1LSTA

Three-dimensional structures of the periplasmic lysine-, arginine-, ornithine-binding protein with and without a ligand
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
238
structure length
238
Chain Sequence
ALPQTVRIGTDTTYAPFSSKDAKGEFIGFDIDLGNEMCKRMQVKCTWVASDFDALIPSLKAKKIDAIISSLSITDKRQQEIAFSDKLYAADSRLIAAKGSPIQPTLESLKGKHVGVLQGSTQEAYANDNWRTKGVDVVAYANQDLIYSDLTAGRLDAALQDEVAASEGFLKQPAGKEYAFAGPSVKDKKYFGDGTGVGLRKDDTELKAAFDKALTELRQDGTYDKMAKKYFDFNVYGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional structures of the periplasmic lysine/arginine/ornithine-binding protein with and without a ligand.
pubmed rcsb
source organism Salmonella typhimurium
molecule tags Amino-acid binding protein
molecule keywords LYSINE, ARGININE, ORNITHINE-BINDING PROTEIN
total genus 83
structure length 238
sequence length 238
ec nomenclature
pdb deposition date 1993-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 1lstA02
2AL4A 4KHZE 3MWBA 1XHYA 4IO4A 1HSJA 1TFAA 3I6VA 4HCWA 1N76A 4OESA 4HW8A 2FNCA 1QJMA 1LBCA 1MQJA 1NMUA 3M8UA 3PD8A 2X26A 4EDPA 1N3WA 4ELQA 2XXVA 1B51A 1B3GA 3KN3A 4BDQA 4I1DA 1NKXA 1ZBMA 1JEUA 2Q9TA 4YKPA 3E4RA 1VSOA 2F7AA 3IAZA 3N94A 4GL0A 1MY3A 4LZ5A 5CMMA 3K01A 1MY2A 4QRZA 4C1TA 3G3KA 5AA3A 4JWYA 5JK4A 1SI1A 1LAXA 3LSFB 1B7UA 1BKAA 5DYHA 1IEJA 4QFLA 2Q88A 3QXMA 4R2BA 3G3IA 3KN8A 3S9MC 4TLMB 3V8XB 3KOTA 1SDXA 3CR9A 1MY4A 5JTYA 2Q8JA 2UYEA 3Q29A 1NL5A 3O97A 1BTJA 3G3JA 2O68A 4EF1A 4ESXA 3DLNA 3MZBA 1D4NA 1OIBA 3IO4A 1EH3A 1IUDA 1FTOA 3CFXA 1YTVA 3DP4A 1B0LA 3MPLA 2G93A 1EZ9A 3G3GA 4OVJA 4QSCA 4X1DA 1JW5A 1BLFA 4F1VA 5KZTA 3C33A 3OD7A 2PBWA 4FJPA 3RPWA 4QFNA 3O2AA 1SW1A 4UACA 5H8SA 3VVFA 3TYHA 5A5XB 3KEIA 4IO7A 3UORA 3PPPA 1O7TA 3IX1A 1H44A 5ITPA 3F11A 2F36A 3FJGA 3G7WA 4GF8A 2XXUA 4RY1A 3W15C 1Q35A 3PGFA 4R75A 4Z0IA 1MQIA 2Z23A 4E0XA 1Y1MA 5K2XA 3V5AA 1B40A 2Y7KA 1B2HA 4G68B 1B5IA 2Y7IA 2UVJA 4ELOA 4BDMA 2R6GE 4F3SA 5CBRA 4KQPA 1MRPA 3TQLA 5I56A 1S7YA 1I6BA 2RF1A 1SVXB 4KR5A 3C9HA 4ECFA 3OO8A 4GRKA 5AA2A 1H45A 2XXXA 4Q0CA 3PMWA 1MXZA 3VLUA 4EQ9A 3VLWA 2F8DA 4LQ2A 3T22A 4QFPA 5L8DA 1SW2A 1QUIA 2ZYKA 3MPKA 2RKMA 1MQGA 3WAFA 3S9NC 3R7XA 4LQ5A 1GV8A 4IO3A 1IIWA 1DMBA 2XXPA 3CFLA 2A5TA 2XHDA 1FTMA 2P1SA 3FV1A 3H6WA 4IB2A 4PETA 4TQUQ 4NF5A 4OHNA 2HEUA 1UTHB 2O84X 3C36A 1XOCA 2DVZA 4G8HA 2HCAA 1FQEA 1B32A 2F7CA 4KPTA 4R72A 4GQOA 5A5XA 2UVIA 4LZ7A 2H5YA 4LP2B 3FIRA 1QKBA 1UTBB 1XVYA 2ONRA 4GD5A 3RGYA 4JWXA 4F2OA 2QMXA 4Q5TA 1NNTA 5IAIA 5KCJA 1Z7NE 1LAGE 2OCUA 3FV2A 1MDQA 3KSXA 4NMYA 1ZU0A 1YPNA 1JVXA 4U2RA 2D5WA 5H8HA 2XXWA 3VFJA 5ITOA 3SEUA 1JNFA 2M8CA 4U1OA 3K02A 3QSLA 4POWA 1SYHA 4MFIA 3JV9A 4Q30B 3RTWB 5ICQA 3S9EA 4OQOA 2E1SA 3DM0A 3TODA 3PMVA 2Y84A 5CC2A 2DWAA 1L5TA 3T66A 4H6DA 4JXIA 2QS2A 4IY5A 3SERA 1YCJA 1QKAA 3EF7A 2ANJA 3IOTA 1NH8A 1AIVA 3E13X 3IOUA 4OEVA 4ZEIA 4FATA 2HAUA 3JZJA 3OMBA 3SESA 2GHAA 3IJXB 3HSTA 4YKJA 4PFYA 4WXJA 2RINA 4R9FA 1GR2A 1M5FA 1XT8A 1SI0A 4GFRA 2LAOA 4NWCA 4RYAA 2NWJA 3QAXA 5CMBA 3T9VA 3UP9A 3TCFA 1POTA 1UTHA 2XX9A 2I0CA 3VXCA 4EXKA 2NVUB 4MLVA 4QF9A 1JVYA 1USYE 4XXUA 1R9LA 3PUWE 4DIGA 4EXLA 5IKBA 4F18A 1OMPA 5ISUA 3HO7A 1URSA 1ANFA 4GL8A 4WEDA 1LFGA 5CMCA 3E9XA 3H3GA 3K1MA 3TTKA 1N7WA 2ZNTA 3MAMA 3SKPA 1BIYA 1O63A 4OMBA 2REJA 4FORA 4NF8A 4OXVA 5I2KA 5L9SA 2AL5A 4G77A 2NXOA 1ELJA 1PDAA 2ABHA 2UVGA 1UIUA 4NEDA 4ZZEA 1B58A 1QUKA 2XXIA 3R6UA 2QPQA 4GWOA 1EZOA 1SQYA 1WVJA 5H8NB 4FIMA 1OVBA 2ALUA 3FD3A 3KZGA 4KD5A 2QS1A 3EPEA 3VVDA 5M2VA 1ZLQA 4MH5A 2OBGA 3RLFE 2ZYNA 4BDLA 3FJMA 2REGA 4GXSB 1Y1ZA 3P7IA 4OFJA 3HCQA 1JETA 2P0SA 5BUUA 3T96B 2DVCA 4DE8A 3MW0A 1NNPA 1B05A 1FTJA 3O28A 1B3FA 2DWIA 4KYSA 4PFTA 1ZMGA 3DELB 2DYXA 2OJTA 3ONMA 1B0HA 3I5OA 3KOSA 5K2YA 3ZKKA 3ZKLA 3K0VA 4E0WA 4I62A 4F1YA 5I56B 3ILTB 5KDTB 1EU8A 2PX1A 5I57B 5B7DA 1II5A 3PPNA 4X48A 4F3BA 5FTHA 2AYSA 1MXXA 4G68C 1P1OA 3TDJA 3PV0E 3TMGA 1D9YA 2QS3A 2ZYMA 1MXYA 2ONSA 2AIXA 1Y3QA 2HAVA 1PBQA 3N26A 4U23A 2V3TA 1MXVA 1SD3A 1B7ZA 2D3IA 4O3AA 2O6AA 4P11A 2V84A 3TTNA 4G4PA 4QSEA 4RJZA 3H6UA 1QUJA 3FGSA 3MBPA 1JW1A 2PVUA 4GIZA 1MS7A 3KGCA 1D9VA 1P1WA 1H76A 3FVGA 4R74A 5DVJA 2OZZA 4IGTA 2ZXTA 4U21A 3ECRA 3FASA 4F22A 3K4UA 4UA8A 5TPAB 4IO5A 2H9BA 1B4HA 2F34A 1PEBA 2V3UA 1P99A 3OOAA 4K3FA 4NTLA 3TPAA 3HN0A 4JWOA 4L17A 3TEPA 1FQDA 3S2VA 3ZSFA 1FQFA 4F3PA 4QHQA 1B4ZA 1IITA 2V25A 4RPNA 1S9TA 3MZ9A 2F5XA 3BFUA 1MPCA 1RYXA 1FCKA 2Q2AA 3HHGA 3MQ9A 4H5FA 1MY1A 4OFLA 4QFKA 4XTCQ 2QMWA 1B9JA 2X7PA 3OSQA 2DQVA 4XKPA 3MP1A 4OTEA 1LGBC 4I9DA 4OENA 3DP8A 4G68A 4HS7A 5I59B 3RN8A 3BFTA 3MP8A 4OWDA 3TQWA 5J1DA 4R9GA 1LLSA 2G29A 4XIGQ 2O1MA 1TXFA 2RC9A 4DXCA 1OQHA 3CI8A 3K00A 2YJPA 4KFQA 4U22A 2XXYA 2FA7A 5TP9A 3TCHA 4EQ7A 2NUVA 1FTLA 1UIVA 1RKMA 2O69A 5CRYA 3OO9A 3JYRA 1B46A 2B3FA 3FZVA 3HV1A 4G8MA 4PE5B 1GTKA 2BJJX 2VP1A 1CB6A 2DXRA 3A3UA 1IZ1A 4IY6A 3VLVA 1FTKA 4BLAA 1MH3A 5I58B 4N07A 4RPOA 1B6HA 4JSOA 1XS5A 3HPIA 4H65A 2DOJA 1N04A 1BP5A 5CMKA 3GBBA 2Z22A 3FXUA 3QIMA 2RCBA 3VE1B 3T93B 1F9BA 1N3XA 1P1UA 1VE4A 1YAEA 2DE2A 4OETA 4YZZA 3KG2A 3C31A 5DVFA 4G8NA 3RUMA 4RXLA 1LFIA 5KCJB 4YICA 3L6HA 4U4XA 1H43A 2I0BA 1MH4A 4DXBA 2YLNA 5I59A 2HZLA 3C35A 3OO6A 5HPQA 4M4GA 1OQGA 1MG1A 4QSDA 4YB5A 4JDFA 3N6UA 3RT6B 3QK6A 5HM4B 3IOVA 1D3KA 3WAEA 2DP8A 5TP9B 1IXHA 4H67A 4LZ8A 3V89B 4DDDA 3FVNA 2XXQA 1B1HA 3UN6A 1UQWA 3K6WA 3ILUB 2ZNSA 2IEEA 4IO6A 4KYDA 3TTLA 2KLFA 2XXTA 4EF2A 3PPQA 1SW5A 1WODA 3H6VA 1POY1 3MC2A 3G3FA 1B3LA 2ESNA 2VHAA 1SBPA 3FATA 1B1XA 3KJTA 2RC7A 4TOZA 4EQBA 5I58A 1DOTA 1ZJLA 3O6IA 4FE8A 1MDP1 4YU0A 2UVHA 3Q27A 3M3KA 3OSRA 2HQ0A 4YB7A 3W9VA 3C34A 4F3GA 4YAHX 3SEVA 4LUBA 4U1ZA 3DP6A 2I3VA 2X7QA 2V3QA 2ONKE 3MVYA 1M5EA 3PPOA 5EHSA 3PUZE 4OYVA 3OENA 3KJ7A 2VD3A 4LA9A 2DE4A 4OFOA 1SYIA 1VFEA 2DSFA 5EHMA 3O9PA 4AB6A 3G3HA 3Q26A 4FEBA 3SETA 5H8QA 3CSGA 4YB6A 5I2KB 1P1QA 3CG1A 2ZNUA 1A7LA 1B3EA 2Z8FA 1LB9A 3B6WA 3H06B 1LAHE 2XD3A 4OZ9A 1LCTA 2OLBA 4ONYA 4DXUA 4XKQA 1TT1A 3IOWA 1FW0A 1I69A 2IA4A 1MPDA 1LB8A 3EN3A 3KN7A 3LBSA 3MJNA 4HTGA 4XKRA 2E0SA 2VGQA 3OXNA 4P0IA 1N7XA 3GZGA 3CIJA 1NNKA 3USDA 5CM6A 3K1PA 2QJEA 2R71A 1CE2A 1P1NA 1DPPA 1NH7A 2GHBA 2HFBA 3Q25A 3TFLA 4LVQA 1Y3NA 4EUOA 2B65A 4G2ZA 1JQFA 1LAFE 2FYIA 4ZEKA 3RTFB 1DSNA 2QRYA 3U92A 1T0KA 3S4UA 4TLLB 2GH9A 1IXCA 1JEVA 3EQ1A 4PP0A 5H8FB 2WKYA 1PB8A 4ZEBA 3RT8A 4H0WA 5BWJA 4C1UA 4GVOA 5I57A 2I48A 5KDTA 3QUJA 1MQDA 4MBPA 4WKMA 3IJOB 4YMAA 1MQHA 1OVTA 1R1NA 3PU5A 1N84A 1B5HA 4ZE9A 3CG3A 4R2FA 3VVEA 4F31B 3KFMA 1M5BA 3PUXE 5H8QB 4WEPA 1I6QA 1H3DA 2I4BA 3N5LA 5AA1A 1XC1A 3TKDA 1DTGA 3M3LA 1B7HA 5HBCA 4X1BA 4F19A 5I2NA 3MZ1A 1Q1KA 3GBAA 4Z7EA 3GLBA 2GFEA 3K6VA 2V93A 2PYYA 2OWTA 3MVWA 3H6TA 4PFWA 2ZYOA 2W7YA 1MM7A 5TPAA 3RY3A 5AE4A 5LOMA 1XVXA 3IB1A 5AA4B 1URGA 3PMXA 3I3VA 3QYTA 3BKIB 2O7UA 4O3BA 3LSXA 1PC3A 3U72A 2GRVA 1URDA 3GXAA 3LSLA 2XXRA 2B3BA 3PD9A 4H5GA 4OERA 3CSBA 3UK4A 4NF4B 5JEIA 4BDOA 3B7DA 3A3CA 2D21A 1QVSA 3EHSA 3IB2A 2F78A 3C32A 3IO6A 4H8IA 2DS9A 1FQCA 3MP6A 5B70A 1LFHA 5FHNA 1ZIUA 4DCXA 3VDFA 4ISUA 2O51A 2O7IA 3EHUA 2P2AA 4KYEA 1AL3A 2RC8A 4R73A 4R6YA 4JBZA 3K6XA 3FXRA 4KCCA 1ATGA 1J1NA 2H99A 3AXFA 3OEKA 5DTBA 4ZE8A 2Q89A 3U94A 4GOTA 5I2NB 3C4MA 3FJ7A 1RYOA 2DWHA 1USYH 4NF6B 2PMSA 3FVOA 5DT6A 3LSWA 1EZPA 2A5SA 4M1VA 3SEXA 3U8QA 1AOVA 1MXWA 5L9OA 3SEYA 3K6UA 5CI5A 2VD2A 3FXQA 4ZS9A 3A09A 4N6PA 4H1XA 4ELPA 4RNSA 4ZECA 4X9TA 5AA4A 4RK9A 2F6GA 1A8EA 3H4ZA 2Y7RA 3UA8A 3CRBA 3O66A 2H4IA 3HHFA 4FAJA 1HSLA 4GLIA 1A8FA 4H8JA 4BDRA 3M3FA 4IGRA 3L6GA 4NF4A 4PQJA 4ESWA 4FECA 2DE3A 1R9QA 2H25A 3O6GA 2Y7PA 4LONB 4YKKA 3CVGA 4DLDA 1OLCA 1US5A 3U1OA 3FVKA 3IORA 5DVIA 4RA1A 3RNNA 3D4GA 5FHOA 1A40A 3TELA 5F7VA 1MPBA 4DCYA 4THIA 5AA2B 3QUFA 5JTYB 4F2QA 1DPEA 1ZKBA 4YMBA 5ICTA 2QS4A 3V83A 2O1LA 3E3KA 4AQ4A 1QW0A 1R6ZA 4ZEDA 4ZDMA 1IXIA 1OLAA 3IL1B 3MVXA 4F1UA 1A54A 2QSXA 4QFOA 1FQBA 1A55A 1VR5A 1PBPA 3PPRA 4NF6A 4ZEFA 3U93A 4XKNA 2I4CA 2VOZA 3TAJA 2A5TB 4I8CA 3IB0A 3FUZA 3PUYE 2I6EA 4FEDA 4POXA 2OWSA 4NF5B 5AA2D 1LBBA 1NNFA 1Y4CA 3TUSA 2HXWA 1Y4TA 4RK2A 1HSEA 3THIA 4R6KA 1TWYA 3CFZA 4Q8RA 2YPNA 1S50A 2DXYA 3KSJA 1AMFA 3B6TA 1UTBA 3KBRA 3SEWA 2I3WA 1GVCA 1MY0A 1N0TA 1PB9A 2OK2A 5CBSA 2F6PA 1Y20A 4N13A 3H7MA 1ZTYA 3SDFA 2I49A 1IQ7A 1Y9UA 5H8HB 4PFUA 3S9LC 1O64A 1M5CA 1IXGA 2CZLA 2F35A 4GXAA 5TU0A 1KWHA 5L9MA 4KCDA 3ODBA 3TTRA 1B52A 2PT1A 3B6QA 1VFDA 4IO2A 4O3CA 3T9UA 3BBRA 2XX7A 4F29A 1M5DA 1TFDA 1WDNA 3LR1A 4JSDA 5DEXB 5F1QA 1SW4A 4DZ1A 2QL3A 2THIA 3K2DA 3MUQA 4OEUA 1B5JA 2F97A 1JW4A 1Y3PA 3D4CA 4R6HA 2H98A 1B3HA 2Q2CA 3TZAA 1Z7ME 1PB7A 4AB5A 4NE4A 4JB7A 4P0GA 3TTMA 2UXAA 3IK6B 1GGGA 4YKIA 1NFTA 3LUYA 3MVZA 4MLQA 2RCAA 5FHMA 3R26A 4C0RA 2UYFA 2ZMBA 3O6HA 3T9XB 4NWDA 3VV5A 4BDNA 2XX8A 4ZZAA 5H8FA 1A99A 1QULA 3W9WA 3T9HB 3EHTA 3H03A 2R9JA 5I84A 2Y7WA 3Q28A 1I6AA 3RQTA 2F7BA 1MXUA 4ELRA 3PUVE 2NOOA 3O29A 2XD2A 3LC8A 3OELA 3OEMA 4HCYA 3VXBA 2Z8EA 3N6TA 4NF8B 5EYFA 4KI0E 1FQAA 2I58A 3K1NA 4LATA 4U4SA 3UIFA 4F39A 1LSTA 1DTZA 5ELVA 1US4A 2Z8DA 3OO7A 2DWJA 1AH5A 2PT2A 2XXHA 1MM6A 5FTIA 3TCGA 2HZKA 3UGWA 4ND9A 5H8NA 5DEXA 3IR1A 3ZS6A 1LCFA 4MF3A 2CMOA
chains in the Genus database with same CATH superfamily
3QMFA 1TFAA 4HCWA 1N76A 4ELQA 4BDQA 3KN3A 4PAIA 4PFRA 1MY3A 1FPLA 1SI1A 1LAXA 1BKAA 3S9MC 4TLMB 5JTYA 1SDXA 3CR9A 2UYEA 3Q29A 4N4UA 1NL5A 3G3JA 2O68A 1NV1A 1FTOA 1YTVA 4OVJA 3G3GA 5KZTA 1BLFA 4PGNA 4F1VA 1FBCA 5IZ3A 3O2AA 4PGPA 3KEIA 4OVSA 1H44A 2F36A 3FBPA 3FJGA 4PDDA 4RY1A 5EYGA 1MQIA 4E0XA 2Y7KA 3TQLA 1S7YA 5AA2A 4GRKA 3VLUA 2F8DA 1SW2A 3MPKA 3WAFA 3R7XA 4LQ5A 4PTKA 1DMBA 2XXPA 2DVZA 4R72A 4UABA 2HCAA 5I7IA 2F7CA 5A5XA 1UTBB 2ONRA 5KCJA 1YPNA 1DCUA 2P3NA 3SEUA 1SYHA 2Y84A 4IY5A 1YCJA 2ANJA 3IOTA 4NHBA 1AIVA 4OEVA 2GHAA 3HSTA 4YKJA 2RINA 4R9FA 1XT8A 3UP9A 3T9VA 5CMBA 3TCFA 1POTA 3IFAA 2I0CA 4MLVA 1R9LA 1OMPA 3MYUA 1LFGA 1PDAA 1UIUA 4ZZEA 4GWOA 5H8NB 4FIMA 3EPEA 2V4CA 1FBPA 4NN3A 2REGA 4NGUA 3P7IA 4OFJA 1JETA 2DVCA 1B05A 1FTJA 4KYSA 3DELB 2DYXA 3ZKKA 5K2YA 4I62A 1EU8A 3PPNA 4F3BA 3TDJA 2ZYMA 2HAVA 1SD3A 2D3IA 3TTMA 2O6AA 4QSEA 4AS4A 2FIEA 2FIXA 2Q8MA 3KGCA 3LUZA 2OZZA 2WEFA 4P9KA 2H9BA 3TEPA 4K3FA 3S2VA 4QHQA 1IITA 4RPNA 3MZ9A 3MQ9A 4QFKA 3HHGA 1RDZA 2QMWA 1LBWA 4I9DA 5I59B 4OWDA 1TXFA 4HE1A 2FA7A 4EQ7A 1RKMA 2O69A 3OO9A 1B46A 3HV1A 4G8MA 2VP1A 2XWIA 1FTKA 4N07A 1XS5A 1BP5A 3ROJA 3VE1B 1VE4A 1P1UA 5DVFA 4U4XA 1H43A 5I59A 3OO6A 1OQGA 1MG1A 4QSDA 4JDFA 3N6UA 5HM4B 3IOVA 3FVNA 3GYYA 2XXQA 1UQWA 4GWZA 4KYDA 4IR8A 4N15A 3MC2A 3G3FA 2ESNA 2VHAA 5I58A 1B1XA 4TOZA 2WX9A 2OX3A 4YU0A 3OSRA 2FVZA 3C34A 4JVIA 2PCRA 3DP6A 1M5EA 5EHMA 3O9PA 4AB6A 3G3HA 5H8QA 3CG1A 1B3EA 1RDXA 1IMDA 3LBSA 3KN7A 2VGQA 2ZZXA 3CIJA 3K1PA 5J16A 4LVQA 1Y3NA 2QRYA 1JEVA 4PP0A 5H8FB 5BWJA 4C1UA 5I57A 2I48A 3IJOB 1N84A 5IM2A 4ZE9A 3CG3A 4F31B 1M5BA 1I6QA 3HFUA 1B7HA 3GLBA 2GFEA 2V93A 2OWTA 4PFWA 5TPAA 2W7YA 1MM7A 5AA4B 3PMXA 3I3VA 2O7UA 4O3BA 2GRVA 4OERA 3LSLA 2XXRA 2R8TA 3A3CA 3EHSA 3IB2A 3IO6A 4H8IA 3MP6A 1YYZA 4R73A 3SDFA 3K6XA 3OEKA 1FJ6A 3FJ7A 4NF6B 2PMSA 2HHMA 4M1VA 3U8QA 1AOVA 4GWSA 5AA4A 4RNSA 3UA8A 5ESYA 3BIGA 4FAJA 1A8FA 4IGRA 3L6GA 3NOHA 4GBWA 3TELA 4DCYA 4THIA 4YMBA 1ZKBA 3MVXA 4F1UA 1K9YA 2F3BA 1FQBA 1A55A 1VR5A 1T0KA 2VOZA 5AA2D 1SPIA 1NNFA 3TUSA 1D9QA 4RK2A 4R6KA 1S50A 1UTBA 2I3WA 1CNQA 1ZTYA 1IQ7A 2Q74A 5L9MA 3B6QA 3BBRA 3LR1A 3MUQA 1B5JA 1JW4A 2H98A 4NE4A 4P0GA 3IK6B 2CZHA 1NFTA 3MVZA 1INPA 2ZMBA 3O6HA 4NWDA 1QULA 4ELRA 2XD2A 3OELA 1FQAA 3UIFA 4F39A 3KBZA 2HZKA 5DEXA 3WAEA 4KHZE 3MWBA 1XHYA 4HW8A 3I6VA 4I40A 1MQJA 3M8UA 2X26A 4EDPA 1N3WA 5IGAA 2XXVA 1B51A 1B3GA 4GWUA 4I1DA 1ZBMA 2Q9TA 1JEUA 4YKPA 4C1TA 4JWYA 1B7UA 5DYHA 1IEJA 1QGXA 3QXMA 5ET7A 4R2BA 3G3IA 3KN8A 3KOTA 1MY4A 2Q8JA 5FBPA 2XXKA 3IO4A 3MPLA 5CBSA 3RPWA 1SW1A 3VVFA 3TYHA 1IMCA 1O7TA 5F24A 2VPNA 4Z0IA 2Y5KA 2Z23A 2MKZA 1B5IA 4F3SA 4ELOA 4BDMA 5CBRA 1NUWA 1FPKA 2RF1A 3VLWA 4LQ2A 2ZYKA 1MQGA 3S9NC 4GX6A 3H6WA 4IB2A 4TQUQ 1FTMA 4NF5A 4OHNA 2HEUA 1UTHB 3C36A 4G8HA 3ISPA 2H5YA 4LP2B 3FIRA 4F2OA 4GD5A 3D1RA 1NNTA 1LAGE 1JVXA 3VFJA 5ITOA 1JNFA 3QSLA 3RTWB 3S9EA 4MFIA 4OQOA 2E1SA 5CC2A 3T66A 3SERA 4MNPA 1QKAA 3EF7A 3E13X 3IOUA 2HAUA 3JZJA 3SESA 3IJXB 4RYAA 4GFRA 3QAXA 1KZ8A 3VXCA 1JVYA 1USYE 4XEQA 4F18A 1URSA 1ANFA 5CMCA 3H3GA 2ZNTA 4MAGA 4FORA 2AL5A 4G77A 4NEDA 4DI4B 1QUKA 2QPQA 1WVJA 1NI9A 4KD5A 2QS1A 2OBGA 1FSAA 1LEVA 1FPDA 4DE8A 2DWIA 4GWXA 4QBAA 3ONMA 4F1YA 5KDTB 5I57B 3KC0A 1MXXA 2QS3A 3N26A 5JTYB 4U23A 3TTNA 1QUJA 1JW1A 2PVUA 1H76A 5I5PA 4IGTA 3ECRA 3FASA 5TPAB 1EYIA 1B4HA 2F34A 2V3UA 3OOAA 3TPAA 4JWOA 4L17A 4KXPA 3ZSFA 1FQFA 1B4ZA 2V25A 4N6DA 3BFUA 1FCKA 2DQVA 4XKPA 4OTEA 1LGBC 4G68A 4HS7A 3MP8A 4R9GA 1LLSA 4XIGQ 2O1MA 2RC9A 3CI8A 3K00A 2XXYA 2B3FA 1CB6A 4IY6A 1LBXA 4BLAA 1FPEA 1B6HA 4H65A 2DOJA 1N04A 3FXUA 1N3XA 2DE2A 3C31A 4G8NA 5KCJB 2I0BA 2HZLA 4M4GA 4YB5A 4PBHA 4LZ8A 4X8RA 1B1HA 3UN6A 3ILUB 3TTLA 1G0HA 4EF2A 1SW5A 4XFEA 1ZJLA 4FE8A 3Q27A 2HQ0A 4LUBA 2VT5A 2I3VA 2V3QA 2ONKE 5EHSA 1SYIA 1VFEA 3SETA 4PAFA 5I2KB 1LB9A 3E78A 1LAHE 4OZ9A 2OLBA 1TT1A 3IOWA 1I69A 2IA4A 4NAPA 3OXNA 1N7XA 4GWWA 1NNKA 3USDA 5CM6A 2R71A 1DPPA 2B65A 1LAFE 2FYIA 2P3VA 3RTFB 1DSNA 3U92A 4TLLB 2PFYA 4H0WA 4P1LA 4GVOA 3QUJA 4WKMA 3PU5A 1FBEA 1FJ9A 3VVEA 4WEPA 2I4BA 4X1BA 5I2NA 1RDYA 1Q1KA 3GBAA 2ZYOA 5LOMA 4P47A 1URGA 2QVRA 4MMPA 1YXIA 3LSXA 1PC3A 3U72A 1URDA 2D21A 1QVSA 1K9ZA 2DS9A 1ZIUA 2F3DA 4ISUA 2O7IA 4HE0A 1AL3A 2RC8A 4OVTA 4JBZA 2H99A 1NV6A 3U94A 4GOTA 2WBDA 3FVOA 1EZPA 3K6UA 3FXQA 4N6PA 4ELPA 2F6GA 4OVRA 1IMBA 4GLIA 3M3FA 4O7IA 4DLDA 1OLCA 1US5A 3RNNA 3D4GA 1A40A 1DPEA 3V83A 2QS4A 1QW0A 4ZEDA 4ZDMA 1IXIA 1A54A 4JVDA 1FBGA 5DW8A 3V8XB 4I8CA 3PUYE 2I6EA 4FEDA 4NF5B 3RYDA 4Q8RA 3KSJA 1AMFA 3T1BA 4N81A 1GVCA 1PB9A 2OK2A 4N13A 4O94A 5H8HB 4PFUA 1O64A 2F35A 5TU0A 4KCDA 3ODBA 1B52A 2PT1A 4IO2A 3T9UA 2XX7A 1TFDA 3K2DA 2Q2CA 3TZAA 1Z7ME 3RPLB 1GGGA 3LUYA 5FHMA 2KR0A 2XX8A 5H8FA 2OWZA 3T9HB 3H03A 2R9JA 1I6AA 1MXUA 3PUVE 2NOOA 1DK4A 3OEMA 4U4SA 4LATA 1LSTA 5ELVA 1US4A 2Z8DA 1AH5A 2PT2A 5FTIA 1LCFA 4MF3A 5IZ3B 4U1OA 4NQ8A 4OESA 2FNCA 1QJMA 1LBCA 1NMUA 4LZ5A 2F7AA 3IAZA 3N94A 5CMMA 3K01A 4QRZA 5JK4A 3LSFB 2Q88A 1LBZA 1XI6A 3O97A 1BTJA 4ESXA 3DLNA 1EH3A 1IUDA 3CFXA 4X1DA 1EZ9A 1JW5A 3BIHA 3C33A 3OD7A 2PBWA 4QFNA 4UACA 4GWYA 4H46A 5A5XB 5ITPA 3F11A 3G7WA 4GF8A 3W15C 1Q35A 3PGFA 1B2HA 4G68B 2R6GE 4KQPA 4KR5A 1FBFA 3C9HA 5IZZA 3OO8A 1H45A 1MXZA 4GX3A 3T22A 2L5VA 4QFPA 5L8DA 4P56A 1GV8A 4GX4A 5B7DA 3CFLA 1VDWA 3FV1A 1FPJA 5EQ9A 5ISUA 5DT6A 4AS5A 1FQEA 1B32A 2UVIA 1NV5A 4JWXA 2QMXA 3KSXA 1MDQA 4NMYA 1ZU0A 3KC1A 2D5WA 2M8CA 5ET8A 3K02A 4POWA 3JV9A 4N6KA 4PFIA 3TODA 3PMVA 2DWAA 4H6DA 3B8BA 1NH8A 1DBZA 1GR2A 1M5FA 1SI0A 4NWCA 2LAOA 2WBBA 4EXKA 2NVUB 5LTCA 2FBPA 3PUWE 4EXLA 4GL8A 3TTKA 3MAMA 4JVCA 4OMBA 1O63A 4OXVA 5I2KA 5L9SA 2QVVA 3EKIA 2XXIA 1SQYA 2ALUA 1ZLQA 4MH5A 4BDLA 1Y1ZA 3HCQA 3CHGA 3T96B 1NNPA 3O28A 1B3FA 1ZMGA 1EYJA 2OJTA 4E0WA 1B0HA 3I5OA 4QXDA 3ZKLA 3K0VA 3ILTB 2PX1A 1II5A 2AYSA 3PV0E 2HXRA 1D9YA 2ONSA 1Y3QA 2AIXA 4OANA 1MXVA 1B7ZA 4P11A 4G4PA 1NV3A 4RJZA 4H45A 3FGSA 3MBPA 5DVJA 1P1WA 2ZXTA 4U21A 4F22A 3K4UA 4UA8A 4NTLA 3SEXA 1PEBA 1P99A 3HN0A 1FQDA 4P3LA 1S9TA 4H5FA 4DCXA 1RYXA 4PFBA 1MY1A 3OSQA 3MP1A 4OENA 3BFTA 5J1DA 4N91A 3TCHA 5TP9A 1FTLA 1UIVA 2DDKA 3JYRA 3FZVA 2BJJX 2DXRA 5IZ1A 4PDHA 5I58B 4JSOA 1FTAA 5CMKA 3GBBA 2Z22A 2RCBA 3T93B 4LN5A 4P8BA 4YICA 1MH4A 4DXBA 2CZIA 3C35A 4NG7A 3RT6B 3QK6A 1D3KA 5TP9B 1IXHA 3V89B 4DDDA 4IO6A 2ZNSA 2IEEA 2XXTA 2CZKA 3H6VA 1SBPA 3FATA 3KJTA 2XWOA 1DOTA 1MDP1 3T0JA 2UVHA 2X7QA 3MVYA 3PPOA 3PUZE 3OENA 3KJ7A 4OFOA 2DSFA 4FEBA 4YB6A 1P1QA 2Z8FA 1YZ0A 4DXUA 4XKQA 1FW0A 3EN3A 3MJNA 2E0SA 4P0IA 1FPBA 3GZGA 2GQ1A 2QJEA 3RPLA 3Q25A 4G2ZA 1JQFA 4ZEKA 3S4UA 1IXCA 4ZEBA 2WKYA 1PB8A 5KDTA 4MBPA 1R1NA 1OVTA 3PUXE 5H8QB 5I3SA 2PFZA 1H3DA 3N5LA 3SZPA 5AA1A 3TKDA 2KQZA 4O8MA 4F19A 3MZ1A 4Z7EA 3H6TA 3RY3A 1NV4A 3QYTA 1AWBA 3GXAA 3PD9A 2B3BA 4NF4B 1NV0A 3C32A 4N17A 3VDFA 2B4LA 3EHUA 2P2AA 4KYEA 4R6YA 3FXRA 1ATGA 3AXFA 3C4MA 2A5SA 4PAKA 3SEYA 2VD2A 4X9TA 4RK9A 3H4ZA 1A8EA 3CRBA 3O66A 4H8JA 4BDRA 4PQJA 4NF4A 2DE3A 1R9QA 3O6GA 4LONB 2Y7PA 4YKKA 4XF5A 3CVGA 3U1OA 3FVKA 2WYPA 1MPBA 4N8YA 5AA2B 4F2QA 5ICTA 2O1LA 3E3KA 1R6ZA 4GBVA 2ZZWA 1OLAA 3IL1B 4ZEFA 3PPRA 1PBPA 4NF6A 4XKNA 3FUZA 4POXA 1Y4CA 3THIA 1TWYA 2BJIA 2YPNA 3SEWA 1MY0A 2F6PA 1Y20A 1Y9UA 2CZLA 4GXAA 1KWHA 1VFDA 4O3CA 1M5DA 1WDNA 4JSDA 5DEXB 4DZ1A 1SW4A 2QL3A 1PB7A 2UXAA 2RCAA 3R26A 4C0RA 4BDNA 1A99A 3RQTA 2Z8EA 4MEVA 5EYFA 3K1NA 2I58A 3TCGA 1MM6A 3U65A 3UGWA 4ND9A 5H8NA 3IR1A 4I3YA 5EQAA 2CMOA 3MSTA 2AL4A 4IO4A 1HSJA 1NUZA 4PE3A 3PD8A 1NKXA 3E4RA 1VSOA 4GL0A 1MY2A 3G3KA 4QFLA 2JJKA 4G61A 5ET6A 4EF1A 3MZBA 1D4NA 1OIBA 4QSCA 3DP4A 1B0LA 2G93A 1G0IA 4FJPA 5H8SA 4IO7A 3UORA 3PPPA 3IX1A 2XXUA 4PBQA 4R75A 1Y1MA 5K2XA 3V5AA 1B40A 2Y7IA 2UVJA 4O7MA 1MRPA 5I56A 1I6BA 1SVXB 4ECFA 2XXXA 4Q0CA 3PMWA 4EQ9A 4OVPA 1QUIA 2RKMA 4IO3A 1IIWA 2A5TA 2XHDA 2P1SA 4PETA 2O84X 1XOCA 4KPTA 4GQOA 4LZ7A 4P1EA 1QKBA 1XVYA 3RGYA 4Q5TA 5IAIA 1Z7NE 2OCUA 3FV2A 4U2RA 5H8HA 2XXWA 2XWVA 4Q30B 5ICQA 3DM0A 4DI3D 1L5TA 4JXIA 2QS2A 3A29A 4ZEIA 4FATA 3OMBA 4PFYA 4WXJA 2CEXA 2NWJA 4AB5A 1UTHA 2XX9A 1NUYA 4QF9A 4I3EA 4XXUA 4DIGA 5IKBA 2XWKA 3HO7A 4HXVA 4WEDA 3E9XA 3K1MA 1N7WA 3SKPA 1BIYA 2REJA 4NF8A 2NXOA 1ELJA 2ABHA 3PTYA 1NUXA 2UVGA 1B58A 4MHFA 3R6UA 1EZOA 1OVBA 3KZGA 3FD3A 1FPIA 3VVDA 5M2VA 1FPGA 3RLFE 2ZYNA 3FJMA 4GXSB 2P0SA 5BUUA 3MW0A 2Y5LA 1KA0A 4PFTA 1LBVA 3KOSA 4MNIA 4X48A 5FTHA 4G68C 1P1OA 3TMGA 1MXYA 1PBQA 2V3TA 4O3AA 2V84A 5EQ8A 3H6UA 5A5LA 4GIZA 1MS7A 1D9VA 3FVGA 4R74A 4IO5A 4F3PA 4H67A 2F5XA 1MPCA 2Q2AA 2WYKA 4OFLA 4XTCQ 1B9JA 2X7PA 4MNCA 3DP8A 1IMFA 3RN8A 3TQWA 2G29A 4DXCA 1OQHA 2YJPA 4KFQA 4U22A 2NUVA 4MX6A 5CRYA 1BK4A 4PE5B 1GTKA 2XA5A 3A3UA 1IZ1A 1NV7A 3VLVA 1MH3A 4RPOA 2CEYA 3HPIA 3LV0A 1IMAA 1NV2A 3QIMA 5T3JA 1F9BA 1YAEA 4OETA 3KG2A 3RUMA 4RXLA 1LFIA 3L6HA 1FPFA 2YLNA 5HPQA 4HE2A 2DP8A 2HPGA 3K6WA 2KLFA 3PPQA 1WODA 1POY1 1B3LA 4EQBA 2RC7A 3O6IA 3M3KA 4YB7A 3W9VA 4F3GA 4YAHX 3SEVA 4U1ZA 1FRPA 4OYVA 2VD3A 4LA9A 2DE4A 3Q26A 3CSGA 2ZNUA 1A7LA 3B6WA 3H06B 5ET5A 2XD3A 1LCTA 4ONYA 1KA1A 4HTGA 1MPDA 1LB8A 4XKRA 4PF6A 1CE2A 1P1NA 1NH7A 2GHBA 2HFBA 3IFCA 3TFLA 4EUOA 1Q9DA 2GH9A 3EQ1A 1EYKA 3RT8A 1MQDA 4YMAA 1MQHA 1LBYA 1B5HA 4R2FA 3KFMA 1XC1A 1DTGA 3M3LA 5HBCA 2FHYA 3K6VA 2PYYA 3MVWA 4MJOA 5AE4A 4NX1A 1XVXA 3IB1A 4PCDA 3BKIB 3UK4A 4H5GA 3CSBA 4BDOA 3B7DA 4OVQA 3E79A 2F78A 5EQ7A 1FQCA 5B70A 1LFHA 4PC9A 5FHNA 2O51A 2QVUA 4YZZA 5DTBA 4KCCA 2B4MA 1J1NA 4ZE8A 2Q89A 5I2NB 1FBDA 1RYOA 2DWHA 2VPOA 1USYH 3LSWA 1MXWA 5L9OA 5CI5A 5AA3A 4ZS9A 3A09A 4H1XA 4ZECA 2Y7RA 2H4IA 3HHFA 1HSLA 3B50A 4OA4A 4ESWA 4FECA 2H25A 3IORA 5DVIA 4RA1A 4PF8A 5FHOA 5I56B 5JEIA 5F7VA 3QUFA 2QFLA 4AQ4A 1IMEA 2QSXA 4QFOA 3FXBA 3U93A 3TAJA 2I4CA 2A5TB 3IB0A 2OWSA 1JP4A 4NF0A 1LBBA 4MCOA 2HXWA 1Y4TA 1HSEA 3CFZA 2DXYA 3B6TA 3KBRA 1N0TA 3H7MA 2I49A 4MIJA 3S9LC 1M5CA 1IXGA 3TTRA 4F29A 5F1QA 1FBHA 2THIA 4OEUA 2ZZVA 2F97A 4FBPA 1Y3PA 3D4CA 4R6HA 1B3HA 4JB7A 4YKIA 4MLQA 2UYFA 3T9XB 3VV5A 4ZZAA 3W9WA 5LDZA 3EHTA 5I84A 2Y7WA 3Q28A 2F7BA 3O29A 3LC8A 4HCYA 3VXBA 4X04A 3N6TA 4NF8B 4KI0E 1DTZA 3OO7A 2DWJA 2XXHA 4N8GA 3ZS6A 5EYHA
chains in the Genus database with same CATH topology
2AL4A 4KHZE 3MWBA 1XHYA 4IO4A 1HSJA 1TFAA 3I6VA 4HCWA 1N76A 4OESA 4HW8A 2FNCA 1QJMA 1LBCA 1MQJA 1NMUA 3M8UA 3PD8A 2X26A 4EDPA 1N3WA 4ELQA 2XXVA 1B51A 1B3GA 3KN3A 4BDQA 4I1DA 1NKXA 1ZBMA 1JEUA 2Q9TA 4YKPA 3E4RA 1VSOA 2F7AA 3IAZA 3N94A 4GL0A 1MY3A 4LZ5A 5CMMA 3K01A 1MY2A 4QRZA 4C1TA 3G3KA 5AA3A 4JWYA 5JK4A 1SI1A 1LAXA 3LSFB 1B7UA 1BKAA 5DYHA 1IEJA 4QFLA 2Q88A 3QXMA 4R2BA 3G3IA 3KN8A 3S9MC 4TLMB 3V8XB 3KOTA 1SDXA 3CR9A 1MY4A 5JTYA 2Q8JA 2UYEA 3Q29A 1NL5A 3O97A 1BTJA 3G3JA 2O68A 4EF1A 4ESXA 3DLNA 3MZBA 1D4NA 1OIBA 3IO4A 1EH3A 1IUDA 1FTOA 3CFXA 1YTVA 3DP4A 1B0LA 3MPLA 2G93A 1EZ9A 3G3GA 4OVJA 4QSCA 4X1DA 1JW5A 1BLFA 4F1VA 5KZTA 3C33A 3OD7A 2PBWA 4FJPA 3RPWA 4QFNA 3O2AA 1SW1A 4UACA 5H8SA 3VVFA 3TYHA 5A5XB 3KEIA 4IO7A 3UORA 3PPPA 1O7TA 3IX1A 1H44A 5ITPA 3F11A 2F36A 3FJGA 3G7WA 4GF8A 2XXUA 4RY1A 3W15C 1Q35A 3PGFA 4R75A 4Z0IA 1MQIA 2Z23A 4E0XA 1Y1MA 5K2XA 3V5AA 1B40A 2Y7KA 1B2HA 4G68B 1B5IA 2Y7IA 2UVJA 4ELOA 4BDMA 2R6GE 4F3SA 5CBRA 4KQPA 1MRPA 3TQLA 5I56A 1S7YA 1I6BA 2RF1A 1SVXB 4KR5A 3C9HA 4ECFA 3OO8A 4GRKA 5AA2A 1H45A 2XXXA 4Q0CA 3PMWA 1MXZA 3VLUA 4EQ9A 3VLWA 2F8DA 4LQ2A 3T22A 4QFPA 5L8DA 1SW2A 1QUIA 2ZYKA 3MPKA 2RKMA 1MQGA 3WAFA 3S9NC 3R7XA 4LQ5A 1GV8A 4IO3A 1IIWA 1DMBA 2XXPA 3CFLA 2A5TA 2XHDA 1FTMA 2P1SA 3FV1A 3H6WA 4IB2A 4PETA 4TQUQ 4NF5A 4OHNA 2HEUA 1UTHB 2O84X 3C36A 1XOCA 2DVZA 4G8HA 2HCAA 1FQEA 1B32A 2F7CA 4KPTA 4R72A 4GQOA 5A5XA 2UVIA 4LZ7A 2H5YA 4LP2B 3FIRA 1QKBA 1UTBB 1XVYA 2ONRA 4GD5A 3RGYA 4JWXA 4F2OA 2QMXA 4Q5TA 1NNTA 5IAIA 5KCJA 1Z7NE 1LAGE 2OCUA 3FV2A 1MDQA 3KSXA 4NMYA 1ZU0A 1YPNA 1JVXA 4U2RA 2D5WA 5H8HA 2XXWA 3VFJA 5ITOA 3SEUA 1JNFA 2M8CA 4U1OA 3K02A 3QSLA 4POWA 1SYHA 4MFIA 3JV9A 4Q30B 3RTWB 5ICQA 3S9EA 4OQOA 2E1SA 3DM0A 3TODA 3PMVA 2Y84A 5CC2A 2DWAA 1L5TA 3T66A 4H6DA 4JXIA 2QS2A 4IY5A 3SERA 1YCJA 1QKAA 3EF7A 2ANJA 3IOTA 1NH8A 1AIVA 3E13X 3IOUA 4OEVA 4ZEIA 4FATA 2HAUA 3JZJA 3OMBA 3SESA 2GHAA 3IJXB 3HSTA 4YKJA 4PFYA 4WXJA 2RINA 4R9FA 1GR2A 1M5FA 1XT8A 1SI0A 4GFRA 2LAOA 4NWCA 4RYAA 2NWJA 3QAXA 5CMBA 3T9VA 3UP9A 3TCFA 1POTA 1UTHA 2XX9A 2I0CA 3VXCA 4EXKA 2NVUB 4MLVA 4QF9A 1JVYA 1USYE 4XXUA 1R9LA 3PUWE 4DIGA 4EXLA 5IKBA 4F18A 1OMPA 5ISUA 3HO7A 1URSA 1ANFA 4GL8A 4WEDA 1LFGA 5CMCA 3E9XA 3H3GA 3K1MA 3TTKA 1N7WA 2ZNTA 3MAMA 3SKPA 1BIYA 1O63A 4OMBA 2REJA 4FORA 4NF8A 4OXVA 5I2KA 5L9SA 2AL5A 4G77A 2NXOA 1ELJA 1PDAA 2ABHA 2UVGA 1UIUA 4NEDA 4ZZEA 1B58A 1QUKA 2XXIA 3R6UA 2QPQA 4GWOA 1EZOA 1SQYA 1WVJA 5H8NB 4FIMA 1OVBA 2ALUA 3FD3A 3KZGA 4KD5A 2QS1A 3EPEA 3VVDA 5M2VA 1ZLQA 4MH5A 2OBGA 3RLFE 2ZYNA 4BDLA 3FJMA 2REGA 4GXSB 1Y1ZA 3P7IA 4OFJA 3HCQA 1JETA 2P0SA 5BUUA 3T96B 2DVCA 4DE8A 3MW0A 1NNPA 1B05A 1FTJA 3O28A 1B3FA 2DWIA 4KYSA 4PFTA 1ZMGA 3DELB 2DYXA 2OJTA 3ONMA 1B0HA 3I5OA 3KOSA 5K2YA 3ZKKA 3ZKLA 3K0VA 4E0WA 4I62A 4F1YA 5I56B 3ILTB 5KDTB 1EU8A 2PX1A 5I57B 5B7DA 1II5A 3PPNA 4X48A 4F3BA 5FTHA 2AYSA 1MXXA 4G68C 1P1OA 3TDJA 3PV0E 3TMGA 1D9YA 2QS3A 2ZYMA 1MXYA 2ONSA 2AIXA 1Y3QA 2HAVA 1PBQA 3N26A 4U23A 2V3TA 1MXVA 1SD3A 1B7ZA 2D3IA 4O3AA 2O6AA 4P11A 2V84A 3TTNA 4G4PA 4QSEA 4RJZA 3H6UA 1QUJA 3FGSA 3MBPA 1JW1A 2PVUA 4GIZA 1MS7A 3KGCA 1D9VA 1P1WA 1H76A 3FVGA 4R74A 5DVJA 2OZZA 4IGTA 2ZXTA 4U21A 3ECRA 3FASA 4F22A 3K4UA 4UA8A 5TPAB 4IO5A 2H9BA 1B4HA 2F34A 1PEBA 2V3UA 1P99A 3OOAA 4K3FA 4NTLA 3TPAA 3HN0A 4JWOA 4L17A 3TEPA 1FQDA 3S2VA 3ZSFA 1FQFA 4F3PA 4QHQA 1B4ZA 1IITA 2V25A 4RPNA 1S9TA 3MZ9A 2F5XA 3BFUA 1MPCA 1RYXA 1FCKA 2Q2AA 3HHGA 3MQ9A 4H5FA 1MY1A 4OFLA 4QFKA 4XTCQ 2QMWA 1B9JA 2X7PA 3OSQA 2DQVA 4XKPA 3MP1A 4OTEA 1LGBC 4I9DA 4OENA 3DP8A 4G68A 4HS7A 5I59B 3RN8A 3BFTA 3MP8A 4OWDA 3TQWA 5J1DA 4R9GA 1LLSA 2G29A 4XIGQ 2O1MA 1TXFA 2RC9A 4DXCA 1OQHA 3CI8A 3K00A 2YJPA 4KFQA 4U22A 2XXYA 2FA7A 5TP9A 3TCHA 4EQ7A 2NUVA 1FTLA 1UIVA 1RKMA 2O69A 5CRYA 3OO9A 3JYRA 1B46A 2B3FA 3FZVA 3HV1A 4G8MA 4PE5B 1GTKA 2BJJX 2VP1A 1CB6A 2DXRA 3A3UA 1IZ1A 4IY6A 3VLVA 1FTKA 4BLAA 1MH3A 5I58B 4N07A 4RPOA 1B6HA 4JSOA 1XS5A 3HPIA 4H65A 2DOJA 1N04A 1BP5A 5CMKA 3GBBA 2Z22A 3FXUA 3QIMA 2RCBA 3VE1B 3T93B 1F9BA 1N3XA 1P1UA 1VE4A 1YAEA 2DE2A 4OETA 4YZZA 3KG2A 3C31A 5DVFA 4G8NA 3RUMA 4RXLA 1LFIA 5KCJB 4YICA 3L6HA 4U4XA 1H43A 2I0BA 1MH4A 4DXBA 2YLNA 5I59A 2HZLA 3C35A 3OO6A 5HPQA 4M4GA 1OQGA 1MG1A 4QSDA 4YB5A 4JDFA 3N6UA 3RT6B 3QK6A 5HM4B 3IOVA 1D3KA 3WAEA 2DP8A 5TP9B 1IXHA 4H67A 4LZ8A 3V89B 4DDDA 3FVNA 2XXQA 1B1HA 3UN6A 1UQWA 3K6WA 3ILUB 2ZNSA 2IEEA 4IO6A 4KYDA 3TTLA 2KLFA 2XXTA 4EF2A 3PPQA 1SW5A 1WODA 3H6VA 1POY1 3MC2A 3G3FA 1B3LA 2ESNA 2VHAA 1SBPA 3FATA 1B1XA 3KJTA 2RC7A 4TOZA 4EQBA 5I58A 1DOTA 1ZJLA 3O6IA 4FE8A 1MDP1 4YU0A 2UVHA 3Q27A 3M3KA 3OSRA 2HQ0A 4YB7A 3W9VA 3C34A 4F3GA 4YAHX 3SEVA 4LUBA 4U1ZA 3DP6A 2I3VA 2X7QA 2V3QA 2ONKE 3MVYA 1M5EA 3PPOA 5EHSA 3PUZE 4OYVA 3OENA 3KJ7A 2VD3A 4LA9A 2DE4A 4OFOA 1SYIA 1VFEA 2DSFA 5EHMA 3O9PA 4AB6A 3G3HA 3Q26A 4FEBA 3SETA 5H8QA 3CSGA 4YB6A 5I2KB 1P1QA 3CG1A 2ZNUA 1A7LA 1B3EA 2Z8FA 1LB9A 3B6WA 3H06B 1LAHE 2XD3A 4OZ9A 1LCTA 2OLBA 4ONYA 4DXUA 4XKQA 1TT1A 3IOWA 1FW0A 1I69A 2IA4A 1MPDA 1LB8A 3EN3A 3KN7A 3LBSA 3MJNA 4HTGA 4XKRA 2E0SA 2VGQA 3OXNA 4P0IA 1N7XA 3GZGA 3CIJA 1NNKA 3USDA 5CM6A 3K1PA 2QJEA 2R71A 1CE2A 1P1NA 1DPPA 1NH7A 2GHBA 2HFBA 3Q25A 3TFLA 4LVQA 1Y3NA 4EUOA 2B65A 4G2ZA 1JQFA 1LAFE 2FYIA 4ZEKA 3RTFB 1DSNA 2QRYA 3U92A 1T0KA 3S4UA 4TLLB 2GH9A 1IXCA 1JEVA 3EQ1A 4PP0A 5H8FB 2WKYA 1PB8A 4ZEBA 3RT8A 4H0WA 5BWJA 4C1UA 4GVOA 5I57A 2I48A 5KDTA 3QUJA 1MQDA 4MBPA 4WKMA 3IJOB 4YMAA 1MQHA 1OVTA 1R1NA 3PU5A 1N84A 1B5HA 4ZE9A 3CG3A 4R2FA 3VVEA 4F31B 3KFMA 1M5BA 3PUXE 5H8QB 4WEPA 1I6QA 1H3DA 2I4BA 3N5LA 5AA1A 1XC1A 3TKDA 1DTGA 3M3LA 1B7HA 5HBCA 4X1BA 4F19A 5I2NA 3MZ1A 1Q1KA 3GBAA 4Z7EA 3GLBA 2GFEA 3K6VA 2V93A 2PYYA 2OWTA 3MVWA 3H6TA 4PFWA 2ZYOA 2W7YA 1MM7A 5TPAA 3RY3A 5AE4A 5LOMA 1XVXA 3IB1A 5AA4B 1URGA 3PMXA 3I3VA 3QYTA 3BKIB 2O7UA 4O3BA 3LSXA 1PC3A 3U72A 2GRVA 1URDA 3GXAA 3LSLA 2XXRA 2B3BA 3PD9A 4H5GA 4OERA 3CSBA 3UK4A 4NF4B 5JEIA 4BDOA 3B7DA 3A3CA 2D21A 1QVSA 3EHSA 3IB2A 2F78A 3C32A 3IO6A 4H8IA 2DS9A 1FQCA 3MP6A 5B70A 1LFHA 5FHNA 1ZIUA 4DCXA 3VDFA 4ISUA 2O51A 2O7IA 3EHUA 2P2AA 4KYEA 1AL3A 2RC8A 4R73A 4R6YA 4JBZA 3K6XA 3FXRA 4KCCA 1ATGA 1J1NA 2H99A 3AXFA 3OEKA 5DTBA 4ZE8A 2Q89A 3U94A 4GOTA 5I2NB 3C4MA 3FJ7A 1RYOA 2DWHA 1USYH 4NF6B 2PMSA 3FVOA 5DT6A 3LSWA 1EZPA 2A5SA 4M1VA 3SEXA 3U8QA 1AOVA 1MXWA 5L9OA 3SEYA 3K6UA 5CI5A 2VD2A 3FXQA 4ZS9A 3A09A 4N6PA 4H1XA 4ELPA 4RNSA 4ZECA 4X9TA 5AA4A 4RK9A 2F6GA 1A8EA 3H4ZA 2Y7RA 3UA8A 3CRBA 3O66A 2H4IA 3HHFA 4FAJA 1HSLA 4GLIA 1A8FA 4H8JA 4BDRA 3M3FA 4IGRA 3L6GA 4NF4A 4PQJA 4ESWA 4FECA 2DE3A 1R9QA 2H25A 3O6GA 2Y7PA 4LONB 4YKKA 3CVGA 4DLDA 1OLCA 1US5A 3U1OA 3FVKA 3IORA 5DVIA 4RA1A 3RNNA 3D4GA 5FHOA 1A40A 3TELA 5F7VA 1MPBA 4DCYA 4THIA 5AA2B 3QUFA 5JTYB 4F2QA 1DPEA 1ZKBA 4YMBA 5ICTA 2QS4A 3V83A 2O1LA 3E3KA 4AQ4A 1QW0A 1R6ZA 4ZEDA 4ZDMA 1IXIA 1OLAA 3IL1B 3MVXA 4F1UA 1A54A 2QSXA 4QFOA 1FQBA 1A55A 1VR5A 1PBPA 3PPRA 4NF6A 4ZEFA 3U93A 4XKNA 2I4CA 2VOZA 3TAJA 2A5TB 4I8CA 3IB0A 3FUZA 3PUYE 2I6EA 4FEDA 4POXA 2OWSA 4NF5B 5AA2D 1LBBA 1NNFA 1Y4CA 3TUSA 2HXWA 1Y4TA 4RK2A 1HSEA 3THIA 4R6KA 1TWYA 3CFZA 4Q8RA 2YPNA 1S50A 2DXYA 3KSJA 1AMFA 3B6TA 1UTBA 3KBRA 3SEWA 2I3WA 1GVCA 1MY0A 1N0TA 1PB9A 2OK2A 5CBSA 2F6PA 1Y20A 4N13A 3H7MA 1ZTYA 3SDFA 2I49A 1IQ7A 1Y9UA 5H8HB 4PFUA 3S9LC 1O64A 1M5CA 1IXGA 2CZLA 2F35A 4GXAA 5TU0A 1KWHA 5L9MA 4KCDA 3ODBA 3TTRA 1B52A 2PT1A 3B6QA 1VFDA 4IO2A 4O3CA 3T9UA 3BBRA 2XX7A 4F29A 1M5DA 1TFDA 1WDNA 3LR1A 4JSDA 5DEXB 5F1QA 1SW4A 4DZ1A 2QL3A 2THIA 3K2DA 3MUQA 4OEUA 1B5JA 2F97A 1JW4A 1Y3PA 3D4CA 4R6HA 2H98A 1B3HA 2Q2CA 3TZAA 1Z7ME 1PB7A 4AB5A 4NE4A 4JB7A 4P0GA 3TTMA 2UXAA 3IK6B 1GGGA 4YKIA 1NFTA 3LUYA 3MVZA 4MLQA 2RCAA 5FHMA 3R26A 4C0RA 2UYFA 2ZMBA 3O6HA 3T9XB 4NWDA 3VV5A 4BDNA 2XX8A 4ZZAA 5H8FA 1A99A 1QULA 3W9WA 3T9HB 3EHTA 3H03A 2R9JA 5I84A 2Y7WA 3Q28A 1I6AA 3RQTA 2F7BA 1MXUA 4ELRA 3PUVE 2NOOA 3O29A 2XD2A 3LC8A 3OELA 3OEMA 4HCYA 3VXBA 2Z8EA 3N6TA 4NF8B 5EYFA 4KI0E 1FQAA 2I58A 3K1NA 4LATA 4U4SA 3UIFA 4F39A 1LSTA 1DTZA 5ELVA 1US4A 2Z8DA 3OO7A 2DWJA 1AH5A 2PT2A 2XXHA 1MM6A 5FTIA 3TCGA 2HZKA 3UGWA 4ND9A 5H8NA 5DEXA 3IR1A 3ZS6A 1LCFA 4MF3A 2CMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AL4 A;  4KHZ E;  3MWB A;  1XHY A;  4IO4 A;  1HSJ A;  1TFA A;  3I6V A;  4HCW A;  1N76 A;  4OES A;  4HW8 A;  2FNC A;  1QJM A;  1LBC A;  1MQJ A;  1NMU A;  3M8U A;  3PD8 A;  2X26 A;  4EDP A;  1N3W A;  4ELQ A;  2XXV A;  1B51 A;  1B3G A;  3KN3 A;  4BDQ A;  4I1D A;  1NKX A;  1ZBM A;  1JEU A;  2Q9T A;  4YKP A;  3E4R A;  1VSO A;  2F7A A;  3IAZ A;  3N94 A;  4GL0 A;  1MY3 A;  4LZ5 A;  5CMM A;  3K01 A;  1MY2 A;  4QRZ A;  4C1T A;  3G3K A;  5AA3 A;  4JWY A;  5JK4 A;  1SI1 A;  1LAX A;  3LSF B;  1B7U A;  1BKA A;  5DYH A;  1IEJ A;  4QFL A;  2Q88 A;  3QXM A;  4R2B A;  3G3I A;  3KN8 A;  3S9M C;  4TLM B;  3V8X B;  3KOT A;  1SDX A;  3CR9 A;  1MY4 A;  5JTY A;  2Q8J A;  2UYE A;  3Q29 A;  1NL5 A;  3O97 A;  1BTJ A;  3G3J A;  2O68 A;  4EF1 A;  4ESX A;  3DLN A;  3MZB A;  1D4N A;  1OIB A;  3IO4 A;  1EH3 A;  1IUD A;  1FTO A;  3CFX A;  1YTV A;  3DP4 A;  1B0L A;  3MPL A;  2G93 A;  1EZ9 A;  3G3G A;  4OVJ A;  4QSC A;  4X1D A;  1JW5 A;  1BLF A;  4F1V A;  5KZT A;  3C33 A;  3OD7 A;  2PBW A;  4FJP A;  3RPW A;  4QFN A;  3O2A A;  1SW1 A;  4UAC A;  5H8S A;  3VVF A;  3TYH A;  5A5X B;  3KEI A;  4IO7 A;  3UOR A;  3PPP A;  1O7T A;  3IX1 A;  1H44 A;  5ITP A;  3F11 A;  2F36 A;  3FJG A;  3G7W A;  4GF8 A;  2XXU A;  4RY1 A;  3W15 C;  1Q35 A;  3PGF A;  4R75 A;  4Z0I A;  1MQI A;  2Z23 A;  4E0X A;  1Y1M A;  5K2X A;  3V5A A;  1B40 A;  2Y7K A;  1B2H A;  4G68 B;  1B5I A;  2Y7I A;  2UVJ A;  4ELO A;  4BDM A;  2R6G E;  4F3S A;  5CBR A;  4KQP A;  1MRP A;  3TQL A;  5I56 A;  1S7Y A;  1I6B A;  2RF1 A;  1SVX B;  4KR5 A;  3C9H A;  4ECF A;  3OO8 A;  4GRK A;  5AA2 A;  1H45 A;  2XXX A;  4Q0C A;  3PMW A;  1MXZ A;  3VLU A;  4EQ9 A;  3VLW A;  2F8D A;  4LQ2 A;  3T22 A;  4QFP A;  5L8D A;  1SW2 A;  1QUI A;  2ZYK A;  3MPK A;  2RKM A;  1MQG A;  3WAF A;  3S9N C;  3R7X A;  4LQ5 A;  1GV8 A;  4IO3 A;  1IIW A;  1DMB A;  2XXP A;  3CFL A;  2A5T A;  2XHD A;  1FTM A;  2P1S A;  3FV1 A;  3H6W A;  4IB2 A;  4PET A;  4TQU Q;  4NF5 A;  4OHN A;  2HEU A;  1UTH B;  2O84 X;  3C36 A;  1XOC A;  2DVZ A;  4G8H A;  2HCA A;  1FQE A;  1B32 A;  2F7C A;  4KPT A;  4R72 A;  4GQO A;  5A5X A;  2UVI A;  4LZ7 A;  2H5Y A;  4LP2 B;  3FIR A;  1QKB A;  1UTB B;  1XVY A;  2ONR A;  4GD5 A;  3RGY A;  4JWX A;  4F2O A;  2QMX A;  4Q5T A;  1NNT A;  5IAI A;  5KCJ A;  1Z7N E;  1LAG E;  2OCU A;  3FV2 A;  1MDQ A;  3KSX A;  4NMY A;  1ZU0 A;  1YPN A;  1JVX A;  4U2R A;  2D5W A;  5H8H A;  2XXW A;  3VFJ A;  5ITO A;  3SEU A;  1JNF A;  2M8C A;  4U1O A;  3K02 A;  3QSL A;  4POW A;  1SYH A;  4MFI A;  3JV9 A;  4Q30 B;  3RTW B;  5ICQ A;  3S9E A;  4OQO A;  2E1S A;  3DM0 A;  3TOD A;  3PMV A;  2Y84 A;  5CC2 A;  2DWA A;  1L5T A;  3T66 A;  4H6D A;  4JXI A;  2QS2 A;  4IY5 A;  3SER A;  1YCJ A;  1QKA A;  3EF7 A;  2ANJ A;  3IOT A;  1NH8 A;  1AIV A;  3E13 X;  3IOU A;  4OEV A;  4ZEI A;  4FAT A;  2HAU A;  3JZJ A;  3OMB A;  3SES A;  2GHA A;  3IJX B;  3HST A;  4YKJ A;  4PFY A;  4WXJ A;  2RIN A;  4R9F A;  1GR2 A;  1M5F A;  1XT8 A;  1SI0 A;  4GFR A;  2LAO A;  4NWC A;  4RYA A;  2NWJ A;  3QAX A;  5CMB A;  3T9V A;  3UP9 A;  3TCF A;  1POT A;  1UTH A;  2XX9 A;  2I0C A;  3VXC A;  4EXK A;  2NVU B;  4MLV A;  4QF9 A;  1JVY A;  1USY E;  4XXU A;  1R9L A;  3PUW E;  4DIG A;  4EXL A;  5IKB A;  4F18 A;  1OMP A;  5ISU A;  3HO7 A;  1URS A;  1ANF A;  4GL8 A;  4WED A;  1LFG A;  5CMC A;  3E9X A;  3H3G A;  3K1M A;  3TTK A;  1N7W A;  2ZNT A;  3MAM A;  3SKP A;  1BIY A;  1O63 A;  4OMB A;  2REJ A;  4FOR A;  4NF8 A;  4OXV A;  5I2K A;  5L9S A;  2AL5 A;  4G77 A;  2NXO A;  1ELJ A;  1PDA A;  2ABH A;  2UVG A;  1UIU A;  4NED A;  4ZZE A;  1B58 A;  1QUK A;  2XXI A;  3R6U A;  2QPQ A;  4GWO A;  1EZO A;  1SQY A;  1WVJ A;  5H8N B;  4FIM A;  1OVB A;  2ALU A;  3FD3 A;  3KZG A;  4KD5 A;  2QS1 A;  3EPE A;  3VVD A;  5M2V A;  1ZLQ A;  4MH5 A;  2OBG A;  3RLF E;  2ZYN A;  4BDL A;  3FJM A;  2REG A;  4GXS B;  1Y1Z A;  3P7I A;  4OFJ A;  3HCQ A;  1JET A;  2P0S A;  5BUU A;  3T96 B;  2DVC A;  4DE8 A;  3MW0 A;  1NNP A;  1B05 A;  1FTJ A;  3O28 A;  1B3F A;  2DWI A;  4KYS A;  4PFT A;  1ZMG A;  3DEL B;  2DYX A;  2OJT A;  3ONM A;  1B0H A;  3I5O A;  3KOS A;  5K2Y A;  3ZKK A;  3ZKL A;  3K0V A;  4E0W A;  4I62 A;  4F1Y A;  5I56 B;  3ILT B;  5KDT B;  1EU8 A;  2PX1 A;  5I57 B;  5B7D A;  1II5 A;  3PPN A;  4X48 A;  4F3B A;  5FTH A;  2AYS A;  1MXX A;  4G68 C;  1P1O A;  3TDJ A;  3PV0 E;  3TMG A;  1D9Y A;  2QS3 A;  2ZYM A;  1MXY A;  2ONS A;  2AIX A;  1Y3Q A;  2HAV A;  1PBQ A;  3N26 A;  4U23 A;  2V3T A;  1MXV A;  1SD3 A;  1B7Z A;  2D3I A;  4O3A A;  2O6A A;  4P11 A;  2V84 A;  3TTN A;  4G4P A;  4QSE A;  4RJZ A;  3H6U A;  1QUJ A;  3FGS A;  3MBP A;  1JW1 A;  2PVU A;  4GIZ A;  1MS7 A;  3KGC A;  1D9V A;  1P1W A;  1H76 A;  3FVG A;  4R74 A;  5DVJ A;  2OZZ A;  4IGT A;  2ZXT A;  4U21 A;  3ECR A;  3FAS A;  4F22 A;  3K4U A;  4UA8 A;  5TPA B;  4IO5 A;  2H9B A;  1B4H A;  2F34 A;  1PEB A;  2V3U A;  1P99 A;  3OOA A;  4K3F A;  4NTL A;  3TPA A;  3HN0 A;  4JWO A;  4L17 A;  3TEP A;  1FQD A;  3S2V A;  3ZSF A;  1FQF A;  4F3P A;  4QHQ A;  1B4Z A;  1IIT A;  2V25 A;  4RPN A;  1S9T A;  3MZ9 A;  2F5X A;  3BFU A;  1MPC A;  1RYX A;  1FCK A;  2Q2A A;  3HHG A;  3MQ9 A;  4H5F A;  1MY1 A;  4OFL A;  4QFK A;  4XTC Q;  2QMW A;  1B9J A;  2X7P A;  3OSQ A;  2DQV A;  4XKP A;  3MP1 A;  4OTE A;  1LGB C;  4I9D A;  4OEN A;  3DP8 A;  4G68 A;  4HS7 A;  5I59 B;  3RN8 A;  3BFT A;  3MP8 A;  4OWD A;  3TQW A;  5J1D A;  4R9G A;  1LLS A;  2G29 A;  4XIG Q;  2O1M A;  1TXF A;  2RC9 A;  4DXC A;  1OQH A;  3CI8 A;  3K00 A;  2YJP A;  4KFQ A;  4U22 A;  2XXY A;  2FA7 A;  5TP9 A;  3TCH A;  4EQ7 A;  2NUV A;  1FTL A;  1UIV A;  1RKM A;  2O69 A;  5CRY A;  3OO9 A;  3JYR A;  1B46 A;  2B3F A;  3FZV A;  3HV1 A;  4G8M A;  4PE5 B;  1GTK A;  2BJJ X;  2VP1 A;  1CB6 A;  2DXR A;  3A3U A;  1IZ1 A;  4IY6 A;  3VLV A;  1FTK A;  4BLA A;  1MH3 A;  5I58 B;  4N07 A;  4RPO A;  1B6H A;  4JSO A;  1XS5 A;  3HPI A;  4H65 A;  2DOJ A;  1N04 A;  1BP5 A;  5CMK A;  3GBB A;  2Z22 A;  3FXU A;  3QIM A;  2RCB A;  3VE1 B;  3T93 B;  1F9B A;  1N3X A;  1P1U A;  1VE4 A;  1YAE A;  2DE2 A;  4OET A;  4YZZ A;  3KG2 A;  3C31 A;  5DVF A;  4G8N A;  3RUM A;  4RXL A;  1LFI A;  5KCJ B;  4YIC A;  3L6H A;  4U4X A;  1H43 A;  2I0B A;  1MH4 A;  4DXB A;  2YLN A;  5I59 A;  2HZL A;  3C35 A;  3OO6 A;  5HPQ A;  4M4G A;  1OQG A;  1MG1 A;  4QSD A;  4YB5 A;  4JDF A;  3N6U A;  3RT6 B;  3QK6 A;  5HM4 B;  3IOV A;  1D3K A;  3WAE A;  2DP8 A;  5TP9 B;  1IXH A;  4H67 A;  4LZ8 A;  3V89 B;  4DDD A;  3FVN A;  2XXQ A;  1B1H A;  3UN6 A;  1UQW A;  3K6W A;  3ILU B;  2ZNS A;  2IEE A;  4IO6 A;  4KYD A;  3TTL A;  2KLF A;  2XXT A;  4EF2 A;  3PPQ A;  1SW5 A;  1WOD A;  3H6V A;  1POY 1;  3MC2 A;  3G3F A;  1B3L A;  2ESN A;  2VHA A;  1SBP A;  3FAT A;  1B1X A;  3KJT A;  2RC7 A;  4TOZ A;  4EQB A;  5I58 A;  1DOT A;  1ZJL A;  3O6I A;  4FE8 A;  1MDP 1;  4YU0 A;  2UVH A;  3Q27 A;  3M3K A;  3OSR A;  2HQ0 A;  4YB7 A;  3W9V A;  3C34 A;  4F3G A;  4YAH X;  3SEV A;  4LUB A;  4U1Z A;  3DP6 A;  2I3V A;  2X7Q A;  2V3Q A;  2ONK E;  3MVY A;  1M5E A;  3PPO A;  5EHS A;  3PUZ E;  4OYV A;  3OEN A;  3KJ7 A;  2VD3 A;  4LA9 A;  2DE4 A;  4OFO A;  1SYI A;  1VFE A;  2DSF A;  5EHM A;  3O9P A;  4AB6 A;  3G3H A;  3Q26 A;  4FEB A;  3SET A;  5H8Q A;  3CSG A;  4YB6 A;  5I2K B;  1P1Q A;  3CG1 A;  2ZNU A;  1A7L A;  1B3E A;  2Z8F A;  1LB9 A;  3B6W A;  3H06 B;  1LAH E;  2XD3 A;  4OZ9 A;  1LCT A;  2OLB A;  4ONY A;  4DXU A;  4XKQ A;  1TT1 A;  3IOW A;  1FW0 A;  1I69 A;  2IA4 A;  1MPD A;  1LB8 A;  3EN3 A;  3KN7 A;  3LBS A;  3MJN A;  4HTG A;  4XKR A;  2E0S A;  2VGQ A;  3OXN A;  4P0I A;  1N7X A;  3GZG A;  3CIJ A;  1NNK A;  3USD A;  5CM6 A;  3K1P A;  2QJE A;  2R71 A;  1CE2 A;  1P1N A;  1DPP A;  1NH7 A;  2GHB A;  2HFB A;  3Q25 A;  3TFL A;  4LVQ A;  1Y3N A;  4EUO A;  2B65 A;  4G2Z A;  1JQF A;  1LAF E;  2FYI A;  4ZEK A;  3RTF B;  1DSN A;  2QRY A;  3U92 A;  1T0K A;  3S4U A;  4TLL B;  2GH9 A;  1IXC A;  1JEV A;  3EQ1 A;  4PP0 A;  5H8F B;  2WKY A;  1PB8 A;  4ZEB A;  3RT8 A;  4H0W A;  5BWJ A;  4C1U A;  4GVO A;  5I57 A;  2I48 A;  5KDT A;  3QUJ A;  1MQD A;  4MBP A;  4WKM A;  3IJO B;  4YMA A;  1MQH A;  1OVT A;  1R1N A;  3PU5 A;  1N84 A;  1B5H A;  4ZE9 A;  3CG3 A;  4R2F A;  3VVE A;  4F31 B;  3KFM A;  1M5B A;  3PUX E;  5H8Q B;  4WEP A;  1I6Q A;  1H3D A;  2I4B A;  3N5L A;  5AA1 A;  1XC1 A;  3TKD A;  1DTG A;  3M3L A;  1B7H A;  5HBC A;  4X1B A;  4F19 A;  5I2N A;  3MZ1 A;  1Q1K A;  3GBA A;  4Z7E A;  3GLB A;  2GFE A;  3K6V A;  2V93 A;  2PYY A;  2OWT A;  3MVW A;  3H6T A;  4PFW A;  2ZYO A;  2W7Y A;  1MM7 A;  5TPA A;  3RY3 A;  5AE4 A;  5LOM A;  1XVX A;  3IB1 A;  5AA4 B;  1URG A;  3PMX A;  3I3V A;  3QYT A;  3BKI B;  2O7U A;  4O3B A;  3LSX A;  1PC3 A;  3U72 A;  2GRV A;  1URD A;  3GXA A;  3LSL A;  2XXR A;  2B3B A;  3PD9 A;  4H5G A;  4OER A;  3CSB A;  3UK4 A;  4NF4 B;  5JEI A;  4BDO A;  3B7D A;  3A3C A;  2D21 A;  1QVS A;  3EHS A;  3IB2 A;  2F78 A;  3C32 A;  3IO6 A;  4H8I A;  2DS9 A;  1FQC A;  3MP6 A;  5B70 A;  1LFH A;  5FHN A;  1ZIU A;  4DCX A;  3VDF A;  4ISU A;  2O51 A;  2O7I A;  3EHU A;  2P2A A;  4KYE A;  1AL3 A;  2RC8 A;  4R73 A;  4R6Y A;  4JBZ A;  3K6X A;  3FXR A;  4KCC A;  1ATG A;  1J1N A;  2H99 A;  3AXF A;  3OEK A;  5DTB A;  4ZE8 A;  2Q89 A;  3U94 A;  4GOT A;  5I2N B;  3C4M A;  3FJ7 A;  1RYO A;  2DWH A;  1USY H;  4NF6 B;  2PMS A;  3FVO A;  5DT6 A;  3LSW A;  1EZP A;  2A5S A;  4M1V A;  3SEX A;  3U8Q A;  1AOV A;  1MXW A;  5L9O A;  3SEY A;  3K6U A;  5CI5 A;  2VD2 A;  3FXQ A;  4ZS9 A;  3A09 A;  4N6P A;  4H1X A;  4ELP A;  4RNS A;  4ZEC A;  4X9T A;  5AA4 A;  4RK9 A;  2F6G A;  1A8E A;  3H4Z A;  2Y7R A;  3UA8 A;  3CRB A;  3O66 A;  2H4I A;  3HHF A;  4FAJ A;  1HSL A;  4GLI A;  1A8F A;  4H8J A;  4BDR A;  3M3F A;  4IGR A;  3L6G A;  4NF4 A;  4PQJ A;  4ESW A;  4FEC A;  2DE3 A;  1R9Q A;  2H25 A;  3O6G A;  2Y7P A;  4LON B;  4YKK A;  3CVG A;  4DLD A;  1OLC A;  1US5 A;  3U1O A;  3FVK A;  3IOR A;  5DVI A;  4RA1 A;  3RNN A;  3D4G A;  5FHO A;  1A40 A;  3TEL A;  5F7V A;  1MPB A;  4DCY A;  4THI A;  5AA2 B;  3QUF A;  5JTY B;  4F2Q A;  1DPE A;  1ZKB A;  4YMB A;  5ICT A;  2QS4 A;  3V83 A;  2O1L A;  3E3K A;  4AQ4 A;  1QW0 A;  1R6Z A;  4ZED A;  4ZDM A;  1IXI A;  1OLA A;  3IL1 B;  3MVX A;  4F1U A;  1A54 A;  2QSX A;  4QFO A;  1FQB A;  1A55 A;  1VR5 A;  1PBP A;  3PPR A;  4NF6 A;  4ZEF A;  3U93 A;  4XKN A;  2I4C A;  2VOZ A;  3TAJ A;  2A5T B;  4I8C A;  3IB0 A;  3FUZ A;  3PUY E;  2I6E A;  4FED A;  4POX A;  2OWS A;  4NF5 B;  5AA2 D;  1LBB A;  1NNF A;  1Y4C A;  3TUS A;  2HXW A;  1Y4T A;  4RK2 A;  1HSE A;  3THI A;  4R6K A;  1TWY A;  3CFZ A;  4Q8R A;  2YPN A;  1S50 A;  2DXY A;  3KSJ A;  1AMF A;  3B6T A;  1UTB A;  3KBR A;  3SEW A;  2I3W A;  1GVC A;  1MY0 A;  1N0T A;  1PB9 A;  2OK2 A;  5CBS A;  2F6P A;  1Y20 A;  4N13 A;  3H7M A;  1ZTY A;  3SDF A;  2I49 A;  1IQ7 A;  1Y9U A;  5H8H B;  4PFU A;  3S9L C;  1O64 A;  1M5C A;  1IXG A;  2CZL A;  2F35 A;  4GXA A;  5TU0 A;  1KWH A;  5L9M A;  4KCD A;  3ODB A;  3TTR A;  1B52 A;  2PT1 A;  3B6Q A;  1VFD A;  4IO2 A;  4O3C A;  3T9U A;  3BBR A;  2XX7 A;  4F29 A;  1M5D A;  1TFD A;  1WDN A;  3LR1 A;  4JSD A;  5DEX B;  5F1Q A;  1SW4 A;  4DZ1 A;  2QL3 A;  2THI A;  3K2D A;  3MUQ A;  4OEU A;  1B5J A;  2F97 A;  1JW4 A;  1Y3P A;  3D4C A;  4R6H A;  2H98 A;  1B3H A;  2Q2C A;  3TZA A;  1Z7M E;  1PB7 A;  4AB5 A;  4NE4 A;  4JB7 A;  4P0G A;  3TTM A;  2UXA A;  3IK6 B;  1GGG A;  4YKI A;  1NFT A;  3LUY A;  3MVZ A;  4MLQ A;  2RCA A;  5FHM A;  3R26 A;  4C0R A;  2UYF A;  2ZMB A;  3O6H A;  3T9X B;  4NWD A;  3VV5 A;  4BDN A;  2XX8 A;  4ZZA A;  5H8F A;  1A99 A;  1QUL A;  3W9W A;  3T9H B;  3EHT A;  3H03 A;  2R9J A;  5I84 A;  2Y7W A;  3Q28 A;  1I6A A;  3RQT A;  2F7B A;  1MXU A;  4ELR A;  3PUV E;  2NOO A;  3O29 A;  2XD2 A;  3LC8 A;  3OEL A;  3OEM A;  4HCY A;  3VXB A;  2Z8E A;  3N6T A;  4NF8 B;  5EYF A;  4KI0 E;  1FQA A;  2I58 A;  3K1N A;  4LAT A;  4U4S A;  3UIF A;  4F39 A;  1LST A;  1DTZ A;  5ELV A;  1US4 A;  2Z8D A;  3OO7 A;  2DWJ A;  1AH5 A;  2PT2 A;  2XXH A;  1MM6 A;  5FTI A;  3TCG A;  2HZK A;  3UGW A;  4ND9 A;  5H8N A;  5DEX A;  3IR1 A;  3ZS6 A;  1LCF A;  4MF3 A;  2CMO A; 
#chains in the Genus database with same CATH topology
 3QMF A;  1TFA A;  4HCW A;  1N76 A;  4ELQ A;  4BDQ A;  3KN3 A;  4PAI A;  4PFR A;  1MY3 A;  1FPL A;  1SI1 A;  1LAX A;  1BKA A;  3S9M C;  4TLM B;  5JTY A;  1SDX A;  3CR9 A;  2UYE A;  3Q29 A;  4N4U A;  1NL5 A;  3G3J A;  2O68 A;  1NV1 A;  1FTO A;  1YTV A;  4OVJ A;  3G3G A;  5KZT A;  1BLF A;  4PGN A;  4F1V A;  1FBC A;  5IZ3 A;  3O2A A;  4PGP A;  3KEI A;  4OVS A;  1H44 A;  2F36 A;  3FBP A;  3FJG A;  4PDD A;  4RY1 A;  5EYG A;  1MQI A;  4E0X A;  2Y7K A;  3TQL A;  1S7Y A;  5AA2 A;  4GRK A;  3VLU A;  2F8D A;  1SW2 A;  3MPK A;  3WAF A;  3R7X A;  4LQ5 A;  4PTK A;  1DMB A;  2XXP A;  2DVZ A;  4R72 A;  4UAB A;  2HCA A;  5I7I A;  2F7C A;  5A5X A;  1UTB B;  2ONR A;  5KCJ A;  1YPN A;  1DCU A;  2P3N A;  3SEU A;  1SYH A;  2Y84 A;  4IY5 A;  1YCJ A;  2ANJ A;  3IOT A;  4NHB A;  1AIV A;  4OEV A;  2GHA A;  3HST A;  4YKJ A;  2RIN A;  4R9F A;  1XT8 A;  3UP9 A;  3T9V A;  5CMB A;  3TCF A;  1POT A;  3IFA A;  2I0C A;  4MLV A;  1R9L A;  1OMP A;  3MYU A;  1LFG A;  1PDA A;  1UIU A;  4ZZE A;  4GWO A;  5H8N B;  4FIM A;  3EPE A;  2V4C A;  1FBP A;  4NN3 A;  2REG A;  4NGU A;  3P7I A;  4OFJ A;  1JET A;  2DVC A;  1B05 A;  1FTJ A;  4KYS A;  3DEL B;  2DYX A;  3ZKK A;  5K2Y A;  4I62 A;  1EU8 A;  3PPN A;  4F3B A;  3TDJ A;  2ZYM A;  2HAV A;  1SD3 A;  2D3I A;  3TTM A;  2O6A A;  4QSE A;  4AS4 A;  2FIE A;  2FIX A;  2Q8M A;  3KGC A;  3LUZ A;  2OZZ A;  2WEF A;  4P9K A;  2H9B A;  3TEP A;  4K3F A;  3S2V A;  4QHQ A;  1IIT A;  4RPN A;  3MZ9 A;  3MQ9 A;  4QFK A;  3HHG A;  1RDZ A;  2QMW A;  1LBW A;  4I9D A;  5I59 B;  4OWD A;  1TXF A;  4HE1 A;  2FA7 A;  4EQ7 A;  1RKM A;  2O69 A;  3OO9 A;  1B46 A;  3HV1 A;  4G8M A;  2VP1 A;  2XWI A;  1FTK A;  4N07 A;  1XS5 A;  1BP5 A;  3ROJ A;  3VE1 B;  1VE4 A;  1P1U A;  5DVF A;  4U4X A;  1H43 A;  5I59 A;  3OO6 A;  1OQG A;  1MG1 A;  4QSD A;  4JDF A;  3N6U A;  5HM4 B;  3IOV A;  3FVN A;  3GYY A;  2XXQ A;  1UQW A;  4GWZ A;  4KYD A;  4IR8 A;  4N15 A;  3MC2 A;  3G3F A;  2ESN A;  2VHA A;  5I58 A;  1B1X A;  4TOZ A;  2WX9 A;  2OX3 A;  4YU0 A;  3OSR A;  2FVZ A;  3C34 A;  4JVI A;  2PCR A;  3DP6 A;  1M5E A;  5EHM A;  3O9P A;  4AB6 A;  3G3H A;  5H8Q A;  3CG1 A;  1B3E A;  1RDX A;  1IMD A;  3LBS A;  3KN7 A;  2VGQ A;  2ZZX A;  3CIJ A;  3K1P A;  5J16 A;  4LVQ A;  1Y3N A;  2QRY A;  1JEV A;  4PP0 A;  5H8F B;  5BWJ A;  4C1U A;  5I57 A;  2I48 A;  3IJO B;  1N84 A;  5IM2 A;  4ZE9 A;  3CG3 A;  4F31 B;  1M5B A;  1I6Q A;  3HFU A;  1B7H A;  3GLB A;  2GFE A;  2V93 A;  2OWT A;  4PFW A;  5TPA A;  2W7Y A;  1MM7 A;  5AA4 B;  3PMX A;  3I3V A;  2O7U A;  4O3B A;  2GRV A;  4OER A;  3LSL A;  2XXR A;  2R8T A;  3A3C A;  3EHS A;  3IB2 A;  3IO6 A;  4H8I A;  3MP6 A;  1YYZ A;  4R73 A;  3SDF A;  3K6X A;  3OEK A;  1FJ6 A;  3FJ7 A;  4NF6 B;  2PMS A;  2HHM A;  4M1V A;  3U8Q A;  1AOV A;  4GWS A;  5AA4 A;  4RNS A;  3UA8 A;  5ESY A;  3BIG A;  4FAJ A;  1A8F A;  4IGR A;  3L6G A;  3NOH A;  4GBW A;  3TEL A;  4DCY A;  4THI A;  4YMB A;  1ZKB A;  3MVX A;  4F1U A;  1K9Y A;  2F3B A;  1FQB A;  1A55 A;  1VR5 A;  1T0K A;  2VOZ A;  5AA2 D;  1SPI A;  1NNF A;  3TUS A;  1D9Q A;  4RK2 A;  4R6K A;  1S50 A;  1UTB A;  2I3W A;  1CNQ A;  1ZTY A;  1IQ7 A;  2Q74 A;  5L9M A;  3B6Q A;  3BBR A;  3LR1 A;  3MUQ A;  1B5J A;  1JW4 A;  2H98 A;  4NE4 A;  4P0G A;  3IK6 B;  2CZH A;  1NFT A;  3MVZ A;  1INP A;  2ZMB A;  3O6H A;  4NWD A;  1QUL A;  4ELR A;  2XD2 A;  3OEL A;  1FQA A;  3UIF A;  4F39 A;  3KBZ A;  2HZK A;  5DEX A;  3WAE A;  4KHZ E;  3MWB A;  1XHY A;  4HW8 A;  3I6V A;  4I40 A;  1MQJ A;  3M8U A;  2X26 A;  4EDP A;  1N3W A;  5IGA A;  2XXV A;  1B51 A;  1B3G A;  4GWU A;  4I1D A;  1ZBM A;  2Q9T A;  1JEU A;  4YKP A;  4C1T A;  4JWY A;  1B7U A;  5DYH A;  1IEJ A;  1QGX A;  3QXM A;  5ET7 A;  4R2B A;  3G3I A;  3KN8 A;  3KOT A;  1MY4 A;  2Q8J A;  5FBP A;  2XXK A;  3IO4 A;  3MPL A;  5CBS A;  3RPW A;  1SW1 A;  3VVF A;  3TYH A;  1IMC A;  1O7T A;  5F24 A;  2VPN A;  4Z0I A;  2Y5K A;  2Z23 A;  2MKZ A;  1B5I A;  4F3S A;  4ELO A;  4BDM A;  5CBR A;  1NUW A;  1FPK A;  2RF1 A;  3VLW A;  4LQ2 A;  2ZYK A;  1MQG A;  3S9N C;  4GX6 A;  3H6W A;  4IB2 A;  4TQU Q;  1FTM A;  4NF5 A;  4OHN A;  2HEU A;  1UTH B;  3C36 A;  4G8H A;  3ISP A;  2H5Y A;  4LP2 B;  3FIR A;  4F2O A;  4GD5 A;  3D1R A;  1NNT A;  1LAG E;  1JVX A;  3VFJ A;  5ITO A;  1JNF A;  3QSL A;  3RTW B;  3S9E A;  4MFI A;  4OQO A;  2E1S A;  5CC2 A;  3T66 A;  3SER A;  4MNP A;  1QKA A;  3EF7 A;  3E13 X;  3IOU A;  2HAU A;  3JZJ A;  3SES A;  3IJX B;  4RYA A;  4GFR A;  3QAX A;  1KZ8 A;  3VXC A;  1JVY A;  1USY E;  4XEQ A;  4F18 A;  1URS A;  1ANF A;  5CMC A;  3H3G A;  2ZNT A;  4MAG A;  4FOR A;  2AL5 A;  4G77 A;  4NED A;  4DI4 B;  1QUK A;  2QPQ A;  1WVJ A;  1NI9 A;  4KD5 A;  2QS1 A;  2OBG A;  1FSA A;  1LEV A;  1FPD A;  4DE8 A;  2DWI A;  4GWX A;  4QBA A;  3ONM A;  4F1Y A;  5KDT B;  5I57 B;  3KC0 A;  1MXX A;  2QS3 A;  3N26 A;  5JTY B;  4U23 A;  3TTN A;  1QUJ A;  1JW1 A;  2PVU A;  1H76 A;  5I5P A;  4IGT A;  3ECR A;  3FAS A;  5TPA B;  1EYI A;  1B4H A;  2F34 A;  2V3U A;  3OOA A;  3TPA A;  4JWO A;  4L17 A;  4KXP A;  3ZSF A;  1FQF A;  1B4Z A;  2V25 A;  4N6D A;  3BFU A;  1FCK A;  2DQV A;  4XKP A;  4OTE A;  1LGB C;  4G68 A;  4HS7 A;  3MP8 A;  4R9G A;  1LLS A;  4XIG Q;  2O1M A;  2RC9 A;  3CI8 A;  3K00 A;  2XXY A;  2B3F A;  1CB6 A;  4IY6 A;  1LBX A;  4BLA A;  1FPE A;  1B6H A;  4H65 A;  2DOJ A;  1N04 A;  3FXU A;  1N3X A;  2DE2 A;  3C31 A;  4G8N A;  5KCJ B;  2I0B A;  2HZL A;  4M4G A;  4YB5 A;  4PBH A;  4LZ8 A;  4X8R A;  1B1H A;  3UN6 A;  3ILU B;  3TTL A;  1G0H A;  4EF2 A;  1SW5 A;  4XFE A;  1ZJL A;  4FE8 A;  3Q27 A;  2HQ0 A;  4LUB A;  2VT5 A;  2I3V A;  2V3Q A;  2ONK E;  5EHS A;  1SYI A;  1VFE A;  3SET A;  4PAF A;  5I2K B;  1LB9 A;  3E78 A;  1LAH E;  4OZ9 A;  2OLB A;  1TT1 A;  3IOW A;  1I69 A;  2IA4 A;  4NAP A;  3OXN A;  1N7X A;  4GWW A;  1NNK A;  3USD A;  5CM6 A;  2R71 A;  1DPP A;  2B65 A;  1LAF E;  2FYI A;  2P3V A;  3RTF B;  1DSN A;  3U92 A;  4TLL B;  2PFY A;  4H0W A;  4P1L A;  4GVO A;  3QUJ A;  4WKM A;  3PU5 A;  1FBE A;  1FJ9 A;  3VVE A;  4WEP A;  2I4B A;  4X1B A;  5I2N A;  1RDY A;  1Q1K A;  3GBA A;  2ZYO A;  5LOM A;  4P47 A;  1URG A;  2QVR A;  4MMP A;  1YXI A;  3LSX A;  1PC3 A;  3U72 A;  1URD A;  2D21 A;  1QVS A;  1K9Z A;  2DS9 A;  1ZIU A;  2F3D A;  4ISU A;  2O7I A;  4HE0 A;  1AL3 A;  2RC8 A;  4OVT A;  4JBZ A;  2H99 A;  1NV6 A;  3U94 A;  4GOT A;  2WBD A;  3FVO A;  1EZP A;  3K6U A;  3FXQ A;  4N6P A;  4ELP A;  2F6G A;  4OVR A;  1IMB A;  4GLI A;  3M3F A;  4O7I A;  4DLD A;  1OLC A;  1US5 A;  3RNN A;  3D4G A;  1A40 A;  1DPE A;  3V83 A;  2QS4 A;  1QW0 A;  4ZED A;  4ZDM A;  1IXI A;  1A54 A;  4JVD A;  1FBG A;  5DW8 A;  3V8X B;  4I8C A;  3PUY E;  2I6E A;  4FED A;  4NF5 B;  3RYD A;  4Q8R A;  3KSJ A;  1AMF A;  3T1B A;  4N81 A;  1GVC A;  1PB9 A;  2OK2 A;  4N13 A;  4O94 A;  5H8H B;  4PFU A;  1O64 A;  2F35 A;  5TU0 A;  4KCD A;  3ODB A;  1B52 A;  2PT1 A;  4IO2 A;  3T9U A;  2XX7 A;  1TFD A;  3K2D A;  2Q2C A;  3TZA A;  1Z7M E;  3RPL B;  1GGG A;  3LUY A;  5FHM A;  2KR0 A;  2XX8 A;  5H8F A;  2OWZ A;  3T9H B;  3H03 A;  2R9J A;  1I6A A;  1MXU A;  3PUV E;  2NOO A;  1DK4 A;  3OEM A;  4U4S A;  4LAT A;  1LST A;  5ELV A;  1US4 A;  2Z8D A;  1AH5 A;  2PT2 A;  5FTI A;  1LCF A;  4MF3 A;  5IZ3 B;  4U1O A;  4NQ8 A;  4OES A;  2FNC A;  1QJM A;  1LBC A;  1NMU A;  4LZ5 A;  2F7A A;  3IAZ A;  3N94 A;  5CMM A;  3K01 A;  4QRZ A;  5JK4 A;  3LSF B;  2Q88 A;  1LBZ A;  1XI6 A;  3O97 A;  1BTJ A;  4ESX A;  3DLN A;  1EH3 A;  1IUD A;  3CFX A;  4X1D A;  1EZ9 A;  1JW5 A;  3BIH A;  3C33 A;  3OD7 A;  2PBW A;  4QFN A;  4UAC A;  4GWY A;  4H46 A;  5A5X B;  5ITP A;  3F11 A;  3G7W A;  4GF8 A;  3W15 C;  1Q35 A;  3PGF A;  1B2H A;  4G68 B;  2R6G E;  4KQP A;  4KR5 A;  1FBF A;  3C9H A;  5IZZ A;  3OO8 A;  1H45 A;  1MXZ A;  4GX3 A;  3T22 A;  2L5V A;  4QFP A;  5L8D A;  4P56 A;  1GV8 A;  4GX4 A;  5B7D A;  3CFL A;  1VDW A;  3FV1 A;  1FPJ A;  5EQ9 A;  5ISU A;  5DT6 A;  4AS5 A;  1FQE A;  1B32 A;  2UVI A;  1NV5 A;  4JWX A;  2QMX A;  3KSX A;  1MDQ A;  4NMY A;  1ZU0 A;  3KC1 A;  2D5W A;  2M8C A;  5ET8 A;  3K02 A;  4POW A;  3JV9 A;  4N6K A;  4PFI A;  3TOD A;  3PMV A;  2DWA A;  4H6D A;  3B8B A;  1NH8 A;  1DBZ A;  1GR2 A;  1M5F A;  1SI0 A;  4NWC A;  2LAO A;  2WBB A;  4EXK A;  2NVU B;  5LTC A;  2FBP A;  3PUW E;  4EXL A;  4GL8 A;  3TTK A;  3MAM A;  4JVC A;  4OMB A;  1O63 A;  4OXV A;  5I2K A;  5L9S A;  2QVV A;  3EKI A;  2XXI A;  1SQY A;  2ALU A;  1ZLQ A;  4MH5 A;  4BDL A;  1Y1Z A;  3HCQ A;  3CHG A;  3T96 B;  1NNP A;  3O28 A;  1B3F A;  1ZMG A;  1EYJ A;  2OJT A;  4E0W A;  1B0H A;  3I5O A;  4QXD A;  3ZKL A;  3K0V A;  3ILT B;  2PX1 A;  1II5 A;  2AYS A;  3PV0 E;  2HXR A;  1D9Y A;  2ONS A;  1Y3Q A;  2AIX A;  4OAN A;  1MXV A;  1B7Z A;  4P11 A;  4G4P A;  1NV3 A;  4RJZ A;  4H45 A;  3FGS A;  3MBP A;  5DVJ A;  1P1W A;  2ZXT A;  4U21 A;  4F22 A;  3K4U A;  4UA8 A;  4NTL A;  3SEX A;  1PEB A;  1P99 A;  3HN0 A;  1FQD A;  4P3L A;  1S9T A;  4H5F A;  4DCX A;  1RYX A;  4PFB A;  1MY1 A;  3OSQ A;  3MP1 A;  4OEN A;  3BFT A;  5J1D A;  4N91 A;  3TCH A;  5TP9 A;  1FTL A;  1UIV A;  2DDK A;  3JYR A;  3FZV A;  2BJJ X;  2DXR A;  5IZ1 A;  4PDH A;  5I58 B;  4JSO A;  1FTA A;  5CMK A;  3GBB A;  2Z22 A;  2RCB A;  3T93 B;  4LN5 A;  4P8B A;  4YIC A;  1MH4 A;  4DXB A;  2CZI A;  3C35 A;  4NG7 A;  3RT6 B;  3QK6 A;  1D3K A;  5TP9 B;  1IXH A;  3V89 B;  4DDD A;  4IO6 A;  2ZNS A;  2IEE A;  2XXT A;  2CZK A;  3H6V A;  1SBP A;  3FAT A;  3KJT A;  2XWO A;  1DOT A;  1MDP 1;  3T0J A;  2UVH A;  2X7Q A;  3MVY A;  3PPO A;  3PUZ E;  3OEN A;  3KJ7 A;  4OFO A;  2DSF A;  4FEB A;  4YB6 A;  1P1Q A;  2Z8F A;  1YZ0 A;  4DXU A;  4XKQ A;  1FW0 A;  3EN3 A;  3MJN A;  2E0S A;  4P0I A;  1FPB A;  3GZG A;  2GQ1 A;  2QJE A;  3RPL A;  3Q25 A;  4G2Z A;  1JQF A;  4ZEK A;  3S4U A;  1IXC A;  4ZEB A;  2WKY A;  1PB8 A;  5KDT A;  4MBP A;  1R1N A;  1OVT A;  3PUX E;  5H8Q B;  5I3S A;  2PFZ A;  1H3D A;  3N5L A;  3SZP A;  5AA1 A;  3TKD A;  2KQZ A;  4O8M A;  4F19 A;  3MZ1 A;  4Z7E A;  3H6T A;  3RY3 A;  1NV4 A;  3QYT A;  1AWB A;  3GXA A;  3PD9 A;  2B3B A;  4NF4 B;  1NV0 A;  3C32 A;  4N17 A;  3VDF A;  2B4L A;  3EHU A;  2P2A A;  4KYE A;  4R6Y A;  3FXR A;  1ATG A;  3AXF A;  3C4M A;  2A5S A;  4PAK A;  3SEY A;  2VD2 A;  4X9T A;  4RK9 A;  3H4Z A;  1A8E A;  3CRB A;  3O66 A;  4H8J A;  4BDR A;  4PQJ A;  4NF4 A;  2DE3 A;  1R9Q A;  3O6G A;  4LON B;  2Y7P A;  4YKK A;  4XF5 A;  3CVG A;  3U1O A;  3FVK A;  2WYP A;  1MPB A;  4N8Y A;  5AA2 B;  4F2Q A;  5ICT A;  2O1L A;  3E3K A;  1R6Z A;  4GBV A;  2ZZW A;  1OLA A;  3IL1 B;  4ZEF A;  3PPR A;  1PBP A;  4NF6 A;  4XKN A;  3FUZ A;  4POX A;  1Y4C A;  3THI A;  1TWY A;  2BJI A;  2YPN A;  3SEW A;  1MY0 A;  2F6P A;  1Y20 A;  1Y9U A;  2CZL A;  4GXA A;  1KWH A;  1VFD A;  4O3C A;  1M5D A;  1WDN A;  4JSD A;  5DEX B;  4DZ1 A;  1SW4 A;  2QL3 A;  1PB7 A;  2UXA A;  2RCA A;  3R26 A;  4C0R A;  4BDN A;  1A99 A;  3RQT A;  2Z8E A;  4MEV A;  5EYF A;  3K1N A;  2I58 A;  3TCG A;  1MM6 A;  3U65 A;  3UGW A;  4ND9 A;  5H8N A;  3IR1 A;  4I3Y A;  5EQA A;  2CMO A;  3MST A;  2AL4 A;  4IO4 A;  1HSJ A;  1NUZ A;  4PE3 A;  3PD8 A;  1NKX A;  3E4R A;  1VSO A;  4GL0 A;  1MY2 A;  3G3K A;  4QFL A;  2JJK A;  4G61 A;  5ET6 A;  4EF1 A;  3MZB A;  1D4N A;  1OIB A;  4QSC A;  3DP4 A;  1B0L A;  2G93 A;  1G0I A;  4FJP A;  5H8S A;  4IO7 A;  3UOR A;  3PPP A;  3IX1 A;  2XXU A;  4PBQ A;  4R75 A;  1Y1M A;  5K2X A;  3V5A A;  1B40 A;  2Y7I A;  2UVJ A;  4O7M A;  1MRP A;  5I56 A;  1I6B A;  1SVX B;  4ECF A;  2XXX A;  4Q0C A;  3PMW A;  4EQ9 A;  4OVP A;  1QUI A;  2RKM A;  4IO3 A;  1IIW A;  2A5T A;  2XHD A;  2P1S A;  4PET A;  2O84 X;  1XOC A;  4KPT A;  4GQO A;  4LZ7 A;  4P1E A;  1QKB A;  1XVY A;  3RGY A;  4Q5T A;  5IAI A;  1Z7N E;  2OCU A;  3FV2 A;  4U2R A;  5H8H A;  2XXW A;  2XWV A;  4Q30 B;  5ICQ A;  3DM0 A;  4DI3 D;  1L5T A;  4JXI A;  2QS2 A;  3A29 A;  4ZEI A;  4FAT A;  3OMB A;  4PFY A;  4WXJ A;  2CEX A;  2NWJ A;  4AB5 A;  1UTH A;  2XX9 A;  1NUY A;  4QF9 A;  4I3E A;  4XXU A;  4DIG A;  5IKB A;  2XWK A;  3HO7 A;  4HXV A;  4WED A;  3E9X A;  3K1M A;  1N7W A;  3SKP A;  1BIY A;  2REJ A;  4NF8 A;  2NXO A;  1ELJ A;  2ABH A;  3PTY A;  1NUX A;  2UVG A;  1B58 A;  4MHF A;  3R6U A;  1EZO A;  1OVB A;  3KZG A;  3FD3 A;  1FPI A;  3VVD A;  5M2V A;  1FPG A;  3RLF E;  2ZYN A;  3FJM A;  4GXS B;  2P0S A;  5BUU A;  3MW0 A;  2Y5L A;  1KA0 A;  4PFT A;  1LBV A;  3KOS A;  4MNI A;  4X48 A;  5FTH A;  4G68 C;  1P1O A;  3TMG A;  1MXY A;  1PBQ A;  2V3T A;  4O3A A;  2V84 A;  5EQ8 A;  3H6U A;  5A5L A;  4GIZ A;  1MS7 A;  1D9V A;  3FVG A;  4R74 A;  4IO5 A;  4F3P A;  4H67 A;  2F5X A;  1MPC A;  2Q2A A;  2WYK A;  4OFL A;  4XTC Q;  1B9J A;  2X7P A;  4MNC A;  3DP8 A;  1IMF A;  3RN8 A;  3TQW A;  2G29 A;  4DXC A;  1OQH A;  2YJP A;  4KFQ A;  4U22 A;  2NUV A;  4MX6 A;  5CRY A;  1BK4 A;  4PE5 B;  1GTK A;  2XA5 A;  3A3U A;  1IZ1 A;  1NV7 A;  3VLV A;  1MH3 A;  4RPO A;  2CEY A;  3HPI A;  3LV0 A;  1IMA A;  1NV2 A;  3QIM A;  5T3J A;  1F9B A;  1YAE A;  4OET A;  3KG2 A;  3RUM A;  4RXL A;  1LFI A;  3L6H A;  1FPF A;  2YLN A;  5HPQ A;  4HE2 A;  2DP8 A;  2HPG A;  3K6W A;  2KLF A;  3PPQ A;  1WOD A;  1POY 1;  1B3L A;  4EQB A;  2RC7 A;  3O6I A;  3M3K A;  4YB7 A;  3W9V A;  4F3G A;  4YAH X;  3SEV A;  4U1Z A;  1FRP A;  4OYV A;  2VD3 A;  4LA9 A;  2DE4 A;  3Q26 A;  3CSG A;  2ZNU A;  1A7L A;  3B6W A;  3H06 B;  5ET5 A;  2XD3 A;  1LCT A;  4ONY A;  1KA1 A;  4HTG A;  1MPD A;  1LB8 A;  4XKR A;  4PF6 A;  1CE2 A;  1P1N A;  1NH7 A;  2GHB A;  2HFB A;  3IFC A;  3TFL A;  4EUO A;  1Q9D A;  2GH9 A;  3EQ1 A;  1EYK A;  3RT8 A;  1MQD A;  4YMA A;  1MQH A;  1LBY A;  1B5H A;  4R2F A;  3KFM A;  1XC1 A;  1DTG A;  3M3L A;  5HBC A;  2FHY A;  3K6V A;  2PYY A;  3MVW A;  4MJO A;  5AE4 A;  4NX1 A;  1XVX A;  3IB1 A;  4PCD A;  3BKI B;  3UK4 A;  4H5G A;  3CSB A;  4BDO A;  3B7D A;  4OVQ A;  3E79 A;  2F78 A;  5EQ7 A;  1FQC A;  5B70 A;  1LFH A;  4PC9 A;  5FHN A;  2O51 A;  2QVU A;  4YZZ A;  5DTB A;  4KCC A;  2B4M A;  1J1N A;  4ZE8 A;  2Q89 A;  5I2N B;  1FBD A;  1RYO A;  2DWH A;  2VPO A;  1USY H;  3LSW A;  1MXW A;  5L9O A;  5CI5 A;  5AA3 A;  4ZS9 A;  3A09 A;  4H1X A;  4ZEC A;  2Y7R A;  2H4I A;  3HHF A;  1HSL A;  3B50 A;  4OA4 A;  4ESW A;  4FEC A;  2H25 A;  3IOR A;  5DVI A;  4RA1 A;  4PF8 A;  5FHO A;  5I56 B;  5JEI A;  5F7V A;  3QUF A;  2QFL A;  4AQ4 A;  1IME A;  2QSX A;  4QFO A;  3FXB A;  3U93 A;  3TAJ A;  2I4C A;  2A5T B;  3IB0 A;  2OWS A;  1JP4 A;  4NF0 A;  1LBB A;  4MCO A;  2HXW A;  1Y4T A;  1HSE A;  3CFZ A;  2DXY A;  3B6T A;  3KBR A;  1N0T A;  3H7M A;  2I49 A;  4MIJ A;  3S9L C;  1M5C A;  1IXG A;  3TTR A;  4F29 A;  5F1Q A;  1FBH A;  2THI A;  4OEU A;  2ZZV A;  2F97 A;  4FBP A;  1Y3P A;  3D4C A;  4R6H A;  1B3H A;  4JB7 A;  4YKI A;  4MLQ A;  2UYF A;  3T9X B;  3VV5 A;  4ZZA A;  3W9W A;  5LDZ A;  3EHT A;  5I84 A;  2Y7W A;  3Q28 A;  2F7B A;  3O29 A;  3LC8 A;  4HCY A;  3VXB A;  4X04 A;  3N6T A;  4NF8 B;  4KI0 E;  1DTZ A;  3OO7 A;  2DWJ A;  2XXH A;  4N8G A;  3ZS6 A;  5EYH A; 
#chains in the Genus database with same CATH homology
 2AL4 A;  4KHZ E;  3MWB A;  1XHY A;  4IO4 A;  1HSJ A;  1TFA A;  3I6V A;  4HCW A;  1N76 A;  4OES A;  4HW8 A;  2FNC A;  1QJM A;  1LBC A;  1MQJ A;  1NMU A;  3M8U A;  3PD8 A;  2X26 A;  4EDP A;  1N3W A;  4ELQ A;  2XXV A;  1B51 A;  1B3G A;  3KN3 A;  4BDQ A;  4I1D A;  1NKX A;  1ZBM A;  1JEU A;  2Q9T A;  4YKP A;  3E4R A;  1VSO A;  2F7A A;  3IAZ A;  3N94 A;  4GL0 A;  1MY3 A;  4LZ5 A;  5CMM A;  3K01 A;  1MY2 A;  4QRZ A;  4C1T A;  3G3K A;  5AA3 A;  4JWY A;  5JK4 A;  1SI1 A;  1LAX A;  3LSF B;  1B7U A;  1BKA A;  5DYH A;  1IEJ A;  4QFL A;  2Q88 A;  3QXM A;  4R2B A;  3G3I A;  3KN8 A;  3S9M C;  4TLM B;  3V8X B;  3KOT A;  1SDX A;  3CR9 A;  1MY4 A;  5JTY A;  2Q8J A;  2UYE A;  3Q29 A;  1NL5 A;  3O97 A;  1BTJ A;  3G3J A;  2O68 A;  4EF1 A;  4ESX A;  3DLN A;  3MZB A;  1D4N A;  1OIB A;  3IO4 A;  1EH3 A;  1IUD A;  1FTO A;  3CFX A;  1YTV A;  3DP4 A;  1B0L A;  3MPL A;  2G93 A;  1EZ9 A;  3G3G A;  4OVJ A;  4QSC A;  4X1D A;  1JW5 A;  1BLF A;  4F1V A;  5KZT A;  3C33 A;  3OD7 A;  2PBW A;  4FJP A;  3RPW A;  4QFN A;  3O2A A;  1SW1 A;  4UAC A;  5H8S A;  3VVF A;  3TYH A;  5A5X B;  3KEI A;  4IO7 A;  3UOR A;  3PPP A;  1O7T A;  3IX1 A;  1H44 A;  5ITP A;  3F11 A;  2F36 A;  3FJG A;  3G7W A;  4GF8 A;  2XXU A;  4RY1 A;  3W15 C;  1Q35 A;  3PGF A;  4R75 A;  4Z0I A;  1MQI A;  2Z23 A;  4E0X A;  1Y1M A;  5K2X A;  3V5A A;  1B40 A;  2Y7K A;  1B2H A;  4G68 B;  1B5I A;  2Y7I A;  2UVJ A;  4ELO A;  4BDM A;  2R6G E;  4F3S A;  5CBR A;  4KQP A;  1MRP A;  3TQL A;  5I56 A;  1S7Y A;  1I6B A;  2RF1 A;  1SVX B;  4KR5 A;  3C9H A;  4ECF A;  3OO8 A;  4GRK A;  5AA2 A;  1H45 A;  2XXX A;  4Q0C A;  3PMW A;  1MXZ A;  3VLU A;  4EQ9 A;  3VLW A;  2F8D A;  4LQ2 A;  3T22 A;  4QFP A;  5L8D A;  1SW2 A;  1QUI A;  2ZYK A;  3MPK A;  2RKM A;  1MQG A;  3WAF A;  3S9N C;  3R7X A;  4LQ5 A;  1GV8 A;  4IO3 A;  1IIW A;  1DMB A;  2XXP A;  3CFL A;  2A5T A;  2XHD A;  1FTM A;  2P1S A;  3FV1 A;  3H6W A;  4IB2 A;  4PET A;  4TQU Q;  4NF5 A;  4OHN A;  2HEU A;  1UTH B;  2O84 X;  3C36 A;  1XOC A;  2DVZ A;  4G8H A;  2HCA A;  1FQE A;  1B32 A;  2F7C A;  4KPT A;  4R72 A;  4GQO A;  5A5X A;  2UVI A;  4LZ7 A;  2H5Y A;  4LP2 B;  3FIR A;  1QKB A;  1UTB B;  1XVY A;  2ONR A;  4GD5 A;  3RGY A;  4JWX A;  4F2O A;  2QMX A;  4Q5T A;  1NNT A;  5IAI A;  5KCJ A;  1Z7N E;  1LAG E;  2OCU A;  3FV2 A;  1MDQ A;  3KSX A;  4NMY A;  1ZU0 A;  1YPN A;  1JVX A;  4U2R A;  2D5W A;  5H8H A;  2XXW A;  3VFJ A;  5ITO A;  3SEU A;  1JNF A;  2M8C A;  4U1O A;  3K02 A;  3QSL A;  4POW A;  1SYH A;  4MFI A;  3JV9 A;  4Q30 B;  3RTW B;  5ICQ A;  3S9E A;  4OQO A;  2E1S A;  3DM0 A;  3TOD A;  3PMV A;  2Y84 A;  5CC2 A;  2DWA A;  1L5T A;  3T66 A;  4H6D A;  4JXI A;  2QS2 A;  4IY5 A;  3SER A;  1YCJ A;  1QKA A;  3EF7 A;  2ANJ A;  3IOT A;  1NH8 A;  1AIV A;  3E13 X;  3IOU A;  4OEV A;  4ZEI A;  4FAT A;  2HAU A;  3JZJ A;  3OMB A;  3SES A;  2GHA A;  3IJX B;  3HST A;  4YKJ A;  4PFY A;  4WXJ A;  2RIN A;  4R9F A;  1GR2 A;  1M5F A;  1XT8 A;  1SI0 A;  4GFR A;  2LAO A;  4NWC A;  4RYA A;  2NWJ A;  3QAX A;  5CMB A;  3T9V A;  3UP9 A;  3TCF A;  1POT A;  1UTH A;  2XX9 A;  2I0C A;  3VXC A;  4EXK A;  2NVU B;  4MLV A;  4QF9 A;  1JVY A;  1USY E;  4XXU A;  1R9L A;  3PUW E;  4DIG A;  4EXL A;  5IKB A;  4F18 A;  1OMP A;  5ISU A;  3HO7 A;  1URS A;  1ANF A;  4GL8 A;  4WED A;  1LFG A;  5CMC A;  3E9X A;  3H3G A;  3K1M A;  3TTK A;  1N7W A;  2ZNT A;  3MAM A;  3SKP A;  1BIY A;  1O63 A;  4OMB A;  2REJ A;  4FOR A;  4NF8 A;  4OXV A;  5I2K A;  5L9S A;  2AL5 A;  4G77 A;  2NXO A;  1ELJ A;  1PDA A;  2ABH A;  2UVG A;  1UIU A;  4NED A;  4ZZE A;  1B58 A;  1QUK A;  2XXI A;  3R6U A;  2QPQ A;  4GWO A;  1EZO A;  1SQY A;  1WVJ A;  5H8N B;  4FIM A;  1OVB A;  2ALU A;  3FD3 A;  3KZG A;  4KD5 A;  2QS1 A;  3EPE A;  3VVD A;  5M2V A;  1ZLQ A;  4MH5 A;  2OBG A;  3RLF E;  2ZYN A;  4BDL A;  3FJM A;  2REG A;  4GXS B;  1Y1Z A;  3P7I A;  4OFJ A;  3HCQ A;  1JET A;  2P0S A;  5BUU A;  3T96 B;  2DVC A;  4DE8 A;  3MW0 A;  1NNP A;  1B05 A;  1FTJ A;  3O28 A;  1B3F A;  2DWI A;  4KYS A;  4PFT A;  1ZMG A;  3DEL B;  2DYX A;  2OJT A;  3ONM A;  1B0H A;  3I5O A;  3KOS A;  5K2Y A;  3ZKK A;  3ZKL A;  3K0V A;  4E0W A;  4I62 A;  4F1Y A;  5I56 B;  3ILT B;  5KDT B;  1EU8 A;  2PX1 A;  5I57 B;  5B7D A;  1II5 A;  3PPN A;  4X48 A;  4F3B A;  5FTH A;  2AYS A;  1MXX A;  4G68 C;  1P1O A;  3TDJ A;  3PV0 E;  3TMG A;  1D9Y A;  2QS3 A;  2ZYM A;  1MXY A;  2ONS A;  2AIX A;  1Y3Q A;  2HAV A;  1PBQ A;  3N26 A;  4U23 A;  2V3T A;  1MXV A;  1SD3 A;  1B7Z A;  2D3I A;  4O3A A;  2O6A A;  4P11 A;  2V84 A;  3TTN A;  4G4P A;  4QSE A;  4RJZ A;  3H6U A;  1QUJ A;  3FGS A;  3MBP A;  1JW1 A;  2PVU A;  4GIZ A;  1MS7 A;  3KGC A;  1D9V A;  1P1W A;  1H76 A;  3FVG A;  4R74 A;  5DVJ A;  2OZZ A;  4IGT A;  2ZXT A;  4U21 A;  3ECR A;  3FAS A;  4F22 A;  3K4U A;  4UA8 A;  5TPA B;  4IO5 A;  2H9B A;  1B4H A;  2F34 A;  1PEB A;  2V3U A;  1P99 A;  3OOA A;  4K3F A;  4NTL A;  3TPA A;  3HN0 A;  4JWO A;  4L17 A;  3TEP A;  1FQD A;  3S2V A;  3ZSF A;  1FQF A;  4F3P A;  4QHQ A;  1B4Z A;  1IIT A;  2V25 A;  4RPN A;  1S9T A;  3MZ9 A;  2F5X A;  3BFU A;  1MPC A;  1RYX A;  1FCK A;  2Q2A A;  3HHG A;  3MQ9 A;  4H5F A;  1MY1 A;  4OFL A;  4QFK A;  4XTC Q;  2QMW A;  1B9J A;  2X7P A;  3OSQ A;  2DQV A;  4XKP A;  3MP1 A;  4OTE A;  1LGB C;  4I9D A;  4OEN A;  3DP8 A;  4G68 A;  4HS7 A;  5I59 B;  3RN8 A;  3BFT A;  3MP8 A;  4OWD A;  3TQW A;  5J1D A;  4R9G A;  1LLS A;  2G29 A;  4XIG Q;  2O1M A;  1TXF A;  2RC9 A;  4DXC A;  1OQH A;  3CI8 A;  3K00 A;  2YJP A;  4KFQ A;  4U22 A;  2XXY A;  2FA7 A;  5TP9 A;  3TCH A;  4EQ7 A;  2NUV A;  1FTL A;  1UIV A;  1RKM A;  2O69 A;  5CRY A;  3OO9 A;  3JYR A;  1B46 A;  2B3F A;  3FZV A;  3HV1 A;  4G8M A;  4PE5 B;  1GTK A;  2BJJ X;  2VP1 A;  1CB6 A;  2DXR A;  3A3U A;  1IZ1 A;  4IY6 A;  3VLV A;  1FTK A;  4BLA A;  1MH3 A;  5I58 B;  4N07 A;  4RPO A;  1B6H A;  4JSO A;  1XS5 A;  3HPI A;  4H65 A;  2DOJ A;  1N04 A;  1BP5 A;  5CMK A;  3GBB A;  2Z22 A;  3FXU A;  3QIM A;  2RCB A;  3VE1 B;  3T93 B;  1F9B A;  1N3X A;  1P1U A;  1VE4 A;  1YAE A;  2DE2 A;  4OET A;  4YZZ A;  3KG2 A;  3C31 A;  5DVF A;  4G8N A;  3RUM A;  4RXL A;  1LFI A;  5KCJ B;  4YIC A;  3L6H A;  4U4X A;  1H43 A;  2I0B A;  1MH4 A;  4DXB A;  2YLN A;  5I59 A;  2HZL A;  3C35 A;  3OO6 A;  5HPQ A;  4M4G A;  1OQG A;  1MG1 A;  4QSD A;  4YB5 A;  4JDF A;  3N6U A;  3RT6 B;  3QK6 A;  5HM4 B;  3IOV A;  1D3K A;  3WAE A;  2DP8 A;  5TP9 B;  1IXH A;  4H67 A;  4LZ8 A;  3V89 B;  4DDD A;  3FVN A;  2XXQ A;  1B1H A;  3UN6 A;  1UQW A;  3K6W A;  3ILU B;  2ZNS A;  2IEE A;  4IO6 A;  4KYD A;  3TTL A;  2KLF A;  2XXT A;  4EF2 A;  3PPQ A;  1SW5 A;  1WOD A;  3H6V A;  1POY 1;  3MC2 A;  3G3F A;  1B3L A;  2ESN A;  2VHA A;  1SBP A;  3FAT A;  1B1X A;  3KJT A;  2RC7 A;  4TOZ A;  4EQB A;  5I58 A;  1DOT A;  1ZJL A;  3O6I A;  4FE8 A;  1MDP 1;  4YU0 A;  2UVH A;  3Q27 A;  3M3K A;  3OSR A;  2HQ0 A;  4YB7 A;  3W9V A;  3C34 A;  4F3G A;  4YAH X;  3SEV A;  4LUB A;  4U1Z A;  3DP6 A;  2I3V A;  2X7Q A;  2V3Q A;  2ONK E;  3MVY A;  1M5E A;  3PPO A;  5EHS A;  3PUZ E;  4OYV A;  3OEN A;  3KJ7 A;  2VD3 A;  4LA9 A;  2DE4 A;  4OFO A;  1SYI A;  1VFE A;  2DSF A;  5EHM A;  3O9P A;  4AB6 A;  3G3H A;  3Q26 A;  4FEB A;  3SET A;  5H8Q A;  3CSG A;  4YB6 A;  5I2K B;  1P1Q A;  3CG1 A;  2ZNU A;  1A7L A;  1B3E A;  2Z8F A;  1LB9 A;  3B6W A;  3H06 B;  1LAH E;  2XD3 A;  4OZ9 A;  1LCT A;  2OLB A;  4ONY A;  4DXU A;  4XKQ A;  1TT1 A;  3IOW A;  1FW0 A;  1I69 A;  2IA4 A;  1MPD A;  1LB8 A;  3EN3 A;  3KN7 A;  3LBS A;  3MJN A;  4HTG A;  4XKR A;  2E0S A;  2VGQ A;  3OXN A;  4P0I A;  1N7X A;  3GZG A;  3CIJ A;  1NNK A;  3USD A;  5CM6 A;  3K1P A;  2QJE A;  2R71 A;  1CE2 A;  1P1N A;  1DPP A;  1NH7 A;  2GHB A;  2HFB A;  3Q25 A;  3TFL A;  4LVQ A;  1Y3N A;  4EUO A;  2B65 A;  4G2Z A;  1JQF A;  1LAF E;  2FYI A;  4ZEK A;  3RTF B;  1DSN A;  2QRY A;  3U92 A;  1T0K A;  3S4U A;  4TLL B;  2GH9 A;  1IXC A;  1JEV A;  3EQ1 A;  4PP0 A;  5H8F B;  2WKY A;  1PB8 A;  4ZEB A;  3RT8 A;  4H0W A;  5BWJ A;  4C1U A;  4GVO A;  5I57 A;  2I48 A;  5KDT A;  3QUJ A;  1MQD A;  4MBP A;  4WKM A;  3IJO B;  4YMA A;  1MQH A;  1OVT A;  1R1N A;  3PU5 A;  1N84 A;  1B5H A;  4ZE9 A;  3CG3 A;  4R2F A;  3VVE A;  4F31 B;  3KFM A;  1M5B A;  3PUX E;  5H8Q B;  4WEP A;  1I6Q A;  1H3D A;  2I4B A;  3N5L A;  5AA1 A;  1XC1 A;  3TKD A;  1DTG A;  3M3L A;  1B7H A;  5HBC A;  4X1B A;  4F19 A;  5I2N A;  3MZ1 A;  1Q1K A;  3GBA A;  4Z7E A;  3GLB A;  2GFE A;  3K6V A;  2V93 A;  2PYY A;  2OWT A;  3MVW A;  3H6T A;  4PFW A;  2ZYO A;  2W7Y A;  1MM7 A;  5TPA A;  3RY3 A;  5AE4 A;  5LOM A;  1XVX A;  3IB1 A;  5AA4 B;  1URG A;  3PMX A;  3I3V A;  3QYT A;  3BKI B;  2O7U A;  4O3B A;  3LSX A;  1PC3 A;  3U72 A;  2GRV A;  1URD A;  3GXA A;  3LSL A;  2XXR A;  2B3B A;  3PD9 A;  4H5G A;  4OER A;  3CSB A;  3UK4 A;  4NF4 B;  5JEI A;  4BDO A;  3B7D A;  3A3C A;  2D21 A;  1QVS A;  3EHS A;  3IB2 A;  2F78 A;  3C32 A;  3IO6 A;  4H8I A;  2DS9 A;  1FQC A;  3MP6 A;  5B70 A;  1LFH A;  5FHN A;  1ZIU A;  4DCX A;  3VDF A;  4ISU A;  2O51 A;  2O7I A;  3EHU A;  2P2A A;  4KYE A;  1AL3 A;  2RC8 A;  4R73 A;  4R6Y A;  4JBZ A;  3K6X A;  3FXR A;  4KCC A;  1ATG A;  1J1N A;  2H99 A;  3AXF A;  3OEK A;  5DTB A;  4ZE8 A;  2Q89 A;  3U94 A;  4GOT A;  5I2N B;  3C4M A;  3FJ7 A;  1RYO A;  2DWH A;  1USY H;  4NF6 B;  2PMS A;  3FVO A;  5DT6 A;  3LSW A;  1EZP A;  2A5S A;  4M1V A;  3SEX A;  3U8Q A;  1AOV A;  1MXW A;  5L9O A;  3SEY A;  3K6U A;  5CI5 A;  2VD2 A;  3FXQ A;  4ZS9 A;  3A09 A;  4N6P A;  4H1X A;  4ELP A;  4RNS A;  4ZEC A;  4X9T A;  5AA4 A;  4RK9 A;  2F6G A;  1A8E A;  3H4Z A;  2Y7R A;  3UA8 A;  3CRB A;  3O66 A;  2H4I A;  3HHF A;  4FAJ A;  1HSL A;  4GLI A;  1A8F A;  4H8J A;  4BDR A;  3M3F A;  4IGR A;  3L6G A;  4NF4 A;  4PQJ A;  4ESW A;  4FEC A;  2DE3 A;  1R9Q A;  2H25 A;  3O6G A;  2Y7P A;  4LON B;  4YKK A;  3CVG A;  4DLD A;  1OLC A;  1US5 A;  3U1O A;  3FVK A;  3IOR A;  5DVI A;  4RA1 A;  3RNN A;  3D4G A;  5FHO A;  1A40 A;  3TEL A;  5F7V A;  1MPB A;  4DCY A;  4THI A;  5AA2 B;  3QUF A;  5JTY B;  4F2Q A;  1DPE A;  1ZKB A;  4YMB A;  5ICT A;  2QS4 A;  3V83 A;  2O1L A;  3E3K A;  4AQ4 A;  1QW0 A;  1R6Z A;  4ZED A;  4ZDM A;  1IXI A;  1OLA A;  3IL1 B;  3MVX A;  4F1U A;  1A54 A;  2QSX A;  4QFO A;  1FQB A;  1A55 A;  1VR5 A;  1PBP A;  3PPR A;  4NF6 A;  4ZEF A;  3U93 A;  4XKN A;  2I4C A;  2VOZ A;  3TAJ A;  2A5T B;  4I8C A;  3IB0 A;  3FUZ A;  3PUY E;  2I6E A;  4FED A;  4POX A;  2OWS A;  4NF5 B;  5AA2 D;  1LBB A;  1NNF A;  1Y4C A;  3TUS A;  2HXW A;  1Y4T A;  4RK2 A;  1HSE A;  3THI A;  4R6K A;  1TWY A;  3CFZ A;  4Q8R A;  2YPN A;  1S50 A;  2DXY A;  3KSJ A;  1AMF A;  3B6T A;  1UTB A;  3KBR A;  3SEW A;  2I3W A;  1GVC A;  1MY0 A;  1N0T A;  1PB9 A;  2OK2 A;  5CBS A;  2F6P A;  1Y20 A;  4N13 A;  3H7M A;  1ZTY A;  3SDF A;  2I49 A;  1IQ7 A;  1Y9U A;  5H8H B;  4PFU A;  3S9L C;  1O64 A;  1M5C A;  1IXG A;  2CZL A;  2F35 A;  4GXA A;  5TU0 A;  1KWH A;  5L9M A;  4KCD A;  3ODB A;  3TTR A;  1B52 A;  2PT1 A;  3B6Q A;  1VFD A;  4IO2 A;  4O3C A;  3T9U A;  3BBR A;  2XX7 A;  4F29 A;  1M5D A;  1TFD A;  1WDN A;  3LR1 A;  4JSD A;  5DEX B;  5F1Q A;  1SW4 A;  4DZ1 A;  2QL3 A;  2THI A;  3K2D A;  3MUQ A;  4OEU A;  1B5J A;  2F97 A;  1JW4 A;  1Y3P A;  3D4C A;  4R6H A;  2H98 A;  1B3H A;  2Q2C A;  3TZA A;  1Z7M E;  1PB7 A;  4AB5 A;  4NE4 A;  4JB7 A;  4P0G A;  3TTM A;  2UXA A;  3IK6 B;  1GGG A;  4YKI A;  1NFT A;  3LUY A;  3MVZ A;  4MLQ A;  2RCA A;  5FHM A;  3R26 A;  4C0R A;  2UYF A;  2ZMB A;  3O6H A;  3T9X B;  4NWD A;  3VV5 A;  4BDN A;  2XX8 A;  4ZZA A;  5H8F A;  1A99 A;  1QUL A;  3W9W A;  3T9H B;  3EHT A;  3H03 A;  2R9J A;  5I84 A;  2Y7W A;  3Q28 A;  1I6A A;  3RQT A;  2F7B A;  1MXU A;  4ELR A;  3PUV E;  2NOO A;  3O29 A;  2XD2 A;  3LC8 A;  3OEL A;  3OEM A;  4HCY A;  3VXB A;  2Z8E A;  3N6T A;  4NF8 B;  5EYF A;  4KI0 E;  1FQA A;  2I58 A;  3K1N A;  4LAT A;  4U4S A;  3UIF A;  4F39 A;  1LST A;  1DTZ A;  5ELV A;  1US4 A;  2Z8D A;  3OO7 A;  2DWJ A;  1AH5 A;  2PT2 A;  2XXH A;  1MM6 A;  5FTI A;  3TCG A;  2HZK A;  3UGW A;  4ND9 A;  5H8N A;  5DEX A;  3IR1 A;  3ZS6 A;  1LCF A;  4MF3 A;  2CMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...