3QAXA

Crystal structure analysis of the cpb0502
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
232
structure length
232
Chain Sequence
RIWIVGTNATYPPFEYVDAQGEVVGFDIDLAKAISEKLGKQLEVREFAFDALILNLKKHRIDAILAGMSITPSRQKEIALLPYYGDEVQELMVVSKRSLETPVLPLTQYSSVAVQTGTYQEHYLLSQPGICVRSFDSTLEVIMEVRYGKSPVAVLEPSVGRVVLKDFPNLVATRLELPPECWVLGCGLGVAKDRPEEIQTIQQAITDLKSEGVIQSLTKKWQLSEVAYEAAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transport protein
molecule keywords Probable ABC transporter arginine-binding protein ArtJ
publication title Crystal structure of the cpb0502
rcsb
source organism Chlamydophila pneumoniae
total genus 64
structure length 232
sequence length 232
chains with identical sequence B
ec nomenclature
pdb deposition date 2011-01-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00497 SBP_bac_3 Bacterial extracellular solute-binding proteins, family 3
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qaxA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3qaxA02
3GLBA 2VD2A 3RNNA 3CFZA 1JW4A 3TQWA 2P2AA 1VFDA 3CSGA 1PB8A 5K2YA 1B7HA 4KHZE 3IR1A 3MZ1A 2ANJA 1TXFA 4DIGA 3U92A 4LUBA 3UORA 1P1OA 4G68A 4U1ZA 3SDFA 5FTIA 3T66A 4OTEA 3V83A 1IXHA 1P1WA 4KD5A 4LP2B 3TZAA 4AB6A 5L9MA 1LFGA 1YPNA 1Z7NE 2Y7WA 2RF1A 3K01A 4OFLA 2Z8FA 4YKKA 4QF9A 2AL5A 3SEUA 3IB2A 3RTWB 2G93A 1EZPA 4JSDA 1R6ZA 1Y3PA 3LSFB 3FIRA 4YMBA 4LATA 3W15C 3OMBA 4IO4A 1XC1A 4DCYA 4DXCA 4F1UA 4ZEKA 4XKNA 4YZZA 1QVSA 3IX1A 5KDTB 1B58A 1MQJA 3TODA 1IEJA 3G3JA 1MXZA 3S4UA 2Y7KA 1DPPA 2F36A 1SI1A 4H6DA 2FA7A 4H1XA 4JSOA 3T9UA 1TWYA 3VXCA 3VLWA 3Q28A 3T9XB 4BDMA 4TLMB 3IB1A 1F9BA 2ZYMA 4QRZA 3K6VA 1XOCA 5KDTA 3B6WA 4F3GA 4GRKA 3EHUA 3K6UA 4F31B 1B7UA 1B3HA 3O97A 1FQEA 3S2VA 1LSTA 3B7DA 2GRVA 5ICQA 3SERA 4MBPA 1ZKBA 2GFEA 4GXAA 3VVFA 2UVIA 3VVEA 2VHAA 3PV0E 1T0KA 4MH5A 2I58A 1ZMGA 1MPCA 3K4UA 2LAOA 2DWAA 5I58A 3OD7A 1B5HA 3UA8A 3UP9A 3TMGA 2F8DA 4NF8B 1H76A 1IQ7A 1B51A 1HSJA 3CG3A 3IOTA 1VFEA 3T93B 3KJTA 3PMWA 4QFLA 2Y7PA 5AA3A 1ZU0A 3FV2A 4P11A 4JDFA 4HCYA 2I4BA 2QS4A 4ELPA 4IY5A 2PX1A 3SEYA 5CMMA 4NF8A 4DLDA 4EQ9A 3OEMA 3EQ1A 1LBBA 1N84A 2O84X 4G68C 4ISUA 1H45A 3PPRA 1IZ1A 2OJTA 1O64A 4BDOA 3QSLA 5F1QA 5DYHA 4XXUA 4XKPA 3FXQA 3C31A 4C1TA 1MXWA 5AA1A 1ELJA 2F34A 5H8HB 1URSA 3MW0A 5JTYA 3UIFA 4F29A 4OESA 1AH5A 4JWXA 3FUZA 3PUXE 4ONYA 5KZTA 2D5WA 4C0RA 5EYFA 4G77A 4F1VA 1MY1A 4O3AA 1PC3A 1VR5A 2OZZA 3IO6A 2Y7IA 3IOVA 4LZ5A 3HN0A 3RT8A 2RINA 4GOTA 2AIXA 3TAJA 2NOOA 1QUJA 2XX7A 3PUWE 4R9FA 3OSRA 1JETA 3IJOB 1LCFA 4OXVA 5I56A 2NVUB 1EZOA 2THIA 1MQHA 5K2XA 4BLAA 3H06B 1Y4CA 5H8QB 5CMKA 1OVBA 5TP9A 5I57A 2PT1A 3KGCA 4KYDA 2QS3A 4JXIA 3HHGA 2X7QA 3CI8A 3FXRA 1XHYA 4OEVA 2I4CA 1B46A 2O6AA 1WODA 4RPOA 1S7YA 3EHTA 3O6GA 1M5CA 4PETA 1EU8A 5H8QA 4P0GA 1FTMA 3RN8A 3TEPA 2DOJA 2QRYA 2WKYA 3BBRA 4NTLA 1D9YA 4R2FA 2UYFA 2O51A 4F39A 4G8MA 2XXRA 4GLIA 4DXUA 1MDP1 4G2ZA 1QKBA 1MPBA 1D3KA 4WEDA 2F5XA 3CVGA 2V25A 4IO7A 4I8CA 3G3FA 2M8CA 5H8NA 3VVDA 5CMCA 1NNPA 3EF7A 5TPAA 1EH3A 4EXKA 3E3KA 3LSXA 4DE8A 3TPAA 2Z23A 1MH3A 1FQDA 1ZLQA 4NWCA 1LCTA 4I9DA 3LR1A 4OHNA 5A5XB 4EF2A 2VD3A 3FVOA 1Y1MA 3PMXA 4YKJA 4NF4B 3FVGA 1LLSA 3H03A 4EF1A 4PFTA 3WAEA 3GXAA 3OOAA 4OVJA 1NKXA 1NFTA 3G3IA 3U93A 2B3BA 3S9EA 1LBCA 1HSLA 2XXVA 4NMYA 1MXUA 2RC9A 1N3WA 3O9PA 3L6HA 4R6HA 3CSBA 2X26A 3ILTB 1SD3A 3R7XA 1QUIA 3DLNA 3HHFA 3MP8A 5AA4B 4THIA 1US4A 4GL0A 4HTGA 1B3GA 1ZBMA 3JZJA 5KCJA 5I2NB 4FEDA 4I1DA 2F6PA 2QPQA 3TUSA 2F7BA 3TELA 3RT6B 5LOMA 1M5BA 5FHNA 1GVCA 4FIMA 2DXYA 1QJMA 5DT6A 4ZDMA 3O28A 4R6YA 5I2NA 4R74A 3KN7A 3H7MA 3LC8A 4PP0A 3TDJA 2IA4A 4KCDA 1NL5A 3CFXA 5ITOA 3C34A 5ITPA 1YTVA 4IO6A 4NF6B 4PQJA 3L6GA 1B3EA 2ABHA 3WAFA 3G3GA 1B4HA 2RC8A 3KG2A 1BTJA 5CBRA 3D4GA 4F19A 2I3WA 1DTGA 1PB7A 4UACA 3TCFA 2XXTA 1RYOA 4WXJA 3H4ZA 3OENA 1IXGA 1M5FA 4NF6A 4KYEA 1ZIUA 3BFTA 3K00A 1N0TA 3PD8A 5FTHA 4I62A 3M3FA 2UYEA 5DEXB 2Q2AA 2I6EA 4PE5B 1P1QA 1AL3A 1FTLA 2H4IA 2Q8JA 3K0VA 1DTZA 1NMUA 3CR9A 4Z7EA 3MAMA 3N26A 1GGGA 3PPOA 3ONMA 1NNTA 3FV1A 2DXRA 2QS2A 3HCQA 4R6KA 2B3FA 2I48A 4IO5A 2BJJX 2ZYOA 5DEXA 1LAGE 1PBQA 3AXFA 4ZECA 2VP1A 1SBPA 3IORA 4Z0IA 3K2DA 1A99A 2DE4A 1AOVA 2DSFA 3V8XB 4YB7A 2HZLA 1YAEA 4R2BA 4PFWA 5AA2B 4KYSA 3DP8A 4GQOA 1BP5A 1ZTYA 3GBAA 4XKQA 2F6GA 1LGBC 2Q88A 5EHMA 3MZ9A 3E9XA 3ODBA 5FHMA 1USYH 3T96B 1XVXA 1AMFA 2XXUA 1M5EA 3Q29A 3UN6A 2DP8A 4EUOA 4AQ4A 3IK6B 1A40A 4JWOA 4GXSB 5AA2A 4IB2A 3MVXA 1OLCA 2R9JA 4R9GA 1DPEA 3RLFE 2I0CA 2OK2A 1B5IA 4JBZA 4MFIA 3PUYE 3S9NC 2XXQA 4TLLB 4ECFA 4KPTA 2KLFA 4M4GA 1US5A 4IGRA 3M3KA 1QUKA 1MH4A 1URDA 1P1UA 1LAXA 1S9TA 2V93A 3B6QA 3H6VA 3HO7A 4P0IA 4UA8A 3ZKKA 1DOTA 1ATGA 2HCAA 2AL4A 2OLBA 1H44A 5M2VA 1B1XA 4RA1A 3IB0A 4BDRA 2DVCA 2XXPA 4F22A 1TT1A 2F35A 4ESXA 5CBSA 3F11A 1JEVA 3TTRA 2YLNA 3TQLA 1QW0A 4L17A 1SDXA 4DXBA 4EQ7A 3DELB 3M8UA 3H6TA 5HPQA 3PU5A 4ZE8A 4NF5B 2PYYA 4EXLA 3RY3A 5I84A 3IAZA 3QUJA 3OO6A 1XVYA 3SEVA 2REJA 4RNSA 3MBPA 1Y9UA 1H3DA 2NWJA 3KJ7A 1PDAA 1B9JA 1TFDA 3IO4A 4JB7A 4F1YA 1J1NA 3OO9A 4N13A 1SW1A 3C9HA 5AA2D 3TYHA 5AE4A 3A3UA 3K1PA 5L9SA 3ZKLA 2DWIA 3P7IA 1UTHB 1Z7ME 2HFBA 1UTBB 5H8HA 3VLVA 4GWOA 1BLFA 1WVJA 1L5TA 3GBBA 3O66A 4X1DA 1R9QA 3O2AA 3QYTA 4WKMA 4YMAA 2I0BA 3MJNA 4RPNA 1N3XA 1B05A 3QIMA 4GF8A 5ELVA 4KQPA 4QSEA 2O7UA 1MY3A 3C36A 1B52A 4YKPA 1A8EA 1UTHA 2DWHA 2H98A 3H6UA 2H25A 3U94A 4U4SA 4KCCA 2ALUA 1KWHA 3FVNA 3K6XA 2UVHA 3R26A 4OETA 1VSOA 1FTJA 2Z8EA 5DVFA 2XHDA 4POWA 2V3QA 3UGWA 2PVUA 3T9HB 1SW2A 3Q26A 2HXWA 3KFMA 5H8SA 5HBCA 4U4XA 1Y4TA 3W9VA 2O7IA 1A55A 1NH8A 3O29A 1MQGA 1B7ZA 3KOTA 4YB6A 2DYXA 3SEXA 1Y3NA 5DVIA 3G3KA 1SI0A 4IGTA 5I2KB 3PUVE 1CB6A 3MPKA 3PPNA 1HSEA 4YICA 2V3UA 3FD3A 2ZNSA 2Y7RA 1MPDA 3TKDA 1MRPA 4FORA 4PFUA 1B2HA 4RXLA 4KR5A 4LVQA 2DS9A 3DM0A 5I2KA 1I6BA 4DZ1A 1B1HA 4G8HA 4OMBA 4H0WA 3RGYA 2ZNTA 3FJ7A 1N04A 2H99A 1R9LA 2Y84A 3CIJA 4Q8RA 3U72A 3QXMA 1MXYA 4LQ5A 2VOZA 2QSXA 2O69A 4H8IA 3BFUA 4NEDA 1O7TA 5A5XA 5HM4B 2OWSA 1LB8A 2VGQA 4NF4A 1MM6A 3A3CA 3PPQA 2XX8A 1A8FA 1N7XA 4ZEBA 2XD2A 1B40A 3LUYA 2F7AA 3FXUA 4F2QA 5I59B 1M5DA 2Z8DA 3KN8A 3IJXB 1Q1KA 4Q30B 3SKPA 1N76A 5H8FB 1OQGA 1JQFA 1MY2A 2HAVA 4YB5A 1I6AA 3A09A 1GR2A 3SETA 5AA4A 1FCKA 2A5TB 3V89B 4QHQA 4KFQA 2O1MA 2I49A 1B3LA 2R71A 2ZYKA 2HAUA 1Q35A 2V84A 1D4NA 3QAXA 3C33A 3PPPA 4HS7A 4ELQA 3QUFA 2F97A 2V3TA 2XX9A 3IL1B 4G8NA 1XS5A 1FTOA 3I3VA 2Q89A 1FQAA 4LA9A 4YAHX 2H5YA 1B32A 1XT8A 3U1OA 4G68B 1IITA 4N6PA 2XD3A 4OFJA 3D4CA 5IKBA 3VE1B 2G29A 4X48A 5L9OA 2DWJA 2YPNA 2OCUA 4YKIA 1TFAA 5CC2A 2ONKE 3KOSA 3QK6A 2XXIA 3KN3A 4TOZA 3CRBA 2XXHA 4H67A 3OXNA 5L8DA 1UQWA 1B3FA 2ONSA 3OO8A 1D9VA 1Y20A 3FZVA 2OBGA 1POY1 4QSDA 4M1VA 2P0SA 1PBPA 2ZXTA 3DP4A 1EZ9A 4IO3A 5CRYA 3TFLA 2DQVA 3T22A 1MY0A 1SW4A 4RK2A 2XXWA 1OMPA 3TTLA 3ECRA 5CI5A 4ZE9A 1JW5A 4O3BA 2I3VA 2X7PA 4FJPA 1OIBA 3FGSA 5B70A 1NH7A 3ILUB 3FASA 4OEUA 2IEEA 4GD5A 3V5AA 2RCBA 1IUDA 4R75A 2O1LA 3MP6A 1JW1A 1FTKA 1FW0A 3THIA 4OENA 4AB5A 4OQOA 5DVJA 1LFHA 3IOWA 1DSNA 4E0XA 2UVJA 3RQTA 1RYXA 4FE8A 1QULA 1MXXA 1QKAA 2W7YA 2A5SA 2ONRA 3KSXA 3MP1A 3PMVA 2NXOA 3W9WA 1II5A 1LAHE 4ZZEA 4Q0CA 5I58B 3N6TA 2QMWA 4LZ8A 1WDNA 1SYHA 4GVOA 1LB9A 3U8QA 3MZBA 5EHSA 3HSTA 5J1DA 4U1OA 4YU0A 2DVZA 3MVZA 4XTCQ 4RK9A 3DP6A 2PBWA 2ZNUA 4KI0E 4FEBA 1B6HA 4GFRA 3PD9A 3OEKA 4NWDA 1B5JA 4BDNA 5B7DA 1SVXB 3S9LC 2QL3A 4FATA 4K3FA 3TTKA 1MQIA 3O6HA 5CM6A 4FAJA 2R6GE 3LSLA 4IO2A 4IY6A 5BWJA 3FJMA 3USDA 3K1MA 2B65A 1IIWA 3MQ9A 5ICTA 4JWYA 3R6UA 2ZYNA 4MF3A 3VV5A 1I6QA 5IAIA 4G4PA 5FHOA 3EPEA 3HV1A 1PB9A 2H9BA 2UXAA 4LQ2A 4QSCA 3I6VA 2Q9TA 5JTYB 3JV9A 3SEWA 5CMBA 3E13X 2NUVA 4RJZA 1AIVA 2HQ0A 1YCJA 4LONB 2HZKA 3MVYA 4NF5A 4OYVA 4LZ7A 4U2RA 1MXVA 3KEIA 4H65A 4ZEFA 4ZZAA 3S9MC 4BDQA 4OWDA 4X9TA 2RC7A 1A7LA 3ZSFA 4U23A 3Q27A 2CMOA 4F3SA 1ANFA 1UIVA 4QFNA 1JVYA 2GHAA 3N94A 5I56B 2O68A 3EN3A 1S50A 1NNFA 2QS1A 3K6WA 4FECA 5TP9B 5I57B 3G3HA 4ESWA 2DE2A 1OLAA 2YJPA 2GH9A 3C32A 5TU0A 2DE3A 3CG1A 1R1NA 1UTBA 4XIGQ 1LFIA 5F7VA 3OELA 4DDDA 4F3PA 4E0WA 2F78A 4OFOA 3VDFA 2D21A 2FNCA 2F7CA 1MY4A 4NE4A 3KZGA 2HEUA 3GZGA 3C4MA 4F3BA 1FQFA 1P1NA 1RKMA 1SQYA 1IXIA 2PT2A 4RY1A 3TCGA 2UVGA 4ZS9A 1MS7A 4TQUQ 4N07A 2CZLA 4F18A 2REGA 5DTBA 3MWBA 4QFPA 4F2OA 4EDPA 2FYIA 3RPWA 5H8NB 3RUMA 1GV8A 1DMBA 3FVKA 3MPLA 3RTFB 4BDLA 4HCWA 5TPAB 2XXXA 4GL8A 1P99A 1SW5A 1URGA 1JEUA 3TTMA 2QMXA 1O63A 4ELOA 4XKRA 1MG1A 3KSJA 1UIUA 1Y3QA 3N5LA 5JK4A 3K02A 4ELRA 4ND9A 3TCHA 1NNKA 3VFJA 3CFLA 3O6IA 5ISUA 2GHBA 3VLUA 4R73A 4O3CA 3FJGA 4U21A 4QFOA 3G7WA 3MVWA 2RKMA 3ZS6A 3T9VA 3JYRA 4GIZA 4ZEIA 1FQBA 1USYE 1MQDA 2Q2CA 3KBRA 2ESNA 4MLQA 2PMSA 2RCAA 1B0HA 1H43A 1OVTA 1B4ZA 1I69A 4EQBA 4H5GA 3MC2A 3SESA 4PFYA 5KCJB 4DCXA 5JEIA 1MDQA 1IXCA 2AYSA 2D3IA 3H6WA 1GTKA 1A54A 1N7WA 3VXBA 2P1SA 1PEBA 3HPIA 4H5FA 2E1SA 3BKIB 1BIYA 3UK4A 4ZEDA 3Q25A 1SYIA 1POTA 4H8JA 4U22A 3LBSA 4C1UA 3TTNA 1LAFE 3B6TA 3IOUA 1JVXA 1MM7A 3E4RA 3K1NA 1ZJLA 4Q5TA 1Y1ZA 2ZMBA 5I59A 1VE4A 3I5OA 3PGFA 4OERA 4X1BA 4RYAA 4HW8A 3M3LA 4MLVA 3MUQA 5H8FA 1BKAA 2OWTA 3C35A 3N6UA 5BUUA 2QJEA 3LSWA 4POXA 4R72A 2Z22A 2E0SA 4QFKA 3PUZE 3H3GA 2XXYA 3FATA 2A5TA 4OZ9A 1B0LA 3OO7A 1CE2A 1FQCA 3OSQA 4WEPA 1OQHA 3EHSA 1JNFA
chains in the Genus database with same CATH superfamily
3GLBA 2VD2A 1NV1A 3RNNA 3CFZA 1JW4A 4N6DA 3T0JA 3TQWA 2P2AA 1VFDA 3CSGA 1PB8A 5K2YA 1B7HA 4KHZE 3IR1A 3MZ1A 3RPLB 2ANJA 1TXFA 2XA5A 4N8YA 4DIGA 3U92A 4LUBA 3UORA 1P1OA 4G68A 4U1ZA 3SDFA 1IMDA 5FTIA 3T66A 4OTEA 1LEVA 3MSTA 3V83A 1IXHA 1P1WA 4KD5A 4MNCA 4LP2B 1KA1A 3TZAA 4AB6A 5L9MA 1LFGA 1YPNA 2ZZXA 1Z7NE 3IFAA 4P1EA 2Y7WA 2RF1A 3K01A 4OFLA 2Z8FA 4YKKA 5EYHA 4QF9A 2AL5A 3SEUA 3IB2A 1FBHA 3RTWB 2G93A 1EZPA 4JSDA 1R6ZA 1Y3PA 3LSFB 3FIRA 4YMBA 4LATA 3NOHA 1AWBA 3W15C 1NV2A 1SPIA 3OMBA 4IO4A 1XC1A 1YYZA 4DCYA 3SZPA 4DXCA 4MHFA 4F1UA 4ZEKA 4XKNA 4YZZA 1QVSA 3IX1A 4PFBA 2QVUA 5KDTB 1B58A 1MQJA 4OA4A 3TODA 1IEJA 3G3JA 1MXZA 3S4UA 2Y7KA 1DPPA 1VDWA 2F36A 1SI1A 4P1LA 4H6DA 2FA7A 4H1XA 4JSOA 3T9UA 1TWYA 3BIHA 3VXCA 3VLWA 3Q28A 3T9XB 4BDMA 4TLMB 3IB1A 1F9BA 2ZYMA 4QRZA 3K6VA 1XOCA 5KDTA 3B6WA 4F3GA 4GRKA 3EHUA 2CEYA 3K6UA 4F31B 2V4CA 4MAGA 1B7UA 1B3HA 3O97A 3QMFA 1FQEA 3S2VA 2QFLA 4P8BA 1LSTA 3B7DA 2GRVA 5ICQA 3SERA 4GWZA 4MBPA 1ZKBA 2GFEA 4GXAA 3VVFA 2UVIA 3VVEA 2VHAA 3PV0E 1T0KA 2HPGA 4MH5A 2I58A 1ZMGA 1MPCA 3K4UA 2LAOA 2DWAA 3U65A 5I58A 3OD7A 2P3NA 1B5HA 3UA8A 3UP9A 3TMGA 2F8DA 4NF8B 1H76A 1IQ7A 1B51A 1HSJA 3CG3A 3IOTA 4PFIA 1VFEA 3T93B 3KJTA 3PMWA 4QFLA 2Y7PA 5AA3A 4I3YA 1ZU0A 3FV2A 2CZHA 4P11A 4GWUA 4JDFA 4HCYA 4X04A 2I4BA 2QS4A 4ELPA 4IY5A 2WX9A 4PGPA 2PX1A 1JP4A 5CMMA 4NF8A 3SEYA 4DLDA 5EQ8A 4EQ9A 3OEMA 3EQ1A 1LBBA 1N84A 2O84X 4G68C 4ISUA 1H45A 3PPRA 1IZ1A 2OJTA 1O64A 4BDOA 3QSLA 5F1QA 2F3BA 4QBAA 5DYHA 4XXUA 4XKPA 4XFEA 3E78A 3FXQA 3C31A 4AS4A 4C1TA 1MXWA 2VT5A 5AA1A 1ELJA 1NI9A 2F34A 5H8HB 1URSA 3MW0A 4O7MA 5JTYA 4PC9A 1EYJA 3UIFA 5IZZA 4F29A 4OESA 1AH5A 4JWXA 3FUZA 3PUXE 4ONYA 5KZTA 2D5WA 4C0RA 5EYFA 4H46A 4G77A 4F1VA 1MY1A 4O3AA 1PC3A 1VR5A 2OZZA 2WYPA 3IO6A 2Y7IA 3IOVA 4LZ5A 3HN0A 3RT8A 2RINA 1FPIA 4GOTA 2AIXA 3TAJA 1XI6A 2NOOA 1QUJA 2XX7A 3PUWE 4R9FA 3OSRA 1JETA 3IJOB 1LCFA 4OXVA 5I56A 2NVUB 1EZOA 2THIA 1MQHA 2GQ1A 5K2XA 3B50A 4BLAA 4O8MA 2FIEA 4P47A 4GX4A 3H06B 1Y4CA 5H8QB 4LN5A 4JVIA 5CMKA 1OVBA 5TP9A 5I57A 4P3LA 5EQ9A 1NV3A 2PT1A 3KGCA 4KYDA 2QS3A 4JXIA 3HHGA 2X7QA 3CI8A 3FXRA 1XHYA 4OEVA 3T1BA 2I4CA 1B46A 2O6AA 1WODA 4RPOA 1S7YA 3EHTA 3O6GA 1M5CA 2VPNA 4PETA 1EU8A 5H8QA 4P0GA 1FTMA 3RN8A 3TEPA 2DOJA 2QRYA 2WKYA 3BBRA 4NTLA 1D9YA 4R2FA 2UYFA 2O51A 4F39A 4G61A 4G8MA 2XXRA 4GLIA 4DXUA 1MDP1 4G2ZA 1RDZA 1QKBA 1MPBA 1D3KA 4WEDA 3PTYA 2F5XA 3CVGA 2V25A 4IO7A 1KA0A 4NQ8A 1IMAA 4I8CA 3G3FA 2WBBA 2M8CA 5H8NA 3VVDA 4MMPA 5CMCA 1NNPA 3EF7A 5TPAA 1EH3A 4EXKA 3E3KA 3LSXA 4DE8A 3TPAA 2Z23A 1IMFA 2FBPA 1MH3A 1FQDA 1LBXA 1ZLQA 4NWCA 1LCTA 4I9DA 3LR1A 4OHNA 5A5XB 4EF2A 2VD3A 3FVOA 1Y1MA 4QXDA 3PMXA 2Q8MA 4YKJA 4NF4B 3FVGA 1LLSA 3H03A 4EF1A 4PFTA 3WAEA 4MJOA 3GXAA 3OOAA 4OVJA 1NKXA 1NFTA 3G3IA 3U93A 2B3BA 3S9EA 1LBCA 1HSLA 2XXVA 1NV5A 4NMYA 1MXUA 2RC9A 1N3WA 3E79A 3O9PA 5EQ7A 3L6HA 4R6HA 3CSBA 1G0IA 5IZ1A 2X26A 1IMBA 3ILTB 1SD3A 3R7XA 1QUIA 3DLNA 3HHFA 3MP8A 5AA4B 1NUWA 4THIA 1US4A 4GL0A 4HTGA 1B3GA 1ZBMA 3JZJA 5KCJA 4MNPA 5I2NB 4FEDA 4I1DA 2F6PA 2QPQA 3TUSA 5ET5A 2F7BA 4GBVA 3TELA 4GWWA 3RT6B 5LOMA 1M5BA 5FHNA 1GVCA 4FIMA 2DXYA 1QJMA 2PFYA 2MKZA 5DT6A 4ZDMA 3O28A 5A5LA 4R6YA 5I2NA 4R74A 3KN7A 3H7MA 3LC8A 4PP0A 3TDJA 2IA4A 4KCDA 1NL5A 3CFXA 5ITOA 3C34A 5ITPA 3KC0A 1YTVA 4IO6A 2HXRA 4NF6B 4PQJA 3L6GA 1B3EA 2ABHA 3WAFA 2WYKA 3G3GA 1YZ0A 4NHBA 2OWZA 1B4HA 1YXIA 2RC8A 3KG2A 1BTJA 5CBRA 3D4GA 4F19A 1FPGA 2I3WA 1DTGA 1PB7A 4UACA 3TCFA 2XWIA 2XXTA 1RYOA 4N17A 4WXJA 3H4ZA 3OENA 1IXGA 1M5FA 4NF6A 4KYEA 1ZIUA 3BFTA 3K00A 1N0TA 3PD8A 5FTHA 4I62A 2P3VA 3M3FA 2FIXA 3RPLA 2UYEA 5DEXB 2CZIA 2I6EA 2Q2AA 4PE5B 1P1QA 1AL3A 1FTLA 2H4IA 2Q8JA 3K0VA 1DTZA 2JJKA 1NMUA 3CR9A 4Z7EA 3MAMA 3N26A 2WBDA 4O94A 1GGGA 1NUXA 3PPOA 3ONMA 1NNTA 5IM2A 3FV1A 2DXRA 2QS2A 3HCQA 4R6KA 2B3FA 4AS5A 2I48A 4IO5A 2BJJX 4OVPA 1FSAA 2ZYOA 5DEXA 1LAGE 1PBQA 3AXFA 4ZECA 2VP1A 1SBPA 3IORA 4N15A 4Z0IA 3K2DA 1A99A 2DE4A 1AOVA 2DSFA 3V8XB 5I3SA 4YB7A 2HZLA 1FJ9A 1YAEA 4R2BA 4PFWA 5AA2B 4KYSA 3DP8A 4GQOA 1BP5A 1ZTYA 3GBAA 4N4UA 4XKQA 2F6GA 2FVZA 1LGBC 2Q88A 5EHMA 2PCRA 3MZ9A 1FRPA 3E9XA 3ODBA 5FHMA 1USYH 3T96B 1XVXA 4MNIA 1AMFA 2XXUA 4MIJA 1M5EA 3Q29A 3UN6A 2DP8A 4EUOA 4X8RA 4AQ4A 4OVSA 3IK6B 1A40A 4JWOA 4GXSB 5AA2A 4IB2A 2CEXA 3MVXA 1OLCA 2R9JA 4R9GA 1DPEA 3RLFE 2I0CA 2OK2A 1B5IA 5J16A 4JBZA 4MFIA 3PUYE 3S9NC 2XXQA 3BIGA 4TLLB 4ECFA 1K9YA 4KPTA 2KLFA 2OX3A 4M4GA 4OVTA 1US5A 4IGRA 1FPFA 3M3KA 3FXBA 1QUKA 1MH4A 1URDA 1P1UA 1LAXA 1S9TA 2ZZVA 2V93A 3B6QA 3H6VA 3HO7A 1LBZA 4P0IA 4UA8A 3ZKKA 1ATGA 1DOTA 2HCAA 2AL4A 2OLBA 4KXPA 1BK4A 1H44A 5M2VA 1B1XA 4RA1A 3IB0A 4BDRA 3GYYA 1RDYA 2DVCA 2XXPA 4F22A 1TT1A 2F35A 4ESXA 5CBSA 5ET6A 3F11A 1JEVA 3TTRA 2YLNA 4JVCA 3TQLA 1QW0A 4L17A 1SDXA 4DXBA 4EQ7A 3DELB 3M8UA 3RYDA 3H6TA 5HPQA 3PU5A 4ZE8A 4NF5B 2PYYA 4H45A 4EXLA 3RY3A 5I84A 3IAZA 3QUJA 4HXVA 3OO6A 1XVYA 3SEVA 2REJA 3MYUA 4RNSA 3MBPA 1Y9UA 5LDZA 1H3DA 2NWJA 3KJ7A 1PDAA 1B9JA 1TFDA 3IO4A 4JB7A 2XWKA 4F1YA 4HE0A 1J1NA 3OO9A 4N13A 4XEQA 1SW1A 3C9HA 5AA2D 5F24A 3TYHA 5AE4A 3A3UA 3K1PA 5L9SA 3ZKLA 2DWIA 3HFUA 3P7IA 4NGUA 1UTHB 1Z7ME 2HFBA 1UTBB 5H8HA 4PAKA 3VLVA 1NUZA 4GWOA 1BLFA 1WVJA 1L5TA 3GBBA 3O66A 4X1DA 1R9QA 3O2AA 3QYTA 4WKMA 4YMAA 2I0BA 3MJNA 4RPNA 1N3XA 1B05A 3QIMA 4GF8A 5ELVA 4KQPA 4QSEA 2O7UA 4GWYA 1MY3A 3C36A 3KBZA 1B52A 4YKPA 3A29A 1FBEA 1A8EA 1UTHA 2DWHA 2H98A 3H6UA 2H25A 3U94A 4U4SA 4KCCA 2ALUA 2XWVA 1KWHA 2Y5LA 3FVNA 3K6XA 4NG7A 4GBWA 2UVHA 3R26A 4OETA 1VSOA 1FTJA 2Z8EA 5DVFA 2XHDA 4POWA 2V3QA 3UGWA 2PVUA 3T9HB 1SW2A 3Q26A 2HXWA 3KFMA 5H8SA 5HBCA 4U4XA 4XF5A 1Y4TA 3W9VA 2O7IA 1A55A 1NH8A 3O29A 1MQGA 1B7ZA 3KOTA 2ZZWA 4YB6A 2DYXA 3SEXA 1Y3NA 5DVIA 3G3KA 1SI0A 4IGTA 5I2KB 3PUVE 2KQZA 1CB6A 3MPKA 3PPNA 4DI3D 1HSEA 2DDKA 4NN3A 4YICA 2V3UA 3FD3A 4GX3A 2ZNSA 2Y7RA 1MPDA 3TKDA 1FPBA 1MRPA 1EYKA 3LUZA 4FORA 1FPDA 4PFUA 1B2HA 2XXKA 4RXLA 4KR5A 5T3JA 5EQAA 4LVQA 2DS9A 3DM0A 5I2KA 1I6BA 1FPLA 4DZ1A 1B1HA 4G8HA 4OMBA 4H0WA 3RGYA 2ZNTA 1DCUA 3FJ7A 1N04A 5IZ3B 2H99A 1R9LA 2Y84A 3CIJA 4Q8RA 4NAPA 4PBQA 3U72A 3QXMA 1MXYA 4LQ5A 2VOZA 2QSXA 2O69A 4H8IA 3BFUA 4NEDA 1O7TA 5A5XA 5HM4B 4PCDA 2OWSA 5ET7A 1LB8A 2VGQA 4NF4A 1MM6A 3A3CA 4DI4B 3PPQA 2B4LA 2XX8A 1A8FA 1N7XA 4ZEBA 2XD2A 1B40A 3LUYA 2F7AA 3FXUA 4F2QA 1FBFA 5I59B 1M5DA 4PE3A 4P56A 2Z8DA 3KN8A 3IJXB 1Q1KA 4Q30B 3SKPA 1N76A 5H8FB 1OQGA 1JQFA 4MX6A 1MY2A 2HAVA 4YB5A 1I6AA 3A09A 4N91A 1GR2A 3SETA 4PDDA 5ESYA 5AA4A 1FCKA 2A5TB 2L5VA 3V89B 4QHQA 4KFQA 2O1MA 2I49A 4FBPA 1B3LA 2R71A 2PFZA 2ZYKA 2HAUA 1Q35A 4GX6A 2V84A 1D4NA 3QAXA 3C33A 3PPPA 4HS7A 4ELQA 3QUFA 2F97A 2V3TA 2XX9A 3IL1B 4G8NA 3IFCA 1XS5A 1FTOA 3I3VA 2Q89A 1FQAA 4LA9A 4YAHX 2H5YA 1NV7A 1B32A 1QGXA 1XT8A 5DW8A 3U1OA 4G68B 1IITA 4N6PA 2XD3A 4OFJA 2Q74A 3D4CA 2KR0A 5IKBA 3VE1B 2G29A 4X48A 5L9OA 3CHGA 4UABA 2DWJA 2YPNA 2OCUA 4YKIA 4MCOA 1TFAA 5CC2A 1FTAA 2ONKE 3KOSA 3QK6A 2XXIA 3KN3A 4TOZA 3CRBA 2XXHA 4H67A 2XWOA 3OXNA 5L8DA 1UQWA 1NV0A 1B3FA 2ONSA 3OO8A 1D9VA 1Y20A 3FZVA 2OBGA 1POY1 4QSDA 1FPEA 4M1VA 1G0HA 2P0SA 1PBPA 2ZXTA 3DP4A 1EZ9A 4IO3A 5CRYA 3TFLA 2DQVA 3T22A 1NUYA 1MY0A 1SW4A 4PF6A 4RK2A 3KC1A 2XXWA 1OMPA 3TTLA 3ECRA 5CI5A 4ZE9A 1JW5A 4O3BA 5ET8A 2I3VA 2X7PA 4FJPA 1OIBA 3FGSA 5B70A 4GWXA 1NH7A 3ILUB 3FASA 1LBYA 4OEUA 4GWSA 2IEEA 4GD5A 3V5AA 3LV0A 4OVQA 2RCBA 1IUDA 1FJ6A 4R75A 2O1LA 3MP6A 1JW1A 1FTKA 4HE2A 1FW0A 3THIA 4OENA 4AB5A 4OQOA 5DVJA 1LFHA 3IOWA 4O7IA 1DSNA 3RQTA 2UVJA 4E0XA 1RYXA 4FE8A 1QULA 5I7IA 2FHYA 1MXXA 1QKAA 2W7YA 2A5SA 2ONRA 3KSXA 3MP1A 3PMVA 2NXOA 3W9WA 1II5A 1LAHE 4ZZEA 4Q0CA 4N6KA 5I58B 3N6TA 2QMWA 2WEFA 1DK4A 4LZ8A 1WDNA 1SYHA 4GVOA 1LB9A 3U8QA 1NV6A 4PTKA 3MZBA 5EHSA 3HSTA 5J1DA 4U1OA 5FBPA 4YU0A 4N8GA 2DVZA 3MVZA 2R8TA 4XTCQ 4RK9A 3DP6A 4PBHA 2PBWA 2ZNUA 4KI0E 4FEBA 1B6HA 4GFRA 1DBZA 4JVDA 3PD9A 3OEKA 4NWDA 1B5JA 4BDNA 5B7DA 5EYGA 1SVXB 3S9LC 2QL3A 4FATA 1K9ZA 4K3FA 3TTKA 1MQIA 3O6HA 4PDHA 5CM6A 4FAJA 2F3DA 2R6GE 3LSLA 3EKIA 4IO2A 4IY6A 5BWJA 3FJMA 3ROJA 3USDA 3K1MA 2B65A 1INPA 1IIWA 3MQ9A 5ICTA 4JWYA 3R6UA 2ZYNA 2CZKA 4MF3A 3VV5A 1I6QA 5IAIA 4G4PA 5FHOA 3EPEA 3HV1A 1PB9A 2H9BA 2UXAA 4LQ2A 4QSCA 3I6VA 2Q9TA 5JTYB 3JV9A 3SEWA 5CMBA 3E13X 2NUVA 4RJZA 1AIVA 1RDXA 2HQ0A 1YCJA 4LONB 2HZKA 3MVYA 4NF5A 4OYVA 4PF8A 4LZ7A 4U2RA 1KZ8A 1MXVA 3KEIA 4H65A 3B8BA 4ZEFA 4ZZAA 3S9MC 4PAFA 4BDQA 4OWDA 4X9TA 2RC7A 1A7LA 4OVRA 1FPJA 3ZSFA 4U23A 3Q27A 2CMOA 4F3SA 1ANFA 1UIVA 4QFNA 1JVYA 4I40A 3FBPA 2GHAA 3N94A 4IR8A 5I56B 2O68A 3EN3A 1S50A 1NNFA 2BJIA 2QS1A 3K6WA 4FECA 5TP9B 5I57B 3G3HA 4PAIA 4ESWA 2DE2A 1OLAA 2YJPA 2GH9A 1Q9DA 3C32A 5TU0A 5LTCA 2DE3A 3CG1A 1R1NA 1UTBA 4XIGQ 1LFIA 5F7VA 2HHMA 3OELA 4DDDA 1FBDA 1LBVA 4E0WA 4F3PA 2F78A 4OFOA 3VDFA 2D21A 2FNCA 2Y5KA 2F7CA 1MY4A 4NE4A 1D9QA 3KZGA 2HEUA 3GZGA 3C4MA 4F3BA 1FQFA 1P1NA 1RKMA 1SQYA 1IXIA 2PT2A 4RY1A 3TCGA 1FBCA 2UVGA 1MS7A 4N81A 4TQUQ 4ZS9A 4N07A 1FBPA 2CZLA 4F18A 2REGA 5DTBA 3MWBA 4QFPA 4F2OA 4EDPA 2FYIA 3RPWA 5H8NB 4MEVA 3RUMA 1GV8A 1DMBA 3FVKA 3MPLA 3RTFB 4BDLA 4HCWA 5TPAB 2VPOA 2XXXA 4GL8A 1P99A 1SW5A 1URGA 1JEUA 3TTMA 2QMXA 1O63A 4ELOA 4XKRA 1MG1A 3KSJA 1UIUA 1Y3QA 3N5LA 5JK4A 3K02A 4ELRA 4ND9A 3TCHA 1NNKA 3VFJA 4I3EA 3CFLA 3O6IA 5ISUA 2GHBA 3VLUA 1NV4A 4R73A 3D1RA 4O3CA 3FJGA 4U21A 4QFOA 5I5PA 3G7WA 3MVWA 2RKMA 3ZS6A 1LBWA 3T9VA 3JYRA 4GIZA 4ZEIA 4PFRA 1FQBA 2B4MA 1USYE 1MQDA 2Q2CA 3KBRA 1IMEA 2ESNA 4MLQA 4HE1A 2PMSA 2RCAA 1B0HA 1H43A 1OVTA 2QVVA 1B4ZA 1I69A 4EQBA 4H5GA 3MC2A 3SESA 4PFYA 5IZ3A 1IMCA 5KCJB 4DCXA 4NF0A 5JEIA 1MDQA 1IXCA 2AYSA 2D3IA 3H6WA 1GTKA 1A54A 1N7WA 3VXBA 1FBGA 2P1SA 1PEBA 4NX1A 3HPIA 2QVRA 4H5FA 2E1SA 3BKIB 1BIYA 3UK4A 4ZEDA 3Q25A 4PGNA 1SYIA 1POTA 4H8JA 4U22A 3LBSA 4C1UA 3TTNA 1LAFE 3B6TA 3IOUA 1JVXA 1CNQA 4P9KA 1MM7A 3E4RA 3K1NA 1ZJLA 4Q5TA 1Y1ZA 2ZMBA 5I59A 1FPKA 1VE4A 3I5OA 3PGFA 4OERA 3ISPA 4X1BA 4RYAA 4HW8A 3M3LA 4MLVA 3MUQA 5H8FA 1BKAA 2OWTA 3C35A 3N6UA 5BUUA 2QJEA 3LSWA 4POXA 4R72A 2Z22A 2E0SA 1EYIA 4QFKA 3PUZE 3H3GA 5IGAA 2XXYA 3FATA 4OANA 2A5TA 4OZ9A 1B0LA 3OO7A 1CE2A 1FQCA 3OSQA 4WEPA 1OQHA 3EHSA 1JNFA
chains in the Genus database with same CATH topology
3GLBA 2VD2A 3RNNA 3CFZA 1JW4A 3TQWA 2P2AA 1VFDA 3CSGA 1PB8A 5K2YA 1B7HA 4KHZE 3IR1A 3MZ1A 2ANJA 1TXFA 4DIGA 3U92A 4LUBA 3UORA 1P1OA 4G68A 4U1ZA 3SDFA 5FTIA 3T66A 4OTEA 3V83A 1IXHA 1P1WA 4KD5A 4LP2B 3TZAA 4AB6A 5L9MA 1LFGA 1YPNA 1Z7NE 2Y7WA 2RF1A 3K01A 4OFLA 2Z8FA 4YKKA 4QF9A 2AL5A 3SEUA 3IB2A 3RTWB 2G93A 1EZPA 4JSDA 1R6ZA 1Y3PA 3LSFB 3FIRA 4YMBA 4LATA 3W15C 3OMBA 4IO4A 1XC1A 4DCYA 4DXCA 4F1UA 4ZEKA 4XKNA 4YZZA 1QVSA 3IX1A 5KDTB 1B58A 1MQJA 3TODA 1IEJA 3G3JA 1MXZA 3S4UA 2Y7KA 1DPPA 2F36A 1SI1A 4H6DA 2FA7A 4H1XA 4JSOA 3T9UA 1TWYA 3VXCA 3VLWA 3Q28A 3T9XB 4BDMA 4TLMB 3IB1A 1F9BA 2ZYMA 4QRZA 3K6VA 1XOCA 5KDTA 3B6WA 4F3GA 4GRKA 3EHUA 3K6UA 4F31B 1B7UA 1B3HA 3O97A 1FQEA 3S2VA 1LSTA 3B7DA 2GRVA 5ICQA 3SERA 4MBPA 1ZKBA 2GFEA 4GXAA 3VVFA 2UVIA 3VVEA 2VHAA 3PV0E 1T0KA 4MH5A 2I58A 1ZMGA 1MPCA 3K4UA 2LAOA 2DWAA 5I58A 3OD7A 1B5HA 3UA8A 3UP9A 3TMGA 2F8DA 4NF8B 1H76A 1IQ7A 1B51A 1HSJA 3CG3A 3IOTA 1VFEA 3T93B 3KJTA 3PMWA 4QFLA 2Y7PA 5AA3A 1ZU0A 3FV2A 4P11A 4JDFA 4HCYA 2I4BA 2QS4A 4ELPA 4IY5A 2PX1A 3SEYA 5CMMA 4NF8A 4DLDA 4EQ9A 3OEMA 3EQ1A 1LBBA 1N84A 2O84X 4G68C 4ISUA 1H45A 3PPRA 1IZ1A 2OJTA 1O64A 4BDOA 3QSLA 5F1QA 5DYHA 4XXUA 4XKPA 3FXQA 3C31A 4C1TA 1MXWA 5AA1A 1ELJA 2F34A 5H8HB 1URSA 3MW0A 5JTYA 3UIFA 4F29A 4OESA 1AH5A 4JWXA 3FUZA 3PUXE 4ONYA 5KZTA 2D5WA 4C0RA 5EYFA 4G77A 4F1VA 1MY1A 4O3AA 1PC3A 1VR5A 2OZZA 3IO6A 2Y7IA 3IOVA 4LZ5A 3HN0A 3RT8A 2RINA 4GOTA 2AIXA 3TAJA 2NOOA 1QUJA 2XX7A 3PUWE 4R9FA 3OSRA 1JETA 3IJOB 1LCFA 4OXVA 5I56A 2NVUB 1EZOA 2THIA 1MQHA 5K2XA 4BLAA 3H06B 1Y4CA 5H8QB 5CMKA 1OVBA 5TP9A 5I57A 2PT1A 3KGCA 4KYDA 2QS3A 4JXIA 3HHGA 2X7QA 3CI8A 3FXRA 1XHYA 4OEVA 2I4CA 1B46A 2O6AA 1WODA 4RPOA 1S7YA 3EHTA 3O6GA 1M5CA 4PETA 1EU8A 5H8QA 4P0GA 1FTMA 3RN8A 3TEPA 2DOJA 2QRYA 2WKYA 3BBRA 4NTLA 1D9YA 4R2FA 2UYFA 2O51A 4F39A 4G8MA 2XXRA 4GLIA 4DXUA 1MDP1 4G2ZA 1QKBA 1MPBA 1D3KA 4WEDA 2F5XA 3CVGA 2V25A 4IO7A 4I8CA 3G3FA 2M8CA 5H8NA 3VVDA 5CMCA 1NNPA 3EF7A 5TPAA 1EH3A 4EXKA 3E3KA 3LSXA 4DE8A 3TPAA 2Z23A 1MH3A 1FQDA 1ZLQA 4NWCA 1LCTA 4I9DA 3LR1A 4OHNA 5A5XB 4EF2A 2VD3A 3FVOA 1Y1MA 3PMXA 4YKJA 4NF4B 3FVGA 1LLSA 3H03A 4EF1A 4PFTA 3WAEA 3GXAA 3OOAA 4OVJA 1NKXA 1NFTA 3G3IA 3U93A 2B3BA 3S9EA 1LBCA 1HSLA 2XXVA 4NMYA 1MXUA 2RC9A 1N3WA 3O9PA 3L6HA 4R6HA 3CSBA 2X26A 3ILTB 1SD3A 3R7XA 1QUIA 3DLNA 3HHFA 3MP8A 5AA4B 4THIA 1US4A 4GL0A 4HTGA 1B3GA 1ZBMA 3JZJA 5KCJA 5I2NB 4FEDA 4I1DA 2F6PA 2QPQA 3TUSA 2F7BA 3TELA 3RT6B 5LOMA 1M5BA 5FHNA 1GVCA 4FIMA 2DXYA 1QJMA 5DT6A 4ZDMA 3O28A 4R6YA 5I2NA 4R74A 3KN7A 3H7MA 3LC8A 4PP0A 3TDJA 2IA4A 4KCDA 1NL5A 3CFXA 5ITOA 3C34A 5ITPA 1YTVA 4IO6A 4NF6B 4PQJA 3L6GA 1B3EA 2ABHA 3WAFA 3G3GA 1B4HA 2RC8A 3KG2A 1BTJA 5CBRA 3D4GA 4F19A 2I3WA 1DTGA 1PB7A 4UACA 3TCFA 2XXTA 1RYOA 4WXJA 3H4ZA 3OENA 1IXGA 1M5FA 4NF6A 4KYEA 1ZIUA 3BFTA 3K00A 1N0TA 3PD8A 5FTHA 4I62A 3M3FA 2UYEA 5DEXB 2Q2AA 2I6EA 4PE5B 1P1QA 1AL3A 1FTLA 2H4IA 2Q8JA 3K0VA 1DTZA 1NMUA 3CR9A 4Z7EA 3MAMA 3N26A 1GGGA 3PPOA 3ONMA 1NNTA 3FV1A 2DXRA 2QS2A 3HCQA 4R6KA 2B3FA 2I48A 4IO5A 2BJJX 2ZYOA 5DEXA 1LAGE 1PBQA 3AXFA 4ZECA 2VP1A 1SBPA 3IORA 4Z0IA 3K2DA 1A99A 2DE4A 1AOVA 2DSFA 3V8XB 4YB7A 2HZLA 1YAEA 4R2BA 4PFWA 5AA2B 4KYSA 3DP8A 4GQOA 1BP5A 1ZTYA 3GBAA 4XKQA 2F6GA 1LGBC 2Q88A 5EHMA 3MZ9A 3E9XA 3ODBA 5FHMA 1USYH 3T96B 1XVXA 1AMFA 2XXUA 1M5EA 3Q29A 3UN6A 2DP8A 4EUOA 4AQ4A 3IK6B 1A40A 4JWOA 4GXSB 5AA2A 4IB2A 3MVXA 1OLCA 2R9JA 4R9GA 1DPEA 3RLFE 2I0CA 2OK2A 1B5IA 4JBZA 4MFIA 3PUYE 3S9NC 2XXQA 4TLLB 4ECFA 4KPTA 2KLFA 4M4GA 1US5A 4IGRA 3M3KA 1QUKA 1MH4A 1URDA 1P1UA 1LAXA 1S9TA 2V93A 3B6QA 3H6VA 3HO7A 4P0IA 4UA8A 3ZKKA 1DOTA 1ATGA 2HCAA 2AL4A 2OLBA 1H44A 5M2VA 1B1XA 4RA1A 3IB0A 4BDRA 2DVCA 2XXPA 4F22A 1TT1A 2F35A 4ESXA 5CBSA 3F11A 1JEVA 3TTRA 2YLNA 3TQLA 1QW0A 4L17A 1SDXA 4DXBA 4EQ7A 3DELB 3M8UA 3H6TA 5HPQA 3PU5A 4ZE8A 4NF5B 2PYYA 4EXLA 3RY3A 5I84A 3IAZA 3QUJA 3OO6A 1XVYA 3SEVA 2REJA 4RNSA 3MBPA 1Y9UA 1H3DA 2NWJA 3KJ7A 1PDAA 1B9JA 1TFDA 3IO4A 4JB7A 4F1YA 1J1NA 3OO9A 4N13A 1SW1A 3C9HA 5AA2D 3TYHA 5AE4A 3A3UA 3K1PA 5L9SA 3ZKLA 2DWIA 3P7IA 1UTHB 1Z7ME 2HFBA 1UTBB 5H8HA 3VLVA 4GWOA 1BLFA 1WVJA 1L5TA 3GBBA 3O66A 4X1DA 1R9QA 3O2AA 3QYTA 4WKMA 4YMAA 2I0BA 3MJNA 4RPNA 1N3XA 1B05A 3QIMA 4GF8A 5ELVA 4KQPA 4QSEA 2O7UA 1MY3A 3C36A 1B52A 4YKPA 1A8EA 1UTHA 2DWHA 2H98A 3H6UA 2H25A 3U94A 4U4SA 4KCCA 2ALUA 1KWHA 3FVNA 3K6XA 2UVHA 3R26A 4OETA 1VSOA 1FTJA 2Z8EA 5DVFA 2XHDA 4POWA 2V3QA 3UGWA 2PVUA 3T9HB 1SW2A 3Q26A 2HXWA 3KFMA 5H8SA 5HBCA 4U4XA 1Y4TA 3W9VA 2O7IA 1A55A 1NH8A 3O29A 1MQGA 1B7ZA 3KOTA 4YB6A 2DYXA 3SEXA 1Y3NA 5DVIA 3G3KA 1SI0A 4IGTA 5I2KB 3PUVE 1CB6A 3MPKA 3PPNA 1HSEA 4YICA 2V3UA 3FD3A 2ZNSA 2Y7RA 1MPDA 3TKDA 1MRPA 4FORA 4PFUA 1B2HA 4RXLA 4KR5A 4LVQA 2DS9A 3DM0A 5I2KA 1I6BA 4DZ1A 1B1HA 4G8HA 4OMBA 4H0WA 3RGYA 2ZNTA 3FJ7A 1N04A 2H99A 1R9LA 2Y84A 3CIJA 4Q8RA 3U72A 3QXMA 1MXYA 4LQ5A 2VOZA 2QSXA 2O69A 4H8IA 3BFUA 4NEDA 1O7TA 5A5XA 5HM4B 2OWSA 1LB8A 2VGQA 4NF4A 1MM6A 3A3CA 3PPQA 2XX8A 1A8FA 1N7XA 4ZEBA 2XD2A 1B40A 3LUYA 2F7AA 3FXUA 4F2QA 5I59B 1M5DA 2Z8DA 3KN8A 3IJXB 1Q1KA 4Q30B 3SKPA 1N76A 5H8FB 1OQGA 1JQFA 1MY2A 2HAVA 4YB5A 1I6AA 3A09A 1GR2A 3SETA 5AA4A 1FCKA 2A5TB 3V89B 4QHQA 4KFQA 2O1MA 2I49A 1B3LA 2R71A 2ZYKA 2HAUA 1Q35A 2V84A 1D4NA 3QAXA 3C33A 3PPPA 4HS7A 4ELQA 3QUFA 2F97A 2V3TA 2XX9A 3IL1B 4G8NA 1XS5A 1FTOA 3I3VA 2Q89A 1FQAA 4LA9A 4YAHX 2H5YA 1B32A 1XT8A 3U1OA 4G68B 1IITA 4N6PA 2XD3A 4OFJA 3D4CA 5IKBA 3VE1B 2G29A 4X48A 5L9OA 2DWJA 2YPNA 2OCUA 4YKIA 1TFAA 5CC2A 2ONKE 3KOSA 3QK6A 2XXIA 3KN3A 4TOZA 3CRBA 2XXHA 4H67A 3OXNA 5L8DA 1UQWA 1B3FA 2ONSA 3OO8A 1D9VA 1Y20A 3FZVA 2OBGA 1POY1 4QSDA 4M1VA 2P0SA 1PBPA 2ZXTA 3DP4A 1EZ9A 4IO3A 5CRYA 3TFLA 2DQVA 3T22A 1MY0A 1SW4A 4RK2A 2XXWA 1OMPA 3TTLA 3ECRA 5CI5A 4ZE9A 1JW5A 4O3BA 2I3VA 2X7PA 4FJPA 1OIBA 3FGSA 5B70A 1NH7A 3ILUB 3FASA 4OEUA 2IEEA 4GD5A 3V5AA 2RCBA 1IUDA 4R75A 2O1LA 3MP6A 1JW1A 1FTKA 1FW0A 3THIA 4OENA 4AB5A 4OQOA 5DVJA 1LFHA 3IOWA 1DSNA 4E0XA 2UVJA 3RQTA 1RYXA 4FE8A 1QULA 1MXXA 1QKAA 2W7YA 2A5SA 2ONRA 3KSXA 3MP1A 3PMVA 2NXOA 3W9WA 1II5A 1LAHE 4ZZEA 4Q0CA 5I58B 3N6TA 2QMWA 4LZ8A 1WDNA 1SYHA 4GVOA 1LB9A 3U8QA 3MZBA 5EHSA 3HSTA 5J1DA 4U1OA 4YU0A 2DVZA 3MVZA 4XTCQ 4RK9A 3DP6A 2PBWA 2ZNUA 4KI0E 4FEBA 1B6HA 4GFRA 3PD9A 3OEKA 4NWDA 1B5JA 4BDNA 5B7DA 1SVXB 3S9LC 2QL3A 4FATA 4K3FA 3TTKA 1MQIA 3O6HA 5CM6A 4FAJA 2R6GE 3LSLA 4IO2A 4IY6A 5BWJA 3FJMA 3USDA 3K1MA 2B65A 1IIWA 3MQ9A 5ICTA 4JWYA 3R6UA 2ZYNA 4MF3A 3VV5A 1I6QA 5IAIA 4G4PA 5FHOA 3EPEA 3HV1A 1PB9A 2H9BA 2UXAA 4LQ2A 4QSCA 3I6VA 2Q9TA 5JTYB 3JV9A 3SEWA 5CMBA 3E13X 2NUVA 4RJZA 1AIVA 2HQ0A 1YCJA 4LONB 2HZKA 3MVYA 4NF5A 4OYVA 4LZ7A 4U2RA 1MXVA 3KEIA 4H65A 4ZEFA 4ZZAA 3S9MC 4BDQA 4OWDA 4X9TA 2RC7A 1A7LA 3ZSFA 4U23A 3Q27A 2CMOA 4F3SA 1ANFA 1UIVA 4QFNA 1JVYA 2GHAA 3N94A 5I56B 2O68A 3EN3A 1S50A 1NNFA 2QS1A 3K6WA 4FECA 5TP9B 5I57B 3G3HA 4ESWA 2DE2A 1OLAA 2YJPA 2GH9A 3C32A 5TU0A 2DE3A 3CG1A 1R1NA 1UTBA 4XIGQ 1LFIA 5F7VA 3OELA 4DDDA 4F3PA 4E0WA 2F78A 4OFOA 3VDFA 2D21A 2FNCA 2F7CA 1MY4A 4NE4A 3KZGA 2HEUA 3GZGA 3C4MA 4F3BA 1FQFA 1P1NA 1RKMA 1SQYA 1IXIA 2PT2A 4RY1A 3TCGA 2UVGA 4ZS9A 1MS7A 4TQUQ 4N07A 2CZLA 4F18A 2REGA 5DTBA 3MWBA 4QFPA 4F2OA 4EDPA 2FYIA 3RPWA 5H8NB 3RUMA 1GV8A 1DMBA 3FVKA 3MPLA 3RTFB 4BDLA 4HCWA 5TPAB 2XXXA 4GL8A 1P99A 1SW5A 1URGA 1JEUA 3TTMA 2QMXA 1O63A 4ELOA 4XKRA 1MG1A 3KSJA 1UIUA 1Y3QA 3N5LA 5JK4A 3K02A 4ELRA 4ND9A 3TCHA 1NNKA 3VFJA 3CFLA 3O6IA 5ISUA 2GHBA 3VLUA 4R73A 4O3CA 3FJGA 4U21A 4QFOA 3G7WA 3MVWA 2RKMA 3ZS6A 3T9VA 3JYRA 4GIZA 4ZEIA 1FQBA 1USYE 1MQDA 2Q2CA 3KBRA 2ESNA 4MLQA 2PMSA 2RCAA 1B0HA 1H43A 1OVTA 1B4ZA 1I69A 4EQBA 4H5GA 3MC2A 3SESA 4PFYA 5KCJB 4DCXA 5JEIA 1MDQA 1IXCA 2AYSA 2D3IA 3H6WA 1GTKA 1A54A 1N7WA 3VXBA 2P1SA 1PEBA 3HPIA 4H5FA 2E1SA 3BKIB 1BIYA 3UK4A 4ZEDA 3Q25A 1SYIA 1POTA 4H8JA 4U22A 3LBSA 4C1UA 3TTNA 1LAFE 3B6TA 3IOUA 1JVXA 1MM7A 3E4RA 3K1NA 1ZJLA 4Q5TA 1Y1ZA 2ZMBA 5I59A 1VE4A 3I5OA 3PGFA 4OERA 4X1BA 4RYAA 4HW8A 3M3LA 4MLVA 3MUQA 5H8FA 1BKAA 2OWTA 3C35A 3N6UA 5BUUA 2QJEA 3LSWA 4POXA 4R72A 2Z22A 2E0SA 4QFKA 3PUZE 3H3GA 2XXYA 3FATA 2A5TA 4OZ9A 1B0LA 3OO7A 1CE2A 1FQCA 3OSQA 4WEPA 1OQHA 3EHSA 1JNFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GLB A;  2VD2 A;  3RNN A;  3CFZ A;  1JW4 A;  3TQW A;  2P2A A;  1VFD A;  3CSG A;  1PB8 A;  5K2Y A;  1B7H A;  4KHZ E;  3IR1 A;  3MZ1 A;  2ANJ A;  1TXF A;  4DIG A;  3U92 A;  4LUB A;  3UOR A;  1P1O A;  4G68 A;  4U1Z A;  3SDF A;  5FTI A;  3T66 A;  4OTE A;  3V83 A;  1IXH A;  1P1W A;  4KD5 A;  4LP2 B;  3TZA A;  4AB6 A;  5L9M A;  1LFG A;  1YPN A;  1Z7N E;  2Y7W A;  2RF1 A;  3K01 A;  4OFL A;  2Z8F A;  4YKK A;  4QF9 A;  2AL5 A;  3SEU A;  3IB2 A;  3RTW B;  2G93 A;  1EZP A;  4JSD A;  1R6Z A;  1Y3P A;  3LSF B;  3FIR A;  4YMB A;  4LAT A;  3W15 C;  3OMB A;  4IO4 A;  1XC1 A;  4DCY A;  4DXC A;  4F1U A;  4ZEK A;  4XKN A;  4YZZ A;  1QVS A;  3IX1 A;  5KDT B;  1B58 A;  1MQJ A;  3TOD A;  1IEJ A;  3G3J A;  1MXZ A;  3S4U A;  2Y7K A;  1DPP A;  2F36 A;  1SI1 A;  4H6D A;  2FA7 A;  4H1X A;  4JSO A;  3T9U A;  1TWY A;  3VXC A;  3VLW A;  3Q28 A;  3T9X B;  4BDM A;  4TLM B;  3IB1 A;  1F9B A;  2ZYM A;  4QRZ A;  3K6V A;  1XOC A;  5KDT A;  3B6W A;  4F3G A;  4GRK A;  3EHU A;  3K6U A;  4F31 B;  1B7U A;  1B3H A;  3O97 A;  1FQE A;  3S2V A;  1LST A;  3B7D A;  2GRV A;  5ICQ A;  3SER A;  4MBP A;  1ZKB A;  2GFE A;  4GXA A;  3VVF A;  2UVI A;  3VVE A;  2VHA A;  3PV0 E;  1T0K A;  4MH5 A;  2I58 A;  1ZMG A;  1MPC A;  3K4U A;  2LAO A;  2DWA A;  5I58 A;  3OD7 A;  1B5H A;  3UA8 A;  3UP9 A;  3TMG A;  2F8D A;  4NF8 B;  1H76 A;  1IQ7 A;  1B51 A;  1HSJ A;  3CG3 A;  3IOT A;  1VFE A;  3T93 B;  3KJT A;  3PMW A;  4QFL A;  2Y7P A;  5AA3 A;  1ZU0 A;  3FV2 A;  4P11 A;  4JDF A;  4HCY A;  2I4B A;  2QS4 A;  4ELP A;  4IY5 A;  2PX1 A;  3SEY A;  5CMM A;  4NF8 A;  4DLD A;  4EQ9 A;  3OEM A;  3EQ1 A;  1LBB A;  1N84 A;  2O84 X;  4G68 C;  4ISU A;  1H45 A;  3PPR A;  1IZ1 A;  2OJT A;  1O64 A;  4BDO A;  3QSL A;  5F1Q A;  5DYH A;  4XXU A;  4XKP A;  3FXQ A;  3C31 A;  4C1T A;  1MXW A;  5AA1 A;  1ELJ A;  2F34 A;  5H8H B;  1URS A;  3MW0 A;  5JTY A;  3UIF A;  4F29 A;  4OES A;  1AH5 A;  4JWX A;  3FUZ A;  3PUX E;  4ONY A;  5KZT A;  2D5W A;  4C0R A;  5EYF A;  4G77 A;  4F1V A;  1MY1 A;  4O3A A;  1PC3 A;  1VR5 A;  2OZZ A;  3IO6 A;  2Y7I A;  3IOV A;  4LZ5 A;  3HN0 A;  3RT8 A;  2RIN A;  4GOT A;  2AIX A;  3TAJ A;  2NOO A;  1QUJ A;  2XX7 A;  3PUW E;  4R9F A;  3OSR A;  1JET A;  3IJO B;  1LCF A;  4OXV A;  5I56 A;  2NVU B;  1EZO A;  2THI A;  1MQH A;  5K2X A;  4BLA A;  3H06 B;  1Y4C A;  5H8Q B;  5CMK A;  1OVB A;  5TP9 A;  5I57 A;  2PT1 A;  3KGC A;  4KYD A;  2QS3 A;  4JXI A;  3HHG A;  2X7Q A;  3CI8 A;  3FXR A;  1XHY A;  4OEV A;  2I4C A;  1B46 A;  2O6A A;  1WOD A;  4RPO A;  1S7Y A;  3EHT A;  3O6G A;  1M5C A;  4PET A;  1EU8 A;  5H8Q A;  4P0G A;  1FTM A;  3RN8 A;  3TEP A;  2DOJ A;  2QRY A;  2WKY A;  3BBR A;  4NTL A;  1D9Y A;  4R2F A;  2UYF A;  2O51 A;  4F39 A;  4G8M A;  2XXR A;  4GLI A;  4DXU A;  1MDP 1;  4G2Z A;  1QKB A;  1MPB A;  1D3K A;  4WED A;  2F5X A;  3CVG A;  2V25 A;  4IO7 A;  4I8C A;  3G3F A;  2M8C A;  5H8N A;  3VVD A;  5CMC A;  1NNP A;  3EF7 A;  5TPA A;  1EH3 A;  4EXK A;  3E3K A;  3LSX A;  4DE8 A;  3TPA A;  2Z23 A;  1MH3 A;  1FQD A;  1ZLQ A;  4NWC A;  1LCT A;  4I9D A;  3LR1 A;  4OHN A;  5A5X B;  4EF2 A;  2VD3 A;  3FVO A;  1Y1M A;  3PMX A;  4YKJ A;  4NF4 B;  3FVG A;  1LLS A;  3H03 A;  4EF1 A;  4PFT A;  3WAE A;  3GXA A;  3OOA A;  4OVJ A;  1NKX A;  1NFT A;  3G3I A;  3U93 A;  2B3B A;  3S9E A;  1LBC A;  1HSL A;  2XXV A;  4NMY A;  1MXU A;  2RC9 A;  1N3W A;  3O9P A;  3L6H A;  4R6H A;  3CSB A;  2X26 A;  3ILT B;  1SD3 A;  3R7X A;  1QUI A;  3DLN A;  3HHF A;  3MP8 A;  5AA4 B;  4THI A;  1US4 A;  4GL0 A;  4HTG A;  1B3G A;  1ZBM A;  3JZJ A;  5KCJ A;  5I2N B;  4FED A;  4I1D A;  2F6P A;  2QPQ A;  3TUS A;  2F7B A;  3TEL A;  3RT6 B;  5LOM A;  1M5B A;  5FHN A;  1GVC A;  4FIM A;  2DXY A;  1QJM A;  5DT6 A;  4ZDM A;  3O28 A;  4R6Y A;  5I2N A;  4R74 A;  3KN7 A;  3H7M A;  3LC8 A;  4PP0 A;  3TDJ A;  2IA4 A;  4KCD A;  1NL5 A;  3CFX A;  5ITO A;  3C34 A;  5ITP A;  1YTV A;  4IO6 A;  4NF6 B;  4PQJ A;  3L6G A;  1B3E A;  2ABH A;  3WAF A;  3G3G A;  1B4H A;  2RC8 A;  3KG2 A;  1BTJ A;  5CBR A;  3D4G A;  4F19 A;  2I3W A;  1DTG A;  1PB7 A;  4UAC A;  3TCF A;  2XXT A;  1RYO A;  4WXJ A;  3H4Z A;  3OEN A;  1IXG A;  1M5F A;  4NF6 A;  4KYE A;  1ZIU A;  3BFT A;  3K00 A;  1N0T A;  3PD8 A;  5FTH A;  4I62 A;  3M3F A;  2UYE A;  5DEX B;  2Q2A A;  2I6E A;  4PE5 B;  1P1Q A;  1AL3 A;  1FTL A;  2H4I A;  2Q8J A;  3K0V A;  1DTZ A;  1NMU A;  3CR9 A;  4Z7E A;  3MAM A;  3N26 A;  1GGG A;  3PPO A;  3ONM A;  1NNT A;  3FV1 A;  2DXR A;  2QS2 A;  3HCQ A;  4R6K A;  2B3F A;  2I48 A;  4IO5 A;  2BJJ X;  2ZYO A;  5DEX A;  1LAG E;  1PBQ A;  3AXF A;  4ZEC A;  2VP1 A;  1SBP A;  3IOR A;  4Z0I A;  3K2D A;  1A99 A;  2DE4 A;  1AOV A;  2DSF A;  3V8X B;  4YB7 A;  2HZL A;  1YAE A;  4R2B A;  4PFW A;  5AA2 B;  4KYS A;  3DP8 A;  4GQO A;  1BP5 A;  1ZTY A;  3GBA A;  4XKQ A;  2F6G A;  1LGB C;  2Q88 A;  5EHM A;  3MZ9 A;  3E9X A;  3ODB A;  5FHM A;  1USY H;  3T96 B;  1XVX A;  1AMF A;  2XXU A;  1M5E A;  3Q29 A;  3UN6 A;  2DP8 A;  4EUO A;  4AQ4 A;  3IK6 B;  1A40 A;  4JWO A;  4GXS B;  5AA2 A;  4IB2 A;  3MVX A;  1OLC A;  2R9J A;  4R9G A;  1DPE A;  3RLF E;  2I0C A;  2OK2 A;  1B5I A;  4JBZ A;  4MFI A;  3PUY E;  3S9N C;  2XXQ A;  4TLL B;  4ECF A;  4KPT A;  2KLF A;  4M4G A;  1US5 A;  4IGR A;  3M3K A;  1QUK A;  1MH4 A;  1URD A;  1P1U A;  1LAX A;  1S9T A;  2V93 A;  3B6Q A;  3H6V A;  3HO7 A;  4P0I A;  4UA8 A;  3ZKK A;  1DOT A;  1ATG A;  2HCA A;  2AL4 A;  2OLB A;  1H44 A;  5M2V A;  1B1X A;  4RA1 A;  3IB0 A;  4BDR A;  2DVC A;  2XXP A;  4F22 A;  1TT1 A;  2F35 A;  4ESX A;  5CBS A;  3F11 A;  1JEV A;  3TTR A;  2YLN A;  3TQL A;  1QW0 A;  4L17 A;  1SDX A;  4DXB A;  4EQ7 A;  3DEL B;  3M8U A;  3H6T A;  5HPQ A;  3PU5 A;  4ZE8 A;  4NF5 B;  2PYY A;  4EXL A;  3RY3 A;  5I84 A;  3IAZ A;  3QUJ A;  3OO6 A;  1XVY A;  3SEV A;  2REJ A;  4RNS A;  3MBP A;  1Y9U A;  1H3D A;  2NWJ A;  3KJ7 A;  1PDA A;  1B9J A;  1TFD A;  3IO4 A;  4JB7 A;  4F1Y A;  1J1N A;  3OO9 A;  4N13 A;  1SW1 A;  3C9H A;  5AA2 D;  3TYH A;  5AE4 A;  3A3U A;  3K1P A;  5L9S A;  3ZKL A;  2DWI A;  3P7I A;  1UTH B;  1Z7M E;  2HFB A;  1UTB B;  5H8H A;  3VLV A;  4GWO A;  1BLF A;  1WVJ A;  1L5T A;  3GBB A;  3O66 A;  4X1D A;  1R9Q A;  3O2A A;  3QYT A;  4WKM A;  4YMA A;  2I0B A;  3MJN A;  4RPN A;  1N3X A;  1B05 A;  3QIM A;  4GF8 A;  5ELV A;  4KQP A;  4QSE A;  2O7U A;  1MY3 A;  3C36 A;  1B52 A;  4YKP A;  1A8E A;  1UTH A;  2DWH A;  2H98 A;  3H6U A;  2H25 A;  3U94 A;  4U4S A;  4KCC A;  2ALU A;  1KWH A;  3FVN A;  3K6X A;  2UVH A;  3R26 A;  4OET A;  1VSO A;  1FTJ A;  2Z8E A;  5DVF A;  2XHD A;  4POW A;  2V3Q A;  3UGW A;  2PVU A;  3T9H B;  1SW2 A;  3Q26 A;  2HXW A;  3KFM A;  5H8S A;  5HBC A;  4U4X A;  1Y4T A;  3W9V A;  2O7I A;  1A55 A;  1NH8 A;  3O29 A;  1MQG A;  1B7Z A;  3KOT A;  4YB6 A;  2DYX A;  3SEX A;  1Y3N A;  5DVI A;  3G3K A;  1SI0 A;  4IGT A;  5I2K B;  3PUV E;  1CB6 A;  3MPK A;  3PPN A;  1HSE A;  4YIC A;  2V3U A;  3FD3 A;  2ZNS A;  2Y7R A;  1MPD A;  3TKD A;  1MRP A;  4FOR A;  4PFU A;  1B2H A;  4RXL A;  4KR5 A;  4LVQ A;  2DS9 A;  3DM0 A;  5I2K A;  1I6B A;  4DZ1 A;  1B1H A;  4G8H A;  4OMB A;  4H0W A;  3RGY A;  2ZNT A;  3FJ7 A;  1N04 A;  2H99 A;  1R9L A;  2Y84 A;  3CIJ A;  4Q8R A;  3U72 A;  3QXM A;  1MXY A;  4LQ5 A;  2VOZ A;  2QSX A;  2O69 A;  4H8I A;  3BFU A;  4NED A;  1O7T A;  5A5X A;  5HM4 B;  2OWS A;  1LB8 A;  2VGQ A;  4NF4 A;  1MM6 A;  3A3C A;  3PPQ A;  2XX8 A;  1A8F A;  1N7X A;  4ZEB A;  2XD2 A;  1B40 A;  3LUY A;  2F7A A;  3FXU A;  4F2Q A;  5I59 B;  1M5D A;  2Z8D A;  3KN8 A;  3IJX B;  1Q1K A;  4Q30 B;  3SKP A;  1N76 A;  5H8F B;  1OQG A;  1JQF A;  1MY2 A;  2HAV A;  4YB5 A;  1I6A A;  3A09 A;  1GR2 A;  3SET A;  5AA4 A;  1FCK A;  2A5T B;  3V89 B;  4QHQ A;  4KFQ A;  2O1M A;  2I49 A;  1B3L A;  2R71 A;  2ZYK A;  2HAU A;  1Q35 A;  2V84 A;  1D4N A;  3QAX A;  3C33 A;  3PPP A;  4HS7 A;  4ELQ A;  3QUF A;  2F97 A;  2V3T A;  2XX9 A;  3IL1 B;  4G8N A;  1XS5 A;  1FTO A;  3I3V A;  2Q89 A;  1FQA A;  4LA9 A;  4YAH X;  2H5Y A;  1B32 A;  1XT8 A;  3U1O A;  4G68 B;  1IIT A;  4N6P A;  2XD3 A;  4OFJ A;  3D4C A;  5IKB A;  3VE1 B;  2G29 A;  4X48 A;  5L9O A;  2DWJ A;  2YPN A;  2OCU A;  4YKI A;  1TFA A;  5CC2 A;  2ONK E;  3KOS A;  3QK6 A;  2XXI A;  3KN3 A;  4TOZ A;  3CRB A;  2XXH A;  4H67 A;  3OXN A;  5L8D A;  1UQW A;  1B3F A;  2ONS A;  3OO8 A;  1D9V A;  1Y20 A;  3FZV A;  2OBG A;  1POY 1;  4QSD A;  4M1V A;  2P0S A;  1PBP A;  2ZXT A;  3DP4 A;  1EZ9 A;  4IO3 A;  5CRY A;  3TFL A;  2DQV A;  3T22 A;  1MY0 A;  1SW4 A;  4RK2 A;  2XXW A;  1OMP A;  3TTL A;  3ECR A;  5CI5 A;  4ZE9 A;  1JW5 A;  4O3B A;  2I3V A;  2X7P A;  4FJP A;  1OIB A;  3FGS A;  5B70 A;  1NH7 A;  3ILU B;  3FAS A;  4OEU A;  2IEE A;  4GD5 A;  3V5A A;  2RCB A;  1IUD A;  4R75 A;  2O1L A;  3MP6 A;  1JW1 A;  1FTK A;  1FW0 A;  3THI A;  4OEN A;  4AB5 A;  4OQO A;  5DVJ A;  1LFH A;  3IOW A;  1DSN A;  4E0X A;  2UVJ A;  3RQT A;  1RYX A;  4FE8 A;  1QUL A;  1MXX A;  1QKA A;  2W7Y A;  2A5S A;  2ONR A;  3KSX A;  3MP1 A;  3PMV A;  2NXO A;  3W9W A;  1II5 A;  1LAH E;  4ZZE A;  4Q0C A;  5I58 B;  3N6T A;  2QMW A;  4LZ8 A;  1WDN A;  1SYH A;  4GVO A;  1LB9 A;  3U8Q A;  3MZB A;  5EHS A;  3HST A;  5J1D A;  4U1O A;  4YU0 A;  2DVZ A;  3MVZ A;  4XTC Q;  4RK9 A;  3DP6 A;  2PBW A;  2ZNU A;  4KI0 E;  4FEB A;  1B6H A;  4GFR A;  3PD9 A;  3OEK A;  4NWD A;  1B5J A;  4BDN A;  5B7D A;  1SVX B;  3S9L C;  2QL3 A;  4FAT A;  4K3F A;  3TTK A;  1MQI A;  3O6H A;  5CM6 A;  4FAJ A;  2R6G E;  3LSL A;  4IO2 A;  4IY6 A;  5BWJ A;  3FJM A;  3USD A;  3K1M A;  2B65 A;  1IIW A;  3MQ9 A;  5ICT A;  4JWY A;  3R6U A;  2ZYN A;  4MF3 A;  3VV5 A;  1I6Q A;  5IAI A;  4G4P A;  5FHO A;  3EPE A;  3HV1 A;  1PB9 A;  2H9B A;  2UXA A;  4LQ2 A;  4QSC A;  3I6V A;  2Q9T A;  5JTY B;  3JV9 A;  3SEW A;  5CMB A;  3E13 X;  2NUV A;  4RJZ A;  1AIV A;  2HQ0 A;  1YCJ A;  4LON B;  2HZK A;  3MVY A;  4NF5 A;  4OYV A;  4LZ7 A;  4U2R A;  1MXV A;  3KEI A;  4H65 A;  4ZEF A;  4ZZA A;  3S9M C;  4BDQ A;  4OWD A;  4X9T A;  2RC7 A;  1A7L A;  3ZSF A;  4U23 A;  3Q27 A;  2CMO A;  4F3S A;  1ANF A;  1UIV A;  4QFN A;  1JVY A;  2GHA A;  3N94 A;  5I56 B;  2O68 A;  3EN3 A;  1S50 A;  1NNF A;  2QS1 A;  3K6W A;  4FEC A;  5TP9 B;  5I57 B;  3G3H A;  4ESW A;  2DE2 A;  1OLA A;  2YJP A;  2GH9 A;  3C32 A;  5TU0 A;  2DE3 A;  3CG1 A;  1R1N A;  1UTB A;  4XIG Q;  1LFI A;  5F7V A;  3OEL A;  4DDD A;  4F3P A;  4E0W A;  2F78 A;  4OFO A;  3VDF A;  2D21 A;  2FNC A;  2F7C A;  1MY4 A;  4NE4 A;  3KZG A;  2HEU A;  3GZG A;  3C4M A;  4F3B A;  1FQF A;  1P1N A;  1RKM A;  1SQY A;  1IXI A;  2PT2 A;  4RY1 A;  3TCG A;  2UVG A;  4ZS9 A;  1MS7 A;  4TQU Q;  4N07 A;  2CZL A;  4F18 A;  2REG A;  5DTB A;  3MWB A;  4QFP A;  4F2O A;  4EDP A;  2FYI A;  3RPW A;  5H8N B;  3RUM A;  1GV8 A;  1DMB A;  3FVK A;  3MPL A;  3RTF B;  4BDL A;  4HCW A;  5TPA B;  2XXX A;  4GL8 A;  1P99 A;  1SW5 A;  1URG A;  1JEU A;  3TTM A;  2QMX A;  1O63 A;  4ELO A;  4XKR A;  1MG1 A;  3KSJ A;  1UIU A;  1Y3Q A;  3N5L A;  5JK4 A;  3K02 A;  4ELR A;  4ND9 A;  3TCH A;  1NNK A;  3VFJ A;  3CFL A;  3O6I A;  5ISU A;  2GHB A;  3VLU A;  4R73 A;  4O3C A;  3FJG A;  4U21 A;  4QFO A;  3G7W A;  3MVW A;  2RKM A;  3ZS6 A;  3T9V A;  3JYR A;  4GIZ A;  4ZEI A;  1FQB A;  1USY E;  1MQD A;  2Q2C A;  3KBR A;  2ESN A;  4MLQ A;  2PMS A;  2RCA A;  1B0H A;  1H43 A;  1OVT A;  1B4Z A;  1I69 A;  4EQB A;  4H5G A;  3MC2 A;  3SES A;  4PFY A;  5KCJ B;  4DCX A;  5JEI A;  1MDQ A;  1IXC A;  2AYS A;  2D3I A;  3H6W A;  1GTK A;  1A54 A;  1N7W A;  3VXB A;  2P1S A;  1PEB A;  3HPI A;  4H5F A;  2E1S A;  3BKI B;  1BIY A;  3UK4 A;  4ZED A;  3Q25 A;  1SYI A;  1POT A;  4H8J A;  4U22 A;  3LBS A;  4C1U A;  3TTN A;  1LAF E;  3B6T A;  3IOU A;  1JVX A;  1MM7 A;  3E4R A;  3K1N A;  1ZJL A;  4Q5T A;  1Y1Z A;  2ZMB A;  5I59 A;  1VE4 A;  3I5O A;  3PGF A;  4OER A;  4X1B A;  4RYA A;  4HW8 A;  3M3L A;  4MLV A;  3MUQ A;  5H8F A;  1BKA A;  2OWT A;  3C35 A;  3N6U A;  5BUU A;  2QJE A;  3LSW A;  4POX A;  4R72 A;  2Z22 A;  2E0S A;  4QFK A;  3PUZ E;  3H3G A;  2XXY A;  3FAT A;  2A5T A;  4OZ9 A;  1B0L A;  3OO7 A;  1CE2 A;  1FQC A;  3OSQ A;  4WEP A;  1OQH A;  3EHS A;  1JNF A; 
#chains in the Genus database with same CATH topology
 3GLB A;  2VD2 A;  1NV1 A;  3RNN A;  3CFZ A;  1JW4 A;  4N6D A;  3T0J A;  3TQW A;  2P2A A;  1VFD A;  3CSG A;  1PB8 A;  5K2Y A;  1B7H A;  4KHZ E;  3IR1 A;  3MZ1 A;  3RPL B;  2ANJ A;  1TXF A;  2XA5 A;  4N8Y A;  4DIG A;  3U92 A;  4LUB A;  3UOR A;  1P1O A;  4G68 A;  4U1Z A;  3SDF A;  1IMD A;  5FTI A;  3T66 A;  4OTE A;  1LEV A;  3MST A;  3V83 A;  1IXH A;  1P1W A;  4KD5 A;  4MNC A;  4LP2 B;  1KA1 A;  3TZA A;  4AB6 A;  5L9M A;  1LFG A;  1YPN A;  2ZZX A;  1Z7N E;  3IFA A;  4P1E A;  2Y7W A;  2RF1 A;  3K01 A;  4OFL A;  2Z8F A;  4YKK A;  5EYH A;  4QF9 A;  2AL5 A;  3SEU A;  3IB2 A;  1FBH A;  3RTW B;  2G93 A;  1EZP A;  4JSD A;  1R6Z A;  1Y3P A;  3LSF B;  3FIR A;  4YMB A;  4LAT A;  3NOH A;  1AWB A;  3W15 C;  1NV2 A;  1SPI A;  3OMB A;  4IO4 A;  1XC1 A;  1YYZ A;  4DCY A;  3SZP A;  4DXC A;  4MHF A;  4F1U A;  4ZEK A;  4XKN A;  4YZZ A;  1QVS A;  3IX1 A;  4PFB A;  2QVU A;  5KDT B;  1B58 A;  1MQJ A;  4OA4 A;  3TOD A;  1IEJ A;  3G3J A;  1MXZ A;  3S4U A;  2Y7K A;  1DPP A;  1VDW A;  2F36 A;  1SI1 A;  4P1L A;  4H6D A;  2FA7 A;  4H1X A;  4JSO A;  3T9U A;  1TWY A;  3BIH A;  3VXC A;  3VLW A;  3Q28 A;  3T9X B;  4BDM A;  4TLM B;  3IB1 A;  1F9B A;  2ZYM A;  4QRZ A;  3K6V A;  1XOC A;  5KDT A;  3B6W A;  4F3G A;  4GRK A;  3EHU A;  2CEY A;  3K6U A;  4F31 B;  2V4C A;  4MAG A;  1B7U A;  1B3H A;  3O97 A;  3QMF A;  1FQE A;  3S2V A;  2QFL A;  4P8B A;  1LST A;  3B7D A;  2GRV A;  5ICQ A;  3SER A;  4GWZ A;  4MBP A;  1ZKB A;  2GFE A;  4GXA A;  3VVF A;  2UVI A;  3VVE A;  2VHA A;  3PV0 E;  1T0K A;  2HPG A;  4MH5 A;  2I58 A;  1ZMG A;  1MPC A;  3K4U A;  2LAO A;  2DWA A;  3U65 A;  5I58 A;  3OD7 A;  2P3N A;  1B5H A;  3UA8 A;  3UP9 A;  3TMG A;  2F8D A;  4NF8 B;  1H76 A;  1IQ7 A;  1B51 A;  1HSJ A;  3CG3 A;  3IOT A;  4PFI A;  1VFE A;  3T93 B;  3KJT A;  3PMW A;  4QFL A;  2Y7P A;  5AA3 A;  4I3Y A;  1ZU0 A;  3FV2 A;  2CZH A;  4P11 A;  4GWU A;  4JDF A;  4HCY A;  4X04 A;  2I4B A;  2QS4 A;  4ELP A;  4IY5 A;  2WX9 A;  4PGP A;  2PX1 A;  1JP4 A;  5CMM A;  4NF8 A;  3SEY A;  4DLD A;  5EQ8 A;  4EQ9 A;  3OEM A;  3EQ1 A;  1LBB A;  1N84 A;  2O84 X;  4G68 C;  4ISU A;  1H45 A;  3PPR A;  1IZ1 A;  2OJT A;  1O64 A;  4BDO A;  3QSL A;  5F1Q A;  2F3B A;  4QBA A;  5DYH A;  4XXU A;  4XKP A;  4XFE A;  3E78 A;  3FXQ A;  3C31 A;  4AS4 A;  4C1T A;  1MXW A;  2VT5 A;  5AA1 A;  1ELJ A;  1NI9 A;  2F34 A;  5H8H B;  1URS A;  3MW0 A;  4O7M A;  5JTY A;  4PC9 A;  1EYJ A;  3UIF A;  5IZZ A;  4F29 A;  4OES A;  1AH5 A;  4JWX A;  3FUZ A;  3PUX E;  4ONY A;  5KZT A;  2D5W A;  4C0R A;  5EYF A;  4H46 A;  4G77 A;  4F1V A;  1MY1 A;  4O3A A;  1PC3 A;  1VR5 A;  2OZZ A;  2WYP A;  3IO6 A;  2Y7I A;  3IOV A;  4LZ5 A;  3HN0 A;  3RT8 A;  2RIN A;  1FPI A;  4GOT A;  2AIX A;  3TAJ A;  1XI6 A;  2NOO A;  1QUJ A;  2XX7 A;  3PUW E;  4R9F A;  3OSR A;  1JET A;  3IJO B;  1LCF A;  4OXV A;  5I56 A;  2NVU B;  1EZO A;  2THI A;  1MQH A;  2GQ1 A;  5K2X A;  3B50 A;  4BLA A;  4O8M A;  2FIE A;  4P47 A;  4GX4 A;  3H06 B;  1Y4C A;  5H8Q B;  4LN5 A;  4JVI A;  5CMK A;  1OVB A;  5TP9 A;  5I57 A;  4P3L A;  5EQ9 A;  1NV3 A;  2PT1 A;  3KGC A;  4KYD A;  2QS3 A;  4JXI A;  3HHG A;  2X7Q A;  3CI8 A;  3FXR A;  1XHY A;  4OEV A;  3T1B A;  2I4C A;  1B46 A;  2O6A A;  1WOD A;  4RPO A;  1S7Y A;  3EHT A;  3O6G A;  1M5C A;  2VPN A;  4PET A;  1EU8 A;  5H8Q A;  4P0G A;  1FTM A;  3RN8 A;  3TEP A;  2DOJ A;  2QRY A;  2WKY A;  3BBR A;  4NTL A;  1D9Y A;  4R2F A;  2UYF A;  2O51 A;  4F39 A;  4G61 A;  4G8M A;  2XXR A;  4GLI A;  4DXU A;  1MDP 1;  4G2Z A;  1RDZ A;  1QKB A;  1MPB A;  1D3K A;  4WED A;  3PTY A;  2F5X A;  3CVG A;  2V25 A;  4IO7 A;  1KA0 A;  4NQ8 A;  1IMA A;  4I8C A;  3G3F A;  2WBB A;  2M8C A;  5H8N A;  3VVD A;  4MMP A;  5CMC A;  1NNP A;  3EF7 A;  5TPA A;  1EH3 A;  4EXK A;  3E3K A;  3LSX A;  4DE8 A;  3TPA A;  2Z23 A;  1IMF A;  2FBP A;  1MH3 A;  1FQD A;  1LBX A;  1ZLQ A;  4NWC A;  1LCT A;  4I9D A;  3LR1 A;  4OHN A;  5A5X B;  4EF2 A;  2VD3 A;  3FVO A;  1Y1M A;  4QXD A;  3PMX A;  2Q8M A;  4YKJ A;  4NF4 B;  3FVG A;  1LLS A;  3H03 A;  4EF1 A;  4PFT A;  3WAE A;  4MJO A;  3GXA A;  3OOA A;  4OVJ A;  1NKX A;  1NFT A;  3G3I A;  3U93 A;  2B3B A;  3S9E A;  1LBC A;  1HSL A;  2XXV A;  1NV5 A;  4NMY A;  1MXU A;  2RC9 A;  1N3W A;  3E79 A;  3O9P A;  5EQ7 A;  3L6H A;  4R6H A;  3CSB A;  1G0I A;  5IZ1 A;  2X26 A;  1IMB A;  3ILT B;  1SD3 A;  3R7X A;  1QUI A;  3DLN A;  3HHF A;  3MP8 A;  5AA4 B;  1NUW A;  4THI A;  1US4 A;  4GL0 A;  4HTG A;  1B3G A;  1ZBM A;  3JZJ A;  5KCJ A;  4MNP A;  5I2N B;  4FED A;  4I1D A;  2F6P A;  2QPQ A;  3TUS A;  5ET5 A;  2F7B A;  4GBV A;  3TEL A;  4GWW A;  3RT6 B;  5LOM A;  1M5B A;  5FHN A;  1GVC A;  4FIM A;  2DXY A;  1QJM A;  2PFY A;  2MKZ A;  5DT6 A;  4ZDM A;  3O28 A;  5A5L A;  4R6Y A;  5I2N A;  4R74 A;  3KN7 A;  3H7M A;  3LC8 A;  4PP0 A;  3TDJ A;  2IA4 A;  4KCD A;  1NL5 A;  3CFX A;  5ITO A;  3C34 A;  5ITP A;  3KC0 A;  1YTV A;  4IO6 A;  2HXR A;  4NF6 B;  4PQJ A;  3L6G A;  1B3E A;  2ABH A;  3WAF A;  2WYK A;  3G3G A;  1YZ0 A;  4NHB A;  2OWZ A;  1B4H A;  1YXI A;  2RC8 A;  3KG2 A;  1BTJ A;  5CBR A;  3D4G A;  4F19 A;  1FPG A;  2I3W A;  1DTG A;  1PB7 A;  4UAC A;  3TCF A;  2XWI A;  2XXT A;  1RYO A;  4N17 A;  4WXJ A;  3H4Z A;  3OEN A;  1IXG A;  1M5F A;  4NF6 A;  4KYE A;  1ZIU A;  3BFT A;  3K00 A;  1N0T A;  3PD8 A;  5FTH A;  4I62 A;  2P3V A;  3M3F A;  2FIX A;  3RPL A;  2UYE A;  5DEX B;  2CZI A;  2I6E A;  2Q2A A;  4PE5 B;  1P1Q A;  1AL3 A;  1FTL A;  2H4I A;  2Q8J A;  3K0V A;  1DTZ A;  2JJK A;  1NMU A;  3CR9 A;  4Z7E A;  3MAM A;  3N26 A;  2WBD A;  4O94 A;  1GGG A;  1NUX A;  3PPO A;  3ONM A;  1NNT A;  5IM2 A;  3FV1 A;  2DXR A;  2QS2 A;  3HCQ A;  4R6K A;  2B3F A;  4AS5 A;  2I48 A;  4IO5 A;  2BJJ X;  4OVP A;  1FSA A;  2ZYO A;  5DEX A;  1LAG E;  1PBQ A;  3AXF A;  4ZEC A;  2VP1 A;  1SBP A;  3IOR A;  4N15 A;  4Z0I A;  3K2D A;  1A99 A;  2DE4 A;  1AOV A;  2DSF A;  3V8X B;  5I3S A;  4YB7 A;  2HZL A;  1FJ9 A;  1YAE A;  4R2B A;  4PFW A;  5AA2 B;  4KYS A;  3DP8 A;  4GQO A;  1BP5 A;  1ZTY A;  3GBA A;  4N4U A;  4XKQ A;  2F6G A;  2FVZ A;  1LGB C;  2Q88 A;  5EHM A;  2PCR A;  3MZ9 A;  1FRP A;  3E9X A;  3ODB A;  5FHM A;  1USY H;  3T96 B;  1XVX A;  4MNI A;  1AMF A;  2XXU A;  4MIJ A;  1M5E A;  3Q29 A;  3UN6 A;  2DP8 A;  4EUO A;  4X8R A;  4AQ4 A;  4OVS A;  3IK6 B;  1A40 A;  4JWO A;  4GXS B;  5AA2 A;  4IB2 A;  2CEX A;  3MVX A;  1OLC A;  2R9J A;  4R9G A;  1DPE A;  3RLF E;  2I0C A;  2OK2 A;  1B5I A;  5J16 A;  4JBZ A;  4MFI A;  3PUY E;  3S9N C;  2XXQ A;  3BIG A;  4TLL B;  4ECF A;  1K9Y A;  4KPT A;  2KLF A;  2OX3 A;  4M4G A;  4OVT A;  1US5 A;  4IGR A;  1FPF A;  3M3K A;  3FXB A;  1QUK A;  1MH4 A;  1URD A;  1P1U A;  1LAX A;  1S9T A;  2ZZV A;  2V93 A;  3B6Q A;  3H6V A;  3HO7 A;  1LBZ A;  4P0I A;  4UA8 A;  3ZKK A;  1ATG A;  1DOT A;  2HCA A;  2AL4 A;  2OLB A;  4KXP A;  1BK4 A;  1H44 A;  5M2V A;  1B1X A;  4RA1 A;  3IB0 A;  4BDR A;  3GYY A;  1RDY A;  2DVC A;  2XXP A;  4F22 A;  1TT1 A;  2F35 A;  4ESX A;  5CBS A;  5ET6 A;  3F11 A;  1JEV A;  3TTR A;  2YLN A;  4JVC A;  3TQL A;  1QW0 A;  4L17 A;  1SDX A;  4DXB A;  4EQ7 A;  3DEL B;  3M8U A;  3RYD A;  3H6T A;  5HPQ A;  3PU5 A;  4ZE8 A;  4NF5 B;  2PYY A;  4H45 A;  4EXL A;  3RY3 A;  5I84 A;  3IAZ A;  3QUJ A;  4HXV A;  3OO6 A;  1XVY A;  3SEV A;  2REJ A;  3MYU A;  4RNS A;  3MBP A;  1Y9U A;  5LDZ A;  1H3D A;  2NWJ A;  3KJ7 A;  1PDA A;  1B9J A;  1TFD A;  3IO4 A;  4JB7 A;  2XWK A;  4F1Y A;  4HE0 A;  1J1N A;  3OO9 A;  4N13 A;  4XEQ A;  1SW1 A;  3C9H A;  5AA2 D;  5F24 A;  3TYH A;  5AE4 A;  3A3U A;  3K1P A;  5L9S A;  3ZKL A;  2DWI A;  3HFU A;  3P7I A;  4NGU A;  1UTH B;  1Z7M E;  2HFB A;  1UTB B;  5H8H A;  4PAK A;  3VLV A;  1NUZ A;  4GWO A;  1BLF A;  1WVJ A;  1L5T A;  3GBB A;  3O66 A;  4X1D A;  1R9Q A;  3O2A A;  3QYT A;  4WKM A;  4YMA A;  2I0B A;  3MJN A;  4RPN A;  1N3X A;  1B05 A;  3QIM A;  4GF8 A;  5ELV A;  4KQP A;  4QSE A;  2O7U A;  4GWY A;  1MY3 A;  3C36 A;  3KBZ A;  1B52 A;  4YKP A;  3A29 A;  1FBE A;  1A8E A;  1UTH A;  2DWH A;  2H98 A;  3H6U A;  2H25 A;  3U94 A;  4U4S A;  4KCC A;  2ALU A;  2XWV A;  1KWH A;  2Y5L A;  3FVN A;  3K6X A;  4NG7 A;  4GBW A;  2UVH A;  3R26 A;  4OET A;  1VSO A;  1FTJ A;  2Z8E A;  5DVF A;  2XHD A;  4POW A;  2V3Q A;  3UGW A;  2PVU A;  3T9H B;  1SW2 A;  3Q26 A;  2HXW A;  3KFM A;  5H8S A;  5HBC A;  4U4X A;  4XF5 A;  1Y4T A;  3W9V A;  2O7I A;  1A55 A;  1NH8 A;  3O29 A;  1MQG A;  1B7Z A;  3KOT A;  2ZZW A;  4YB6 A;  2DYX A;  3SEX A;  1Y3N A;  5DVI A;  3G3K A;  1SI0 A;  4IGT A;  5I2K B;  3PUV E;  2KQZ A;  1CB6 A;  3MPK A;  3PPN A;  4DI3 D;  1HSE A;  2DDK A;  4NN3 A;  4YIC A;  2V3U A;  3FD3 A;  4GX3 A;  2ZNS A;  2Y7R A;  1MPD A;  3TKD A;  1FPB A;  1MRP A;  1EYK A;  3LUZ A;  4FOR A;  1FPD A;  4PFU A;  1B2H A;  2XXK A;  4RXL A;  4KR5 A;  5T3J A;  5EQA A;  4LVQ A;  2DS9 A;  3DM0 A;  5I2K A;  1I6B A;  1FPL A;  4DZ1 A;  1B1H A;  4G8H A;  4OMB A;  4H0W A;  3RGY A;  2ZNT A;  1DCU A;  3FJ7 A;  1N04 A;  5IZ3 B;  2H99 A;  1R9L A;  2Y84 A;  3CIJ A;  4Q8R A;  4NAP A;  4PBQ A;  3U72 A;  3QXM A;  1MXY A;  4LQ5 A;  2VOZ A;  2QSX A;  2O69 A;  4H8I A;  3BFU A;  4NED A;  1O7T A;  5A5X A;  5HM4 B;  4PCD A;  2OWS A;  5ET7 A;  1LB8 A;  2VGQ A;  4NF4 A;  1MM6 A;  3A3C A;  4DI4 B;  3PPQ A;  2B4L A;  2XX8 A;  1A8F A;  1N7X A;  4ZEB A;  2XD2 A;  1B40 A;  3LUY A;  2F7A A;  3FXU A;  4F2Q A;  1FBF A;  5I59 B;  1M5D A;  4PE3 A;  4P56 A;  2Z8D A;  3KN8 A;  3IJX B;  1Q1K A;  4Q30 B;  3SKP A;  1N76 A;  5H8F B;  1OQG A;  1JQF A;  4MX6 A;  1MY2 A;  2HAV A;  4YB5 A;  1I6A A;  3A09 A;  4N91 A;  1GR2 A;  3SET A;  4PDD A;  5ESY A;  5AA4 A;  1FCK A;  2A5T B;  2L5V A;  3V89 B;  4QHQ A;  4KFQ A;  2O1M A;  2I49 A;  4FBP A;  1B3L A;  2R71 A;  2PFZ A;  2ZYK A;  2HAU A;  1Q35 A;  4GX6 A;  2V84 A;  1D4N A;  3QAX A;  3C33 A;  3PPP A;  4HS7 A;  4ELQ A;  3QUF A;  2F97 A;  2V3T A;  2XX9 A;  3IL1 B;  4G8N A;  3IFC A;  1XS5 A;  1FTO A;  3I3V A;  2Q89 A;  1FQA A;  4LA9 A;  4YAH X;  2H5Y A;  1NV7 A;  1B32 A;  1QGX A;  1XT8 A;  5DW8 A;  3U1O A;  4G68 B;  1IIT A;  4N6P A;  2XD3 A;  4OFJ A;  2Q74 A;  3D4C A;  2KR0 A;  5IKB A;  3VE1 B;  2G29 A;  4X48 A;  5L9O A;  3CHG A;  4UAB A;  2DWJ A;  2YPN A;  2OCU A;  4YKI A;  4MCO A;  1TFA A;  5CC2 A;  1FTA A;  2ONK E;  3KOS A;  3QK6 A;  2XXI A;  3KN3 A;  4TOZ A;  3CRB A;  2XXH A;  4H67 A;  2XWO A;  3OXN A;  5L8D A;  1UQW A;  1NV0 A;  1B3F A;  2ONS A;  3OO8 A;  1D9V A;  1Y20 A;  3FZV A;  2OBG A;  1POY 1;  4QSD A;  1FPE A;  4M1V A;  1G0H A;  2P0S A;  1PBP A;  2ZXT A;  3DP4 A;  1EZ9 A;  4IO3 A;  5CRY A;  3TFL A;  2DQV A;  3T22 A;  1NUY A;  1MY0 A;  1SW4 A;  4PF6 A;  4RK2 A;  3KC1 A;  2XXW A;  1OMP A;  3TTL A;  3ECR A;  5CI5 A;  4ZE9 A;  1JW5 A;  4O3B A;  5ET8 A;  2I3V A;  2X7P A;  4FJP A;  1OIB A;  3FGS A;  5B70 A;  4GWX A;  1NH7 A;  3ILU B;  3FAS A;  1LBY A;  4OEU A;  4GWS A;  2IEE A;  4GD5 A;  3V5A A;  3LV0 A;  4OVQ A;  2RCB A;  1IUD A;  1FJ6 A;  4R75 A;  2O1L A;  3MP6 A;  1JW1 A;  1FTK A;  4HE2 A;  1FW0 A;  3THI A;  4OEN A;  4AB5 A;  4OQO A;  5DVJ A;  1LFH A;  3IOW A;  4O7I A;  1DSN A;  3RQT A;  2UVJ A;  4E0X A;  1RYX A;  4FE8 A;  1QUL A;  5I7I A;  2FHY A;  1MXX A;  1QKA A;  2W7Y A;  2A5S A;  2ONR A;  3KSX A;  3MP1 A;  3PMV A;  2NXO A;  3W9W A;  1II5 A;  1LAH E;  4ZZE A;  4Q0C A;  4N6K A;  5I58 B;  3N6T A;  2QMW A;  2WEF A;  1DK4 A;  4LZ8 A;  1WDN A;  1SYH A;  4GVO A;  1LB9 A;  3U8Q A;  1NV6 A;  4PTK A;  3MZB A;  5EHS A;  3HST A;  5J1D A;  4U1O A;  5FBP A;  4YU0 A;  4N8G A;  2DVZ A;  3MVZ A;  2R8T A;  4XTC Q;  4RK9 A;  3DP6 A;  4PBH A;  2PBW A;  2ZNU A;  4KI0 E;  4FEB A;  1B6H A;  4GFR A;  1DBZ A;  4JVD A;  3PD9 A;  3OEK A;  4NWD A;  1B5J A;  4BDN A;  5B7D A;  5EYG A;  1SVX B;  3S9L C;  2QL3 A;  4FAT A;  1K9Z A;  4K3F A;  3TTK A;  1MQI A;  3O6H A;  4PDH A;  5CM6 A;  4FAJ A;  2F3D A;  2R6G E;  3LSL A;  3EKI A;  4IO2 A;  4IY6 A;  5BWJ A;  3FJM A;  3ROJ A;  3USD A;  3K1M A;  2B65 A;  1INP A;  1IIW A;  3MQ9 A;  5ICT A;  4JWY A;  3R6U A;  2ZYN A;  2CZK A;  4MF3 A;  3VV5 A;  1I6Q A;  5IAI A;  4G4P A;  5FHO A;  3EPE A;  3HV1 A;  1PB9 A;  2H9B A;  2UXA A;  4LQ2 A;  4QSC A;  3I6V A;  2Q9T A;  5JTY B;  3JV9 A;  3SEW A;  5CMB A;  3E13 X;  2NUV A;  4RJZ A;  1AIV A;  1RDX A;  2HQ0 A;  1YCJ A;  4LON B;  2HZK A;  3MVY A;  4NF5 A;  4OYV A;  4PF8 A;  4LZ7 A;  4U2R A;  1KZ8 A;  1MXV A;  3KEI A;  4H65 A;  3B8B A;  4ZEF A;  4ZZA A;  3S9M C;  4PAF A;  4BDQ A;  4OWD A;  4X9T A;  2RC7 A;  1A7L A;  4OVR A;  1FPJ A;  3ZSF A;  4U23 A;  3Q27 A;  2CMO A;  4F3S A;  1ANF A;  1UIV A;  4QFN A;  1JVY A;  4I40 A;  3FBP A;  2GHA A;  3N94 A;  4IR8 A;  5I56 B;  2O68 A;  3EN3 A;  1S50 A;  1NNF A;  2BJI A;  2QS1 A;  3K6W A;  4FEC A;  5TP9 B;  5I57 B;  3G3H A;  4PAI A;  4ESW A;  2DE2 A;  1OLA A;  2YJP A;  2GH9 A;  1Q9D A;  3C32 A;  5TU0 A;  5LTC A;  2DE3 A;  3CG1 A;  1R1N A;  1UTB A;  4XIG Q;  1LFI A;  5F7V A;  2HHM A;  3OEL A;  4DDD A;  1FBD A;  1LBV A;  4E0W A;  4F3P A;  2F78 A;  4OFO A;  3VDF A;  2D21 A;  2FNC A;  2Y5K A;  2F7C A;  1MY4 A;  4NE4 A;  1D9Q A;  3KZG A;  2HEU A;  3GZG A;  3C4M A;  4F3B A;  1FQF A;  1P1N A;  1RKM A;  1SQY A;  1IXI A;  2PT2 A;  4RY1 A;  3TCG A;  1FBC A;  2UVG A;  1MS7 A;  4N81 A;  4TQU Q;  4ZS9 A;  4N07 A;  1FBP A;  2CZL A;  4F18 A;  2REG A;  5DTB A;  3MWB A;  4QFP A;  4F2O A;  4EDP A;  2FYI A;  3RPW A;  5H8N B;  4MEV A;  3RUM A;  1GV8 A;  1DMB A;  3FVK A;  3MPL A;  3RTF B;  4BDL A;  4HCW A;  5TPA B;  2VPO A;  2XXX A;  4GL8 A;  1P99 A;  1SW5 A;  1URG A;  1JEU A;  3TTM A;  2QMX A;  1O63 A;  4ELO A;  4XKR A;  1MG1 A;  3KSJ A;  1UIU A;  1Y3Q A;  3N5L A;  5JK4 A;  3K02 A;  4ELR A;  4ND9 A;  3TCH A;  1NNK A;  3VFJ A;  4I3E A;  3CFL A;  3O6I A;  5ISU A;  2GHB A;  3VLU A;  1NV4 A;  4R73 A;  3D1R A;  4O3C A;  3FJG A;  4U21 A;  4QFO A;  5I5P A;  3G7W A;  3MVW A;  2RKM A;  3ZS6 A;  1LBW A;  3T9V A;  3JYR A;  4GIZ A;  4ZEI A;  4PFR A;  1FQB A;  2B4M A;  1USY E;  1MQD A;  2Q2C A;  3KBR A;  1IME A;  2ESN A;  4MLQ A;  4HE1 A;  2PMS A;  2RCA A;  1B0H A;  1H43 A;  1OVT A;  2QVV A;  1B4Z A;  1I69 A;  4EQB A;  4H5G A;  3MC2 A;  3SES A;  4PFY A;  5IZ3 A;  1IMC A;  5KCJ B;  4DCX A;  4NF0 A;  5JEI A;  1MDQ A;  1IXC A;  2AYS A;  2D3I A;  3H6W A;  1GTK A;  1A54 A;  1N7W A;  3VXB A;  1FBG A;  2P1S A;  1PEB A;  4NX1 A;  3HPI A;  2QVR A;  4H5F A;  2E1S A;  3BKI B;  1BIY A;  3UK4 A;  4ZED A;  3Q25 A;  4PGN A;  1SYI A;  1POT A;  4H8J A;  4U22 A;  3LBS A;  4C1U A;  3TTN A;  1LAF E;  3B6T A;  3IOU A;  1JVX A;  1CNQ A;  4P9K A;  1MM7 A;  3E4R A;  3K1N A;  1ZJL A;  4Q5T A;  1Y1Z A;  2ZMB A;  5I59 A;  1FPK A;  1VE4 A;  3I5O A;  3PGF A;  4OER A;  3ISP A;  4X1B A;  4RYA A;  4HW8 A;  3M3L A;  4MLV A;  3MUQ A;  5H8F A;  1BKA A;  2OWT A;  3C35 A;  3N6U A;  5BUU A;  2QJE A;  3LSW A;  4POX A;  4R72 A;  2Z22 A;  2E0S A;  1EYI A;  4QFK A;  3PUZ E;  3H3G A;  5IGA A;  2XXY A;  3FAT A;  4OAN A;  2A5T A;  4OZ9 A;  1B0L A;  3OO7 A;  1CE2 A;  1FQC A;  3OSQ A;  4WEP A;  1OQH A;  3EHS A;  1JNF A; 
#chains in the Genus database with same CATH homology
 3GLB A;  2VD2 A;  3RNN A;  3CFZ A;  1JW4 A;  3TQW A;  2P2A A;  1VFD A;  3CSG A;  1PB8 A;  5K2Y A;  1B7H A;  4KHZ E;  3IR1 A;  3MZ1 A;  2ANJ A;  1TXF A;  4DIG A;  3U92 A;  4LUB A;  3UOR A;  1P1O A;  4G68 A;  4U1Z A;  3SDF A;  5FTI A;  3T66 A;  4OTE A;  3V83 A;  1IXH A;  1P1W A;  4KD5 A;  4LP2 B;  3TZA A;  4AB6 A;  5L9M A;  1LFG A;  1YPN A;  1Z7N E;  2Y7W A;  2RF1 A;  3K01 A;  4OFL A;  2Z8F A;  4YKK A;  4QF9 A;  2AL5 A;  3SEU A;  3IB2 A;  3RTW B;  2G93 A;  1EZP A;  4JSD A;  1R6Z A;  1Y3P A;  3LSF B;  3FIR A;  4YMB A;  4LAT A;  3W15 C;  3OMB A;  4IO4 A;  1XC1 A;  4DCY A;  4DXC A;  4F1U A;  4ZEK A;  4XKN A;  4YZZ A;  1QVS A;  3IX1 A;  5KDT B;  1B58 A;  1MQJ A;  3TOD A;  1IEJ A;  3G3J A;  1MXZ A;  3S4U A;  2Y7K A;  1DPP A;  2F36 A;  1SI1 A;  4H6D A;  2FA7 A;  4H1X A;  4JSO A;  3T9U A;  1TWY A;  3VXC A;  3VLW A;  3Q28 A;  3T9X B;  4BDM A;  4TLM B;  3IB1 A;  1F9B A;  2ZYM A;  4QRZ A;  3K6V A;  1XOC A;  5KDT A;  3B6W A;  4F3G A;  4GRK A;  3EHU A;  3K6U A;  4F31 B;  1B7U A;  1B3H A;  3O97 A;  1FQE A;  3S2V A;  1LST A;  3B7D A;  2GRV A;  5ICQ A;  3SER A;  4MBP A;  1ZKB A;  2GFE A;  4GXA A;  3VVF A;  2UVI A;  3VVE A;  2VHA A;  3PV0 E;  1T0K A;  4MH5 A;  2I58 A;  1ZMG A;  1MPC A;  3K4U A;  2LAO A;  2DWA A;  5I58 A;  3OD7 A;  1B5H A;  3UA8 A;  3UP9 A;  3TMG A;  2F8D A;  4NF8 B;  1H76 A;  1IQ7 A;  1B51 A;  1HSJ A;  3CG3 A;  3IOT A;  1VFE A;  3T93 B;  3KJT A;  3PMW A;  4QFL A;  2Y7P A;  5AA3 A;  1ZU0 A;  3FV2 A;  4P11 A;  4JDF A;  4HCY A;  2I4B A;  2QS4 A;  4ELP A;  4IY5 A;  2PX1 A;  3SEY A;  5CMM A;  4NF8 A;  4DLD A;  4EQ9 A;  3OEM A;  3EQ1 A;  1LBB A;  1N84 A;  2O84 X;  4G68 C;  4ISU A;  1H45 A;  3PPR A;  1IZ1 A;  2OJT A;  1O64 A;  4BDO A;  3QSL A;  5F1Q A;  5DYH A;  4XXU A;  4XKP A;  3FXQ A;  3C31 A;  4C1T A;  1MXW A;  5AA1 A;  1ELJ A;  2F34 A;  5H8H B;  1URS A;  3MW0 A;  5JTY A;  3UIF A;  4F29 A;  4OES A;  1AH5 A;  4JWX A;  3FUZ A;  3PUX E;  4ONY A;  5KZT A;  2D5W A;  4C0R A;  5EYF A;  4G77 A;  4F1V A;  1MY1 A;  4O3A A;  1PC3 A;  1VR5 A;  2OZZ A;  3IO6 A;  2Y7I A;  3IOV A;  4LZ5 A;  3HN0 A;  3RT8 A;  2RIN A;  4GOT A;  2AIX A;  3TAJ A;  2NOO A;  1QUJ A;  2XX7 A;  3PUW E;  4R9F A;  3OSR A;  1JET A;  3IJO B;  1LCF A;  4OXV A;  5I56 A;  2NVU B;  1EZO A;  2THI A;  1MQH A;  5K2X A;  4BLA A;  3H06 B;  1Y4C A;  5H8Q B;  5CMK A;  1OVB A;  5TP9 A;  5I57 A;  2PT1 A;  3KGC A;  4KYD A;  2QS3 A;  4JXI A;  3HHG A;  2X7Q A;  3CI8 A;  3FXR A;  1XHY A;  4OEV A;  2I4C A;  1B46 A;  2O6A A;  1WOD A;  4RPO A;  1S7Y A;  3EHT A;  3O6G A;  1M5C A;  4PET A;  1EU8 A;  5H8Q A;  4P0G A;  1FTM A;  3RN8 A;  3TEP A;  2DOJ A;  2QRY A;  2WKY A;  3BBR A;  4NTL A;  1D9Y A;  4R2F A;  2UYF A;  2O51 A;  4F39 A;  4G8M A;  2XXR A;  4GLI A;  4DXU A;  1MDP 1;  4G2Z A;  1QKB A;  1MPB A;  1D3K A;  4WED A;  2F5X A;  3CVG A;  2V25 A;  4IO7 A;  4I8C A;  3G3F A;  2M8C A;  5H8N A;  3VVD A;  5CMC A;  1NNP A;  3EF7 A;  5TPA A;  1EH3 A;  4EXK A;  3E3K A;  3LSX A;  4DE8 A;  3TPA A;  2Z23 A;  1MH3 A;  1FQD A;  1ZLQ A;  4NWC A;  1LCT A;  4I9D A;  3LR1 A;  4OHN A;  5A5X B;  4EF2 A;  2VD3 A;  3FVO A;  1Y1M A;  3PMX A;  4YKJ A;  4NF4 B;  3FVG A;  1LLS A;  3H03 A;  4EF1 A;  4PFT A;  3WAE A;  3GXA A;  3OOA A;  4OVJ A;  1NKX A;  1NFT A;  3G3I A;  3U93 A;  2B3B A;  3S9E A;  1LBC A;  1HSL A;  2XXV A;  4NMY A;  1MXU A;  2RC9 A;  1N3W A;  3O9P A;  3L6H A;  4R6H A;  3CSB A;  2X26 A;  3ILT B;  1SD3 A;  3R7X A;  1QUI A;  3DLN A;  3HHF A;  3MP8 A;  5AA4 B;  4THI A;  1US4 A;  4GL0 A;  4HTG A;  1B3G A;  1ZBM A;  3JZJ A;  5KCJ A;  5I2N B;  4FED A;  4I1D A;  2F6P A;  2QPQ A;  3TUS A;  2F7B A;  3TEL A;  3RT6 B;  5LOM A;  1M5B A;  5FHN A;  1GVC A;  4FIM A;  2DXY A;  1QJM A;  5DT6 A;  4ZDM A;  3O28 A;  4R6Y A;  5I2N A;  4R74 A;  3KN7 A;  3H7M A;  3LC8 A;  4PP0 A;  3TDJ A;  2IA4 A;  4KCD A;  1NL5 A;  3CFX A;  5ITO A;  3C34 A;  5ITP A;  1YTV A;  4IO6 A;  4NF6 B;  4PQJ A;  3L6G A;  1B3E A;  2ABH A;  3WAF A;  3G3G A;  1B4H A;  2RC8 A;  3KG2 A;  1BTJ A;  5CBR A;  3D4G A;  4F19 A;  2I3W A;  1DTG A;  1PB7 A;  4UAC A;  3TCF A;  2XXT A;  1RYO A;  4WXJ A;  3H4Z A;  3OEN A;  1IXG A;  1M5F A;  4NF6 A;  4KYE A;  1ZIU A;  3BFT A;  3K00 A;  1N0T A;  3PD8 A;  5FTH A;  4I62 A;  3M3F A;  2UYE A;  5DEX B;  2Q2A A;  2I6E A;  4PE5 B;  1P1Q A;  1AL3 A;  1FTL A;  2H4I A;  2Q8J A;  3K0V A;  1DTZ A;  1NMU A;  3CR9 A;  4Z7E A;  3MAM A;  3N26 A;  1GGG A;  3PPO A;  3ONM A;  1NNT A;  3FV1 A;  2DXR A;  2QS2 A;  3HCQ A;  4R6K A;  2B3F A;  2I48 A;  4IO5 A;  2BJJ X;  2ZYO A;  5DEX A;  1LAG E;  1PBQ A;  3AXF A;  4ZEC A;  2VP1 A;  1SBP A;  3IOR A;  4Z0I A;  3K2D A;  1A99 A;  2DE4 A;  1AOV A;  2DSF A;  3V8X B;  4YB7 A;  2HZL A;  1YAE A;  4R2B A;  4PFW A;  5AA2 B;  4KYS A;  3DP8 A;  4GQO A;  1BP5 A;  1ZTY A;  3GBA A;  4XKQ A;  2F6G A;  1LGB C;  2Q88 A;  5EHM A;  3MZ9 A;  3E9X A;  3ODB A;  5FHM A;  1USY H;  3T96 B;  1XVX A;  1AMF A;  2XXU A;  1M5E A;  3Q29 A;  3UN6 A;  2DP8 A;  4EUO A;  4AQ4 A;  3IK6 B;  1A40 A;  4JWO A;  4GXS B;  5AA2 A;  4IB2 A;  3MVX A;  1OLC A;  2R9J A;  4R9G A;  1DPE A;  3RLF E;  2I0C A;  2OK2 A;  1B5I A;  4JBZ A;  4MFI A;  3PUY E;  3S9N C;  2XXQ A;  4TLL B;  4ECF A;  4KPT A;  2KLF A;  4M4G A;  1US5 A;  4IGR A;  3M3K A;  1QUK A;  1MH4 A;  1URD A;  1P1U A;  1LAX A;  1S9T A;  2V93 A;  3B6Q A;  3H6V A;  3HO7 A;  4P0I A;  4UA8 A;  3ZKK A;  1DOT A;  1ATG A;  2HCA A;  2AL4 A;  2OLB A;  1H44 A;  5M2V A;  1B1X A;  4RA1 A;  3IB0 A;  4BDR A;  2DVC A;  2XXP A;  4F22 A;  1TT1 A;  2F35 A;  4ESX A;  5CBS A;  3F11 A;  1JEV A;  3TTR A;  2YLN A;  3TQL A;  1QW0 A;  4L17 A;  1SDX A;  4DXB A;  4EQ7 A;  3DEL B;  3M8U A;  3H6T A;  5HPQ A;  3PU5 A;  4ZE8 A;  4NF5 B;  2PYY A;  4EXL A;  3RY3 A;  5I84 A;  3IAZ A;  3QUJ A;  3OO6 A;  1XVY A;  3SEV A;  2REJ A;  4RNS A;  3MBP A;  1Y9U A;  1H3D A;  2NWJ A;  3KJ7 A;  1PDA A;  1B9J A;  1TFD A;  3IO4 A;  4JB7 A;  4F1Y A;  1J1N A;  3OO9 A;  4N13 A;  1SW1 A;  3C9H A;  5AA2 D;  3TYH A;  5AE4 A;  3A3U A;  3K1P A;  5L9S A;  3ZKL A;  2DWI A;  3P7I A;  1UTH B;  1Z7M E;  2HFB A;  1UTB B;  5H8H A;  3VLV A;  4GWO A;  1BLF A;  1WVJ A;  1L5T A;  3GBB A;  3O66 A;  4X1D A;  1R9Q A;  3O2A A;  3QYT A;  4WKM A;  4YMA A;  2I0B A;  3MJN A;  4RPN A;  1N3X A;  1B05 A;  3QIM A;  4GF8 A;  5ELV A;  4KQP A;  4QSE A;  2O7U A;  1MY3 A;  3C36 A;  1B52 A;  4YKP A;  1A8E A;  1UTH A;  2DWH A;  2H98 A;  3H6U A;  2H25 A;  3U94 A;  4U4S A;  4KCC A;  2ALU A;  1KWH A;  3FVN A;  3K6X A;  2UVH A;  3R26 A;  4OET A;  1VSO A;  1FTJ A;  2Z8E A;  5DVF A;  2XHD A;  4POW A;  2V3Q A;  3UGW A;  2PVU A;  3T9H B;  1SW2 A;  3Q26 A;  2HXW A;  3KFM A;  5H8S A;  5HBC A;  4U4X A;  1Y4T A;  3W9V A;  2O7I A;  1A55 A;  1NH8 A;  3O29 A;  1MQG A;  1B7Z A;  3KOT A;  4YB6 A;  2DYX A;  3SEX A;  1Y3N A;  5DVI A;  3G3K A;  1SI0 A;  4IGT A;  5I2K B;  3PUV E;  1CB6 A;  3MPK A;  3PPN A;  1HSE A;  4YIC A;  2V3U A;  3FD3 A;  2ZNS A;  2Y7R A;  1MPD A;  3TKD A;  1MRP A;  4FOR A;  4PFU A;  1B2H A;  4RXL A;  4KR5 A;  4LVQ A;  2DS9 A;  3DM0 A;  5I2K A;  1I6B A;  4DZ1 A;  1B1H A;  4G8H A;  4OMB A;  4H0W A;  3RGY A;  2ZNT A;  3FJ7 A;  1N04 A;  2H99 A;  1R9L A;  2Y84 A;  3CIJ A;  4Q8R A;  3U72 A;  3QXM A;  1MXY A;  4LQ5 A;  2VOZ A;  2QSX A;  2O69 A;  4H8I A;  3BFU A;  4NED A;  1O7T A;  5A5X A;  5HM4 B;  2OWS A;  1LB8 A;  2VGQ A;  4NF4 A;  1MM6 A;  3A3C A;  3PPQ A;  2XX8 A;  1A8F A;  1N7X A;  4ZEB A;  2XD2 A;  1B40 A;  3LUY A;  2F7A A;  3FXU A;  4F2Q A;  5I59 B;  1M5D A;  2Z8D A;  3KN8 A;  3IJX B;  1Q1K A;  4Q30 B;  3SKP A;  1N76 A;  5H8F B;  1OQG A;  1JQF A;  1MY2 A;  2HAV A;  4YB5 A;  1I6A A;  3A09 A;  1GR2 A;  3SET A;  5AA4 A;  1FCK A;  2A5T B;  3V89 B;  4QHQ A;  4KFQ A;  2O1M A;  2I49 A;  1B3L A;  2R71 A;  2ZYK A;  2HAU A;  1Q35 A;  2V84 A;  1D4N A;  3QAX A;  3C33 A;  3PPP A;  4HS7 A;  4ELQ A;  3QUF A;  2F97 A;  2V3T A;  2XX9 A;  3IL1 B;  4G8N A;  1XS5 A;  1FTO A;  3I3V A;  2Q89 A;  1FQA A;  4LA9 A;  4YAH X;  2H5Y A;  1B32 A;  1XT8 A;  3U1O A;  4G68 B;  1IIT A;  4N6P A;  2XD3 A;  4OFJ A;  3D4C A;  5IKB A;  3VE1 B;  2G29 A;  4X48 A;  5L9O A;  2DWJ A;  2YPN A;  2OCU A;  4YKI A;  1TFA A;  5CC2 A;  2ONK E;  3KOS A;  3QK6 A;  2XXI A;  3KN3 A;  4TOZ A;  3CRB A;  2XXH A;  4H67 A;  3OXN A;  5L8D A;  1UQW A;  1B3F A;  2ONS A;  3OO8 A;  1D9V A;  1Y20 A;  3FZV A;  2OBG A;  1POY 1;  4QSD A;  4M1V A;  2P0S A;  1PBP A;  2ZXT A;  3DP4 A;  1EZ9 A;  4IO3 A;  5CRY A;  3TFL A;  2DQV A;  3T22 A;  1MY0 A;  1SW4 A;  4RK2 A;  2XXW A;  1OMP A;  3TTL A;  3ECR A;  5CI5 A;  4ZE9 A;  1JW5 A;  4O3B A;  2I3V A;  2X7P A;  4FJP A;  1OIB A;  3FGS A;  5B70 A;  1NH7 A;  3ILU B;  3FAS A;  4OEU A;  2IEE A;  4GD5 A;  3V5A A;  2RCB A;  1IUD A;  4R75 A;  2O1L A;  3MP6 A;  1JW1 A;  1FTK A;  1FW0 A;  3THI A;  4OEN A;  4AB5 A;  4OQO A;  5DVJ A;  1LFH A;  3IOW A;  1DSN A;  4E0X A;  2UVJ A;  3RQT A;  1RYX A;  4FE8 A;  1QUL A;  1MXX A;  1QKA A;  2W7Y A;  2A5S A;  2ONR A;  3KSX A;  3MP1 A;  3PMV A;  2NXO A;  3W9W A;  1II5 A;  1LAH E;  4ZZE A;  4Q0C A;  5I58 B;  3N6T A;  2QMW A;  4LZ8 A;  1WDN A;  1SYH A;  4GVO A;  1LB9 A;  3U8Q A;  3MZB A;  5EHS A;  3HST A;  5J1D A;  4U1O A;  4YU0 A;  2DVZ A;  3MVZ A;  4XTC Q;  4RK9 A;  3DP6 A;  2PBW A;  2ZNU A;  4KI0 E;  4FEB A;  1B6H A;  4GFR A;  3PD9 A;  3OEK A;  4NWD A;  1B5J A;  4BDN A;  5B7D A;  1SVX B;  3S9L C;  2QL3 A;  4FAT A;  4K3F A;  3TTK A;  1MQI A;  3O6H A;  5CM6 A;  4FAJ A;  2R6G E;  3LSL A;  4IO2 A;  4IY6 A;  5BWJ A;  3FJM A;  3USD A;  3K1M A;  2B65 A;  1IIW A;  3MQ9 A;  5ICT A;  4JWY A;  3R6U A;  2ZYN A;  4MF3 A;  3VV5 A;  1I6Q A;  5IAI A;  4G4P A;  5FHO A;  3EPE A;  3HV1 A;  1PB9 A;  2H9B A;  2UXA A;  4LQ2 A;  4QSC A;  3I6V A;  2Q9T A;  5JTY B;  3JV9 A;  3SEW A;  5CMB A;  3E13 X;  2NUV A;  4RJZ A;  1AIV A;  2HQ0 A;  1YCJ A;  4LON B;  2HZK A;  3MVY A;  4NF5 A;  4OYV A;  4LZ7 A;  4U2R A;  1MXV A;  3KEI A;  4H65 A;  4ZEF A;  4ZZA A;  3S9M C;  4BDQ A;  4OWD A;  4X9T A;  2RC7 A;  1A7L A;  3ZSF A;  4U23 A;  3Q27 A;  2CMO A;  4F3S A;  1ANF A;  1UIV A;  4QFN A;  1JVY A;  2GHA A;  3N94 A;  5I56 B;  2O68 A;  3EN3 A;  1S50 A;  1NNF A;  2QS1 A;  3K6W A;  4FEC A;  5TP9 B;  5I57 B;  3G3H A;  4ESW A;  2DE2 A;  1OLA A;  2YJP A;  2GH9 A;  3C32 A;  5TU0 A;  2DE3 A;  3CG1 A;  1R1N A;  1UTB A;  4XIG Q;  1LFI A;  5F7V A;  3OEL A;  4DDD A;  4F3P A;  4E0W A;  2F78 A;  4OFO A;  3VDF A;  2D21 A;  2FNC A;  2F7C A;  1MY4 A;  4NE4 A;  3KZG A;  2HEU A;  3GZG A;  3C4M A;  4F3B A;  1FQF A;  1P1N A;  1RKM A;  1SQY A;  1IXI A;  2PT2 A;  4RY1 A;  3TCG A;  2UVG A;  4ZS9 A;  1MS7 A;  4TQU Q;  4N07 A;  2CZL A;  4F18 A;  2REG A;  5DTB A;  3MWB A;  4QFP A;  4F2O A;  4EDP A;  2FYI A;  3RPW A;  5H8N B;  3RUM A;  1GV8 A;  1DMB A;  3FVK A;  3MPL A;  3RTF B;  4BDL A;  4HCW A;  5TPA B;  2XXX A;  4GL8 A;  1P99 A;  1SW5 A;  1URG A;  1JEU A;  3TTM A;  2QMX A;  1O63 A;  4ELO A;  4XKR A;  1MG1 A;  3KSJ A;  1UIU A;  1Y3Q A;  3N5L A;  5JK4 A;  3K02 A;  4ELR A;  4ND9 A;  3TCH A;  1NNK A;  3VFJ A;  3CFL A;  3O6I A;  5ISU A;  2GHB A;  3VLU A;  4R73 A;  4O3C A;  3FJG A;  4U21 A;  4QFO A;  3G7W A;  3MVW A;  2RKM A;  3ZS6 A;  3T9V A;  3JYR A;  4GIZ A;  4ZEI A;  1FQB A;  1USY E;  1MQD A;  2Q2C A;  3KBR A;  2ESN A;  4MLQ A;  2PMS A;  2RCA A;  1B0H A;  1H43 A;  1OVT A;  1B4Z A;  1I69 A;  4EQB A;  4H5G A;  3MC2 A;  3SES A;  4PFY A;  5KCJ B;  4DCX A;  5JEI A;  1MDQ A;  1IXC A;  2AYS A;  2D3I A;  3H6W A;  1GTK A;  1A54 A;  1N7W A;  3VXB A;  2P1S A;  1PEB A;  3HPI A;  4H5F A;  2E1S A;  3BKI B;  1BIY A;  3UK4 A;  4ZED A;  3Q25 A;  1SYI A;  1POT A;  4H8J A;  4U22 A;  3LBS A;  4C1U A;  3TTN A;  1LAF E;  3B6T A;  3IOU A;  1JVX A;  1MM7 A;  3E4R A;  3K1N A;  1ZJL A;  4Q5T A;  1Y1Z A;  2ZMB A;  5I59 A;  1VE4 A;  3I5O A;  3PGF A;  4OER A;  4X1B A;  4RYA A;  4HW8 A;  3M3L A;  4MLV A;  3MUQ A;  5H8F A;  1BKA A;  2OWT A;  3C35 A;  3N6U A;  5BUU A;  2QJE A;  3LSW A;  4POX A;  4R72 A;  2Z22 A;  2E0S A;  4QFK A;  3PUZ E;  3H3G A;  2XXY A;  3FAT A;  2A5T A;  4OZ9 A;  1B0L A;  3OO7 A;  1CE2 A;  1FQC A;  3OSQ A;  4WEP A;  1OQH A;  3EHS A;  1JNF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...