1LSTA

Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Amino-acid binding protein
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
publication title Three-dimensional structures of the periplasmic lysine/arginine/ornithine-binding protein with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA02
4MLQA 3LR1A 1NNFA 3PUVE 1PEBA 4NF5A 3W15C 3BFUA 2Q8JA 4F19A 4JDFA 4R6KA 4F1UA 1BIYA 1MXWA 1N3WA 1Y3PA 2OLBA 4OXVA 1BP5A 3TODA 1GTKA 4IO2A 4TQUQ 5CC2A 5KCJB 4JBZA 2XXUA 2Y84A 2A5TB 3U93A 2V25A 4R72A 1MQIA 2THIA 1JEUA 3GXAA 3V83A 3UIFA 1S50A 2OBGA 3USDA 1MY4A 3FJ7A 1JW1A 3LSXA 1MXXA 3MUQA 4U1ZA 2V3TA 5AA2D 1M5DA 3TCHA 1VR5A 2AL4A 5AA3A 3QIMA 3V89B 1BKAA 5L9MA 3PPOA 3RUMA 1AH5A 3VDFA 2O68A 2HAVA 2O69A 1B2HA 4ECFA 1MXYA 3KSXA 3T9HB 3KJ7A 3OEKA 4H1XA 3MP1A 1XS5A 1NNKA 1I69A 2X7QA 4K3FA 4ESXA 2PT2A 3TTKA 2XHDA 5HBCA 1WVJA 4LQ5A 1FW0A 2QL3A 1H76A 2OWTA 1ZMGA 4LQ2A 3TAJA 4IO5A 1B32A 4WEPA 4FATA 3V8XB 4C0RA 1AOVA 3OSRA 4FJPA 2F97A 5DTBA 3KOSA 3V5AA 3O2AA 4X9TA 3VV5A 4TOZA 5TPAB 5FTHA 1Y1ZA 4R2FA 3MWBA 4QHQA 4F31B 1B1HA 2W7YA 2Z23A 4EDPA 4YKJA 1TT1A 5TP9A 3VLVA 5I57B 4KR5A 1XC1A 2OWSA 4NF6A 4ND9A 3G3KA 1B40A 5H8HB 4ONYA 3VLWA 3DP6A 4XXUA 3CI8A 2XXVA 4R73A 3HHFA 2OK2A 1NH8A 2DVCA 2X7PA 4YAHX 4KPTA 4OYVA 2RCBA 3ODBA 4KHZE 2ONSA 2ZYNA 3HN0A 1MY3A 2OCUA 3CSBA 3IX1A 2XXRA 2DE2A 4NF5B 4OVJA 4N6PA 1P1UA 1TFDA 1ZU0A 1PBPA 3IB1A 4N13A 3TTRA 3TDJA 4G2ZA 4XKQA 1IUDA 3H3GA 2HQ0A 2ZYKA 4FE8A 4N07A 1B3GA 2XXYA 4U22A 4Z7EA 3ECRA 4H8JA 4M4GA 4UA8A 3TQWA 5ITPA 1FQAA 3LSFB 3DP4A 2NWJA 3CR9A 1WODA 5TU0A 4JXIA 1IXCA 4DXBA 4ZZAA 3UP9A 3H06B 4RA1A 4X1BA 3C4MA 3T22A 1B4HA 3EN3A 3I3VA 4GL8A 3C34A 3EHSA 3KN7A 1USYH 5I2KA 4DIGA 5F7VA 1A99A 3CFXA 3ZKKA 3SETA 3LSWA 4GQOA 3KBRA 5B7DA 4GL0A 2V3UA 5IAIA 2ZYMA 1MPDA 4EF1A 3K1NA 2UVIA 2M8CA 1MY1A 4KYSA 3H6WA 1SW2A 3KJTA 5DVFA 3GZGA 2ZNUA 4AB6A 3RPWA 4GD5A 3TQLA 4GVOA 5EHMA 4U23A 3C36A 3OO8A 3GBAA 2HCAA 1LFGA 1ELJA 1P1WA 1QUJA 3QYTA 1M5FA 5CMMA 4IGRA 4RK2A 1DPEA 3C9HA 3PV0E 3U92A 4RY1A 2F5XA 2H9BA 4RXLA 1LCFA 3G3HA 4RYAA 3PUZE 3EF7A 4ELQA 3QAXA 1EU8A 1B0LA 5I58A 5JTYA 1GR2A 1KWHA 4LVQA 3BKIB 2RINA 2H99A 2GH9A 4KCDA 2I4BA 1DTGA 3IOUA 3O29A 3T9VA 3MPKA 1IXHA 5I59A 2HFBA 5TP9B 3G3FA 1F9BA 3SEWA 1PB9A 3IO6A 4PE5B 4HW8A 4NF6B 2P1SA 4RPNA 1POY1 2Z22A 1FQBA 2DSFA 1QKAA 1NH7A 2FYIA 1B5HA 2H5YA 3CRBA 3FASA 4IO7A 2O84X 1UIVA 3FIRA 2UYEA 5CM6A 5CMCA 4QRZA 5DVIA 4Q8RA 3PUXE 1MDQA 5ICQA 2QMXA 1B0HA 1URGA 4BLAA 5H8FB 3FV2A 1IXIA 4YZZA 3SEYA 3E13X 1JETA 3FZVA 2Z8EA 4X1DA 3PU5A 3N26A 3UK4A 4G68C 5FHNA 2HZKA 4F1VA 2P2AA 3B6QA 5L9SA 4OZ9A 3SERA 1MQGA 3QK6A 2Q2CA 1LAGE 5H8QB 4H5FA 1Y9UA 4U2RA 2BJJX 3TCGA 5ICTA 2ESNA 1O7TA 1FTMA 4NF8A 4POWA 4ZEBA 2PYYA 3PD9A 3PMWA 3OMBA 2XD2A 3DLNA 2NUVA 4QSEA 4PETA 1LBBA 5I2KB 3TTMA 4G77A 4R9GA 2UYFA 1NNPA 4JWYA 4NMYA 3PD8A 1NFTA 3SKPA 1MM7A 1R6ZA 3M3KA 2DWIA 3IJOB 3E9XA 2I3WA 3SEUA 3RNNA 1S9TA 4P0IA 3VXBA 4FEBA 4JWOA 3W9VA 2YPNA 1VFEA 4WEDA 4H0WA 1DSNA 4WKMA 2Q9TA 2O51A 1H45A 1GVCA 2QSXA 2XX8A 4YU0A 2V93A 1OQHA 3OENA 5AA4A 4AQ4A 2I4CA 5L9OA 2CMOA 4PFYA 3B7DA 4JSDA 4RK9A 3TYHA 3U8QA 3A09A 2R9JA 2HEUA 2XX9A 3Q28A 2ABHA 2F6GA 3GLBA 2QJEA 3IR1A 2QS2A 3SDFA 4NE4A 4P11A 2RF1A 4E0XA 3A3CA 4ZEFA 1D9VA 5JTYB 3VVFA 5I58B 4G4PA 3HCQA 2DVZA 1GGGA 2XX7A 2HXWA 2UVGA 3KN3A 4Q0CA 1IEJA 5LOMA 2NOOA 2O1LA 5I59B 3OSQA 5K2XA 3ZKLA 1QUKA 3FXUA 3P7IA 3M3FA 1UTBA 2ZMBA 4OESA 5CBSA 4LZ8A 3SESA 1RKMA 1QULA 1US4A 1UTHA 3JV9A 4THIA 3TCFA 3RY3A 1HSEA 3IO4A 1IZ1A 3O97A 4UACA 4ZDMA 5CMBA 4QSDA 3TTLA 4FECA 1MPCA 1UQWA 3W9WA 1XVXA 2Q89A 1CE2A 4XTCQ 4OMBA 2Y7RA 2DE4A 3MZ9A 1MQDA 2Y7IA 1QJMA 4KCCA 3S9LC 1SW1A 3K6WA 3FD3A 3KZGA 3RGYA 4DCYA 4GLIA 3U72A 4C1UA 1M5BA 2IA4A 1R9LA 2E1SA 2O6AA 5AA2A 2UVJA 1ZTYA 1A54A 1B52A 1NKXA 3OO6A 4FORA 3UN6A 2Y7WA 1ZLQA 3O66A 1MG1A 3PUYE 1SW5A 3IB2A 5F1QA 1VFDA 5DT6A 2QS1A 1LSTA 4NF8B 5KDTA 2XXXA 4DCXA 5I2NA 3H7MA 3O9PA 3TUSA 1N0TA 2G93A 4YICA 2AL5A 2NXOA 4F3GA 3K0VA 4GXSB 3T66A 2XXWA 3N6UA 2XXQA 2UVHA 2DQVA 2REJA 3CFLA 1MY2A 1JW5A 3OD7A 4BDOA 3KOTA 5ELVA 1N76A 4I62A 2H4IA 1ZBMA 5H8NA 3BBRA 1FQDA 2F34A 4YMBA 1LLSA 4G8HA 3KGCA 4XKRA 3FJMA 3K1PA 4I8CA 4ZE9A 4TLMB 1Y3QA 3S9MC 4YMAA 1QW0A 1A8FA 4JWXA 3IB0A 2ONRA 3MVWA 3TEPA 3HV1A 1B4ZA 4EUOA 3PPPA 4HCWA 4LZ7A 4MBPA 4QSCA 1SI1A 3T9UA 4DDDA 1H44A 1UTBB 2GFEA 4JB7A 1LCTA 4ZEKA 1EZOA 1EH3A 4H65A 2XXTA 2UXAA 1UTHB 3IK6B 3FVGA 4IO6A 3G3GA 3FGSA 3IORA 4KYEA 2Z8DA 2YJPA 1DTZA 2DYXA 4F39A 3HO7A 3B6TA 4ZE8A 3Q26A 5DYHA 2GRVA 3S9EA 4G68A 4ZEIA 1J1NA 5I56A 3T9XB 1A8EA 3RN8A 1B3LA 3VVDA 2IEEA 1QVSA 3PPRA 1MQJA 1PC3A 4OENA 2PMSA 3TTNA 1MPBA 3MZ1A 1RYOA 1MDP1 5AA2B 5EYFA 4KD5A 3ONMA 1B5JA 3EHTA 1FQCA 2D21A 3C32A 5CRYA 4QF9A 3L6GA 3M8UA 1P1OA 1Q1KA 1Z7NE 3PPQA 2I0CA 1LFIA 1N3XA 2ZXTA 1TXFA 3CG1A 4ZS9A 1MY0A 2E0SA 3K00A 1AL3A 3MBPA 4NWCA 4AB5A 5KDTB 4L17A 3JYRA 5I2NB 3N94A 3PMVA 4KI0E 3H03A 4O3BA 5M2VA 2KLFA 3FVNA 1SYHA 3IJXB 3BFTA 1PB7A 2DWAA 1VE4A 1TFAA 4QFKA 3RT8A 3DP8A 4R75A 5JEIA 1QUIA 2DWHA 3Q29A 1AMFA 1B7HA 1I6AA 2I0BA 2I3VA 3THIA 5AA1A 1POTA 2F7AA 2I49A 3B6WA 1SBPA 1SW4A 4BDRA 4LP2B 2Y7PA 3IOTA 4H8IA 5H8NB 4KYDA 1H3DA 4R6HA 5H8SA 4DZ1A 1UIUA 1SYIA 3ILTB 1B3HA 1SVXB 1FQFA 1QKBA 2V84A 1LAXA 1HSJA 1M5CA 3L6HA 5CBRA 1JVYA 1P1QA 5HM4B 4ELPA 1O63A 2Z8FA 2DXYA 3KFMA 3D4CA 3G3IA 2VOZA 4MLVA 4FAJA 2H25A 4OTEA 4P0GA 1NNTA 2RCAA 4IO3A 3JZJA 1D9YA 1B7ZA 2OJTA 4GWOA 1OVBA 3H4ZA 3KN8A 1B3EA 1PDAA 1FQEA 1I6BA 4F29A 4XKNA 3MZBA 1B05A 4F3PA 4R6YA 2WKYA 3QXMA 1ZJLA 2NVUB 1Q35A 1I6QA 1Y20A 4RPOA 2CZLA 4C1TA 5K2YA 3FXQA 4PQJA 1URSA 2B3FA 3K02A 5DEXA 1EZPA 5HPQA 3R26A 4G8MA 5EHSA 3MAMA 4ISUA 4F2QA 4MFIA 2P0SA 4G68B 4YB7A 4IB2A 4WXJA 3E3KA 5I56B 4JSOA 4F22A 2Q2AA 3F11A 3KEIA 3R7XA 3PUWE 4U4XA 1JQFA 4ELRA 4HTGA 5J1DA 1O64A 1MXUA 3VVEA 4H5GA 2QPQA 3MVYA 1LAFE 2QMWA 2I58A 2F6PA 1XVYA 2F78A 1RYXA 1Y1MA 1LFHA 1B1XA 1XOCA 1XT8A 3E4RA 3QUJA 2PVUA 3RTFB 4XIGQ 1HSLA 4BDLA 1L5TA 1DPPA 4F18A 1P1NA 4DE8A 3M3LA 1A55A 3FXRA 3T93B 4U21A 4H67A 1FTKA 2DOJA 1N84A 2H98A 3VFJA 3SEXA 2I48A 3Q27A 5B70A 1WDNA 4YB6A 4O3AA 1Z7ME 4Q5TA 3FVOA 1YCJA 1BTJA 3R6UA 2VGQA 2GHBA 3RQTA 3HSTA 3QSLA 5FTIA 4ZECA 2ONKE 4LATA 3RLFE 2F7CA 3RT6B 1B5IA 4GOTA 4BDNA 3DELB 1AIVA 2AYSA 1II5A 3KG2A 3IOWA 3MW0A 1B9JA 4OEVA 1JEVA 3CVGA 3A3UA 3OO7A 4OQOA 2R6GE 5A5XA 4I1DA 1NL5A 4YKIA 3S4UA 2G29A 3MP6A 1R1NA 2ALUA 4R2BA 4YKKA 3CFZA 3OXNA 5I84A 4YKPA 1A40A 1B6HA 2D3IA 3DM0A 3K6XA 1OLCA 1D3KA 4I9DA 2XXHA 2PT1A 4BDMA 3K1MA 2RKMA 3N6TA 3PPNA 1T0KA 2QS3A 3OO9A 3O6IA 1B7UA 3GBBA 2VHAA 3EQ1A 4ZEDA 1MQHA 1URDA 2F35A 3K2DA 3TZAA 3HHGA 1LGBC 2RC8A 4Z0IA 3H6TA 2FNCA 1NMUA 2V3QA 2B3BA 2O7UA 1Y3NA 3MVXA 3PMXA 2O7IA 4E0WA 3N5LA 4LONB 4HCYA 1P99A 1OVTA 3U94A 2F36A 5DEXB 4TLLB 4IY5A 1MS7A 4GF8A 4H6DA 5DVJA 4DLDA 3EHUA 4QFLA 3T96B 2VP1A 3H6VA 3OEMA 4R9FA 1ATGA 1LB8A 4NF4A 2Y7KA 4EF2A 4M1VA 4QFPA 5AA4B 5IKBA 1OIBA 1A7LA 3Q25A 1FTOA 1OMPA 5H8FA 3QUFA 1S7YA 3TMGA 1N04A 4EQ7A 2DWJA 2PBWA 5L8DA 1OQGA 4U4SA 1ZKBA 1ZIUA 5JK4A 1MXZA 1MH3A 2ANJA 1Y4CA 3WAEA 4IO4A 2AIXA 3FJGA 5ITOA 3CSGA 5H8QA 1VSOA 3LC8A 4F2OA 5CMKA 3LUYA 3MJNA 4EXLA 3RTWB 3CG3A 2ZYOA 3UORA 4BDQA 3K01A 2F7BA 2GHAA 3CIJA 1JW4A 4XKPA 3C31A 3HPIA 2DE3A 1IQ7A 3UGWA 2HZLA 3TKDA 5ISUA 4GFRA 4EQ9A 5AE4A 3FUZA 3OOAA 1R9QA 2LAOA 2XXPA 4OETA 3MPLA 3UA8A 3IAZA 4OERA 4GRKA 4QFNA 5A5XB 4OFJA 3O28A 2FA7A 4NTLA 4POXA 5BWJA 2RC7A 1SD3A 3VXCA 1BLFA 2Q88A 2DP8A 4HS7A 1TWYA 3G3JA 3ILUB 3ZS6A 3SEVA 2RC9A 3VLUA 3MQ9A 2ZNTA 1CB6A 1MH4A 1MRPA 1EZ9A 2VD3A 2O1MA 4R74A 4LUBA 3K4UA 1MXVA 3LBSA 4ESWA 4F1YA 1N7WA 3O6GA 5KZTA 2REGA 2DXRA 1B58A 4LZ5A 5KCJA 5FHOA 2ZNSA 3LSLA 1JVXA 2VD2A 4FIMA 1YPNA 2DS9A 2A5TA 2QRYA 4LA9A 1OLAA 3FV1A 1FTLA 3H6UA 1MM6A 1XHYA 4QFOA 5BUUA 4PFWA 2D5WA 3TELA 4F3SA 3WAFA 3I6VA 4MF3A 3TPAA 3C33A 3TFLA 1USYE 4DXCA 1M5EA 4OWDA 1DMBA 3I5OA 1SI0A 4OEUA 4RJZA 4NEDA 3G7WA 2OZZA 3VE1B 3IOVA 1YTVA 1B51A 3AXFA 4YB5A 3D4GA 3MC2A 2X26A 4PP0A 4IGTA 1FCKA 2QS4A 2R71A 3C35A 3O6HA 4PFUA 1PB8A 5FHMA 5CI5A 4ZZEA 1ANFA 4MH5A 4NF4B 2YLNA 2I6EA 1PBQA 1FTJA 1SQYA 4KFQA 2HAUA 3FVKA 3MP8A 2XD3A 4NWDA 4FEDA 2A5SA 1LB9A 1Y4TA 3FATA 3K6UA 4GIZA 1SDXA 1LAHE 4PFTA 4OFOA 1GV8A 1B46A 4OHNA 4KQPA 2XXIA 4U1OA 4GXAA 5TPAA 4Q30B 3ZSFA 1JNFA 4O3CA 4OFLA 2PX1A 4EXKA 1H43A 1B3FA 1LBCA 3S2VA 4DXUA 5I57A 4RNSA 3EPEA 2F8DA 3IL1B 4G8NA 4IY6A 3S9NC 1US5A 3OELA 1IITA 5H8HA 1IXGA 1N7XA 4F3BA 1D4NA 1IIWA 4X48A 2B65A 4ELOA 4EQBA 3PGFA 3K6VA 3MVZA 3U1OA 1YAEA 1DOTA 3KSJA
chains in the Genus database with same CATH superfamily
4MLQA 4NG7A 3LR1A 1NNFA 3PUVE 1PEBA 4NF5A 3W15C 3BFUA 4IR8A 3D1RA 2XWOA 2Q8JA 4DI4B 4F19A 4JDFA 4R6KA 4F1UA 1BIYA 1MXWA 1N3WA 1Y3PA 2OLBA 4OXVA 1BP5A 3TODA 4MMPA 1GTKA 4P8BA 4IO2A 4TQUQ 5CC2A 5KCJB 4JBZA 2XXUA 2Y84A 4N4UA 4PAFA 2CEXA 2A5TB 3U93A 2V25A 1KZ8A 4R72A 1MQIA 2THIA 1JEUA 3HFUA 3GXAA 3V83A 3UIFA 1K9YA 1S50A 2OBGA 3USDA 1MY4A 3FJ7A 1JW1A 3LSXA 1MXXA 3MUQA 2QVUA 2MKZA 4U1ZA 4PTKA 2V3TA 4N8YA 5AA2D 1M5DA 3TCHA 1VR5A 1AWBA 2AL4A 5AA3A 3QIMA 3V89B 4OVQA 1BKAA 5L9MA 3PPOA 3RUMA 1AH5A 3VDFA 2O68A 2HAVA 2O69A 1B2HA 4ECFA 1MXYA 3KSXA 3T9HB 3KJ7A 3OEKA 1K9ZA 4H1XA 3MP1A 1XS5A 1NNKA 1I69A 2X7QA 4K3FA 4ESXA 2PT2A 3TTKA 2XHDA 5HBCA 1WVJA 4LQ5A 1FW0A 1Q9DA 2QL3A 1H76A 2OWTA 1ZMGA 4LQ2A 3TAJA 4IO5A 2V4CA 1B32A 4WEPA 4FATA 4OVTA 1FBDA 3V8XB 4C0RA 1AOVA 1FBEA 4PFRA 3OSRA 4FJPA 2F97A 5DTBA 3KOSA 3V5AA 3O2AA 4O94A 2P3VA 4X9TA 3KBZA 3VV5A 4TOZA 5TPAB 5FTHA 1G0HA 1Y1ZA 4R2FA 3MWBA 4MNPA 4QHQA 4F31B 1B1HA 4N17A 2W7YA 2Z23A 4EDPA 1FPBA 4YKJA 1TT1A 5TP9A 4PE3A 4O7IA 3VLVA 2P3NA 5I57B 4KR5A 1XC1A 2OWSA 4NF6A 4MCOA 4ND9A 3G3KA 4JVCA 2VPOA 1B40A 5H8HB 5ET5A 4MIJA 4ONYA 3VLWA 3DP6A 5IZ3A 4XXUA 3CI8A 2XXVA 4R73A 3HHFA 4XF5A 2OK2A 1NH8A 5EYGA 2DVCA 2X7PA 4YAHX 4KPTA 2PCRA 4OYVA 2CZHA 2RCBA 3ODBA 4KHZE 2ONSA 1FSAA 2ZYNA 3HN0A 1MY3A 2OCUA 3CSBA 3IX1A 2XXRA 2DE2A 4NF5B 4OVJA 4N6PA 1P1UA 1TFDA 3GYYA 1ZU0A 1PBPA 3IB1A 3ROJA 1INPA 4N13A 3CHGA 3TTRA 3TDJA 1LBYA 4G2ZA 4GWYA 4XKQA 1IUDA 3H3GA 5IGAA 2HQ0A 2ZYKA 1KA0A 4FE8A 4N07A 1B3GA 2OWZA 2XXYA 4U22A 4Z7EA 3ECRA 4H8JA 4M4GA 2DDKA 4UA8A 4MNCA 3TQWA 5ITPA 1FQAA 3LSFB 3DP4A 4OA4A 2NWJA 3CR9A 2B4MA 1WODA 5TU0A 4P47A 1LEVA 4JXIA 1IXCA 4DXBA 4MX6A 4ZZAA 3H06B 3UP9A 2QVVA 4RA1A 4X1BA 4LN5A 3C4MA 3T22A 1B4HA 3EN3A 3I3VA 4GL8A 3LV0A 3C34A 3EHSA 3KN7A 1USYH 5I2KA 4DIGA 5F7VA 1A99A 4PFIA 3CFXA 3ZKKA 3SETA 3LSWA 4GQOA 3KBRA 5B7DA 4GL0A 2V3UA 5IAIA 2ZYMA 1MPDA 2QFLA 4EF1A 2FBPA 3K1NA 2UVIA 3MYUA 2M8CA 1MY1A 4NX1A 4AS5A 4KYSA 4I40A 3H6WA 1SW2A 3KJTA 2JJKA 5DVFA 3GZGA 2ZNUA 4AB6A 3RPWA 4GD5A 3TQLA 4GVOA 5EHMA 5F24A 4PFBA 4U23A 3C36A 3OO8A 3GBAA 2HCAA 3IFAA 1LFGA 1ELJA 1P1WA 1QUJA 3QYTA 1M5FA 5CMMA 4IGRA 2XWKA 4RK2A 1DPEA 3C9HA 3PV0E 4GBVA 3U92A 4RY1A 2F5XA 2H9BA 4RXLA 1LCFA 3G3HA 4RYAA 3PUZE 3EF7A 4ELQA 3QAXA 1EU8A 4P9KA 1CNQA 1B0LA 5I58A 5JTYA 1GR2A 2HPGA 1KWHA 4LVQA 3BKIB 2RINA 2H99A 2GH9A 4KCDA 2I4BA 1DTGA 3IOUA 3O29A 3T9VA 3MPKA 1IXHA 5I59A 2HFBA 5TP9B 3G3FA 1F9BA 3SEWA 1PB9A 3IO6A 4PE5B 4HW8A 4NF6B 4N81A 2P1SA 4RPNA 1POY1 2Z22A 1FQBA 2DSFA 1QKAA 1NH7A 2FYIA 1B5HA 2H5YA 5IZ3B 3CRBA 3FASA 2WBBA 1FPLA 4IO7A 2O84X 1UIVA 3FIRA 2UYEA 5CM6A 5CMCA 4OVSA 4QRZA 5DVIA 4Q8RA 3PUXE 2VPNA 1MDQA 5ICQA 3SZPA 2CZIA 2QMXA 1B0HA 4PAIA 1URGA 4GWZA 4BLAA 5H8FB 3FXBA 3FV2A 1FPFA 1IXIA 4YZZA 5LDZA 3SEYA 3E13X 1JETA 3FZVA 2Z8EA 4X1DA 3PU5A 3N26A 3UK4A 4G68C 5FHNA 2HZKA 4F1VA 2P2AA 1EYIA 3B6QA 5L9SA 3KC0A 4OZ9A 3SERA 4O7MA 1MQGA 3QK6A 4AS4A 2Q2CA 1LAGE 5H8QB 4H5FA 1Y9UA 4U2RA 2BJJX 5EQ8A 3TCGA 5ICTA 2ESNA 1O7TA 1FTMA 4NF8A 4POWA 4HE0A 4PCDA 4ZEBA 2PYYA 3PD9A 3PMWA 3OMBA 1NUZA 2XD2A 3DLNA 1FPJA 2PFYA 2NUVA 4QSEA 4PETA 4GX4A 1LBBA 5I2KB 3TTMA 4G77A 4R9GA 2UYFA 1NNPA 4JWYA 4NMYA 2F3BA 3PD8A 1NFTA 4PAKA 1MM7A 3SKPA 1R6ZA 3M3KA 2DWIA 3IJOB 4X8RA 3E9XA 2I3WA 3SEUA 3RNNA 1S9TA 4P0IA 3VXBA 4FEBA 1FBGA 4JWOA 3W9VA 2YPNA 1VFEA 1VDWA 4MNIA 4WEDA 4H0WA 1DSNA 4WKMA 2Q9TA 2O51A 1H45A 2QSXA 1GVCA 4GBWA 2XX8A 4YU0A 2V93A 1OQHA 3OENA 5AA4A 4AQ4A 3QMFA 2I4CA 5L9OA 2CMOA 4PFYA 4NHBA 3B7DA 4JSDA 4RK9A 3TYHA 3U8QA 3A09A 2XA5A 2R9JA 2HEUA 2XX9A 3Q28A 2ABHA 2F6GA 3GLBA 2QJEA 5ET6A 3IR1A 2QS2A 3SDFA 4NE4A 2WEFA 4P11A 5A5LA 2RF1A 4E0XA 3A3CA 4ZEFA 1D9VA 1FTAA 5JTYB 3VVFA 5I58B 3RPLB 4G4PA 3HCQA 2GQ1A 2DVZA 1GGGA 4OVRA 2XX7A 2HXWA 2UVGA 3KN3A 4Q0CA 1IEJA 5LOMA 2NOOA 2O1LA 5I59B 3OSQA 5K2XA 3ZKLA 1QUKA 3FXUA 3P7IA 3M3FA 1UTBA 2ZMBA 4OESA 5CBSA 4LZ8A 3SESA 1RKMA 1QULA 1US4A 1UTHA 3JV9A 4THIA 3TCFA 3RY3A 1HSEA 3IO4A 1IZ1A 3O97A 4UACA 4ZDMA 5CMBA 4QSDA 3TTLA 4FECA 1FPEA 2R8TA 1MPCA 1UQWA 3W9WA 1XVXA 2Q89A 1CE2A 4XTCQ 4OMBA 2Y7RA 2DE4A 3MZ9A 1MQDA 2Y7IA 1QJMA 2FIXA 4KCCA 3S9LC 1SW1A 3K6WA 3FD3A 3E78A 1NV7A 3KZGA 3RGYA 4DCYA 4GLIA 3U72A 4C1UA 4HE1A 1M5BA 2IA4A 1R9LA 2E1SA 2O6AA 5AA2A 2UVJA 1ZTYA 2CZKA 5I5PA 1A54A 1B52A 1NKXA 4P1EA 3OO6A 4FORA 3UN6A 2Y7WA 2XWIA 3MSTA 3PTYA 1ZLQA 2F3DA 3O66A 1NV5A 1MG1A 3PUYE 1SW5A 1LBWA 3IB2A 5F1QA 2B4LA 1VFDA 4N8GA 5DT6A 2QS1A 1LSTA 4NF8B 5KDTA 2XXXA 4DCXA 5I2NA 3H7MA 1FBPA 3O9PA 3TUSA 1N0TA 2G93A 4YICA 5IM2A 2AL5A 2NXOA 4F3GA 3K0VA 4GXSB 4N6DA 3T66A 1BK4A 2XXWA 3N6UA 4GWWA 3E79A 2XXQA 2UVHA 4UABA 2DQVA 2REJA 3CFLA 1MY2A 1JW5A 4PGPA 1EYJA 2QVRA 3OD7A 1NV2A 3IFCA 2Q74A 4BDOA 4N15A 3KOTA 4DI3D 1IMEA 5ELVA 1N76A 4I62A 2H4IA 1ZBMA 5H8NA 3BBRA 1FQDA 2F34A 4YMBA 4MHFA 5ET8A 1LLSA 4G8HA 3KGCA 4XKRA 3FJMA 3K1PA 4I8CA 4ZE9A 4TLMB 5ET7A 1Y3QA 3S9MC 4YMAA 1NV3A 1QW0A 5EQAA 1A8FA 4JWXA 3IB0A 2ONRA 3MVWA 3TEPA 3HV1A 1B4ZA 4EUOA 1LBXA 3PPPA 1NUYA 4HCWA 4LZ7A 4MBPA 4QSCA 4QXDA 1SI1A 3T9UA 4DDDA 1H44A 1UTBB 2GFEA 4JB7A 1LCTA 4ZEKA 1EZOA 1EH3A 4H65A 2XXTA 2UXAA 3FBPA 1UTHB 3IK6B 3FVGA 1JP4A 4IO6A 3G3GA 3FGSA 3IORA 4KYEA 2Z8DA 2YJPA 1DTZA 2DYXA 4F39A 3HO7A 3B6TA 4ZE8A 3Q26A 5DYHA 2GRVA 3S9EA 4G68A 4ZEIA 5T3JA 1J1NA 5I56A 1FBFA 3T9XB 1A8EA 3RN8A 4PGNA 1B3LA 3VVDA 2IEEA 1QVSA 3PPRA 2WX9A 1RDYA 1MQJA 1PC3A 4OENA 2PMSA 3TTNA 1MPBA 3MZ1A 4PDHA 4GX3A 1RYOA 1MDP1 5AA2B 5EYFA 4KD5A 5EQ9A 3ONMA 1B5JA 3EHTA 1FQCA 2D21A 3C32A 5CRYA 4QF9A 3L6GA 3M8UA 1P1OA 1Q1KA 1Z7NE 3PPQA 2I0CA 5J16A 1LFIA 1N3XA 2ZXTA 1TXFA 3CG1A 4MAGA 4ZS9A 1MY0A 2E0SA 3K00A 1AL3A 3MBPA 4NWCA 4AB5A 5KDTB 4L17A 3JYRA 5I2NB 3N94A 3PMVA 4KI0E 3H03A 4O3BA 5M2VA 2KLFA 3FVNA 1SYHA 3IJXB 3BFTA 1PB7A 2DWAA 1VE4A 1TFAA 4HE2A 4QFKA 3RT8A 1NV4A 3DP8A 4R75A 5JEIA 1IMFA 1QUIA 2DWHA 3Q29A 1AMFA 1B7HA 1I6AA 2I0BA 1XI6A 2I3VA 3THIA 4OVPA 5AA1A 2XWVA 1IMBA 1POTA 2F7AA 4HXVA 2I49A 2WYKA 3B6WA 1SBPA 1SW4A 4BDRA 4LP2B 2Y7PA 3IOTA 4H8IA 5H8NB 4KYDA 1H3DA 4R6HA 5H8SA 4DZ1A 1UIUA 1SYIA 3ILTB 1B3HA 1SVXB 1FQFA 1QKBA 2CEYA 1SPIA 2V84A 1LAXA 1HSJA 1M5CA 3L6HA 5CBRA 1JVYA 1P1QA 5HM4B 4ELPA 1O63A 1FRPA 2Z8FA 2DXYA 3KFMA 3D4CA 3G3IA 2VOZA 4MLVA 4FAJA 1FJ6A 2H25A 4OTEA 4NN3A 4P0GA 4OANA 1NNTA 1NUWA 2RCAA 4IO3A 3JZJA 2Y5LA 1D9YA 1B7ZA 2WYPA 5EYHA 2OJTA 4GWOA 1OVBA 3H4ZA 3KN8A 1B3EA 1PDAA 1FQEA 1I6BA 4F29A 4XKNA 3MZBA 1B05A 4F3PA 4R6YA 2WKYA 3QXMA 1ZJLA 2NVUB 1Q35A 1I6QA 1Y20A 4MEVA 4RPOA 2CZLA 4C1TA 1FJ9A 5K2YA 3FXQA 4PQJA 4PBQA 3A29A 1URSA 2B3FA 3K02A 4H46A 5DEXA 1EZPA 5HPQA 3R26A 4G8MA 5EHSA 3MAMA 4ISUA 4F2QA 4MFIA 2P0SA 4G68B 4YB7A 4IB2A 3EKIA 4O8MA 4WXJA 3E3KA 5I56B 4JSOA 4F22A 2Q2AA 3F11A 3KEIA 4H45A 3PUWE 4U4XA 3R7XA 1JQFA 3KC1A 4ELRA 2FHYA 4HTGA 5J1DA 4KXPA 4GWXA 1O64A 1MXUA 3VVEA 4H5GA 2QPQA 3MVYA 1LAFE 2QMWA 2I58A 2F6PA 1XVYA 2F78A 1DCUA 1RYXA 1Y1MA 1LFHA 4P1LA 1B1XA 1XOCA 1XT8A 1FBHA 3E4RA 3QUJA 2PVUA 3RTFB 4XIGQ 1HSLA 4BDLA 1L5TA 1DPPA 4F18A 1P1NA 4NF0A 4DE8A 3M3LA 1A55A 2Y5KA 3FXRA 3T93B 4U21A 4H67A 1FTKA 2DOJA 1N84A 3T1BA 2H98A 3VFJA 3SEXA 2I48A 3Q27A 5B70A 1WDNA 4YB6A 4O3AA 1EYKA 1Z7ME 4Q5TA 2KQZA 3FVOA 1YCJA 1BTJA 2L5VA 3R6UA 2VGQA 2GHBA 3RQTA 3HSTA 3QSLA 5FTIA 4ZECA 2ONKE 4LATA 3RLFE 2F7CA 3RT6B 1B5IA 4GOTA 4BDNA 3DELB 1AIVA 2AYSA 1II5A 2KR0A 3KG2A 3IOWA 3MW0A 3LUZA 1B9JA 4OEVA 1JEVA 3CVGA 3A3UA 3OO7A 4OQOA 2R6GE 4I1DA 1NL5A 4YKIA 5A5XA 3S4UA 2G29A 1IMDA 3MP6A 1R1NA 2ZZXA 2ALUA 1D9QA 2PFZA 4R2BA 4YKKA 3CFZA 3OXNA 5I84A 4YKPA 1A40A 1B6HA 2D3IA 3DM0A 3K6XA 1OLCA 1D3KA 1NUXA 4I9DA 2XXHA 2PT1A 4I3YA 4BDMA 3K1MA 2RKMA 3N6TA 3PPNA 1YZ0A 2QS3A 3OO9A 1T0KA 3O6IA 1B7UA 3GBBA 2VHAA 3EQ1A 2BJIA 4ZEDA 3ISPA 1MQHA 1URDA 2F35A 3K2DA 4JVDA 3HHGA 1LGBC 3TZAA 2RC8A 4Z0IA 3H6TA 2FNCA 1NMUA 2V3QA 1NI9A 2B3BA 2O7UA 4G61A 1Y3NA 3MVXA 3PMXA 2O7IA 4E0WA 3N5LA 3B8BA 4LONB 4HCYA 1P99A 1OVTA 3U94A 2F36A 5DEXB 3BIHA 4TLLB 4IY5A 1MS7A 2HXRA 4GF8A 4H6DA 5DVJA 4NGUA 4DLDA 3EHUA 4QFLA 2OX3A 3T96B 2VP1A 3H6VA 3OEMA 4R9FA 1ATGA 4QBAA 1LB8A 4NF4A 4PBHA 2Y7KA 4EF2A 4M1VA 4QFPA 5AA4B 5IKBA 1OIBA 1A7LA 3Q25A 1FTOA 1QGXA 3NOHA 2ZZVA 1OMPA 5H8FA 3QUFA 1S7YA 3TMGA 1N04A 4EQ7A 2DWJA 2PBWA 5EQ7A 5L8DA 1OQGA 4U4SA 1ZKBA 1ZIUA 5JK4A 1MXZA 1MH3A 2ANJA 1Y4CA 3WAEA 4IO4A 1NV1A 2AIXA 3FJGA 5ITOA 3CSGA 5H8QA 1VSOA 3LC8A 4F2OA 4P3LA 5CMKA 3LUYA 3MJNA 4EXLA 3RTWB 3CG3A 2ZYOA 4NQ8A 3UORA 4BDQA 3K01A 2F7BA 2GHAA 3CIJA 1JW4A 4XKPA 5I7IA 3C31A 3HPIA 2DE3A 1IQ7A 3UGWA 2HZLA 3TKDA 5ISUA 4GFRA 4EQ9A 5AE4A 3FUZA 3OOAA 1R9QA 2LAOA 2XXPA 1FPIA 4OETA 3MPLA 3UA8A 3IAZA 4OERA 4GRKA 2ZZWA 4QFNA 5A5XB 4OFJA 1RDZA 3O28A 2FA7A 4NTLA 4POXA 5BWJA 2RC7A 4PF8A 1SD3A 3VXCA 1BLFA 2Q88A 2DP8A 4N6KA 4HS7A 1FBCA 1TWYA 3G3JA 3ILUB 1FPGA 3ZS6A 3SEVA 2RC9A 1DBZA 3VLUA 3MQ9A 2ZNTA 1CB6A 1MH4A 1MRPA 1EZ9A 2VD3A 2O1MA 4R74A 4LUBA 3K4UA 2FIEA 1MXVA 3LBSA 4ESWA 4F1YA 4P56A 1N7WA 3O6GA 4PDDA 2HHMA 5KZTA 2REGA 1G0IA 2DXRA 1B58A 4LZ5A 5KCJA 5FHOA 2ZNSA 3LSLA 1JVXA 2VD2A 4FIMA 1YPNA 1KA1A 1RDXA 2A5TA 2DS9A 2QRYA 4LA9A 1OLAA 4GWSA 3FV1A 1FTLA 3BIGA 3H6UA 1MM6A 3RPLA 1XHYA 4QFOA 5BUUA 4PFWA 2D5WA 4I3EA 1LBZA 3TELA 4F3SA 4MF3A 3I6VA 3WAFA 4FBPA 1YYZA 3T0JA 3TPAA 3C33A 3TFLA 1USYE 5LTCA 1LBVA 4PC9A 4DXCA 1M5EA 4OWDA 1DMBA 3I5OA 1SI0A 1IMAA 2XXKA 2Q8MA 4OEUA 4RJZA 5ESYA 4NEDA 3G7WA 2OZZA 3VE1B 3IOVA 1YTVA 1B51A 4N91A 3AXFA 4YB5A 3D4GA 3MC2A 4XEQA 2X26A 4PP0A 4IGTA 1FCKA 3B50A 2QS4A 2R71A 3C35A 3O6HA 4PFUA 5FBPA 1PB8A 1IMCA 5FHMA 5CI5A 4ZZEA 1ANFA 4MH5A 4NF4B 4GWUA 2YLNA 2I6EA 4GX6A 1PBQA 1FTJA 1SQYA 5IZZA 4KFQA 2HAUA 3FVKA 4XFEA 3MP8A 2XD3A 4NWDA 4FEDA 2A5SA 1LB9A 1Y4TA 4NAPA 3FATA 2VT5A 3K6UA 4GIZA 1SDXA 1LAHE 4PFTA 4OFOA 1GV8A 1B46A 1YXIA 1NV0A 5DW8A 4OHNA 4KQPA 4MJOA 2XXIA 5I3SA 4U1OA 4GXAA 5TPAA 4JVIA 4Q30B 2FVZA 5IZ1A 3ZSFA 1JNFA 4O3CA 4OFLA 2PX1A 4EXKA 1NV6A 1H43A 1B3FA 1LBCA 3S2VA 3RYDA 1FPDA 4DXUA 1FPKA 5I57A 4RNSA 3U65A 3EPEA 4PF6A 2F8DA 3IL1B 4G8NA 4IY6A 3S9NC 1US5A 3OELA 2WBDA 1IITA 5H8HA 1IXGA 1N7XA 4F3BA 1DK4A 1D4NA 1IIWA 4X48A 2B65A 4ELOA 4EQBA 3PGFA 3K6VA 3MVZA 3U1OA 1YAEA 4X04A 1DOTA 3KSJA
chains in the Genus database with same CATH topology
4MLQA 3LR1A 1NNFA 3PUVE 1PEBA 4NF5A 3W15C 3BFUA 2Q8JA 4F19A 4JDFA 4R6KA 4F1UA 1BIYA 1MXWA 1N3WA 1Y3PA 2OLBA 4OXVA 1BP5A 3TODA 1GTKA 4IO2A 4TQUQ 5CC2A 5KCJB 4JBZA 2XXUA 2Y84A 2A5TB 3U93A 2V25A 4R72A 1MQIA 2THIA 1JEUA 3GXAA 3V83A 3UIFA 1S50A 2OBGA 3USDA 1MY4A 3FJ7A 1JW1A 3LSXA 1MXXA 3MUQA 4U1ZA 2V3TA 5AA2D 1M5DA 3TCHA 1VR5A 2AL4A 5AA3A 3QIMA 3V89B 1BKAA 5L9MA 3PPOA 3RUMA 1AH5A 3VDFA 2O68A 2HAVA 2O69A 1B2HA 4ECFA 1MXYA 3KSXA 3T9HB 3KJ7A 3OEKA 4H1XA 3MP1A 1XS5A 1NNKA 1I69A 2X7QA 4K3FA 4ESXA 2PT2A 3TTKA 2XHDA 5HBCA 1WVJA 4LQ5A 1FW0A 2QL3A 1H76A 2OWTA 1ZMGA 4LQ2A 3TAJA 4IO5A 1B32A 4WEPA 4FATA 3V8XB 4C0RA 1AOVA 3OSRA 4FJPA 2F97A 5DTBA 3KOSA 3V5AA 3O2AA 4X9TA 3VV5A 4TOZA 5TPAB 5FTHA 1Y1ZA 4R2FA 3MWBA 4QHQA 4F31B 1B1HA 2W7YA 2Z23A 4EDPA 4YKJA 1TT1A 5TP9A 3VLVA 5I57B 4KR5A 1XC1A 2OWSA 4NF6A 4ND9A 3G3KA 1B40A 5H8HB 4ONYA 3VLWA 3DP6A 4XXUA 3CI8A 2XXVA 4R73A 3HHFA 2OK2A 1NH8A 2DVCA 2X7PA 4YAHX 4KPTA 4OYVA 2RCBA 3ODBA 4KHZE 2ONSA 2ZYNA 3HN0A 1MY3A 2OCUA 3CSBA 3IX1A 2XXRA 2DE2A 4NF5B 4OVJA 4N6PA 1P1UA 1TFDA 1ZU0A 1PBPA 3IB1A 4N13A 3TTRA 3TDJA 4G2ZA 4XKQA 1IUDA 3H3GA 2HQ0A 2ZYKA 4FE8A 4N07A 1B3GA 2XXYA 4U22A 4Z7EA 3ECRA 4H8JA 4M4GA 4UA8A 3TQWA 5ITPA 1FQAA 3LSFB 3DP4A 2NWJA 3CR9A 1WODA 5TU0A 4JXIA 1IXCA 4DXBA 4ZZAA 3UP9A 3H06B 4RA1A 4X1BA 3C4MA 3T22A 1B4HA 3EN3A 3I3VA 4GL8A 3C34A 3EHSA 3KN7A 1USYH 5I2KA 4DIGA 5F7VA 1A99A 3CFXA 3ZKKA 3SETA 3LSWA 4GQOA 3KBRA 5B7DA 4GL0A 2V3UA 5IAIA 2ZYMA 1MPDA 4EF1A 3K1NA 2UVIA 2M8CA 1MY1A 4KYSA 3H6WA 1SW2A 3KJTA 5DVFA 3GZGA 2ZNUA 4AB6A 3RPWA 4GD5A 3TQLA 4GVOA 5EHMA 4U23A 3C36A 3OO8A 3GBAA 2HCAA 1LFGA 1ELJA 1P1WA 1QUJA 3QYTA 1M5FA 5CMMA 4IGRA 4RK2A 1DPEA 3C9HA 3PV0E 3U92A 4RY1A 2F5XA 2H9BA 4RXLA 1LCFA 3G3HA 4RYAA 3PUZE 3EF7A 4ELQA 3QAXA 1EU8A 1B0LA 5I58A 5JTYA 1GR2A 1KWHA 4LVQA 3BKIB 2RINA 2H99A 2GH9A 4KCDA 2I4BA 1DTGA 3IOUA 3O29A 3T9VA 3MPKA 1IXHA 5I59A 2HFBA 5TP9B 3G3FA 1F9BA 3SEWA 1PB9A 3IO6A 4PE5B 4HW8A 4NF6B 2P1SA 4RPNA 1POY1 2Z22A 1FQBA 2DSFA 1QKAA 1NH7A 2FYIA 1B5HA 2H5YA 3CRBA 3FASA 4IO7A 2O84X 1UIVA 3FIRA 2UYEA 5CM6A 5CMCA 4QRZA 5DVIA 4Q8RA 3PUXE 1MDQA 5ICQA 2QMXA 1B0HA 1URGA 4BLAA 5H8FB 3FV2A 1IXIA 4YZZA 3SEYA 3E13X 1JETA 3FZVA 2Z8EA 4X1DA 3PU5A 3N26A 3UK4A 4G68C 5FHNA 2HZKA 4F1VA 2P2AA 3B6QA 5L9SA 4OZ9A 3SERA 1MQGA 3QK6A 2Q2CA 1LAGE 5H8QB 4H5FA 1Y9UA 4U2RA 2BJJX 3TCGA 5ICTA 2ESNA 1O7TA 1FTMA 4NF8A 4POWA 4ZEBA 2PYYA 3PD9A 3PMWA 3OMBA 2XD2A 3DLNA 2NUVA 4QSEA 4PETA 1LBBA 5I2KB 3TTMA 4G77A 4R9GA 2UYFA 1NNPA 4JWYA 4NMYA 3PD8A 1NFTA 3SKPA 1MM7A 1R6ZA 3M3KA 2DWIA 3IJOB 3E9XA 2I3WA 3SEUA 3RNNA 1S9TA 4P0IA 3VXBA 4FEBA 4JWOA 3W9VA 2YPNA 1VFEA 4WEDA 4H0WA 1DSNA 4WKMA 2Q9TA 2O51A 1H45A 1GVCA 2QSXA 2XX8A 4YU0A 2V93A 1OQHA 3OENA 5AA4A 4AQ4A 2I4CA 5L9OA 2CMOA 4PFYA 3B7DA 4JSDA 4RK9A 3TYHA 3U8QA 3A09A 2R9JA 2HEUA 2XX9A 3Q28A 2ABHA 2F6GA 3GLBA 2QJEA 3IR1A 2QS2A 3SDFA 4NE4A 4P11A 2RF1A 4E0XA 3A3CA 4ZEFA 1D9VA 5JTYB 3VVFA 5I58B 4G4PA 3HCQA 2DVZA 1GGGA 2XX7A 2HXWA 2UVGA 3KN3A 4Q0CA 1IEJA 5LOMA 2NOOA 2O1LA 5I59B 3OSQA 5K2XA 3ZKLA 1QUKA 3FXUA 3P7IA 3M3FA 1UTBA 2ZMBA 4OESA 5CBSA 4LZ8A 3SESA 1RKMA 1QULA 1US4A 1UTHA 3JV9A 4THIA 3TCFA 3RY3A 1HSEA 3IO4A 1IZ1A 3O97A 4UACA 4ZDMA 5CMBA 4QSDA 3TTLA 4FECA 1MPCA 1UQWA 3W9WA 1XVXA 2Q89A 1CE2A 4XTCQ 4OMBA 2Y7RA 2DE4A 3MZ9A 1MQDA 2Y7IA 1QJMA 4KCCA 3S9LC 1SW1A 3K6WA 3FD3A 3KZGA 3RGYA 4DCYA 4GLIA 3U72A 4C1UA 1M5BA 2IA4A 1R9LA 2E1SA 2O6AA 5AA2A 2UVJA 1ZTYA 1A54A 1B52A 1NKXA 3OO6A 4FORA 3UN6A 2Y7WA 1ZLQA 3O66A 1MG1A 3PUYE 1SW5A 3IB2A 5F1QA 1VFDA 5DT6A 2QS1A 1LSTA 4NF8B 5KDTA 2XXXA 4DCXA 5I2NA 3H7MA 3O9PA 3TUSA 1N0TA 2G93A 4YICA 2AL5A 2NXOA 4F3GA 3K0VA 4GXSB 3T66A 2XXWA 3N6UA 2XXQA 2UVHA 2DQVA 2REJA 3CFLA 1MY2A 1JW5A 3OD7A 4BDOA 3KOTA 5ELVA 1N76A 4I62A 2H4IA 1ZBMA 5H8NA 3BBRA 1FQDA 2F34A 4YMBA 1LLSA 4G8HA 3KGCA 4XKRA 3FJMA 3K1PA 4I8CA 4ZE9A 4TLMB 1Y3QA 3S9MC 4YMAA 1QW0A 1A8FA 4JWXA 3IB0A 2ONRA 3MVWA 3TEPA 3HV1A 1B4ZA 4EUOA 3PPPA 4HCWA 4LZ7A 4MBPA 4QSCA 1SI1A 3T9UA 4DDDA 1H44A 1UTBB 2GFEA 4JB7A 1LCTA 4ZEKA 1EZOA 1EH3A 4H65A 2XXTA 2UXAA 1UTHB 3IK6B 3FVGA 4IO6A 3G3GA 3FGSA 3IORA 4KYEA 2Z8DA 2YJPA 1DTZA 2DYXA 4F39A 3HO7A 3B6TA 4ZE8A 3Q26A 5DYHA 2GRVA 3S9EA 4G68A 4ZEIA 1J1NA 5I56A 3T9XB 1A8EA 3RN8A 1B3LA 3VVDA 2IEEA 1QVSA 3PPRA 1MQJA 1PC3A 4OENA 2PMSA 3TTNA 1MPBA 3MZ1A 1RYOA 1MDP1 5AA2B 5EYFA 4KD5A 3ONMA 1B5JA 3EHTA 1FQCA 2D21A 3C32A 5CRYA 4QF9A 3L6GA 3M8UA 1P1OA 1Q1KA 1Z7NE 3PPQA 2I0CA 1LFIA 1N3XA 2ZXTA 1TXFA 3CG1A 4ZS9A 1MY0A 2E0SA 3K00A 1AL3A 3MBPA 4NWCA 4AB5A 5KDTB 4L17A 3JYRA 5I2NB 3N94A 3PMVA 4KI0E 3H03A 4O3BA 5M2VA 2KLFA 3FVNA 1SYHA 3IJXB 3BFTA 1PB7A 2DWAA 1VE4A 1TFAA 4QFKA 3RT8A 3DP8A 4R75A 5JEIA 1QUIA 2DWHA 3Q29A 1AMFA 1B7HA 1I6AA 2I0BA 2I3VA 3THIA 5AA1A 1POTA 2F7AA 2I49A 3B6WA 1SBPA 1SW4A 4BDRA 4LP2B 2Y7PA 3IOTA 4H8IA 5H8NB 4KYDA 1H3DA 4R6HA 5H8SA 4DZ1A 1UIUA 1SYIA 3ILTB 1B3HA 1SVXB 1FQFA 1QKBA 2V84A 1LAXA 1HSJA 1M5CA 3L6HA 5CBRA 1JVYA 1P1QA 5HM4B 4ELPA 1O63A 2Z8FA 2DXYA 3KFMA 3D4CA 3G3IA 2VOZA 4MLVA 4FAJA 2H25A 4OTEA 4P0GA 1NNTA 2RCAA 4IO3A 3JZJA 1D9YA 1B7ZA 2OJTA 4GWOA 1OVBA 3H4ZA 3KN8A 1B3EA 1PDAA 1FQEA 1I6BA 4F29A 4XKNA 3MZBA 1B05A 4F3PA 4R6YA 2WKYA 3QXMA 1ZJLA 2NVUB 1Q35A 1I6QA 1Y20A 4RPOA 2CZLA 4C1TA 5K2YA 3FXQA 4PQJA 1URSA 2B3FA 3K02A 5DEXA 1EZPA 5HPQA 3R26A 4G8MA 5EHSA 3MAMA 4ISUA 4F2QA 4MFIA 2P0SA 4G68B 4YB7A 4IB2A 4WXJA 3E3KA 5I56B 4JSOA 4F22A 2Q2AA 3F11A 3KEIA 3R7XA 3PUWE 4U4XA 1JQFA 4ELRA 4HTGA 5J1DA 1O64A 1MXUA 3VVEA 4H5GA 2QPQA 3MVYA 1LAFE 2QMWA 2I58A 2F6PA 1XVYA 2F78A 1RYXA 1Y1MA 1LFHA 1B1XA 1XOCA 1XT8A 3E4RA 3QUJA 2PVUA 3RTFB 4XIGQ 1HSLA 4BDLA 1L5TA 1DPPA 4F18A 1P1NA 4DE8A 3M3LA 1A55A 3FXRA 3T93B 4U21A 4H67A 1FTKA 2DOJA 1N84A 2H98A 3VFJA 3SEXA 2I48A 3Q27A 5B70A 1WDNA 4YB6A 4O3AA 1Z7ME 4Q5TA 3FVOA 1YCJA 1BTJA 3R6UA 2VGQA 2GHBA 3RQTA 3HSTA 3QSLA 5FTIA 4ZECA 2ONKE 4LATA 3RLFE 2F7CA 3RT6B 1B5IA 4GOTA 4BDNA 3DELB 1AIVA 2AYSA 1II5A 3KG2A 3IOWA 3MW0A 1B9JA 4OEVA 1JEVA 3CVGA 3A3UA 3OO7A 4OQOA 2R6GE 5A5XA 4I1DA 1NL5A 4YKIA 3S4UA 2G29A 3MP6A 1R1NA 2ALUA 4R2BA 4YKKA 3CFZA 3OXNA 5I84A 4YKPA 1A40A 1B6HA 2D3IA 3DM0A 3K6XA 1OLCA 1D3KA 4I9DA 2XXHA 2PT1A 4BDMA 3K1MA 2RKMA 3N6TA 3PPNA 1T0KA 2QS3A 3OO9A 3O6IA 1B7UA 3GBBA 2VHAA 3EQ1A 4ZEDA 1MQHA 1URDA 2F35A 3K2DA 3TZAA 3HHGA 1LGBC 2RC8A 4Z0IA 3H6TA 2FNCA 1NMUA 2V3QA 2B3BA 2O7UA 1Y3NA 3MVXA 3PMXA 2O7IA 4E0WA 3N5LA 4LONB 4HCYA 1P99A 1OVTA 3U94A 2F36A 5DEXB 4TLLB 4IY5A 1MS7A 4GF8A 4H6DA 5DVJA 4DLDA 3EHUA 4QFLA 3T96B 2VP1A 3H6VA 3OEMA 4R9FA 1ATGA 1LB8A 4NF4A 2Y7KA 4EF2A 4M1VA 4QFPA 5AA4B 5IKBA 1OIBA 1A7LA 3Q25A 1FTOA 1OMPA 5H8FA 3QUFA 1S7YA 3TMGA 1N04A 4EQ7A 2DWJA 2PBWA 5L8DA 1OQGA 4U4SA 1ZKBA 1ZIUA 5JK4A 1MXZA 1MH3A 2ANJA 1Y4CA 3WAEA 4IO4A 2AIXA 3FJGA 5ITOA 3CSGA 5H8QA 1VSOA 3LC8A 4F2OA 5CMKA 3LUYA 3MJNA 4EXLA 3RTWB 3CG3A 2ZYOA 3UORA 4BDQA 3K01A 2F7BA 2GHAA 3CIJA 1JW4A 4XKPA 3C31A 3HPIA 2DE3A 1IQ7A 3UGWA 2HZLA 3TKDA 5ISUA 4GFRA 4EQ9A 5AE4A 3FUZA 3OOAA 1R9QA 2LAOA 2XXPA 4OETA 3MPLA 3UA8A 3IAZA 4OERA 4GRKA 4QFNA 5A5XB 4OFJA 3O28A 2FA7A 4NTLA 4POXA 5BWJA 2RC7A 1SD3A 3VXCA 1BLFA 2Q88A 2DP8A 4HS7A 1TWYA 3G3JA 3ILUB 3ZS6A 3SEVA 2RC9A 3VLUA 3MQ9A 2ZNTA 1CB6A 1MH4A 1MRPA 1EZ9A 2VD3A 2O1MA 4R74A 4LUBA 3K4UA 1MXVA 3LBSA 4ESWA 4F1YA 1N7WA 3O6GA 5KZTA 2REGA 2DXRA 1B58A 4LZ5A 5KCJA 5FHOA 2ZNSA 3LSLA 1JVXA 2VD2A 4FIMA 1YPNA 2DS9A 2A5TA 2QRYA 4LA9A 1OLAA 3FV1A 1FTLA 3H6UA 1MM6A 1XHYA 4QFOA 5BUUA 4PFWA 2D5WA 3TELA 4F3SA 3WAFA 3I6VA 4MF3A 3TPAA 3C33A 3TFLA 1USYE 4DXCA 1M5EA 4OWDA 1DMBA 3I5OA 1SI0A 4OEUA 4RJZA 4NEDA 3G7WA 2OZZA 3VE1B 3IOVA 1YTVA 1B51A 3AXFA 4YB5A 3D4GA 3MC2A 2X26A 4PP0A 4IGTA 1FCKA 2QS4A 2R71A 3C35A 3O6HA 4PFUA 1PB8A 5FHMA 5CI5A 4ZZEA 1ANFA 4MH5A 4NF4B 2YLNA 2I6EA 1PBQA 1FTJA 1SQYA 4KFQA 2HAUA 3FVKA 3MP8A 2XD3A 4NWDA 4FEDA 2A5SA 1LB9A 1Y4TA 3FATA 3K6UA 4GIZA 1SDXA 1LAHE 4PFTA 4OFOA 1GV8A 1B46A 4OHNA 4KQPA 2XXIA 4U1OA 4GXAA 5TPAA 4Q30B 3ZSFA 1JNFA 4O3CA 4OFLA 2PX1A 4EXKA 1H43A 1B3FA 1LBCA 3S2VA 4DXUA 5I57A 4RNSA 3EPEA 2F8DA 3IL1B 4G8NA 4IY6A 3S9NC 1US5A 3OELA 1IITA 5H8HA 1IXGA 1N7XA 4F3BA 1D4NA 1IIWA 4X48A 2B65A 4ELOA 4EQBA 3PGFA 3K6VA 3MVZA 3U1OA 1YAEA 1DOTA 3KSJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MLQ A;  3LR1 A;  1NNF A;  3PUV E;  1PEB A;  4NF5 A;  3W15 C;  3BFU A;  2Q8J A;  4F19 A;  4JDF A;  4R6K A;  4F1U A;  1BIY A;  1MXW A;  1N3W A;  1Y3P A;  2OLB A;  4OXV A;  1BP5 A;  3TOD A;  1GTK A;  4IO2 A;  4TQU Q;  5CC2 A;  5KCJ B;  4JBZ A;  2XXU A;  2Y84 A;  2A5T B;  3U93 A;  2V25 A;  4R72 A;  1MQI A;  2THI A;  1JEU A;  3GXA A;  3V83 A;  3UIF A;  1S50 A;  2OBG A;  3USD A;  1MY4 A;  3FJ7 A;  1JW1 A;  3LSX A;  1MXX A;  3MUQ A;  4U1Z A;  2V3T A;  5AA2 D;  1M5D A;  3TCH A;  1VR5 A;  2AL4 A;  5AA3 A;  3QIM A;  3V89 B;  1BKA A;  5L9M A;  3PPO A;  3RUM A;  1AH5 A;  3VDF A;  2O68 A;  2HAV A;  2O69 A;  1B2H A;  4ECF A;  1MXY A;  3KSX A;  3T9H B;  3KJ7 A;  3OEK A;  4H1X A;  3MP1 A;  1XS5 A;  1NNK A;  1I69 A;  2X7Q A;  4K3F A;  4ESX A;  2PT2 A;  3TTK A;  2XHD A;  5HBC A;  1WVJ A;  4LQ5 A;  1FW0 A;  2QL3 A;  1H76 A;  2OWT A;  1ZMG A;  4LQ2 A;  3TAJ A;  4IO5 A;  1B32 A;  4WEP A;  4FAT A;  3V8X B;  4C0R A;  1AOV A;  3OSR A;  4FJP A;  2F97 A;  5DTB A;  3KOS A;  3V5A A;  3O2A A;  4X9T A;  3VV5 A;  4TOZ A;  5TPA B;  5FTH A;  1Y1Z A;  4R2F A;  3MWB A;  4QHQ A;  4F31 B;  1B1H A;  2W7Y A;  2Z23 A;  4EDP A;  4YKJ A;  1TT1 A;  5TP9 A;  3VLV A;  5I57 B;  4KR5 A;  1XC1 A;  2OWS A;  4NF6 A;  4ND9 A;  3G3K A;  1B40 A;  5H8H B;  4ONY A;  3VLW A;  3DP6 A;  4XXU A;  3CI8 A;  2XXV A;  4R73 A;  3HHF A;  2OK2 A;  1NH8 A;  2DVC A;  2X7P A;  4YAH X;  4KPT A;  4OYV A;  2RCB A;  3ODB A;  4KHZ E;  2ONS A;  2ZYN A;  3HN0 A;  1MY3 A;  2OCU A;  3CSB A;  3IX1 A;  2XXR A;  2DE2 A;  4NF5 B;  4OVJ A;  4N6P A;  1P1U A;  1TFD A;  1ZU0 A;  1PBP A;  3IB1 A;  4N13 A;  3TTR A;  3TDJ A;  4G2Z A;  4XKQ A;  1IUD A;  3H3G A;  2HQ0 A;  2ZYK A;  4FE8 A;  4N07 A;  1B3G A;  2XXY A;  4U22 A;  4Z7E A;  3ECR A;  4H8J A;  4M4G A;  4UA8 A;  3TQW A;  5ITP A;  1FQA A;  3LSF B;  3DP4 A;  2NWJ A;  3CR9 A;  1WOD A;  5TU0 A;  4JXI A;  1IXC A;  4DXB A;  4ZZA A;  3UP9 A;  3H06 B;  4RA1 A;  4X1B A;  3C4M A;  3T22 A;  1B4H A;  3EN3 A;  3I3V A;  4GL8 A;  3C34 A;  3EHS A;  3KN7 A;  1USY H;  5I2K A;  4DIG A;  5F7V A;  1A99 A;  3CFX A;  3ZKK A;  3SET A;  3LSW A;  4GQO A;  3KBR A;  5B7D A;  4GL0 A;  2V3U A;  5IAI A;  2ZYM A;  1MPD A;  4EF1 A;  3K1N A;  2UVI A;  2M8C A;  1MY1 A;  4KYS A;  3H6W A;  1SW2 A;  3KJT A;  5DVF A;  3GZG A;  2ZNU A;  4AB6 A;  3RPW A;  4GD5 A;  3TQL A;  4GVO A;  5EHM A;  4U23 A;  3C36 A;  3OO8 A;  3GBA A;  2HCA A;  1LFG A;  1ELJ A;  1P1W A;  1QUJ A;  3QYT A;  1M5F A;  5CMM A;  4IGR A;  4RK2 A;  1DPE A;  3C9H A;  3PV0 E;  3U92 A;  4RY1 A;  2F5X A;  2H9B A;  4RXL A;  1LCF A;  3G3H A;  4RYA A;  3PUZ E;  3EF7 A;  4ELQ A;  3QAX A;  1EU8 A;  1B0L A;  5I58 A;  5JTY A;  1GR2 A;  1KWH A;  4LVQ A;  3BKI B;  2RIN A;  2H99 A;  2GH9 A;  4KCD A;  2I4B A;  1DTG A;  3IOU A;  3O29 A;  3T9V A;  3MPK A;  1IXH A;  5I59 A;  2HFB A;  5TP9 B;  3G3F A;  1F9B A;  3SEW A;  1PB9 A;  3IO6 A;  4PE5 B;  4HW8 A;  4NF6 B;  2P1S A;  4RPN A;  1POY 1;  2Z22 A;  1FQB A;  2DSF A;  1QKA A;  1NH7 A;  2FYI A;  1B5H A;  2H5Y A;  3CRB A;  3FAS A;  4IO7 A;  2O84 X;  1UIV A;  3FIR A;  2UYE A;  5CM6 A;  5CMC A;  4QRZ A;  5DVI A;  4Q8R A;  3PUX E;  1MDQ A;  5ICQ A;  2QMX A;  1B0H A;  1URG A;  4BLA A;  5H8F B;  3FV2 A;  1IXI A;  4YZZ A;  3SEY A;  3E13 X;  1JET A;  3FZV A;  2Z8E A;  4X1D A;  3PU5 A;  3N26 A;  3UK4 A;  4G68 C;  5FHN A;  2HZK A;  4F1V A;  2P2A A;  3B6Q A;  5L9S A;  4OZ9 A;  3SER A;  1MQG A;  3QK6 A;  2Q2C A;  1LAG E;  5H8Q B;  4H5F A;  1Y9U A;  4U2R A;  2BJJ X;  3TCG A;  5ICT A;  2ESN A;  1O7T A;  1FTM A;  4NF8 A;  4POW A;  4ZEB A;  2PYY A;  3PD9 A;  3PMW A;  3OMB A;  2XD2 A;  3DLN A;  2NUV A;  4QSE A;  4PET A;  1LBB A;  5I2K B;  3TTM A;  4G77 A;  4R9G A;  2UYF A;  1NNP A;  4JWY A;  4NMY A;  3PD8 A;  1NFT A;  3SKP A;  1MM7 A;  1R6Z A;  3M3K A;  2DWI A;  3IJO B;  3E9X A;  2I3W A;  3SEU A;  3RNN A;  1S9T A;  4P0I A;  3VXB A;  4FEB A;  4JWO A;  3W9V A;  2YPN A;  1VFE A;  4WED A;  4H0W A;  1DSN A;  4WKM A;  2Q9T A;  2O51 A;  1H45 A;  1GVC A;  2QSX A;  2XX8 A;  4YU0 A;  2V93 A;  1OQH A;  3OEN A;  5AA4 A;  4AQ4 A;  2I4C A;  5L9O A;  2CMO A;  4PFY A;  3B7D A;  4JSD A;  4RK9 A;  3TYH A;  3U8Q A;  3A09 A;  2R9J A;  2HEU A;  2XX9 A;  3Q28 A;  2ABH A;  2F6G A;  3GLB A;  2QJE A;  3IR1 A;  2QS2 A;  3SDF A;  4NE4 A;  4P11 A;  2RF1 A;  4E0X A;  3A3C A;  4ZEF A;  1D9V A;  5JTY B;  3VVF A;  5I58 B;  4G4P A;  3HCQ A;  2DVZ A;  1GGG A;  2XX7 A;  2HXW A;  2UVG A;  3KN3 A;  4Q0C A;  1IEJ A;  5LOM A;  2NOO A;  2O1L A;  5I59 B;  3OSQ A;  5K2X A;  3ZKL A;  1QUK A;  3FXU A;  3P7I A;  3M3F A;  1UTB A;  2ZMB A;  4OES A;  5CBS A;  4LZ8 A;  3SES A;  1RKM A;  1QUL A;  1US4 A;  1UTH A;  3JV9 A;  4THI A;  3TCF A;  3RY3 A;  1HSE A;  3IO4 A;  1IZ1 A;  3O97 A;  4UAC A;  4ZDM A;  5CMB A;  4QSD A;  3TTL A;  4FEC A;  1MPC A;  1UQW A;  3W9W A;  1XVX A;  2Q89 A;  1CE2 A;  4XTC Q;  4OMB A;  2Y7R A;  2DE4 A;  3MZ9 A;  1MQD A;  2Y7I A;  1QJM A;  4KCC A;  3S9L C;  1SW1 A;  3K6W A;  3FD3 A;  3KZG A;  3RGY A;  4DCY A;  4GLI A;  3U72 A;  4C1U A;  1M5B A;  2IA4 A;  1R9L A;  2E1S A;  2O6A A;  5AA2 A;  2UVJ A;  1ZTY A;  1A54 A;  1B52 A;  1NKX A;  3OO6 A;  4FOR A;  3UN6 A;  2Y7W A;  1ZLQ A;  3O66 A;  1MG1 A;  3PUY E;  1SW5 A;  3IB2 A;  5F1Q A;  1VFD A;  5DT6 A;  2QS1 A;  1LST A;  4NF8 B;  5KDT A;  2XXX A;  4DCX A;  5I2N A;  3H7M A;  3O9P A;  3TUS A;  1N0T A;  2G93 A;  4YIC A;  2AL5 A;  2NXO A;  4F3G A;  3K0V A;  4GXS B;  3T66 A;  2XXW A;  3N6U A;  2XXQ A;  2UVH A;  2DQV A;  2REJ A;  3CFL A;  1MY2 A;  1JW5 A;  3OD7 A;  4BDO A;  3KOT A;  5ELV A;  1N76 A;  4I62 A;  2H4I A;  1ZBM A;  5H8N A;  3BBR A;  1FQD A;  2F34 A;  4YMB A;  1LLS A;  4G8H A;  3KGC A;  4XKR A;  3FJM A;  3K1P A;  4I8C A;  4ZE9 A;  4TLM B;  1Y3Q A;  3S9M C;  4YMA A;  1QW0 A;  1A8F A;  4JWX A;  3IB0 A;  2ONR A;  3MVW A;  3TEP A;  3HV1 A;  1B4Z A;  4EUO A;  3PPP A;  4HCW A;  4LZ7 A;  4MBP A;  4QSC A;  1SI1 A;  3T9U A;  4DDD A;  1H44 A;  1UTB B;  2GFE A;  4JB7 A;  1LCT A;  4ZEK A;  1EZO A;  1EH3 A;  4H65 A;  2XXT A;  2UXA A;  1UTH B;  3IK6 B;  3FVG A;  4IO6 A;  3G3G A;  3FGS A;  3IOR A;  4KYE A;  2Z8D A;  2YJP A;  1DTZ A;  2DYX A;  4F39 A;  3HO7 A;  3B6T A;  4ZE8 A;  3Q26 A;  5DYH A;  2GRV A;  3S9E A;  4G68 A;  4ZEI A;  1J1N A;  5I56 A;  3T9X B;  1A8E A;  3RN8 A;  1B3L A;  3VVD A;  2IEE A;  1QVS A;  3PPR A;  1MQJ A;  1PC3 A;  4OEN A;  2PMS A;  3TTN A;  1MPB A;  3MZ1 A;  1RYO A;  1MDP 1;  5AA2 B;  5EYF A;  4KD5 A;  3ONM A;  1B5J A;  3EHT A;  1FQC A;  2D21 A;  3C32 A;  5CRY A;  4QF9 A;  3L6G A;  3M8U A;  1P1O A;  1Q1K A;  1Z7N E;  3PPQ A;  2I0C A;  1LFI A;  1N3X A;  2ZXT A;  1TXF A;  3CG1 A;  4ZS9 A;  1MY0 A;  2E0S A;  3K00 A;  1AL3 A;  3MBP A;  4NWC A;  4AB5 A;  5KDT B;  4L17 A;  3JYR A;  5I2N B;  3N94 A;  3PMV A;  4KI0 E;  3H03 A;  4O3B A;  5M2V A;  2KLF A;  3FVN A;  1SYH A;  3IJX B;  3BFT A;  1PB7 A;  2DWA A;  1VE4 A;  1TFA A;  4QFK A;  3RT8 A;  3DP8 A;  4R75 A;  5JEI A;  1QUI A;  2DWH A;  3Q29 A;  1AMF A;  1B7H A;  1I6A A;  2I0B A;  2I3V A;  3THI A;  5AA1 A;  1POT A;  2F7A A;  2I49 A;  3B6W A;  1SBP A;  1SW4 A;  4BDR A;  4LP2 B;  2Y7P A;  3IOT A;  4H8I A;  5H8N B;  4KYD A;  1H3D A;  4R6H A;  5H8S A;  4DZ1 A;  1UIU A;  1SYI A;  3ILT B;  1B3H A;  1SVX B;  1FQF A;  1QKB A;  2V84 A;  1LAX A;  1HSJ A;  1M5C A;  3L6H A;  5CBR A;  1JVY A;  1P1Q A;  5HM4 B;  4ELP A;  1O63 A;  2Z8F A;  2DXY A;  3KFM A;  3D4C A;  3G3I A;  2VOZ A;  4MLV A;  4FAJ A;  2H25 A;  4OTE A;  4P0G A;  1NNT A;  2RCA A;  4IO3 A;  3JZJ A;  1D9Y A;  1B7Z A;  2OJT A;  4GWO A;  1OVB A;  3H4Z A;  3KN8 A;  1B3E A;  1PDA A;  1FQE A;  1I6B A;  4F29 A;  4XKN A;  3MZB A;  1B05 A;  4F3P A;  4R6Y A;  2WKY A;  3QXM A;  1ZJL A;  2NVU B;  1Q35 A;  1I6Q A;  1Y20 A;  4RPO A;  2CZL A;  4C1T A;  5K2Y A;  3FXQ A;  4PQJ A;  1URS A;  2B3F A;  3K02 A;  5DEX A;  1EZP A;  5HPQ A;  3R26 A;  4G8M A;  5EHS A;  3MAM A;  4ISU A;  4F2Q A;  4MFI A;  2P0S A;  4G68 B;  4YB7 A;  4IB2 A;  4WXJ A;  3E3K A;  5I56 B;  4JSO A;  4F22 A;  2Q2A A;  3F11 A;  3KEI A;  3R7X A;  3PUW E;  4U4X A;  1JQF A;  4ELR A;  4HTG A;  5J1D A;  1O64 A;  1MXU A;  3VVE A;  4H5G A;  2QPQ A;  3MVY A;  1LAF E;  2QMW A;  2I58 A;  2F6P A;  1XVY A;  2F78 A;  1RYX A;  1Y1M A;  1LFH A;  1B1X A;  1XOC A;  1XT8 A;  3E4R A;  3QUJ A;  2PVU A;  3RTF B;  4XIG Q;  1HSL A;  4BDL A;  1L5T A;  1DPP A;  4F18 A;  1P1N A;  4DE8 A;  3M3L A;  1A55 A;  3FXR A;  3T93 B;  4U21 A;  4H67 A;  1FTK A;  2DOJ A;  1N84 A;  2H98 A;  3VFJ A;  3SEX A;  2I48 A;  3Q27 A;  5B70 A;  1WDN A;  4YB6 A;  4O3A A;  1Z7M E;  4Q5T A;  3FVO A;  1YCJ A;  1BTJ A;  3R6U A;  2VGQ A;  2GHB A;  3RQT A;  3HST A;  3QSL A;  5FTI A;  4ZEC A;  2ONK E;  4LAT A;  3RLF E;  2F7C A;  3RT6 B;  1B5I A;  4GOT A;  4BDN A;  3DEL B;  1AIV A;  2AYS A;  1II5 A;  3KG2 A;  3IOW A;  3MW0 A;  1B9J A;  4OEV A;  1JEV A;  3CVG A;  3A3U A;  3OO7 A;  4OQO A;  2R6G E;  5A5X A;  4I1D A;  1NL5 A;  4YKI A;  3S4U A;  2G29 A;  3MP6 A;  1R1N A;  2ALU A;  4R2B A;  4YKK A;  3CFZ A;  3OXN A;  5I84 A;  4YKP A;  1A40 A;  1B6H A;  2D3I A;  3DM0 A;  3K6X A;  1OLC A;  1D3K A;  4I9D A;  2XXH A;  2PT1 A;  4BDM A;  3K1M A;  2RKM A;  3N6T A;  3PPN A;  1T0K A;  2QS3 A;  3OO9 A;  3O6I A;  1B7U A;  3GBB A;  2VHA A;  3EQ1 A;  4ZED A;  1MQH A;  1URD A;  2F35 A;  3K2D A;  3TZA A;  3HHG A;  1LGB C;  2RC8 A;  4Z0I A;  3H6T A;  2FNC A;  1NMU A;  2V3Q A;  2B3B A;  2O7U A;  1Y3N A;  3MVX A;  3PMX A;  2O7I A;  4E0W A;  3N5L A;  4LON B;  4HCY A;  1P99 A;  1OVT A;  3U94 A;  2F36 A;  5DEX B;  4TLL B;  4IY5 A;  1MS7 A;  4GF8 A;  4H6D A;  5DVJ A;  4DLD A;  3EHU A;  4QFL A;  3T96 B;  2VP1 A;  3H6V A;  3OEM A;  4R9F A;  1ATG A;  1LB8 A;  4NF4 A;  2Y7K A;  4EF2 A;  4M1V A;  4QFP A;  5AA4 B;  5IKB A;  1OIB A;  1A7L A;  3Q25 A;  1FTO A;  1OMP A;  5H8F A;  3QUF A;  1S7Y A;  3TMG A;  1N04 A;  4EQ7 A;  2DWJ A;  2PBW A;  5L8D A;  1OQG A;  4U4S A;  1ZKB A;  1ZIU A;  5JK4 A;  1MXZ A;  1MH3 A;  2ANJ A;  1Y4C A;  3WAE A;  4IO4 A;  2AIX A;  3FJG A;  5ITO A;  3CSG A;  5H8Q A;  1VSO A;  3LC8 A;  4F2O A;  5CMK A;  3LUY A;  3MJN A;  4EXL A;  3RTW B;  3CG3 A;  2ZYO A;  3UOR A;  4BDQ A;  3K01 A;  2F7B A;  2GHA A;  3CIJ A;  1JW4 A;  4XKP A;  3C31 A;  3HPI A;  2DE3 A;  1IQ7 A;  3UGW A;  2HZL A;  3TKD A;  5ISU A;  4GFR A;  4EQ9 A;  5AE4 A;  3FUZ A;  3OOA A;  1R9Q A;  2LAO A;  2XXP A;  4OET A;  3MPL A;  3UA8 A;  3IAZ A;  4OER A;  4GRK A;  4QFN A;  5A5X B;  4OFJ A;  3O28 A;  2FA7 A;  4NTL A;  4POX A;  5BWJ A;  2RC7 A;  1SD3 A;  3VXC A;  1BLF A;  2Q88 A;  2DP8 A;  4HS7 A;  1TWY A;  3G3J A;  3ILU B;  3ZS6 A;  3SEV A;  2RC9 A;  3VLU A;  3MQ9 A;  2ZNT A;  1CB6 A;  1MH4 A;  1MRP A;  1EZ9 A;  2VD3 A;  2O1M A;  4R74 A;  4LUB A;  3K4U A;  1MXV A;  3LBS A;  4ESW A;  4F1Y A;  1N7W A;  3O6G A;  5KZT A;  2REG A;  2DXR A;  1B58 A;  4LZ5 A;  5KCJ A;  5FHO A;  2ZNS A;  3LSL A;  1JVX A;  2VD2 A;  4FIM A;  1YPN A;  2DS9 A;  2A5T A;  2QRY A;  4LA9 A;  1OLA A;  3FV1 A;  1FTL A;  3H6U A;  1MM6 A;  1XHY A;  4QFO A;  5BUU A;  4PFW A;  2D5W A;  3TEL A;  4F3S A;  3WAF A;  3I6V A;  4MF3 A;  3TPA A;  3C33 A;  3TFL A;  1USY E;  4DXC A;  1M5E A;  4OWD A;  1DMB A;  3I5O A;  1SI0 A;  4OEU A;  4RJZ A;  4NED A;  3G7W A;  2OZZ A;  3VE1 B;  3IOV A;  1YTV A;  1B51 A;  3AXF A;  4YB5 A;  3D4G A;  3MC2 A;  2X26 A;  4PP0 A;  4IGT A;  1FCK A;  2QS4 A;  2R71 A;  3C35 A;  3O6H A;  4PFU A;  1PB8 A;  5FHM A;  5CI5 A;  4ZZE A;  1ANF A;  4MH5 A;  4NF4 B;  2YLN A;  2I6E A;  1PBQ A;  1FTJ A;  1SQY A;  4KFQ A;  2HAU A;  3FVK A;  3MP8 A;  2XD3 A;  4NWD A;  4FED A;  2A5S A;  1LB9 A;  1Y4T A;  3FAT A;  3K6U A;  4GIZ A;  1SDX A;  1LAH E;  4PFT A;  4OFO A;  1GV8 A;  1B46 A;  4OHN A;  4KQP A;  2XXI A;  4U1O A;  4GXA A;  5TPA A;  4Q30 B;  3ZSF A;  1JNF A;  4O3C A;  4OFL A;  2PX1 A;  4EXK A;  1H43 A;  1B3F A;  1LBC A;  3S2V A;  4DXU A;  5I57 A;  4RNS A;  3EPE A;  2F8D A;  3IL1 B;  4G8N A;  4IY6 A;  3S9N C;  1US5 A;  3OEL A;  1IIT A;  5H8H A;  1IXG A;  1N7X A;  4F3B A;  1D4N A;  1IIW A;  4X48 A;  2B65 A;  4ELO A;  4EQB A;  3PGF A;  3K6V A;  3MVZ A;  3U1O A;  1YAE A;  1DOT A;  3KSJ A; 
#chains in the Genus database with same CATH topology
 4MLQ A;  4NG7 A;  3LR1 A;  1NNF A;  3PUV E;  1PEB A;  4NF5 A;  3W15 C;  3BFU A;  4IR8 A;  3D1R A;  2XWO A;  2Q8J A;  4DI4 B;  4F19 A;  4JDF A;  4R6K A;  4F1U A;  1BIY A;  1MXW A;  1N3W A;  1Y3P A;  2OLB A;  4OXV A;  1BP5 A;  3TOD A;  4MMP A;  1GTK A;  4P8B A;  4IO2 A;  4TQU Q;  5CC2 A;  5KCJ B;  4JBZ A;  2XXU A;  2Y84 A;  4N4U A;  4PAF A;  2CEX A;  2A5T B;  3U93 A;  2V25 A;  1KZ8 A;  4R72 A;  1MQI A;  2THI A;  1JEU A;  3HFU A;  3GXA A;  3V83 A;  3UIF A;  1K9Y A;  1S50 A;  2OBG A;  3USD A;  1MY4 A;  3FJ7 A;  1JW1 A;  3LSX A;  1MXX A;  3MUQ A;  2QVU A;  2MKZ A;  4U1Z A;  4PTK A;  2V3T A;  4N8Y A;  5AA2 D;  1M5D A;  3TCH A;  1VR5 A;  1AWB A;  2AL4 A;  5AA3 A;  3QIM A;  3V89 B;  4OVQ A;  1BKA A;  5L9M A;  3PPO A;  3RUM A;  1AH5 A;  3VDF A;  2O68 A;  2HAV A;  2O69 A;  1B2H A;  4ECF A;  1MXY A;  3KSX A;  3T9H B;  3KJ7 A;  3OEK A;  1K9Z A;  4H1X A;  3MP1 A;  1XS5 A;  1NNK A;  1I69 A;  2X7Q A;  4K3F A;  4ESX A;  2PT2 A;  3TTK A;  2XHD A;  5HBC A;  1WVJ A;  4LQ5 A;  1FW0 A;  1Q9D A;  2QL3 A;  1H76 A;  2OWT A;  1ZMG A;  4LQ2 A;  3TAJ A;  4IO5 A;  2V4C A;  1B32 A;  4WEP A;  4FAT A;  4OVT A;  1FBD A;  3V8X B;  4C0R A;  1AOV A;  1FBE A;  4PFR A;  3OSR A;  4FJP A;  2F97 A;  5DTB A;  3KOS A;  3V5A A;  3O2A A;  4O94 A;  2P3V A;  4X9T A;  3KBZ A;  3VV5 A;  4TOZ A;  5TPA B;  5FTH A;  1G0H A;  1Y1Z A;  4R2F A;  3MWB A;  4MNP A;  4QHQ A;  4F31 B;  1B1H A;  4N17 A;  2W7Y A;  2Z23 A;  4EDP A;  1FPB A;  4YKJ A;  1TT1 A;  5TP9 A;  4PE3 A;  4O7I A;  3VLV A;  2P3N A;  5I57 B;  4KR5 A;  1XC1 A;  2OWS A;  4NF6 A;  4MCO A;  4ND9 A;  3G3K A;  4JVC A;  2VPO A;  1B40 A;  5H8H B;  5ET5 A;  4MIJ A;  4ONY A;  3VLW A;  3DP6 A;  5IZ3 A;  4XXU A;  3CI8 A;  2XXV A;  4R73 A;  3HHF A;  4XF5 A;  2OK2 A;  1NH8 A;  5EYG A;  2DVC A;  2X7P A;  4YAH X;  4KPT A;  2PCR A;  4OYV A;  2CZH A;  2RCB A;  3ODB A;  4KHZ E;  2ONS A;  1FSA A;  2ZYN A;  3HN0 A;  1MY3 A;  2OCU A;  3CSB A;  3IX1 A;  2XXR A;  2DE2 A;  4NF5 B;  4OVJ A;  4N6P A;  1P1U A;  1TFD A;  3GYY A;  1ZU0 A;  1PBP A;  3IB1 A;  3ROJ A;  1INP A;  4N13 A;  3CHG A;  3TTR A;  3TDJ A;  1LBY A;  4G2Z A;  4GWY A;  4XKQ A;  1IUD A;  3H3G A;  5IGA A;  2HQ0 A;  2ZYK A;  1KA0 A;  4FE8 A;  4N07 A;  1B3G A;  2OWZ A;  2XXY A;  4U22 A;  4Z7E A;  3ECR A;  4H8J A;  4M4G A;  2DDK A;  4UA8 A;  4MNC A;  3TQW A;  5ITP A;  1FQA A;  3LSF B;  3DP4 A;  4OA4 A;  2NWJ A;  3CR9 A;  2B4M A;  1WOD A;  5TU0 A;  4P47 A;  1LEV A;  4JXI A;  1IXC A;  4DXB A;  4MX6 A;  4ZZA A;  3H06 B;  3UP9 A;  2QVV A;  4RA1 A;  4X1B A;  4LN5 A;  3C4M A;  3T22 A;  1B4H A;  3EN3 A;  3I3V A;  4GL8 A;  3LV0 A;  3C34 A;  3EHS A;  3KN7 A;  1USY H;  5I2K A;  4DIG A;  5F7V A;  1A99 A;  4PFI A;  3CFX A;  3ZKK A;  3SET A;  3LSW A;  4GQO A;  3KBR A;  5B7D A;  4GL0 A;  2V3U A;  5IAI A;  2ZYM A;  1MPD A;  2QFL A;  4EF1 A;  2FBP A;  3K1N A;  2UVI A;  3MYU A;  2M8C A;  1MY1 A;  4NX1 A;  4AS5 A;  4KYS A;  4I40 A;  3H6W A;  1SW2 A;  3KJT A;  2JJK A;  5DVF A;  3GZG A;  2ZNU A;  4AB6 A;  3RPW A;  4GD5 A;  3TQL A;  4GVO A;  5EHM A;  5F24 A;  4PFB A;  4U23 A;  3C36 A;  3OO8 A;  3GBA A;  2HCA A;  3IFA A;  1LFG A;  1ELJ A;  1P1W A;  1QUJ A;  3QYT A;  1M5F A;  5CMM A;  4IGR A;  2XWK A;  4RK2 A;  1DPE A;  3C9H A;  3PV0 E;  4GBV A;  3U92 A;  4RY1 A;  2F5X A;  2H9B A;  4RXL A;  1LCF A;  3G3H A;  4RYA A;  3PUZ E;  3EF7 A;  4ELQ A;  3QAX A;  1EU8 A;  4P9K A;  1CNQ A;  1B0L A;  5I58 A;  5JTY A;  1GR2 A;  2HPG A;  1KWH A;  4LVQ A;  3BKI B;  2RIN A;  2H99 A;  2GH9 A;  4KCD A;  2I4B A;  1DTG A;  3IOU A;  3O29 A;  3T9V A;  3MPK A;  1IXH A;  5I59 A;  2HFB A;  5TP9 B;  3G3F A;  1F9B A;  3SEW A;  1PB9 A;  3IO6 A;  4PE5 B;  4HW8 A;  4NF6 B;  4N81 A;  2P1S A;  4RPN A;  1POY 1;  2Z22 A;  1FQB A;  2DSF A;  1QKA A;  1NH7 A;  2FYI A;  1B5H A;  2H5Y A;  5IZ3 B;  3CRB A;  3FAS A;  2WBB A;  1FPL A;  4IO7 A;  2O84 X;  1UIV A;  3FIR A;  2UYE A;  5CM6 A;  5CMC A;  4OVS A;  4QRZ A;  5DVI A;  4Q8R A;  3PUX E;  2VPN A;  1MDQ A;  5ICQ A;  3SZP A;  2CZI A;  2QMX A;  1B0H A;  4PAI A;  1URG A;  4GWZ A;  4BLA A;  5H8F B;  3FXB A;  3FV2 A;  1FPF A;  1IXI A;  4YZZ A;  5LDZ A;  3SEY A;  3E13 X;  1JET A;  3FZV A;  2Z8E A;  4X1D A;  3PU5 A;  3N26 A;  3UK4 A;  4G68 C;  5FHN A;  2HZK A;  4F1V A;  2P2A A;  1EYI A;  3B6Q A;  5L9S A;  3KC0 A;  4OZ9 A;  3SER A;  4O7M A;  1MQG A;  3QK6 A;  4AS4 A;  2Q2C A;  1LAG E;  5H8Q B;  4H5F A;  1Y9U A;  4U2R A;  2BJJ X;  5EQ8 A;  3TCG A;  5ICT A;  2ESN A;  1O7T A;  1FTM A;  4NF8 A;  4POW A;  4HE0 A;  4PCD A;  4ZEB A;  2PYY A;  3PD9 A;  3PMW A;  3OMB A;  1NUZ A;  2XD2 A;  3DLN A;  1FPJ A;  2PFY A;  2NUV A;  4QSE A;  4PET A;  4GX4 A;  1LBB A;  5I2K B;  3TTM A;  4G77 A;  4R9G A;  2UYF A;  1NNP A;  4JWY A;  4NMY A;  2F3B A;  3PD8 A;  1NFT A;  4PAK A;  1MM7 A;  3SKP A;  1R6Z A;  3M3K A;  2DWI A;  3IJO B;  4X8R A;  3E9X A;  2I3W A;  3SEU A;  3RNN A;  1S9T A;  4P0I A;  3VXB A;  4FEB A;  1FBG A;  4JWO A;  3W9V A;  2YPN A;  1VFE A;  1VDW A;  4MNI A;  4WED A;  4H0W A;  1DSN A;  4WKM A;  2Q9T A;  2O51 A;  1H45 A;  2QSX A;  1GVC A;  4GBW A;  2XX8 A;  4YU0 A;  2V93 A;  1OQH A;  3OEN A;  5AA4 A;  4AQ4 A;  3QMF A;  2I4C A;  5L9O A;  2CMO A;  4PFY A;  4NHB A;  3B7D A;  4JSD A;  4RK9 A;  3TYH A;  3U8Q A;  3A09 A;  2XA5 A;  2R9J A;  2HEU A;  2XX9 A;  3Q28 A;  2ABH A;  2F6G A;  3GLB A;  2QJE A;  5ET6 A;  3IR1 A;  2QS2 A;  3SDF A;  4NE4 A;  2WEF A;  4P11 A;  5A5L A;  2RF1 A;  4E0X A;  3A3C A;  4ZEF A;  1D9V A;  1FTA A;  5JTY B;  3VVF A;  5I58 B;  3RPL B;  4G4P A;  3HCQ A;  2GQ1 A;  2DVZ A;  1GGG A;  4OVR A;  2XX7 A;  2HXW A;  2UVG A;  3KN3 A;  4Q0C A;  1IEJ A;  5LOM A;  2NOO A;  2O1L A;  5I59 B;  3OSQ A;  5K2X A;  3ZKL A;  1QUK A;  3FXU A;  3P7I A;  3M3F A;  1UTB A;  2ZMB A;  4OES A;  5CBS A;  4LZ8 A;  3SES A;  1RKM A;  1QUL A;  1US4 A;  1UTH A;  3JV9 A;  4THI A;  3TCF A;  3RY3 A;  1HSE A;  3IO4 A;  1IZ1 A;  3O97 A;  4UAC A;  4ZDM A;  5CMB A;  4QSD A;  3TTL A;  4FEC A;  1FPE A;  2R8T A;  1MPC A;  1UQW A;  3W9W A;  1XVX A;  2Q89 A;  1CE2 A;  4XTC Q;  4OMB A;  2Y7R A;  2DE4 A;  3MZ9 A;  1MQD A;  2Y7I A;  1QJM A;  2FIX A;  4KCC A;  3S9L C;  1SW1 A;  3K6W A;  3FD3 A;  3E78 A;  1NV7 A;  3KZG A;  3RGY A;  4DCY A;  4GLI A;  3U72 A;  4C1U A;  4HE1 A;  1M5B A;  2IA4 A;  1R9L A;  2E1S A;  2O6A A;  5AA2 A;  2UVJ A;  1ZTY A;  2CZK A;  5I5P A;  1A54 A;  1B52 A;  1NKX A;  4P1E A;  3OO6 A;  4FOR A;  3UN6 A;  2Y7W A;  2XWI A;  3MST A;  3PTY A;  1ZLQ A;  2F3D A;  3O66 A;  1NV5 A;  1MG1 A;  3PUY E;  1SW5 A;  1LBW A;  3IB2 A;  5F1Q A;  2B4L A;  1VFD A;  4N8G A;  5DT6 A;  2QS1 A;  1LST A;  4NF8 B;  5KDT A;  2XXX A;  4DCX A;  5I2N A;  3H7M A;  1FBP A;  3O9P A;  3TUS A;  1N0T A;  2G93 A;  4YIC A;  5IM2 A;  2AL5 A;  2NXO A;  4F3G A;  3K0V A;  4GXS B;  4N6D A;  3T66 A;  1BK4 A;  2XXW A;  3N6U A;  4GWW A;  3E79 A;  2XXQ A;  2UVH A;  4UAB A;  2DQV A;  2REJ A;  3CFL A;  1MY2 A;  1JW5 A;  4PGP A;  1EYJ A;  2QVR A;  3OD7 A;  1NV2 A;  3IFC A;  2Q74 A;  4BDO A;  4N15 A;  3KOT A;  4DI3 D;  1IME A;  5ELV A;  1N76 A;  4I62 A;  2H4I A;  1ZBM A;  5H8N A;  3BBR A;  1FQD A;  2F34 A;  4YMB A;  4MHF A;  5ET8 A;  1LLS A;  4G8H A;  3KGC A;  4XKR A;  3FJM A;  3K1P A;  4I8C A;  4ZE9 A;  4TLM B;  5ET7 A;  1Y3Q A;  3S9M C;  4YMA A;  1NV3 A;  1QW0 A;  5EQA A;  1A8F A;  4JWX A;  3IB0 A;  2ONR A;  3MVW A;  3TEP A;  3HV1 A;  1B4Z A;  4EUO A;  1LBX A;  3PPP A;  1NUY A;  4HCW A;  4LZ7 A;  4MBP A;  4QSC A;  4QXD A;  1SI1 A;  3T9U A;  4DDD A;  1H44 A;  1UTB B;  2GFE A;  4JB7 A;  1LCT A;  4ZEK A;  1EZO A;  1EH3 A;  4H65 A;  2XXT A;  2UXA A;  3FBP A;  1UTH B;  3IK6 B;  3FVG A;  1JP4 A;  4IO6 A;  3G3G A;  3FGS A;  3IOR A;  4KYE A;  2Z8D A;  2YJP A;  1DTZ A;  2DYX A;  4F39 A;  3HO7 A;  3B6T A;  4ZE8 A;  3Q26 A;  5DYH A;  2GRV A;  3S9E A;  4G68 A;  4ZEI A;  5T3J A;  1J1N A;  5I56 A;  1FBF A;  3T9X B;  1A8E A;  3RN8 A;  4PGN A;  1B3L A;  3VVD A;  2IEE A;  1QVS A;  3PPR A;  2WX9 A;  1RDY A;  1MQJ A;  1PC3 A;  4OEN A;  2PMS A;  3TTN A;  1MPB A;  3MZ1 A;  4PDH A;  4GX3 A;  1RYO A;  1MDP 1;  5AA2 B;  5EYF A;  4KD5 A;  5EQ9 A;  3ONM A;  1B5J A;  3EHT A;  1FQC A;  2D21 A;  3C32 A;  5CRY A;  4QF9 A;  3L6G A;  3M8U A;  1P1O A;  1Q1K A;  1Z7N E;  3PPQ A;  2I0C A;  5J16 A;  1LFI A;  1N3X A;  2ZXT A;  1TXF A;  3CG1 A;  4MAG A;  4ZS9 A;  1MY0 A;  2E0S A;  3K00 A;  1AL3 A;  3MBP A;  4NWC A;  4AB5 A;  5KDT B;  4L17 A;  3JYR A;  5I2N B;  3N94 A;  3PMV A;  4KI0 E;  3H03 A;  4O3B A;  5M2V A;  2KLF A;  3FVN A;  1SYH A;  3IJX B;  3BFT A;  1PB7 A;  2DWA A;  1VE4 A;  1TFA A;  4HE2 A;  4QFK A;  3RT8 A;  1NV4 A;  3DP8 A;  4R75 A;  5JEI A;  1IMF A;  1QUI A;  2DWH A;  3Q29 A;  1AMF A;  1B7H A;  1I6A A;  2I0B A;  1XI6 A;  2I3V A;  3THI A;  4OVP A;  5AA1 A;  2XWV A;  1IMB A;  1POT A;  2F7A A;  4HXV A;  2I49 A;  2WYK A;  3B6W A;  1SBP A;  1SW4 A;  4BDR A;  4LP2 B;  2Y7P A;  3IOT A;  4H8I A;  5H8N B;  4KYD A;  1H3D A;  4R6H A;  5H8S A;  4DZ1 A;  1UIU A;  1SYI A;  3ILT B;  1B3H A;  1SVX B;  1FQF A;  1QKB A;  2CEY A;  1SPI A;  2V84 A;  1LAX A;  1HSJ A;  1M5C A;  3L6H A;  5CBR A;  1JVY A;  1P1Q A;  5HM4 B;  4ELP A;  1O63 A;  1FRP A;  2Z8F A;  2DXY A;  3KFM A;  3D4C A;  3G3I A;  2VOZ A;  4MLV A;  4FAJ A;  1FJ6 A;  2H25 A;  4OTE A;  4NN3 A;  4P0G A;  4OAN A;  1NNT A;  1NUW A;  2RCA A;  4IO3 A;  3JZJ A;  2Y5L A;  1D9Y A;  1B7Z A;  2WYP A;  5EYH A;  2OJT A;  4GWO A;  1OVB A;  3H4Z A;  3KN8 A;  1B3E A;  1PDA A;  1FQE A;  1I6B A;  4F29 A;  4XKN A;  3MZB A;  1B05 A;  4F3P A;  4R6Y A;  2WKY A;  3QXM A;  1ZJL A;  2NVU B;  1Q35 A;  1I6Q A;  1Y20 A;  4MEV A;  4RPO A;  2CZL A;  4C1T A;  1FJ9 A;  5K2Y A;  3FXQ A;  4PQJ A;  4PBQ A;  3A29 A;  1URS A;  2B3F A;  3K02 A;  4H46 A;  5DEX A;  1EZP A;  5HPQ A;  3R26 A;  4G8M A;  5EHS A;  3MAM A;  4ISU A;  4F2Q A;  4MFI A;  2P0S A;  4G68 B;  4YB7 A;  4IB2 A;  3EKI A;  4O8M A;  4WXJ A;  3E3K A;  5I56 B;  4JSO A;  4F22 A;  2Q2A A;  3F11 A;  3KEI A;  4H45 A;  3PUW E;  4U4X A;  3R7X A;  1JQF A;  3KC1 A;  4ELR A;  2FHY A;  4HTG A;  5J1D A;  4KXP A;  4GWX A;  1O64 A;  1MXU A;  3VVE A;  4H5G A;  2QPQ A;  3MVY A;  1LAF E;  2QMW A;  2I58 A;  2F6P A;  1XVY A;  2F78 A;  1DCU A;  1RYX A;  1Y1M A;  1LFH A;  4P1L A;  1B1X A;  1XOC A;  1XT8 A;  1FBH A;  3E4R A;  3QUJ A;  2PVU A;  3RTF B;  4XIG Q;  1HSL A;  4BDL A;  1L5T A;  1DPP A;  4F18 A;  1P1N A;  4NF0 A;  4DE8 A;  3M3L A;  1A55 A;  2Y5K A;  3FXR A;  3T93 B;  4U21 A;  4H67 A;  1FTK A;  2DOJ A;  1N84 A;  3T1B A;  2H98 A;  3VFJ A;  3SEX A;  2I48 A;  3Q27 A;  5B70 A;  1WDN A;  4YB6 A;  4O3A A;  1EYK A;  1Z7M E;  4Q5T A;  2KQZ A;  3FVO A;  1YCJ A;  1BTJ A;  2L5V A;  3R6U A;  2VGQ A;  2GHB A;  3RQT A;  3HST A;  3QSL A;  5FTI A;  4ZEC A;  2ONK E;  4LAT A;  3RLF E;  2F7C A;  3RT6 B;  1B5I A;  4GOT A;  4BDN A;  3DEL B;  1AIV A;  2AYS A;  1II5 A;  2KR0 A;  3KG2 A;  3IOW A;  3MW0 A;  3LUZ A;  1B9J A;  4OEV A;  1JEV A;  3CVG A;  3A3U A;  3OO7 A;  4OQO A;  2R6G E;  4I1D A;  1NL5 A;  4YKI A;  5A5X A;  3S4U A;  2G29 A;  1IMD A;  3MP6 A;  1R1N A;  2ZZX A;  2ALU A;  1D9Q A;  2PFZ A;  4R2B A;  4YKK A;  3CFZ A;  3OXN A;  5I84 A;  4YKP A;  1A40 A;  1B6H A;  2D3I A;  3DM0 A;  3K6X A;  1OLC A;  1D3K A;  1NUX A;  4I9D A;  2XXH A;  2PT1 A;  4I3Y A;  4BDM A;  3K1M A;  2RKM A;  3N6T A;  3PPN A;  1YZ0 A;  2QS3 A;  3OO9 A;  1T0K A;  3O6I A;  1B7U A;  3GBB A;  2VHA A;  3EQ1 A;  2BJI A;  4ZED A;  3ISP A;  1MQH A;  1URD A;  2F35 A;  3K2D A;  4JVD A;  3HHG A;  1LGB C;  3TZA A;  2RC8 A;  4Z0I A;  3H6T A;  2FNC A;  1NMU A;  2V3Q A;  1NI9 A;  2B3B A;  2O7U A;  4G61 A;  1Y3N A;  3MVX A;  3PMX A;  2O7I A;  4E0W A;  3N5L A;  3B8B A;  4LON B;  4HCY A;  1P99 A;  1OVT A;  3U94 A;  2F36 A;  5DEX B;  3BIH A;  4TLL B;  4IY5 A;  1MS7 A;  2HXR A;  4GF8 A;  4H6D A;  5DVJ A;  4NGU A;  4DLD A;  3EHU A;  4QFL A;  2OX3 A;  3T96 B;  2VP1 A;  3H6V A;  3OEM A;  4R9F A;  1ATG A;  4QBA A;  1LB8 A;  4NF4 A;  4PBH A;  2Y7K A;  4EF2 A;  4M1V A;  4QFP A;  5AA4 B;  5IKB A;  1OIB A;  1A7L A;  3Q25 A;  1FTO A;  1QGX A;  3NOH A;  2ZZV A;  1OMP A;  5H8F A;  3QUF A;  1S7Y A;  3TMG A;  1N04 A;  4EQ7 A;  2DWJ A;  2PBW A;  5EQ7 A;  5L8D A;  1OQG A;  4U4S A;  1ZKB A;  1ZIU A;  5JK4 A;  1MXZ A;  1MH3 A;  2ANJ A;  1Y4C A;  3WAE A;  4IO4 A;  1NV1 A;  2AIX A;  3FJG A;  5ITO A;  3CSG A;  5H8Q A;  1VSO A;  3LC8 A;  4F2O A;  4P3L A;  5CMK A;  3LUY A;  3MJN A;  4EXL A;  3RTW B;  3CG3 A;  2ZYO A;  4NQ8 A;  3UOR A;  4BDQ A;  3K01 A;  2F7B A;  2GHA A;  3CIJ A;  1JW4 A;  4XKP A;  5I7I A;  3C31 A;  3HPI A;  2DE3 A;  1IQ7 A;  3UGW A;  2HZL A;  3TKD A;  5ISU A;  4GFR A;  4EQ9 A;  5AE4 A;  3FUZ A;  3OOA A;  1R9Q A;  2LAO A;  2XXP A;  1FPI A;  4OET A;  3MPL A;  3UA8 A;  3IAZ A;  4OER A;  4GRK A;  2ZZW A;  4QFN A;  5A5X B;  4OFJ A;  1RDZ A;  3O28 A;  2FA7 A;  4NTL A;  4POX A;  5BWJ A;  2RC7 A;  4PF8 A;  1SD3 A;  3VXC A;  1BLF A;  2Q88 A;  2DP8 A;  4N6K A;  4HS7 A;  1FBC A;  1TWY A;  3G3J A;  3ILU B;  1FPG A;  3ZS6 A;  3SEV A;  2RC9 A;  1DBZ A;  3VLU A;  3MQ9 A;  2ZNT A;  1CB6 A;  1MH4 A;  1MRP A;  1EZ9 A;  2VD3 A;  2O1M A;  4R74 A;  4LUB A;  3K4U A;  2FIE A;  1MXV A;  3LBS A;  4ESW A;  4F1Y A;  4P56 A;  1N7W A;  3O6G A;  4PDD A;  2HHM A;  5KZT A;  2REG A;  1G0I A;  2DXR A;  1B58 A;  4LZ5 A;  5KCJ A;  5FHO A;  2ZNS A;  3LSL A;  1JVX A;  2VD2 A;  4FIM A;  1YPN A;  1KA1 A;  1RDX A;  2A5T A;  2DS9 A;  2QRY A;  4LA9 A;  1OLA A;  4GWS A;  3FV1 A;  1FTL A;  3BIG A;  3H6U A;  1MM6 A;  3RPL A;  1XHY A;  4QFO A;  5BUU A;  4PFW A;  2D5W A;  4I3E A;  1LBZ A;  3TEL A;  4F3S A;  4MF3 A;  3I6V A;  3WAF A;  4FBP A;  1YYZ A;  3T0J A;  3TPA A;  3C33 A;  3TFL A;  1USY E;  5LTC A;  1LBV A;  4PC9 A;  4DXC A;  1M5E A;  4OWD A;  1DMB A;  3I5O A;  1SI0 A;  1IMA A;  2XXK A;  2Q8M A;  4OEU A;  4RJZ A;  5ESY A;  4NED A;  3G7W A;  2OZZ A;  3VE1 B;  3IOV A;  1YTV A;  1B51 A;  4N91 A;  3AXF A;  4YB5 A;  3D4G A;  3MC2 A;  4XEQ A;  2X26 A;  4PP0 A;  4IGT A;  1FCK A;  3B50 A;  2QS4 A;  2R71 A;  3C35 A;  3O6H A;  4PFU A;  5FBP A;  1PB8 A;  1IMC A;  5FHM A;  5CI5 A;  4ZZE A;  1ANF A;  4MH5 A;  4NF4 B;  4GWU A;  2YLN A;  2I6E A;  4GX6 A;  1PBQ A;  1FTJ A;  1SQY A;  5IZZ A;  4KFQ A;  2HAU A;  3FVK A;  4XFE A;  3MP8 A;  2XD3 A;  4NWD A;  4FED A;  2A5S A;  1LB9 A;  1Y4T A;  4NAP A;  3FAT A;  2VT5 A;  3K6U A;  4GIZ A;  1SDX A;  1LAH E;  4PFT A;  4OFO A;  1GV8 A;  1B46 A;  1YXI A;  1NV0 A;  5DW8 A;  4OHN A;  4KQP A;  4MJO A;  2XXI A;  5I3S A;  4U1O A;  4GXA A;  5TPA A;  4JVI A;  4Q30 B;  2FVZ A;  5IZ1 A;  3ZSF A;  1JNF A;  4O3C A;  4OFL A;  2PX1 A;  4EXK A;  1NV6 A;  1H43 A;  1B3F A;  1LBC A;  3S2V A;  3RYD A;  1FPD A;  4DXU A;  1FPK A;  5I57 A;  4RNS A;  3U65 A;  3EPE A;  4PF6 A;  2F8D A;  3IL1 B;  4G8N A;  4IY6 A;  3S9N C;  1US5 A;  3OEL A;  2WBD A;  1IIT A;  5H8H A;  1IXG A;  1N7X A;  4F3B A;  1DK4 A;  1D4N A;  1IIW A;  4X48 A;  2B65 A;  4ELO A;  4EQB A;  3PGF A;  3K6V A;  3MVZ A;  3U1O A;  1YAE A;  4X04 A;  1DOT A;  3KSJ A; 
#chains in the Genus database with same CATH homology
 4MLQ A;  3LR1 A;  1NNF A;  3PUV E;  1PEB A;  4NF5 A;  3W15 C;  3BFU A;  2Q8J A;  4F19 A;  4JDF A;  4R6K A;  4F1U A;  1BIY A;  1MXW A;  1N3W A;  1Y3P A;  2OLB A;  4OXV A;  1BP5 A;  3TOD A;  1GTK A;  4IO2 A;  4TQU Q;  5CC2 A;  5KCJ B;  4JBZ A;  2XXU A;  2Y84 A;  2A5T B;  3U93 A;  2V25 A;  4R72 A;  1MQI A;  2THI A;  1JEU A;  3GXA A;  3V83 A;  3UIF A;  1S50 A;  2OBG A;  3USD A;  1MY4 A;  3FJ7 A;  1JW1 A;  3LSX A;  1MXX A;  3MUQ A;  4U1Z A;  2V3T A;  5AA2 D;  1M5D A;  3TCH A;  1VR5 A;  2AL4 A;  5AA3 A;  3QIM A;  3V89 B;  1BKA A;  5L9M A;  3PPO A;  3RUM A;  1AH5 A;  3VDF A;  2O68 A;  2HAV A;  2O69 A;  1B2H A;  4ECF A;  1MXY A;  3KSX A;  3T9H B;  3KJ7 A;  3OEK A;  4H1X A;  3MP1 A;  1XS5 A;  1NNK A;  1I69 A;  2X7Q A;  4K3F A;  4ESX A;  2PT2 A;  3TTK A;  2XHD A;  5HBC A;  1WVJ A;  4LQ5 A;  1FW0 A;  2QL3 A;  1H76 A;  2OWT A;  1ZMG A;  4LQ2 A;  3TAJ A;  4IO5 A;  1B32 A;  4WEP A;  4FAT A;  3V8X B;  4C0R A;  1AOV A;  3OSR A;  4FJP A;  2F97 A;  5DTB A;  3KOS A;  3V5A A;  3O2A A;  4X9T A;  3VV5 A;  4TOZ A;  5TPA B;  5FTH A;  1Y1Z A;  4R2F A;  3MWB A;  4QHQ A;  4F31 B;  1B1H A;  2W7Y A;  2Z23 A;  4EDP A;  4YKJ A;  1TT1 A;  5TP9 A;  3VLV A;  5I57 B;  4KR5 A;  1XC1 A;  2OWS A;  4NF6 A;  4ND9 A;  3G3K A;  1B40 A;  5H8H B;  4ONY A;  3VLW A;  3DP6 A;  4XXU A;  3CI8 A;  2XXV A;  4R73 A;  3HHF A;  2OK2 A;  1NH8 A;  2DVC A;  2X7P A;  4YAH X;  4KPT A;  4OYV A;  2RCB A;  3ODB A;  4KHZ E;  2ONS A;  2ZYN A;  3HN0 A;  1MY3 A;  2OCU A;  3CSB A;  3IX1 A;  2XXR A;  2DE2 A;  4NF5 B;  4OVJ A;  4N6P A;  1P1U A;  1TFD A;  1ZU0 A;  1PBP A;  3IB1 A;  4N13 A;  3TTR A;  3TDJ A;  4G2Z A;  4XKQ A;  1IUD A;  3H3G A;  2HQ0 A;  2ZYK A;  4FE8 A;  4N07 A;  1B3G A;  2XXY A;  4U22 A;  4Z7E A;  3ECR A;  4H8J A;  4M4G A;  4UA8 A;  3TQW A;  5ITP A;  1FQA A;  3LSF B;  3DP4 A;  2NWJ A;  3CR9 A;  1WOD A;  5TU0 A;  4JXI A;  1IXC A;  4DXB A;  4ZZA A;  3UP9 A;  3H06 B;  4RA1 A;  4X1B A;  3C4M A;  3T22 A;  1B4H A;  3EN3 A;  3I3V A;  4GL8 A;  3C34 A;  3EHS A;  3KN7 A;  1USY H;  5I2K A;  4DIG A;  5F7V A;  1A99 A;  3CFX A;  3ZKK A;  3SET A;  3LSW A;  4GQO A;  3KBR A;  5B7D A;  4GL0 A;  2V3U A;  5IAI A;  2ZYM A;  1MPD A;  4EF1 A;  3K1N A;  2UVI A;  2M8C A;  1MY1 A;  4KYS A;  3H6W A;  1SW2 A;  3KJT A;  5DVF A;  3GZG A;  2ZNU A;  4AB6 A;  3RPW A;  4GD5 A;  3TQL A;  4GVO A;  5EHM A;  4U23 A;  3C36 A;  3OO8 A;  3GBA A;  2HCA A;  1LFG A;  1ELJ A;  1P1W A;  1QUJ A;  3QYT A;  1M5F A;  5CMM A;  4IGR A;  4RK2 A;  1DPE A;  3C9H A;  3PV0 E;  3U92 A;  4RY1 A;  2F5X A;  2H9B A;  4RXL A;  1LCF A;  3G3H A;  4RYA A;  3PUZ E;  3EF7 A;  4ELQ A;  3QAX A;  1EU8 A;  1B0L A;  5I58 A;  5JTY A;  1GR2 A;  1KWH A;  4LVQ A;  3BKI B;  2RIN A;  2H99 A;  2GH9 A;  4KCD A;  2I4B A;  1DTG A;  3IOU A;  3O29 A;  3T9V A;  3MPK A;  1IXH A;  5I59 A;  2HFB A;  5TP9 B;  3G3F A;  1F9B A;  3SEW A;  1PB9 A;  3IO6 A;  4PE5 B;  4HW8 A;  4NF6 B;  2P1S A;  4RPN A;  1POY 1;  2Z22 A;  1FQB A;  2DSF A;  1QKA A;  1NH7 A;  2FYI A;  1B5H A;  2H5Y A;  3CRB A;  3FAS A;  4IO7 A;  2O84 X;  1UIV A;  3FIR A;  2UYE A;  5CM6 A;  5CMC A;  4QRZ A;  5DVI A;  4Q8R A;  3PUX E;  1MDQ A;  5ICQ A;  2QMX A;  1B0H A;  1URG A;  4BLA A;  5H8F B;  3FV2 A;  1IXI A;  4YZZ A;  3SEY A;  3E13 X;  1JET A;  3FZV A;  2Z8E A;  4X1D A;  3PU5 A;  3N26 A;  3UK4 A;  4G68 C;  5FHN A;  2HZK A;  4F1V A;  2P2A A;  3B6Q A;  5L9S A;  4OZ9 A;  3SER A;  1MQG A;  3QK6 A;  2Q2C A;  1LAG E;  5H8Q B;  4H5F A;  1Y9U A;  4U2R A;  2BJJ X;  3TCG A;  5ICT A;  2ESN A;  1O7T A;  1FTM A;  4NF8 A;  4POW A;  4ZEB A;  2PYY A;  3PD9 A;  3PMW A;  3OMB A;  2XD2 A;  3DLN A;  2NUV A;  4QSE A;  4PET A;  1LBB A;  5I2K B;  3TTM A;  4G77 A;  4R9G A;  2UYF A;  1NNP A;  4JWY A;  4NMY A;  3PD8 A;  1NFT A;  3SKP A;  1MM7 A;  1R6Z A;  3M3K A;  2DWI A;  3IJO B;  3E9X A;  2I3W A;  3SEU A;  3RNN A;  1S9T A;  4P0I A;  3VXB A;  4FEB A;  4JWO A;  3W9V A;  2YPN A;  1VFE A;  4WED A;  4H0W A;  1DSN A;  4WKM A;  2Q9T A;  2O51 A;  1H45 A;  1GVC A;  2QSX A;  2XX8 A;  4YU0 A;  2V93 A;  1OQH A;  3OEN A;  5AA4 A;  4AQ4 A;  2I4C A;  5L9O A;  2CMO A;  4PFY A;  3B7D A;  4JSD A;  4RK9 A;  3TYH A;  3U8Q A;  3A09 A;  2R9J A;  2HEU A;  2XX9 A;  3Q28 A;  2ABH A;  2F6G A;  3GLB A;  2QJE A;  3IR1 A;  2QS2 A;  3SDF A;  4NE4 A;  4P11 A;  2RF1 A;  4E0X A;  3A3C A;  4ZEF A;  1D9V A;  5JTY B;  3VVF A;  5I58 B;  4G4P A;  3HCQ A;  2DVZ A;  1GGG A;  2XX7 A;  2HXW A;  2UVG A;  3KN3 A;  4Q0C A;  1IEJ A;  5LOM A;  2NOO A;  2O1L A;  5I59 B;  3OSQ A;  5K2X A;  3ZKL A;  1QUK A;  3FXU A;  3P7I A;  3M3F A;  1UTB A;  2ZMB A;  4OES A;  5CBS A;  4LZ8 A;  3SES A;  1RKM A;  1QUL A;  1US4 A;  1UTH A;  3JV9 A;  4THI A;  3TCF A;  3RY3 A;  1HSE A;  3IO4 A;  1IZ1 A;  3O97 A;  4UAC A;  4ZDM A;  5CMB A;  4QSD A;  3TTL A;  4FEC A;  1MPC A;  1UQW A;  3W9W A;  1XVX A;  2Q89 A;  1CE2 A;  4XTC Q;  4OMB A;  2Y7R A;  2DE4 A;  3MZ9 A;  1MQD A;  2Y7I A;  1QJM A;  4KCC A;  3S9L C;  1SW1 A;  3K6W A;  3FD3 A;  3KZG A;  3RGY A;  4DCY A;  4GLI A;  3U72 A;  4C1U A;  1M5B A;  2IA4 A;  1R9L A;  2E1S A;  2O6A A;  5AA2 A;  2UVJ A;  1ZTY A;  1A54 A;  1B52 A;  1NKX A;  3OO6 A;  4FOR A;  3UN6 A;  2Y7W A;  1ZLQ A;  3O66 A;  1MG1 A;  3PUY E;  1SW5 A;  3IB2 A;  5F1Q A;  1VFD A;  5DT6 A;  2QS1 A;  1LST A;  4NF8 B;  5KDT A;  2XXX A;  4DCX A;  5I2N A;  3H7M A;  3O9P A;  3TUS A;  1N0T A;  2G93 A;  4YIC A;  2AL5 A;  2NXO A;  4F3G A;  3K0V A;  4GXS B;  3T66 A;  2XXW A;  3N6U A;  2XXQ A;  2UVH A;  2DQV A;  2REJ A;  3CFL A;  1MY2 A;  1JW5 A;  3OD7 A;  4BDO A;  3KOT A;  5ELV A;  1N76 A;  4I62 A;  2H4I A;  1ZBM A;  5H8N A;  3BBR A;  1FQD A;  2F34 A;  4YMB A;  1LLS A;  4G8H A;  3KGC A;  4XKR A;  3FJM A;  3K1P A;  4I8C A;  4ZE9 A;  4TLM B;  1Y3Q A;  3S9M C;  4YMA A;  1QW0 A;  1A8F A;  4JWX A;  3IB0 A;  2ONR A;  3MVW A;  3TEP A;  3HV1 A;  1B4Z A;  4EUO A;  3PPP A;  4HCW A;  4LZ7 A;  4MBP A;  4QSC A;  1SI1 A;  3T9U A;  4DDD A;  1H44 A;  1UTB B;  2GFE A;  4JB7 A;  1LCT A;  4ZEK A;  1EZO A;  1EH3 A;  4H65 A;  2XXT A;  2UXA A;  1UTH B;  3IK6 B;  3FVG A;  4IO6 A;  3G3G A;  3FGS A;  3IOR A;  4KYE A;  2Z8D A;  2YJP A;  1DTZ A;  2DYX A;  4F39 A;  3HO7 A;  3B6T A;  4ZE8 A;  3Q26 A;  5DYH A;  2GRV A;  3S9E A;  4G68 A;  4ZEI A;  1J1N A;  5I56 A;  3T9X B;  1A8E A;  3RN8 A;  1B3L A;  3VVD A;  2IEE A;  1QVS A;  3PPR A;  1MQJ A;  1PC3 A;  4OEN A;  2PMS A;  3TTN A;  1MPB A;  3MZ1 A;  1RYO A;  1MDP 1;  5AA2 B;  5EYF A;  4KD5 A;  3ONM A;  1B5J A;  3EHT A;  1FQC A;  2D21 A;  3C32 A;  5CRY A;  4QF9 A;  3L6G A;  3M8U A;  1P1O A;  1Q1K A;  1Z7N E;  3PPQ A;  2I0C A;  1LFI A;  1N3X A;  2ZXT A;  1TXF A;  3CG1 A;  4ZS9 A;  1MY0 A;  2E0S A;  3K00 A;  1AL3 A;  3MBP A;  4NWC A;  4AB5 A;  5KDT B;  4L17 A;  3JYR A;  5I2N B;  3N94 A;  3PMV A;  4KI0 E;  3H03 A;  4O3B A;  5M2V A;  2KLF A;  3FVN A;  1SYH A;  3IJX B;  3BFT A;  1PB7 A;  2DWA A;  1VE4 A;  1TFA A;  4QFK A;  3RT8 A;  3DP8 A;  4R75 A;  5JEI A;  1QUI A;  2DWH A;  3Q29 A;  1AMF A;  1B7H A;  1I6A A;  2I0B A;  2I3V A;  3THI A;  5AA1 A;  1POT A;  2F7A A;  2I49 A;  3B6W A;  1SBP A;  1SW4 A;  4BDR A;  4LP2 B;  2Y7P A;  3IOT A;  4H8I A;  5H8N B;  4KYD A;  1H3D A;  4R6H A;  5H8S A;  4DZ1 A;  1UIU A;  1SYI A;  3ILT B;  1B3H A;  1SVX B;  1FQF A;  1QKB A;  2V84 A;  1LAX A;  1HSJ A;  1M5C A;  3L6H A;  5CBR A;  1JVY A;  1P1Q A;  5HM4 B;  4ELP A;  1O63 A;  2Z8F A;  2DXY A;  3KFM A;  3D4C A;  3G3I A;  2VOZ A;  4MLV A;  4FAJ A;  2H25 A;  4OTE A;  4P0G A;  1NNT A;  2RCA A;  4IO3 A;  3JZJ A;  1D9Y A;  1B7Z A;  2OJT A;  4GWO A;  1OVB A;  3H4Z A;  3KN8 A;  1B3E A;  1PDA A;  1FQE A;  1I6B A;  4F29 A;  4XKN A;  3MZB A;  1B05 A;  4F3P A;  4R6Y A;  2WKY A;  3QXM A;  1ZJL A;  2NVU B;  1Q35 A;  1I6Q A;  1Y20 A;  4RPO A;  2CZL A;  4C1T A;  5K2Y A;  3FXQ A;  4PQJ A;  1URS A;  2B3F A;  3K02 A;  5DEX A;  1EZP A;  5HPQ A;  3R26 A;  4G8M A;  5EHS A;  3MAM A;  4ISU A;  4F2Q A;  4MFI A;  2P0S A;  4G68 B;  4YB7 A;  4IB2 A;  4WXJ A;  3E3K A;  5I56 B;  4JSO A;  4F22 A;  2Q2A A;  3F11 A;  3KEI A;  3R7X A;  3PUW E;  4U4X A;  1JQF A;  4ELR A;  4HTG A;  5J1D A;  1O64 A;  1MXU A;  3VVE A;  4H5G A;  2QPQ A;  3MVY A;  1LAF E;  2QMW A;  2I58 A;  2F6P A;  1XVY A;  2F78 A;  1RYX A;  1Y1M A;  1LFH A;  1B1X A;  1XOC A;  1XT8 A;  3E4R A;  3QUJ A;  2PVU A;  3RTF B;  4XIG Q;  1HSL A;  4BDL A;  1L5T A;  1DPP A;  4F18 A;  1P1N A;  4DE8 A;  3M3L A;  1A55 A;  3FXR A;  3T93 B;  4U21 A;  4H67 A;  1FTK A;  2DOJ A;  1N84 A;  2H98 A;  3VFJ A;  3SEX A;  2I48 A;  3Q27 A;  5B70 A;  1WDN A;  4YB6 A;  4O3A A;  1Z7M E;  4Q5T A;  3FVO A;  1YCJ A;  1BTJ A;  3R6U A;  2VGQ A;  2GHB A;  3RQT A;  3HST A;  3QSL A;  5FTI A;  4ZEC A;  2ONK E;  4LAT A;  3RLF E;  2F7C A;  3RT6 B;  1B5I A;  4GOT A;  4BDN A;  3DEL B;  1AIV A;  2AYS A;  1II5 A;  3KG2 A;  3IOW A;  3MW0 A;  1B9J A;  4OEV A;  1JEV A;  3CVG A;  3A3U A;  3OO7 A;  4OQO A;  2R6G E;  5A5X A;  4I1D A;  1NL5 A;  4YKI A;  3S4U A;  2G29 A;  3MP6 A;  1R1N A;  2ALU A;  4R2B A;  4YKK A;  3CFZ A;  3OXN A;  5I84 A;  4YKP A;  1A40 A;  1B6H A;  2D3I A;  3DM0 A;  3K6X A;  1OLC A;  1D3K A;  4I9D A;  2XXH A;  2PT1 A;  4BDM A;  3K1M A;  2RKM A;  3N6T A;  3PPN A;  1T0K A;  2QS3 A;  3OO9 A;  3O6I A;  1B7U A;  3GBB A;  2VHA A;  3EQ1 A;  4ZED A;  1MQH A;  1URD A;  2F35 A;  3K2D A;  3TZA A;  3HHG A;  1LGB C;  2RC8 A;  4Z0I A;  3H6T A;  2FNC A;  1NMU A;  2V3Q A;  2B3B A;  2O7U A;  1Y3N A;  3MVX A;  3PMX A;  2O7I A;  4E0W A;  3N5L A;  4LON B;  4HCY A;  1P99 A;  1OVT A;  3U94 A;  2F36 A;  5DEX B;  4TLL B;  4IY5 A;  1MS7 A;  4GF8 A;  4H6D A;  5DVJ A;  4DLD A;  3EHU A;  4QFL A;  3T96 B;  2VP1 A;  3H6V A;  3OEM A;  4R9F A;  1ATG A;  1LB8 A;  4NF4 A;  2Y7K A;  4EF2 A;  4M1V A;  4QFP A;  5AA4 B;  5IKB A;  1OIB A;  1A7L A;  3Q25 A;  1FTO A;  1OMP A;  5H8F A;  3QUF A;  1S7Y A;  3TMG A;  1N04 A;  4EQ7 A;  2DWJ A;  2PBW A;  5L8D A;  1OQG A;  4U4S A;  1ZKB A;  1ZIU A;  5JK4 A;  1MXZ A;  1MH3 A;  2ANJ A;  1Y4C A;  3WAE A;  4IO4 A;  2AIX A;  3FJG A;  5ITO A;  3CSG A;  5H8Q A;  1VSO A;  3LC8 A;  4F2O A;  5CMK A;  3LUY A;  3MJN A;  4EXL A;  3RTW B;  3CG3 A;  2ZYO A;  3UOR A;  4BDQ A;  3K01 A;  2F7B A;  2GHA A;  3CIJ A;  1JW4 A;  4XKP A;  3C31 A;  3HPI A;  2DE3 A;  1IQ7 A;  3UGW A;  2HZL A;  3TKD A;  5ISU A;  4GFR A;  4EQ9 A;  5AE4 A;  3FUZ A;  3OOA A;  1R9Q A;  2LAO A;  2XXP A;  4OET A;  3MPL A;  3UA8 A;  3IAZ A;  4OER A;  4GRK A;  4QFN A;  5A5X B;  4OFJ A;  3O28 A;  2FA7 A;  4NTL A;  4POX A;  5BWJ A;  2RC7 A;  1SD3 A;  3VXC A;  1BLF A;  2Q88 A;  2DP8 A;  4HS7 A;  1TWY A;  3G3J A;  3ILU B;  3ZS6 A;  3SEV A;  2RC9 A;  3VLU A;  3MQ9 A;  2ZNT A;  1CB6 A;  1MH4 A;  1MRP A;  1EZ9 A;  2VD3 A;  2O1M A;  4R74 A;  4LUB A;  3K4U A;  1MXV A;  3LBS A;  4ESW A;  4F1Y A;  1N7W A;  3O6G A;  5KZT A;  2REG A;  2DXR A;  1B58 A;  4LZ5 A;  5KCJ A;  5FHO A;  2ZNS A;  3LSL A;  1JVX A;  2VD2 A;  4FIM A;  1YPN A;  2DS9 A;  2A5T A;  2QRY A;  4LA9 A;  1OLA A;  3FV1 A;  1FTL A;  3H6U A;  1MM6 A;  1XHY A;  4QFO A;  5BUU A;  4PFW A;  2D5W A;  3TEL A;  4F3S A;  3WAF A;  3I6V A;  4MF3 A;  3TPA A;  3C33 A;  3TFL A;  1USY E;  4DXC A;  1M5E A;  4OWD A;  1DMB A;  3I5O A;  1SI0 A;  4OEU A;  4RJZ A;  4NED A;  3G7W A;  2OZZ A;  3VE1 B;  3IOV A;  1YTV A;  1B51 A;  3AXF A;  4YB5 A;  3D4G A;  3MC2 A;  2X26 A;  4PP0 A;  4IGT A;  1FCK A;  2QS4 A;  2R71 A;  3C35 A;  3O6H A;  4PFU A;  1PB8 A;  5FHM A;  5CI5 A;  4ZZE A;  1ANF A;  4MH5 A;  4NF4 B;  2YLN A;  2I6E A;  1PBQ A;  1FTJ A;  1SQY A;  4KFQ A;  2HAU A;  3FVK A;  3MP8 A;  2XD3 A;  4NWD A;  4FED A;  2A5S A;  1LB9 A;  1Y4T A;  3FAT A;  3K6U A;  4GIZ A;  1SDX A;  1LAH E;  4PFT A;  4OFO A;  1GV8 A;  1B46 A;  4OHN A;  4KQP A;  2XXI A;  4U1O A;  4GXA A;  5TPA A;  4Q30 B;  3ZSF A;  1JNF A;  4O3C A;  4OFL A;  2PX1 A;  4EXK A;  1H43 A;  1B3F A;  1LBC A;  3S2V A;  4DXU A;  5I57 A;  4RNS A;  3EPE A;  2F8D A;  3IL1 B;  4G8N A;  4IY6 A;  3S9N C;  1US5 A;  3OEL A;  1IIT A;  5H8H A;  1IXG A;  1N7X A;  4F3B A;  1D4N A;  1IIW A;  4X48 A;  2B65 A;  4ELO A;  4EQB A;  3PGF A;  3K6V A;  3MVZ A;  3U1O A;  1YAE A;  1DOT A;  3KSJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...