3QAXA

Crystal structure analysis of the cpb0502
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
232
structure length
232
Chain Sequence
RIWIVGTNATYPPFEYVDAQGEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSRQKEIALLPYYGDEVQELMVVSKRSLETPVLPLTQYSSVAVQTGTYQEHYLLSQPGICVRSFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNLVATRLELPPECWVLGCGLGVAKDRPEEIQTIQQAITDLKSEGVIQSLTKKWQLSEVAYEAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable ABC transporter arginine-binding protein ArtJ
publication title Crystal structure of the cpb0502
rcsb
source organism Chlamydophila pneumoniae
molecule tags Transport protein
total genus 64
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qaxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qaxA02
1MY1A 3MUQA 3CFZA 3T9UA 1SD3A 3O29A 1Y20A 2R71A 3OXNA 1R9LA 5I58A 3GBBA 5JK4A 3G3HA 3O2AA 1MY0A 3K1MA 4QFPA 1PB8A 2XD2A 4IO3A 2HEUA 4Q8RA 5ICTA 3K6XA 3MW0A 3JZJA 4DXCA 1DPPA 1PEBA 1JNFA 4GQOA 4ZZAA 4RXLA 1A7LA 1MXUA 3K6WA 3FVNA 1BIYA 4PQJA 4JWXA 4OERA 2DQVA 2ONSA 1PB9A 3IOVA 4YKKA 1MS7A 4QHQA 3H6WA 1MQHA 3TUSA 3TCFA 4YKPA 2ONRA 4QSEA 2F7CA 2O7IA 4QFLA 4R72A 1Y1ZA 2Q89A 3THIA 4Q30B 2ZYNA 2QS3A 4U22A 3PPPA 1N0TA 3M3LA 3MBPA 3CR9A 2RF1A 3IB2A 4R75A 4G68A 5KDTA 4H5GA 4NF8B 4XTCQ 1XVXA 4OFLA 3TCGA 3M3KA 3SDFA 1NNTA 3MVXA 1LBBA 4KYDA 3O6IA 3VLUA 2VD2A 1LCFA 1VSOA 3VLWA 1MG1A 1I69A 2OBGA 4G2ZA 4ZE8A 3DLNA 4F19A 4N6PA 4FATA 3TQLA 4TOZA 1A54A 1T0KA 1TFDA 3HV1A 5I56A 1MY2A 2BJJX 2XX7A 4Q5TA 3HO7A 3O9PA 1HSLA 1GGGA 4U4XA 5I2NA 1POY1 3T96B 3FXRA 1UTHA 2Y84A 4F1VA 1WDNA 3ZKKA 3KGCA 3TELA 3N5LA 5K2YA 3VLVA 2I48A 4NMYA 4DDDA 1DOTA 3CSBA 3SEUA 4ZEFA 5CMKA 1FQDA 4G68C 1GTKA 2UXAA 4OFOA 4GVOA 3RNNA 3H06B 1FCKA 3WAFA 4POXA 4TQUQ 2HAVA 3PPRA 4RK2A 4EDPA 2E0SA 4LATA 3B6TA 1SI0A 1ZKBA 1SW1A 3T22A 3IOUA 2ESNA 4EXKA 1IXHA 4FECA 3Q26A 1MM6A 4I62A 1YPNA 3TDJA 4XKRA 4YAHX 3C32A 3JYRA 2O68A 4GFRA 1MXVA 4OESA 4YMAA 2Y7WA 2XX9A 3R26A 3V89B 1JEUA 2RINA 4IB2A 4F2OA 2B65A 1JVYA 2DXRA 3RY3A 4OWDA 2UYFA 3EF7A 4P0GA 1IIWA 1GR2A 3KJ7A 1B3FA 3CG3A 3G3GA 1P1OA 4THIA 1LAHE 4R9GA 1DSNA 2YLNA 3H6VA 3Q27A 3RTWB 3HSTA 3TTMA 2Z22A 1ANFA 4QFNA 2HFBA 3L6GA 4H67A 4FIMA 3C34A 2DE2A 2AYSA 1FTMA 1A8FA 4IY6A 2QMWA 1Q1KA 4ZEKA 3USDA 1EZOA 1B05A 4H8IA 4F1YA 1O63A 1RYOA 4M1VA 1SVXB 4LQ2A 4YMBA 4DCYA 2XXXA 3MZBA 1YTVA 4DXBA 4OEUA 1PC3A 4JBZA 2OLBA 1MQDA 2XXTA 1DTZA 2I4BA 3QUFA 1IZ1A 4YICA 3TTLA 1VFDA 5BWJA 1MXYA 1FQCA 1NL5A 1O64A 3W9WA 1OVTA 5EHSA 3FATA 3K01A 3I3VA 3M3FA 3OO9A 4R6KA 1LAXA 2QS2A 1QKAA 1A8EA 5ITOA 3D4CA 2O1LA 3FJ7A 3UN6A 2H99A 4X9TA 5H8FA 1EU8A 4POWA 3T9XB 1SQYA 3RGYA 3FD3A 1I6QA 3OOAA 4JXIA 3KBRA 3G7WA 1LFIA 1SW4A 4FEDA 1BLFA 2NWJA 2HZKA 1LSTA 3KOSA 1JW1A 3LR1A 2IA4A 2ZYMA 4F3SA 1OQHA 4DXUA 1KWHA 2OWSA 4YKJA 1LB9A 1B4ZA 1ZU0A 5LOMA 4X1DA 1R9QA 5AE4A 2DOJA 5JTYB 2V84A 4TLMB 3RUMA 5CBSA 2UVHA 5KCJB 4G4PA 4LVQA 2UVGA 1OIBA 3KN8A 1N3WA 1US5A 3CI8A 3KSJA 2AL4A 1QUIA 3D4GA 1B40A 1Y4TA 1FQEA 1PB7A 3IO6A 3U93A 2PMSA 1NNPA 1P1QA 2Y7IA 4OEVA 2PT2A 4NTLA 5FHMA 3TODA 4O3CA 1N7WA 4EQBA 3U1OA 3RN8A 3QIMA 2PT1A 3MP1A 2V25A 4PFYA 4FORA 3EHUA 3QXMA 4KHZE 5IAIA 3G3KA 3FV1A 3N6TA 2O69A 3H6UA 4L17A 3MZ9A 2ZNTA 4HW8A 1B51A 3FXUA 1D4NA 1M5BA 2XXIA 4G8NA 4U23A 2DE3A 4MLQA 4DCXA 3H3GA 1OLCA 4H1XA 2HQ0A 4PP0A 3OO8A 4DZ1A 3S9EA 1XVYA 3OD7A 1QUKA 3QSLA 1EZPA 3TYHA 4F1UA 1PBQA 5HM4B 3SERA 2RC9A 2HAUA 4QSDA 1SYIA 3PUZE 1QJMA 2Y7KA 1AH5A 2NXOA 3PPQA 4YB5A 1FTJA 4ND9A 2PYYA 5I59B 4BDRA 3B6WA 5ITPA 3EPEA 4ZEIA 4HS7A 3JV9A 4LA9A 3MVWA 3BBRA 4X1BA 4IGRA 2A5TB 4NF5B 3MP6A 1PBPA 4LZ5A 3U8QA 3DM0A 3PGFA 1B3LA 4LP2B 3KOTA 2O7UA 4OTEA 2VD3A 4PE5B 4BDNA 5JTYA 5I84A 3O6HA 4R6HA 3OO6A 5KCJA 4KYSA 5L9MA 2CZLA 5F7VA 2H4IA 4BDOA 3OMBA 1HSJA 2Z8FA 4KR5A 2P2AA 2VP1A 3FJGA 3LC8A 2O51A 3TAJA 3QK6A 5H8QB 1B2HA 1NKXA 1URDA 1XHYA 3PUWE 2VHAA 2LAOA 1IITA 3BFUA 5CM6A 1LAGE 3TTKA 1Y1MA 3EQ1A 3LSXA 4RJZA 3K0VA 4I9DA 4ZS9A 3V83A 1R6ZA 3L6HA 3VXCA 1LBCA 3FXQA 3K00A 4F39A 1B46A 3T9VA 4F3BA 1ELJA 3E3KA 4JWYA 3Q28A 1LCTA 4H8JA 1ATGA 1XS5A 1USYH 4RA1A 1B9JA 1JQFA 5FHNA 4UACA 4NF4B 3VVEA 4F22A 4LONB 1M5CA 3V5AA 4ELOA 3O97A 5CMMA 1NMUA 4RY1A 5I2KB 2R9JA 4ECFA 1NFTA 1IXGA 1L5TA 4OHNA 2D21A 3K02A 2F6GA 2XXVA 1MDP1 2I3VA 5DYHA 4RPNA 1H45A 4QF9A 2NOOA 1MM7A 1NH7A 2PVUA 1HSEA 1PDAA 3O28A 2DSFA 3PD8A 1LGBC 2XXHA 2A5TA 3SETA 4NF5A 4OENA 5H8SA 1B32A 2ZMBA 4G8MA 3K2DA 4ESXA 1MH3A 4IGTA 5L8DA 2GRVA 2DWJA 3UGWA 3S9NC 4KPTA 2F7AA 4F3PA 4BDMA 3CFLA 1RKMA 1UQWA 3IOTA 5H8QA 5AA2B 1Y9UA 3W15C 1XT8A 3E9XA 5F1QA 1ZBMA 4BDLA 2I6EA 2O1MA 5TU0A 4RNSA 2DWIA 3TEPA 1N84A 4Z7EA 1MH4A 3QAXA 2H98A 3IB1A 3PPOA 1P1WA 3N26A 2XXQA 1O7TA 4YU0A 1B5HA 2HCAA 5AA4B 1LFGA 1YCJA 2F78A 3IO4A 2HZLA 3R7XA 5FTIA 3RT8A 1GVCA 5DEXB 4QRZA 4QFOA 3N6UA 1OQGA 3U72A 4OVJA 3VE1B 2R6GE 4FAJA 4NF4A 1DTGA 2ALUA 4OETA 3TMGA 1SBPA 4HTGA 3LUYA 3MAMA 4NF8A 2I4CA 1TFAA 5I2KA 4OYVA 5AA3A 3IX1A 2XXUA 3ZSFA 5DVFA 3PD9A 5EHMA 3SEYA 3U92A 4LZ8A 4LZ7A 4IO2A 1IUDA 1S50A 1QUJA 4H5FA 3FUZA 4UA8A 4C1TA 3KN7A 4GD5A 4GXSB 4U1OA 2REJA 3K6VA 4R2BA 3TPAA 2O84X 4G77A 1IEJA 3E13X 1P1NA 2H5YA 3FZVA 3FGSA 3TCHA 3S9LC 3BFTA 4R2FA 4EQ9A 1URGA 3I6VA 1MXZA 3MP8A 3GLBA 3T9HB 5AA2A 2RCBA 4WEDA 4KCDA 4K3FA 4YB7A 3GZGA 5KZTA 4EQ7A 4RPOA 1N76A 4ZZEA 3ILUB 1DMBA 1P99A 3OEMA 1B7HA 4DIGA 2DWHA 5EYFA 4NWCA 4GL8A 4MFIA 2XXRA 4ZECA 1D9YA 1B6HA 2PX1A 3Q25A 2GHAA 3C33A 5ELVA 4QFKA 5DEXA 2DE4A 3FVKA 2F35A 2W7YA 1A40A 5H8HB 4JDFA 2ZYOA 3KSXA 4U1ZA 2X7PA 1QKBA 1H43A 3KZGA 3E4RA 1MQJA 4HCYA 3W9VA 3H4ZA 4ZE9A 3MPKA 1BP5A 3ONMA 1BKAA 1UIVA 4O3AA 1NNKA 1ZIUA 4H0WA 3FVOA 4I1DA 2Q88A 3HCQA 3QUJA 4GRKA 2UYEA 1B1HA 1OMPA 1QVSA 2F8DA 2H25A 1F9BA 4PFTA 3EHTA 3V8XB 4XKQA 3KJTA 2G29A 1JW5A 3MVYA 4N07A 2OJTA 4Q0CA 3HHGA 5B70A 2XD3A 2B3BA 3MQ9A 4TLLB 4NE4A 3IJXB 1LLSA 4NEDA 3TZAA 3H7MA 3CSGA 2Q9TA 3LBSA 2XXYA 3UK4A 3ZKLA 2RKMA 2QS4A 3LSFB 2RC7A 2I0CA 1MQGA 2F34A 1SW2A 3PV0E 1SW5A 4NWDA 1S9TA 4C1UA 1I6AA 1BTJA 3IORA 2D5WA 2XHDA 1VFEA 4MLVA 4NF6B 4G68B 4F3GA 3OEKA 2H9BA 4RK9A 1SYHA 2V3QA 1S7YA 4M4GA 1AOVA 1AL3A 2QL3A 5H8HA 4AB6A 3VV5A 4XKNA 1OVBA 4ELRA 3MJNA 2IEEA 4MH5A 3SEXA 3O66A 1MXXA 1USYE 1TT1A 3UORA 1B7UA 2RCAA 1JVXA 1LFHA 5CMBA 2QRYA 3IAZA 5CMCA 3OELA 5TP9B 1CB6A 1TXFA 4MF3A 2QPQA 4P0IA 5L9OA 3ZS6A 2DYXA 2CMOA 1FTOA 5AA1A 4F18A 4FE8A 1H76A 1H44A 3QYTA 2Y7RA 1AMFA 2XXPA 3PMVA 1B3EA 4XXUA 4ZDMA 5L9SA 5CBRA 4R74A 3RTFB 1ZTYA 1EZ9A 3KN3A 3SEWA 2ZNUA 3UP9A 4FEBA 4P11A 3CFXA 1B5IA 4U4SA 4IO6A 4IY5A 3C35A 3TFLA 2I58A 1Y3QA 2B3FA 2Z8EA 4ZEDA 5ICQA 3HPIA 1Z7NE 3S2VA 2V93A 4Z0IA 3A09A 3IL1B 1US4A 1B3HA 4E0XA 1IXIA 3F11A 3IR1A 4R9FA 3WAEA 3R6UA 3C4MA 1FQAA 4YZZA 4NF6A 1AIVA 3DELB 5I57B 2P1SA 1FQFA 3I5OA 2DVZA 5M2VA 4KD5A 1Y3NA 5I59A 3C36A 3IOWA 3B6QA 2A5SA 1IXCA 3A3CA 4ESWA 3B7DA 5DVJA 2Z23A 3PUXE 2DWAA 1WVJA 4KYEA 5IKBA 1A99A 2HXWA 4HCWA 2Q8JA 4GIZA 4ISUA 2I49A 4PFUA 3CRBA 4ELQA 4GL0A 2P0SA 3S4UA 3SEVA 3A3UA 5TP9A 4RYAA 3RQTA 4GLIA 3MZ1A 4G8HA 3ECRA 1SI1A 2D3IA 2QSXA 3Q29A 4EF1A 3SESA 5CI5A 3G3FA 1I6BA 2X7QA 1P1UA 1ZJLA 3UA8A 2UVJA 3OSQA 2Z8DA 3P7IA 1MPDA 4YKIA 2V3TA 4E0WA 2F6PA 4BDQA 2YPNA 2QS1A 4WKMA 4F31B 3OENA 3GBAA 1JW4A 2G93A 4C0RA 3OO7A 3DP6A 5FHOA 5H8FB 3UIFA 1B0HA 3MWBA 1M5FA 2ONKE 5CRYA 3AXFA 1UTBB 1Q35A 5ISUA 2Y7PA 4OMBA 4JSOA 4KFQA 3T66A 5H8NB 2F36A 3GXAA 1B52A 3PMWA 4WXJA 5A5XB 4O3BA 2KLFA 4EUOA 1B7ZA 3LSLA 2ABHA 1D3KA 3KG2A 1OLAA 3BKIB 3IK6B 2I0BA 2FYIA 4F29A 5I57A 1N7XA 1A55A 2DVCA 4H65A 1NH8A 1B0LA 1YAEA 3M8UA 4KQPA 4AQ4A 3K1PA 5BUUA 3MC2A 2FNCA 1JETA 4KI0E 4GOTA 1Y4CA 5CC2A 2OCUA 5DVIA 5K2XA 3TTRA 1B58A 2ZXTA 3FVGA 4JSDA 1XOCA 3K6UA 1DPEA 4YB6A 4LQ5A 1FQBA 3H6TA 3TKDA 2I3WA 3G3IA 4DE8A 2Q2CA 4OZ9A 3HN0A 2GH9A 1MXWA 1Y3PA 1VE4A 4GF8A 2QMXA 2REGA 5FTHA 1QULA 4JWOA 4LUBA 1MPCA 2F97A 2F5XA 2ZNSA 4XKPA 3PPNA 1MQIA 4QSCA 4U2RA 3RT6B 4GWOA 3U94A 3K4UA 1B3GA 2GHBA 3FASA 2AL5A 2Q2AA 5AA2D 3OSRA 3CIJA 1QW0A 1J1NA 4EXLA 1H3DA 4JB7A 3T93B 3TQWA 4F2QA 2RC8A 2YJPA 3VDFA 2PBWA 2QJEA 4H6DA 5AA4A 5JEIA 2FA7A 1GV8A 3HHFA 1B4HA 4IO4A 3C9HA 1JEVA 3K1NA 2DP8A 1UTBA 2OK2A 1TWYA 3DP4A 3N94A 3KEIA 5H8NA 4IO7A 4PFWA 3O6GA 2ZYKA 1N3XA 5A5XA 4U21A 5J1DA 1II5A 5B7DA 2AIXA 3IB0A 3IJOB 2O6AA 1B5JA 3FJMA 1MY4A 5TPAB 2XX8A 3LSWA 1Z7ME 3EHSA 3S9MC 3CG1A 4ONYA 3SKPA 4GXAA 5I58B 3VVFA 1MDQA 1MY3A 3G3JA 4R73A 3CVGA 3RLFE 1R1NA 1IQ7A 1FW0A 1UIUA 3FV2A 5HPQA 2UVIA 3RPWA 4OQOA 3TTNA 1XC1A 1MRPA 1EH3A 3PUVE 2DXYA 2E1SA 3C31A 4WEPA 3VFJA 2F7BA 1ZLQA 4KCCA 3FIRA 4IO5A 5HBCA 3PU5A 4PETA 1FTKA 4XIGQ 1M5EA 5DTBA 3MVZA 3VVDA 2X26A 4X48A 3EN3A 2ANJA 2OWTA 1RYXA 3PUYE 3DP8A 2THIA 2OZZA 1M5DA 5KDTB 1VR5A 4I8CA 4BLAA 2VOZA 4FJPA 1POTA 2V3UA 3PMXA 2NUVA 1ZMGA 4AB5A 2M8CA 1SDXA 4N13A 4EF2A 2VGQA 1B1XA 4DLDA 1NNFA 1D9VA 3MPLA 5DT6A 1WODA 2NVUB 4ZEBA 3ILTB 1FTLA 2XXWA 4ELPA 5I56B 2WKYA 1LAFE 4R6YA 3KFMA 3ODBA 2GFEA 4OXVA 4OFJA 5I2NB 3H03A 5TPAA 1UTHB 3VXBA 4MBPA 2DS9A 1LB8A 1URSA 1CE2A 1MPBA 1N04A
chains in the Genus database with same CATH superfamily
1MY1A 3MUQA 3CFZA 3T9UA 1SD3A 3O29A 1Y20A 2R71A 3OXNA 1YZ0A 3D1RA 3EKIA 1R9LA 5I58A 3GBBA 5JK4A 1IMAA 3G3HA 3O2AA 1MY0A 3K1MA 4QFPA 1PB8A 2XD2A 4IO3A 2HEUA 4Q8RA 5ICTA 3K6XA 3MW0A 3JZJA 4MMPA 1FPGA 1DPPA 5T3JA 4DXCA 5EQAA 1PEBA 1JNFA 4GQOA 4ZZAA 4RXLA 4MNIA 1A7LA 1MXUA 3K6WA 3FVNA 1BIYA 4PQJA 4JWXA 4OERA 1XI6A 2DQVA 2ONSA 4NQ8A 1PB9A 3IOVA 4XEQA 4MEVA 4YKKA 1MS7A 4QHQA 3H6WA 1MQHA 4MAGA 3TUSA 3TCFA 4YKPA 2ONRA 2QVRA 4QSEA 2F7CA 2O7IA 5I3SA 4QFLA 4O94A 4R72A 1Y1ZA 2Q89A 1K9ZA 3THIA 4Q30B 2ZYNA 2QS3A 4U22A 3PPPA 1N0TA 2CZIA 3M3LA 2JJKA 3MBPA 3CR9A 4PF8A 2RF1A 3IB2A 3T1BA 4R75A 4G68A 5KDTA 4H5GA 4NF8B 4XTCQ 4PDDA 1XVXA 4OFLA 3TCGA 3M3KA 3SDFA 1NNTA 3MVXA 1LBBA 4KYDA 2OWZA 3O6IA 3VLUA 2VD2A 1LCFA 1VSOA 3VLWA 1MG1A 2WYPA 1I69A 2OBGA 4G2ZA 4ZE8A 3DLNA 5ET5A 4F19A 4N6PA 4FATA 1FBEA 3TQLA 1G0IA 4TOZA 1A54A 3FXBA 4PGPA 1T0KA 1TFDA 3HV1A 5I56A 1MY2A 2BJJX 2XX7A 4Q5TA 3HO7A 3O9PA 1HSLA 1GGGA 4U4XA 5I2NA 1POY1 3T96B 3FXRA 1UTHA 2Y84A 4F1VA 2XWOA 3HFUA 1WDNA 3ZKKA 3KGCA 1FPLA 3TELA 3N5LA 5K2YA 3VLVA 2I48A 4H46A 4NMYA 4DDDA 1DOTA 3CSBA 3SEUA 4ZEFA 5CMKA 1FQDA 4OVPA 3MSTA 4G68C 1GTKA 2UXAA 1D9QA 4OFOA 4GVOA 3RNNA 3H06B 1FCKA 3WAFA 4POXA 4TQUQ 2HAVA 3PPRA 4RK2A 4EDPA 2E0SA 1IMDA 4LATA 3B6TA 1SI0A 2CEXA 1ZKBA 1SW1A 3T22A 3IOUA 2ESNA 4EXKA 1IXHA 4FECA 3Q26A 4UABA 1MM6A 4I62A 1YPNA 4IR8A 4OVSA 3TDJA 4I3YA 4XKRA 4NGUA 4YAHX 3C32A 3JYRA 4N91A 2O68A 4GFRA 1MXVA 4OESA 4YMAA 2Y7WA 2XX9A 3R26A 3V89B 1JEUA 2RINA 4IB2A 2XWIA 4F2OA 3BIGA 2B65A 1JVYA 2DXRA 3RY3A 4OWDA 2UYFA 3EF7A 4P0GA 1IIWA 1GR2A 1SPIA 3KJ7A 1B3FA 3CG3A 3G3GA 1P1OA 4THIA 1LAHE 4R9GA 4QXDA 1DSNA 2YLNA 3H6VA 2P3VA 3Q27A 3RTWB 5ET7A 3HSTA 3TTMA 2Z22A 1ANFA 4QFNA 2HFBA 3L6GA 4H67A 4FIMA 3C34A 2DE2A 2AYSA 1FTMA 1A8FA 4IY6A 2QMWA 1Q1KA 4ZEKA 3USDA 1EZOA 1B05A 4H8IA 4F1YA 1O63A 1RYOA 4N15A 2Y5KA 4M1VA 5EYHA 1SVXB 4LQ2A 4YMBA 2FHYA 4DCYA 2XXXA 3MZBA 1YTVA 4DXBA 4OEUA 1PC3A 4JBZA 2OLBA 1MQDA 2XXTA 1DTZA 2I4BA 3QUFA 1IZ1A 4YICA 3TTLA 1VFDA 5BWJA 1MXYA 4HE2A 1FQCA 5IZ1A 1NL5A 1O64A 2WBDA 3W9WA 1OVTA 5EHSA 3FATA 3K01A 3I3VA 3M3FA 2VT5A 3OO9A 2ZZVA 4R6KA 1LAXA 2QS2A 1QKAA 1A8EA 5ITOA 3D4CA 2O1LA 3FJ7A 3UN6A 2H99A 4X9TA 5H8FA 4OA4A 1EU8A 2WX9A 1NV1A 4POWA 3T9XB 1SQYA 3RGYA 3FD3A 1I6QA 3OOAA 4JXIA 3KBRA 3G7WA 1LFIA 1SW4A 4FEDA 1BLFA 2NWJA 2HZKA 1LSTA 3KOSA 1JW1A 3LR1A 2IA4A 2ZYMA 4F3SA 1OQHA 4DXUA 1KWHA 2OWSA 4YKJA 1LB9A 1B4ZA 1ZU0A 4PBHA 1EYJA 5LOMA 4X1DA 1R9QA 1DCUA 5AE4A 2DOJA 1INPA 1K9YA 5JTYB 2V84A 4TLMB 3RUMA 5CBSA 2UVHA 5KCJB 3BIHA 4G4PA 2Q8MA 4LVQA 2UVGA 1OIBA 3KN8A 1N3WA 4N4UA 1US5A 1NUYA 2XXKA 3CI8A 3KSJA 1KA0A 2AL4A 1QUIA 3D4GA 1B40A 1Y4TA 1FQEA 1PB7A 3IO6A 3U93A 2PMSA 1NNPA 1P1QA 2Y7IA 4OEVA 2PT2A 4NTLA 5FHMA 3TODA 4O3CA 1N7WA 4EQBA 3U1OA 3RN8A 1FPBA 3QIMA 2PT1A 3MP1A 2V25A 4PFYA 4FORA 3EHUA 3QXMA 4KHZE 1KA1A 3B50A 5IAIA 3ROJA 3G3KA 3FV1A 3N6TA 2O69A 3H6UA 4L17A 3MZ9A 2ZNTA 4HW8A 1B51A 3FXUA 1D4NA 1M5BA 4XF5A 2XXIA 4G8NA 4OVRA 4U23A 2DE3A 4MLQA 4DCXA 3H3GA 1OLCA 4H1XA 2HQ0A 2FIEA 4PP0A 3OO8A 4DZ1A 3S9EA 1XVYA 3OD7A 1QUKA 3QSLA 5ET8A 1EZPA 3TYHA 4F1UA 1PBQA 5HM4B 3SERA 2RC9A 2HAUA 4QSDA 1SYIA 3PUZE 1QJMA 2Y7KA 1AH5A 2NXOA 4GWYA 3PPQA 4YB5A 2CZHA 1FTJA 4ND9A 2PYYA 5I59B 4BDRA 3B6WA 5ITPA 3EPEA 4ZEIA 4HS7A 3JV9A 4LA9A 2B4LA 2BJIA 5IZ3B 3MVWA 3BBRA 4X1BA 4IGRA 2A5TB 4NF5B 3MP6A 1PBPA 4LZ5A 3U8QA 3DM0A 3PGFA 1B3LA 4LP2B 3KOTA 2O7UA 4JVIA 4OTEA 2VD3A 4PE5B 4BDNA 5JTYA 5I84A 3O6HA 4R6HA 4PE3A 3OO6A 5KCJA 4KYSA 5L9MA 2CZLA 5F7VA 2H4IA 4BDOA 1VDWA 3OMBA 1HSJA 2Z8FA 4KR5A 2P2AA 2VP1A 3FJGA 1FBCA 3LC8A 2O51A 3TAJA 3QK6A 5I5PA 5H8QB 1NV2A 1FTAA 1B2HA 1NKXA 1URDA 1XHYA 3PUWE 2VHAA 2LAOA 1IITA 3BFUA 5CM6A 1LAGE 3TTKA 4O8MA 1Y1MA 3EQ1A 3LSXA 4O7IA 4RJZA 1FPEA 3K0VA 4I9DA 4ZS9A 3V83A 5A5LA 1R6ZA 3L6HA 3VXCA 1LBCA 3FXQA 3K00A 4F39A 2QVUA 1B46A 3T9VA 4F3BA 1ELJA 3E3KA 4JWYA 3Q28A 1LCTA 4H8JA 1ATGA 1XS5A 1USYH 4RA1A 1B9JA 1JQFA 5FHNA 1LBZA 4UACA 4NF4B 3VVEA 4F22A 4LONB 1M5CA 3V5AA 1FBHA 2XA5A 4ELOA 3O97A 5CMMA 1NMUA 4RY1A 5I2KB 2R9JA 4ECFA 1NFTA 1IXGA 5ESYA 4JVCA 1L5TA 4OHNA 2D21A 1FPDA 3K02A 2F6GA 1NUXA 2XXVA 1MDP1 4GX6A 2I3VA 5DYHA 4RPNA 1H45A 4QF9A 2NOOA 1MM7A 1NH7A 2PVUA 1HSEA 1PDAA 3O28A 5IZ3A 2DSFA 3PD8A 1LGBC 2XXHA 2A5TA 4P1EA 3SETA 4NF5A 4OENA 5H8SA 1B32A 2ZMBA 4G8MA 4P3LA 3K2DA 4ESXA 1MH3A 2HHMA 4IGTA 1YXIA 5L8DA 4KXPA 4GX4A 2GRVA 2DWJA 3UGWA 1FJ6A 3RYDA 3S9NC 4KPTA 2F7AA 4F3PA 4BDMA 3CFLA 1RKMA 2WYKA 1UQWA 3IOTA 5H8QA 5AA2B 2Y5LA 1NUWA 1IMFA 4PFBA 1Y9UA 3W15C 1XT8A 4NF0A 3E9XA 5F1QA 1ZBMA 4BDLA 2I6EA 2O1MA 5TU0A 4RNSA 2DWIA 3TEPA 1N84A 4Z7EA 1MH4A 3QAXA 2H98A 3IB1A 3PPOA 1P1WA 3N26A 2XXQA 1O7TA 1DK4A 4YU0A 1B5HA 2HCAA 5AA4B 1LFGA 1YCJA 2B4MA 2F78A 3IO4A 2HZLA 3E79A 3R7XA 5FTIA 3RT8A 1GVCA 5DEXB 4QRZA 4P56A 4QFOA 3N6UA 1OQGA 4MJOA 3U72A 4OVJA 3VE1B 2R6GE 2WBBA 4FAJA 4NF4A 1DTGA 2ALUA 1FPJA 4OETA 3TMGA 1SBPA 4HTGA 3LUYA 3MAMA 4NF8A 2I4CA 1TFAA 5I2KA 4OYVA 5AA3A 3IX1A 2XXUA 3ZSFA 5DVFA 4PGNA 3PD9A 5EHMA 3SEYA 2HXRA 3U92A 4LZ8A 4LZ7A 4IO2A 1IUDA 1FPFA 1S50A 1QUJA 4H5FA 3FUZA 4UA8A 5EQ9A 4C1TA 5DW8A 3KN7A 4GD5A 4I3EA 1LBXA 4GXSB 1EYIA 3B8BA 4U1OA 2REJA 3IFAA 3K6VA 4R2BA 3TPAA 4LN5A 2O84X 4G77A 4N8GA 1IEJA 3E13X 1P1NA 1NV3A 2H5YA 3FZVA 3FGSA 3TCHA 3S9LC 3BFTA 4R2FA 4EQ9A 1URGA 3U65A 3I6VA 3T0JA 1MXZA 3MP8A 3GLBA 3T9HB 5AA2A 2RCBA 4WEDA 4KCDA 4K3FA 4O7MA 4YB7A 3GZGA 5KZTA 4EQ7A 2VPOA 4RPOA 1N76A 2F3DA 4ZZEA 3ILUB 1DMBA 1P99A 3OEMA 1B7HA 4DIGA 2R8TA 2DWHA 5EYFA 4NWCA 4GL8A 1YYZA 1FBDA 2XXRA 4MFIA 4X8RA 1CNQA 4ZECA 2PCRA 1D9YA 1B6HA 2PX1A 3Q25A 2GHAA 3C33A 1IMEA 4GX3A 5EQ7A 5ELVA 4QFKA 5DEXA 2DE4A 3FVKA 3A29A 2F35A 2W7YA 1A40A 2KQZA 5H8HB 4JDFA 4GWWA 4XFEA 2DDKA 2ZYOA 1NV0A 3KSXA 4U1ZA 2X7PA 1QKBA 1RDZA 1H43A 3KZGA 1IMCA 3E4RA 1MQJA 4HCYA 3W9VA 3RPLB 3H4ZA 4ZE9A 3MPKA 1BP5A 3ONMA 4HE0A 1BKAA 1UIVA 4O3AA 1NNKA 1ZIUA 4H0WA 3FVOA 4I1DA 2GQ1A 2Q88A 3HCQA 3QUJA 4G61A 4GRKA 2OX3A 2UYEA 1B1HA 1OMPA 1QVSA 2F8DA 1QGXA 4N81A 2H25A 1F9BA 4PFTA 3EHTA 3V8XB 4XKQA 3KJTA 2G29A 1JW5A 3MVYA 4N07A 2MKZA 5FBPA 2OJTA 4Q0CA 3HHGA 5B70A 4PAKA 3KBZA 2XD3A 2B3BA 1G0HA 3MQ9A 4TLLB 3PTYA 5IZZA 4NE4A 3IJXB 1LLSA 4NEDA 1KZ8A 3MYUA 3TZAA 3H7MA 3CSGA 2Q9TA 3LBSA 2VPNA 2XXYA 1IMBA 3UK4A 3ZKLA 4PF6A 2RKMA 2QS4A 1AWBA 3LSFB 2RC7A 2I0CA 1MQGA 2F34A 1SW2A 3PV0E 1SW5A 4NWDA 1S9TA 4P47A 4C1UA 1I6AA 1BTJA 3IORA 2D5WA 2XHDA 1VFEA 4MLVA 4NF6B 4G68B 4F3GA 3OEKA 2H9BA 4RK9A 1SYHA 2V3QA 1S7YA 4M4GA 1AOVA 1AL3A 1FBPA 2QL3A 5H8HA 2ZZXA 4AB6A 3VV5A 4MX6A 3GYYA 4XKNA 1OVBA 4ELRA 3MJNA 2IEEA 4MH5A 2Q74A 3SEXA 3O66A 1MXXA 3RPLA 1USYE 1TT1A 3UORA 1B7UA 2RCAA 1JVXA 1LFHA 5CMBA 2QRYA 3IAZA 5CMCA 3OELA 5TP9B 3SZPA 1CB6A 1TXFA 4MF3A 2QPQA 4P0IA 5L9OA 3ZS6A 2DYXA 2CMOA 1FTOA 2FIXA 5IM2A 5AA1A 4F18A 4FE8A 1H76A 1H44A 3QYTA 2Y7RA 1AMFA 2XXPA 3PMVA 1B3EA 4XXUA 4ZDMA 5L9SA 5CBRA 4FBPA 5I7IA 4R74A 3RTFB 1ZTYA 1EZ9A 3KN3A 1NV5A 3SEWA 2L5VA 4DI3D 2ZNUA 3UP9A 4FEBA 4P11A 1LEVA 3CFXA 1B5IA 4MNPA 4N8YA 4PAIA 4U4SA 4N17A 4IO6A 3FBPA 4IY5A 3C35A 3TFLA 2I58A 1Y3QA 1BK4A 2B3FA 2Z8EA 4ZEDA 5ICQA 3HPIA 4NAPA 1Z7NE 3S2VA 2V93A 4Z0IA 3A09A 3IL1B 1US4A 1B3HA 4E0XA 4X04A 1IXIA 3F11A 4PTKA 3IR1A 4R9FA 4GBVA 4I40A 3WAEA 3R6UA 3C4MA 1FQAA 4YZZA 4NF6A 1AIVA 3DELB 1FJ9A 2CEYA 5I57B 2P1SA 1FQFA 3I5OA 2DVZA 5M2VA 4KD5A 1Y3NA 5I59A 3C36A 3IOWA 2QFLA 3B6QA 2A5SA 1IXCA 3A3CA 4ESWA 3B7DA 5DVJA 2Z23A 3PUXE 1FBGA 2DWAA 4NHBA 1WVJA 4MNCA 4KYEA 4DI4B 5IKBA 1A99A 2HXWA 4HCWA 2Q8JA 4GIZA 4ISUA 2I49A 4PFUA 5LTCA 4MCOA 3CRBA 4ELQA 4PFIA 4GL0A 1FBFA 2P0SA 3S4UA 3SEVA 3A3UA 5TP9A 4RYAA 3RQTA 4GLIA 4MHFA 3MZ1A 4G8HA 3ECRA 5EQ8A 1SI1A 2D3IA 2QSXA 3Q29A 4EF1A 4GBWA 3SESA 5CI5A 3G3FA 1I6BA 1EYKA 2X7QA 1P1UA 1ZJLA 3UA8A 2UVJA 4PAFA 3OSQA 2Z8DA 3P7IA 1MPDA 4YKIA 2V3TA 4E0WA 2F6PA 1NI9A 4BDQA 2YPNA 2QS1A 4WKMA 4F31B 3OENA 3GBAA 1JW4A 2G93A 4C0RA 3OO7A 3DP6A 5FHOA 5H8FB 3UIFA 1B0HA 3MWBA 1M5FA 5F24A 2ONKE 5CRYA 3AXFA 1UTBB 4PFRA 1Q35A 5ISUA 2Y7PA 4OMBA 4JSOA 4KFQA 4NG7A 3T66A 5H8NB 2PFYA 2F36A 3GXAA 1B52A 1FPKA 3PMWA 4WXJA 5A5XB 4O3BA 3QMFA 2KLFA 4EUOA 1B7ZA 3IFCA 3LSLA 2ABHA 1D3KA 3KC0A 3KG2A 1OLAA 3BKIB 3IK6B 4NX1A 2I0BA 2FYIA 4P8BA 4F29A 5I57A 1N7XA 1A55A 2DVCA 4H65A 1DBZA 1NH8A 1B0LA 1YAEA 1JP4A 3M8UA 4KQPA 4AQ4A 3K1PA 5BUUA 2PFZA 3MC2A 2FNCA 5LDZA 2ZZWA 1JETA 4KI0E 4GOTA 1Y4CA 5CC2A 2OCUA 5DVIA 5K2XA 3TTRA 1B58A 2ZXTA 3FVGA 4JSDA 1XOCA 3K6UA 1DPEA 4YB6A 4LQ5A 1FQBA 3H6TA 3TKDA 2I3WA 3G3IA 4DE8A 2Q2CA 3KC1A 4OZ9A 3HN0A 2GH9A 1MXWA 1Y3PA 1VE4A 4GF8A 2QMXA 1FRPA 4GWSA 2REGA 5FTHA 1QULA 4JWOA 4LUBA 1MPCA 2F97A 2F5XA 2ZNSA 2FVZA 4QBAA 4XKPA 3PPNA 1MQIA 3CHGA 4OANA 4QSCA 4U2RA 3RT6B 4GWOA 3U94A 3K4UA 1B3GA 2GHBA 3FASA 2XWVA 2AL5A 2Q2AA 5AA2D 3OSRA 3CIJA 1QW0A 1J1NA 4EXLA 2CZKA 1H3DA 4JB7A 3T93B 3TQWA 4F2QA 2KR0A 2RC8A 2YJPA 3VDFA 2PBWA 2QJEA 4H6DA 3ISPA 4P1LA 5AA4A 5JEIA 4MIJA 2FA7A 1GV8A 4H45A 3HHFA 1B4HA 4IO4A 3C9HA 4AS5A 1JEVA 3K1NA 2DP8A 1UTBA 2OK2A 1TWYA 1NV6A 3DP4A 3N94A 3KEIA 5H8NA 4IO7A 4PFWA 4OVQA 3O6GA 2HPGA 2ZYKA 1N3XA 4OVTA 4P9KA 5A5XA 1NV4A 4U21A 5J1DA 1II5A 5B7DA 2AIXA 3IB0A 3IJOB 2O6AA 5EYGA 1FSAA 1B5JA 3FJMA 1MY4A 5TPAB 1NUZA 2XX8A 3LSWA 1LBWA 1Z7ME 3EHSA 3S9MC 3CG1A 4ONYA 3SKPA 4GXAA 5I58B 1FPIA 3VVFA 1MDQA 1MY3A 3G3JA 4R73A 3CVGA 3RLFE 4HXVA 3E78A 1R1NA 1LBYA 1IQ7A 1FW0A 1UIUA 3FV2A 5HPQA 1RDYA 2UVIA 2XWKA 3RPWA 4OQOA 3TTNA 4NN3A 4HE1A 1XC1A 1MRPA 5J16A 1EH3A 3PUVE 2DXYA 1RDXA 2E1SA 3C31A 4WEPA 4GWUA 4AS4A 3VFJA 2F7BA 1ZLQA 4KCCA 3FIRA 4IO5A 5HBCA 3PU5A 4PETA 1FTKA 4XIGQ 1M5EA 4N6DA 5DTBA 2P3NA 3MVZA 3VVDA 2X26A 4X48A 3EN3A 4GWZA 2ANJA 3LUZA 2OWTA 1RYXA 3PUYE 3DP8A 2FBPA 2THIA 2OZZA 1M5DA 4PCDA 5KDTB 2V4CA 1VR5A 1NV7A 4GWXA 4I8CA 4BLAA 2VOZA 4FJPA 1POTA 2V3UA 3PMXA 3NOHA 2NUVA 1ZMGA 1Q9DA 4AB5A 2F3BA 1LBVA 2M8CA 1SDXA 4N13A 4EF2A 2VGQA 1B1XA 4DLDA 1NNFA 1D9VA 3MPLA 5DT6A 1WODA 2NVUB 4ZEBA 4PBQA 3ILTB 1FTLA 5ET6A 2XXWA 4ELPA 5I56B 5IGAA 2WKYA 1LAFE 4R6YA 3KFMA 4JVDA 4PC9A 4PDHA 3ODBA 2GFEA 4OXVA 2QVVA 4OFJA 5I2NB 3H03A 3LV0A 5TPAA 1UTHB 3VXBA 4MBPA 2DS9A 1LB8A 4N6KA 1URSA 1CE2A 1MPBA 1N04A 2WEFA
chains in the Genus database with same CATH topology
1MY1A 3MUQA 3CFZA 3T9UA 1SD3A 3O29A 1Y20A 2R71A 3OXNA 1R9LA 5I58A 3GBBA 5JK4A 3G3HA 3O2AA 1MY0A 3K1MA 4QFPA 1PB8A 2XD2A 4IO3A 2HEUA 4Q8RA 5ICTA 3K6XA 3MW0A 3JZJA 4DXCA 1DPPA 1PEBA 1JNFA 4GQOA 4ZZAA 4RXLA 1A7LA 1MXUA 3K6WA 3FVNA 1BIYA 4PQJA 4JWXA 4OERA 2DQVA 2ONSA 1PB9A 3IOVA 4YKKA 1MS7A 4QHQA 3H6WA 1MQHA 3TUSA 3TCFA 4YKPA 2ONRA 4QSEA 2F7CA 2O7IA 4QFLA 4R72A 1Y1ZA 2Q89A 3THIA 4Q30B 2ZYNA 2QS3A 4U22A 3PPPA 1N0TA 3M3LA 3MBPA 3CR9A 2RF1A 3IB2A 4R75A 4G68A 5KDTA 4H5GA 4NF8B 4XTCQ 1XVXA 4OFLA 3TCGA 3M3KA 3SDFA 1NNTA 3MVXA 1LBBA 4KYDA 3O6IA 3VLUA 2VD2A 1LCFA 1VSOA 3VLWA 1MG1A 1I69A 2OBGA 4G2ZA 4ZE8A 3DLNA 4F19A 4N6PA 4FATA 3TQLA 4TOZA 1A54A 1T0KA 1TFDA 3HV1A 5I56A 1MY2A 2BJJX 2XX7A 4Q5TA 3HO7A 3O9PA 1HSLA 1GGGA 4U4XA 5I2NA 1POY1 3T96B 3FXRA 1UTHA 2Y84A 4F1VA 1WDNA 3ZKKA 3KGCA 3TELA 3N5LA 5K2YA 3VLVA 2I48A 4NMYA 4DDDA 1DOTA 3CSBA 3SEUA 4ZEFA 5CMKA 1FQDA 4G68C 1GTKA 2UXAA 4OFOA 4GVOA 3RNNA 3H06B 1FCKA 3WAFA 4POXA 4TQUQ 2HAVA 3PPRA 4RK2A 4EDPA 2E0SA 4LATA 3B6TA 1SI0A 1ZKBA 1SW1A 3T22A 3IOUA 2ESNA 4EXKA 1IXHA 4FECA 3Q26A 1MM6A 4I62A 1YPNA 3TDJA 4XKRA 4YAHX 3C32A 3JYRA 2O68A 4GFRA 1MXVA 4OESA 4YMAA 2Y7WA 2XX9A 3R26A 3V89B 1JEUA 2RINA 4IB2A 4F2OA 2B65A 1JVYA 2DXRA 3RY3A 4OWDA 2UYFA 3EF7A 4P0GA 1IIWA 1GR2A 3KJ7A 1B3FA 3CG3A 3G3GA 1P1OA 4THIA 1LAHE 4R9GA 1DSNA 2YLNA 3H6VA 3Q27A 3RTWB 3HSTA 3TTMA 2Z22A 1ANFA 4QFNA 2HFBA 3L6GA 4H67A 4FIMA 3C34A 2DE2A 2AYSA 1FTMA 1A8FA 4IY6A 2QMWA 1Q1KA 4ZEKA 3USDA 1EZOA 1B05A 4H8IA 4F1YA 1O63A 1RYOA 4M1VA 1SVXB 4LQ2A 4YMBA 4DCYA 2XXXA 3MZBA 1YTVA 4DXBA 4OEUA 1PC3A 4JBZA 2OLBA 1MQDA 2XXTA 1DTZA 2I4BA 3QUFA 1IZ1A 4YICA 3TTLA 1VFDA 5BWJA 1MXYA 1FQCA 1NL5A 1O64A 3W9WA 1OVTA 5EHSA 3FATA 3K01A 3I3VA 3M3FA 3OO9A 4R6KA 1LAXA 2QS2A 1QKAA 1A8EA 5ITOA 3D4CA 2O1LA 3FJ7A 3UN6A 2H99A 4X9TA 5H8FA 1EU8A 4POWA 3T9XB 1SQYA 3RGYA 3FD3A 1I6QA 3OOAA 4JXIA 3KBRA 3G7WA 1LFIA 1SW4A 4FEDA 1BLFA 2NWJA 2HZKA 1LSTA 3KOSA 1JW1A 3LR1A 2IA4A 2ZYMA 4F3SA 1OQHA 4DXUA 1KWHA 2OWSA 4YKJA 1LB9A 1B4ZA 1ZU0A 5LOMA 4X1DA 1R9QA 5AE4A 2DOJA 5JTYB 2V84A 4TLMB 3RUMA 5CBSA 2UVHA 5KCJB 4G4PA 4LVQA 2UVGA 1OIBA 3KN8A 1N3WA 1US5A 3CI8A 3KSJA 2AL4A 1QUIA 3D4GA 1B40A 1Y4TA 1FQEA 1PB7A 3IO6A 3U93A 2PMSA 1NNPA 1P1QA 2Y7IA 4OEVA 2PT2A 4NTLA 5FHMA 3TODA 4O3CA 1N7WA 4EQBA 3U1OA 3RN8A 3QIMA 2PT1A 3MP1A 2V25A 4PFYA 4FORA 3EHUA 3QXMA 4KHZE 5IAIA 3G3KA 3FV1A 3N6TA 2O69A 3H6UA 4L17A 3MZ9A 2ZNTA 4HW8A 1B51A 3FXUA 1D4NA 1M5BA 2XXIA 4G8NA 4U23A 2DE3A 4MLQA 4DCXA 3H3GA 1OLCA 4H1XA 2HQ0A 4PP0A 3OO8A 4DZ1A 3S9EA 1XVYA 3OD7A 1QUKA 3QSLA 1EZPA 3TYHA 4F1UA 1PBQA 5HM4B 3SERA 2RC9A 2HAUA 4QSDA 1SYIA 3PUZE 1QJMA 2Y7KA 1AH5A 2NXOA 3PPQA 4YB5A 1FTJA 4ND9A 2PYYA 5I59B 4BDRA 3B6WA 5ITPA 3EPEA 4ZEIA 4HS7A 3JV9A 4LA9A 3MVWA 3BBRA 4X1BA 4IGRA 2A5TB 4NF5B 3MP6A 1PBPA 4LZ5A 3U8QA 3DM0A 3PGFA 1B3LA 4LP2B 3KOTA 2O7UA 4OTEA 2VD3A 4PE5B 4BDNA 5JTYA 5I84A 3O6HA 4R6HA 3OO6A 5KCJA 4KYSA 5L9MA 2CZLA 5F7VA 2H4IA 4BDOA 3OMBA 1HSJA 2Z8FA 4KR5A 2P2AA 2VP1A 3FJGA 3LC8A 2O51A 3TAJA 3QK6A 5H8QB 1B2HA 1NKXA 1URDA 1XHYA 3PUWE 2VHAA 2LAOA 1IITA 3BFUA 5CM6A 1LAGE 3TTKA 1Y1MA 3EQ1A 3LSXA 4RJZA 3K0VA 4I9DA 4ZS9A 3V83A 1R6ZA 3L6HA 3VXCA 1LBCA 3FXQA 3K00A 4F39A 1B46A 3T9VA 4F3BA 1ELJA 3E3KA 4JWYA 3Q28A 1LCTA 4H8JA 1ATGA 1XS5A 1USYH 4RA1A 1B9JA 1JQFA 5FHNA 4UACA 4NF4B 3VVEA 4F22A 4LONB 1M5CA 3V5AA 4ELOA 3O97A 5CMMA 1NMUA 4RY1A 5I2KB 2R9JA 4ECFA 1NFTA 1IXGA 1L5TA 4OHNA 2D21A 3K02A 2F6GA 2XXVA 1MDP1 2I3VA 5DYHA 4RPNA 1H45A 4QF9A 2NOOA 1MM7A 1NH7A 2PVUA 1HSEA 1PDAA 3O28A 2DSFA 3PD8A 1LGBC 2XXHA 2A5TA 3SETA 4NF5A 4OENA 5H8SA 1B32A 2ZMBA 4G8MA 3K2DA 4ESXA 1MH3A 4IGTA 5L8DA 2GRVA 2DWJA 3UGWA 3S9NC 4KPTA 2F7AA 4F3PA 4BDMA 3CFLA 1RKMA 1UQWA 3IOTA 5H8QA 5AA2B 1Y9UA 3W15C 1XT8A 3E9XA 5F1QA 1ZBMA 4BDLA 2I6EA 2O1MA 5TU0A 4RNSA 2DWIA 3TEPA 1N84A 4Z7EA 1MH4A 3QAXA 2H98A 3IB1A 3PPOA 1P1WA 3N26A 2XXQA 1O7TA 4YU0A 1B5HA 2HCAA 5AA4B 1LFGA 1YCJA 2F78A 3IO4A 2HZLA 3R7XA 5FTIA 3RT8A 1GVCA 5DEXB 4QRZA 4QFOA 3N6UA 1OQGA 3U72A 4OVJA 3VE1B 2R6GE 4FAJA 4NF4A 1DTGA 2ALUA 4OETA 3TMGA 1SBPA 4HTGA 3LUYA 3MAMA 4NF8A 2I4CA 1TFAA 5I2KA 4OYVA 5AA3A 3IX1A 2XXUA 3ZSFA 5DVFA 3PD9A 5EHMA 3SEYA 3U92A 4LZ8A 4LZ7A 4IO2A 1IUDA 1S50A 1QUJA 4H5FA 3FUZA 4UA8A 4C1TA 3KN7A 4GD5A 4GXSB 4U1OA 2REJA 3K6VA 4R2BA 3TPAA 2O84X 4G77A 1IEJA 3E13X 1P1NA 2H5YA 3FZVA 3FGSA 3TCHA 3S9LC 3BFTA 4R2FA 4EQ9A 1URGA 3I6VA 1MXZA 3MP8A 3GLBA 3T9HB 5AA2A 2RCBA 4WEDA 4KCDA 4K3FA 4YB7A 3GZGA 5KZTA 4EQ7A 4RPOA 1N76A 4ZZEA 3ILUB 1DMBA 1P99A 3OEMA 1B7HA 4DIGA 2DWHA 5EYFA 4NWCA 4GL8A 4MFIA 2XXRA 4ZECA 1D9YA 1B6HA 2PX1A 3Q25A 2GHAA 3C33A 5ELVA 4QFKA 5DEXA 2DE4A 3FVKA 2F35A 2W7YA 1A40A 5H8HB 4JDFA 2ZYOA 3KSXA 4U1ZA 2X7PA 1QKBA 1H43A 3KZGA 3E4RA 1MQJA 4HCYA 3W9VA 3H4ZA 4ZE9A 3MPKA 1BP5A 3ONMA 1BKAA 1UIVA 4O3AA 1NNKA 1ZIUA 4H0WA 3FVOA 4I1DA 2Q88A 3HCQA 3QUJA 4GRKA 2UYEA 1B1HA 1OMPA 1QVSA 2F8DA 2H25A 1F9BA 4PFTA 3EHTA 3V8XB 4XKQA 3KJTA 2G29A 1JW5A 3MVYA 4N07A 2OJTA 4Q0CA 3HHGA 5B70A 2XD3A 2B3BA 3MQ9A 4TLLB 4NE4A 3IJXB 1LLSA 4NEDA 3TZAA 3H7MA 3CSGA 2Q9TA 3LBSA 2XXYA 3UK4A 3ZKLA 2RKMA 2QS4A 3LSFB 2RC7A 2I0CA 1MQGA 2F34A 1SW2A 3PV0E 1SW5A 4NWDA 1S9TA 4C1UA 1I6AA 1BTJA 3IORA 2D5WA 2XHDA 1VFEA 4MLVA 4NF6B 4G68B 4F3GA 3OEKA 2H9BA 4RK9A 1SYHA 2V3QA 1S7YA 4M4GA 1AOVA 1AL3A 2QL3A 5H8HA 4AB6A 3VV5A 4XKNA 1OVBA 4ELRA 3MJNA 2IEEA 4MH5A 3SEXA 3O66A 1MXXA 1USYE 1TT1A 3UORA 1B7UA 2RCAA 1JVXA 1LFHA 5CMBA 2QRYA 3IAZA 5CMCA 3OELA 5TP9B 1CB6A 1TXFA 4MF3A 2QPQA 4P0IA 5L9OA 3ZS6A 2DYXA 2CMOA 1FTOA 5AA1A 4F18A 4FE8A 1H76A 1H44A 3QYTA 2Y7RA 1AMFA 2XXPA 3PMVA 1B3EA 4XXUA 4ZDMA 5L9SA 5CBRA 4R74A 3RTFB 1ZTYA 1EZ9A 3KN3A 3SEWA 2ZNUA 3UP9A 4FEBA 4P11A 3CFXA 1B5IA 4U4SA 4IO6A 4IY5A 3C35A 3TFLA 2I58A 1Y3QA 2B3FA 2Z8EA 4ZEDA 5ICQA 3HPIA 1Z7NE 3S2VA 2V93A 4Z0IA 3A09A 3IL1B 1US4A 1B3HA 4E0XA 1IXIA 3F11A 3IR1A 4R9FA 3WAEA 3R6UA 3C4MA 1FQAA 4YZZA 4NF6A 1AIVA 3DELB 5I57B 2P1SA 1FQFA 3I5OA 2DVZA 5M2VA 4KD5A 1Y3NA 5I59A 3C36A 3IOWA 3B6QA 2A5SA 1IXCA 3A3CA 4ESWA 3B7DA 5DVJA 2Z23A 3PUXE 2DWAA 1WVJA 4KYEA 5IKBA 1A99A 2HXWA 4HCWA 2Q8JA 4GIZA 4ISUA 2I49A 4PFUA 3CRBA 4ELQA 4GL0A 2P0SA 3S4UA 3SEVA 3A3UA 5TP9A 4RYAA 3RQTA 4GLIA 3MZ1A 4G8HA 3ECRA 1SI1A 2D3IA 2QSXA 3Q29A 4EF1A 3SESA 5CI5A 3G3FA 1I6BA 2X7QA 1P1UA 1ZJLA 3UA8A 2UVJA 3OSQA 2Z8DA 3P7IA 1MPDA 4YKIA 2V3TA 4E0WA 2F6PA 4BDQA 2YPNA 2QS1A 4WKMA 4F31B 3OENA 3GBAA 1JW4A 2G93A 4C0RA 3OO7A 3DP6A 5FHOA 5H8FB 3UIFA 1B0HA 3MWBA 1M5FA 2ONKE 5CRYA 3AXFA 1UTBB 1Q35A 5ISUA 2Y7PA 4OMBA 4JSOA 4KFQA 3T66A 5H8NB 2F36A 3GXAA 1B52A 3PMWA 4WXJA 5A5XB 4O3BA 2KLFA 4EUOA 1B7ZA 3LSLA 2ABHA 1D3KA 3KG2A 1OLAA 3BKIB 3IK6B 2I0BA 2FYIA 4F29A 5I57A 1N7XA 1A55A 2DVCA 4H65A 1NH8A 1B0LA 1YAEA 3M8UA 4KQPA 4AQ4A 3K1PA 5BUUA 3MC2A 2FNCA 1JETA 4KI0E 4GOTA 1Y4CA 5CC2A 2OCUA 5DVIA 5K2XA 3TTRA 1B58A 2ZXTA 3FVGA 4JSDA 1XOCA 3K6UA 1DPEA 4YB6A 4LQ5A 1FQBA 3H6TA 3TKDA 2I3WA 3G3IA 4DE8A 2Q2CA 4OZ9A 3HN0A 2GH9A 1MXWA 1Y3PA 1VE4A 4GF8A 2QMXA 2REGA 5FTHA 1QULA 4JWOA 4LUBA 1MPCA 2F97A 2F5XA 2ZNSA 4XKPA 3PPNA 1MQIA 4QSCA 4U2RA 3RT6B 4GWOA 3U94A 3K4UA 1B3GA 2GHBA 3FASA 2AL5A 2Q2AA 5AA2D 3OSRA 3CIJA 1QW0A 1J1NA 4EXLA 1H3DA 4JB7A 3T93B 3TQWA 4F2QA 2RC8A 2YJPA 3VDFA 2PBWA 2QJEA 4H6DA 5AA4A 5JEIA 2FA7A 1GV8A 3HHFA 1B4HA 4IO4A 3C9HA 1JEVA 3K1NA 2DP8A 1UTBA 2OK2A 1TWYA 3DP4A 3N94A 3KEIA 5H8NA 4IO7A 4PFWA 3O6GA 2ZYKA 1N3XA 5A5XA 4U21A 5J1DA 1II5A 5B7DA 2AIXA 3IB0A 3IJOB 2O6AA 1B5JA 3FJMA 1MY4A 5TPAB 2XX8A 3LSWA 1Z7ME 3EHSA 3S9MC 3CG1A 4ONYA 3SKPA 4GXAA 5I58B 3VVFA 1MDQA 1MY3A 3G3JA 4R73A 3CVGA 3RLFE 1R1NA 1IQ7A 1FW0A 1UIUA 3FV2A 5HPQA 2UVIA 3RPWA 4OQOA 3TTNA 1XC1A 1MRPA 1EH3A 3PUVE 2DXYA 2E1SA 3C31A 4WEPA 3VFJA 2F7BA 1ZLQA 4KCCA 3FIRA 4IO5A 5HBCA 3PU5A 4PETA 1FTKA 4XIGQ 1M5EA 5DTBA 3MVZA 3VVDA 2X26A 4X48A 3EN3A 2ANJA 2OWTA 1RYXA 3PUYE 3DP8A 2THIA 2OZZA 1M5DA 5KDTB 1VR5A 4I8CA 4BLAA 2VOZA 4FJPA 1POTA 2V3UA 3PMXA 2NUVA 1ZMGA 4AB5A 2M8CA 1SDXA 4N13A 4EF2A 2VGQA 1B1XA 4DLDA 1NNFA 1D9VA 3MPLA 5DT6A 1WODA 2NVUB 4ZEBA 3ILTB 1FTLA 2XXWA 4ELPA 5I56B 2WKYA 1LAFE 4R6YA 3KFMA 3ODBA 2GFEA 4OXVA 4OFJA 5I2NB 3H03A 5TPAA 1UTHB 3VXBA 4MBPA 2DS9A 1LB8A 1URSA 1CE2A 1MPBA 1N04A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MY1 A;  3MUQ A;  3CFZ A;  3T9U A;  1SD3 A;  3O29 A;  1Y20 A;  2R71 A;  3OXN A;  1R9L A;  5I58 A;  3GBB A;  5JK4 A;  3G3H A;  3O2A A;  1MY0 A;  3K1M A;  4QFP A;  1PB8 A;  2XD2 A;  4IO3 A;  2HEU A;  4Q8R A;  5ICT A;  3K6X A;  3MW0 A;  3JZJ A;  4DXC A;  1DPP A;  1PEB A;  1JNF A;  4GQO A;  4ZZA A;  4RXL A;  1A7L A;  1MXU A;  3K6W A;  3FVN A;  1BIY A;  4PQJ A;  4JWX A;  4OER A;  2DQV A;  2ONS A;  1PB9 A;  3IOV A;  4YKK A;  1MS7 A;  4QHQ A;  3H6W A;  1MQH A;  3TUS A;  3TCF A;  4YKP A;  2ONR A;  4QSE A;  2F7C A;  2O7I A;  4QFL A;  4R72 A;  1Y1Z A;  2Q89 A;  3THI A;  4Q30 B;  2ZYN A;  2QS3 A;  4U22 A;  3PPP A;  1N0T A;  3M3L A;  3MBP A;  3CR9 A;  2RF1 A;  3IB2 A;  4R75 A;  4G68 A;  5KDT A;  4H5G A;  4NF8 B;  4XTC Q;  1XVX A;  4OFL A;  3TCG A;  3M3K A;  3SDF A;  1NNT A;  3MVX A;  1LBB A;  4KYD A;  3O6I A;  3VLU A;  2VD2 A;  1LCF A;  1VSO A;  3VLW A;  1MG1 A;  1I69 A;  2OBG A;  4G2Z A;  4ZE8 A;  3DLN A;  4F19 A;  4N6P A;  4FAT A;  3TQL A;  4TOZ A;  1A54 A;  1T0K A;  1TFD A;  3HV1 A;  5I56 A;  1MY2 A;  2BJJ X;  2XX7 A;  4Q5T A;  3HO7 A;  3O9P A;  1HSL A;  1GGG A;  4U4X A;  5I2N A;  1POY 1;  3T96 B;  3FXR A;  1UTH A;  2Y84 A;  4F1V A;  1WDN A;  3ZKK A;  3KGC A;  3TEL A;  3N5L A;  5K2Y A;  3VLV A;  2I48 A;  4NMY A;  4DDD A;  1DOT A;  3CSB A;  3SEU A;  4ZEF A;  5CMK A;  1FQD A;  4G68 C;  1GTK A;  2UXA A;  4OFO A;  4GVO A;  3RNN A;  3H06 B;  1FCK A;  3WAF A;  4POX A;  4TQU Q;  2HAV A;  3PPR A;  4RK2 A;  4EDP A;  2E0S A;  4LAT A;  3B6T A;  1SI0 A;  1ZKB A;  1SW1 A;  3T22 A;  3IOU A;  2ESN A;  4EXK A;  1IXH A;  4FEC A;  3Q26 A;  1MM6 A;  4I62 A;  1YPN A;  3TDJ A;  4XKR A;  4YAH X;  3C32 A;  3JYR A;  2O68 A;  4GFR A;  1MXV A;  4OES A;  4YMA A;  2Y7W A;  2XX9 A;  3R26 A;  3V89 B;  1JEU A;  2RIN A;  4IB2 A;  4F2O A;  2B65 A;  1JVY A;  2DXR A;  3RY3 A;  4OWD A;  2UYF A;  3EF7 A;  4P0G A;  1IIW A;  1GR2 A;  3KJ7 A;  1B3F A;  3CG3 A;  3G3G A;  1P1O A;  4THI A;  1LAH E;  4R9G A;  1DSN A;  2YLN A;  3H6V A;  3Q27 A;  3RTW B;  3HST A;  3TTM A;  2Z22 A;  1ANF A;  4QFN A;  2HFB A;  3L6G A;  4H67 A;  4FIM A;  3C34 A;  2DE2 A;  2AYS A;  1FTM A;  1A8F A;  4IY6 A;  2QMW A;  1Q1K A;  4ZEK A;  3USD A;  1EZO A;  1B05 A;  4H8I A;  4F1Y A;  1O63 A;  1RYO A;  4M1V A;  1SVX B;  4LQ2 A;  4YMB A;  4DCY A;  2XXX A;  3MZB A;  1YTV A;  4DXB A;  4OEU A;  1PC3 A;  4JBZ A;  2OLB A;  1MQD A;  2XXT A;  1DTZ A;  2I4B A;  3QUF A;  1IZ1 A;  4YIC A;  3TTL A;  1VFD A;  5BWJ A;  1MXY A;  1FQC A;  1NL5 A;  1O64 A;  3W9W A;  1OVT A;  5EHS A;  3FAT A;  3K01 A;  3I3V A;  3M3F A;  3OO9 A;  4R6K A;  1LAX A;  2QS2 A;  1QKA A;  1A8E A;  5ITO A;  3D4C A;  2O1L A;  3FJ7 A;  3UN6 A;  2H99 A;  4X9T A;  5H8F A;  1EU8 A;  4POW A;  3T9X B;  1SQY A;  3RGY A;  3FD3 A;  1I6Q A;  3OOA A;  4JXI A;  3KBR A;  3G7W A;  1LFI A;  1SW4 A;  4FED A;  1BLF A;  2NWJ A;  2HZK A;  1LST A;  3KOS A;  1JW1 A;  3LR1 A;  2IA4 A;  2ZYM A;  4F3S A;  1OQH A;  4DXU A;  1KWH A;  2OWS A;  4YKJ A;  1LB9 A;  1B4Z A;  1ZU0 A;  5LOM A;  4X1D A;  1R9Q A;  5AE4 A;  2DOJ A;  5JTY B;  2V84 A;  4TLM B;  3RUM A;  5CBS A;  2UVH A;  5KCJ B;  4G4P A;  4LVQ A;  2UVG A;  1OIB A;  3KN8 A;  1N3W A;  1US5 A;  3CI8 A;  3KSJ A;  2AL4 A;  1QUI A;  3D4G A;  1B40 A;  1Y4T A;  1FQE A;  1PB7 A;  3IO6 A;  3U93 A;  2PMS A;  1NNP A;  1P1Q A;  2Y7I A;  4OEV A;  2PT2 A;  4NTL A;  5FHM A;  3TOD A;  4O3C A;  1N7W A;  4EQB A;  3U1O A;  3RN8 A;  3QIM A;  2PT1 A;  3MP1 A;  2V25 A;  4PFY A;  4FOR A;  3EHU A;  3QXM A;  4KHZ E;  5IAI A;  3G3K A;  3FV1 A;  3N6T A;  2O69 A;  3H6U A;  4L17 A;  3MZ9 A;  2ZNT A;  4HW8 A;  1B51 A;  3FXU A;  1D4N A;  1M5B A;  2XXI A;  4G8N A;  4U23 A;  2DE3 A;  4MLQ A;  4DCX A;  3H3G A;  1OLC A;  4H1X A;  2HQ0 A;  4PP0 A;  3OO8 A;  4DZ1 A;  3S9E A;  1XVY A;  3OD7 A;  1QUK A;  3QSL A;  1EZP A;  3TYH A;  4F1U A;  1PBQ A;  5HM4 B;  3SER A;  2RC9 A;  2HAU A;  4QSD A;  1SYI A;  3PUZ E;  1QJM A;  2Y7K A;  1AH5 A;  2NXO A;  3PPQ A;  4YB5 A;  1FTJ A;  4ND9 A;  2PYY A;  5I59 B;  4BDR A;  3B6W A;  5ITP A;  3EPE A;  4ZEI A;  4HS7 A;  3JV9 A;  4LA9 A;  3MVW A;  3BBR A;  4X1B A;  4IGR A;  2A5T B;  4NF5 B;  3MP6 A;  1PBP A;  4LZ5 A;  3U8Q A;  3DM0 A;  3PGF A;  1B3L A;  4LP2 B;  3KOT A;  2O7U A;  4OTE A;  2VD3 A;  4PE5 B;  4BDN A;  5JTY A;  5I84 A;  3O6H A;  4R6H A;  3OO6 A;  5KCJ A;  4KYS A;  5L9M A;  2CZL A;  5F7V A;  2H4I A;  4BDO A;  3OMB A;  1HSJ A;  2Z8F A;  4KR5 A;  2P2A A;  2VP1 A;  3FJG A;  3LC8 A;  2O51 A;  3TAJ A;  3QK6 A;  5H8Q B;  1B2H A;  1NKX A;  1URD A;  1XHY A;  3PUW E;  2VHA A;  2LAO A;  1IIT A;  3BFU A;  5CM6 A;  1LAG E;  3TTK A;  1Y1M A;  3EQ1 A;  3LSX A;  4RJZ A;  3K0V A;  4I9D A;  4ZS9 A;  3V83 A;  1R6Z A;  3L6H A;  3VXC A;  1LBC A;  3FXQ A;  3K00 A;  4F39 A;  1B46 A;  3T9V A;  4F3B A;  1ELJ A;  3E3K A;  4JWY A;  3Q28 A;  1LCT A;  4H8J A;  1ATG A;  1XS5 A;  1USY H;  4RA1 A;  1B9J A;  1JQF A;  5FHN A;  4UAC A;  4NF4 B;  3VVE A;  4F22 A;  4LON B;  1M5C A;  3V5A A;  4ELO A;  3O97 A;  5CMM A;  1NMU A;  4RY1 A;  5I2K B;  2R9J A;  4ECF A;  1NFT A;  1IXG A;  1L5T A;  4OHN A;  2D21 A;  3K02 A;  2F6G A;  2XXV A;  1MDP 1;  2I3V A;  5DYH A;  4RPN A;  1H45 A;  4QF9 A;  2NOO A;  1MM7 A;  1NH7 A;  2PVU A;  1HSE A;  1PDA A;  3O28 A;  2DSF A;  3PD8 A;  1LGB C;  2XXH A;  2A5T A;  3SET A;  4NF5 A;  4OEN A;  5H8S A;  1B32 A;  2ZMB A;  4G8M A;  3K2D A;  4ESX A;  1MH3 A;  4IGT A;  5L8D A;  2GRV A;  2DWJ A;  3UGW A;  3S9N C;  4KPT A;  2F7A A;  4F3P A;  4BDM A;  3CFL A;  1RKM A;  1UQW A;  3IOT A;  5H8Q A;  5AA2 B;  1Y9U A;  3W15 C;  1XT8 A;  3E9X A;  5F1Q A;  1ZBM A;  4BDL A;  2I6E A;  2O1M A;  5TU0 A;  4RNS A;  2DWI A;  3TEP A;  1N84 A;  4Z7E A;  1MH4 A;  3QAX A;  2H98 A;  3IB1 A;  3PPO A;  1P1W A;  3N26 A;  2XXQ A;  1O7T A;  4YU0 A;  1B5H A;  2HCA A;  5AA4 B;  1LFG A;  1YCJ A;  2F78 A;  3IO4 A;  2HZL A;  3R7X A;  5FTI A;  3RT8 A;  1GVC A;  5DEX B;  4QRZ A;  4QFO A;  3N6U A;  1OQG A;  3U72 A;  4OVJ A;  3VE1 B;  2R6G E;  4FAJ A;  4NF4 A;  1DTG A;  2ALU A;  4OET A;  3TMG A;  1SBP A;  4HTG A;  3LUY A;  3MAM A;  4NF8 A;  2I4C A;  1TFA A;  5I2K A;  4OYV A;  5AA3 A;  3IX1 A;  2XXU A;  3ZSF A;  5DVF A;  3PD9 A;  5EHM A;  3SEY A;  3U92 A;  4LZ8 A;  4LZ7 A;  4IO2 A;  1IUD A;  1S50 A;  1QUJ A;  4H5F A;  3FUZ A;  4UA8 A;  4C1T A;  3KN7 A;  4GD5 A;  4GXS B;  4U1O A;  2REJ A;  3K6V A;  4R2B A;  3TPA A;  2O84 X;  4G77 A;  1IEJ A;  3E13 X;  1P1N A;  2H5Y A;  3FZV A;  3FGS A;  3TCH A;  3S9L C;  3BFT A;  4R2F A;  4EQ9 A;  1URG A;  3I6V A;  1MXZ A;  3MP8 A;  3GLB A;  3T9H B;  5AA2 A;  2RCB A;  4WED A;  4KCD A;  4K3F A;  4YB7 A;  3GZG A;  5KZT A;  4EQ7 A;  4RPO A;  1N76 A;  4ZZE A;  3ILU B;  1DMB A;  1P99 A;  3OEM A;  1B7H A;  4DIG A;  2DWH A;  5EYF A;  4NWC A;  4GL8 A;  4MFI A;  2XXR A;  4ZEC A;  1D9Y A;  1B6H A;  2PX1 A;  3Q25 A;  2GHA A;  3C33 A;  5ELV A;  4QFK A;  5DEX A;  2DE4 A;  3FVK A;  2F35 A;  2W7Y A;  1A40 A;  5H8H B;  4JDF A;  2ZYO A;  3KSX A;  4U1Z A;  2X7P A;  1QKB A;  1H43 A;  3KZG A;  3E4R A;  1MQJ A;  4HCY A;  3W9V A;  3H4Z A;  4ZE9 A;  3MPK A;  1BP5 A;  3ONM A;  1BKA A;  1UIV A;  4O3A A;  1NNK A;  1ZIU A;  4H0W A;  3FVO A;  4I1D A;  2Q88 A;  3HCQ A;  3QUJ A;  4GRK A;  2UYE A;  1B1H A;  1OMP A;  1QVS A;  2F8D A;  2H25 A;  1F9B A;  4PFT A;  3EHT A;  3V8X B;  4XKQ A;  3KJT A;  2G29 A;  1JW5 A;  3MVY A;  4N07 A;  2OJT A;  4Q0C A;  3HHG A;  5B70 A;  2XD3 A;  2B3B A;  3MQ9 A;  4TLL B;  4NE4 A;  3IJX B;  1LLS A;  4NED A;  3TZA A;  3H7M A;  3CSG A;  2Q9T A;  3LBS A;  2XXY A;  3UK4 A;  3ZKL A;  2RKM A;  2QS4 A;  3LSF B;  2RC7 A;  2I0C A;  1MQG A;  2F34 A;  1SW2 A;  3PV0 E;  1SW5 A;  4NWD A;  1S9T A;  4C1U A;  1I6A A;  1BTJ A;  3IOR A;  2D5W A;  2XHD A;  1VFE A;  4MLV A;  4NF6 B;  4G68 B;  4F3G A;  3OEK A;  2H9B A;  4RK9 A;  1SYH A;  2V3Q A;  1S7Y A;  4M4G A;  1AOV A;  1AL3 A;  2QL3 A;  5H8H A;  4AB6 A;  3VV5 A;  4XKN A;  1OVB A;  4ELR A;  3MJN A;  2IEE A;  4MH5 A;  3SEX A;  3O66 A;  1MXX A;  1USY E;  1TT1 A;  3UOR A;  1B7U A;  2RCA A;  1JVX A;  1LFH A;  5CMB A;  2QRY A;  3IAZ A;  5CMC A;  3OEL A;  5TP9 B;  1CB6 A;  1TXF A;  4MF3 A;  2QPQ A;  4P0I A;  5L9O A;  3ZS6 A;  2DYX A;  2CMO A;  1FTO A;  5AA1 A;  4F18 A;  4FE8 A;  1H76 A;  1H44 A;  3QYT A;  2Y7R A;  1AMF A;  2XXP A;  3PMV A;  1B3E A;  4XXU A;  4ZDM A;  5L9S A;  5CBR A;  4R74 A;  3RTF B;  1ZTY A;  1EZ9 A;  3KN3 A;  3SEW A;  2ZNU A;  3UP9 A;  4FEB A;  4P11 A;  3CFX A;  1B5I A;  4U4S A;  4IO6 A;  4IY5 A;  3C35 A;  3TFL A;  2I58 A;  1Y3Q A;  2B3F A;  2Z8E A;  4ZED A;  5ICQ A;  3HPI A;  1Z7N E;  3S2V A;  2V93 A;  4Z0I A;  3A09 A;  3IL1 B;  1US4 A;  1B3H A;  4E0X A;  1IXI A;  3F11 A;  3IR1 A;  4R9F A;  3WAE A;  3R6U A;  3C4M A;  1FQA A;  4YZZ A;  4NF6 A;  1AIV A;  3DEL B;  5I57 B;  2P1S A;  1FQF A;  3I5O A;  2DVZ A;  5M2V A;  4KD5 A;  1Y3N A;  5I59 A;  3C36 A;  3IOW A;  3B6Q A;  2A5S A;  1IXC A;  3A3C A;  4ESW A;  3B7D A;  5DVJ A;  2Z23 A;  3PUX E;  2DWA A;  1WVJ A;  4KYE A;  5IKB A;  1A99 A;  2HXW A;  4HCW A;  2Q8J A;  4GIZ A;  4ISU A;  2I49 A;  4PFU A;  3CRB A;  4ELQ A;  4GL0 A;  2P0S A;  3S4U A;  3SEV A;  3A3U A;  5TP9 A;  4RYA A;  3RQT A;  4GLI A;  3MZ1 A;  4G8H A;  3ECR A;  1SI1 A;  2D3I A;  2QSX A;  3Q29 A;  4EF1 A;  3SES A;  5CI5 A;  3G3F A;  1I6B A;  2X7Q A;  1P1U A;  1ZJL A;  3UA8 A;  2UVJ A;  3OSQ A;  2Z8D A;  3P7I A;  1MPD A;  4YKI A;  2V3T A;  4E0W A;  2F6P A;  4BDQ A;  2YPN A;  2QS1 A;  4WKM A;  4F31 B;  3OEN A;  3GBA A;  1JW4 A;  2G93 A;  4C0R A;  3OO7 A;  3DP6 A;  5FHO A;  5H8F B;  3UIF A;  1B0H A;  3MWB A;  1M5F A;  2ONK E;  5CRY A;  3AXF A;  1UTB B;  1Q35 A;  5ISU A;  2Y7P A;  4OMB A;  4JSO A;  4KFQ A;  3T66 A;  5H8N B;  2F36 A;  3GXA A;  1B52 A;  3PMW A;  4WXJ A;  5A5X B;  4O3B A;  2KLF A;  4EUO A;  1B7Z A;  3LSL A;  2ABH A;  1D3K A;  3KG2 A;  1OLA A;  3BKI B;  3IK6 B;  2I0B A;  2FYI A;  4F29 A;  5I57 A;  1N7X A;  1A55 A;  2DVC A;  4H65 A;  1NH8 A;  1B0L A;  1YAE A;  3M8U A;  4KQP A;  4AQ4 A;  3K1P A;  5BUU A;  3MC2 A;  2FNC A;  1JET A;  4KI0 E;  4GOT A;  1Y4C A;  5CC2 A;  2OCU A;  5DVI A;  5K2X A;  3TTR A;  1B58 A;  2ZXT A;  3FVG A;  4JSD A;  1XOC A;  3K6U A;  1DPE A;  4YB6 A;  4LQ5 A;  1FQB A;  3H6T A;  3TKD A;  2I3W A;  3G3I A;  4DE8 A;  2Q2C A;  4OZ9 A;  3HN0 A;  2GH9 A;  1MXW A;  1Y3P A;  1VE4 A;  4GF8 A;  2QMX A;  2REG A;  5FTH A;  1QUL A;  4JWO A;  4LUB A;  1MPC A;  2F97 A;  2F5X A;  2ZNS A;  4XKP A;  3PPN A;  1MQI A;  4QSC A;  4U2R A;  3RT6 B;  4GWO A;  3U94 A;  3K4U A;  1B3G A;  2GHB A;  3FAS A;  2AL5 A;  2Q2A A;  5AA2 D;  3OSR A;  3CIJ A;  1QW0 A;  1J1N A;  4EXL A;  1H3D A;  4JB7 A;  3T93 B;  3TQW A;  4F2Q A;  2RC8 A;  2YJP A;  3VDF A;  2PBW A;  2QJE A;  4H6D A;  5AA4 A;  5JEI A;  2FA7 A;  1GV8 A;  3HHF A;  1B4H A;  4IO4 A;  3C9H A;  1JEV A;  3K1N A;  2DP8 A;  1UTB A;  2OK2 A;  1TWY A;  3DP4 A;  3N94 A;  3KEI A;  5H8N A;  4IO7 A;  4PFW A;  3O6G A;  2ZYK A;  1N3X A;  5A5X A;  4U21 A;  5J1D A;  1II5 A;  5B7D A;  2AIX A;  3IB0 A;  3IJO B;  2O6A A;  1B5J A;  3FJM A;  1MY4 A;  5TPA B;  2XX8 A;  3LSW A;  1Z7M E;  3EHS A;  3S9M C;  3CG1 A;  4ONY A;  3SKP A;  4GXA A;  5I58 B;  3VVF A;  1MDQ A;  1MY3 A;  3G3J A;  4R73 A;  3CVG A;  3RLF E;  1R1N A;  1IQ7 A;  1FW0 A;  1UIU A;  3FV2 A;  5HPQ A;  2UVI A;  3RPW A;  4OQO A;  3TTN A;  1XC1 A;  1MRP A;  1EH3 A;  3PUV E;  2DXY A;  2E1S A;  3C31 A;  4WEP A;  3VFJ A;  2F7B A;  1ZLQ A;  4KCC A;  3FIR A;  4IO5 A;  5HBC A;  3PU5 A;  4PET A;  1FTK A;  4XIG Q;  1M5E A;  5DTB A;  3MVZ A;  3VVD A;  2X26 A;  4X48 A;  3EN3 A;  2ANJ A;  2OWT A;  1RYX A;  3PUY E;  3DP8 A;  2THI A;  2OZZ A;  1M5D A;  5KDT B;  1VR5 A;  4I8C A;  4BLA A;  2VOZ A;  4FJP A;  1POT A;  2V3U A;  3PMX A;  2NUV A;  1ZMG A;  4AB5 A;  2M8C A;  1SDX A;  4N13 A;  4EF2 A;  2VGQ A;  1B1X A;  4DLD A;  1NNF A;  1D9V A;  3MPL A;  5DT6 A;  1WOD A;  2NVU B;  4ZEB A;  3ILT B;  1FTL A;  2XXW A;  4ELP A;  5I56 B;  2WKY A;  1LAF E;  4R6Y A;  3KFM A;  3ODB A;  2GFE A;  4OXV A;  4OFJ A;  5I2N B;  3H03 A;  5TPA A;  1UTH B;  3VXB A;  4MBP A;  2DS9 A;  1LB8 A;  1URS A;  1CE2 A;  1MPB A;  1N04 A; 
#chains in the Genus database with same CATH topology
 1MY1 A;  3MUQ A;  3CFZ A;  3T9U A;  1SD3 A;  3O29 A;  1Y20 A;  2R71 A;  3OXN A;  1YZ0 A;  3D1R A;  3EKI A;  1R9L A;  5I58 A;  3GBB A;  5JK4 A;  1IMA A;  3G3H A;  3O2A A;  1MY0 A;  3K1M A;  4QFP A;  1PB8 A;  2XD2 A;  4IO3 A;  2HEU A;  4Q8R A;  5ICT A;  3K6X A;  3MW0 A;  3JZJ A;  4MMP A;  1FPG A;  1DPP A;  5T3J A;  4DXC A;  5EQA A;  1PEB A;  1JNF A;  4GQO A;  4ZZA A;  4RXL A;  4MNI A;  1A7L A;  1MXU A;  3K6W A;  3FVN A;  1BIY A;  4PQJ A;  4JWX A;  4OER A;  1XI6 A;  2DQV A;  2ONS A;  4NQ8 A;  1PB9 A;  3IOV A;  4XEQ A;  4MEV A;  4YKK A;  1MS7 A;  4QHQ A;  3H6W A;  1MQH A;  4MAG A;  3TUS A;  3TCF A;  4YKP A;  2ONR A;  2QVR A;  4QSE A;  2F7C A;  2O7I A;  5I3S A;  4QFL A;  4O94 A;  4R72 A;  1Y1Z A;  2Q89 A;  1K9Z A;  3THI A;  4Q30 B;  2ZYN A;  2QS3 A;  4U22 A;  3PPP A;  1N0T A;  2CZI A;  3M3L A;  2JJK A;  3MBP A;  3CR9 A;  4PF8 A;  2RF1 A;  3IB2 A;  3T1B A;  4R75 A;  4G68 A;  5KDT A;  4H5G A;  4NF8 B;  4XTC Q;  4PDD A;  1XVX A;  4OFL A;  3TCG A;  3M3K A;  3SDF A;  1NNT A;  3MVX A;  1LBB A;  4KYD A;  2OWZ A;  3O6I A;  3VLU A;  2VD2 A;  1LCF A;  1VSO A;  3VLW A;  1MG1 A;  2WYP A;  1I69 A;  2OBG A;  4G2Z A;  4ZE8 A;  3DLN A;  5ET5 A;  4F19 A;  4N6P A;  4FAT A;  1FBE A;  3TQL A;  1G0I A;  4TOZ A;  1A54 A;  3FXB A;  4PGP A;  1T0K A;  1TFD A;  3HV1 A;  5I56 A;  1MY2 A;  2BJJ X;  2XX7 A;  4Q5T A;  3HO7 A;  3O9P A;  1HSL A;  1GGG A;  4U4X A;  5I2N A;  1POY 1;  3T96 B;  3FXR A;  1UTH A;  2Y84 A;  4F1V A;  2XWO A;  3HFU A;  1WDN A;  3ZKK A;  3KGC A;  1FPL A;  3TEL A;  3N5L A;  5K2Y A;  3VLV A;  2I48 A;  4H46 A;  4NMY A;  4DDD A;  1DOT A;  3CSB A;  3SEU A;  4ZEF A;  5CMK A;  1FQD A;  4OVP A;  3MST A;  4G68 C;  1GTK A;  2UXA A;  1D9Q A;  4OFO A;  4GVO A;  3RNN A;  3H06 B;  1FCK A;  3WAF A;  4POX A;  4TQU Q;  2HAV A;  3PPR A;  4RK2 A;  4EDP A;  2E0S A;  1IMD A;  4LAT A;  3B6T A;  1SI0 A;  2CEX A;  1ZKB A;  1SW1 A;  3T22 A;  3IOU A;  2ESN A;  4EXK A;  1IXH A;  4FEC A;  3Q26 A;  4UAB A;  1MM6 A;  4I62 A;  1YPN A;  4IR8 A;  4OVS A;  3TDJ A;  4I3Y A;  4XKR A;  4NGU A;  4YAH X;  3C32 A;  3JYR A;  4N91 A;  2O68 A;  4GFR A;  1MXV A;  4OES A;  4YMA A;  2Y7W A;  2XX9 A;  3R26 A;  3V89 B;  1JEU A;  2RIN A;  4IB2 A;  2XWI A;  4F2O A;  3BIG A;  2B65 A;  1JVY A;  2DXR A;  3RY3 A;  4OWD A;  2UYF A;  3EF7 A;  4P0G A;  1IIW A;  1GR2 A;  1SPI A;  3KJ7 A;  1B3F A;  3CG3 A;  3G3G A;  1P1O A;  4THI A;  1LAH E;  4R9G A;  4QXD A;  1DSN A;  2YLN A;  3H6V A;  2P3V A;  3Q27 A;  3RTW B;  5ET7 A;  3HST A;  3TTM A;  2Z22 A;  1ANF A;  4QFN A;  2HFB A;  3L6G A;  4H67 A;  4FIM A;  3C34 A;  2DE2 A;  2AYS A;  1FTM A;  1A8F A;  4IY6 A;  2QMW A;  1Q1K A;  4ZEK A;  3USD A;  1EZO A;  1B05 A;  4H8I A;  4F1Y A;  1O63 A;  1RYO A;  4N15 A;  2Y5K A;  4M1V A;  5EYH A;  1SVX B;  4LQ2 A;  4YMB A;  2FHY A;  4DCY A;  2XXX A;  3MZB A;  1YTV A;  4DXB A;  4OEU A;  1PC3 A;  4JBZ A;  2OLB A;  1MQD A;  2XXT A;  1DTZ A;  2I4B A;  3QUF A;  1IZ1 A;  4YIC A;  3TTL A;  1VFD A;  5BWJ A;  1MXY A;  4HE2 A;  1FQC A;  5IZ1 A;  1NL5 A;  1O64 A;  2WBD A;  3W9W A;  1OVT A;  5EHS A;  3FAT A;  3K01 A;  3I3V A;  3M3F A;  2VT5 A;  3OO9 A;  2ZZV A;  4R6K A;  1LAX A;  2QS2 A;  1QKA A;  1A8E A;  5ITO A;  3D4C A;  2O1L A;  3FJ7 A;  3UN6 A;  2H99 A;  4X9T A;  5H8F A;  4OA4 A;  1EU8 A;  2WX9 A;  1NV1 A;  4POW A;  3T9X B;  1SQY A;  3RGY A;  3FD3 A;  1I6Q A;  3OOA A;  4JXI A;  3KBR A;  3G7W A;  1LFI A;  1SW4 A;  4FED A;  1BLF A;  2NWJ A;  2HZK A;  1LST A;  3KOS A;  1JW1 A;  3LR1 A;  2IA4 A;  2ZYM A;  4F3S A;  1OQH A;  4DXU A;  1KWH A;  2OWS A;  4YKJ A;  1LB9 A;  1B4Z A;  1ZU0 A;  4PBH A;  1EYJ A;  5LOM A;  4X1D A;  1R9Q A;  1DCU A;  5AE4 A;  2DOJ A;  1INP A;  1K9Y A;  5JTY B;  2V84 A;  4TLM B;  3RUM A;  5CBS A;  2UVH A;  5KCJ B;  3BIH A;  4G4P A;  2Q8M A;  4LVQ A;  2UVG A;  1OIB A;  3KN8 A;  1N3W A;  4N4U A;  1US5 A;  1NUY A;  2XXK A;  3CI8 A;  3KSJ A;  1KA0 A;  2AL4 A;  1QUI A;  3D4G A;  1B40 A;  1Y4T A;  1FQE A;  1PB7 A;  3IO6 A;  3U93 A;  2PMS A;  1NNP A;  1P1Q A;  2Y7I A;  4OEV A;  2PT2 A;  4NTL A;  5FHM A;  3TOD A;  4O3C A;  1N7W A;  4EQB A;  3U1O A;  3RN8 A;  1FPB A;  3QIM A;  2PT1 A;  3MP1 A;  2V25 A;  4PFY A;  4FOR A;  3EHU A;  3QXM A;  4KHZ E;  1KA1 A;  3B50 A;  5IAI A;  3ROJ A;  3G3K A;  3FV1 A;  3N6T A;  2O69 A;  3H6U A;  4L17 A;  3MZ9 A;  2ZNT A;  4HW8 A;  1B51 A;  3FXU A;  1D4N A;  1M5B A;  4XF5 A;  2XXI A;  4G8N A;  4OVR A;  4U23 A;  2DE3 A;  4MLQ A;  4DCX A;  3H3G A;  1OLC A;  4H1X A;  2HQ0 A;  2FIE A;  4PP0 A;  3OO8 A;  4DZ1 A;  3S9E A;  1XVY A;  3OD7 A;  1QUK A;  3QSL A;  5ET8 A;  1EZP A;  3TYH A;  4F1U A;  1PBQ A;  5HM4 B;  3SER A;  2RC9 A;  2HAU A;  4QSD A;  1SYI A;  3PUZ E;  1QJM A;  2Y7K A;  1AH5 A;  2NXO A;  4GWY A;  3PPQ A;  4YB5 A;  2CZH A;  1FTJ A;  4ND9 A;  2PYY A;  5I59 B;  4BDR A;  3B6W A;  5ITP A;  3EPE A;  4ZEI A;  4HS7 A;  3JV9 A;  4LA9 A;  2B4L A;  2BJI A;  5IZ3 B;  3MVW A;  3BBR A;  4X1B A;  4IGR A;  2A5T B;  4NF5 B;  3MP6 A;  1PBP A;  4LZ5 A;  3U8Q A;  3DM0 A;  3PGF A;  1B3L A;  4LP2 B;  3KOT A;  2O7U A;  4JVI A;  4OTE A;  2VD3 A;  4PE5 B;  4BDN A;  5JTY A;  5I84 A;  3O6H A;  4R6H A;  4PE3 A;  3OO6 A;  5KCJ A;  4KYS A;  5L9M A;  2CZL A;  5F7V A;  2H4I A;  4BDO A;  1VDW A;  3OMB A;  1HSJ A;  2Z8F A;  4KR5 A;  2P2A A;  2VP1 A;  3FJG A;  1FBC A;  3LC8 A;  2O51 A;  3TAJ A;  3QK6 A;  5I5P A;  5H8Q B;  1NV2 A;  1FTA A;  1B2H A;  1NKX A;  1URD A;  1XHY A;  3PUW E;  2VHA A;  2LAO A;  1IIT A;  3BFU A;  5CM6 A;  1LAG E;  3TTK A;  4O8M A;  1Y1M A;  3EQ1 A;  3LSX A;  4O7I A;  4RJZ A;  1FPE A;  3K0V A;  4I9D A;  4ZS9 A;  3V83 A;  5A5L A;  1R6Z A;  3L6H A;  3VXC A;  1LBC A;  3FXQ A;  3K00 A;  4F39 A;  2QVU A;  1B46 A;  3T9V A;  4F3B A;  1ELJ A;  3E3K A;  4JWY A;  3Q28 A;  1LCT A;  4H8J A;  1ATG A;  1XS5 A;  1USY H;  4RA1 A;  1B9J A;  1JQF A;  5FHN A;  1LBZ A;  4UAC A;  4NF4 B;  3VVE A;  4F22 A;  4LON B;  1M5C A;  3V5A A;  1FBH A;  2XA5 A;  4ELO A;  3O97 A;  5CMM A;  1NMU A;  4RY1 A;  5I2K B;  2R9J A;  4ECF A;  1NFT A;  1IXG A;  5ESY A;  4JVC A;  1L5T A;  4OHN A;  2D21 A;  1FPD A;  3K02 A;  2F6G A;  1NUX A;  2XXV A;  1MDP 1;  4GX6 A;  2I3V A;  5DYH A;  4RPN A;  1H45 A;  4QF9 A;  2NOO A;  1MM7 A;  1NH7 A;  2PVU A;  1HSE A;  1PDA A;  3O28 A;  5IZ3 A;  2DSF A;  3PD8 A;  1LGB C;  2XXH A;  2A5T A;  4P1E A;  3SET A;  4NF5 A;  4OEN A;  5H8S A;  1B32 A;  2ZMB A;  4G8M A;  4P3L A;  3K2D A;  4ESX A;  1MH3 A;  2HHM A;  4IGT A;  1YXI A;  5L8D A;  4KXP A;  4GX4 A;  2GRV A;  2DWJ A;  3UGW A;  1FJ6 A;  3RYD A;  3S9N C;  4KPT A;  2F7A A;  4F3P A;  4BDM A;  3CFL A;  1RKM A;  2WYK A;  1UQW A;  3IOT A;  5H8Q A;  5AA2 B;  2Y5L A;  1NUW A;  1IMF A;  4PFB A;  1Y9U A;  3W15 C;  1XT8 A;  4NF0 A;  3E9X A;  5F1Q A;  1ZBM A;  4BDL A;  2I6E A;  2O1M A;  5TU0 A;  4RNS A;  2DWI A;  3TEP A;  1N84 A;  4Z7E A;  1MH4 A;  3QAX A;  2H98 A;  3IB1 A;  3PPO A;  1P1W A;  3N26 A;  2XXQ A;  1O7T A;  1DK4 A;  4YU0 A;  1B5H A;  2HCA A;  5AA4 B;  1LFG A;  1YCJ A;  2B4M A;  2F78 A;  3IO4 A;  2HZL A;  3E79 A;  3R7X A;  5FTI A;  3RT8 A;  1GVC A;  5DEX B;  4QRZ A;  4P56 A;  4QFO A;  3N6U A;  1OQG A;  4MJO A;  3U72 A;  4OVJ A;  3VE1 B;  2R6G E;  2WBB A;  4FAJ A;  4NF4 A;  1DTG A;  2ALU A;  1FPJ A;  4OET A;  3TMG A;  1SBP A;  4HTG A;  3LUY A;  3MAM A;  4NF8 A;  2I4C A;  1TFA A;  5I2K A;  4OYV A;  5AA3 A;  3IX1 A;  2XXU A;  3ZSF A;  5DVF A;  4PGN A;  3PD9 A;  5EHM A;  3SEY A;  2HXR A;  3U92 A;  4LZ8 A;  4LZ7 A;  4IO2 A;  1IUD A;  1FPF A;  1S50 A;  1QUJ A;  4H5F A;  3FUZ A;  4UA8 A;  5EQ9 A;  4C1T A;  5DW8 A;  3KN7 A;  4GD5 A;  4I3E A;  1LBX A;  4GXS B;  1EYI A;  3B8B A;  4U1O A;  2REJ A;  3IFA A;  3K6V A;  4R2B A;  3TPA A;  4LN5 A;  2O84 X;  4G77 A;  4N8G A;  1IEJ A;  3E13 X;  1P1N A;  1NV3 A;  2H5Y A;  3FZV A;  3FGS A;  3TCH A;  3S9L C;  3BFT A;  4R2F A;  4EQ9 A;  1URG A;  3U65 A;  3I6V A;  3T0J A;  1MXZ A;  3MP8 A;  3GLB A;  3T9H B;  5AA2 A;  2RCB A;  4WED A;  4KCD A;  4K3F A;  4O7M A;  4YB7 A;  3GZG A;  5KZT A;  4EQ7 A;  2VPO A;  4RPO A;  1N76 A;  2F3D A;  4ZZE A;  3ILU B;  1DMB A;  1P99 A;  3OEM A;  1B7H A;  4DIG A;  2R8T A;  2DWH A;  5EYF A;  4NWC A;  4GL8 A;  1YYZ A;  1FBD A;  2XXR A;  4MFI A;  4X8R A;  1CNQ A;  4ZEC A;  2PCR A;  1D9Y A;  1B6H A;  2PX1 A;  3Q25 A;  2GHA A;  3C33 A;  1IME A;  4GX3 A;  5EQ7 A;  5ELV A;  4QFK A;  5DEX A;  2DE4 A;  3FVK A;  3A29 A;  2F35 A;  2W7Y A;  1A40 A;  2KQZ A;  5H8H B;  4JDF A;  4GWW A;  4XFE A;  2DDK A;  2ZYO A;  1NV0 A;  3KSX A;  4U1Z A;  2X7P A;  1QKB A;  1RDZ A;  1H43 A;  3KZG A;  1IMC A;  3E4R A;  1MQJ A;  4HCY A;  3W9V A;  3RPL B;  3H4Z A;  4ZE9 A;  3MPK A;  1BP5 A;  3ONM A;  4HE0 A;  1BKA A;  1UIV A;  4O3A A;  1NNK A;  1ZIU A;  4H0W A;  3FVO A;  4I1D A;  2GQ1 A;  2Q88 A;  3HCQ A;  3QUJ A;  4G61 A;  4GRK A;  2OX3 A;  2UYE A;  1B1H A;  1OMP A;  1QVS A;  2F8D A;  1QGX A;  4N81 A;  2H25 A;  1F9B A;  4PFT A;  3EHT A;  3V8X B;  4XKQ A;  3KJT A;  2G29 A;  1JW5 A;  3MVY A;  4N07 A;  2MKZ A;  5FBP A;  2OJT A;  4Q0C A;  3HHG A;  5B70 A;  4PAK A;  3KBZ A;  2XD3 A;  2B3B A;  1G0H A;  3MQ9 A;  4TLL B;  3PTY A;  5IZZ A;  4NE4 A;  3IJX B;  1LLS A;  4NED A;  1KZ8 A;  3MYU A;  3TZA A;  3H7M A;  3CSG A;  2Q9T A;  3LBS A;  2VPN A;  2XXY A;  1IMB A;  3UK4 A;  3ZKL A;  4PF6 A;  2RKM A;  2QS4 A;  1AWB A;  3LSF B;  2RC7 A;  2I0C A;  1MQG A;  2F34 A;  1SW2 A;  3PV0 E;  1SW5 A;  4NWD A;  1S9T A;  4P47 A;  4C1U A;  1I6A A;  1BTJ A;  3IOR A;  2D5W A;  2XHD A;  1VFE A;  4MLV A;  4NF6 B;  4G68 B;  4F3G A;  3OEK A;  2H9B A;  4RK9 A;  1SYH A;  2V3Q A;  1S7Y A;  4M4G A;  1AOV A;  1AL3 A;  1FBP A;  2QL3 A;  5H8H A;  2ZZX A;  4AB6 A;  3VV5 A;  4MX6 A;  3GYY A;  4XKN A;  1OVB A;  4ELR A;  3MJN A;  2IEE A;  4MH5 A;  2Q74 A;  3SEX A;  3O66 A;  1MXX A;  3RPL A;  1USY E;  1TT1 A;  3UOR A;  1B7U A;  2RCA A;  1JVX A;  1LFH A;  5CMB A;  2QRY A;  3IAZ A;  5CMC A;  3OEL A;  5TP9 B;  3SZP A;  1CB6 A;  1TXF A;  4MF3 A;  2QPQ A;  4P0I A;  5L9O A;  3ZS6 A;  2DYX A;  2CMO A;  1FTO A;  2FIX A;  5IM2 A;  5AA1 A;  4F18 A;  4FE8 A;  1H76 A;  1H44 A;  3QYT A;  2Y7R A;  1AMF A;  2XXP A;  3PMV A;  1B3E A;  4XXU A;  4ZDM A;  5L9S A;  5CBR A;  4FBP A;  5I7I A;  4R74 A;  3RTF B;  1ZTY A;  1EZ9 A;  3KN3 A;  1NV5 A;  3SEW A;  2L5V A;  4DI3 D;  2ZNU A;  3UP9 A;  4FEB A;  4P11 A;  1LEV A;  3CFX A;  1B5I A;  4MNP A;  4N8Y A;  4PAI A;  4U4S A;  4N17 A;  4IO6 A;  3FBP A;  4IY5 A;  3C35 A;  3TFL A;  2I58 A;  1Y3Q A;  1BK4 A;  2B3F A;  2Z8E A;  4ZED A;  5ICQ A;  3HPI A;  4NAP A;  1Z7N E;  3S2V A;  2V93 A;  4Z0I A;  3A09 A;  3IL1 B;  1US4 A;  1B3H A;  4E0X A;  4X04 A;  1IXI A;  3F11 A;  4PTK A;  3IR1 A;  4R9F A;  4GBV A;  4I40 A;  3WAE A;  3R6U A;  3C4M A;  1FQA A;  4YZZ A;  4NF6 A;  1AIV A;  3DEL B;  1FJ9 A;  2CEY A;  5I57 B;  2P1S A;  1FQF A;  3I5O A;  2DVZ A;  5M2V A;  4KD5 A;  1Y3N A;  5I59 A;  3C36 A;  3IOW A;  2QFL A;  3B6Q A;  2A5S A;  1IXC A;  3A3C A;  4ESW A;  3B7D A;  5DVJ A;  2Z23 A;  3PUX E;  1FBG A;  2DWA A;  4NHB A;  1WVJ A;  4MNC A;  4KYE A;  4DI4 B;  5IKB A;  1A99 A;  2HXW A;  4HCW A;  2Q8J A;  4GIZ A;  4ISU A;  2I49 A;  4PFU A;  5LTC A;  4MCO A;  3CRB A;  4ELQ A;  4PFI A;  4GL0 A;  1FBF A;  2P0S A;  3S4U A;  3SEV A;  3A3U A;  5TP9 A;  4RYA A;  3RQT A;  4GLI A;  4MHF A;  3MZ1 A;  4G8H A;  3ECR A;  5EQ8 A;  1SI1 A;  2D3I A;  2QSX A;  3Q29 A;  4EF1 A;  4GBW A;  3SES A;  5CI5 A;  3G3F A;  1I6B A;  1EYK A;  2X7Q A;  1P1U A;  1ZJL A;  3UA8 A;  2UVJ A;  4PAF A;  3OSQ A;  2Z8D A;  3P7I A;  1MPD A;  4YKI A;  2V3T A;  4E0W A;  2F6P A;  1NI9 A;  4BDQ A;  2YPN A;  2QS1 A;  4WKM A;  4F31 B;  3OEN A;  3GBA A;  1JW4 A;  2G93 A;  4C0R A;  3OO7 A;  3DP6 A;  5FHO A;  5H8F B;  3UIF A;  1B0H A;  3MWB A;  1M5F A;  5F24 A;  2ONK E;  5CRY A;  3AXF A;  1UTB B;  4PFR A;  1Q35 A;  5ISU A;  2Y7P A;  4OMB A;  4JSO A;  4KFQ A;  4NG7 A;  3T66 A;  5H8N B;  2PFY A;  2F36 A;  3GXA A;  1B52 A;  1FPK A;  3PMW A;  4WXJ A;  5A5X B;  4O3B A;  3QMF A;  2KLF A;  4EUO A;  1B7Z A;  3IFC A;  3LSL A;  2ABH A;  1D3K A;  3KC0 A;  3KG2 A;  1OLA A;  3BKI B;  3IK6 B;  4NX1 A;  2I0B A;  2FYI A;  4P8B A;  4F29 A;  5I57 A;  1N7X A;  1A55 A;  2DVC A;  4H65 A;  1DBZ A;  1NH8 A;  1B0L A;  1YAE A;  1JP4 A;  3M8U A;  4KQP A;  4AQ4 A;  3K1P A;  5BUU A;  2PFZ A;  3MC2 A;  2FNC A;  5LDZ A;  2ZZW A;  1JET A;  4KI0 E;  4GOT A;  1Y4C A;  5CC2 A;  2OCU A;  5DVI A;  5K2X A;  3TTR A;  1B58 A;  2ZXT A;  3FVG A;  4JSD A;  1XOC A;  3K6U A;  1DPE A;  4YB6 A;  4LQ5 A;  1FQB A;  3H6T A;  3TKD A;  2I3W A;  3G3I A;  4DE8 A;  2Q2C A;  3KC1 A;  4OZ9 A;  3HN0 A;  2GH9 A;  1MXW A;  1Y3P A;  1VE4 A;  4GF8 A;  2QMX A;  1FRP A;  4GWS A;  2REG A;  5FTH A;  1QUL A;  4JWO A;  4LUB A;  1MPC A;  2F97 A;  2F5X A;  2ZNS A;  2FVZ A;  4QBA A;  4XKP A;  3PPN A;  1MQI A;  3CHG A;  4OAN A;  4QSC A;  4U2R A;  3RT6 B;  4GWO A;  3U94 A;  3K4U A;  1B3G A;  2GHB A;  3FAS A;  2XWV A;  2AL5 A;  2Q2A A;  5AA2 D;  3OSR A;  3CIJ A;  1QW0 A;  1J1N A;  4EXL A;  2CZK A;  1H3D A;  4JB7 A;  3T93 B;  3TQW A;  4F2Q A;  2KR0 A;  2RC8 A;  2YJP A;  3VDF A;  2PBW A;  2QJE A;  4H6D A;  3ISP A;  4P1L A;  5AA4 A;  5JEI A;  4MIJ A;  2FA7 A;  1GV8 A;  4H45 A;  3HHF A;  1B4H A;  4IO4 A;  3C9H A;  4AS5 A;  1JEV A;  3K1N A;  2DP8 A;  1UTB A;  2OK2 A;  1TWY A;  1NV6 A;  3DP4 A;  3N94 A;  3KEI A;  5H8N A;  4IO7 A;  4PFW A;  4OVQ A;  3O6G A;  2HPG A;  2ZYK A;  1N3X A;  4OVT A;  4P9K A;  5A5X A;  1NV4 A;  4U21 A;  5J1D A;  1II5 A;  5B7D A;  2AIX A;  3IB0 A;  3IJO B;  2O6A A;  5EYG A;  1FSA A;  1B5J A;  3FJM A;  1MY4 A;  5TPA B;  1NUZ A;  2XX8 A;  3LSW A;  1LBW A;  1Z7M E;  3EHS A;  3S9M C;  3CG1 A;  4ONY A;  3SKP A;  4GXA A;  5I58 B;  1FPI A;  3VVF A;  1MDQ A;  1MY3 A;  3G3J A;  4R73 A;  3CVG A;  3RLF E;  4HXV A;  3E78 A;  1R1N A;  1LBY A;  1IQ7 A;  1FW0 A;  1UIU A;  3FV2 A;  5HPQ A;  1RDY A;  2UVI A;  2XWK A;  3RPW A;  4OQO A;  3TTN A;  4NN3 A;  4HE1 A;  1XC1 A;  1MRP A;  5J16 A;  1EH3 A;  3PUV E;  2DXY A;  1RDX A;  2E1S A;  3C31 A;  4WEP A;  4GWU A;  4AS4 A;  3VFJ A;  2F7B A;  1ZLQ A;  4KCC A;  3FIR A;  4IO5 A;  5HBC A;  3PU5 A;  4PET A;  1FTK A;  4XIG Q;  1M5E A;  4N6D A;  5DTB A;  2P3N A;  3MVZ A;  3VVD A;  2X26 A;  4X48 A;  3EN3 A;  4GWZ A;  2ANJ A;  3LUZ A;  2OWT A;  1RYX A;  3PUY E;  3DP8 A;  2FBP A;  2THI A;  2OZZ A;  1M5D A;  4PCD A;  5KDT B;  2V4C A;  1VR5 A;  1NV7 A;  4GWX A;  4I8C A;  4BLA A;  2VOZ A;  4FJP A;  1POT A;  2V3U A;  3PMX A;  3NOH A;  2NUV A;  1ZMG A;  1Q9D A;  4AB5 A;  2F3B A;  1LBV A;  2M8C A;  1SDX A;  4N13 A;  4EF2 A;  2VGQ A;  1B1X A;  4DLD A;  1NNF A;  1D9V A;  3MPL A;  5DT6 A;  1WOD A;  2NVU B;  4ZEB A;  4PBQ A;  3ILT B;  1FTL A;  5ET6 A;  2XXW A;  4ELP A;  5I56 B;  5IGA A;  2WKY A;  1LAF E;  4R6Y A;  3KFM A;  4JVD A;  4PC9 A;  4PDH A;  3ODB A;  2GFE A;  4OXV A;  2QVV A;  4OFJ A;  5I2N B;  3H03 A;  3LV0 A;  5TPA A;  1UTH B;  3VXB A;  4MBP A;  2DS9 A;  1LB8 A;  4N6K A;  1URS A;  1CE2 A;  1MPB A;  1N04 A;  2WEF A; 
#chains in the Genus database with same CATH homology
 1MY1 A;  3MUQ A;  3CFZ A;  3T9U A;  1SD3 A;  3O29 A;  1Y20 A;  2R71 A;  3OXN A;  1R9L A;  5I58 A;  3GBB A;  5JK4 A;  3G3H A;  3O2A A;  1MY0 A;  3K1M A;  4QFP A;  1PB8 A;  2XD2 A;  4IO3 A;  2HEU A;  4Q8R A;  5ICT A;  3K6X A;  3MW0 A;  3JZJ A;  4DXC A;  1DPP A;  1PEB A;  1JNF A;  4GQO A;  4ZZA A;  4RXL A;  1A7L A;  1MXU A;  3K6W A;  3FVN A;  1BIY A;  4PQJ A;  4JWX A;  4OER A;  2DQV A;  2ONS A;  1PB9 A;  3IOV A;  4YKK A;  1MS7 A;  4QHQ A;  3H6W A;  1MQH A;  3TUS A;  3TCF A;  4YKP A;  2ONR A;  4QSE A;  2F7C A;  2O7I A;  4QFL A;  4R72 A;  1Y1Z A;  2Q89 A;  3THI A;  4Q30 B;  2ZYN A;  2QS3 A;  4U22 A;  3PPP A;  1N0T A;  3M3L A;  3MBP A;  3CR9 A;  2RF1 A;  3IB2 A;  4R75 A;  4G68 A;  5KDT A;  4H5G A;  4NF8 B;  4XTC Q;  1XVX A;  4OFL A;  3TCG A;  3M3K A;  3SDF A;  1NNT A;  3MVX A;  1LBB A;  4KYD A;  3O6I A;  3VLU A;  2VD2 A;  1LCF A;  1VSO A;  3VLW A;  1MG1 A;  1I69 A;  2OBG A;  4G2Z A;  4ZE8 A;  3DLN A;  4F19 A;  4N6P A;  4FAT A;  3TQL A;  4TOZ A;  1A54 A;  1T0K A;  1TFD A;  3HV1 A;  5I56 A;  1MY2 A;  2BJJ X;  2XX7 A;  4Q5T A;  3HO7 A;  3O9P A;  1HSL A;  1GGG A;  4U4X A;  5I2N A;  1POY 1;  3T96 B;  3FXR A;  1UTH A;  2Y84 A;  4F1V A;  1WDN A;  3ZKK A;  3KGC A;  3TEL A;  3N5L A;  5K2Y A;  3VLV A;  2I48 A;  4NMY A;  4DDD A;  1DOT A;  3CSB A;  3SEU A;  4ZEF A;  5CMK A;  1FQD A;  4G68 C;  1GTK A;  2UXA A;  4OFO A;  4GVO A;  3RNN A;  3H06 B;  1FCK A;  3WAF A;  4POX A;  4TQU Q;  2HAV A;  3PPR A;  4RK2 A;  4EDP A;  2E0S A;  4LAT A;  3B6T A;  1SI0 A;  1ZKB A;  1SW1 A;  3T22 A;  3IOU A;  2ESN A;  4EXK A;  1IXH A;  4FEC A;  3Q26 A;  1MM6 A;  4I62 A;  1YPN A;  3TDJ A;  4XKR A;  4YAH X;  3C32 A;  3JYR A;  2O68 A;  4GFR A;  1MXV A;  4OES A;  4YMA A;  2Y7W A;  2XX9 A;  3R26 A;  3V89 B;  1JEU A;  2RIN A;  4IB2 A;  4F2O A;  2B65 A;  1JVY A;  2DXR A;  3RY3 A;  4OWD A;  2UYF A;  3EF7 A;  4P0G A;  1IIW A;  1GR2 A;  3KJ7 A;  1B3F A;  3CG3 A;  3G3G A;  1P1O A;  4THI A;  1LAH E;  4R9G A;  1DSN A;  2YLN A;  3H6V A;  3Q27 A;  3RTW B;  3HST A;  3TTM A;  2Z22 A;  1ANF A;  4QFN A;  2HFB A;  3L6G A;  4H67 A;  4FIM A;  3C34 A;  2DE2 A;  2AYS A;  1FTM A;  1A8F A;  4IY6 A;  2QMW A;  1Q1K A;  4ZEK A;  3USD A;  1EZO A;  1B05 A;  4H8I A;  4F1Y A;  1O63 A;  1RYO A;  4M1V A;  1SVX B;  4LQ2 A;  4YMB A;  4DCY A;  2XXX A;  3MZB A;  1YTV A;  4DXB A;  4OEU A;  1PC3 A;  4JBZ A;  2OLB A;  1MQD A;  2XXT A;  1DTZ A;  2I4B A;  3QUF A;  1IZ1 A;  4YIC A;  3TTL A;  1VFD A;  5BWJ A;  1MXY A;  1FQC A;  1NL5 A;  1O64 A;  3W9W A;  1OVT A;  5EHS A;  3FAT A;  3K01 A;  3I3V A;  3M3F A;  3OO9 A;  4R6K A;  1LAX A;  2QS2 A;  1QKA A;  1A8E A;  5ITO A;  3D4C A;  2O1L A;  3FJ7 A;  3UN6 A;  2H99 A;  4X9T A;  5H8F A;  1EU8 A;  4POW A;  3T9X B;  1SQY A;  3RGY A;  3FD3 A;  1I6Q A;  3OOA A;  4JXI A;  3KBR A;  3G7W A;  1LFI A;  1SW4 A;  4FED A;  1BLF A;  2NWJ A;  2HZK A;  1LST A;  3KOS A;  1JW1 A;  3LR1 A;  2IA4 A;  2ZYM A;  4F3S A;  1OQH A;  4DXU A;  1KWH A;  2OWS A;  4YKJ A;  1LB9 A;  1B4Z A;  1ZU0 A;  5LOM A;  4X1D A;  1R9Q A;  5AE4 A;  2DOJ A;  5JTY B;  2V84 A;  4TLM B;  3RUM A;  5CBS A;  2UVH A;  5KCJ B;  4G4P A;  4LVQ A;  2UVG A;  1OIB A;  3KN8 A;  1N3W A;  1US5 A;  3CI8 A;  3KSJ A;  2AL4 A;  1QUI A;  3D4G A;  1B40 A;  1Y4T A;  1FQE A;  1PB7 A;  3IO6 A;  3U93 A;  2PMS A;  1NNP A;  1P1Q A;  2Y7I A;  4OEV A;  2PT2 A;  4NTL A;  5FHM A;  3TOD A;  4O3C A;  1N7W A;  4EQB A;  3U1O A;  3RN8 A;  3QIM A;  2PT1 A;  3MP1 A;  2V25 A;  4PFY A;  4FOR A;  3EHU A;  3QXM A;  4KHZ E;  5IAI A;  3G3K A;  3FV1 A;  3N6T A;  2O69 A;  3H6U A;  4L17 A;  3MZ9 A;  2ZNT A;  4HW8 A;  1B51 A;  3FXU A;  1D4N A;  1M5B A;  2XXI A;  4G8N A;  4U23 A;  2DE3 A;  4MLQ A;  4DCX A;  3H3G A;  1OLC A;  4H1X A;  2HQ0 A;  4PP0 A;  3OO8 A;  4DZ1 A;  3S9E A;  1XVY A;  3OD7 A;  1QUK A;  3QSL A;  1EZP A;  3TYH A;  4F1U A;  1PBQ A;  5HM4 B;  3SER A;  2RC9 A;  2HAU A;  4QSD A;  1SYI A;  3PUZ E;  1QJM A;  2Y7K A;  1AH5 A;  2NXO A;  3PPQ A;  4YB5 A;  1FTJ A;  4ND9 A;  2PYY A;  5I59 B;  4BDR A;  3B6W A;  5ITP A;  3EPE A;  4ZEI A;  4HS7 A;  3JV9 A;  4LA9 A;  3MVW A;  3BBR A;  4X1B A;  4IGR A;  2A5T B;  4NF5 B;  3MP6 A;  1PBP A;  4LZ5 A;  3U8Q A;  3DM0 A;  3PGF A;  1B3L A;  4LP2 B;  3KOT A;  2O7U A;  4OTE A;  2VD3 A;  4PE5 B;  4BDN A;  5JTY A;  5I84 A;  3O6H A;  4R6H A;  3OO6 A;  5KCJ A;  4KYS A;  5L9M A;  2CZL A;  5F7V A;  2H4I A;  4BDO A;  3OMB A;  1HSJ A;  2Z8F A;  4KR5 A;  2P2A A;  2VP1 A;  3FJG A;  3LC8 A;  2O51 A;  3TAJ A;  3QK6 A;  5H8Q B;  1B2H A;  1NKX A;  1URD A;  1XHY A;  3PUW E;  2VHA A;  2LAO A;  1IIT A;  3BFU A;  5CM6 A;  1LAG E;  3TTK A;  1Y1M A;  3EQ1 A;  3LSX A;  4RJZ A;  3K0V A;  4I9D A;  4ZS9 A;  3V83 A;  1R6Z A;  3L6H A;  3VXC A;  1LBC A;  3FXQ A;  3K00 A;  4F39 A;  1B46 A;  3T9V A;  4F3B A;  1ELJ A;  3E3K A;  4JWY A;  3Q28 A;  1LCT A;  4H8J A;  1ATG A;  1XS5 A;  1USY H;  4RA1 A;  1B9J A;  1JQF A;  5FHN A;  4UAC A;  4NF4 B;  3VVE A;  4F22 A;  4LON B;  1M5C A;  3V5A A;  4ELO A;  3O97 A;  5CMM A;  1NMU A;  4RY1 A;  5I2K B;  2R9J A;  4ECF A;  1NFT A;  1IXG A;  1L5T A;  4OHN A;  2D21 A;  3K02 A;  2F6G A;  2XXV A;  1MDP 1;  2I3V A;  5DYH A;  4RPN A;  1H45 A;  4QF9 A;  2NOO A;  1MM7 A;  1NH7 A;  2PVU A;  1HSE A;  1PDA A;  3O28 A;  2DSF A;  3PD8 A;  1LGB C;  2XXH A;  2A5T A;  3SET A;  4NF5 A;  4OEN A;  5H8S A;  1B32 A;  2ZMB A;  4G8M A;  3K2D A;  4ESX A;  1MH3 A;  4IGT A;  5L8D A;  2GRV A;  2DWJ A;  3UGW A;  3S9N C;  4KPT A;  2F7A A;  4F3P A;  4BDM A;  3CFL A;  1RKM A;  1UQW A;  3IOT A;  5H8Q A;  5AA2 B;  1Y9U A;  3W15 C;  1XT8 A;  3E9X A;  5F1Q A;  1ZBM A;  4BDL A;  2I6E A;  2O1M A;  5TU0 A;  4RNS A;  2DWI A;  3TEP A;  1N84 A;  4Z7E A;  1MH4 A;  3QAX A;  2H98 A;  3IB1 A;  3PPO A;  1P1W A;  3N26 A;  2XXQ A;  1O7T A;  4YU0 A;  1B5H A;  2HCA A;  5AA4 B;  1LFG A;  1YCJ A;  2F78 A;  3IO4 A;  2HZL A;  3R7X A;  5FTI A;  3RT8 A;  1GVC A;  5DEX B;  4QRZ A;  4QFO A;  3N6U A;  1OQG A;  3U72 A;  4OVJ A;  3VE1 B;  2R6G E;  4FAJ A;  4NF4 A;  1DTG A;  2ALU A;  4OET A;  3TMG A;  1SBP A;  4HTG A;  3LUY A;  3MAM A;  4NF8 A;  2I4C A;  1TFA A;  5I2K A;  4OYV A;  5AA3 A;  3IX1 A;  2XXU A;  3ZSF A;  5DVF A;  3PD9 A;  5EHM A;  3SEY A;  3U92 A;  4LZ8 A;  4LZ7 A;  4IO2 A;  1IUD A;  1S50 A;  1QUJ A;  4H5F A;  3FUZ A;  4UA8 A;  4C1T A;  3KN7 A;  4GD5 A;  4GXS B;  4U1O A;  2REJ A;  3K6V A;  4R2B A;  3TPA A;  2O84 X;  4G77 A;  1IEJ A;  3E13 X;  1P1N A;  2H5Y A;  3FZV A;  3FGS A;  3TCH A;  3S9L C;  3BFT A;  4R2F A;  4EQ9 A;  1URG A;  3I6V A;  1MXZ A;  3MP8 A;  3GLB A;  3T9H B;  5AA2 A;  2RCB A;  4WED A;  4KCD A;  4K3F A;  4YB7 A;  3GZG A;  5KZT A;  4EQ7 A;  4RPO A;  1N76 A;  4ZZE A;  3ILU B;  1DMB A;  1P99 A;  3OEM A;  1B7H A;  4DIG A;  2DWH A;  5EYF A;  4NWC A;  4GL8 A;  4MFI A;  2XXR A;  4ZEC A;  1D9Y A;  1B6H A;  2PX1 A;  3Q25 A;  2GHA A;  3C33 A;  5ELV A;  4QFK A;  5DEX A;  2DE4 A;  3FVK A;  2F35 A;  2W7Y A;  1A40 A;  5H8H B;  4JDF A;  2ZYO A;  3KSX A;  4U1Z A;  2X7P A;  1QKB A;  1H43 A;  3KZG A;  3E4R A;  1MQJ A;  4HCY A;  3W9V A;  3H4Z A;  4ZE9 A;  3MPK A;  1BP5 A;  3ONM A;  1BKA A;  1UIV A;  4O3A A;  1NNK A;  1ZIU A;  4H0W A;  3FVO A;  4I1D A;  2Q88 A;  3HCQ A;  3QUJ A;  4GRK A;  2UYE A;  1B1H A;  1OMP A;  1QVS A;  2F8D A;  2H25 A;  1F9B A;  4PFT A;  3EHT A;  3V8X B;  4XKQ A;  3KJT A;  2G29 A;  1JW5 A;  3MVY A;  4N07 A;  2OJT A;  4Q0C A;  3HHG A;  5B70 A;  2XD3 A;  2B3B A;  3MQ9 A;  4TLL B;  4NE4 A;  3IJX B;  1LLS A;  4NED A;  3TZA A;  3H7M A;  3CSG A;  2Q9T A;  3LBS A;  2XXY A;  3UK4 A;  3ZKL A;  2RKM A;  2QS4 A;  3LSF B;  2RC7 A;  2I0C A;  1MQG A;  2F34 A;  1SW2 A;  3PV0 E;  1SW5 A;  4NWD A;  1S9T A;  4C1U A;  1I6A A;  1BTJ A;  3IOR A;  2D5W A;  2XHD A;  1VFE A;  4MLV A;  4NF6 B;  4G68 B;  4F3G A;  3OEK A;  2H9B A;  4RK9 A;  1SYH A;  2V3Q A;  1S7Y A;  4M4G A;  1AOV A;  1AL3 A;  2QL3 A;  5H8H A;  4AB6 A;  3VV5 A;  4XKN A;  1OVB A;  4ELR A;  3MJN A;  2IEE A;  4MH5 A;  3SEX A;  3O66 A;  1MXX A;  1USY E;  1TT1 A;  3UOR A;  1B7U A;  2RCA A;  1JVX A;  1LFH A;  5CMB A;  2QRY A;  3IAZ A;  5CMC A;  3OEL A;  5TP9 B;  1CB6 A;  1TXF A;  4MF3 A;  2QPQ A;  4P0I A;  5L9O A;  3ZS6 A;  2DYX A;  2CMO A;  1FTO A;  5AA1 A;  4F18 A;  4FE8 A;  1H76 A;  1H44 A;  3QYT A;  2Y7R A;  1AMF A;  2XXP A;  3PMV A;  1B3E A;  4XXU A;  4ZDM A;  5L9S A;  5CBR A;  4R74 A;  3RTF B;  1ZTY A;  1EZ9 A;  3KN3 A;  3SEW A;  2ZNU A;  3UP9 A;  4FEB A;  4P11 A;  3CFX A;  1B5I A;  4U4S A;  4IO6 A;  4IY5 A;  3C35 A;  3TFL A;  2I58 A;  1Y3Q A;  2B3F A;  2Z8E A;  4ZED A;  5ICQ A;  3HPI A;  1Z7N E;  3S2V A;  2V93 A;  4Z0I A;  3A09 A;  3IL1 B;  1US4 A;  1B3H A;  4E0X A;  1IXI A;  3F11 A;  3IR1 A;  4R9F A;  3WAE A;  3R6U A;  3C4M A;  1FQA A;  4YZZ A;  4NF6 A;  1AIV A;  3DEL B;  5I57 B;  2P1S A;  1FQF A;  3I5O A;  2DVZ A;  5M2V A;  4KD5 A;  1Y3N A;  5I59 A;  3C36 A;  3IOW A;  3B6Q A;  2A5S A;  1IXC A;  3A3C A;  4ESW A;  3B7D A;  5DVJ A;  2Z23 A;  3PUX E;  2DWA A;  1WVJ A;  4KYE A;  5IKB A;  1A99 A;  2HXW A;  4HCW A;  2Q8J A;  4GIZ A;  4ISU A;  2I49 A;  4PFU A;  3CRB A;  4ELQ A;  4GL0 A;  2P0S A;  3S4U A;  3SEV A;  3A3U A;  5TP9 A;  4RYA A;  3RQT A;  4GLI A;  3MZ1 A;  4G8H A;  3ECR A;  1SI1 A;  2D3I A;  2QSX A;  3Q29 A;  4EF1 A;  3SES A;  5CI5 A;  3G3F A;  1I6B A;  2X7Q A;  1P1U A;  1ZJL A;  3UA8 A;  2UVJ A;  3OSQ A;  2Z8D A;  3P7I A;  1MPD A;  4YKI A;  2V3T A;  4E0W A;  2F6P A;  4BDQ A;  2YPN A;  2QS1 A;  4WKM A;  4F31 B;  3OEN A;  3GBA A;  1JW4 A;  2G93 A;  4C0R A;  3OO7 A;  3DP6 A;  5FHO A;  5H8F B;  3UIF A;  1B0H A;  3MWB A;  1M5F A;  2ONK E;  5CRY A;  3AXF A;  1UTB B;  1Q35 A;  5ISU A;  2Y7P A;  4OMB A;  4JSO A;  4KFQ A;  3T66 A;  5H8N B;  2F36 A;  3GXA A;  1B52 A;  3PMW A;  4WXJ A;  5A5X B;  4O3B A;  2KLF A;  4EUO A;  1B7Z A;  3LSL A;  2ABH A;  1D3K A;  3KG2 A;  1OLA A;  3BKI B;  3IK6 B;  2I0B A;  2FYI A;  4F29 A;  5I57 A;  1N7X A;  1A55 A;  2DVC A;  4H65 A;  1NH8 A;  1B0L A;  1YAE A;  3M8U A;  4KQP A;  4AQ4 A;  3K1P A;  5BUU A;  3MC2 A;  2FNC A;  1JET A;  4KI0 E;  4GOT A;  1Y4C A;  5CC2 A;  2OCU A;  5DVI A;  5K2X A;  3TTR A;  1B58 A;  2ZXT A;  3FVG A;  4JSD A;  1XOC A;  3K6U A;  1DPE A;  4YB6 A;  4LQ5 A;  1FQB A;  3H6T A;  3TKD A;  2I3W A;  3G3I A;  4DE8 A;  2Q2C A;  4OZ9 A;  3HN0 A;  2GH9 A;  1MXW A;  1Y3P A;  1VE4 A;  4GF8 A;  2QMX A;  2REG A;  5FTH A;  1QUL A;  4JWO A;  4LUB A;  1MPC A;  2F97 A;  2F5X A;  2ZNS A;  4XKP A;  3PPN A;  1MQI A;  4QSC A;  4U2R A;  3RT6 B;  4GWO A;  3U94 A;  3K4U A;  1B3G A;  2GHB A;  3FAS A;  2AL5 A;  2Q2A A;  5AA2 D;  3OSR A;  3CIJ A;  1QW0 A;  1J1N A;  4EXL A;  1H3D A;  4JB7 A;  3T93 B;  3TQW A;  4F2Q A;  2RC8 A;  2YJP A;  3VDF A;  2PBW A;  2QJE A;  4H6D A;  5AA4 A;  5JEI A;  2FA7 A;  1GV8 A;  3HHF A;  1B4H A;  4IO4 A;  3C9H A;  1JEV A;  3K1N A;  2DP8 A;  1UTB A;  2OK2 A;  1TWY A;  3DP4 A;  3N94 A;  3KEI A;  5H8N A;  4IO7 A;  4PFW A;  3O6G A;  2ZYK A;  1N3X A;  5A5X A;  4U21 A;  5J1D A;  1II5 A;  5B7D A;  2AIX A;  3IB0 A;  3IJO B;  2O6A A;  1B5J A;  3FJM A;  1MY4 A;  5TPA B;  2XX8 A;  3LSW A;  1Z7M E;  3EHS A;  3S9M C;  3CG1 A;  4ONY A;  3SKP A;  4GXA A;  5I58 B;  3VVF A;  1MDQ A;  1MY3 A;  3G3J A;  4R73 A;  3CVG A;  3RLF E;  1R1N A;  1IQ7 A;  1FW0 A;  1UIU A;  3FV2 A;  5HPQ A;  2UVI A;  3RPW A;  4OQO A;  3TTN A;  1XC1 A;  1MRP A;  1EH3 A;  3PUV E;  2DXY A;  2E1S A;  3C31 A;  4WEP A;  3VFJ A;  2F7B A;  1ZLQ A;  4KCC A;  3FIR A;  4IO5 A;  5HBC A;  3PU5 A;  4PET A;  1FTK A;  4XIG Q;  1M5E A;  5DTB A;  3MVZ A;  3VVD A;  2X26 A;  4X48 A;  3EN3 A;  2ANJ A;  2OWT A;  1RYX A;  3PUY E;  3DP8 A;  2THI A;  2OZZ A;  1M5D A;  5KDT B;  1VR5 A;  4I8C A;  4BLA A;  2VOZ A;  4FJP A;  1POT A;  2V3U A;  3PMX A;  2NUV A;  1ZMG A;  4AB5 A;  2M8C A;  1SDX A;  4N13 A;  4EF2 A;  2VGQ A;  1B1X A;  4DLD A;  1NNF A;  1D9V A;  3MPL A;  5DT6 A;  1WOD A;  2NVU B;  4ZEB A;  3ILT B;  1FTL A;  2XXW A;  4ELP A;  5I56 B;  2WKY A;  1LAF E;  4R6Y A;  3KFM A;  3ODB A;  2GFE A;  4OXV A;  4OFJ A;  5I2N B;  3H03 A;  5TPA A;  1UTH B;  3VXB A;  4MBP A;  2DS9 A;  1LB8 A;  1URS A;  1CE2 A;  1MPB A;  1N04 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...