A;  3R6U A;  2F8D A;  4ISU A;  3FV2 A;  5CMM A;  2UXA A;  3UK4 A;  1MDP 1;  4U23 A;  4KD5 A;  3TUS A;  1EZ9 A;  1BKA A;  5DTB A;  2XD2 A;  2D3I A;  2G93 A;  4U21 A;  1FQE A;  4QFL A;  1P1O A;  4XIG Q;  1A54 A;  3PU5 A;  3FAT A;  1D9V A;  3PUW E;  4QFN A;  1R6Z A;  2QJE A;  1DPE A;  4EXK A;  2KLF A;  4YAH X;  1RKM A;  1Q1K A;  3E13 X;  1S9T A;  4FEC A;  1BIY A;  4R72 A;  1N84 A;  2RCB A;  3KOS A;  3SES A;  1SI1 A;  1IXG A;  1QUJ A;  4G8H A;  2VHA A;  2VOZ A;  3N5L A;  5CMK A;  4KYD A;  3K01 A;  3FUZ A;  5H8Q A;  4EDP A;  3U1O A;  4LA9 A;  2PX1 A;  1JNF A;  3KJT A;  1LAX A;  3LBS A;  1IXC A;  5KDT A;  2H5Y A;  3U93 A;  5TU0 A;  3RGY A;  3F11 A;  3CG1 A;  3TEL A;  1HSE A;  3GLB A;  1H45 A;  3IB2 A;  1A99 A;  5IKB A;  2XXI A;  3PD9 A;  2XXR A;  3QIM A;  4IY6 A;  1MH3 A;  3IO6 A;  1PBP A;  1H3D A;  2QS4 A;  2ALU A;  2V3U A;  2I6E A;  4YKP A;  4G68 A;  5LOM A;  3E4R A;  3FZV A;  5I56 B;  4EQ7 A;  1Y3N A;  3T93 B;  2RCA A;  1Y9U A;  2Y7I A;  3G3F A;  4G68 C;  1LFH A;  3VLU A;  3V83 A;  2I48 A;  2O7I A;  5ICT A;  5AA4 B;  1N3W A;  4M4G A;  2Z8E A;  2R9J A;  3OEK A;  1SYI A;  3PV0 E;  3MBP A;  2B65 A;  3VVE A;  3PPO A;  1DOT A;  3VE1 B;  1LBC A;  2P0S A;  5I59 B;  1FCK A;  4OWD A;  4QFO A;  1B1H A;  2XXW A;  4QHQ A;  1NH7 A;  1ZKB A;  3OO8 A;  2PT2 A;  4LQ5 A;  3Q27 A;  1IEJ A;  3L6H A;  4F3B A;  1NKX A;  3HN0 A;  1N7W A;  4OTE A;  3O66 A;  3EF7 A;  4NF5 A;  2Y7K A;  4R2B A;  1JEV A;  1B2H A;  1LB8 A;  2H9B A;  1II5 A;  3MJN A;  3PUV E;  4F2O A;  4POX A;  3MP6 A;  2O1L A;  3OO6 A;  2QRY A;  4RNS A;  4FEB A;  4FAT A;  1OMP A;  4UA8 A;  4NF6 A;  1WOD A;  2V93 A;  3VVF A;  3MVZ A;  4F3P A;  4YZZ A;  1QVS A;  3PMV A;  1B6H A;  4TLM B;  3T96 B;  3S2V A;  1JW4 A;  3V8X B;  5H8N A;  1FTM A;  3TTR A;  1OVB A;  4OER A;  3SDF A;  3D4C A;  4GXA A;  3RQT A;  4EXL A;  1LAG E;  4NF8 A;  2F7A A;  1PC3 A;  1ZLQ A;  3KOT A;  3LSW A;  4N07 A;  1JW5 A;  2VD2 A;  1VFD A;  2QSX A;  2XX8 A;  1P1Q A;  4FJP A;  2NWJ A;  2DE4 A;  1CB6 A;  1SVX B;  1M5F A;  3I3V A;  4MLQ A;  5ISU A;  3IB1 A;  4JWY A;  4IB2 A;  3K0V A;  2Q2A A;  3E3K A;  3CRB A;  3QXM A;  1B7H A;  1S50 A;  1M5E A;  1P1U A;  4GIZ A;  4BDR A;  1MY3 A;  1JVY A;  4IO7 A;  4U4S A;  5FHO A;  1OLA A;  3MPK A;  3FVK A;  2DE3 A;  1KWH A;  3MAM A;  3CI8 A;  2H98 A;  1QW0 A;  3I6V A;  3W9V A;  1OVT A;  1B9J A;  4BDN A;  1AMF A;  2O69 A;  4ELQ A;  1JQF A;  2I3W A;  2XXH A;  4EQ9 A;  1TXF A;  1R1N A;  3C4M A;  2ZYM A;  4MH5 A;  4H8I A;  3MC2 A;  5K2X A;  2G29 A;  3TTK A;  2UVH A;  2A5T B;  4P11 A;  1OLC A;  2HAU A;  4RYA A;  3H6W A;  1PB7 A;  1MXV A;  2ZNS A;  4GOT A;  1A7L A;  4FIM A;  3AXF A;  5FTH A;  1MY1 A;  1P1N A;  3CFX A;  3SEW A;  1TWY A;  1T0K A;  3OMB A;  4NWD A;  3K6X A;  1NFT A;  3LC8 A;  4M1V A;  1A55 A;  5KCJ B;  1VSO A;  1MXZ A;  4GWO A;  3IO4 A;  4QSE A;  3K1M A;  3HCQ A;  4NWC A;  3VLW A;  3LR1 A;  1MPB A;  4OFJ A;  1FQA A;  3TOD A;  3H6U A;  3ODB A;  1PB9 A;  4NF4 A;  3G3G A;  3MPL A;  3JV9 A;  3OO7 A;  4X1B A;  4IGR A;  4BDM A;  1LB9 A;  3VVD A;  4LAT A;  4ESX A;  3C33 A;  4PET A;  4OFL A;  3R7X A;  3KN7 A;  3PUZ E;  3DP4 A;  5DYH A;  4C1U A;  2DOJ A;  2P2A A;  5CRY A;  3SEY A;  1YTV A;  4XTC Q;  1FW0 A;  2OK2 A;  4YB5 A;  4QSD A;  1BTJ A;  4Z7E A;  1JVX A;  2XX9 A;  3RT6 B;  2H99 A;  1IXI A;  3O29 A;  1NNK A;  4HS7 A;  2REG A;  3TCH A;  4QRZ A;  3VLV A;  3JZJ A;  2F5X A;  5JTY A;  5ITO A;  3KN8 A;  4F22 A;  3OSQ A;  5I2N B;  4R2F A;  4XKQ A;  4ELR A;  1BLF A;  1Z7N E;  2XXU A;  1JEU A;  1IXH A;  5BWJ A;  3H3G A;  3HST A;  3H4Z A;  2NVU B;  2F34 A;  2M8C A;  3OD7 A;  3RTF B;  1MM7 A;  3H6V A;  3EN3 A;  1FTK A;  2NXO A;  3M3L A;  3P7I A;  3TFL A;  4I8C A;  1XOC A;  3RTW B;  1M5C A;  1SI0 A;  4ELP A;  5B7D A;  2HCA A;  4GL8 A;  2DP8 A;  3H03 A;  1MM6 A;  1SQY A;  2YLN A;  1US4 A;  2VP1 A;  1ZBM A;  2UVI A;  5CBR A;  1Y3Q A;  2PYY A;  1N7X A;  1QUK A;  4OFO A;  3K1N A;  1XVX A;  3BFU A;  1WVJ A;  4NTL A;  4YU0 A;  5CC2 A;  1B3F A;  3OOA A;  4I9D A;  2Q88 A;  4JXI A;  4Q8R A;  4DCY A;  4IY5 A;  2NUV A;  3DM0 A;  4DZ1 A;  4H0W A;  4WEP A;  4GFR A;  4PFY A;  5H8H A;  5L9M A;  3HO7 A;  3RLF E;  1LAH E;  1JET A;  3M3K A;  3PGF A;  1SW4 A;  3OSR A;  1HSJ A;  5CBS A;  1MY4 A;  3GBB A;  1FQF A;  1NNT A;  1ZTY A;  3DP8 A;  4LVQ A;  4Q5T A;  5CM6 A;  3TKD A;  5TPA B;  1CE2 A;  3KJ7 A;  4F1U A;  4PFW A;  1MDQ A;  4RPO A;  5AA2 B;  4LZ7 A;  5HM4 B;  1I69 A;  4OQO A;  3LSX A;  1UIV A;  3O28 A;  3H06 B;  3N94 A;  4OXV A;  2Y7W A;  3M8U A;  3TCG A;  4ZZE A;  3IL1 B;  2I4C A;  1YPN A;  1LST A;  3ILU B;  3IK6 B;  2O1M A;  2F35 A;  2UVG A;  4DXC A;  4F2Q A;  3RUM A;  4GQO A;  3TPA A;  4OES A;  3VXC A;  3UGW A;  4H65 A;  4RA1 A;  5AA2 D;  4Q30 B;  3KN3 A;  3TZA A;  1MG1 A;  1M5D A;  5ICQ A;  4KYE A;  3KSX A;  1LCF A;  3FV1 A;  1AOV A;  2UYE A;  4HCY A;  4XKP A;  1GVC A;  5FTI A;  3PUY E;  3IB0 A;  3TQW A;  1Y20 A;  3ILT B;  1DSN A;  1MQD A;  1TFA A;  2FYI A;  1SYH A;  2ONS A;  4NMY A;  4YB7 A;  1J1N A;  3MVW A;  2P1S A;  4AB5 A;  3S9N C;  3KZG A;  2X26 A;  1US5 A;  4R6K A;  4G8N A;  4H1X A;  5EYF A;  4Z0I A;  1XVY A;  1XS5 A;  1IIT A;  2W7Y A;  4F31 B;  2AYS A;  2HQ0 A;  2OWT A;  2ONR A;  1TFD A;  5I59 A;  1MQG A;  1OQH A;  4F1V A;  5DEX B;  2F7B A;  3GZG A;  4PP0 A;  3T9X B;  2GHA A;  1VR5 A;  4YMA A;  4NE4 A;  3FVG A;  1XT8 A;  4ZS9 A;  1B4H A;  2O6A A;  1QUI A;  4IO6 A;  2DXR A;  2I0B A;  3K2D A;  3TCF A;  3CVG A;  2V3T A;  4JSO A;  3FIR A;  2PMS A;  2DXY A;  1Q35 A;  4X9T A;  5TP9 A;  2QMW A;  4DLD A;  1NNP A;  3EHT A;  3K6V A;  1NL5 A;  2OWS A;  4GL0 A;  3U8Q A;  4ZZA A;  2O84 X;  3BBR A;  5I57 B;  4JB7 A;  1LGB C;  4ELO A;  4G8M A;  2HEU A;  5J1D A;  4N6P A;  1S7Y A;  1Y4C A;  1WDN A;  2XHD A;  2GH9 A;  4YIC A;  1B3G A;  3OEN A;  1PBQ A;  4R75 A;  3H7M A;  2UVJ A;  1P99 A;  3ZSF A;  2F6G A;  4OEN A;  3Q29 A;  4YKK A;  4O3A A;  3UIF A;  2XX7 A;  3BFT A;  3FD3 A;  3PPR A;  2WKY A;  3QSL A;  1Z7M E;  4KI0 E;  4H5F A;  1XHY A;  2I58 A;  2QS1 A;  5AA1 A;  3UA8 A;  2H25 A;  3LSF B;  3M3F A;  4ESW A;  2Z23 A;  1FTJ A;  2ESN A;  1R9Q A;  4RK9 A;  4H6D A;  3WAE A;  3FVN A;  4DXB A;  1N76 A;  4LQ2 A;  1IZ1 A;  3B6T A;  2DSF A;  4QFK A;  4HTG A;  1F9B A;  2QMX A;  3FGS A;  2E1S A;  3TAJ A;  1H43 A;  1LCT A;  1BP5 A;  3MVX A;  4R9G A;  3PMX A;  1ELJ A;  3DLN A;  3IOU A;  4ZEB A;  4LON B;  3PPQ A;  3C35 A;  1I6B A;  3B6W A;  2HZL A;  1B46 A;  3IJO B;  1AIV A;  4F19 A;  3S9L C;  3T9H B;  3EQ1 A;  3MQ9 A;  4UAC A;  5AE4 A;  3PPN A;  4R9F A;  5DVI A;  3IR1 A;  4HW8 A;  2Y84 A;  2A5T A;  2R6G E;  2DYX A;  1MPD A;  2YPN A;  3K6U A;  5DVF A;  1ZIU A;  3UN6 A;  2HZK A;  4R6Y A;  1ZJL A;  3PUX E;  4PQJ A;  4RXL A;  4IO5 A;  4FOR A;  3QAX A;  1GGG A;  2GHB A;  2I49 A;  4LUB A;  2UYF A;  2B3B A;  1MPC A;  5KCJ A;  4RJZ A;  3FVO A;  3TMG A;  1EH3 A;  4POW A;  4RY1 A;  5A5X B;  4OET A;  4OHN A;  3DEL B;  1O63 A;  2O68 A;  4U22 A;  2QPQ A;  4KYS A;  4ONY A;  2THI A;  4LZ5 A;  1MXU A;  2X7Q A;  2FNC A;  3C32 A;  4C1T A;  4U2R A;  1XC1 A;  1MS7 A;  2Y7P A;  4L17 A;  3C9H A;  1H76 A;  2DWI A;  3HHG A;  4JSD A;  4ECF A;  5I58 B;  1SBP A;  2DE2 A;  1NNF A;  1B3L A;  3TYH A;  1B05 A;  2F7C A;  1UTB B;  1GTK A;  2XXX A;  4JWX A;  2AIX A;  4I1D A;  2ZNT A;  3IOV A;  2RC9 A;  2E0S A;  4WED A;  2AL5 A;  3B6Q A;  4KR5 A;  3W15 C;  5CMB A;  3O97 A;  2RKM A;  3G7W A;  1URG A;  1Y1M A;  4ZEK A;  5K2Y A;  3T9V A;  1OIB A;  1HSL A;  5L9S A;  3A3U A;  2RIN A;  5I2K B;  4BDL A;  4QSC A;  3FJM A;  3PD8 A;  4EQB A;  1UTH B;  3FXR A;  3SET A;  1M5B A;  1P1W A;  3PMW A;  5I2N A;  3THI A;  4U1Z A;  4P0G A;  1URS A;  3HV1 A;  4R73 A;  5H8F B;  2IA4 A;  1AL3 A;  3MW0 A;  4XXU A;  3IOR A;  3FXQ A;  3K1P A;  4QFP A;  3IX1 A;  2O7U A;  4RK2 A;  2V25 A;  2DVZ A;  4TOZ A;  3VXB A;  3I5O A;  2GFE A;  2QS2 A;  1ANF A;  1OQG A;  3K6W A;  3SEX A;  3H6T A;  2ZMB A;  1EZP A;  1N3X A;  3RT8 A;  3N6T A;  1MRP A;  1USY E;  1YCJ A;  1MXY A;  3O6I A;  2YJP A;  2IEE A;  5KZT A;  3U72 A;  4FED A;  1TT1 A;  3G3H A;  4F29 A;  4O3C A;  4GLI A;  3S4U A;  3IAZ A;  2CZL A;  3CG3 A;  2D5W A;  3E9X A;  3OXN A;  2D21 A;  1B40 A;  5HPQ A;  4ZEF A;  2ANJ A;  4ZDM A;  1B58 A;  4E0W A;  1FQB A;  4WKM A;  4AB6 A;  3TTN A;  3S9E A;  1FTO A;  3EHU A;  5CMC A;  1B1X A;  2DQV A;  1QJM A;  1FTL A;  3TTM A;  2RC7 A;  4XKR A;  4H8J A;  4H5G A;  4EF1 A;  3HHF A;  1A8E A;  3W9W A;  2Q8J A;  3MZB A;  5L8D A;  1NH8 A;  1Y4T A;  4WXJ A;  2Y7R A;  5ITP A;  4YKI A;  4R6H A;  2ZNU A;  2OLB A;  5DVJ A;  2VGQ A;  3UOR A;  5TPA A;  1IQ7 A;  2DWH A;  4DXU A;  5B70 A;  3T9U A;  2I3V A;  5AA2 A;  3N6U A;  4TLL B;  4O3B A;  5H8H B;  4GXS B;  1PEB A;  1PDA A;  1Y1Z A;  1LFI A;  3QUJ A;  2I0C A;  4DDD A;  1VE4 A;  3ZKL A;  1B3E A;  5H8Q B;  5JK4 A;  3C31 A;  2Z22 A;  1B52 A;  2XD3 A;  3TTL A;  4FAJ A;  4YMB A;  1B32 A;  3MP8 A;  5KDT B;  1QKA A;  1N04 A;  1DTG A;  1RYX A;  5F7V A;  5I56 A;  1H44 A;  4BDQ A;  1URD A;  2X7P A;  3ECR A;  4XKN A;  2HXW A;  4U4X A;  2QS3 A;  3FJ7 A;  4KHZ E;  4BDO A;  1SD3 A;  4DE8 A;  5AA4 A;  3IOW A;  1B5J A;  2R71 A;  1B0H A;  3HPI A;  3CR9 A;  1B3H A;  5F1Q A;  3V5A A;  3MZ1 A;  3C34 A;  4OYV A;  4JWO A;  3B7D A;  4G68 B;  3ONM A;  1DPP A;  5EHS A;  4F39 A;  5ELV A;  2ZYK A;  1EZO A;  2ZYO A;  3IOT A;  2ZXT A;  1MY0 A;  1D3K A;  4OZ9 A;  5L9O A;  2B3F A;  2H4I A;  3SER A;  2BJJ X;  3TEP A;  3LSL A;  1DMB A;  4NED A;  3S9M C;  2F6P A;  1A8F A;  5DEX A;  1LBB A;  1GV8 A;  4ZEI A;  3JYR A;  3BKI B;  4F1Y A;  3SEU A;  3T22 A;  2OJT A;  3SEV A;  5JEI A;  4KCD A;  2OZZ A;  3G3I A;  3MP1 A;  1MQJ A;  4KQP A;  4G4P A;  2XXQ A;  1MXW A;  3K4U A;  3G3J A;  2RC8 A;  2HAV A;  1MQI A;  5AA3 A;  3OO9 A;  2PBW A;  2XXT A;  1O7T A;  4GVO A;  1QKB A;  4JBZ A;  4RPN A;  1SW5 A;  1JW1 A;  3VV5 A;  1R9L A;  3VFJ A;  3KGC A;  4N13 A;  4R74 A;  5IAI A;  3QYT A;  3GXA A;  3CSG A;  2CMO A;  5I57 A;  3A09 A;  3MVY A;  4IO4 A;  1B4Z A;  4P0I A;  4LP2 B;  1N0T A;  3ZS6 A;  5BUU A;  1LFG A;  4GRK A;  1D4N A;  4OMB A;  5TP9 B;  4X48 A;  1NMU A;  1FQC A;  1MY2 A;  3QUF A;  4NF5 B;  4DIG A;  2I4B A;  1UQW A;  1POY 1;  2GRV A;  4X1D A;  1PB8 A;  4G2Z A;  3KFM A;  4GF8 A;  3D4G A;  2QL3 A;  2OCU A;  2RF1 A;  4MF3 A;  1IIW A;  3IJX B;  4NF6 B;  4BLA A;  3VDF A;  4FE8 A;  5I84 A;  2A5S A;  3KEI A;  5H8N B;  1SDX A;  3RN8 A;  1IUD A;  1YAE A;  4ZE8 A;  4YKJ A;  2AL4 A;  4GD5 A;  1AH5 A;  4ZEC A;  4H67 A;  4NF8 B;  1MH4 A;  1QUL A;  4IO3 A;  3FAS A;  3TDJ A;  3U94 A;  3N26 A;  5DT6 A;  1B0L A;  2FA7 A;  3EHS A;  3K02 A;  4OVJ A;  2O51 A;  1DTZ A;  2DWJ A;  4F3S A;  4MLV A;  1B51 A;  4ZED A;  5HBC A;  5CI5 A;  4Q0C A;  3MWB A;  3SKP A;  1POT A;  4MBP A;  1LAF E;  3KG2 A;  4G77 A;  3U92 A;  3UP9 A;  1MXX A;  2Z8F A;  4KFQ A;  4EUO A;  4AQ4 A;  1FQD A;  2HFB A;  1SW2 A;  2F78 A;  4KCC A;  2V84 A;  3O2A A; 
#chains in the Genus database with same CATH topology
 3A3C A;  3CFL A;  4ND9 A;  1RYO A;  4MFI A;  3LV0 A;  2NOO A;  3Q26 A;  4MCO A;  1VFE A;  4NN3 A;  5M2V A;  3WAF A;  1A40 A;  4K3F A;  2XXV A;  2REJ A;  4N4U A;  1KA1 A;  5A5X A;  3RY3 A;  3Q28 A;  2Q2C A;  1DCU A;  2F36 A;  1USY H;  4ZE9 A;  2DWA A;  3MZ9 A;  2DS9 A;  4PF8 A;  3PPP A;  3C36 A;  1Q9D A;  2DDK A;  2DVC A;  3KBR A;  2ONK E;  3CFZ A;  4IGT A;  2F97 A;  4LZ8 A;  3EPE A;  3LUY A;  3E78 A;  5I58 A;  1ZU0 A;  1ATG A;  2XXP A;  3RPW A;  2XWK A;  2PT1 A;  1UTB A;  1D9Y A;  3FXU A;  3K00 A;  4JDF A;  1B5H A;  3GBA A;  3FBP A;  2JJK A;  2WBD A;  5EHM A;  5ET8 A;  4OVP A;  4PAI A;  2ABH A;  4OEU A;  4DI3 D;  1LLS A;  4NF4 B;  1NV7 A;  1UIU A;  3MYU A;  4HCW A;  2LAO A;  5ET6 A;  5H8S A;  4U1O A;  1O64 A;  3V89 B;  2Q89 A;  5FHN A;  4PFT A;  3KSJ A;  3HFU A;  5I2K A;  3RNN A;  3DP6 A;  4EF2 A;  1UTH A;  3BIG A;  3G3K A;  3FJG A;  3OEM A;  4QXD A;  1EU8 A;  1I6Q A;  1Y3P A;  1NV2 A;  4C0R A;  3QK6 A;  4DCX A;  4OEV A;  5H8F A;  4E0X A;  1ZMG A;  3O9P A;  4I62 A;  3O6G A;  4GWS A;  2PVU A;  2V3Q A;  4PFU A;  1MQH A;  4PCD A;  1I6A A;  1GR2 A;  1FBP A;  2P3V A;  5JTY B;  1B7U A;  2OBG A;  5EQ7 A;  3L6G A;  3CSB A;  4PE5 B;  4TQU Q;  5I3S A;  4PE3 A;  4THI A;  2Z8D A;  3R26 A;  4LN5 A;  4MNI A;  5FHM A;  3T66 A;  3TQL A;  4IO2 A;  3USD A;  3Q25 A;  2Q9T A;  4KPT A;  3O6H A;  2VD3 A;  4F18 A;  1FPE A;  2ZYN A;  3CIJ A;  4QF9 A;  4F3G A;  3ZKK A;  1B7Z A;  1SW1 A;  2FVZ A;  4GWU A;  4YB6 A;  1FJ9 A;  2XXY A;  1B5I A;  3OEL A;  1L5T A;  3MUQ A;  3QMF A;  3R6U A;  2F8D A;  4ISU A;  3FV2 A;  1LEV A;  3T1B A;  5CMM A;  3EKI A;  2UXA A;  3UK4 A;  1MDP 1;  4GX3 A;  4U23 A;  4KD5 A;  3TUS A;  1EZ9 A;  1BKA A;  1FBD A;  5DTB A;  2XD2 A;  2D3I A;  2G93 A;  1VDW A;  4U21 A;  1FQE A;  4QFL A;  1P1O A;  4XIG Q;  1A54 A;  3PU5 A;  3E79 A;  3FAT A;  1D9V A;  3PUW E;  4QFN A;  1R6Z A;  2QJE A;  1DPE A;  5ET7 A;  4EXK A;  2KLF A;  4GBW A;  4YAH X;  1QGX A;  1RKM A;  1Q1K A;  3E13 X;  1S9T A;  4FEC A;  1BIY A;  4R72 A;  1N84 A;  2RCB A;  1FPG A;  3KOS A;  3SES A;  1SI1 A;  1IXG A;  1QUJ A;  5I5P A;  2FHY A;  4G8H A;  4I3E A;  2VHA A;  2VOZ A;  3ROJ A;  3N5L A;  5CMK A;  4KYD A;  2ZZW A;  3K01 A;  4HXV A;  3FUZ A;  1KA0 A;  5H8Q A;  4EDP A;  1CNQ A;  3U1O A;  4LA9 A;  1NUZ A;  2PX1 A;  1JNF A;  3KJT A;  1LAX A;  3LBS A;  4HE1 A;  1IXC A;  5KDT A;  2H5Y A;  3U93 A;  5TU0 A;  3RGY A;  3F11 A;  3CG1 A;  5IM2 A;  3TEL A;  1HSE A;  3GLB A;  3ISP A;  1H45 A;  3IB2 A;  1A99 A;  5IKB A;  2XXI A;  3PD9 A;  2XXR A;  3QIM A;  4IY6 A;  1MH3 A;  4PBQ A;  3IO6 A;  1PBP A;  1H3D A;  3SZP A;  2QS4 A;  2ALU A;  2V3U A;  2I6E A;  4YKP A;  2Y5L A;  4G68 A;  5LOM A;  4N81 A;  3E4R A;  2XWO A;  3FZV A;  5I56 B;  4P9K A;  4EQ7 A;  1Y3N A;  3T93 B;  2RCA A;  1Y9U A;  1NV6 A;  2Y7I A;  3G3F A;  4G68 C;  1LFH A;  3VLU A;  3V83 A;  2I48 A;  2O7I A;  5ICT A;  5AA4 B;  1N3W A;  4M4G A;  2Z8E A;  2R9J A;  2ZZV A;  2QVR A;  3OEK A;  1NV5 A;  1SYI A;  3PV0 E;  3MBP A;  2B65 A;  3VVE A;  1NUW A;  3PPO A;  1DOT A;  4OA4 A;  4GX6 A;  3VE1 B;  1LBC A;  2P0S A;  5I59 B;  4JVC A;  1FCK A;  4OWD A;  4QFO A;  1B1H A;  2QFL A;  2XXW A;  1IMF A;  4QHQ A;  1NH7 A;  1ZKB A;  3OO8 A;  2PT2 A;  4LQ5 A;  2FIE A;  3Q27 A;  1IEJ A;  3L6H A;  4F3B A;  1FSA A;  3GYY A;  1NKX A;  3A29 A;  3HN0 A;  1N7W A;  4OTE A;  3O66 A;  4N8G A;  4P47 A;  3B50 A;  3EF7 A;  4NF5 A;  2Y7K A;  3RPL A;  1NV0 A;  4R2B A;  4N8Y A;  1JEV A;  4AS4 A;  1B2H A;  1LB8 A;  2H9B A;  4MNP A;  1II5 A;  3MJN A;  3PUV E;  4F2O A;  4POX A;  3MP6 A;  1RDZ A;  2O1L A;  3OO6 A;  2QRY A;  4RNS A;  4FEB A;  4FAT A;  1OMP A;  4UA8 A;  4NF6 A;  1WOD A;  2V93 A;  3VVF A;  3MVZ A;  4F3P A;  4YZZ A;  1QVS A;  3PMV A;  1B6H A;  4TLM B;  3T96 B;  3S2V A;  1JW4 A;  4I40 A;  3V8X B;  5H8N A;  1G0I A;  1FTM A;  3TTR A;  2HHM A;  1OVB A;  4OER A;  3SDF A;  3D4C A;  4GXA A;  3RQT A;  4PFI A;  4EXL A;  1LAG E;  4NF8 A;  5EYG A;  2F7A A;  1PC3 A;  1ZLQ A;  3KOT A;  1LBY A;  2HXR A;  3LSW A;  4N07 A;  1JW5 A;  2VD2 A;  1VFD A;  2QSX A;  2XX8 A;  1P1Q A;  4PC9 A;  4FJP A;  2NWJ A;  2DE4 A;  1CB6 A;  1SVX B;  1M5F A;  3I3V A;  3IFC A;  4MLQ A;  5ISU A;  3IB1 A;  4JWY A;  4GX4 A;  4IB2 A;  3K0V A;  2Q2A A;  3E3K A;  3CRB A;  3QXM A;  1B7H A;  4MHF A;  1S50 A;  1M5E A;  1P1U A;  4GIZ A;  4BDR A;  2V4C A;  1MY3 A;  4X8R A;  4O7I A;  1JVY A;  4IO7 A;  1FPL A;  4U4S A;  5FHO A;  1OLA A;  3MPK A;  3FVK A;  1K9Z A;  2P3N A;  2DE3 A;  1KWH A;  3MAM A;  3CI8 A;  2H98 A;  1QW0 A;  3I6V A;  3W9V A;  1OVT A;  1B9J A;  1JP4 A;  1YZ0 A;  4BDN A;  1AMF A;  2O69 A;  4ELQ A;  1JQF A;  2I3W A;  2XXH A;  2Y5K A;  4EQ9 A;  1TXF A;  4PGP A;  1R1N A;  3C4M A;  2ZYM A;  4N6K A;  3MST A;  4MH5 A;  1FPB A;  4H8I A;  3MC2 A;  5K2X A;  2G29 A;  2QVU A;  3TTK A;  2UVH A;  2A5T B;  4NG7 A;  4P11 A;  1OLC A;  3RYD A;  2HAU A;  4RYA A;  3H6W A;  2BJI A;  1BK4 A;  1MXV A;  1PB7 A;  2MKZ A;  2ZNS A;  2L5V A;  4GOT A;  1A7L A;  4FIM A;  3AXF A;  5FTH A;  1MY1 A;  1P1N A;  2PFZ A;  3CFX A;  3SEW A;  1FPI A;  1TWY A;  1T0K A;  3OMB A;  4NWD A;  1NI9 A;  5EQ8 A;  3K6X A;  1NFT A;  3LC8 A;  4M1V A;  1AWB A;  1A55 A;  5KCJ B;  4P1E A;  1VSO A;  4GWY A;  1MXZ A;  4GWO A;  3IO4 A;  4QSE A;  3K1M A;  5A5L A;  3HCQ A;  4NWC A;  3VLW A;  3LR1 A;  1MPB A;  4OFJ A;  1FQA A;  3TOD A;  3H6U A;  3ODB A;  1IMD A;  1PB9 A;  4NF4 A;  3G3G A;  3MPL A;  4HE2 A;  3JV9 A;  3OO7 A;  4X1B A;  4IGR A;  4BDM A;  1LB9 A;  4N91 A;  3VVD A;  4LAT A;  4ESX A;  3C33 A;  4PET A;  4PDD A;  4OFL A;  3R7X A;  3KN7 A;  3PUZ E;  3DP4 A;  5DYH A;  4C1U A;  2DOJ A;  2P2A A;  5CRY A;  3SEY A;  1YTV A;  4XTC Q;  1FW0 A;  2ZZX A;  2OK2 A;  4YB5 A;  5IZ1 A;  4QSD A;  1BTJ A;  4Z7E A;  1JVX A;  2XX9 A;  3RT6 B;  1YXI A;  2H99 A;  1IXI A;  3O29 A;  1NNK A;  4HS7 A;  2REG A;  4MMP A;  4OVS A;  3TCH A;  4QRZ A;  3VLV A;  3JZJ A;  2F5X A;  5JTY A;  5ITO A;  3KN8 A;  4F22 A;  3OSQ A;  5I2N B;  4R2F A;  4XKQ A;  4ELR A;  1BLF A;  1Z7N E;  2XXU A;  1JEU A;  1IXH A;  5BWJ A;  3H3G A;  3HST A;  3H4Z A;  2F34 A;  2M8C A;  3OD7 A;  2NVU B;  3RTF B;  1MM7 A;  3H6V A;  3EN3 A;  4O7M A;  1FTK A;  2NXO A;  3M3L A;  3P7I A;  3TFL A;  4I8C A;  1XOC A;  3RTW B;  1M5C A;  1SI0 A;  4ELP A;  5B7D A;  2HCA A;  4GL8 A;  2DP8 A;  2CZK A;  3H03 A;  5IZ3 B;  1MM6 A;  1SQY A;  2YLN A;  1US4 A;  2VP1 A;  1ZBM A;  2UVI A;  5CBR A;  4MEV A;  1Y3Q A;  2PYY A;  1N7X A;  1QUK A;  4GWX A;  4OFO A;  4NHB A;  3K1N A;  1XVX A;  3BFU A;  1WVJ A;  4NTL A;  2KR0 A;  4YU0 A;  5CC2 A;  1B3F A;  3OOA A;  4I9D A;  2Q88 A;  3KBZ A;  1FBC A;  4JXI A;  4Q8R A;  1FPK A;  4HE0 A;  4DCY A;  4GWZ A;  4IY5 A;  2NUV A;  2CZH A;  3DM0 A;  4DZ1 A;  4H0W A;  4WEP A;  4GFR A;  4PFY A;  5H8H A;  5L9M A;  1KZ8 A;  3HO7 A;  3RLF E;  1LAH E;  4UAB A;  1JET A;  3M3K A;  3PGF A;  3LUZ A;  2XWI A;  1SW4 A;  3OSR A;  1HSJ A;  4DI4 B;  5CBS A;  1MY4 A;  1IMB A;  3GBB A;  2XXK A;  1FQF A;  1NNT A;  1ZTY A;  3DP8 A;  4LVQ A;  4Q5T A;  5CM6 A;  3TKD A;  5TPA B;  1CE2 A;  3KJ7 A;  4F1U A;  4PFW A;  1MDQ A;  2OWZ A;  4RPO A;  4LZ7 A;  5AA2 B;  5HM4 B;  5I7I A;  1I69 A;  4OQO A;  4NAP A;  3LSX A;  4MIJ A;  1UIV A;  3O28 A;  3H06 B;  3N94 A;  4OXV A;  2Y7W A;  3M8U A;  1EYJ A;  3TCG A;  4ZZE A;  3IL1 B;  2I4C A;  1YPN A;  1LST A;  3ILU B;  3IK6 B;  2O1M A;  2F35 A;  2UVG A;  4DXC A;  4F2Q A;  3RUM A;  4GQO A;  3TPA A;  4OES A;  3VXC A;  3UGW A;  4H65 A;  4RA1 A;  5AA2 D;  4Q30 B;  3KN3 A;  3TZA A;  1NV4 A;  1MG1 A;  1M5D A;  5T3J A;  5ICQ A;  4KYE A;  3KSX A;  4O8M A;  1LCF A;  3FV1 A;  1AOV A;  2UYE A;  1EYK A;  4HCY A;  4XKP A;  1GVC A;  5FTI A;  3PUY E;  3IB0 A;  3TQW A;  1Y20 A;  3ILT B;  1DSN A;  1MQD A;  1TFA A;  2FYI A;  1SYH A;  2B4L A;  2ONS A;  4NMY A;  1EYI A;  4YB7 A;  2FBP A;  5EQA A;  1J1N A;  3MVW A;  2P1S A;  4AB5 A;  3IFA A;  3S9N C;  2F3B A;  2OX3 A;  2X26 A;  3KZG A;  1US5 A;  4R6K A;  4G8N A;  4H1X A;  5EYF A;  4Z0I A;  1XVY A;  4OAN A;  1XS5 A;  1IIT A;  4XEQ A;  2W7Y A;  4F31 B;  2AYS A;  2HQ0 A;  2OWT A;  2ONR A;  1DK4 A;  1TFD A;  5I59 A;  1MQG A;  1OQH A;  4F1V A;  5DEX B;  2F7B A;  3GZG A;  2VPO A;  4PP0 A;  3T9X B;  4X04 A;  1G0H A;  2GHA A;  1VR5 A;  4YMA A;  4NE4 A;  3FVG A;  1XT8 A;  4ZS9 A;  1B4H A;  2O6A A;  1QUI A;  4IO6 A;  2DXR A;  2I0B A;  3K2D A;  3TCF A;  3CVG A;  2V3T A;  4JSO A;  4H46 A;  3FIR A;  2PMS A;  2DXY A;  1Q35 A;  4X9T A;  1RDY A;  5TP9 A;  4GBV A;  1NV1 A;  2QMW A;  4DLD A;  5ET5 A;  1NNP A;  3EHT A;  3K6V A;  1NL5 A;  2OWS A;  4GL0 A;  3U8Q A;  4ZZA A;  2O84 X;  3BBR A;  5I57 B;  4JB7 A;  1LGB C;  4ELO A;  4G8M A;  2HEU A;  5J1D A;  4N6P A;  1S7Y A;  1Y4C A;  1WDN A;  2XHD A;  2GH9 A;  4YIC A;  2WEF A;  1B3G A;  3OEN A;  1PBQ A;  1LBW A;  4R75 A;  3H7M A;  2UVJ A;  2Q8M A;  1P99 A;  3ZSF A;  2F6G A;  4OEN A;  3Q29 A;  4YKK A;  4O3A A;  3UIF A;  2XX7 A;  3BFT A;  4PGN A;  3FD3 A;  4N15 A;  3PPR A;  2QVV A;  2WKY A;  3QSL A;  1Z7M E;  4KI0 E;  3U65 A;  4H5F A;  1XHY A;  2I58 A;  3BIH A;  2QS1 A;  5AA1 A;  3UA8 A;  2H25 A;  3LSF B;  3M3F A;  4ESW A;  2Z23 A;  1FTJ A;  2ESN A;  1R9Q A;  4RK9 A;  4H6D A;  3WAE A;  3FVN A;  4DXB A;  4OVQ A;  4XFE A;  1N76 A;  2R8T A;  4LQ2 A;  1IZ1 A;  1XI6 A;  3B6T A;  2DSF A;  4QFK A;  1FRP A;  4HTG A;  1F9B A;  1NUY A;  2QMX A;  4JVD A;  3FGS A;  2E1S A;  4OVT A;  3TAJ A;  1H43 A;  1LCT A;  1BP5 A;  4R9G A;  3MVX A;  3PMX A;  1ELJ A;  3DLN A;  3IOU A;  4ZEB A;  4LON B;  4P1L A;  3PPQ A;  3C35 A;  1I6B A;  1LBZ A;  3B6W A;  2HZL A;  1B46 A;  3IJO B;  1AIV A;  4F19 A;  3S9L C;  3T9H B;  3EQ1 A;  3MQ9 A;  4UAC A;  5AE4 A;  3PPN A;  4R9F A;  1YYZ A;  3IR1 A;  5DVI A;  4HW8 A;  2Y84 A;  2A5T A;  2R6G E;  2DYX A;  1MPD A;  3KC1 A;  2YPN A;  2F3D A;  3K6U A;  5DVF A;  1ZIU A;  3UN6 A;  2HZK A;  4R6Y A;  1LBV A;  4MX6 A;  1ZJL A;  3PUX E;  4PQJ A;  4RXL A;  4MNC A;  4IO5 A;  4FOR A;  3QAX A;  1GGG A;  2GHB A;  2I49 A;  4LUB A;  2UYF A;  2B3B A;  1MPC A;  5KCJ A;  4RJZ A;  1IMC A;  3FVO A;  3TMG A;  1EH3 A;  4POW A;  4RY1 A;  5A5X B;  4OET A;  4OHN A;  3DEL B;  1O63 A;  2O68 A;  4U22 A;  2QPQ A;  4KYS A;  4ONY A;  2THI A;  4LZ5 A;  1MXU A;  2X7Q A;  2FNC A;  3C32 A;  4C1T A;  4U2R A;  1XC1 A;  1MS7 A;  2Y7P A;  4L17 A;  3C9H A;  1H76 A;  2DWI A;  3HHG A;  4JSD A;  4PFR A;  5IZZ A;  4ECF A;  5EQ9 A;  5I58 B;  1SBP A;  2DE2 A;  5DW8 A;  4H45 A;  1NNF A;  1B3L A;  3TYH A;  1B05 A;  2F7C A;  1UTB B;  1GTK A;  2XXX A;  4JWX A;  2AIX A;  4I3Y A;  4I1D A;  2ZNT A;  3IOV A;  2RC9 A;  2E0S A;  3NOH A;  4WED A;  2AL5 A;  3B6Q A;  4KR5 A;  3W15 C;  4NQ8 A;  4PTK A;  5CMB A;  5FBP A;  1NV3 A;  3O97 A;  2RKM A;  3G7W A;  1FPJ A;  1URG A;  1Y1M A;  4ZEK A;  5K2Y A;  3T9V A;  1OIB A;  1HSL A;  5L9S A;  3A3U A;  2RIN A;  5I2K B;  4BDL A;  1FBG A;  4QSC A;  4PAK A;  3FJM A;  3PD8 A;  4EQB A;  1UTH B;  3FXR A;  3SET A;  1M5B A;  1P1W A;  3PMW A;  5I2N A;  2HPG A;  3THI A;  4U1Z A;  4P0G A;  1URS A;  3HV1 A;  4R73 A;  5H8F B;  2IA4 A;  1AL3 A;  3MW0 A;  1IME A;  3IOR A;  4XXU A;  3FXQ A;  3K1P A;  4QFP A;  3IX1 A;  2O7U A;  4RK2 A;  2V25 A;  2DVZ A;  4TOZ A;  3VXB A;  3I5O A;  2GFE A;  5LDZ A;  2QS2 A;  1ANF A;  1OQG A;  3K6W A;  4PDH A;  3SEX A;  3H6T A;  2ZMB A;  1EZP A;  1N3X A;  3RT8 A;  3N6T A;  1MRP A;  2CZI A;  1USY E;  1YCJ A;  1MXY A;  3O6I A;  1NUX A;  2YJP A;  5F24 A;  2IEE A;  5KZT A;  3U72 A;  4FED A;  1TT1 A;  2PFY A;  3G3H A;  4F29 A;  4O3C A;  2VT5 A;  4GLI A;  5IZ3 A;  3S4U A;  3IAZ A;  2CZL A;  3CG3 A;  3KC0 A;  2D5W A;  4MJO A;  3E9X A;  3OXN A;  2D21 A;  1B40 A;  5HPQ A;  4ZEF A;  1FBE A;  2ANJ A;  5EYH A;  4ZDM A;  1B58 A;  4E0W A;  2PCR A;  1FQB A;  4WKM A;  4AB6 A;  3TTN A;  3S9E A;  1FTO A;  2WBB A;  3EHU A;  5CMC A;  1B1X A;  4XF5 A;  2DQV A;  1QJM A;  1FTL A;  3TTM A;  2RC7 A;  4PAF A;  4XKR A;  4H8J A;  1INP A;  3PTY A;  2XWV A;  4H5G A;  4EF1 A;  3HHF A;  1A8E A;  3W9W A;  4P3L A;  2Q8J A;  3MZB A;  5L8D A;  1K9Y A;  1NH8 A;  1Y4T A;  4WXJ A;  2Y7R A;  5ITP A;  4YKI A;  4R6H A;  2ZNU A;  2OLB A;  5DVJ A;  2VGQ A;  3UOR A;  2WX9 A;  5TPA A;  1IQ7 A;  2DWH A;  4DXU A;  5B70 A;  3T9U A;  2I3V A;  5AA2 A;  3N6U A;  4PBH A;  4TLL B;  1D9Q A;  4O3B A;  5H8H B;  2CEX A;  1PEB A;  4GXS B;  1PDA A;  1Y1Z A;  1LFI A;  3QUJ A;  2WYK A;  2I0C A;  4DDD A;  1VE4 A;  3ZKL A;  1B3E A;  5H8Q B;  5JK4 A;  3C31 A;  2CEY A;  2Z22 A;  1B52 A;  2XD3 A;  3TTL A;  4FAJ A;  4YMB A;  1B32 A;  3MP8 A;  5KDT B;  1QKA A;  1N04 A;  5ESY A;  4PFB A;  1DTG A;  4AS5 A;  1RYX A;  5F7V A;  5I56 A;  1H44 A;  4BDQ A;  1URD A;  2X7P A;  3ECR A;  4XKN A;  2HXW A;  4MAG A;  4U4X A;  2QS3 A;  3FJ7 A;  4KHZ E;  4BDO A;  1SD3 A;  4DE8 A;  5AA4 A;  3IOW A;  1B5J A;  2R71 A;  1B0H A;  3HPI A;  3CR9 A;  1B3H A;  1LBX A;  5F1Q A;  3V5A A;  2Q74 A;  3MZ1 A;  3C34 A;  4OYV A;  4JWO A;  1SPI A;  3B7D A;  4G68 B;  3ONM A;  1DPP A;  5EHS A;  4F39 A;  5ELV A;  2ZYK A;  1EZO A;  2ZYO A;  3IOT A;  2ZXT A;  1MY0 A;  1D3K A;  4OZ9 A;  5L9O A;  2B3F A;  4N17 A;  2H4I A;  3SER A;  2BJJ X;  4FBP A;  3TEP A;  3LSL A;  1DMB A;  3T0J A;  4NED A;  3S9M C;  2F6P A;  1A8F A;  5DEX A;  1LBB A;  1FJ6 A;  1GV8 A;  4ZEI A;  3JYR A;  2GQ1 A;  3BKI B;  4F1Y A;  3SEU A;  3T22 A;  4PF6 A;  2OJT A;  3SEV A;  5JEI A;  4KCD A;  2OZZ A;  3G3I A;  1FBF A;  4IR8 A;  3MP1 A;  1MQJ A;  4KQP A;  4G4P A;  2XXQ A;  1MXW A;  4JVI A;  3K4U A;  3G3J A;  2RC8 A;  2HAV A;  1MQI A;  3D1R A;  1FBH A;  5AA3 A;  3OO9 A;  2PBW A;  2XXT A;  1O7T A;  4GVO A;  1QKB A;  4JBZ A;  4OVR A;  4RPN A;  1SW5 A;  4KXP A;  1JW1 A;  3VV5 A;  1R9L A;  3VFJ A;  3KGC A;  4N13 A;  4R74 A;  5IAI A;  4P8B A;  3QYT A;  3GXA A;  3CSG A;  2CMO A;  5I57 A;  3A09 A;  3MVY A;  4IO4 A;  2B4M A;  1B4Z A;  4P0I A;  1FTA A;  4LP2 B;  1N0T A;  3ZS6 A;  5BUU A;  1LFG A;  4GRK A;  1D4N A;  4OMB A;  3B8B A;  5TP9 B;  4X48 A;  1NMU A;  1FQC A;  4N6D A;  1MY2 A;  3QUF A;  2WYP A;  1DBZ A;  4NF5 B;  4DIG A;  2I4B A;  1UQW A;  3RPL B;  4NF0 A;  1POY 1;  2GRV A;  4X1D A;  1PB8 A;  4G2Z A;  3KFM A;  4GF8 A;  3D4G A;  1FPD A;  4QBA A;  2QL3 A;  2OCU A;  3FXB A;  2RF1 A;  4MF3 A;  1IIW A;  3IJX B;  4NF6 B;  4BLA A;  1RDX A;  4GWW A;  3VDF A;  4FE8 A;  5I84 A;  2A5S A;  3KEI A;  4NX1 A;  5H8N B;  1SDX A;  2XA5 A;  3RN8 A;  1IUD A;  1YAE A;  4ZE8 A;  4YKJ A;  2AL4 A;  4GD5 A;  1AH5 A;  4ZEC A;  2VPN A;  5LTC A;  4H67 A;  4NF8 B;  3CHG A;  1MH4 A;  1QUL A;  4IO3 A;  3FAS A;  3TDJ A;  3U94 A;  4O94 A;  3N26 A;  5DT6 A;  2KQZ A;  1B0L A;  2FA7 A;  3EHS A;  3K02 A;  4OVJ A;  2O51 A;  1DTZ A;  2DWJ A;  4F3S A;  4MLV A;  1B51 A;  4ZED A;  4P56 A;  5HBC A;  5CI5 A;  4Q0C A;  3MWB A;  3SKP A;  1POT A;  4MBP A;  1LAF E;  3KG2 A;  4G77 A;  1IMA A;  4G61 A;  3U92 A;  5J16 A;  5IGA A;  3UP9 A;  1MXX A;  2Z8F A;  4NGU A;  4KFQ A;  4EUO A;  2FIX A;  4AQ4 A;  1FQD A;  2HFB A;  1SW2 A;  2F78 A;  4KCC A;  1FPF A;  3O2A A;  2V84 A; 
#chains in the Genus database with same CATH homology
 3A3C A;  3CFL A;  4ND9 A;  1RYO A;  4MFI A;  2NOO A;  3Q26 A;  1VFE A;  5M2V A;  3WAF A;  1A40 A;  4K3F A;  2XXV A;  2REJ A;  5A5X A;  3RY3 A;  3Q28 A;  2Q2C A;  2F36 A;  1USY H;  4ZE9 A;  2DWA A;  3MZ9 A;  2DS9 A;  3PPP A;  3C36 A;  2DVC A;  3KBR A;  2ONK E;  3CFZ A;  4IGT A;  2F97 A;  4LZ8 A;  3EPE A;  3LUY A;  5I58 A;  1ZU0 A;  1ATG A;  2XXP A;  3RPW A;  2PT1 A;  1UTB A;  1D9Y A;  3FXU A;  3K00 A;  4JDF A;  1B5H A;  3GBA A;  5EHM A;  2ABH A;  4OEU A;  1LLS A;  4NF4 B;  1UIU A;  4HCW A;  2LAO A;  5H8S A;  4U1O A;  1O64 A;  3V89 B;  2Q89 A;  5FHN A;  4PFT A;  3KSJ A;  5I2K A;  3RNN A;  3DP6 A;  4EF2 A;  1UTH A;  3G3K A;  3FJG A;  3OEM A;  1EU8 A;  1I6Q A;  1Y3P A;  4C0R A;  3QK6 A;  4DCX A;  4OEV A;  5H8F A;  4E0X A;  1ZMG A;  3O9P A;  4I62 A;  3O6G A;  2PVU A;  2V3Q A;  4PFU A;  1MQH A;  1I6A A;  1GR2 A;  5JTY B;  1B7U A;  2OBG A;  3L6G A;  3CSB A;  4PE5 B;  4TQU Q;  4THI A;  2Z8D A;  3R26 A;  5FHM A;  3T66 A;  3TQL A;  4IO2 A;  3USD A;  3Q25 A;  2Q9T A;  4KPT A;  3O6H A;  2VD3 A;  4F18 A;  2ZYN A;  3CIJ A;  4QF9 A;  4F3G A;  3ZKK A;  1B7Z A;  1SW1 A;  4YB6 A;  2XXY A;  1B5I A;  3OEL A;  1L5T A;  3MUQ A;  3R6U A;  2F8D A;  4ISU A;  3FV2 A;  5CMM A;  2UXA A;  3UK4 A;  1MDP 1;  4U23 A;  4KD5 A;  3TUS A;  1EZ9 A;  1BKA A;  5DTB A;  2XD2 A;  2D3I A;  2G93 A;  4U21 A;  1FQE A;  4QFL A;  1P1O A;  4XIG Q;  1A54 A;  3PU5 A;  3FAT A;  1D9V A;  3PUW E;  4QFN A;  1R6Z A;  2QJE A;  1DPE A;  4EXK A;  2KLF A;  4YAH X;  1RKM A;  1Q1K A;  3E13 X;  1S9T A;  4FEC A;  1BIY A;  4R72 A;  1N84 A;  2RCB A;  3KOS A;  3SES A;  1SI1 A;  1IXG A;  1QUJ A;  4G8H A;  2VHA A;  2VOZ A;  3N5L A;  5CMK A;  4KYD A;  3K01 A;  3FUZ A;  5H8Q A;  4EDP A;  3U1O A;  4LA9 A;  2PX1 A;  1JNF A;  3KJT A;  1LAX A;  3LBS A;  1IXC A;  5KDT A;  2H5Y A;  3U93 A;  5TU0 A;  3RGY A;  3F11 A;  3CG1 A;  3TEL A;  1HSE A;  3GLB A;  1H45 A;  3IB2 A;  1A99 A;  5IKB A;  2XXI A;  3PD9 A;  2XXR A;  3QIM A;  4IY6 A;  1MH3 A;  3IO6 A;  1PBP A;  1H3D A;  2QS4 A;  2ALU A;  2V3U A;  2I6E A;  4YKP A;  4G68 A;  5LOM A;  3E4R A;  3FZV A;  5I56 B;  4EQ7 A;  1Y3N A;  3T93 B;  2RCA A;  1Y9U A;  2Y7I A;  3G3F A;  4G68 C;  1LFH A;  3VLU A;  3V83 A;  2I48 A;  2O7I A;  5ICT A;  5AA4 B;  1N3W A;  4M4G A;  2Z8E A;  2R9J A;  3OEK A;  1SYI A;  3PV0 E;  3MBP A;  2B65 A;  3VVE A;  3PPO A;  1DOT A;  3VE1 B;  1LBC A;  2P0S A;  5I59 B;  1FCK A;  4OWD A;  4QFO A;  1B1H A;  2XXW A;  4QHQ A;  1NH7 A;  1ZKB A;  3OO8 A;  2PT2 A;  4LQ5 A;  3Q27 A;  1IEJ A;  3L6H A;  4F3B A;  1NKX A;  3HN0 A;  1N7W A;  4OTE A;  3O66 A;  3EF7 A;  4NF5 A;  2Y7K A;  4R2B A;  1JEV A;  1B2H A;  1LB8 A;  2H9B A;  1II5 A;  3MJN A;  3PUV E;  4F2O A;  4POX A;  3MP6 A;  2O1L A;  3OO6 A;  2QRY A;  4RNS A;  4FEB A;  4FAT A;  1OMP A;  4UA8 A;  4NF6 A;  1WOD A;  2V93 A;  3VVF A;  3MVZ A;  4F3P A;  4YZZ A;  1QVS A;  3PMV A;  1B6H A;  4TLM B;  3T96 B;  3S2V A;  1JW4 A;  3V8X B;  5H8N A;  1FTM A;  3TTR A;  1OVB A;  4OER A;  3SDF A;  3D4C A;  4GXA A;  3RQT A;  4EXL A;  1LAG E;  4NF8 A;  2F7A A;  1PC3 A;  1ZLQ A;  3KOT A;  3LSW A;  4N07 A;  1JW5 A;  2VD2 A;  1VFD A;  2QSX A;  2XX8 A;  1P1Q A;  4FJP A;  2NWJ A;  2DE4 A;  1CB6 A;  1SVX B;  1M5F A;  3I3V A;  4MLQ A;  5ISU A;  3IB1 A;  4JWY A;  4IB2 A;  3K0V A;  2Q2A A;  3E3K A;  3CRB A;  3QXM A;  1B7H A;  1S50 A;  1M5E A;  1P1U A;  4GIZ A;  4BDR A;  1MY3 A;  1JVY A;  4IO7 A;  4U4S A;  5FHO A;  1OLA A;  3MPK A;  3FVK A;  2DE3 A;  1KWH A;  3MAM A;  3CI8 A;  2H98 A;  1QW0 A;  3I6V A;  3W9V A;  1OVT A;  1B9J A;  4BDN A;  1AMF A;  2O69 A;  4ELQ A;  1JQF A;  2I3W A;  2XXH A;  4EQ9 A;  1TXF A;  1R1N A;  3C4M A;  2ZYM A;  4MH5 A;  4H8I A;  3MC2 A;  5K2X A;  2G29 A;  3TTK A;  2UVH A;  2A5T B;  4P11 A;  1OLC A;  2HAU A;  4RYA A;  3H6W A;  1PB7 A;  1MXV A;  2ZNS A;  4GOT A;  1A7L A;  4FIM A;  3AXF A;  5FTH A;  1MY1 A;  1P1N A;  3CFX A;  3SEW A;  1TWY A;  1T0K A;  3OMB A;  4NWD A;  3K6X A;  1NFT A;  3LC8 A;  4M1V A;  1A55 A;  5KCJ B;  1VSO A;  1MXZ A;  4GWO A;  3IO4 A;  4QSE A;  3K1M A;  3HCQ A;  4NWC A;  3VLW A;  3LR1 A;  1MPB A;  4OFJ A;  1FQA A;  3TOD A;  3H6U A;  3ODB A;  1PB9 A;  4NF4 A;  3G3G A;  3MPL A;  3JV9 A;  3OO7 A;  4X1B A;  4IGR A;  4BDM A;  1LB9 A;  3VVD A;  4LAT A;  4ESX A;  3C33 A;  4PET A;  4OFL A;  3R7X A;  3KN7 A;  3PUZ E;  3DP4 A;  5DYH A;  4C1U A;  2DOJ A;  2P2A A;  5CRY A;  3SEY A;  1YTV A;  4XTC Q;  1FW0 A;  2OK2 A;  4YB5 A;  4QSD A;  1BTJ A;  4Z7E A;  1JVX A;  2XX9 A;  3RT6 B;  2H99 A;  1IXI A;  3O29 A;  1NNK A;  4HS7 A;  2REG A;  3TCH A;  4QRZ A;  3VLV A;  3JZJ A;  2F5X A;  5JTY A;  5ITO A;  3KN8 A;  4F22 A;  3OSQ A;  5I2N B;  4R2F A;  4XKQ A;  4ELR A;  1BLF A;  1Z7N E;  2XXU A;  1JEU A;  1IXH A;  5BWJ A;  3H3G A;  3HST A;  3H4Z A;  2NVU B;  2F34 A;  2M8C A;  3OD7 A;  3RTF B;  1MM7 A;  3H6V A;  3EN3 A;  1FTK A;  2NXO A;  3M3L A;  3P7I A;  3TFL A;  4I8C A;  1XOC A;  3RTW B;  1M5C A;  1SI0 A;  4ELP A;  5B7D A;  2HCA A;  4GL8 A;  2DP8 A;  3H03 A;  1MM6 A;  1SQY A;  2YLN A;  1US4 A;  2VP1 A;  1ZBM A;  2UVI A;  5CBR A;  1Y3Q A;  2PYY A;  1N7X A;  1QUK A;  4OFO A;  3K1N A;  1XVX A;  3BFU A;  1WVJ A;  4NTL A;  4YU0 A;  5CC2 A;  1B3F A;  3OOA A;  4I9D A;  2Q88 A;  4JXI A;  4Q8R A;  4DCY A;  4IY5 A;  2NUV A;  3DM0 A;  4DZ1 A;  4H0W A;  4WEP A;  4GFR A;  4PFY A;  5H8H A;  5L9M A;  3HO7 A;  3RLF E;  1LAH E;  1JET A;  3M3K A;  3PGF A;  1SW4 A;  3OSR A;  1HSJ A;  5CBS A;  1MY4 A;  3GBB A;  1FQF A;  1NNT A;  1ZTY A;  3DP8 A;  4LVQ A;  4Q5T A;  5CM6 A;  3TKD A;  5TPA B;  1CE2 A;  3KJ7 A;  4F1U A;  4PFW A;  1MDQ A;  4RPO A;  5AA2 B;  4LZ7 A;  5HM4 B;  1I69 A;  4OQO A;  3LSX A;  1UIV A;  3O28 A;  3H06 B;  3N94 A;  4OXV A;  2Y7W A;  3M8U A;  3TCG A;  4ZZE A;  3IL1 B;  2I4C A;  1YPN A;  1LST A;  3ILU B;  3IK6 B;  2O1M A;  2F35 A;  2UVG A;  4DXC A;  4F2Q A;  3RUM A;  4GQO A;  3TPA A;  4OES A;  3VXC A;  3UGW A;  4H65 A;  4RA1 A;  5AA2 D;  4Q30 B;  3KN3 A;  3TZA A;  1MG1 A;  1M5D A;  5ICQ A;  4KYE A;  3KSX A;  1LCF A;  3FV1 A;  1AOV A;  2UYE A;  4HCY A;  4XKP A;  1GVC A;  5FTI A;  3PUY E;  3IB0 A;  3TQW A;  1Y20 A;  3ILT B;  1DSN A;  1MQD A;  1TFA A;  2FYI A;  1SYH A;  2ONS A;  4NMY A;  4YB7 A;  1J1N A;  3MVW A;  2P1S A;  4AB5 A;  3S9N C;  3KZG A;  2X26 A;  1US5 A;  4R6K A;  4G8N A;  4H1X A;  5EYF A;  4Z0I A;  1XVY A;  1XS5 A;  1IIT A;  2W7Y A;  4F31 B;  2AYS A;  2HQ0 A;  2OWT A;  2ONR A;  1TFD A;  5I59 A;  1MQG A;  1OQH A;  4F1V A;  5DEX B;  2F7B A;  3GZG A;  4PP0 A;  3T9X B;  2GHA A;  1VR5 A;  4YMA A;  4NE4 A;  3FVG A;  1XT8 A;  4ZS9 A;  1B4H A;  2O6A A;  1QUI A;  4IO6 A;  2DXR A;  2I0B A;  3K2D A;  3TCF A;  3CVG A;  2V3T A;  4JSO A;  3FIR A;  2PMS A;  2DXY A;  1Q35 A;  4X9T A;  5TP9 A;  2QMW A;  4DLD A;  1NNP A;  3EHT A;  3K6V A;  1NL5 A;  2OWS A;  4GL0 A;  3U8Q A;  4ZZA A;  2O84 X;  3BBR A;  5I57 B;  4JB7 A;  1LGB C;  4ELO A;  4G8M A;  2HEU A;  5J1D A;  4N6P A;  1S7Y A;  1Y4C A;  1WDN A;  2XHD A;  2GH9 A;  4YIC A;  1B3G A;  3OEN A;  1PBQ A;  4R75 A;  3H7M A;  2UVJ A;  1P99 A;  3ZSF A;  2F6G A;  4OEN A;  3Q29 A;  4YKK A;  4O3A A;  3UIF A;  2XX7 A;  3BFT A;  3FD3 A;  3PPR A;  2WKY A;  3QSL A;  1Z7M E;  4KI0 E;  4H5F A;  1XHY A;  2I58 A;  2QS1 A;  5AA1 A;  3UA8 A;  2H25 A;  3LSF B;  3M3F A;  4ESW A;  2Z23 A;  1FTJ A;  2ESN A;  1R9Q A;  4RK9 A;  4H6D A;  3WAE A;  3FVN A;  4DXB A;  1N76 A;  4LQ2 A;  1IZ1 A;  3B6T A;  2DSF A;  4QFK A;  4HTG A;  1F9B A;  2QMX A;  3FGS A;  2E1S A;  3TAJ A;  1H43 A;  1LCT A;  1BP5 A;  3MVX A;  4R9G A;  3PMX A;  1ELJ A;  3DLN A;  3IOU A;  4ZEB A;  4LON B;  3PPQ A;  3C35 A;  1I6B A;  3B6W A;  2HZL A;  1B46 A;  3IJO B;  1AIV A;  4F19 A;  3S9L C;  3T9H B;  3EQ1 A;  3MQ9 A;  4UAC A;  5AE4 A;  3PPN A;  4R9F A;  5DVI A;  3IR1 A;  4HW8 A;  2Y84 A;  2A5T A;  2R6G E;  2DYX A;  1MPD A;  2YPN A;  3K6U A;  5DVF A;  1ZIU A;  3UN6 A;  2HZK A;  4R6Y A;  1ZJL A;  3PUX E;  4PQJ A;  4RXL A;  4IO5 A;  4FOR A;  3QAX A;  1GGG A;  2GHB A;  2I49 A;  4LUB A;  2UYF A;  2B3B A;  1MPC A;  5KCJ A;  4RJZ A;  3FVO A;  3TMG A;  1EH3 A;  4POW A;  4RY1 A;  5A5X B;  4OET A;  4OHN A;  3DEL B;  1O63 A;  2O68 A;  4U22 A;  2QPQ A;  4KYS A;  4ONY A;  2THI A;  4LZ5 A;  1MXU A;  2X7Q A;  2FNC A;  3C32 A;  4C1T A;  4U2R A;  1XC1 A;  1MS7 A;  2Y7P A;  4L17 A;  3C9H A;  1H76 A;  2DWI A;  3HHG A;  4JSD A;  4ECF A;  5I58 B;  1SBP A;  2DE2 A;  1NNF A;  1B3L A;  3TYH A;  1B05 A;  2F7C A;  1UTB B;  1GTK A;  2XXX A;  4JWX A;  2AIX A;  4I1D A;  2ZNT A;  3IOV A;  2RC9 A;  2E0S A;  4WED A;  2AL5 A;  3B6Q A;  4KR5 A;  3W15 C;  5CMB A;  3O97 A;  2RKM A;  3G7W A;  1URG A;  1Y1M A;  4ZEK A;  5K2Y A;  3T9V A;  1OIB A;  1HSL A;  5L9S A;  3A3U A;  2RIN A;  5I2K B;  4BDL A;  4QSC A;  3FJM A;  3PD8 A;  4EQB A;  1UTH B;  3FXR A;  3SET A;  1M5B A;  1P1W A;  3PMW A;  5I2N A;  3THI A;  4U1Z A;  4P0G A;  1URS A;  3HV1 A;  4R73 A;  5H8F B;  2IA4 A;  1AL3 A;  3MW0 A;  4XXU A;  3IOR A;  3FXQ A;  3K1P A;  4QFP A;  3IX1 A;  2O7U A;  4RK2 A;  2V25 A;  2DVZ A;  4TOZ A;  3VXB A;  3I5O A;  2GFE A;  2QS2 A;  1ANF A;  1OQG A;  3K6W A;  3SEX A;  3H6T A;  2ZMB A;  1EZP A;  1N3X A;  3RT8 A;  3N6T A;  1MRP A;  1USY E;  1YCJ A;  1MXY A;  3O6I A;  2YJP A;  2IEE A;  5KZT A;  3U72 A;  4FED A;  1TT1 A;  3G3H A;  4F29 A;  4O3C A;  4GLI A;  3S4U A;  3IAZ A;  2CZL A;  3CG3 A;  2D5W A;  3E9X A;  3OXN A;  2D21 A;  1B40 A;  5HPQ A;  4ZEF A;  2ANJ A;  4ZDM A;  1B58 A;  4E0W A;  1FQB A;  4WKM A;  4AB6 A;  3TTN A;  3S9E A;  1FTO A;  3EHU A;  5CMC A;  1B1X A;  2DQV A;  1QJM A;  1FTL A;  3TTM A;  2RC7 A;  4XKR A;  4H8J A;  4H5G A;  4EF1 A;  3HHF A;  1A8E A;  3W9W A;  2Q8J A;  3MZB A;  5L8D A;  1NH8 A;  1Y4T A;  4WXJ A;  2Y7R A;  5ITP A;  4YKI A;  4R6H A;  2ZNU A;  2OLB A;  5DVJ A;  2VGQ A;  3UOR A;  5TPA A;  1IQ7 A;  2DWH A;  4DXU A;  5B70 A;  3T9U A;  2I3V A;  5AA2 A;  3N6U A;  4TLL B;  4O3B A;  5H8H B;  4GXS B;  1PEB A;  1PDA A;  1Y1Z A;  1LFI A;  3QUJ A;  2I0C A;  4DDD A;  1VE4 A;  3ZKL A;  1B3E A;  5H8Q B;  5JK4 A;  3C31 A;  2Z22 A;  1B52 A;  2XD3 A;  3TTL A;  4FAJ A;  4YMB A;  1B32 A;  3MP8 A;  5KDT B;  1QKA A;  1N04 A;  1DTG A;  1RYX A;  5F7V A;  5I56 A;  1H44 A;  4BDQ A;  1URD A;  2X7P A;  3ECR A;  4XKN A;  2HXW A;  4U4X A;  2QS3 A;  3FJ7 A;  4KHZ E;  4BDO A;  1SD3 A;  4DE8 A;  5AA4 A;  3IOW A;  1B5J A;  2R71 A;  1B0H A;  3HPI A;  3CR9 A;  1B3H A;  5F1Q A;  3V5A A;  3MZ1 A;  3C34 A;  4OYV A;  4JWO A;  3B7D A;  4G68 B;  3ONM A;  1DPP A;  5EHS A;  4F39 A;  5ELV A;  2ZYK A;  1EZO A;  2ZYO A;  3IOT A;  2ZXT A;  1MY0 A;  1D3K A;  4OZ9 A;  5L9O A;  2B3F A;  2H4I A;  3SER A;  2BJJ X;  3TEP A;  3LSL A;  1DMB A;  4NED A;  3S9M C;  2F6P A;  1A8F A;  5DEX A;  1LBB A;  1GV8 A;  4ZEI A;  3JYR A;  3BKI B;  4F1Y A;  3SEU A;  3T22 A;  2OJT A;  3SEV A;  5JEI A;  4KCD A;  2OZZ A;  3G3I A;  3MP1 A;  1MQJ A;  4KQP A;  4G4P A;  2XXQ A;  1MXW A;  3K4U A;  3G3J A;  2RC8 A;  2HAV A;  1MQI A;  5AA3 A;  3OO9 A;  2PBW A;  2XXT A;  1O7T A;  4GVO A;  1QKB A;  4JBZ A;  4RPN A;  1SW5 A;  1JW1 A;  3VV5 A;  1R9L A;  3VFJ A;  3KGC A;  4N13 A;  4R74 A;  5IAI A;  3QYT A;  3GXA A;  3CSG A;  2CMO A;  5I57 A;  3A09 A;  3MVY A;  4IO4 A;  1B4Z A;  4P0I A;  4LP2 B;  1N0T A;  3ZS6 A;  5BUU A;  1LFG A;  4GRK A;  1D4N A;  4OMB A;  5TP9 B;  4X48 A;  1NMU A;  1FQC A;  1MY2 A;  3QUF A;  4NF5 B;  4DIG A;  2I4B A;  1UQW A;  1POY 1;  2GRV A;  4X1D A;  1PB8 A;  4G2Z A;  3KFM A;  4GF8 A;  3D4G A;  2QL3 A;  2OCU A;  2RF1 A;  4MF3 A;  1IIW A;  3IJX B;  4NF6 B;  4BLA A;  3VDF A;  4FE8 A;  5I84 A;  2A5S A;  3KEI A;  5H8N B;  1SDX A;  3RN8 A;  1IUD A;  1YAE A;  4ZE8 A;  4YKJ A;  2AL4 A;  4GD5 A;  1AH5 A;  4ZEC A;  4H67 A;  4NF8 B;  1MH4 A;  1QUL A;  4IO3 A;  3FAS A;  3TDJ A;  3U94 A;  3N26 A;  5DT6 A;  1B0L A;  2FA7 A;  3EHS A;  3K02 A;  4OVJ A;  2O51 A;  1DTZ A;  2DWJ A;  4F3S A;  4MLV A;  1B51 A;  4ZED A;  5HBC A;  5CI5 A;  4Q0C A;  3MWB A;  3SKP A;  1POT A;  4MBP A;  1LAF E;  3KG2 A;  4G77 A;  3U92 A;  3UP9 A;  1MXX A;  2Z8F A;  4KFQ A;  4EUO A;  4AQ4 A;  1FQD A;  2HFB A;  1SW2 A;  2F78 A;  4KCC A;  2V84 A;  3O2A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...