1LSTA

Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of the periplasmic lysine/arginine/ornithine-binding protein with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Amino-acid binding protein
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA02
3MAMA 4NF5B 3THIA 3MUQA 1PB7A 3G3IA 4IO4A 4UA8A 4NWCA 4ZZEA 3ZS6A 2AIXA 1PDAA 1JVXA 1URGA 4OESA 4ZEDA 1IXCA 2X7QA 2NXOA 2Y7WA 4U21A 2D21A 4ELOA 3FVOA 3HSTA 4R72A 3N5LA 1N7WA 4R6KA 1P1NA 2H25A 1LCFA 2GHAA 2RF1A 1FQFA 4G77A 1IXHA 4K3FA 4R2BA 1TT1A 5I59A 4ZEIA 4DDDA 2RCAA 1PBPA 1SW1A 1AH5A 4KYSA 2Q2CA 4KR5A 4LUBA 3RNNA 3K4UA 3TTRA 2F7CA 3T93B 2F7BA 1NFTA 1IQ7A 3HCQA 1ZJLA 3PUZE 2XXQA 2H99A 1QKAA 4IO5A 2ALUA 1H43A 2ZNUA 5DVIA 3RTFB 3RT8A 3K2DA 1TWYA 4AB6A 2A5SA 5FTHA 3OD7A 4WEPA 2QJEA 2XD2A 1VFDA 4O3BA 1IIWA 3VVFA 5J1DA 5B7DA 1JEUA 2AL5A 2FNCA 1B51A 3OXNA 3FATA 1O7TA 2PVUA 4DCXA 1YCJA 3ILTB 3OO8A 5HBCA 4F22A 4F3SA 1MH3A 1DTZA 2VGQA 4G4PA 5CMBA 3RGYA 4O3CA 4TQUQ 2RC8A 2QS2A 1I69A 2R71A 2DS9A 2V3TA 4LP2B 4NF8B 4OETA 3M8UA 5CI5A 4U22A 3ZKLA 4KYDA 4DXBA 2FYIA 4F2QA 3O6GA 4I1DA 4THIA 4BDNA 2ZYNA 4R74A 2DP8A 2ZYKA 1QJMA 4QF9A 4ELRA 4YAHX 5M2VA 3U94A 1XOCA 1EU8A 3C9HA 3K02A 2NVUB 1XVYA 2REJA 3MP8A 1MY0A 1OVBA 1SBPA 1USYH 3DELB 2THIA 4OXVA 4ZEKA 3TELA 5L9OA 1AIVA 3BFUA 3MWBA 5EHSA 2Q88A 3EHTA 1RYXA 2BJJX 3PPOA 4GQOA 4LQ5A 1DOTA 1SYIA 3U1OA 1LFGA 3A09A 3G3KA 1LAHE 3H06B 4YB5A 2F6GA 2F35A 1PBQA 2Q8JA 2RC9A 3PPQA 1GR2A 4EDPA 5AA4B 4I8CA 3GXAA 1AOVA 3FUZA 3TODA 3QUFA 5FHNA 3JZJA 4Z7EA 1CE2A 1B9JA 1LB8A 1P99A 1OVTA 3ONMA 2HQ0A 3PD9A 1ANFA 3PUXE 4G8NA 3TCGA 1UTHA 2V25A 1JW1A 1NNPA 1S9TA 1NMUA 4KYEA 3PMXA 1IXIA 2DE3A 5K2YA 2R6GE 2I49A 2P2AA 3IB1A 3R26A 4F3PA 4MBPA 4XKQA 4G68C 1LCTA 2F78A 3PGFA 4GIZA 4ISUA 4R2FA 4YB6A 3T9VA 2F36A 2NUVA 4HTGA 5DTBA 2RINA 1GV8A 4F3BA 5JTYB 4BDRA 3TUSA 4HS7A 1P1QA 2PBWA 3U8QA 2O69A 1FQBA 3C4MA 1BIYA 3L6GA 1SI1A 1M5DA 2XXUA 3UP9A 3KN7A 4IY6A 5I56A 1XC1A 4QSDA 4OEVA 1MH4A 5I57A 3KJTA 4QFNA 2DXYA 1US4A 3KBRA 3O9PA 5H8FA 1LAXA 3WAEA 1B7ZA 5JTYA 3Q28A 1B4HA 5H8HB 3MZ9A 4FEDA 1A8EA 4LA9A 1ZKBA 2R9JA 3O66A 3CRBA 4QFLA 3SEWA 3IB0A 4R6YA 5I2KA 4KCCA 2Y7RA 4ONYA 5CBRA 4ZE8A 2I3VA 3W9WA 1EZOA 1MS7A 4GD5A 1FW0A 4GWOA 4RPOA 1NKXA 1YAEA 3KGCA 2ANJA 4OZ9A 1B3FA 1JW5A 2OCUA 3KFMA 3N6UA 4R9FA 5H8FB 3UA8A 3GLBA 4F2OA 1PB8A 1H76A 3VLUA 3U72A 4EQ7A 4EXKA 4DIGA 2HCAA 2RCBA 1R1NA 3MW0A 3OSRA 4G2ZA 4LONB 4NWDA 4R9GA 5I2KB 5F1QA 3U92A 4IGRA 2UVJA 3DLNA 3OENA 4X48A 2G29A 5ISUA 3MP6A 1MM6A 3IX1A 2UXAA 4RA1A 4WXJA 3TDJA 1B1HA 1R6ZA 2ONKE 2QPQA 2G93A 4OYVA 4OQOA 4U2RA 1H44A 1N76A 5H8NA 2XXIA 1UTBB 5TP9B 1B5JA 3G3JA 3FJ7A 3AXFA 4GLIA 2H9BA 4H5GA 1A7LA 3V5AA 1QKBA 1A55A 3IAZA 4ZECA 2O6AA 1Y20A 3IORA 4GOTA 4H0WA 1FQCA 4TOZA 1MY2A 4LQ2A 4NMYA 5TPAB 1NH8A 4M4GA 4RNSA 1GGGA 2XXWA 3ILUB 5I84A 5KCJB 2DWHA 5F7VA 4FEBA 1B1XA 4JSOA 4LVQA 2XXPA 4RXLA 3RQTA 5CMKA 1JEVA 1N3XA 3FZVA 3MC2A 3O28A 5TPAA 1D4NA 4NF4B 1NNTA 3LUYA 3MBPA 3O6HA 3IJOB 1MXWA 4MFIA 4POXA 1LSTA 3GBBA 2QRYA 4ZDMA 3U93A 4JBZA 3RN8A 1LBBA 2F8DA 2OK2A 3OEMA 4JDFA 3H3GA 1WDNA 2XX7A 1M5BA 3EHSA 4H8IA 3TKDA 2XX8A 1JW4A 5I2NB 2A5TA 3O6IA 5H8NB 4MLQA 5AA2B 4GF8A 3HN0A 4ZS9A 3OMBA 2GRVA 3B7DA 3FVGA 3LC8A 4UACA 3RT6B 4AQ4A 4BDQA 3W15C 4C0RA 2ZNSA 5L9SA 5L9MA 3KOTA 2PYYA 3MVXA 4FORA 5CRYA 3Q25A 1MXVA 2IEEA 5IKBA 1ZTYA 1HSEA 4OEUA 1QUKA 3K1NA 4P11A 4POWA 1ZMGA 4RK2A 3M3LA 3PUVE 4XIGQ 1LB9A 3ECRA 4FAJA 5L8DA 2XX9A 4BDOA 2V84A 2VOZA 1MG1A 5AA1A 3IR1A 3FGSA 3OOAA 1EZ9A 1SD3A 2PT1A 3I5OA 1TFAA 4QSCA 1N3WA 3MZBA 1KWHA 3Q27A 5EYFA 5FTIA 3MZ1A 1HSJA 1USYE 3CFZA 3PPNA 3T9HB 5DEXB 2NOOA 4PE5B 2HXWA 3TQWA 1B3LA 3C35A 4LZ8A 3TMGA 4EF1A 3E4RA 1CB6A 2DQVA 1PB9A 4XXUA 4L17A 3VDFA 2I0BA 4TLMB 2OWSA 3A3CA 4QSEA 3IOUA 3TTNA 3MVWA 5CM6A 1XHYA 5H8SA 4EUOA 1D9YA 2ONRA 1ZIUA 2ZYOA 1RKMA 3LR1A 4H67A 5I58A 2Q89A 4YKPA 4E0WA 2H4IA 1RYOA 3IOTA 1UIVA 1LFIA 1P1WA 2E0SA 3TTMA 4DCYA 1N7XA 2GFEA 2WKYA 2ZXTA 4GL8A 3FV1A 4F19A 3T96B 2REGA 2RKMA 3OELA 4N07A 3IOVA 3V89B 1MQGA 5TU0A 4YKKA 4XKPA 3H6UA 3SETA 1BP5A 5KZTA 2XXVA 2HEUA 1B5IA 1MY4A 2F6PA 1B2HA 4P0GA 4OENA 3EHUA 4PFYA 4O3AA 3N6TA 1R9QA 1A8FA 1LBCA 1O64A 1QUIA 2V93A 3DM0A 3K6XA 3KOSA 3CG3A 3OO9A 1B5HA 4Q30B 4YB7A 4AB5A 1MQJA 4EXLA 4JWOA 3CIJA 3FD3A 3QK6A 1GVCA 1SI0A 5CBSA 2Y7PA 3T9XB 3PUWE 3FXQA 4YKIA 3PUYE 2F34A 3SDFA 4OTEA 5HM4B 3ZSFA 1FTOA 1Z7ME 1D9VA 3O29A 5KDTA 3H03A 5JEIA 2UVGA 1SVXB 4OFOA 5DT6A 1JVYA 3OSQA 3K6VA 3H6VA 2F7AA 2LAOA 5DVJA 4Q8RA 1B0LA 4GXAA 4G68A 3SEVA 1N0TA 4RK9A 3UIFA 1FTMA 1VFEA 4KFQA 3OO6A 4Q0CA 4P0IA 4HCWA 2QS1A 3S9NC 1SYHA 3P7IA 2H5YA 3E9XA 1NNKA 3KN8A 5AA2D 5ITPA 3IO4A 3HPIA 3KZGA 4KHZE 5LOMA 4XKRA 1LFHA 3HV1A 1ATGA 2PX1A 1BKAA 3BBRA 1B0HA 5ITOA 1MY1A 2X7PA 4OMBA 4G68B 5I59B 1ZU0A 2X26A 4LZ5A 4M1VA 2B3FA 4NEDA 5FHOA 2UYEA 3PPPA 2P0SA 5FHMA 5BUUA 3C36A 1B4ZA 5CMMA 2B3BA 3V8XB 3VVDA 5A5XB 1FQAA 1TFDA 1Y3NA 1MPCA 2GHBA 1OLAA 2OLBA 2PMSA 2O1LA 2XXYA 3CG1A 3E3KA 1B58A 1MDQA 2VP1A 1O63A 1M5CA 4NF5A 4U1OA 4WKMA 5ELVA 3R6UA 3S2VA 4YMBA 1FCKA 2XHDA 1M5EA 3FIRA 3IB2A 5DVFA 4RY1A 4NE4A 4KQPA 3K00A 1QUJA 1B3GA 3FV2A 5JK4A 5H8QA 2V3QA 2YLNA 1R9LA 4ESXA 2DVZA 1IZ1A 3VV5A 4KPTA 3G3FA 4N6PA 3SEXA 5AE4A 1MXZA 3USDA 5ICTA 2D3IA 3O97A 4R75A 1NH7A 1B40A 2XXRA 3BFTA 2QMWA 4ZE9A 1Y3QA 1Y4CA 3T22A 4QHQA 2M8CA 3FASA 3UN6A 1FTJA 2O51A 4NF8A 3KSXA 1MY3A 4WEDA 4MH5A 4ZEFA 1IUDA 1Y3PA 3QUJA 3SERA 3TFLA 5I56B 5KDTB 2H98A 4N13A 2FA7A 4DLDA 1EH3A 1NL5A 2ZMBA 3E13X 4LZ7A 1S7YA 2Z22A 3CFXA 3QXMA 2DWJA 5A5XA 1FTLA 1MQDA 2B65A 3UORA 3PD8A 1GTKA 3C34A 4GFRA 3D4GA 3MP1A 4BDLA 2Z23A 1A40A 1FQDA 2QSXA 2YPNA 3MVZA 4I9DA 4H6DA 4RPNA 5DYHA 1BTJA 3FJGA 3VLVA 4XKNA 5H8QB 3K6UA 1UQWA 2DE4A 3H4ZA 1M5FA 2I6EA 3UGWA 2RC7A 4PFTA 4YICA 1MQIA 1XT8A 3RUMA 1LLSA 1WVJA 4OVJA 3R7XA 3PMVA 5I57B 3VVEA 4YMAA 4YZZA 3RLFE 2ZYMA 1UTHB 3LSWA 4OFJA 3OO7A 3RY3A 4F29A 4MF3A 1UTBA 4RYAA 1B6HA 5TP9A 3CSBA 3B6WA 4TLLB 2OJTA 3PMWA 2D5WA 4PQJA 3TTKA 1N84A 4F18A 1MQHA 2CZLA 3GBAA 2QS4A 3HO7A 4HCYA 4LATA 4PFWA 4F39A 3N26A 2QS3A 4HW8A 2IA4A 2NWJA 4H8JA 4RJZA 3TCHA 2Y7KA 1SQYA 4QFOA 2P1SA 2I4CA 2HAVA 5BWJA 3SEUA 4OWDA 2O1MA 1DSNA 5CC2A 4H65A 1ELJA 1OIBA 2DSFA 4IO3A 5H8HA 1XS5A 1SW2A 2Z8FA 3CSGA 3VXCA 4FJPA 1HSLA 5B70A 1YTVA 1ZBMA 1Y9UA 2KLFA 2ONSA 2VD2A 1Z7NE 3IL1B 2HFBA 3QYTA 4JB7A 1T0KA 3BKIB 3FJMA 3LSLA 1FTKA 1AMFA 3KN3A 4DZ1A 1P1UA 1YPNA 2I48A 1JNFA 2I0CA 3KEIA 1VSOA 4ECFA 1B32A 1AL3A 1OLCA 1DPPA 3EPEA 4F1YA 4F1UA 2I58A 4IB2A 1WODA 1DMBA 2AYSA 3KSJA 3QIMA 3IOWA 3Q26A 3MPKA 3LSFB 1B7UA 1PEBA 1Y4TA 3FXRA 3JYRA 1MXXA 1IITA 4EQBA 4FE8A 3OEKA 3QSLA 3M3FA 3T9UA 4F3GA 4JXIA 3S9EA 4BLAA 2HZKA 4ND9A 3TCFA 3DP8A 3TTLA 4BDMA 2V3UA 3G3GA 3ODBA 3TYHA 1OQHA 2HAUA 1EZPA 4X9TA 3QAXA 4R6HA 1QW0A 2A5TB 1J1NA 2Q9TA 4DXUA 4NF6A 2YJPA 4PP0A 4ZEBA 3VLWA 1TXFA 1BLFA 2F5XA 4C1UA 1SW4A 1POY1 2HZLA 3HHFA 4X1BA 1QVSA 3G7WA 4NTLA 4C1TA 3K01A 4YKJA 1D3KA 3GZGA 3LBSA 4PETA 3PV0E 4U4SA 3SKPA 1PC3A 2F97A 2OBGA 3FVNA 3K1PA 3TQLA 3VXBA 4X1DA 3TEPA 1JQFA 1LGBC 1Y1ZA 4I62A 4IO7A 2AL4A 4NF6B 1N04A 1S50A 2Y84A 1LAGE 1MDP1 3KJ7A 3RPWA 3RTWB 3UK4A 1OMPA 4F1VA 4U4XA 3S4UA 2DYXA 3C32A 4Z0IA 3L6HA 1MRPA 3CVGA 3SESA 4H1XA 5I2NA 2UVIA 1DTGA 3FVKA 3K6WA 4F31B 1MM7A 4IY5A 3S9LC 3MQ9A 4IGTA 2ZNTA 1IXGA 1LAFE 1MXYA 3N94A 5KCJA 3PPRA 5I58B 4U23A 1DPEA 4DXCA 5CMCA 5EHMA 1A99A 3H6WA 3CR9A 3K1MA 4KD5A 5DEXA 4NF4A 1I6BA 3DP4A 1B52A 3Q29A 4KI0E 2CMOA 1II5A 4YU0A 3MPLA 3V83A 1B05A 5IAIA 3O2AA 4QFPA 1ZLQA 3LSXA 4U1ZA 3VE1B 2O7IA 1SDXA 1IEJA 3T66A 4ESWA 3S9MC 1US5A 1FQEA 1XVXA 2DVCA 4OHNA 2I3WA 1P1OA 4QFKA 3ZKKA 4ELQA 3W9VA 2O68A 3H6TA 3I3VA 3KG2A 4EF2A 3PU5A 5AA2A 2PT2A 4GL0A 1JETA 4OFLA 3D4CA 1OQGA 4E0XA 1MPDA 1H45A 2Q2AA 3EN3A 1B3HA 3IO6A 1L5TA 1A54A 3IJXB 2DE2A 4FECA 1NNFA 2DOJA 4DE8A 5AA3A 4ELPA 3EQ1A 4QRZA 5K2XA 2XXHA 2I4BA 2UVHA 2Z8DA 1H3DA 2DXRA 3DP6A 3F11A 2DWAA 2OWTA 2VHAA 1URDA 1SW5A 4G8HA 4GVOA 2QL3A 4OERA 2Y7IA 2OZZA 3WAFA 4XTCQ 4GRKA 3JV9A 3SEYA 4KCDA 3TPAA 4EQ9A 3IK6B 2VD3A 3MJNA 4R73A 5AA4A 1B3EA 2O84X 4ZZAA 3VFJA 1UIUA 3B6TA 4MLVA 1I6AA 3B6QA 4G8MA 1F9BA 1POTA 2UYFA 4FIMA 1B46A 1VE4A 3TZAA 2E1SA 2QMXA 4JWXA 2XD3A 4JSDA 2XXXA 4H5FA 1B7HA 3MVYA 3I6VA 2Z8EA 2O7UA 1Q1KA 3M3KA 4FATA 5ICQA 3CI8A 1MXUA 1MPBA 4GXSB 1Q35A 4Q5TA 5HPQA 3K0VA 3C31A 1VR5A 4PFUA 3EF7A 1Y1MA 3C33A 1URSA 4IO2A 2ESNA 3TAJA 4JWYA 1I6QA 2ABHA 3FXUA 2XXTA 3G3HA 3H7MA 4IO6A 2DWIA 3A3UA 2W7YA 3CFLA 3HHGA 2GH9A 1QULA
chains in the Genus database with same CATH superfamily
3MAMA 4NF5B 1PB7A 1NV6A 1IXCA 4ELOA 4U21A 4R72A 4R6KA 2H25A 1LCFA 2GHAA 4K3FA 4DDDA 4KYSA 4KR5A 3TTRA 2F7CA 3HCQA 2H99A 2ZNUA 5DVIA 4HE0A 2CZIA 2A5SA 3OD7A 1IIWA 5J1DA 1B51A 3KC1A 3FATA 1IMAA 1O7TA 2PVUA 4DCXA 5HBCA 1MH3A 4G4PA 5CMBA 5F24A 4XKPA 2QS2A 4LP2B 4OETA 4GX4A 4U22A 4KYDA 4THIA 2P3NA 4YAHX 4OA4A 3PTYA 1OVBA 1LBYA 3DELB 4P47A 5EHSA 2Q88A 3PPOA 2BJJX 3A09A 3G3KA 4YB5A 2F35A 5AA4B 1GR2A 2R8TA 2CZKA 3FUZA 1CE2A 1B9JA 3TCGA 3PUXE 1UTHA 2V25A 1JW1A 2WYKA 2DE3A 5K2YA 2I49A 4XKQA 4G68C 4YB6A 5JTYB 1P1QA 2O69A 4QSDA 4OEVA 1DK4A 3KBRA 1NV3A 1A8EA 4LA9A 3CRBA 5I2KA 3IB0A 4R6YA 4ONYA 4ZE8A 5H8FB 3UA8A 3GLBA 1H76A 3VLUA 2HCAA 3V8XB 4NHBA 2Q8MA 2UVJA 4X48A 1MM6A 2UXAA 4RA1A 2QPQA 2G93A 1UTBB 4GBWA 5TP9B 3FJ7A 4QXDA 1QKBA 1A55A 4ZECA 1MY2A 4M4GA 3ILUB 3HFUA 2DWHA 5F7VA 1B1XA 2XXPA 1JEVA 3FZVA 3MC2A 5TPAA 4NF4B 4MJOA 3MBPA 3IJOB 1LSTA 1LBBA 3OEMA 3TKDA 4N15A 2XX8A 1LBZA 3CHGA 4ZS9A 4BDQA 4GX3A 3W15C 2PYYA 3MVXA 3Q25A 4P11A 3M3LA 3PUVE 3FBPA 4XIGQ 4BDOA 2V84A 3IR1A 3LV0A 1TFAA 4QSCA 5FTIA 4N8YA 2PFYA 1IMBA 2NOOA 1CB6A 2DQVA 1PB9A 5EQ7A 4MNCA 5CM6A 1XHYA 5H8SA 1D9YA 5I58A 4YKPA 1RYOA 3IOTA 1LFIA 3TTMA 1N7XA 2ZXTA 4GL8A 3MYUA 2REGA 4GWXA 2RKMA 2HHMA 4XFEA 5KZTA 2XXVA 1B2HA 3T1BA 1O64A 3CG3A 2Y7PA 4YKIA 3PUYE 4GWYA 5KDTA 1FPLA 1SVXB 1JVYA 3OSQA 3K6VA 2ZZXA 3OO6A 2H5YA 3IO4A 3HPIA 3KZGA 4P8BA 4XKRA 3HV1A 2PX1A 5I59B 1B0HA 4OMBA 4N4UA 3IFCA 1ZU0A 2B3FA 5FHMA 3C36A 1B4ZA 5CMMA 3VVDA 4FEDA 2OLBA 5ET7A 2GHBA 2XXYA 3CG1A 2O1LA 5ELVA 4NF5A 2XHDA 1B3GA 5H8QA 2V3QA 4KPTA 5AE4A 2D3IA 4R75A 1Y3QA 2M8CA 3UN6A 2O51A 4ZEFA 1IUDA 4N13A 2FA7A 2ZMBA 3E13X 1S7YA 2Z22A 3CFXA 1FTLA 2B65A 4OANA 1A40A 1FQDA 2QSXA 5DYHA 1BTJA 5H8QB 3K6UA 4PF8A 4OVJA 5I57B 4GBVA 1UTHB 1NV2A 4MF3A 4TLLB 2Q74A 2D5WA 4F18A 1D9QA 4GWZA 4LATA 4PE3A 4F39A 2NWJA 2HAVA 5BWJA 4OWDA 2O1MA 1XS5A 3CSGA 5B70A 4FJPA 1YTVA 4JB7A 4KXPA 2WBDA 3KN3A 5A5LA 4ECFA 1VSOA 1B32A 3EPEA 3QIMA 4OVSA 3Q26A 1PEBA 1Y4TA 3FXRA 3RPLA 4EQBA 3S9EA 3T9UA 3M3FA 4JXIA 4BLAA 3TCFA 4BDMA 3LUZA 2HAUA 2Q9TA 4DXUA 4NX1A 2F5XA 4C1UA 3HHFA 3FXBA 3KC0A 1FBEA 4PETA 3LBSA 3SKPA 2OBGA 4X1DA 4NF6B 1N04A 2Y84A 1MDP1 3KJ7A 4U4XA 3C32A 1MRPA 3SESA 4IY5A 3PPRA 4U23A 1DPEA 4DXCA 1A99A 3CR9A 5EQ8A 4NF4A 1B52A 2CMOA 1II5A 3MPLA 4PBHA 4NN3A 4O7MA 2O7IA 3RYDA 2DVCA 3W9VA 2PT2A 4E0XA 3D4CA 1MPDA 1B3HA 4UABA 4FECA 1NNFA 5LDZA 4ELPA 1L5TA 3DP6A 2UVHA 3F11A 4DI4B 2OWTA 1FPIA 4OERA 2OZZA 1B3EA 2O84X 4ZZAA 4P9KA 4N81A 1I6AA 2UYFA 1INPA 3TZAA 4JWXA 2XD3A 2Z8EA 3M3KA 4FATA 4Q5TA 1Q35A 5HPQA 2ABHA 3G3HA 1BK4A 3CFLA 3HHGA 3V5AA 3ROJA 1LEVA 3MUQA 3G3IA 2WEFA 4NWCA 4ZZEA 4DI3D 4ZEDA 2D21A 3FVOA 1IXHA 3U65A 1AH5A 3K4UA 1EYJA 3T93B 1NFTA 3PUZE 1QKAA 4IO5A 1NI9A 1TWYA 3IFAA 4WEPA 2HPGA 2QVVA 2KQZA 3VVFA 3OXNA 2WX9A 3OO8A 4F22A 1DTZA 2VGQA 4TQUQ 2RC8A 1AIVA 3M8UA 4BDNA 1QJMA 4QF9A 5M2VA 3K02A 1MY0A 2CEXA 2THIA 4N6KA 5L9OA 2PCRA 1NV1A 1LFGA 1LAHE 3H06B 2Q8JA 2RC9A 4EDPA 3GXAA 2XWKA 1OVTA 4G8NA 3PMXA 3QMFA 3IB1A 3R26A 1FBDA 3PGFA 4ISUA 4HXVA 3T9VA 2VPOA 4HTGA 5DTBA 4F3BA 4BDRA 2PBWA 3C4MA 1BIYA 3L6GA 5I57A 1MH4A 3KJTA 4QFNA 1B7ZA 3MZ9A 3SEWA 1ZKBA 4QFLA 4KCCA 2Y7RA 1MS7A 1FW0A 4RPOA 4HE2A 4EXKA 2RCBA 4PGNA 5I2KB 4NWDA 5F1QA 2G29A 3IX1A 4WXJA 4U2RA 2XXIA 1B5JA 3G3JA 2OX3A 5I5PA 2O6AA 4GOTA 3IORA 4H0WA 1VDWA 4TOZA 4NMYA 5TPAB 4RNSA 5ET6A 5KCJB 4JSOA 2F3BA 4MFIA 4ZDMA 3U93A 2OK2A 4JDFA 2XA5A 3H3GA 1M5BA 2A5TA 3O6IA 3HN0A 3OMBA 4UACA 5L9SA 3RT6B 1MXVA 2IEEA 5IKBA 1HSEA 4O94A 1QUKA 3K1NA 1ZMGA 4RK2A 4OVQA 3ECRA 4FAJA 2XX9A 2VOZA 4NF0A 5IZ3B 3FGSA 2B4MA 1EZ9A 3MZBA 1KWHA 5EYFA 3MZ1A 5DEXB 4PE5B 4LZ8A 3TMGA 4L17A 4X04A 2I0BA 3A3CA 4QSEA 4G61A 2ZYOA 4XF5A 4E0WA 1UIVA 2E0SA 2WKYA 3T96B 3V89B 4OVRA 1MQGA 1B5IA 4OENA 3EHUA 3OO9A 1MQJA 3FXQA 4PAIA 3B50A 4PFIA 2UVGA 1FBFA 4Q8RA 4GWSA 1FTMA 3S9NC 4P0IA 3P7IA 3KN8A 1YZ0A 5ITPA 1MY1A 2X26A 4LZ5A 5FHOA 5BUUA 3PPPA 2WYPA 1FQAA 2PMSA 4NG7A 3E3KA 4U1OA 4WKMA 1M5CA 1FCKA 1M5EA 3IB2A 5EQ9A 4RY1A 4KQPA 2OWZA 2DVZA 1IZ1A 5ET5A 4N6PA 1G0HA 4PAKA 1Y4CA 2DDKA 4OVPA 3FASA 3KSXA 3TFLA 4JVCA 2H98A 1LBWA 1NL5A 5A5XA 1MQDA 5FBPA 4GFRA 3MP1A 4BDLA 2XWIA 3MVZA 3FJGA 4XKNA 3UGWA 3H4ZA 4PFTA 1MQIA 3RUMA 3PMVA 3VVEA 3RLFE 1FBCA 3LSWA 1UTBA 5TP9A 1B6HA 3B6WA 2JJKA 4PQJA 3TTKA 3HO7A 4HCYA 4PFWA 2QS3A 4HW8A 2IA4A 2F3DA 2P1SA 4H65A 5I7IA 2Z8FA 4IB2A 1Y9UA 4PCDA 2ZZWA 4F1YA 2WBBA 2I58A 2AYSA 3KSJA 1B7UA 4F3GA 2V3UA 1OQHA 4O7IA 3QAXA 2YJPA 3VLWA 1BLFA 4NGUA 1POY1 1FBGA 4YKJA 1D3KA 3GZGA 3GYYA 2F97A 3K1PA 3TEPA 1LGBC 1Y1ZA 4IO7A 1LAGE 3UK4A 3CVGA 5I2NA 1DTGA 4F31B 1MM7A 3S9LC 1LAFE 3N94A 5KCJA 5EHMA 4QFPA 1XI6A 1SDXA 1US5A 1FQEA 1XVXA 2I3WA 1P1OA 5IZ3A 3ZKKA 4EF2A 3KG2A 3PU5A 1JETA 4OFLA 4PBQA 3EN3A 1A54A 2I4BA 1H3DA 2DWAA 3WAFA 1FPJA 2QL3A 2Y7IA 4I3EA 3TPAA 1Q9DA 4R73A 3MJNA 1FRPA 3VFJA 3B6QA 4JSDA 1B7HA 5ICQA 1MXUA 4GXSB 1NUWA 5LTCA 1I6QA 3FXUA 3H7MA 1FJ6A 3THIA 4GWUA 3ZS6A 4IO4A 4DCYA 2AIXA 1PDAA 1JVXA 4OESA 2X7QA 2Y7WA 1P1NA 5I59A 2RF1A 1FQFA 4G77A 4R2BA 1TT1A 1PBPA 5DW8A 2XXQA 3RTFB 3K2DA 4AB6A 2XD2A 4O3BA 1JEUA 2AL5A 4H45A 1NUYA 4F3SA 3RGYA 4O3CA 2R71A 1I69A 1LBVA 2V3TA 4NF8B 5CI5A 4DXBA 4F2QA 3O6GA 4I1DA 4R74A 2DP8A 1EU8A 2NVUB 4ZEKA 3BFUA 1QGXA 4QBAA 3EHTA 1RYXA 1DOTA 4MCOA 2F6GA 1PBQA 3PPQA 4I8CA 3QUFA 4P1EA 3JZJA 3PD9A 2HQ0A 2XWVA 1ANFA 1NMUA 1IMDA 1IXIA 4F3PA 2R6GE 4MBPA 1IMEA 4GIZA 2F36A 2NUVA 2RINA 4HS7A 3E78A 3U8QA 1FQBA 4PF6A 2XXUA 5I56A 4PFBA 3O9PA 3Q28A 2R9JA 3O66A 2I3VA 4XEQA 4GD5A 1YAEA 4OZ9A 1JW5A 2OCUA 4R9FA 4F2OA 4EQ7A 4DIGA 3OSRA 3U92A 1FPFA 4LONB 4PGPA 4R9GA 4IGRA 1B1HA 1R6ZA 2ONKE 5ESYA 1H44A 4GLIA 2H9BA 1FQCA 2FHYA 1GGGA 2XXWA 4N17A 4FEBA 4RXLA 4LVQA 3RQTA 1NNTA 4POXA 3GBBA 3RN8A 1CNQA 2F8DA 1WDNA 2XX7A 4H8IA 2VT5A 4MLQA 5I3SA 4GF8A 5AA2B 2GRVA 3B7DA 3FVGA 3LC8A 4C0RA 5CRYA 2QFLA 1ZTYA 4OEUA 4POWA 1LB9A 5L8DA 2MKZA 2L5VA 5AA1A 3OOAA 3BIGA 1SD3A 1K9YA 3Q27A 1NV5A 1HSJA 3PPNA 1B3LA 4XXUA 3IOUA 3MVWA 4EUOA 2ONRA 1ZIUA 3LR1A 4H67A 2Q89A 2H4IA 3OELA 4N07A 3IOVA 2GQ1A 4P1LA 1BP5A 4PFYA 4O3AA 3N6TA 1R9QA 3KOSA 4EXLA 3CIJA 5CBSA 2CZHA 3T9XB 4OTEA 3ZSFA 1FTOA 3H03A 5JEIA 3T0JA 2QVUA 3H6VA 2LAOA 1B0LA 1N0TA 4KFQA 2KR0A 2ZZVA 1SYHA 3E9XA 1NNKA 5AA2D 1LFHA 1SPIA 3BBRA 5ITOA 4G68B 4MAGA 2UYEA 2P0SA 4NQ8A 2B3BA 3I3VA 1TFDA 1MPCA 1OLAA 4YMBA 3S2VA 3R6UA 1FBHA 3FIRA 3BIHA 1QUJA 3FV2A 2YLNA 1R9LA 1KZ8A 3VV5A 1FSAA 3G3FA 1MXZA 3USDA 1NUZA 5ICTA 1B40A 2QMWA 3T22A 4QHQA 4NF8A 1MY3A 4WEDA 4MH5A 3SERA 1Y3PA 2BJIA 4DLDA 1KA0A 3UORA 1G0IA 3PD8A 1GTKA 1AWBA 3C34A 2Z23A 2YPNA 4I9DA 3VLVA 2DE4A 1LLSA 4YZZA 4OFJA 3OO7A 4RYAA 3CSBA 5EYGA 3B8BA 2OJTA 1N84A 4PDDA 1MQHA 2CZLA 3GBAA 1JP4A 2V4CA 3N26A 3TCHA 4H8JA 4RJZA 4QFOA 2I4CA 1DSNA 1FPGA 2DSFA 4IO3A 1ZBMA 3BKIB 3FJMA 1FTKA 1NV0A 4DZ1A 2I48A 1JNFA 2I0CA 1AL3A 1FTAA 4F1UA 1WODA 1DMBA 3IOWA 3MPKA 3JYRA 1IITA 3OEKA 3QSLA 2HZKA 3DP8A 3TTLA 3ODBA 3TYHA 4PAFA 1EZPA 4R6HA 1QW0A 2A5TB 1J1NA 4PP0A 4ZEBA 4X1BA 1QVSA 4NTLA 3G7WA 3K01A 3PV0E 3FVNA 5IZZA 2AL4A 1S50A 3RPWA 3S4UA 3L6HA 4H1XA 2UVIA 3K6WA 4MIJA 4NAPA 1IMFA 5CMCA 3H6WA 3K1MA 4KD5A 5DEXA 1I6BA 4KI0E 3V83A 1B05A 3O2AA 1ZLQA 3LSXA 4U1ZA 3VE1B 5T3JA 1IEJA 4ESWA 4OHNA 4QFKA 4ELQA 5AA2A 1OQGA 2QVRA 1H45A 3IJXB 4DE8A 5AA3A 3EQ1A 2Z8DA 4ELRA 4G8HA 2VHAA 1URDA 1SW5A 4GVOA 1KA1A 4XTCQ 4GRKA 2XWOA 3JV9A 3SEYA 2VD3A 4G8MA 1F9BA 4FIMA 1B46A 3MVYA 3I6VA 1YYZA 2O7UA 3C31A 2B4LA 3EF7A 4PFUA 1Y1MA 1URSA 4IO2A 2ESNA 4JWYA 2DWIA 2FBPA 3A3UA 4UA8A 1URGA 2NXOA 1FPDA 4MMPA 3HSTA 3N5LA 1N7WA 4N91A 2RCAA 1SW1A 4LUBA 5KDTB 5IAIA 2Q2CA 3RNNA 4MHFA 2F7BA 1IQ7A 4GX6A 1ZJLA 4GWWA 4X8RA 2ALUA 1RDZA 1H43A 3RT8A 4JVDA 2Y5KA 5FTHA 2QJEA 4JVIA 1VFDA 5B7DA 2FNCA 1YCJA 3ILTB 3A29A 2DS9A 5IZ1A 3ZKLA 2FYIA 1FPEA 2ZYNA 2ZYKA 3U94A 1XOCA 3C9HA 1XVYA 2REJA 3MP8A 1SBPA 1USYH 4OXVA 1RDYA 3TELA 3MWBA 4LQ5A 1NUXA 4GQOA 1SYIA 3U1OA 3TODA 3D1RA 5FHNA 4Z7EA 5IGAA 1LB8A 1P99A 3ONMA 1NNPA 4OVTA 1S9TA 4KYEA 2P2AA 1LCTA 2F78A 4I40A 2FIEA 4R2FA 4AS5A 1GV8A 3TUSA 1SI1A 1M5DA 3UP9A 3KN7A 4IY6A 1XC1A 2FIXA 2DXYA 1US4A 5H8FA 1LAXA 3WAEA 5JTYA 1B4HA 5H8HB 4P3LA 3W9WA 4GWOA 1EZOA 1NKXA 3KGCA 2ANJA 1B3FA 3KFMA 3N6UA 1PB8A 3U72A 1EYKA 4G2ZA 3MW0A 1R1NA 3DLNA 3OENA 5ISUA 3MP6A 3TDJA 4OYVA 4OQOA 5H8NA 1N76A 3AXFA 4H5GA 1A7LA 3IAZA 1LBXA 1Y20A 4LQ2A 1NH8A 1YXIA 1K9ZA 5I84A 5CMKA 3O28A 1N3XA 1D4NA 3LUYA 3O6HA 1MXWA 2QRYA 4JBZA 3EHSA 4MNPA 1JW4A 5I2NB 5H8NB 4IR8A 4AQ4A 2ZNSA 5L9MA 3KOTA 2P3VA 4FORA 4AS4A 1MG1A 2PT1A 3I5OA 1N3WA 2CEYA 1USYE 3CFZA 3T9HB 2HXWA 3MSTA 3C35A 4EF1A 3E4RA 3VDFA 4TLMB 2OWSA 3TTNA 1RKMA 5ET8A 1P1WA 3EKIA 2XXKA 2GFEA 4PFRA 4F19A 3FV1A 5EQAA 5TU0A 4YKKA 3H6UA 3SETA 2HEUA 1MY4A 2F6PA 4P0GA 4YB7A 1A8FA 1LBCA 1QUIA 3DM0A 2V93A 3K6XA 3ISPA 4Q30B 4AB5A 1B5HA 4JWOA 5IM2A 3FD3A 3QK6A 1GVCA 1SI0A 3PUWE 1NV4A 2F34A 3SDFA 1FPKA 5HM4B 1Z7ME 1D9VA 3O29A 4OFOA 5DT6A 2F7AA 5DVJA 4GXAA 4G68A 3SEVA 4RK9A 3UIFA 1VFEA 4Q0CA 4LN5A 4HCWA 2QS1A 4KHZE 5LOMA 1ATGA 1BKAA 2X7PA 4M1VA 4NEDA 5A5XB 1Y3NA 5AA4A 1B58A 1MDQA 2VP1A 1O63A 5DVFA 4NE4A 3K00A 5JK4A 4ESXA 3SEXA 4N8GA 3O97A 1NH7A 2XXRA 3BFTA 4ZE9A 1FTJA 3QUJA 5I56B 4PTKA 1EH3A 4LZ7A 3QXMA 2DWJA 4O8MA 1DBZA 4H46A 4MEVA 3D4GA 4H6DA 4RPNA 1UQWA 1M5FA 2I6EA 2RC7A 4YICA 1XT8A 1WVJA 1EYIA 3R7XA 4YMAA 2ZYMA 2Y5LA 2PFZA 3RY3A 4F29A 3PMWA 2QS4A 2Y7KA 1SQYA 3SEUA 5CC2A 1ELJA 1OIBA 5H8HA 1SW2A 4FBPA 3VXCA 1HSLA 2ONSA 3QYTA 2KLFA 2VD2A 1T0KA 1Z7NE 3IL1B 2HFBA 3LSLA 1AMFA 4PDHA 1P1UA 1YPNA 3KEIA 3RPLB 1OLCA 1DPPA 2VPNA 3LSFB 1AOVA 1MXXA 4FE8A 4ND9A 3G3GA 4X9TA 4P56A 4NF6A 1NV7A 1FPBA 1TXFA 1SW4A 1FJ9A 2HZLA 4MX6A 4EQ9A 4N6DA 4C1TA 4PC9A 4U4SA 4I3YA 5CBRA 1PC3A 3TQLA 3VXBA 1JQFA 4I62A 3RTWB 1OMPA 5EYHA 4F1VA 2DYXA 4Z0IA 1DCUA 2HXRA 3FVKA 3MQ9A 4IGTA 2ZNTA 1IXGA 1MXYA 5I58B 3DP4A 3Q29A 4YU0A 3T66A 3S9MC 2O68A 3H6TA 4HE1A 4GL0A 3IO6A 2Q2AA 2DE2A 2DOJA 4QRZA 5K2XA 2XXHA 3E79A 2DXRA 3TQWA 4ZEIA 1RDXA 1IMCA 4KCDA 3IK6B 5J16A 1UIUA 3B6TA 4MLVA 3KBZA 1POTA 4MNIA 1VE4A 2E1SA 2QMXA 2XXXA 4H5FA 3NOHA 1Q1KA 3CI8A 1MPBA 3K0VA 1VR5A 3SZPA 3C33A 3TAJA 1FBPA 2FVZA 2XXTA 4IO6A 2W7YA 2GH9A 1QULA
chains in the Genus database with same CATH topology
3MAMA 4NF5B 3THIA 3MUQA 1PB7A 3G3IA 4IO4A 4UA8A 4NWCA 4ZZEA 3ZS6A 2AIXA 1PDAA 1JVXA 1URGA 4OESA 4ZEDA 1IXCA 2X7QA 2NXOA 2Y7WA 4U21A 2D21A 4ELOA 3FVOA 3HSTA 4R72A 3N5LA 1N7WA 4R6KA 1P1NA 2H25A 1LCFA 2GHAA 2RF1A 1FQFA 4G77A 1IXHA 4K3FA 4R2BA 1TT1A 5I59A 4ZEIA 4DDDA 2RCAA 1PBPA 1SW1A 1AH5A 4KYSA 2Q2CA 4KR5A 4LUBA 3RNNA 3K4UA 3TTRA 2F7CA 3T93B 2F7BA 1NFTA 1IQ7A 3HCQA 1ZJLA 3PUZE 2XXQA 2H99A 1QKAA 4IO5A 2ALUA 1H43A 2ZNUA 5DVIA 3RTFB 3RT8A 3K2DA 1TWYA 4AB6A 2A5SA 5FTHA 3OD7A 4WEPA 2QJEA 2XD2A 1VFDA 4O3BA 1IIWA 3VVFA 5J1DA 5B7DA 1JEUA 2AL5A 2FNCA 1B51A 3OXNA 3FATA 1O7TA 2PVUA 4DCXA 1YCJA 3ILTB 3OO8A 5HBCA 4F22A 4F3SA 1MH3A 1DTZA 2VGQA 4G4PA 5CMBA 3RGYA 4O3CA 4TQUQ 2RC8A 2QS2A 1I69A 2R71A 2DS9A 2V3TA 4LP2B 4NF8B 4OETA 3M8UA 5CI5A 4U22A 3ZKLA 4KYDA 4DXBA 2FYIA 4F2QA 3O6GA 4I1DA 4THIA 4BDNA 2ZYNA 4R74A 2DP8A 2ZYKA 1QJMA 4QF9A 4ELRA 4YAHX 5M2VA 3U94A 1XOCA 1EU8A 3C9HA 3K02A 2NVUB 1XVYA 2REJA 3MP8A 1MY0A 1OVBA 1SBPA 1USYH 3DELB 2THIA 4OXVA 4ZEKA 3TELA 5L9OA 1AIVA 3BFUA 3MWBA 5EHSA 2Q88A 3EHTA 1RYXA 2BJJX 3PPOA 4GQOA 4LQ5A 1DOTA 1SYIA 3U1OA 1LFGA 3A09A 3G3KA 1LAHE 3H06B 4YB5A 2F6GA 2F35A 1PBQA 2Q8JA 2RC9A 3PPQA 1GR2A 4EDPA 5AA4B 4I8CA 3GXAA 1AOVA 3FUZA 3TODA 3QUFA 5FHNA 3JZJA 4Z7EA 1CE2A 1B9JA 1LB8A 1P99A 1OVTA 3ONMA 2HQ0A 3PD9A 1ANFA 3PUXE 4G8NA 3TCGA 1UTHA 2V25A 1JW1A 1NNPA 1S9TA 1NMUA 4KYEA 3PMXA 1IXIA 2DE3A 5K2YA 2R6GE 2I49A 2P2AA 3IB1A 3R26A 4F3PA 4MBPA 4XKQA 4G68C 1LCTA 2F78A 3PGFA 4GIZA 4ISUA 4R2FA 4YB6A 3T9VA 2F36A 2NUVA 4HTGA 5DTBA 2RINA 1GV8A 4F3BA 5JTYB 4BDRA 3TUSA 4HS7A 1P1QA 2PBWA 3U8QA 2O69A 1FQBA 3C4MA 1BIYA 3L6GA 1SI1A 1M5DA 2XXUA 3UP9A 3KN7A 4IY6A 5I56A 1XC1A 4QSDA 4OEVA 1MH4A 5I57A 3KJTA 4QFNA 2DXYA 1US4A 3KBRA 3O9PA 5H8FA 1LAXA 3WAEA 1B7ZA 5JTYA 3Q28A 1B4HA 5H8HB 3MZ9A 4FEDA 1A8EA 4LA9A 1ZKBA 2R9JA 3O66A 3CRBA 4QFLA 3SEWA 3IB0A 4R6YA 5I2KA 4KCCA 2Y7RA 4ONYA 5CBRA 4ZE8A 2I3VA 3W9WA 1EZOA 1MS7A 4GD5A 1FW0A 4GWOA 4RPOA 1NKXA 1YAEA 3KGCA 2ANJA 4OZ9A 1B3FA 1JW5A 2OCUA 3KFMA 3N6UA 4R9FA 5H8FB 3UA8A 3GLBA 4F2OA 1PB8A 1H76A 3VLUA 3U72A 4EQ7A 4EXKA 4DIGA 2HCAA 2RCBA 1R1NA 3MW0A 3OSRA 4G2ZA 4LONB 4NWDA 4R9GA 5I2KB 5F1QA 3U92A 4IGRA 2UVJA 3DLNA 3OENA 4X48A 2G29A 5ISUA 3MP6A 1MM6A 3IX1A 2UXAA 4RA1A 4WXJA 3TDJA 1B1HA 1R6ZA 2ONKE 2QPQA 2G93A 4OYVA 4OQOA 4U2RA 1H44A 1N76A 5H8NA 2XXIA 1UTBB 5TP9B 1B5JA 3G3JA 3FJ7A 3AXFA 4GLIA 2H9BA 4H5GA 1A7LA 3V5AA 1QKBA 1A55A 3IAZA 4ZECA 2O6AA 1Y20A 3IORA 4GOTA 4H0WA 1FQCA 4TOZA 1MY2A 4LQ2A 4NMYA 5TPAB 1NH8A 4M4GA 4RNSA 1GGGA 2XXWA 3ILUB 5I84A 5KCJB 2DWHA 5F7VA 4FEBA 1B1XA 4JSOA 4LVQA 2XXPA 4RXLA 3RQTA 5CMKA 1JEVA 1N3XA 3FZVA 3MC2A 3O28A 5TPAA 1D4NA 4NF4B 1NNTA 3LUYA 3MBPA 3O6HA 3IJOB 1MXWA 4MFIA 4POXA 1LSTA 3GBBA 2QRYA 4ZDMA 3U93A 4JBZA 3RN8A 1LBBA 2F8DA 2OK2A 3OEMA 4JDFA 3H3GA 1WDNA 2XX7A 1M5BA 3EHSA 4H8IA 3TKDA 2XX8A 1JW4A 5I2NB 2A5TA 3O6IA 5H8NB 4MLQA 5AA2B 4GF8A 3HN0A 4ZS9A 3OMBA 2GRVA 3B7DA 3FVGA 3LC8A 4UACA 3RT6B 4AQ4A 4BDQA 3W15C 4C0RA 2ZNSA 5L9SA 5L9MA 3KOTA 2PYYA 3MVXA 4FORA 5CRYA 3Q25A 1MXVA 2IEEA 5IKBA 1ZTYA 1HSEA 4OEUA 1QUKA 3K1NA 4P11A 4POWA 1ZMGA 4RK2A 3M3LA 3PUVE 4XIGQ 1LB9A 3ECRA 4FAJA 5L8DA 2XX9A 4BDOA 2V84A 2VOZA 1MG1A 5AA1A 3IR1A 3FGSA 3OOAA 1EZ9A 1SD3A 2PT1A 3I5OA 1TFAA 4QSCA 1N3WA 3MZBA 1KWHA 3Q27A 5EYFA 5FTIA 3MZ1A 1HSJA 1USYE 3CFZA 3PPNA 3T9HB 5DEXB 2NOOA 4PE5B 2HXWA 3TQWA 1B3LA 3C35A 4LZ8A 3TMGA 4EF1A 3E4RA 1CB6A 2DQVA 1PB9A 4XXUA 4L17A 3VDFA 2I0BA 4TLMB 2OWSA 3A3CA 4QSEA 3IOUA 3TTNA 3MVWA 5CM6A 1XHYA 5H8SA 4EUOA 1D9YA 2ONRA 1ZIUA 2ZYOA 1RKMA 3LR1A 4H67A 5I58A 2Q89A 4YKPA 4E0WA 2H4IA 1RYOA 3IOTA 1UIVA 1LFIA 1P1WA 2E0SA 3TTMA 4DCYA 1N7XA 2GFEA 2WKYA 2ZXTA 4GL8A 3FV1A 4F19A 3T96B 2REGA 2RKMA 3OELA 4N07A 3IOVA 3V89B 1MQGA 5TU0A 4YKKA 4XKPA 3H6UA 3SETA 1BP5A 5KZTA 2XXVA 2HEUA 1B5IA 1MY4A 2F6PA 1B2HA 4P0GA 4OENA 3EHUA 4PFYA 4O3AA 3N6TA 1R9QA 1A8FA 1LBCA 1O64A 1QUIA 2V93A 3DM0A 3K6XA 3KOSA 3CG3A 3OO9A 1B5HA 4Q30B 4YB7A 4AB5A 1MQJA 4EXLA 4JWOA 3CIJA 3FD3A 3QK6A 1GVCA 1SI0A 5CBSA 2Y7PA 3T9XB 3PUWE 3FXQA 4YKIA 3PUYE 2F34A 3SDFA 4OTEA 5HM4B 3ZSFA 1FTOA 1Z7ME 1D9VA 3O29A 5KDTA 3H03A 5JEIA 2UVGA 1SVXB 4OFOA 5DT6A 1JVYA 3OSQA 3K6VA 3H6VA 2F7AA 2LAOA 5DVJA 4Q8RA 1B0LA 4GXAA 4G68A 3SEVA 1N0TA 4RK9A 3UIFA 1FTMA 1VFEA 4KFQA 3OO6A 4Q0CA 4P0IA 4HCWA 2QS1A 3S9NC 1SYHA 3P7IA 2H5YA 3E9XA 1NNKA 3KN8A 5AA2D 5ITPA 3IO4A 3HPIA 3KZGA 4KHZE 5LOMA 4XKRA 1LFHA 3HV1A 1ATGA 2PX1A 1BKAA 3BBRA 1B0HA 5ITOA 1MY1A 2X7PA 4OMBA 4G68B 5I59B 1ZU0A 2X26A 4LZ5A 4M1VA 2B3FA 4NEDA 5FHOA 2UYEA 3PPPA 2P0SA 5FHMA 5BUUA 3C36A 1B4ZA 5CMMA 2B3BA 3V8XB 3VVDA 5A5XB 1FQAA 1TFDA 1Y3NA 1MPCA 2GHBA 1OLAA 2OLBA 2PMSA 2O1LA 2XXYA 3CG1A 3E3KA 1B58A 1MDQA 2VP1A 1O63A 1M5CA 4NF5A 4U1OA 4WKMA 5ELVA 3R6UA 3S2VA 4YMBA 1FCKA 2XHDA 1M5EA 3FIRA 3IB2A 5DVFA 4RY1A 4NE4A 4KQPA 3K00A 1QUJA 1B3GA 3FV2A 5JK4A 5H8QA 2V3QA 2YLNA 1R9LA 4ESXA 2DVZA 1IZ1A 3VV5A 4KPTA 3G3FA 4N6PA 3SEXA 5AE4A 1MXZA 3USDA 5ICTA 2D3IA 3O97A 4R75A 1NH7A 1B40A 2XXRA 3BFTA 2QMWA 4ZE9A 1Y3QA 1Y4CA 3T22A 4QHQA 2M8CA 3FASA 3UN6A 1FTJA 2O51A 4NF8A 3KSXA 1MY3A 4WEDA 4MH5A 4ZEFA 1IUDA 1Y3PA 3QUJA 3SERA 3TFLA 5I56B 5KDTB 2H98A 4N13A 2FA7A 4DLDA 1EH3A 1NL5A 2ZMBA 3E13X 4LZ7A 1S7YA 2Z22A 3CFXA 3QXMA 2DWJA 5A5XA 1FTLA 1MQDA 2B65A 3UORA 3PD8A 1GTKA 3C34A 4GFRA 3D4GA 3MP1A 4BDLA 2Z23A 1A40A 1FQDA 2QSXA 2YPNA 3MVZA 4I9DA 4H6DA 4RPNA 5DYHA 1BTJA 3FJGA 3VLVA 4XKNA 5H8QB 3K6UA 1UQWA 2DE4A 3H4ZA 1M5FA 2I6EA 3UGWA 2RC7A 4PFTA 4YICA 1MQIA 1XT8A 3RUMA 1LLSA 1WVJA 4OVJA 3R7XA 3PMVA 5I57B 3VVEA 4YMAA 4YZZA 3RLFE 2ZYMA 1UTHB 3LSWA 4OFJA 3OO7A 3RY3A 4F29A 4MF3A 1UTBA 4RYAA 1B6HA 5TP9A 3CSBA 3B6WA 4TLLB 2OJTA 3PMWA 2D5WA 4PQJA 3TTKA 1N84A 4F18A 1MQHA 2CZLA 3GBAA 2QS4A 3HO7A 4HCYA 4LATA 4PFWA 4F39A 3N26A 2QS3A 4HW8A 2IA4A 2NWJA 4H8JA 4RJZA 3TCHA 2Y7KA 1SQYA 4QFOA 2P1SA 2I4CA 2HAVA 5BWJA 3SEUA 4OWDA 2O1MA 1DSNA 5CC2A 4H65A 1ELJA 1OIBA 2DSFA 4IO3A 5H8HA 1XS5A 1SW2A 2Z8FA 3CSGA 3VXCA 4FJPA 1HSLA 5B70A 1YTVA 1ZBMA 1Y9UA 2KLFA 2ONSA 2VD2A 1Z7NE 3IL1B 2HFBA 3QYTA 4JB7A 1T0KA 3BKIB 3FJMA 3LSLA 1FTKA 1AMFA 3KN3A 4DZ1A 1P1UA 1YPNA 2I48A 1JNFA 2I0CA 3KEIA 1VSOA 4ECFA 1B32A 1AL3A 1OLCA 1DPPA 3EPEA 4F1YA 4F1UA 2I58A 4IB2A 1WODA 1DMBA 2AYSA 3KSJA 3QIMA 3IOWA 3Q26A 3MPKA 3LSFB 1B7UA 1PEBA 1Y4TA 3FXRA 3JYRA 1MXXA 1IITA 4EQBA 4FE8A 3OEKA 3QSLA 3M3FA 3T9UA 4F3GA 4JXIA 3S9EA 4BLAA 2HZKA 4ND9A 3TCFA 3DP8A 3TTLA 4BDMA 2V3UA 3G3GA 3ODBA 3TYHA 1OQHA 2HAUA 1EZPA 4X9TA 3QAXA 4R6HA 1QW0A 2A5TB 1J1NA 2Q9TA 4DXUA 4NF6A 2YJPA 4PP0A 4ZEBA 3VLWA 1TXFA 1BLFA 2F5XA 4C1UA 1SW4A 1POY1 2HZLA 3HHFA 4X1BA 1QVSA 3G7WA 4NTLA 4C1TA 3K01A 4YKJA 1D3KA 3GZGA 3LBSA 4PETA 3PV0E 4U4SA 3SKPA 1PC3A 2F97A 2OBGA 3FVNA 3K1PA 3TQLA 3VXBA 4X1DA 3TEPA 1JQFA 1LGBC 1Y1ZA 4I62A 4IO7A 2AL4A 4NF6B 1N04A 1S50A 2Y84A 1LAGE 1MDP1 3KJ7A 3RPWA 3RTWB 3UK4A 1OMPA 4F1VA 4U4XA 3S4UA 2DYXA 3C32A 4Z0IA 3L6HA 1MRPA 3CVGA 3SESA 4H1XA 5I2NA 2UVIA 1DTGA 3FVKA 3K6WA 4F31B 1MM7A 4IY5A 3S9LC 3MQ9A 4IGTA 2ZNTA 1IXGA 1LAFE 1MXYA 3N94A 5KCJA 3PPRA 5I58B 4U23A 1DPEA 4DXCA 5CMCA 5EHMA 1A99A 3H6WA 3CR9A 3K1MA 4KD5A 5DEXA 4NF4A 1I6BA 3DP4A 1B52A 3Q29A 4KI0E 2CMOA 1II5A 4YU0A 3MPLA 3V83A 1B05A 5IAIA 3O2AA 4QFPA 1ZLQA 3LSXA 4U1ZA 3VE1B 2O7IA 1SDXA 1IEJA 3T66A 4ESWA 3S9MC 1US5A 1FQEA 1XVXA 2DVCA 4OHNA 2I3WA 1P1OA 4QFKA 3ZKKA 4ELQA 3W9VA 2O68A 3H6TA 3I3VA 3KG2A 4EF2A 3PU5A 5AA2A 2PT2A 4GL0A 1JETA 4OFLA 3D4CA 1OQGA 4E0XA 1MPDA 1H45A 2Q2AA 3EN3A 1B3HA 3IO6A 1L5TA 1A54A 3IJXB 2DE2A 4FECA 1NNFA 2DOJA 4DE8A 5AA3A 4ELPA 3EQ1A 4QRZA 5K2XA 2XXHA 2I4BA 2UVHA 2Z8DA 1H3DA 2DXRA 3DP6A 3F11A 2DWAA 2OWTA 2VHAA 1URDA 1SW5A 4G8HA 4GVOA 2QL3A 4OERA 2Y7IA 2OZZA 3WAFA 4XTCQ 4GRKA 3JV9A 3SEYA 4KCDA 3TPAA 4EQ9A 3IK6B 2VD3A 3MJNA 4R73A 5AA4A 1B3EA 2O84X 4ZZAA 3VFJA 1UIUA 3B6TA 4MLVA 1I6AA 3B6QA 4G8MA 1F9BA 1POTA 2UYFA 4FIMA 1B46A 1VE4A 3TZAA 2E1SA 2QMXA 4JWXA 2XD3A 4JSDA 2XXXA 4H5FA 1B7HA 3MVYA 3I6VA 2Z8EA 2O7UA 1Q1KA 3M3KA 4FATA 5ICQA 3CI8A 1MXUA 1MPBA 4GXSB 1Q35A 4Q5TA 5HPQA 3K0VA 3C31A 1VR5A 4PFUA 3EF7A 1Y1MA 3C33A 1URSA 4IO2A 2ESNA 3TAJA 4JWYA 1I6QA 2ABHA 3FXUA 2XXTA 3G3HA 3H7MA 4IO6A 2DWIA 3A3UA 2W7YA 3CFLA 3HHGA 2GH9A 1QULA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MAM A;  4NF5 B;  3THI A;  3MUQ A;  1PB7 A;  3G3I A;  4IO4 A;  4UA8 A;  4NWC A;  4ZZE A;  3ZS6 A;  2AIX A;  1PDA A;  1JVX A;  1URG A;  4OES A;  4ZED A;  1IXC A;  2X7Q A;  2NXO A;  2Y7W A;  4U21 A;  2D21 A;  4ELO A;  3FVO A;  3HST A;  4R72 A;  3N5L A;  1N7W A;  4R6K A;  1P1N A;  2H25 A;  1LCF A;  2GHA A;  2RF1 A;  1FQF A;  4G77 A;  1IXH A;  4K3F A;  4R2B A;  1TT1 A;  5I59 A;  4ZEI A;  4DDD A;  2RCA A;  1PBP A;  1SW1 A;  1AH5 A;  4KYS A;  2Q2C A;  4KR5 A;  4LUB A;  3RNN A;  3K4U A;  3TTR A;  2F7C A;  3T93 B;  2F7B A;  1NFT A;  1IQ7 A;  3HCQ A;  1ZJL A;  3PUZ E;  2XXQ A;  2H99 A;  1QKA A;  4IO5 A;  2ALU A;  1H43 A;  2ZNU A;  5DVI A;  3RTF B;  3RT8 A;  3K2D A;  1TWY A;  4AB6 A;  2A5S A;  5FTH A;  3OD7 A;  4WEP A;  2QJE A;  2XD2 A;  1VFD A;  4O3B A;  1IIW A;  3VVF A;  5J1D A;  5B7D A;  1JEU A;  2AL5 A;  2FNC A;  1B51 A;  3OXN A;  3FAT A;  1O7T A;  2PVU A;  4DCX A;  1YCJ A;  3ILT B;  3OO8 A;  5HBC A;  4F22 A;  4F3S A;  1MH3 A;  1DTZ A;  2VGQ A;  4G4P A;  5CMB A;  3RGY A;  4O3C A;  4TQU Q;  2RC8 A;  2QS2 A;  1I69 A;  2R71 A;  2DS9 A;  2V3T A;  4LP2 B;  4NF8 B;  4OET A;  3M8U A;  5CI5 A;  4U22 A;  3ZKL A;  4KYD A;  4DXB A;  2FYI A;  4F2Q A;  3O6G A;  4I1D A;  4THI A;  4BDN A;  2ZYN A;  4R74 A;  2DP8 A;  2ZYK A;  1QJM A;  4QF9 A;  4ELR A;  4YAH X;  5M2V A;  3U94 A;  1XOC A;  1EU8 A;  3C9H A;  3K02 A;  2NVU B;  1XVY A;  2REJ A;  3MP8 A;  1MY0 A;  1OVB A;  1SBP A;  1USY H;  3DEL B;  2THI A;  4OXV A;  4ZEK A;  3TEL A;  5L9O A;  1AIV A;  3BFU A;  3MWB A;  5EHS A;  2Q88 A;  3EHT A;  1RYX A;  2BJJ X;  3PPO A;  4GQO A;  4LQ5 A;  1DOT A;  1SYI A;  3U1O A;  1LFG A;  3A09 A;  3G3K A;  1LAH E;  3H06 B;  4YB5 A;  2F6G A;  2F35 A;  1PBQ A;  2Q8J A;  2RC9 A;  3PPQ A;  1GR2 A;  4EDP A;  5AA4 B;  4I8C A;  3GXA A;  1AOV A;  3FUZ A;  3TOD A;  3QUF A;  5FHN A;  3JZJ A;  4Z7E A;  1CE2 A;  1B9J A;  1LB8 A;  1P99 A;  1OVT A;  3ONM A;  2HQ0 A;  3PD9 A;  1ANF A;  3PUX E;  4G8N A;  3TCG A;  1UTH A;  2V25 A;  1JW1 A;  1NNP A;  1S9T A;  1NMU A;  4KYE A;  3PMX A;  1IXI A;  2DE3 A;  5K2Y A;  2R6G E;  2I49 A;  2P2A A;  3IB1 A;  3R26 A;  4F3P A;  4MBP A;  4XKQ A;  4G68 C;  1LCT A;  2F78 A;  3PGF A;  4GIZ A;  4ISU A;  4R2F A;  4YB6 A;  3T9V A;  2F36 A;  2NUV A;  4HTG A;  5DTB A;  2RIN A;  1GV8 A;  4F3B A;  5JTY B;  4BDR A;  3TUS A;  4HS7 A;  1P1Q A;  2PBW A;  3U8Q A;  2O69 A;  1FQB A;  3C4M A;  1BIY A;  3L6G A;  1SI1 A;  1M5D A;  2XXU A;  3UP9 A;  3KN7 A;  4IY6 A;  5I56 A;  1XC1 A;  4QSD A;  4OEV A;  1MH4 A;  5I57 A;  3KJT A;  4QFN A;  2DXY A;  1US4 A;  3KBR A;  3O9P A;  5H8F A;  1LAX A;  3WAE A;  1B7Z A;  5JTY A;  3Q28 A;  1B4H A;  5H8H B;  3MZ9 A;  4FED A;  1A8E A;  4LA9 A;  1ZKB A;  2R9J A;  3O66 A;  3CRB A;  4QFL A;  3SEW A;  3IB0 A;  4R6Y A;  5I2K A;  4KCC A;  2Y7R A;  4ONY A;  5CBR A;  4ZE8 A;  2I3V A;  3W9W A;  1EZO A;  1MS7 A;  4GD5 A;  1FW0 A;  4GWO A;  4RPO A;  1NKX A;  1YAE A;  3KGC A;  2ANJ A;  4OZ9 A;  1B3F A;  1JW5 A;  2OCU A;  3KFM A;  3N6U A;  4R9F A;  5H8F B;  3UA8 A;  3GLB A;  4F2O A;  1PB8 A;  1H76 A;  3VLU A;  3U72 A;  4EQ7 A;  4EXK A;  4DIG A;  2HCA A;  2RCB A;  1R1N A;  3MW0 A;  3OSR A;  4G2Z A;  4LON B;  4NWD A;  4R9G A;  5I2K B;  5F1Q A;  3U92 A;  4IGR A;  2UVJ A;  3DLN A;  3OEN A;  4X48 A;  2G29 A;  5ISU A;  3MP6 A;  1MM6 A;  3IX1 A;  2UXA A;  4RA1 A;  4WXJ A;  3TDJ A;  1B1H A;  1R6Z A;  2ONK E;  2QPQ A;  2G93 A;  4OYV A;  4OQO A;  4U2R A;  1H44 A;  1N76 A;  5H8N A;  2XXI A;  1UTB B;  5TP9 B;  1B5J A;  3G3J A;  3FJ7 A;  3AXF A;  4GLI A;  2H9B A;  4H5G A;  1A7L A;  3V5A A;  1QKB A;  1A55 A;  3IAZ A;  4ZEC A;  2O6A A;  1Y20 A;  3IOR A;  4GOT A;  4H0W A;  1FQC A;  4TOZ A;  1MY2 A;  4LQ2 A;  4NMY A;  5TPA B;  1NH8 A;  4M4G A;  4RNS A;  1GGG A;  2XXW A;  3ILU B;  5I84 A;  5KCJ B;  2DWH A;  5F7V A;  4FEB A;  1B1X A;  4JSO A;  4LVQ A;  2XXP A;  4RXL A;  3RQT A;  5CMK A;  1JEV A;  1N3X A;  3FZV A;  3MC2 A;  3O28 A;  5TPA A;  1D4N A;  4NF4 B;  1NNT A;  3LUY A;  3MBP A;  3O6H A;  3IJO B;  1MXW A;  4MFI A;  4POX A;  1LST A;  3GBB A;  2QRY A;  4ZDM A;  3U93 A;  4JBZ A;  3RN8 A;  1LBB A;  2F8D A;  2OK2 A;  3OEM A;  4JDF A;  3H3G A;  1WDN A;  2XX7 A;  1M5B A;  3EHS A;  4H8I A;  3TKD A;  2XX8 A;  1JW4 A;  5I2N B;  2A5T A;  3O6I A;  5H8N B;  4MLQ A;  5AA2 B;  4GF8 A;  3HN0 A;  4ZS9 A;  3OMB A;  2GRV A;  3B7D A;  3FVG A;  3LC8 A;  4UAC A;  3RT6 B;  4AQ4 A;  4BDQ A;  3W15 C;  4C0R A;  2ZNS A;  5L9S A;  5L9M A;  3KOT A;  2PYY A;  3MVX A;  4FOR A;  5CRY A;  3Q25 A;  1MXV A;  2IEE A;  5IKB A;  1ZTY A;  1HSE A;  4OEU A;  1QUK A;  3K1N A;  4P11 A;  4POW A;  1ZMG A;  4RK2 A;  3M3L A;  3PUV E;  4XIG Q;  1LB9 A;  3ECR A;  4FAJ A;  5L8D A;  2XX9 A;  4BDO A;  2V84 A;  2VOZ A;  1MG1 A;  5AA1 A;  3IR1 A;  3FGS A;  3OOA A;  1EZ9 A;  1SD3 A;  2PT1 A;  3I5O A;  1TFA A;  4QSC A;  1N3W A;  3MZB A;  1KWH A;  3Q27 A;  5EYF A;  5FTI A;  3MZ1 A;  1HSJ A;  1USY E;  3CFZ A;  3PPN A;  3T9H B;  5DEX B;  2NOO A;  4PE5 B;  2HXW A;  3TQW A;  1B3L A;  3C35 A;  4LZ8 A;  3TMG A;  4EF1 A;  3E4R A;  1CB6 A;  2DQV A;  1PB9 A;  4XXU A;  4L17 A;  3VDF A;  2I0B A;  4TLM B;  2OWS A;  3A3C A;  4QSE A;  3IOU A;  3TTN A;  3MVW A;  5CM6 A;  1XHY A;  5H8S A;  4EUO A;  1D9Y A;  2ONR A;  1ZIU A;  2ZYO A;  1RKM A;  3LR1 A;  4H67 A;  5I58 A;  2Q89 A;  4YKP A;  4E0W A;  2H4I A;  1RYO A;  3IOT A;  1UIV A;  1LFI A;  1P1W A;  2E0S A;  3TTM A;  4DCY A;  1N7X A;  2GFE A;  2WKY A;  2ZXT A;  4GL8 A;  3FV1 A;  4F19 A;  3T96 B;  2REG A;  2RKM A;  3OEL A;  4N07 A;  3IOV A;  3V89 B;  1MQG A;  5TU0 A;  4YKK A;  4XKP A;  3H6U A;  3SET A;  1BP5 A;  5KZT A;  2XXV A;  2HEU A;  1B5I A;  1MY4 A;  2F6P A;  1B2H A;  4P0G A;  4OEN A;  3EHU A;  4PFY A;  4O3A A;  3N6T A;  1R9Q A;  1A8F A;  1LBC A;  1O64 A;  1QUI A;  2V93 A;  3DM0 A;  3K6X A;  3KOS A;  3CG3 A;  3OO9 A;  1B5H A;  4Q30 B;  4YB7 A;  4AB5 A;  1MQJ A;  4EXL A;  4JWO A;  3CIJ A;  3FD3 A;  3QK6 A;  1GVC A;  1SI0 A;  5CBS A;  2Y7P A;  3T9X B;  3PUW E;  3FXQ A;  4YKI A;  3PUY E;  2F34 A;  3SDF A;  4OTE A;  5HM4 B;  3ZSF A;  1FTO A;  1Z7M E;  1D9V A;  3O29 A;  5KDT A;  3H03 A;  5JEI A;  2UVG A;  1SVX B;  4OFO A;  5DT6 A;  1JVY A;  3OSQ A;  3K6V A;  3H6V A;  2F7A A;  2LAO A;  5DVJ A;  4Q8R A;  1B0L A;  4GXA A;  4G68 A;  3SEV A;  1N0T A;  4RK9 A;  3UIF A;  1FTM A;  1VFE A;  4KFQ A;  3OO6 A;  4Q0C A;  4P0I A;  4HCW A;  2QS1 A;  3S9N C;  1SYH A;  3P7I A;  2H5Y A;  3E9X A;  1NNK A;  3KN8 A;  5AA2 D;  5ITP A;  3IO4 A;  3HPI A;  3KZG A;  4KHZ E;  5LOM A;  4XKR A;  1LFH A;  3HV1 A;  1ATG A;  2PX1 A;  1BKA A;  3BBR A;  1B0H A;  5ITO A;  1MY1 A;  2X7P A;  4OMB A;  4G68 B;  5I59 B;  1ZU0 A;  2X26 A;  4LZ5 A;  4M1V A;  2B3F A;  4NED A;  5FHO A;  2UYE A;  3PPP A;  2P0S A;  5FHM A;  5BUU A;  3C36 A;  1B4Z A;  5CMM A;  2B3B A;  3V8X B;  3VVD A;  5A5X B;  1FQA A;  1TFD A;  1Y3N A;  1MPC A;  2GHB A;  1OLA A;  2OLB A;  2PMS A;  2O1L A;  2XXY A;  3CG1 A;  3E3K A;  1B58 A;  1MDQ A;  2VP1 A;  1O63 A;  1M5C A;  4NF5 A;  4U1O A;  4WKM A;  5ELV A;  3R6U A;  3S2V A;  4YMB A;  1FCK A;  2XHD A;  1M5E A;  3FIR A;  3IB2 A;  5DVF A;  4RY1 A;  4NE4 A;  4KQP A;  3K00 A;  1QUJ A;  1B3G A;  3FV2 A;  5JK4 A;  5H8Q A;  2V3Q A;  2YLN A;  1R9L A;  4ESX A;  2DVZ A;  1IZ1 A;  3VV5 A;  4KPT A;  3G3F A;  4N6P A;  3SEX A;  5AE4 A;  1MXZ A;  3USD A;  5ICT A;  2D3I A;  3O97 A;  4R75 A;  1NH7 A;  1B40 A;  2XXR A;  3BFT A;  2QMW A;  4ZE9 A;  1Y3Q A;  1Y4C A;  3T22 A;  4QHQ A;  2M8C A;  3FAS A;  3UN6 A;  1FTJ A;  2O51 A;  4NF8 A;  3KSX A;  1MY3 A;  4WED A;  4MH5 A;  4ZEF A;  1IUD A;  1Y3P A;  3QUJ A;  3SER A;  3TFL A;  5I56 B;  5KDT B;  2H98 A;  4N13 A;  2FA7 A;  4DLD A;  1EH3 A;  1NL5 A;  2ZMB A;  3E13 X;  4LZ7 A;  1S7Y A;  2Z22 A;  3CFX A;  3QXM A;  2DWJ A;  5A5X A;  1FTL A;  1MQD A;  2B65 A;  3UOR A;  3PD8 A;  1GTK A;  3C34 A;  4GFR A;  3D4G A;  3MP1 A;  4BDL A;  2Z23 A;  1A40 A;  1FQD A;  2QSX A;  2YPN A;  3MVZ A;  4I9D A;  4H6D A;  4RPN A;  5DYH A;  1BTJ A;  3FJG A;  3VLV A;  4XKN A;  5H8Q B;  3K6U A;  1UQW A;  2DE4 A;  3H4Z A;  1M5F A;  2I6E A;  3UGW A;  2RC7 A;  4PFT A;  4YIC A;  1MQI A;  1XT8 A;  3RUM A;  1LLS A;  1WVJ A;  4OVJ A;  3R7X A;  3PMV A;  5I57 B;  3VVE A;  4YMA A;  4YZZ A;  3RLF E;  2ZYM A;  1UTH B;  3LSW A;  4OFJ A;  3OO7 A;  3RY3 A;  4F29 A;  4MF3 A;  1UTB A;  4RYA A;  1B6H A;  5TP9 A;  3CSB A;  3B6W A;  4TLL B;  2OJT A;  3PMW A;  2D5W A;  4PQJ A;  3TTK A;  1N84 A;  4F18 A;  1MQH A;  2CZL A;  3GBA A;  2QS4 A;  3HO7 A;  4HCY A;  4LAT A;  4PFW A;  4F39 A;  3N26 A;  2QS3 A;  4HW8 A;  2IA4 A;  2NWJ A;  4H8J A;  4RJZ A;  3TCH A;  2Y7K A;  1SQY A;  4QFO A;  2P1S A;  2I4C A;  2HAV A;  5BWJ A;  3SEU A;  4OWD A;  2O1M A;  1DSN A;  5CC2 A;  4H65 A;  1ELJ A;  1OIB A;  2DSF A;  4IO3 A;  5H8H A;  1XS5 A;  1SW2 A;  2Z8F A;  3CSG A;  3VXC A;  4FJP A;  1HSL A;  5B70 A;  1YTV A;  1ZBM A;  1Y9U A;  2KLF A;  2ONS A;  2VD2 A;  1Z7N E;  3IL1 B;  2HFB A;  3QYT A;  4JB7 A;  1T0K A;  3BKI B;  3FJM A;  3LSL A;  1FTK A;  1AMF A;  3KN3 A;  4DZ1 A;  1P1U A;  1YPN A;  2I48 A;  1JNF A;  2I0C A;  3KEI A;  1VSO A;  4ECF A;  1B32 A;  1AL3 A;  1OLC A;  1DPP A;  3EPE A;  4F1Y A;  4F1U A;  2I58 A;  4IB2 A;  1WOD A;  1DMB A;  2AYS A;  3KSJ A;  3QIM A;  3IOW A;  3Q26 A;  3MPK A;  3LSF B;  1B7U A;  1PEB A;  1Y4T A;  3FXR A;  3JYR A;  1MXX A;  1IIT A;  4EQB A;  4FE8 A;  3OEK A;  3QSL A;  3M3F A;  3T9U A;  4F3G A;  4JXI A;  3S9E A;  4BLA A;  2HZK A;  4ND9 A;  3TCF A;  3DP8 A;  3TTL A;  4BDM A;  2V3U A;  3G3G A;  3ODB A;  3TYH A;  1OQH A;  2HAU A;  1EZP A;  4X9T A;  3QAX A;  4R6H A;  1QW0 A;  2A5T B;  1J1N A;  2Q9T A;  4DXU A;  4NF6 A;  2YJP A;  4PP0 A;  4ZEB A;  3VLW A;  1TXF A;  1BLF A;  2F5X A;  4C1U A;  1SW4 A;  1POY 1;  2HZL A;  3HHF A;  4X1B A;  1QVS A;  3G7W A;  4NTL A;  4C1T A;  3K01 A;  4YKJ A;  1D3K A;  3GZG A;  3LBS A;  4PET A;  3PV0 E;  4U4S A;  3SKP A;  1PC3 A;  2F97 A;  2OBG A;  3FVN A;  3K1P A;  3TQL A;  3VXB A;  4X1D A;  3TEP A;  1JQF A;  1LGB C;  1Y1Z A;  4I62 A;  4IO7 A;  2AL4 A;  4NF6 B;  1N04 A;  1S50 A;  2Y84 A;  1LAG E;  1MDP 1;  3KJ7 A;  3RPW A;  3RTW B;  3UK4 A;  1OMP A;  4F1V A;  4U4X A;  3S4U A;  2DYX A;  3C32 A;  4Z0I A;  3L6H A;  1MRP A;  3CVG A;  3SES A;  4H1X A;  5I2N A;  2UVI A;  1DTG A;  3FVK A;  3K6W A;  4F31 B;  1MM7 A;  4IY5 A;  3S9L C;  3MQ9 A;  4IGT A;  2ZNT A;  1IXG A;  1LAF E;  1MXY A;  3N94 A;  5KCJ A;  3PPR A;  5I58 B;  4U23 A;  1DPE A;  4DXC A;  5CMC A;  5EHM A;  1A99 A;  3H6W A;  3CR9 A;  3K1M A;  4KD5 A;  5DEX A;  4NF4 A;  1I6B A;  3DP4 A;  1B52 A;  3Q29 A;  4KI0 E;  2CMO A;  1II5 A;  4YU0 A;  3MPL A;  3V83 A;  1B05 A;  5IAI A;  3O2A A;  4QFP A;  1ZLQ A;  3LSX A;  4U1Z A;  3VE1 B;  2O7I A;  1SDX A;  1IEJ A;  3T66 A;  4ESW A;  3S9M C;  1US5 A;  1FQE A;  1XVX A;  2DVC A;  4OHN A;  2I3W A;  1P1O A;  4QFK A;  3ZKK A;  4ELQ A;  3W9V A;  2O68 A;  3H6T A;  3I3V A;  3KG2 A;  4EF2 A;  3PU5 A;  5AA2 A;  2PT2 A;  4GL0 A;  1JET A;  4OFL A;  3D4C A;  1OQG A;  4E0X A;  1MPD A;  1H45 A;  2Q2A A;  3EN3 A;  1B3H A;  3IO6 A;  1L5T A;  1A54 A;  3IJX B;  2DE2 A;  4FEC A;  1NNF A;  2DOJ A;  4DE8 A;  5AA3 A;  4ELP A;  3EQ1 A;  4QRZ A;  5K2X A;  2XXH A;  2I4B A;  2UVH A;  2Z8D A;  1H3D A;  2DXR A;  3DP6 A;  3F11 A;  2DWA A;  2OWT A;  2VHA A;  1URD A;  1SW5 A;  4G8H A;  4GVO A;  2QL3 A;  4OER A;  2Y7I A;  2OZZ A;  3WAF A;  4XTC Q;  4GRK A;  3JV9 A;  3SEY A;  4KCD A;  3TPA A;  4EQ9 A;  3IK6 B;  2VD3 A;  3MJN A;  4R73 A;  5AA4 A;  1B3E A;  2O84 X;  4ZZA A;  3VFJ A;  1UIU A;  3B6T A;  4MLV A;  1I6A A;  3B6Q A;  4G8M A;  1F9B A;  1POT A;  2UYF A;  4FIM A;  1B46 A;  1VE4 A;  3TZA A;  2E1S A;  2QMX A;  4JWX A;  2XD3 A;  4JSD A;  2XXX A;  4H5F A;  1B7H A;  3MVY A;  3I6V A;  2Z8E A;  2O7U A;  1Q1K A;  3M3K A;  4FAT A;  5ICQ A;  3CI8 A;  1MXU A;  1MPB A;  4GXS B;  1Q35 A;  4Q5T A;  5HPQ A;  3K0V A;  3C31 A;  1VR5 A;  4PFU A;  3EF7 A;  1Y1M A;  3C33 A;  1URS A;  4IO2 A;  2ESN A;  3TAJ A;  4JWY A;  1I6Q A;  2ABH A;  3FXU A;  2XXT A;  3G3H A;  3H7M A;  4IO6 A;  2DWI A;  3A3U A;  2W7Y A;  3CFL A;  3HHG A;  2GH9 A;  1QUL A; 
#chains in the Genus database with same CATH topology
 3MAM A;  4NF5 B;  1PB7 A;  1NV6 A;  1IXC A;  4ELO A;  4U21 A;  4R72 A;  4R6K A;  2H25 A;  1LCF A;  2GHA A;  4K3F A;  4DDD A;  4KYS A;  4KR5 A;  3TTR A;  2F7C A;  3HCQ A;  2H99 A;  2ZNU A;  5DVI A;  4HE0 A;  2CZI A;  2A5S A;  3OD7 A;  1IIW A;  5J1D A;  1B51 A;  3KC1 A;  3FAT A;  1IMA A;  1O7T A;  2PVU A;  4DCX A;  5HBC A;  1MH3 A;  4G4P A;  5CMB A;  5F24 A;  4XKP A;  2QS2 A;  4LP2 B;  4OET A;  4GX4 A;  4U22 A;  4KYD A;  4THI A;  2P3N A;  4YAH X;  4OA4 A;  3PTY A;  1OVB A;  1LBY A;  3DEL B;  4P47 A;  5EHS A;  2Q88 A;  3PPO A;  2BJJ X;  3A09 A;  3G3K A;  4YB5 A;  2F35 A;  5AA4 B;  1GR2 A;  2R8T A;  2CZK A;  3FUZ A;  1CE2 A;  1B9J A;  3TCG A;  3PUX E;  1UTH A;  2V25 A;  1JW1 A;  2WYK A;  2DE3 A;  5K2Y A;  2I49 A;  4XKQ A;  4G68 C;  4YB6 A;  5JTY B;  1P1Q A;  2O69 A;  4QSD A;  4OEV A;  1DK4 A;  3KBR A;  1NV3 A;  1A8E A;  4LA9 A;  3CRB A;  5I2K A;  3IB0 A;  4R6Y A;  4ONY A;  4ZE8 A;  5H8F B;  3UA8 A;  3GLB A;  1H76 A;  3VLU A;  2HCA A;  3V8X B;  4NHB A;  2Q8M A;  2UVJ A;  4X48 A;  1MM6 A;  2UXA A;  4RA1 A;  2QPQ A;  2G93 A;  1UTB B;  4GBW A;  5TP9 B;  3FJ7 A;  4QXD A;  1QKB A;  1A55 A;  4ZEC A;  1MY2 A;  4M4G A;  3ILU B;  3HFU A;  2DWH A;  5F7V A;  1B1X A;  2XXP A;  1JEV A;  3FZV A;  3MC2 A;  5TPA A;  4NF4 B;  4MJO A;  3MBP A;  3IJO B;  1LST A;  1LBB A;  3OEM A;  3TKD A;  4N15 A;  2XX8 A;  1LBZ A;  3CHG A;  4ZS9 A;  4BDQ A;  4GX3 A;  3W15 C;  2PYY A;  3MVX A;  3Q25 A;  4P11 A;  3M3L A;  3PUV E;  3FBP A;  4XIG Q;  4BDO A;  2V84 A;  3IR1 A;  3LV0 A;  1TFA A;  4QSC A;  5FTI A;  4N8Y A;  2PFY A;  1IMB A;  2NOO A;  1CB6 A;  2DQV A;  1PB9 A;  5EQ7 A;  4MNC A;  5CM6 A;  1XHY A;  5H8S A;  1D9Y A;  5I58 A;  4YKP A;  1RYO A;  3IOT A;  1LFI A;  3TTM A;  1N7X A;  2ZXT A;  4GL8 A;  3MYU A;  2REG A;  4GWX A;  2RKM A;  2HHM A;  4XFE A;  5KZT A;  2XXV A;  1B2H A;  3T1B A;  1O64 A;  3CG3 A;  2Y7P A;  4YKI A;  3PUY E;  4GWY A;  5KDT A;  1FPL A;  1SVX B;  1JVY A;  3OSQ A;  3K6V A;  2ZZX A;  3OO6 A;  2H5Y A;  3IO4 A;  3HPI A;  3KZG A;  4P8B A;  4XKR A;  3HV1 A;  2PX1 A;  5I59 B;  1B0H A;  4OMB A;  4N4U A;  3IFC A;  1ZU0 A;  2B3F A;  5FHM A;  3C36 A;  1B4Z A;  5CMM A;  3VVD A;  4FED A;  2OLB A;  5ET7 A;  2GHB A;  2XXY A;  3CG1 A;  2O1L A;  5ELV A;  4NF5 A;  2XHD A;  1B3G A;  5H8Q A;  2V3Q A;  4KPT A;  5AE4 A;  2D3I A;  4R75 A;  1Y3Q A;  2M8C A;  3UN6 A;  2O51 A;  4ZEF A;  1IUD A;  4N13 A;  2FA7 A;  2ZMB A;  3E13 X;  1S7Y A;  2Z22 A;  3CFX A;  1FTL A;  2B65 A;  4OAN A;  1A40 A;  1FQD A;  2QSX A;  5DYH A;  1BTJ A;  5H8Q B;  3K6U A;  4PF8 A;  4OVJ A;  5I57 B;  4GBV A;  1UTH B;  1NV2 A;  4MF3 A;  4TLL B;  2Q74 A;  2D5W A;  4F18 A;  1D9Q A;  4GWZ A;  4LAT A;  4PE3 A;  4F39 A;  2NWJ A;  2HAV A;  5BWJ A;  4OWD A;  2O1M A;  1XS5 A;  3CSG A;  5B70 A;  4FJP A;  1YTV A;  4JB7 A;  4KXP A;  2WBD A;  3KN3 A;  5A5L A;  4ECF A;  1VSO A;  1B32 A;  3EPE A;  3QIM A;  4OVS A;  3Q26 A;  1PEB A;  1Y4T A;  3FXR A;  3RPL A;  4EQB A;  3S9E A;  3T9U A;  3M3F A;  4JXI A;  4BLA A;  3TCF A;  4BDM A;  3LUZ A;  2HAU A;  2Q9T A;  4DXU A;  4NX1 A;  2F5X A;  4C1U A;  3HHF A;  3FXB A;  3KC0 A;  1FBE A;  4PET A;  3LBS A;  3SKP A;  2OBG A;  4X1D A;  4NF6 B;  1N04 A;  2Y84 A;  1MDP 1;  3KJ7 A;  4U4X A;  3C32 A;  1MRP A;  3SES A;  4IY5 A;  3PPR A;  4U23 A;  1DPE A;  4DXC A;  1A99 A;  3CR9 A;  5EQ8 A;  4NF4 A;  1B52 A;  2CMO A;  1II5 A;  3MPL A;  4PBH A;  4NN3 A;  4O7M A;  2O7I A;  3RYD A;  2DVC A;  3W9V A;  2PT2 A;  4E0X A;  3D4C A;  1MPD A;  1B3H A;  4UAB A;  4FEC A;  1NNF A;  5LDZ A;  4ELP A;  1L5T A;  3DP6 A;  2UVH A;  3F11 A;  4DI4 B;  2OWT A;  1FPI A;  4OER A;  2OZZ A;  1B3E A;  2O84 X;  4ZZA A;  4P9K A;  4N81 A;  1I6A A;  2UYF A;  1INP A;  3TZA A;  4JWX A;  2XD3 A;  2Z8E A;  3M3K A;  4FAT A;  4Q5T A;  1Q35 A;  5HPQ A;  2ABH A;  3G3H A;  1BK4 A;  3CFL A;  3HHG A;  3V5A A;  3ROJ A;  1LEV A;  3MUQ A;  3G3I A;  2WEF A;  4NWC A;  4ZZE A;  4DI3 D;  4ZED A;  2D21 A;  3FVO A;  1IXH A;  3U65 A;  1AH5 A;  3K4U A;  1EYJ A;  3T93 B;  1NFT A;  3PUZ E;  1QKA A;  4IO5 A;  1NI9 A;  1TWY A;  3IFA A;  4WEP A;  2HPG A;  2QVV A;  2KQZ A;  3VVF A;  3OXN A;  2WX9 A;  3OO8 A;  4F22 A;  1DTZ A;  2VGQ A;  4TQU Q;  2RC8 A;  1AIV A;  3M8U A;  4BDN A;  1QJM A;  4QF9 A;  5M2V A;  3K02 A;  1MY0 A;  2CEX A;  2THI A;  4N6K A;  5L9O A;  2PCR A;  1NV1 A;  1LFG A;  1LAH E;  3H06 B;  2Q8J A;  2RC9 A;  4EDP A;  3GXA A;  2XWK A;  1OVT A;  4G8N A;  3PMX A;  3QMF A;  3IB1 A;  3R26 A;  1FBD A;  3PGF A;  4ISU A;  4HXV A;  3T9V A;  2VPO A;  4HTG A;  5DTB A;  4F3B A;  4BDR A;  2PBW A;  3C4M A;  1BIY A;  3L6G A;  5I57 A;  1MH4 A;  3KJT A;  4QFN A;  1B7Z A;  3MZ9 A;  3SEW A;  1ZKB A;  4QFL A;  4KCC A;  2Y7R A;  1MS7 A;  1FW0 A;  4RPO A;  4HE2 A;  4EXK A;  2RCB A;  4PGN A;  5I2K B;  4NWD A;  5F1Q A;  2G29 A;  3IX1 A;  4WXJ A;  4U2R A;  2XXI A;  1B5J A;  3G3J A;  2OX3 A;  5I5P A;  2O6A A;  4GOT A;  3IOR A;  4H0W A;  1VDW A;  4TOZ A;  4NMY A;  5TPA B;  4RNS A;  5ET6 A;  5KCJ B;  4JSO A;  2F3B A;  4MFI A;  4ZDM A;  3U93 A;  2OK2 A;  4JDF A;  2XA5 A;  3H3G A;  1M5B A;  2A5T A;  3O6I A;  3HN0 A;  3OMB A;  4UAC A;  5L9S A;  3RT6 B;  1MXV A;  2IEE A;  5IKB A;  1HSE A;  4O94 A;  1QUK A;  3K1N A;  1ZMG A;  4RK2 A;  4OVQ A;  3ECR A;  4FAJ A;  2XX9 A;  2VOZ A;  4NF0 A;  5IZ3 B;  3FGS A;  2B4M A;  1EZ9 A;  3MZB A;  1KWH A;  5EYF A;  3MZ1 A;  5DEX B;  4PE5 B;  4LZ8 A;  3TMG A;  4L17 A;  4X04 A;  2I0B A;  3A3C A;  4QSE A;  4G61 A;  2ZYO A;  4XF5 A;  4E0W A;  1UIV A;  2E0S A;  2WKY A;  3T96 B;  3V89 B;  4OVR A;  1MQG A;  1B5I A;  4OEN A;  3EHU A;  3OO9 A;  1MQJ A;  3FXQ A;  4PAI A;  3B50 A;  4PFI A;  2UVG A;  1FBF A;  4Q8R A;  4GWS A;  1FTM A;  3S9N C;  4P0I A;  3P7I A;  3KN8 A;  1YZ0 A;  5ITP A;  1MY1 A;  2X26 A;  4LZ5 A;  5FHO A;  5BUU A;  3PPP A;  2WYP A;  1FQA A;  2PMS A;  4NG7 A;  3E3K A;  4U1O A;  4WKM A;  1M5C A;  1FCK A;  1M5E A;  3IB2 A;  5EQ9 A;  4RY1 A;  4KQP A;  2OWZ A;  2DVZ A;  1IZ1 A;  5ET5 A;  4N6P A;  1G0H A;  4PAK A;  1Y4C A;  2DDK A;  4OVP A;  3FAS A;  3KSX A;  3TFL A;  4JVC A;  2H98 A;  1LBW A;  1NL5 A;  5A5X A;  1MQD A;  5FBP A;  4GFR A;  3MP1 A;  4BDL A;  2XWI A;  3MVZ A;  3FJG A;  4XKN A;  3UGW A;  3H4Z A;  4PFT A;  1MQI A;  3RUM A;  3PMV A;  3VVE A;  3RLF E;  1FBC A;  3LSW A;  1UTB A;  5TP9 A;  1B6H A;  3B6W A;  2JJK A;  4PQJ A;  3TTK A;  3HO7 A;  4HCY A;  4PFW A;  2QS3 A;  4HW8 A;  2IA4 A;  2F3D A;  2P1S A;  4H65 A;  5I7I A;  2Z8F A;  4IB2 A;  1Y9U A;  4PCD A;  2ZZW A;  4F1Y A;  2WBB A;  2I58 A;  2AYS A;  3KSJ A;  1B7U A;  4F3G A;  2V3U A;  1OQH A;  4O7I A;  3QAX A;  2YJP A;  3VLW A;  1BLF A;  4NGU A;  1POY 1;  1FBG A;  4YKJ A;  1D3K A;  3GZG A;  3GYY A;  2F97 A;  3K1P A;  3TEP A;  1LGB C;  1Y1Z A;  4IO7 A;  1LAG E;  3UK4 A;  3CVG A;  5I2N A;  1DTG A;  4F31 B;  1MM7 A;  3S9L C;  1LAF E;  3N94 A;  5KCJ A;  5EHM A;  4QFP A;  1XI6 A;  1SDX A;  1US5 A;  1FQE A;  1XVX A;  2I3W A;  1P1O A;  5IZ3 A;  3ZKK A;  4EF2 A;  3KG2 A;  3PU5 A;  1JET A;  4OFL A;  4PBQ A;  3EN3 A;  1A54 A;  2I4B A;  1H3D A;  2DWA A;  3WAF A;  1FPJ A;  2QL3 A;  2Y7I A;  4I3E A;  3TPA A;  1Q9D A;  4R73 A;  3MJN A;  1FRP A;  3VFJ A;  3B6Q A;  4JSD A;  1B7H A;  5ICQ A;  1MXU A;  4GXS B;  1NUW A;  5LTC A;  1I6Q A;  3FXU A;  3H7M A;  1FJ6 A;  3THI A;  4GWU A;  3ZS6 A;  4IO4 A;  4DCY A;  2AIX A;  1PDA A;  1JVX A;  4OES A;  2X7Q A;  2Y7W A;  1P1N A;  5I59 A;  2RF1 A;  1FQF A;  4G77 A;  4R2B A;  1TT1 A;  1PBP A;  5DW8 A;  2XXQ A;  3RTF B;  3K2D A;  4AB6 A;  2XD2 A;  4O3B A;  1JEU A;  2AL5 A;  4H45 A;  1NUY A;  4F3S A;  3RGY A;  4O3C A;  2R71 A;  1I69 A;  1LBV A;  2V3T A;  4NF8 B;  5CI5 A;  4DXB A;  4F2Q A;  3O6G A;  4I1D A;  4R74 A;  2DP8 A;  1EU8 A;  2NVU B;  4ZEK A;  3BFU A;  1QGX A;  4QBA A;  3EHT A;  1RYX A;  1DOT A;  4MCO A;  2F6G A;  1PBQ A;  3PPQ A;  4I8C A;  3QUF A;  4P1E A;  3JZJ A;  3PD9 A;  2HQ0 A;  2XWV A;  1ANF A;  1NMU A;  1IMD A;  1IXI A;  4F3P A;  2R6G E;  4MBP A;  1IME A;  4GIZ A;  2F36 A;  2NUV A;  2RIN A;  4HS7 A;  3E78 A;  3U8Q A;  1FQB A;  4PF6 A;  2XXU A;  5I56 A;  4PFB A;  3O9P A;  3Q28 A;  2R9J A;  3O66 A;  2I3V A;  4XEQ A;  4GD5 A;  1YAE A;  4OZ9 A;  1JW5 A;  2OCU A;  4R9F A;  4F2O A;  4EQ7 A;  4DIG A;  3OSR A;  3U92 A;  1FPF A;  4LON B;  4PGP A;  4R9G A;  4IGR A;  1B1H A;  1R6Z A;  2ONK E;  5ESY A;  1H44 A;  4GLI A;  2H9B A;  1FQC A;  2FHY A;  1GGG A;  2XXW A;  4N17 A;  4FEB A;  4RXL A;  4LVQ A;  3RQT A;  1NNT A;  4POX A;  3GBB A;  3RN8 A;  1CNQ A;  2F8D A;  1WDN A;  2XX7 A;  4H8I A;  2VT5 A;  4MLQ A;  5I3S A;  4GF8 A;  5AA2 B;  2GRV A;  3B7D A;  3FVG A;  3LC8 A;  4C0R A;  5CRY A;  2QFL A;  1ZTY A;  4OEU A;  4POW A;  1LB9 A;  5L8D A;  2MKZ A;  2L5V A;  5AA1 A;  3OOA A;  3BIG A;  1SD3 A;  1K9Y A;  3Q27 A;  1NV5 A;  1HSJ A;  3PPN A;  1B3L A;  4XXU A;  3IOU A;  3MVW A;  4EUO A;  2ONR A;  1ZIU A;  3LR1 A;  4H67 A;  2Q89 A;  2H4I A;  3OEL A;  4N07 A;  3IOV A;  2GQ1 A;  4P1L A;  1BP5 A;  4PFY A;  4O3A A;  3N6T A;  1R9Q A;  3KOS A;  4EXL A;  3CIJ A;  5CBS A;  2CZH A;  3T9X B;  4OTE A;  3ZSF A;  1FTO A;  3H03 A;  5JEI A;  3T0J A;  2QVU A;  3H6V A;  2LAO A;  1B0L A;  1N0T A;  4KFQ A;  2KR0 A;  2ZZV A;  1SYH A;  3E9X A;  1NNK A;  5AA2 D;  1LFH A;  1SPI A;  3BBR A;  5ITO A;  4G68 B;  4MAG A;  2UYE A;  2P0S A;  4NQ8 A;  2B3B A;  3I3V A;  1TFD A;  1MPC A;  1OLA A;  4YMB A;  3S2V A;  3R6U A;  1FBH A;  3FIR A;  3BIH A;  1QUJ A;  3FV2 A;  2YLN A;  1R9L A;  1KZ8 A;  3VV5 A;  1FSA A;  3G3F A;  1MXZ A;  3USD A;  1NUZ A;  5ICT A;  1B40 A;  2QMW A;  3T22 A;  4QHQ A;  4NF8 A;  1MY3 A;  4WED A;  4MH5 A;  3SER A;  1Y3P A;  2BJI A;  4DLD A;  1KA0 A;  3UOR A;  1G0I A;  3PD8 A;  1GTK A;  1AWB A;  3C34 A;  2Z23 A;  2YPN A;  4I9D A;  3VLV A;  2DE4 A;  1LLS A;  4YZZ A;  4OFJ A;  3OO7 A;  4RYA A;  3CSB A;  5EYG A;  3B8B A;  2OJT A;  1N84 A;  4PDD A;  1MQH A;  2CZL A;  3GBA A;  1JP4 A;  2V4C A;  3N26 A;  3TCH A;  4H8J A;  4RJZ A;  4QFO A;  2I4C A;  1DSN A;  1FPG A;  2DSF A;  4IO3 A;  1ZBM A;  3BKI B;  3FJM A;  1FTK A;  1NV0 A;  4DZ1 A;  2I48 A;  1JNF A;  2I0C A;  1AL3 A;  1FTA A;  4F1U A;  1WOD A;  1DMB A;  3IOW A;  3MPK A;  3JYR A;  1IIT A;  3OEK A;  3QSL A;  2HZK A;  3DP8 A;  3TTL A;  3ODB A;  3TYH A;  4PAF A;  1EZP A;  4R6H A;  1QW0 A;  2A5T B;  1J1N A;  4PP0 A;  4ZEB A;  4X1B A;  1QVS A;  4NTL A;  3G7W A;  3K01 A;  3PV0 E;  3FVN A;  5IZZ A;  2AL4 A;  1S50 A;  3RPW A;  3S4U A;  3L6H A;  4H1X A;  2UVI A;  3K6W A;  4MIJ A;  4NAP A;  1IMF A;  5CMC A;  3H6W A;  3K1M A;  4KD5 A;  5DEX A;  1I6B A;  4KI0 E;  3V83 A;  1B05 A;  3O2A A;  1ZLQ A;  3LSX A;  4U1Z A;  3VE1 B;  5T3J A;  1IEJ A;  4ESW A;  4OHN A;  4QFK A;  4ELQ A;  5AA2 A;  1OQG A;  2QVR A;  1H45 A;  3IJX B;  4DE8 A;  5AA3 A;  3EQ1 A;  2Z8D A;  4ELR A;  4G8H A;  2VHA A;  1URD A;  1SW5 A;  4GVO A;  1KA1 A;  4XTC Q;  4GRK A;  2XWO A;  3JV9 A;  3SEY A;  2VD3 A;  4G8M A;  1F9B A;  4FIM A;  1B46 A;  3MVY A;  3I6V A;  1YYZ A;  2O7U A;  3C31 A;  2B4L A;  3EF7 A;  4PFU A;  1Y1M A;  1URS A;  4IO2 A;  2ESN A;  4JWY A;  2DWI A;  2FBP A;  3A3U A;  4UA8 A;  1URG A;  2NXO A;  1FPD A;  4MMP A;  3HST A;  3N5L A;  1N7W A;  4N91 A;  2RCA A;  1SW1 A;  4LUB A;  5KDT B;  5IAI A;  2Q2C A;  3RNN A;  4MHF A;  2F7B A;  1IQ7 A;  4GX6 A;  1ZJL A;  4GWW A;  4X8R A;  2ALU A;  1RDZ A;  1H43 A;  3RT8 A;  4JVD A;  2Y5K A;  5FTH A;  2QJE A;  4JVI A;  1VFD A;  5B7D A;  2FNC A;  1YCJ A;  3ILT B;  3A29 A;  2DS9 A;  5IZ1 A;  3ZKL A;  2FYI A;  1FPE A;  2ZYN A;  2ZYK A;  3U94 A;  1XOC A;  3C9H A;  1XVY A;  2REJ A;  3MP8 A;  1SBP A;  1USY H;  4OXV A;  1RDY A;  3TEL A;  3MWB A;  4LQ5 A;  1NUX A;  4GQO A;  1SYI A;  3U1O A;  3TOD A;  3D1R A;  5FHN A;  4Z7E A;  5IGA A;  1LB8 A;  1P99 A;  3ONM A;  1NNP A;  4OVT A;  1S9T A;  4KYE A;  2P2A A;  1LCT A;  2F78 A;  4I40 A;  2FIE A;  4R2F A;  4AS5 A;  1GV8 A;  3TUS A;  1SI1 A;  1M5D A;  3UP9 A;  3KN7 A;  4IY6 A;  1XC1 A;  2FIX A;  2DXY A;  1US4 A;  5H8F A;  1LAX A;  3WAE A;  5JTY A;  1B4H A;  5H8H B;  4P3L A;  3W9W A;  4GWO A;  1EZO A;  1NKX A;  3KGC A;  2ANJ A;  1B3F A;  3KFM A;  3N6U A;  1PB8 A;  3U72 A;  1EYK A;  4G2Z A;  3MW0 A;  1R1N A;  3DLN A;  3OEN A;  5ISU A;  3MP6 A;  3TDJ A;  4OYV A;  4OQO A;  5H8N A;  1N76 A;  3AXF A;  4H5G A;  1A7L A;  3IAZ A;  1LBX A;  1Y20 A;  4LQ2 A;  1NH8 A;  1YXI A;  1K9Z A;  5I84 A;  5CMK A;  3O28 A;  1N3X A;  1D4N A;  3LUY A;  3O6H A;  1MXW A;  2QRY A;  4JBZ A;  3EHS A;  4MNP A;  1JW4 A;  5I2N B;  5H8N B;  4IR8 A;  4AQ4 A;  2ZNS A;  5L9M A;  3KOT A;  2P3V A;  4FOR A;  4AS4 A;  1MG1 A;  2PT1 A;  3I5O A;  1N3W A;  2CEY A;  1USY E;  3CFZ A;  3T9H B;  2HXW A;  3MST A;  3C35 A;  4EF1 A;  3E4R A;  3VDF A;  4TLM B;  2OWS A;  3TTN A;  1RKM A;  5ET8 A;  1P1W A;  3EKI A;  2XXK A;  2GFE A;  4PFR A;  4F19 A;  3FV1 A;  5EQA A;  5TU0 A;  4YKK A;  3H6U A;  3SET A;  2HEU A;  1MY4 A;  2F6P A;  4P0G A;  4YB7 A;  1A8F A;  1LBC A;  1QUI A;  3DM0 A;  2V93 A;  3K6X A;  3ISP A;  4Q30 B;  4AB5 A;  1B5H A;  4JWO A;  5IM2 A;  3FD3 A;  3QK6 A;  1GVC A;  1SI0 A;  3PUW E;  1NV4 A;  2F34 A;  3SDF A;  1FPK A;  5HM4 B;  1Z7M E;  1D9V A;  3O29 A;  4OFO A;  5DT6 A;  2F7A A;  5DVJ A;  4GXA A;  4G68 A;  3SEV A;  4RK9 A;  3UIF A;  1VFE A;  4Q0C A;  4LN5 A;  4HCW A;  2QS1 A;  4KHZ E;  5LOM A;  1ATG A;  1BKA A;  2X7P A;  4M1V A;  4NED A;  5A5X B;  1Y3N A;  5AA4 A;  1B58 A;  1MDQ A;  2VP1 A;  1O63 A;  5DVF A;  4NE4 A;  3K00 A;  5JK4 A;  4ESX A;  3SEX A;  4N8G A;  3O97 A;  1NH7 A;  2XXR A;  3BFT A;  4ZE9 A;  1FTJ A;  3QUJ A;  5I56 B;  4PTK A;  1EH3 A;  4LZ7 A;  3QXM A;  2DWJ A;  4O8M A;  1DBZ A;  4H46 A;  4MEV A;  3D4G A;  4H6D A;  4RPN A;  1UQW A;  1M5F A;  2I6E A;  2RC7 A;  4YIC A;  1XT8 A;  1WVJ A;  1EYI A;  3R7X A;  4YMA A;  2ZYM A;  2Y5L A;  2PFZ A;  3RY3 A;  4F29 A;  3PMW A;  2QS4 A;  2Y7K A;  1SQY A;  3SEU A;  5CC2 A;  1ELJ A;  1OIB A;  5H8H A;  1SW2 A;  4FBP A;  3VXC A;  1HSL A;  2ONS A;  3QYT A;  2KLF A;  2VD2 A;  1T0K A;  1Z7N E;  3IL1 B;  2HFB A;  3LSL A;  1AMF A;  4PDH A;  1P1U A;  1YPN A;  3KEI A;  3RPL B;  1OLC A;  1DPP A;  2VPN A;  3LSF B;  1AOV A;  1MXX A;  4FE8 A;  4ND9 A;  3G3G A;  4X9T A;  4P56 A;  4NF6 A;  1NV7 A;  1FPB A;  1TXF A;  1SW4 A;  1FJ9 A;  2HZL A;  4MX6 A;  4EQ9 A;  4N6D A;  4C1T A;  4PC9 A;  4U4S A;  4I3Y A;  5CBR A;  1PC3 A;  3TQL A;  3VXB A;  1JQF A;  4I62 A;  3RTW B;  1OMP A;  5EYH A;  4F1V A;  2DYX A;  4Z0I A;  1DCU A;  2HXR A;  3FVK A;  3MQ9 A;  4IGT A;  2ZNT A;  1IXG A;  1MXY A;  5I58 B;  3DP4 A;  3Q29 A;  4YU0 A;  3T66 A;  3S9M C;  2O68 A;  3H6T A;  4HE1 A;  4GL0 A;  3IO6 A;  2Q2A A;  2DE2 A;  2DOJ A;  4QRZ A;  5K2X A;  2XXH A;  3E79 A;  2DXR A;  3TQW A;  4ZEI A;  1RDX A;  1IMC A;  4KCD A;  3IK6 B;  5J16 A;  1UIU A;  3B6T A;  4MLV A;  3KBZ A;  1POT A;  4MNI A;  1VE4 A;  2E1S A;  2QMX A;  2XXX A;  4H5F A;  3NOH A;  1Q1K A;  3CI8 A;  1MPB A;  3K0V A;  1VR5 A;  3SZP A;  3C33 A;  3TAJ A;  1FBP A;  2FVZ A;  2XXT A;  4IO6 A;  2W7Y A;  2GH9 A;  1QUL A; 
#chains in the Genus database with same CATH homology
 3MAM A;  4NF5 B;  3THI A;  3MUQ A;  1PB7 A;  3G3I A;  4IO4 A;  4UA8 A;  4NWC A;  4ZZE A;  3ZS6 A;  2AIX A;  1PDA A;  1JVX A;  1URG A;  4OES A;  4ZED A;  1IXC A;  2X7Q A;  2NXO A;  2Y7W A;  4U21 A;  2D21 A;  4ELO A;  3FVO A;  3HST A;  4R72 A;  3N5L A;  1N7W A;  4R6K A;  1P1N A;  2H25 A;  1LCF A;  2GHA A;  2RF1 A;  1FQF A;  4G77 A;  1IXH A;  4K3F A;  4R2B A;  1TT1 A;  5I59 A;  4ZEI A;  4DDD A;  2RCA A;  1PBP A;  1SW1 A;  1AH5 A;  4KYS A;  2Q2C A;  4KR5 A;  4LUB A;  3RNN A;  3K4U A;  3TTR A;  2F7C A;  3T93 B;  2F7B A;  1NFT A;  1IQ7 A;  3HCQ A;  1ZJL A;  3PUZ E;  2XXQ A;  2H99 A;  1QKA A;  4IO5 A;  2ALU A;  1H43 A;  2ZNU A;  5DVI A;  3RTF B;  3RT8 A;  3K2D A;  1TWY A;  4AB6 A;  2A5S A;  5FTH A;  3OD7 A;  4WEP A;  2QJE A;  2XD2 A;  1VFD A;  4O3B A;  1IIW A;  3VVF A;  5J1D A;  5B7D A;  1JEU A;  2AL5 A;  2FNC A;  1B51 A;  3OXN A;  3FAT A;  1O7T A;  2PVU A;  4DCX A;  1YCJ A;  3ILT B;  3OO8 A;  5HBC A;  4F22 A;  4F3S A;  1MH3 A;  1DTZ A;  2VGQ A;  4G4P A;  5CMB A;  3RGY A;  4O3C A;  4TQU Q;  2RC8 A;  2QS2 A;  1I69 A;  2R71 A;  2DS9 A;  2V3T A;  4LP2 B;  4NF8 B;  4OET A;  3M8U A;  5CI5 A;  4U22 A;  3ZKL A;  4KYD A;  4DXB A;  2FYI A;  4F2Q A;  3O6G A;  4I1D A;  4THI A;  4BDN A;  2ZYN A;  4R74 A;  2DP8 A;  2ZYK A;  1QJM A;  4QF9 A;  4ELR A;  4YAH X;  5M2V A;  3U94 A;  1XOC A;  1EU8 A;  3C9H A;  3K02 A;  2NVU B;  1XVY A;  2REJ A;  3MP8 A;  1MY0 A;  1OVB A;  1SBP A;  1USY H;  3DEL B;  2THI A;  4OXV A;  4ZEK A;  3TEL A;  5L9O A;  1AIV A;  3BFU A;  3MWB A;  5EHS A;  2Q88 A;  3EHT A;  1RYX A;  2BJJ X;  3PPO A;  4GQO A;  4LQ5 A;  1DOT A;  1SYI A;  3U1O A;  1LFG A;  3A09 A;  3G3K A;  1LAH E;  3H06 B;  4YB5 A;  2F6G A;  2F35 A;  1PBQ A;  2Q8J A;  2RC9 A;  3PPQ A;  1GR2 A;  4EDP A;  5AA4 B;  4I8C A;  3GXA A;  1AOV A;  3FUZ A;  3TOD A;  3QUF A;  5FHN A;  3JZJ A;  4Z7E A;  1CE2 A;  1B9J A;  1LB8 A;  1P99 A;  1OVT A;  3ONM A;  2HQ0 A;  3PD9 A;  1ANF A;  3PUX E;  4G8N A;  3TCG A;  1UTH A;  2V25 A;  1JW1 A;  1NNP A;  1S9T A;  1NMU A;  4KYE A;  3PMX A;  1IXI A;  2DE3 A;  5K2Y A;  2R6G E;  2I49 A;  2P2A A;  3IB1 A;  3R26 A;  4F3P A;  4MBP A;  4XKQ A;  4G68 C;  1LCT A;  2F78 A;  3PGF A;  4GIZ A;  4ISU A;  4R2F A;  4YB6 A;  3T9V A;  2F36 A;  2NUV A;  4HTG A;  5DTB A;  2RIN A;  1GV8 A;  4F3B A;  5JTY B;  4BDR A;  3TUS A;  4HS7 A;  1P1Q A;  2PBW A;  3U8Q A;  2O69 A;  1FQB A;  3C4M A;  1BIY A;  3L6G A;  1SI1 A;  1M5D A;  2XXU A;  3UP9 A;  3KN7 A;  4IY6 A;  5I56 A;  1XC1 A;  4QSD A;  4OEV A;  1MH4 A;  5I57 A;  3KJT A;  4QFN A;  2DXY A;  1US4 A;  3KBR A;  3O9P A;  5H8F A;  1LAX A;  3WAE A;  1B7Z A;  5JTY A;  3Q28 A;  1B4H A;  5H8H B;  3MZ9 A;  4FED A;  1A8E A;  4LA9 A;  1ZKB A;  2R9J A;  3O66 A;  3CRB A;  4QFL A;  3SEW A;  3IB0 A;  4R6Y A;  5I2K A;  4KCC A;  2Y7R A;  4ONY A;  5CBR A;  4ZE8 A;  2I3V A;  3W9W A;  1EZO A;  1MS7 A;  4GD5 A;  1FW0 A;  4GWO A;  4RPO A;  1NKX A;  1YAE A;  3KGC A;  2ANJ A;  4OZ9 A;  1B3F A;  1JW5 A;  2OCU A;  3KFM A;  3N6U A;  4R9F A;  5H8F B;  3UA8 A;  3GLB A;  4F2O A;  1PB8 A;  1H76 A;  3VLU A;  3U72 A;  4EQ7 A;  4EXK A;  4DIG A;  2HCA A;  2RCB A;  1R1N A;  3MW0 A;  3OSR A;  4G2Z A;  4LON B;  4NWD A;  4R9G A;  5I2K B;  5F1Q A;  3U92 A;  4IGR A;  2UVJ A;  3DLN A;  3OEN A;  4X48 A;  2G29 A;  5ISU A;  3MP6 A;  1MM6 A;  3IX1 A;  2UXA A;  4RA1 A;  4WXJ A;  3TDJ A;  1B1H A;  1R6Z A;  2ONK E;  2QPQ A;  2G93 A;  4OYV A;  4OQO A;  4U2R A;  1H44 A;  1N76 A;  5H8N A;  2XXI A;  1UTB B;  5TP9 B;  1B5J A;  3G3J A;  3FJ7 A;  3AXF A;  4GLI A;  2H9B A;  4H5G A;  1A7L A;  3V5A A;  1QKB A;  1A55 A;  3IAZ A;  4ZEC A;  2O6A A;  1Y20 A;  3IOR A;  4GOT A;  4H0W A;  1FQC A;  4TOZ A;  1MY2 A;  4LQ2 A;  4NMY A;  5TPA B;  1NH8 A;  4M4G A;  4RNS A;  1GGG A;  2XXW A;  3ILU B;  5I84 A;  5KCJ B;  2DWH A;  5F7V A;  4FEB A;  1B1X A;  4JSO A;  4LVQ A;  2XXP A;  4RXL A;  3RQT A;  5CMK A;  1JEV A;  1N3X A;  3FZV A;  3MC2 A;  3O28 A;  5TPA A;  1D4N A;  4NF4 B;  1NNT A;  3LUY A;  3MBP A;  3O6H A;  3IJO B;  1MXW A;  4MFI A;  4POX A;  1LST A;  3GBB A;  2QRY A;  4ZDM A;  3U93 A;  4JBZ A;  3RN8 A;  1LBB A;  2F8D A;  2OK2 A;  3OEM A;  4JDF A;  3H3G A;  1WDN A;  2XX7 A;  1M5B A;  3EHS A;  4H8I A;  3TKD A;  2XX8 A;  1JW4 A;  5I2N B;  2A5T A;  3O6I A;  5H8N B;  4MLQ A;  5AA2 B;  4GF8 A;  3HN0 A;  4ZS9 A;  3OMB A;  2GRV A;  3B7D A;  3FVG A;  3LC8 A;  4UAC A;  3RT6 B;  4AQ4 A;  4BDQ A;  3W15 C;  4C0R A;  2ZNS A;  5L9S A;  5L9M A;  3KOT A;  2PYY A;  3MVX A;  4FOR A;  5CRY A;  3Q25 A;  1MXV A;  2IEE A;  5IKB A;  1ZTY A;  1HSE A;  4OEU A;  1QUK A;  3K1N A;  4P11 A;  4POW A;  1ZMG A;  4RK2 A;  3M3L A;  3PUV E;  4XIG Q;  1LB9 A;  3ECR A;  4FAJ A;  5L8D A;  2XX9 A;  4BDO A;  2V84 A;  2VOZ A;  1MG1 A;  5AA1 A;  3IR1 A;  3FGS A;  3OOA A;  1EZ9 A;  1SD3 A;  2PT1 A;  3I5O A;  1TFA A;  4QSC A;  1N3W A;  3MZB A;  1KWH A;  3Q27 A;  5EYF A;  5FTI A;  3MZ1 A;  1HSJ A;  1USY E;  3CFZ A;  3PPN A;  3T9H B;  5DEX B;  2NOO A;  4PE5 B;  2HXW A;  3TQW A;  1B3L A;  3C35 A;  4LZ8 A;  3TMG A;  4EF1 A;  3E4R A;  1CB6 A;  2DQV A;  1PB9 A;  4XXU A;  4L17 A;  3VDF A;  2I0B A;  4TLM B;  2OWS A;  3A3C A;  4QSE A;  3IOU A;  3TTN A;  3MVW A;  5CM6 A;  1XHY A;  5H8S A;  4EUO A;  1D9Y A;  2ONR A;  1ZIU A;  2ZYO A;  1RKM A;  3LR1 A;  4H67 A;  5I58 A;  2Q89 A;  4YKP A;  4E0W A;  2H4I A;  1RYO A;  3IOT A;  1UIV A;  1LFI A;  1P1W A;  2E0S A;  3TTM A;  4DCY A;  1N7X A;  2GFE A;  2WKY A;  2ZXT A;  4GL8 A;  3FV1 A;  4F19 A;  3T96 B;  2REG A;  2RKM A;  3OEL A;  4N07 A;  3IOV A;  3V89 B;  1MQG A;  5TU0 A;  4YKK A;  4XKP A;  3H6U A;  3SET A;  1BP5 A;  5KZT A;  2XXV A;  2HEU A;  1B5I A;  1MY4 A;  2F6P A;  1B2H A;  4P0G A;  4OEN A;  3EHU A;  4PFY A;  4O3A A;  3N6T A;  1R9Q A;  1A8F A;  1LBC A;  1O64 A;  1QUI A;  2V93 A;  3DM0 A;  3K6X A;  3KOS A;  3CG3 A;  3OO9 A;  1B5H A;  4Q30 B;  4YB7 A;  4AB5 A;  1MQJ A;  4EXL A;  4JWO A;  3CIJ A;  3FD3 A;  3QK6 A;  1GVC A;  1SI0 A;  5CBS A;  2Y7P A;  3T9X B;  3PUW E;  3FXQ A;  4YKI A;  3PUY E;  2F34 A;  3SDF A;  4OTE A;  5HM4 B;  3ZSF A;  1FTO A;  1Z7M E;  1D9V A;  3O29 A;  5KDT A;  3H03 A;  5JEI A;  2UVG A;  1SVX B;  4OFO A;  5DT6 A;  1JVY A;  3OSQ A;  3K6V A;  3H6V A;  2F7A A;  2LAO A;  5DVJ A;  4Q8R A;  1B0L A;  4GXA A;  4G68 A;  3SEV A;  1N0T A;  4RK9 A;  3UIF A;  1FTM A;  1VFE A;  4KFQ A;  3OO6 A;  4Q0C A;  4P0I A;  4HCW A;  2QS1 A;  3S9N C;  1SYH A;  3P7I A;  2H5Y A;  3E9X A;  1NNK A;  3KN8 A;  5AA2 D;  5ITP A;  3IO4 A;  3HPI A;  3KZG A;  4KHZ E;  5LOM A;  4XKR A;  1LFH A;  3HV1 A;  1ATG A;  2PX1 A;  1BKA A;  3BBR A;  1B0H A;  5ITO A;  1MY1 A;  2X7P A;  4OMB A;  4G68 B;  5I59 B;  1ZU0 A;  2X26 A;  4LZ5 A;  4M1V A;  2B3F A;  4NED A;  5FHO A;  2UYE A;  3PPP A;  2P0S A;  5FHM A;  5BUU A;  3C36 A;  1B4Z A;  5CMM A;  2B3B A;  3V8X B;  3VVD A;  5A5X B;  1FQA A;  1TFD A;  1Y3N A;  1MPC A;  2GHB A;  1OLA A;  2OLB A;  2PMS A;  2O1L A;  2XXY A;  3CG1 A;  3E3K A;  1B58 A;  1MDQ A;  2VP1 A;  1O63 A;  1M5C A;  4NF5 A;  4U1O A;  4WKM A;  5ELV A;  3R6U A;  3S2V A;  4YMB A;  1FCK A;  2XHD A;  1M5E A;  3FIR A;  3IB2 A;  5DVF A;  4RY1 A;  4NE4 A;  4KQP A;  3K00 A;  1QUJ A;  1B3G A;  3FV2 A;  5JK4 A;  5H8Q A;  2V3Q A;  2YLN A;  1R9L A;  4ESX A;  2DVZ A;  1IZ1 A;  3VV5 A;  4KPT A;  3G3F A;  4N6P A;  3SEX A;  5AE4 A;  1MXZ A;  3USD A;  5ICT A;  2D3I A;  3O97 A;  4R75 A;  1NH7 A;  1B40 A;  2XXR A;  3BFT A;  2QMW A;  4ZE9 A;  1Y3Q A;  1Y4C A;  3T22 A;  4QHQ A;  2M8C A;  3FAS A;  3UN6 A;  1FTJ A;  2O51 A;  4NF8 A;  3KSX A;  1MY3 A;  4WED A;  4MH5 A;  4ZEF A;  1IUD A;  1Y3P A;  3QUJ A;  3SER A;  3TFL A;  5I56 B;  5KDT B;  2H98 A;  4N13 A;  2FA7 A;  4DLD A;  1EH3 A;  1NL5 A;  2ZMB A;  3E13 X;  4LZ7 A;  1S7Y A;  2Z22 A;  3CFX A;  3QXM A;  2DWJ A;  5A5X A;  1FTL A;  1MQD A;  2B65 A;  3UOR A;  3PD8 A;  1GTK A;  3C34 A;  4GFR A;  3D4G A;  3MP1 A;  4BDL A;  2Z23 A;  1A40 A;  1FQD A;  2QSX A;  2YPN A;  3MVZ A;  4I9D A;  4H6D A;  4RPN A;  5DYH A;  1BTJ A;  3FJG A;  3VLV A;  4XKN A;  5H8Q B;  3K6U A;  1UQW A;  2DE4 A;  3H4Z A;  1M5F A;  2I6E A;  3UGW A;  2RC7 A;  4PFT A;  4YIC A;  1MQI A;  1XT8 A;  3RUM A;  1LLS A;  1WVJ A;  4OVJ A;  3R7X A;  3PMV A;  5I57 B;  3VVE A;  4YMA A;  4YZZ A;  3RLF E;  2ZYM A;  1UTH B;  3LSW A;  4OFJ A;  3OO7 A;  3RY3 A;  4F29 A;  4MF3 A;  1UTB A;  4RYA A;  1B6H A;  5TP9 A;  3CSB A;  3B6W A;  4TLL B;  2OJT A;  3PMW A;  2D5W A;  4PQJ A;  3TTK A;  1N84 A;  4F18 A;  1MQH A;  2CZL A;  3GBA A;  2QS4 A;  3HO7 A;  4HCY A;  4LAT A;  4PFW A;  4F39 A;  3N26 A;  2QS3 A;  4HW8 A;  2IA4 A;  2NWJ A;  4H8J A;  4RJZ A;  3TCH A;  2Y7K A;  1SQY A;  4QFO A;  2P1S A;  2I4C A;  2HAV A;  5BWJ A;  3SEU A;  4OWD A;  2O1M A;  1DSN A;  5CC2 A;  4H65 A;  1ELJ A;  1OIB A;  2DSF A;  4IO3 A;  5H8H A;  1XS5 A;  1SW2 A;  2Z8F A;  3CSG A;  3VXC A;  4FJP A;  1HSL A;  5B70 A;  1YTV A;  1ZBM A;  1Y9U A;  2KLF A;  2ONS A;  2VD2 A;  1Z7N E;  3IL1 B;  2HFB A;  3QYT A;  4JB7 A;  1T0K A;  3BKI B;  3FJM A;  3LSL A;  1FTK A;  1AMF A;  3KN3 A;  4DZ1 A;  1P1U A;  1YPN A;  2I48 A;  1JNF A;  2I0C A;  3KEI A;  1VSO A;  4ECF A;  1B32 A;  1AL3 A;  1OLC A;  1DPP A;  3EPE A;  4F1Y A;  4F1U A;  2I58 A;  4IB2 A;  1WOD A;  1DMB A;  2AYS A;  3KSJ A;  3QIM A;  3IOW A;  3Q26 A;  3MPK A;  3LSF B;  1B7U A;  1PEB A;  1Y4T A;  3FXR A;  3JYR A;  1MXX A;  1IIT A;  4EQB A;  4FE8 A;  3OEK A;  3QSL A;  3M3F A;  3T9U A;  4F3G A;  4JXI A;  3S9E A;  4BLA A;  2HZK A;  4ND9 A;  3TCF A;  3DP8 A;  3TTL A;  4BDM A;  2V3U A;  3G3G A;  3ODB A;  3TYH A;  1OQH A;  2HAU A;  1EZP A;  4X9T A;  3QAX A;  4R6H A;  1QW0 A;  2A5T B;  1J1N A;  2Q9T A;  4DXU A;  4NF6 A;  2YJP A;  4PP0 A;  4ZEB A;  3VLW A;  1TXF A;  1BLF A;  2F5X A;  4C1U A;  1SW4 A;  1POY 1;  2HZL A;  3HHF A;  4X1B A;  1QVS A;  3G7W A;  4NTL A;  4C1T A;  3K01 A;  4YKJ A;  1D3K A;  3GZG A;  3LBS A;  4PET A;  3PV0 E;  4U4S A;  3SKP A;  1PC3 A;  2F97 A;  2OBG A;  3FVN A;  3K1P A;  3TQL A;  3VXB A;  4X1D A;  3TEP A;  1JQF A;  1LGB C;  1Y1Z A;  4I62 A;  4IO7 A;  2AL4 A;  4NF6 B;  1N04 A;  1S50 A;  2Y84 A;  1LAG E;  1MDP 1;  3KJ7 A;  3RPW A;  3RTW B;  3UK4 A;  1OMP A;  4F1V A;  4U4X A;  3S4U A;  2DYX A;  3C32 A;  4Z0I A;  3L6H A;  1MRP A;  3CVG A;  3SES A;  4H1X A;  5I2N A;  2UVI A;  1DTG A;  3FVK A;  3K6W A;  4F31 B;  1MM7 A;  4IY5 A;  3S9L C;  3MQ9 A;  4IGT A;  2ZNT A;  1IXG A;  1LAF E;  1MXY A;  3N94 A;  5KCJ A;  3PPR A;  5I58 B;  4U23 A;  1DPE A;  4DXC A;  5CMC A;  5EHM A;  1A99 A;  3H6W A;  3CR9 A;  3K1M A;  4KD5 A;  5DEX A;  4NF4 A;  1I6B A;  3DP4 A;  1B52 A;  3Q29 A;  4KI0 E;  2CMO A;  1II5 A;  4YU0 A;  3MPL A;  3V83 A;  1B05 A;  5IAI A;  3O2A A;  4QFP A;  1ZLQ A;  3LSX A;  4U1Z A;  3VE1 B;  2O7I A;  1SDX A;  1IEJ A;  3T66 A;  4ESW A;  3S9M C;  1US5 A;  1FQE A;  1XVX A;  2DVC A;  4OHN A;  2I3W A;  1P1O A;  4QFK A;  3ZKK A;  4ELQ A;  3W9V A;  2O68 A;  3H6T A;  3I3V A;  3KG2 A;  4EF2 A;  3PU5 A;  5AA2 A;  2PT2 A;  4GL0 A;  1JET A;  4OFL A;  3D4C A;  1OQG A;  4E0X A;  1MPD A;  1H45 A;  2Q2A A;  3EN3 A;  1B3H A;  3IO6 A;  1L5T A;  1A54 A;  3IJX B;  2DE2 A;  4FEC A;  1NNF A;  2DOJ A;  4DE8 A;  5AA3 A;  4ELP A;  3EQ1 A;  4QRZ A;  5K2X A;  2XXH A;  2I4B A;  2UVH A;  2Z8D A;  1H3D A;  2DXR A;  3DP6 A;  3F11 A;  2DWA A;  2OWT A;  2VHA A;  1URD A;  1SW5 A;  4G8H A;  4GVO A;  2QL3 A;  4OER A;  2Y7I A;  2OZZ A;  3WAF A;  4XTC Q;  4GRK A;  3JV9 A;  3SEY A;  4KCD A;  3TPA A;  4EQ9 A;  3IK6 B;  2VD3 A;  3MJN A;  4R73 A;  5AA4 A;  1B3E A;  2O84 X;  4ZZA A;  3VFJ A;  1UIU A;  3B6T A;  4MLV A;  1I6A A;  3B6Q A;  4G8M A;  1F9B A;  1POT A;  2UYF A;  4FIM A;  1B46 A;  1VE4 A;  3TZA A;  2E1S A;  2QMX A;  4JWX A;  2XD3 A;  4JSD A;  2XXX A;  4H5F A;  1B7H A;  3MVY A;  3I6V A;  2Z8E A;  2O7U A;  1Q1K A;  3M3K A;  4FAT A;  5ICQ A;  3CI8 A;  1MXU A;  1MPB A;  4GXS B;  1Q35 A;  4Q5T A;  5HPQ A;  3K0V A;  3C31 A;  1VR5 A;  4PFU A;  3EF7 A;  1Y1M A;  3C33 A;  1URS A;  4IO2 A;  2ESN A;  3TAJ A;  4JWY A;  1I6Q A;  2ABH A;  3FXU A;  2XXT A;  3G3H A;  3H7M A;  4IO6 A;  2DWI A;  3A3U A;  2W7Y A;  3CFL A;  3HHG A;  2GH9 A;  1QUL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...