2HFBA

Crystal structure of selenomethionine-labelled rafe from streptococcus pneumoniae
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
383
structure length
383
Chain Sequence
TVTIEYFNQKKEMTKTLEEITRDFEKENPKIKVKVVNVPNAGEVLKTRVLAGDVPDVVNIYPQSIELQEWAKAGVFEDLSNKDYLKRVKNGYAEKYAVNEKVYNVPFTANAYGIYYNKDKFEELGLKVPETWDEFEQLVKDIVAKGQTPFGIAGADAWTLNGYNQLAFATATGGGKEANQYLRYSQPNAIKLSDPIMKDDIKVMDILRINGSKQKNWEGAGYTDVIGAFARGDVLMTPNGSWAITAINEQKPNFKIGTFMIPGKEKGQSLTVGAGDLAWSISATTKHPKEANAFVEYMTRPEVMQKYYDVDGSPTAIEGVKQAGEDSPLAGMTEYAFTDRHLVWLQQYWTSEADFHTLTMNYVLTGDKQGMVNDLNAFFNPMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein
molecule keywords Sugar ABC transporter, sugar-binding protein
publication title Crystal structure of selenomethionine-labelled RafE from Streptococcus pneumoniae
rcsb
source organism Streptococcus pneumoniae
total genus 119
structure length 383
sequence length 383
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-06-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13416 SBP_bac_8 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hfbA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 2hfbA02
3BFTA 3PUVE 4LUBA 2Z8FA 3TZAA 4XTCQ 3K6VA 2I48A 2DQVA 2F7BA 4QFPA 1MQIA 5I57B 1B51A 4DCYA 1M5CA 3S9MC 5CMMA 2QS2A 3H6WA 1B1XA 3M3KA 4C0RA 1WODA 3IJXB 4FIMA 4GWOA 3K01A 3I3VA 5DEXA 1Y20A 1N04A 3O66A 2Q9TA 1MXWA 4DE8A 1O64A 4OFOA 1A8FA 1PB7A 4DCXA 2Y7RA 1XHYA 3T9VA 4AQ4A 4OFJA 4ELQA 4YAHX 3U93A 3GZGA 4OZ9A 4GVOA 3JYRA 1FTKA 2O69A 4IO4A 1LAFE 2OK2A 3RT8A 4HS7A 3R26A 4IB2A 3OO9A 3UIFA 2ABHA 3T93B 4ZE8A 1MY0A 2H25A 4YKKA 1MY1A 2D21A 2ZNTA 1SW2A 1FCKA 4AB6A 1MXVA 4OEVA 1FQCA 4H67A 3H06B 4U4XA 2QSXA 3IORA 5H8QA 1DTZA 2A5TA 1VR5A 3QAXA 3FVGA 3Q28A 4EF1A 3N26A 4GLIA 4F29A 4F2OA 4ZZEA 1QVSA 3VE1B 4DIGA 1S50A 3CRBA 2ZYMA 5HM4B 4N07A 5H8NA 3PMXA 5H8QB 2A5TB 1IXIA 1TXFA 4L17A 2XX8A 4QSDA 2R6GE 3C36A 3OENA 3EHSA 4DXBA 3VLUA 3E9XA 3PMWA 3GXAA 3PPRA 3M3LA 5I2KA 3ECRA 5L9MA 4MFIA 4ZEIA 4LVQA 1GTKA 4G68A 1JQFA 4EXKA 4F3PA 3U72A 1MY3A 3K00A 3LSLA 1WVJA 3TQWA 3KJ7A 4EQ7A 1FQEA 3F11A 4H1XA 4ZZAA 3ONMA 5ITPA 1MQJA 2AYSA 3VLVA 2BJJX 1D9YA 5I2KB 4LQ5A 1QULA 4OMBA 1UTBA 4G68B 4OTEA 4PP0A 3OSRA 4GD5A 4OVJA 3TCHA 2XXVA 4WKMA 3PPNA 4OXVA 3DLNA 3KZGA 3O97A 4Q5TA 1QUIA 1JW5A 2UYFA 1GGGA 1UTHA 2B3BA 1I69A 1TT1A 3HV1A 3KOSA 2P1SA 1MXXA 1ZBMA 2RINA 5BUUA 2DXRA 2ONSA 1SVXB 3KBRA 1N76A 3BFUA 3SDFA 1MM6A 2QS4A 3OO6A 4N13A 3S9EA 1Y3PA 4ZEDA 3FUZA 1Y1MA 2I6EA 3MUQA 2FYIA 3IK6B 3RTWB 1UTHB 3GBBA 2DE4A 2H4IA 3EN3A 3PMVA 3UK4A 4ESXA 5KCJA 4NTLA 2ZYKA 4NMYA 4U4SA 5ICTA 2M8CA 3CG3A 1LAHE 3MZ1A 4KYEA 3KG2A 4IY5A 3FVOA 1O63A 3MVXA 3OSQA 1LFIA 1B5HA 3CFZA 3W9WA 4KYDA 2Z8DA 1Y3NA 3M8UA 4PETA 2H9BA 1OVBA 5KCJB 1URGA 1B0HA 3SEXA 4EQ9A 4IO7A 5JEIA 3O6IA 5AA1A 1H76A 4QRZA 1MPCA 3VVFA 1VFEA 1IUDA 3H6VA 4F18A 1Y9UA 3T96B 4UACA 3P7IA 3A09A 2Y7KA 3TDJA 1B6HA 4ISUA 1IXHA 2Q2AA 2IA4A 1SW4A 2V3TA 4F1UA 4IO6A 3HHFA 2XX7A 2DVZA 2ZYNA 2XD2A 1XS5A 1JVYA 3O28A 2PVUA 3GBAA 3S4UA 3EHTA 3PPOA 1LBCA 1MDP1 3MP1A 4KCDA 1B46A 1OVTA 4BDOA 4OENA 3TTKA 4EXLA 1H45A 4ONYA 2B65A 3KEIA 3V5AA 1B52A 4G8HA 2O1LA 1YTVA 4PFTA 3N5LA 3H7MA 1B7UA 2DWJA 1IXGA 3TCGA 4OHNA 3RPWA 5FTIA 4JXIA 1MRPA 4IY6A 3IAZA 3SETA 3E4RA 4F3GA 3VXBA 4DZ1A 1MXYA 4LP2B 3KN7A 4EQBA 5KZTA 1US4A 3A3CA 1SI0A 1MQGA 4RPOA 2HFBA 3K6WA 5F1QA 5TU0A 4DXUA 3MWBA 2REJA 1DOTA 1JW4A 1MH4A 1LAGE 3H6TA 3DM0A 2ONKE 2ZNUA 1SD3A 4DLDA 4H8JA 3ZS6A 1B7HA 4P0GA 3MJNA 2NWJA 5AA4A 1LCTA 1N84A 4IGTA 1CB6A 5H8FA 3OEKA 2OLBA 4XKRA 2OWTA 2RCAA 4YKPA 5B70A 3Q25A 2Z22A 2A5SA 1N0TA 3H6UA 4O3BA 2D3IA 5LOMA 1A54A 3S9NC 4F2QA 3IO4A 2VD2A 4F31B 2V84A 2W7YA 1VE4A 1MY2A 1B58A 5FHOA 2QMXA 1NKXA 2HAUA 5AA4B 1M5DA 5H8SA 4NWDA 5H8FB 4F1VA 3TMGA 5FTHA 2DE2A 1M5FA 3ZKLA 3CIJA 3SERA 2GHAA 3V8XB 3FV1A 5CRYA 1B32A 4R75A 3G3IA 3E13X 4WXJA 3QXMA 1JETA 1KWHA 1UIUA 1MPDA 3MZ9A 4F22A 4NF6A 3N94A 4FATA 4R9FA 4HW8A 3B6WA 4BDRA 4ZECA 4MBPA 2ONRA 1MQHA 1SW5A 2RKMA 4FJPA 1FQAA 2V93A 3FJGA 2UYEA 1PB8A 2XX9A 2VOZA 1AOVA 2F36A 2DYXA 3N6UA 2G93A 4F39A 1N3WA 2I49A 1A55A 3HPIA 2I3VA 1B0LA 2V3QA 1FQDA 3K6UA 2UVGA 2Y84A 4G77A 3TCFA 4NF6B 3U92A 1R6ZA 2QS1A 3CR9A 3WAEA 4ECFA 5AA2A 1AMFA 5CBSA 1MQDA 4LZ5A 1NNTA 5JTYA 4P11A 5L9SA 3V89B 3ZKKA 5DEXB 4XKNA 5KDTA 2FA7A 3T9UA 3K02A 3PUZE 3IB2A 1PDAA 2KLFA 2P0SA 4MF3A 3VLWA 1QW0A 2PT1A 3FVKA 3VDFA 4GIZA 1D3KA 4U1OA 2CMOA 5K2XA 4F3BA 1PBQA 2RC7A 4OERA 1Z7ME 4I1DA 2IEEA 5JTYB 3U1OA 3TTRA 1FQBA 4FE8A 3QSLA 5KDTB 3AXFA 2AL4A 5FHMA 3GLBA 3IB0A 5CMKA 5TP9A 2Z23A 1QKBA 1YAEA 2O7UA 1BIYA 2DWHA 1OQHA 5I58A 3L6GA 1PC3A 4P0IA 3PU5A 2VHAA 2Q88A 4QHQA 2H5YA 1JVXA 3RTFB 5CM6A 4RNSA 4FEDA 5DVJA 4LA9A 4F19A 2FNCA 4R2BA 3TPAA 2QPQA 3RY3A 5TP9B 1XOCA 3PPQA 3D4GA 4HCWA 5I58B 1AL3A 1ZLQA 4GL0A 5IKBA 4YB5A 5I84A 5CBRA 1M5EA 1SDXA 3MQ9A 1EZOA 4I8CA 2O84X 5H8NB 1B3FA 4ELRA 2ZYOA 2H98A 4IO5A 4QSEA 3RT6B 2F6GA 4PQJA 3FIRA 1IXCA 1WDNA 3L6HA 1SW1A 2ESNA 4OFLA 1POTA 4G4PA 4KPTA 3Q29A 3KN8A 3QYTA 3C32A 1N7WA 5L9OA 4TLMB 2NVUB 1QUJA 1HSEA 2Q89A 2Y7IA 3RQTA 3CI8A 1B05A 3KSXA 1T0KA 4YMAA 3CSGA 4JWYA 1NH7A 2F7AA 4X9TA 2F7CA 3O2AA 5HPQA 3E3KA 2G29A 3C34A 1NNPA 5CMCA 2O68A 5DVFA 4KQPA 3FXUA 3UGWA 1UTBB 3C9HA 3MVYA 1RYOA 3TKDA 1LFGA 1B3EA 2HXWA 4OEUA 3T9HB 3PUWE 1LCFA 4O3AA 3TTNA 4N6PA 1LGBC 1XT8A 2DS9A 3MP8A 3C31A 5AE4A 4H0WA 4H8IA 4TLLB 1AIVA 3QK6A 3EF7A 3MC2A 1D4NA 1MY4A 2Y7WA 3TQLA 1S9TA 4JWXA 3K0VA 1ZMGA 3SKPA 1DMBA 2QL3A 1F9BA 3TYHA 2I4BA 4JSDA 2Y7PA 3VXCA 3OELA 3CFXA 4MLVA 3LR1A 4ELPA 2PT2A 1B9JA 3T9XB 3G3GA 1FW0A 3ZSFA 3KGCA 3VFJA 1AH5A 4TOZA 1PB9A 5ISUA 2F35A 4NE4A 4RY1A 3G3FA 1NH8A 4WEDA 2HZKA 1B40A 2QS3A 1I6BA 3G3JA 3WAFA 2GFEA 3C35A 2YPNA 3W9VA 4EF2A 1LLSA 2DE3A 2NXOA 3A3UA 3TEPA 4R2FA 4YKJA 3T22A 1OLCA 5M2VA 1QUKA 3H03A 2HEUA 2HQ0A 3MPKA 3VVDA 1Q1KA 2XXUA 3FJMA 3TAJA 4GQOA 1BTJA 3EQ1A 4GL8A 2DWAA 3KFMA 4G8NA 3MP6A 4RYAA 2OWSA 1ZJLA 2UVHA 2F8DA 5CMBA 4I9DA 3N6TA 3OEMA 1BKAA 1MH3A 4Q30B 3SEYA 4G2ZA 1NMUA 3IX1A 3LC8A 3EHUA 1POY1 2XXRA 2XXXA 1PBPA 2QJEA 4FECA 2UVJA 4QFOA 4X1DA 4G8MA 3ILUB 3H4ZA 3O29A 3IL1B 1ATGA 5CI5A 3SEWA 3HSTA 2XHDA 4FORA 2DXYA 4NF5A 4U22A 3MW0A 4ZE9A 1NNFA 4NF8A 1EZPA 1P1OA 1XC1A 4LZ7A 1B7ZA 2ZNSA 3PD8A 1IIWA 5EHSA 1N3XA 3H3GA 4KCCA 1EU8A 4KYSA 2X7QA 2OZZA 3OO8A 3FV2A 1Y4TA 2OBGA 3SEUA 2O6AA 2RCBA 1OLAA 1P1NA 4KR5A 4OYVA 4LZ8A 1A8EA 4NF5B 4YKIA 5EHMA 1LFHA 4NF8B 2GRVA 2LAOA 2YJPA 1I6AA 5I56A 3OMBA 2REGA 2AL5A 4ND9A 4JSOA 1A7LA 5IAIA 3RGYA 1ZIUA 1M5BA 2DWIA 3VV5A 3K1MA 3R7XA 3DP8A 1II5A 3Q26A 3TFLA 3UA8A 1JW1A 3IOVA 4AB5A 5TPAA 2NUVA 1LB9A 3U94A 5JK4A 1B4HA 5I56B 1XVXA 3HN0A 5AA2D 3HHGA 4IO2A 3PPPA 4RXLA 1GR2A 3PUYE 4YZZA 1DTGA 3D4CA 1QJMA 3RNNA 3CG1A 5I57A 2F97A 4RK9A 1IEJA 3FD3A 2VD3A 1NNKA 3UORA 4YU0A 3PGFA 2ZXTA 5TPAB 5I2NA 4M4GA 3CVGA 3IOWA 4X1BA 4YICA 1YPNA 2P2AA 2PBWA 1NFTA 3G7WA 4Q0CA 4OWDA 1EZ9A 1VFDA 4R6KA 3FZVA 3B6QA 4NEDA 1MM7A 1O7TA 1TFAA 1CE2A 3ODBA 3K6XA 5I2NB 3PUXE 2F78A 2I0CA 3G3KA 3U8QA 3I6VA 4IGRA 4Z7EA 5DTBA 2O7IA 4U21A 4M1VA 1OIBA 1LB8A 3O6HA 2HAVA 2D5WA 1IITA 4R6HA 5I59A 1B4ZA 1B1HA 3TTMA 5F7VA 1DPEA 4HTGA 3IO6A 2RF1A 3JZJA 2THIA 2YLNA 3DP4A 4R6YA 5AA2B 1B2HA 3RN8A 4RA1A 4ZEKA 1URSA 4PFWA 2QMWA 4KHZE 1EH3A 5EYFA 3IOTA 3K2DA 4ZEFA 3DELB 5I59B 1ZTYA 2E1SA 4E0WA 2XXTA 2VGQA 5HBCA 1USYH 2R71A 1Y1ZA 2X7PA 1URDA 3PV0E 3CSBA 1FTMA 4LQ2A 4YB6A 1ANFA 4OESA 3MVZA 2ALUA 4GXSB 4EDPA 2RC8A 4FEBA 3FGSA 4U1ZA 1B3GA 3T66A 2I58A 4EUOA 4R74A 4H5FA 4X48A 3QUJA 2B3FA 1R1NA 1VSOA 3O6GA 4JB7A 5ICQA 2ZMBA 1JNFA 1I6QA 1JEVA 4LONB 5K2YA 4QSCA 4GF8A 4C1TA 1BP5A 4OETA 2UXAA 1JEUA 4RJZA 4GFRA 3S2VA 2GHBA 5J1DA 2PYYA 2XD3A 2X26A 1D9VA 2XXHA 2H99A 2XXYA 1BLFA 4FAJA 3I5OA 4XIGQ 2E0SA 3FATA 4BDQA 1MXZA 4E0XA 3DP6A 1UQWA 5DVIA 3THIA 3QIMA 2RC9A 2DOJA 3IB1A 4JBZA 4GRKA 4HCYA 2I4CA 2HZLA 4C1UA 3MZBA 4PE5B 1SBPA 3ILTB 5ELVA 1RKMA 1B5IA 4QF9A 3PD9A 5BWJA 1A99A 4TQUQ 3KN3A 4ZS9A 1TWYA 4KFQA 1P99A 3TUSA 4F3SA 1MS7A 4RK2A 4BLAA 3FVNA 1ZKBA 1P1QA 3JV9A 3C33A 1MDQA 4PFUA 3HO7A 4WEPA 1LAXA 4OQOA 3O9PA 3TELA 4NF4A 4YMBA 3MPLA 3M3FA 4GOTA 1OMPA 5L8DA 1B5JA 3KSJA 4H6DA 3OD7A 1ELJA 4K3FA 4YB7A 2Q2CA 3S9LC 1SYIA 2O1MA 4KI0E 3TTLA 1UIVA 4U23A 2UVIA 4NF4B 4QFKA 4IO3A 3K1NA 4F1YA 4QFNA 4BDLA 2F34A 3K4UA 2QRYA 2R9JA 1IQ7A 2XXWA 1DSNA 3Q27A 1B3HA 4POXA 1H3DA 3IJOB 1SYHA 3BKIB 4XXUA 3RUMA 1SQYA 3LSFB 2CZLA 4ELOA 3SESA 1FTOA 5DT6A 3C4MA 3FXQA 1XVYA 4JDFA 1IZ1A 1Y3QA 3KJTA 2HCAA 3RLFE 5A5XA 4U2RA 2ANJA 1YCJA 5H8HA 3BBRA 2WKYA 3LSXA 4JWOA 4H5GA 4MLQA 4XKQA 2XXPA 4G68C 4DDDA 1Q35A 3LBSA 5FHNA 2NOOA 3OOAA 4GXAA 3IR1A 3B7DA 3MVWA 2DVCA 3V83A 5ITOA 5A5XB 1USYE 4PFYA 5CC2A 5H8HB 4UA8A 3VVEA 3HCQA 4THIA 1RYXA 2Z8EA 1J1NA 4R9GA 3MBPA 2PMSA 4DXCA 4BDNA 4R73A 1MXUA 2OCUA 3R6UA 3W15C 1P1WA 1DPPA 1US5A 3G3HA 2F5XA 1L5TA 2V3UA 4ESWA 5DYHA 4POWA 4RPNA 1PEBA 2I0BA 4Q8RA 3IOUA 2XXIA 4R72A 2PX1A 3OXNA 2GH9A 3KOTA 1OQGA 4MH5A 1Z7NE 2O51A 4H65A 2VP1A 1FTJA 1TFDA 3TODA 1MG1A 1R9LA 2XXQA 4BDMA 3UN6A 1R9QA 4KD5A 3SEVA 1GVCA 2F6PA 4ZEBA 4ZDMA 4LATA 1HSLA 1FQFA 3USDA 3LUYA 2OJTA 1H44A 4O3CA 3UP9A 3FJ7A 4I62A 1FTLA 2DP8A 1NL5A 1P1UA 1GV8A 1LSTA 2V25A 3LSWA 2AIXA 3FXRA 2Q8JA 4Z0IA 1SI1A 3B6TA 2DSFA 1ZU0A 3EPEA 1N7XA 1Y4CA 3QUFA 1H43A 3K1PA 1S7YA 3OO7A 5AA3A 1A40A 3CFLA 1HSJA 1MPBA 5B7DA 4XKPA 1QKAA 3FASA 4QFLA 4NWCA 1B3LA 3MAMA 2I3WA 1LBBA
chains in the Genus database with same CATH superfamily
3BFTA 3PUVE 4LUBA 2Z8FA 3E79A 4MAGA 3TZAA 4XTCQ 3K6VA 2I48A 2DQVA 2P3VA 4N91A 2F7BA 4QFPA 1MQIA 5I57B 3EKIA 1B51A 4DCYA 1M5CA 3S9MC 5CMMA 2QS2A 3H6WA 1B1XA 3M3KA 4C0RA 1WODA 3IJXB 4FIMA 4GWOA 3K01A 3I3VA 5DEXA 1Y20A 1CNQA 1N04A 3O66A 2Q9TA 1MXWA 4DE8A 1KA1A 1O64A 4OFOA 5LTCA 1A8FA 1PB7A 4DCXA 2Y7RA 1XHYA 3T9VA 4AQ4A 4OFJA 4ELQA 4YAHX 3U93A 2R8TA 3GZGA 4OZ9A 5A5LA 4GVOA 2CEXA 3JYRA 1FTKA 2O69A 4IO4A 4FBPA 1LAFE 2OK2A 3RT8A 4HS7A 3R26A 4N8GA 2OX3A 4IB2A 4MNPA 3OO9A 3UIFA 2ABHA 3T93B 4ZE8A 1MY0A 2H25A 4YKKA 1MY1A 2D21A 2ZNTA 1SW2A 1FCKA 4GWUA 3IFAA 4AB6A 1MXVA 1QGXA 3T0JA 4OEVA 1FQCA 4H67A 3H06B 1FBCA 4U4XA 3MYUA 4P8BA 2QSXA 3IORA 5H8QA 1DTZA 2A5TA 1VR5A 3QAXA 3FVGA 3Q28A 4EF1A 3N26A 4GLIA 4F29A 4O7IA 4F2OA 2Y5LA 4ZZEA 1QVSA 2FIEA 3VE1B 4DIGA 1S50A 3CRBA 2ZYMA 5IZZA 5HM4B 4N07A 5H8NA 3PMXA 5H8QB 2A5TB 1IXIA 1TXFA 4L17A 2XX8A 4XEQA 4QSDA 2R6GE 3C36A 3OENA 5FBPA 3EHSA 4DXBA 3VLUA 3E9XA 3PMWA 2PCRA 3GXAA 1FTAA 3PPRA 1NV5A 3M3LA 5I2KA 3ECRA 1VDWA 5L9MA 4MFIA 4ZEIA 4LVQA 1GTKA 4HE1A 4G68A 1JQFA 4EXKA 4F3PA 3U72A 1NV4A 2VT5A 1MY3A 3K00A 3LSLA 1WVJA 3TQWA 3T1BA 3KJ7A 4EQ7A 1FQEA 2FHYA 3F11A 2V4CA 4H1XA 4ZZAA 4X8RA 3ONMA 5ITPA 1MQJA 2AYSA 3VLVA 2BJJX 4LN5A 1D9YA 5I2KB 4LQ5A 1QULA 4OMBA 1UTBA 4G68B 4OTEA 4PP0A 3OSRA 4GD5A 4OVJA 3TCHA 2XXVA 4WKMA 4OANA 3PPNA 4OXVA 3DLNA 3KZGA 3O97A 4Q5TA 1QUIA 1JW5A 2UYFA 1GGGA 1UTHA 2B3BA 1I69A 2KR0A 1TT1A 3HV1A 2VPNA 3BIGA 3KOSA 2KQZA 4MNCA 1FRPA 2P1SA 1MXXA 1ZBMA 2RINA 5BUUA 2DXRA 2ONSA 1SVXB 3KBRA 1N76A 4QBAA 3BFUA 3SDFA 1MM6A 2QS4A 3OO6A 4N13A 3S9EA 1Y3PA 3FUZA 4ZEDA 1Y1MA 2I6EA 3MUQA 4NN3A 2FYIA 3IK6B 3RTWB 1UTHB 3GBBA 2DE4A 2H4IA 5LDZA 1IMFA 3EN3A 3PMVA 3UK4A 4ESXA 5I5PA 5KCJA 3RYDA 4MHFA 4NTLA 2ZYKA 4NMYA 4U4SA 5ICTA 2M8CA 3CG3A 1LAHE 3MZ1A 4KYEA 3KG2A 3MSTA 1RDYA 4IY5A 2ZZWA 2F3DA 3FVOA 4PF6A 1O63A 4AS4A 3MVXA 3OSQA 1LFIA 1B5HA 3CFZA 3W9WA 4KYDA 2Z8DA 1Y3NA 3M8UA 4PETA 4N6KA 2H9BA 1OVBA 5KCJB 1URGA 1B0HA 3ROJA 3SEXA 4EQ9A 5ET5A 4IO7A 5EYHA 5JEIA 3O6IA 2XA5A 5AA1A 1H76A 4QRZA 1MPCA 1YXIA 3VVFA 1VFEA 1IUDA 3H6VA 1FPFA 4F18A 1Y9UA 5I3SA 3T96B 2WBDA 1NUXA 4UACA 3P7IA 1EYIA 3A09A 4PCDA 2Y7KA 3TDJA 1B6HA 4ISUA 1IXHA 2Q2AA 2Q74A 2IA4A 1SW4A 5EQ9A 2V3TA 4F1UA 4IO6A 3HHFA 2XX7A 1FJ9A 2DVZA 2ZYNA 2XD2A 1XS5A 1JVYA 3O28A 2PVUA 3GBAA 3S4UA 2QFLA 3EHTA 3PPOA 4H46A 1LBCA 1MDP1 3MP1A 4KCDA 1B46A 1OVTA 4PC9A 4BDOA 4OENA 3TTKA 4EXLA 1H45A 4GBWA 4ONYA 2B65A 4UABA 3KEIA 4PAFA 3V5AA 1B52A 4JVCA 4G8HA 2O1LA 1YTVA 4PFTA 3N5LA 3H7MA 1B7UA 2DWJA 2BJIA 4PGNA 1IMEA 1IXGA 3TCGA 4OHNA 3RPWA 4N17A 5FTIA 4DI3D 3LV0A 4JXIA 1MRPA 4IY6A 3IAZA 3SETA 2L5VA 3E4RA 4F3GA 3VXBA 4DZ1A 1MXYA 4LP2B 3KN7A 4NX1A 4EQBA 5KZTA 1US4A 3A3CA 1SI0A 4I3EA 1MQGA 4RPOA 2HFBA 3K6WA 1LBWA 5F1QA 5TU0A 4GWYA 4DXUA 3MWBA 3FBPA 2REJA 3B50A 1DOTA 1JW4A 1MH4A 5ET6A 1LAGE 3H6TA 2B4LA 3DM0A 2ONKE 2ZNUA 1SD3A 2PFZA 4H8JA 3ZS6A 4DLDA 1B7HA 4P0GA 3MJNA 2NWJA 5AA4A 1LCTA 1N84A 4IGTA 1CB6A 5H8FA 3OEKA 2OLBA 4XKRA 2OWTA 2RCAA 4G61A 4YKPA 5B70A 3Q25A 2Z22A 1FPEA 2A5SA 4JVDA 1LBYA 1N0TA 3H6UA 4O3BA 2D3IA 5LOMA 1A54A 4PF8A 3S9NC 4F2QA 3IO4A 2VD2A 4F31B 2V84A 2W7YA 1VE4A 1MY2A 1B58A 5FHOA 2QMXA 1NKXA 2HAUA 4PFRA 5AA4B 1M5DA 5H8SA 4NWDA 1LBXA 5H8FB 4F1VA 3TMGA 5FTHA 2DE2A 4PTKA 1M5FA 1FBDA 3ZKLA 3CIJA 4N4UA 2GHAA 3SERA 3FV1A 3V8XB 1EYJA 5CRYA 1B32A 4R75A 3G3IA 3QMFA 3E13X 4WXJA 3QXMA 1JETA 1KWHA 1UIUA 1NV6A 1MPDA 3MZ9A 1K9ZA 1LBVA 4P1EA 4NGUA 4F22A 4NF6A 3N94A 4FATA 4R9FA 4HW8A 3B6WA 4BDRA 4ZECA 3IFCA 4MBPA 2ONRA 1MQHA 1SW5A 2RKMA 4FJPA 5IZ3A 1FQAA 2V93A 3FJGA 2UYEA 1PB8A 2XX9A 2VOZA 1AOVA 2F36A 2DYXA 3N6UA 2G93A 4F39A 1N3WA 2I49A 1A55A 3HPIA 2WYPA 2B4MA 2HHMA 2I3VA 1B0LA 2V3QA 1FQDA 3K6UA 2UVGA 2Y84A 4G77A 2QVUA 2HXRA 3TCFA 4NF6B 3U92A 1R6ZA 2QS1A 3CR9A 3WAEA 4ECFA 5AA2A 5ET8A 1AMFA 3ISPA 5CBSA 1MQDA 4LZ5A 5IZ3B 1NNTA 1FPIA 5JTYA 4P11A 5L9SA 3V89B 3ZKKA 4NHBA 5DEXB 2XWOA 4XKNA 5KDTA 2FA7A 1YZ0A 2CZHA 1EYKA 3T9UA 3K02A 3PUZE 3IB2A 1PDAA 2KLFA 2P0SA 4MF3A 3VLWA 1QW0A 2PT1A 3FVKA 3VDFA 4GIZA 1D3KA 4U1OA 2CMOA 5K2XA 4F3BA 1PBQA 2RC7A 4OERA 1Z7ME 4I1DA 2IEEA 2CZIA 5JTYB 3U1OA 3TTRA 4P3LA 1FQBA 4FE8A 3QSLA 4GBVA 3AXFA 5KDTB 4OVTA 2AL4A 5FHMA 3GLBA 3IB0A 5CMKA 5TP9A 2Z23A 1QKBA 1YAEA 2O7UA 1BIYA 1YYZA 2DWHA 1OQHA 5I58A 3L6GA 1PC3A 4P0IA 2PFYA 3PU5A 2VHAA 1FJ6A 2Q88A 4QHQA 2H5YA 1JVXA 3RTFB 5CM6A 4RNSA 4FEDA 5DVJA 1G0IA 2ZZVA 4LA9A 4F19A 4P1LA 2FNCA 1FSAA 4R2BA 4NQ8A 3TPAA 2QPQA 4JVIA 3RY3A 5TP9B 1XOCA 3PPQA 3D4GA 4HCWA 2XWIA 5I58B 1AL3A 1ZLQA 4X04A 4GL0A 5IKBA 1NV2A 4YB5A 5I84A 5CBRA 1M5EA 1SDXA 3MQ9A 1EZOA 4I8CA 2O84X 5H8NB 1B3FA 4ELRA 2ZYOA 2H98A 1KZ8A 4IO5A 4QSEA 1NV0A 5ESYA 1FPLA 2Y5KA 3RT6B 2F6GA 4PQJA 3FIRA 1IXCA 1WDNA 3L6HA 1Q9DA 1SW1A 2ESNA 4OFLA 1POTA 4PBHA 4G4PA 4KPTA 3Q29A 3KN8A 3QYTA 3C32A 1N7WA 5L9OA 4TLMB 2NVUB 4PFIA 1QUJA 1HSEA 4AS5A 2Q89A 2OWZA 2Y7IA 3RQTA 3CI8A 4NF0A 1B05A 3KSXA 1T0KA 4YMAA 3CSGA 4JWYA 1NH7A 2F7AA 4X9TA 2F7CA 3O2AA 5HPQA 4IR8A 3E3KA 2G29A 3C34A 1NNPA 5CMCA 2O68A 5DVFA 4KQPA 3FXUA 4MIJA 3UGWA 1UTBB 3C9HA 3MVYA 1RYOA 3TKDA 1FPBA 1LFGA 1B3EA 2HXWA 4GX3A 4OEUA 3T9HB 3PUWE 1LCFA 4O3AA 3TTNA 4N6PA 1LGBC 1XT8A 4DI4B 2DS9A 3MP8A 3C31A 5AE4A 4H0WA 4H8IA 4TLLB 1AIVA 3QK6A 3EF7A 3MC2A 1D4NA 1MY4A 2Y7WA 3TQLA 1S9TA 4JWXA 3K0VA 1ZMGA 4PAKA 3SKPA 1DMBA 2QL3A 5EQ7A 1F9BA 3TYHA 2I4BA 4JSDA 2Y7PA 3VXCA 1NI9A 3OELA 1FBEA 3CFXA 4MLVA 3LR1A 1INPA 4ELPA 2PT2A 1B9JA 3T9XB 3G3GA 1FW0A 3ZSFA 3KGCA 3VFJA 1AH5A 4TOZA 1BK4A 1PB9A 5ISUA 2F35A 4NG7A 4NE4A 4RY1A 3G3FA 1NH8A 4WEDA 2HZKA 1B40A 1NUWA 2QS3A 1I6BA 4QXDA 3G3JA 3WAFA 5IM2A 2GFEA 3C35A 2YPNA 3W9VA 4EF2A 1LLSA 2DE3A 3KC1A 2NXOA 3A3UA 4XFEA 3TEPA 4R2FA 4YKJA 3T22A 1OLCA 5IZ1A 4PE3A 5M2VA 4I40A 1QUKA 3H03A 2HEUA 2HQ0A 4NAPA 3MPKA 3LUZA 5EQ8A 3VVDA 1Q1KA 2XXUA 3FJMA 4PGPA 3TAJA 4GQOA 1BTJA 3EQ1A 4GL8A 1NV3A 2DWAA 3KFMA 4G8NA 3MP6A 4RYAA 2OWSA 4MNIA 1ZJLA 4P47A 2UVHA 4OVRA 2F8DA 5CMBA 4I9DA 3N6TA 3OEMA 1BKAA 1MH3A 4Q30B 3SEYA 4GX4A 3B8BA 4G2ZA 1NMUA 3IX1A 3LC8A 3EHUA 1POY1 2XXRA 2XXXA 1PBPA 1LBZA 2QJEA 3GYYA 4FECA 2UVJA 4QFOA 4X1DA 4G8MA 3ILUB 3H4ZA 4OVSA 3O29A 3IL1B 1ATGA 5CI5A 3SEWA 3HSTA 5J16A 2XHDA 4HE0A 4FORA 2DXYA 4NF5A 4GWWA 4U22A 3MW0A 4ZE9A 1NNFA 4NF8A 1EZPA 4GWSA 1P1OA 1XC1A 4LZ7A 3KBZA 1B7ZA 2DDKA 1DCUA 2ZNSA 3PD8A 2WX9A 3RPLA 1IIWA 5EHSA 1N3XA 3H3GA 4KCCA 1EU8A 4KYSA 2X7QA 2OZZA 3OO8A 3FV2A 1FPGA 1Y4TA 5EQAA 2OBGA 3SEUA 4OA4A 2O6AA 2RCBA 2CEYA 1OLAA 1P1NA 4KR5A 4OYVA 4LZ8A 1A8EA 4NF5B 4YKIA 5EHMA 1LFHA 4NF8B 2GRVA 2LAOA 2VPOA 2YJPA 1JP4A 1I6AA 5I56A 2F3BA 3RPLB 3OMBA 2REGA 2AL5A 4ND9A 4JSOA 1A7LA 5IAIA 3RGYA 1ZIUA 1M5BA 2DWIA 3VV5A 2WYKA 3K1MA 3R7XA 5EYGA 3DP8A 1II5A 3Q26A 3TFLA 4MMPA 3UA8A 1JW1A 3IOVA 4AB5A 5TPAA 2NUVA 4N81A 1LB9A 4O7MA 3SZPA 3U94A 5JK4A 1B4HA 2FIXA 5I56B 1XVXA 3HN0A 5AA2D 3HHGA 4IO2A 3PPPA 4RXLA 2FBPA 1GR2A 3PUYE 4YZZA 1DTGA 4PDDA 5T3JA 3D4CA 1QJMA 3RNNA 3CG1A 5I57A 2F97A 1IMCA 4RK9A 1IEJA 3FD3A 2VD3A 1NNKA 3UORA 4YU0A 1SPIA 3PGFA 2ZXTA 5TPAB 5I2NA 4M4GA 3CVGA 3IOWA 4X1BA 4YICA 1YPNA 2P2AA 2PBWA 1K9YA 1NFTA 3G7WA 4Q0CA 4OWDA 1EZ9A 1VFDA 4R6KA 3FZVA 1IMBA 3B6QA 1FBPA 4O8MA 4NEDA 1MM7A 1O7TA 1TFAA 1CE2A 3ODBA 3K6XA 4XF5A 5I2NB 2MKZA 3PUXE 2F78A 2I0CA 3G3KA 3U8QA 3I6VA 3U65A 4IGRA 2XXKA 4HXVA 4Z7EA 5DTBA 2O7IA 4U21A 4M1VA 1OIBA 1LB8A 3O6HA 2HAVA 2D5WA 1IITA 4R6HA 5I59A 1B4ZA 1B1HA 3TTMA 1FBFA 5F7VA 1DPEA 4HTGA 3IO6A 2RF1A 3JZJA 2THIA 2YLNA 3DP4A 4R6YA 5AA2B 1B2HA 3RN8A 2WEFA 4RA1A 4ZEKA 1URSA 4PAIA 4MEVA 4PFWA 2QMWA 4KHZE 1EH3A 5EYFA 3IOTA 3K2DA 4ZEFA 3DELB 5I59B 1ZTYA 2E1SA 4E0WA 2XXTA 2VGQA 5HBCA 1USYH 2R71A 1Y1ZA 2X7PA 1URDA 3PV0E 3CSBA 1FTMA 4I3YA 1KA0A 4LQ2A 1XI6A 4YB6A 1ANFA 1FPDA 4OESA 3A29A 3MVZA 3HFUA 2ALUA 4GXSB 4PBQA 4EDPA 2RC8A 2XWKA 4FEBA 3FGSA 4U1ZA 1B3GA 3T66A 2I58A 5F24A 4EUOA 4R74A 4H5FA 4X48A 3QUJA 2B3FA 1R1NA 1VSOA 3O6GA 4KXPA 4JB7A 1IMDA 5ICQA 2ZMBA 1JNFA 1I6QA 1JEVA 4LONB 5K2YA 4QSCA 1G0HA 4GF8A 4C1TA 1BP5A 4OETA 1NUYA 2UXAA 1JEUA 4PDHA 4RJZA 4GFRA 3S2VA 2GHBA 5J1DA 2PYYA 2XD3A 2X26A 1D9VA 2XXHA 2H99A 2XXYA 1AWBA 1BLFA 4FAJA 3I5OA 4XIGQ 2E0SA 3FATA 4BDQA 1MXZA 4E0XA 3DP6A 1UQWA 5DVIA 2GQ1A 3THIA 4P9KA 3QIMA 2RC9A 2WBBA 2DOJA 3IB1A 4JBZA 1FBHA 4GRKA 4HCYA 2I4CA 2HZLA 4C1UA 3MZBA 4PE5B 4OVQA 1SBPA 3ILTB 4N8YA 1FPJA 5ELVA 4P56A 5I7IA 1RKMA 4MJOA 1B5IA 4QF9A 3PD9A 5BWJA 1A99A 2ZZXA 4TQUQ 2QVRA 3KN3A 1TWYA 4ZS9A 4KFQA 1P99A 1RDZA 3KC0A 3TUSA 4F3SA 1MS7A 4RK2A 4BLAA 4GX6A 3FVNA 1ZKBA 1P1QA 2JJKA 3JV9A 3C33A 1MDQA 4PFUA 3HO7A 4WEPA 1LAXA 4GWXA 4OQOA 3O9PA 3TELA 4NF4A 3CHGA 1DK4A 4YMBA 3MPLA 3M3FA 4GOTA 2QVVA 1OMPA 5L8DA 4GWZA 1B5JA 4MCOA 3KSJA 4H6DA 1NV7A 3OD7A 1ELJA 4K3FA 4YB7A 2Q2CA 3S9LC 1SYIA 2O1MA 4KI0E 3TTLA 2Q8MA 1UIVA 4U23A 2UVIA 4NF4B 4QFKA 4IO3A 3K1NA 4F1YA 3PTYA 4QFNA 4BDLA 2F34A 3K4UA 2XWVA 2QRYA 2R9JA 1IQ7A 2XXWA 1DSNA 3Q27A 1B3HA 4POXA 1H3DA 3IJOB 1SYHA 3BKIB 4XXUA 3RUMA 1SQYA 3LSFB 2CZLA 4ELOA 3SESA 4N15A 1FTOA 5DT6A 3C4MA 3FXQA 1XVYA 4JDFA 1IZ1A 1Y3QA 3KJTA 2HCAA 3RLFE 5A5XA 4U2RA 2ANJA 1YCJA 5H8HA 3BBRA 2WKYA 3D1RA 3LSXA 4JWOA 4H5GA 4MLQA 4XKQA 2XXPA 4G68C 4DDDA 1Q35A 3LBSA 5FHNA 2NOOA 3OOAA 4GXAA 3IR1A 3B7DA 3MVWA 2DVCA 3V83A 5ITOA 5A5XB 1USYE 4PFYA 5CC2A 5H8HB 4UA8A 3VVEA 2P3NA 3HCQA 3E78A 4THIA 1RYXA 2Z8EA 1J1NA 1FBGA 4R9GA 3MBPA 2PMSA 4DXCA 4BDNA 4R73A 1MXUA 2OCUA 3R6UA 3W15C 1P1WA 1DPPA 1US5A 3G3HA 2F5XA 1IMAA 1L5TA 2V3UA 4ESWA 5DYHA 1FPKA 4POWA 5ET7A 4RPNA 1PEBA 3FXBA 2I0BA 3BIHA 4Q8RA 4HE2A 3IOUA 2XXIA 4R72A 2PX1A 3OXNA 2GH9A 4OVPA 3KOTA 1OQGA 4MX6A 2CZKA 4MH5A 3NOHA 1Z7NE 2O51A 4O94A 4H65A 2VP1A 1FTJA 1TFDA 3TODA 1MG1A 1R9LA 2XXQA 3UN6A 4BDMA 1R9QA 4KD5A 3SEVA 1GVCA 2F6PA 4ZEBA 5IGAA 4ZDMA 4LATA 1HSLA 1FQFA 3USDA 3LUYA 2OJTA 4H45A 1H44A 4O3CA 3UP9A 3FJ7A 4I62A 1D9QA 1FTLA 2DP8A 4PFBA 1NL5A 1P1UA 1GV8A 2HPGA 5DW8A 1LSTA 2V25A 3LSWA 2AIXA 3FXRA 2Q8JA 4Z0IA 1SI1A 3B6TA 2DSFA 1ZU0A 1RDXA 1NV1A 3EPEA 4N6DA 1N7XA 1Y4CA 3QUFA 1DBZA 1H43A 3K1PA 1S7YA 3OO7A 5AA3A 1A40A 3CFLA 1HSJA 1MPBA 5B7DA 4XKPA 1NUZA 1QKAA 1LEVA 3FASA 4QFLA 4NWCA 1B3LA 3MAMA 2FVZA 2I3WA 1LBBA
chains in the Genus database with same CATH topology
3BFTA 3PUVE 4LUBA 2Z8FA 3TZAA 4XTCQ 3K6VA 2I48A 2DQVA 2F7BA 4QFPA 1MQIA 5I57B 1B51A 4DCYA 1M5CA 3S9MC 5CMMA 2QS2A 3H6WA 1B1XA 3M3KA 4C0RA 1WODA 3IJXB 4FIMA 4GWOA 3K01A 3I3VA 5DEXA 1Y20A 1N04A 3O66A 2Q9TA 1MXWA 4DE8A 1O64A 4OFOA 1A8FA 1PB7A 4DCXA 2Y7RA 1XHYA 3T9VA 4AQ4A 4OFJA 4ELQA 4YAHX 3U93A 3GZGA 4OZ9A 4GVOA 3JYRA 1FTKA 2O69A 4IO4A 1LAFE 2OK2A 3RT8A 4HS7A 3R26A 4IB2A 3OO9A 3UIFA 2ABHA 3T93B 4ZE8A 1MY0A 2H25A 4YKKA 1MY1A 2D21A 2ZNTA 1SW2A 1FCKA 4AB6A 1MXVA 4OEVA 1FQCA 4H67A 3H06B 4U4XA 2QSXA 3IORA 5H8QA 1DTZA 2A5TA 1VR5A 3QAXA 3FVGA 3Q28A 4EF1A 3N26A 4GLIA 4F29A 4F2OA 4ZZEA 1QVSA 3VE1B 4DIGA 1S50A 3CRBA 2ZYMA 5HM4B 4N07A 5H8NA 3PMXA 5H8QB 2A5TB 1IXIA 1TXFA 4L17A 2XX8A 4QSDA 2R6GE 3C36A 3OENA 3EHSA 4DXBA 3VLUA 3E9XA 3PMWA 3GXAA 3PPRA 3M3LA 5I2KA 3ECRA 5L9MA 4MFIA 4ZEIA 4LVQA 1GTKA 4G68A 1JQFA 4EXKA 4F3PA 3U72A 1MY3A 3K00A 3LSLA 1WVJA 3TQWA 3KJ7A 4EQ7A 1FQEA 3F11A 4H1XA 4ZZAA 3ONMA 5ITPA 1MQJA 2AYSA 3VLVA 2BJJX 1D9YA 5I2KB 4LQ5A 1QULA 4OMBA 1UTBA 4G68B 4OTEA 4PP0A 3OSRA 4GD5A 4OVJA 3TCHA 2XXVA 4WKMA 3PPNA 4OXVA 3DLNA 3KZGA 3O97A 4Q5TA 1QUIA 1JW5A 2UYFA 1GGGA 1UTHA 2B3BA 1I69A 1TT1A 3HV1A 3KOSA 2P1SA 1MXXA 1ZBMA 2RINA 5BUUA 2DXRA 2ONSA 1SVXB 3KBRA 1N76A 3BFUA 3SDFA 1MM6A 2QS4A 3OO6A 4N13A 3S9EA 1Y3PA 4ZEDA 3FUZA 1Y1MA 2I6EA 3MUQA 2FYIA 3IK6B 3RTWB 1UTHB 3GBBA 2DE4A 2H4IA 3EN3A 3PMVA 3UK4A 4ESXA 5KCJA 4NTLA 2ZYKA 4NMYA 4U4SA 5ICTA 2M8CA 3CG3A 1LAHE 3MZ1A 4KYEA 3KG2A 4IY5A 3FVOA 1O63A 3MVXA 3OSQA 1LFIA 1B5HA 3CFZA 3W9WA 4KYDA 2Z8DA 1Y3NA 3M8UA 4PETA 2H9BA 1OVBA 5KCJB 1URGA 1B0HA 3SEXA 4EQ9A 4IO7A 5JEIA 3O6IA 5AA1A 1H76A 4QRZA 1MPCA 3VVFA 1VFEA 1IUDA 3H6VA 4F18A 1Y9UA 3T96B 4UACA 3P7IA 3A09A 2Y7KA 3TDJA 1B6HA 4ISUA 1IXHA 2Q2AA 2IA4A 1SW4A 2V3TA 4F1UA 4IO6A 3HHFA 2XX7A 2DVZA 2ZYNA 2XD2A 1XS5A 1JVYA 3O28A 2PVUA 3GBAA 3S4UA 3EHTA 3PPOA 1LBCA 1MDP1 3MP1A 4KCDA 1B46A 1OVTA 4BDOA 4OENA 3TTKA 4EXLA 1H45A 4ONYA 2B65A 3KEIA 3V5AA 1B52A 4G8HA 2O1LA 1YTVA 4PFTA 3N5LA 3H7MA 1B7UA 2DWJA 1IXGA 3TCGA 4OHNA 3RPWA 5FTIA 4JXIA 1MRPA 4IY6A 3IAZA 3SETA 3E4RA 4F3GA 3VXBA 4DZ1A 1MXYA 4LP2B 3KN7A 4EQBA 5KZTA 1US4A 3A3CA 1SI0A 1MQGA 4RPOA 2HFBA 3K6WA 5F1QA 5TU0A 4DXUA 3MWBA 2REJA 1DOTA 1JW4A 1MH4A 1LAGE 3H6TA 3DM0A 2ONKE 2ZNUA 1SD3A 4DLDA 4H8JA 3ZS6A 1B7HA 4P0GA 3MJNA 2NWJA 5AA4A 1LCTA 1N84A 4IGTA 1CB6A 5H8FA 3OEKA 2OLBA 4XKRA 2OWTA 2RCAA 4YKPA 5B70A 3Q25A 2Z22A 2A5SA 1N0TA 3H6UA 4O3BA 2D3IA 5LOMA 1A54A 3S9NC 4F2QA 3IO4A 2VD2A 4F31B 2V84A 2W7YA 1VE4A 1MY2A 1B58A 5FHOA 2QMXA 1NKXA 2HAUA 5AA4B 1M5DA 5H8SA 4NWDA 5H8FB 4F1VA 3TMGA 5FTHA 2DE2A 1M5FA 3ZKLA 3CIJA 3SERA 2GHAA 3V8XB 3FV1A 5CRYA 1B32A 4R75A 3G3IA 3E13X 4WXJA 3QXMA 1JETA 1KWHA 1UIUA 1MPDA 3MZ9A 4F22A 4NF6A 3N94A 4FATA 4R9FA 4HW8A 3B6WA 4BDRA 4ZECA 4MBPA 2ONRA 1MQHA 1SW5A 2RKMA 4FJPA 1FQAA 2V93A 3FJGA 2UYEA 1PB8A 2XX9A 2VOZA 1AOVA 2F36A 2DYXA 3N6UA 2G93A 4F39A 1N3WA 2I49A 1A55A 3HPIA 2I3VA 1B0LA 2V3QA 1FQDA 3K6UA 2UVGA 2Y84A 4G77A 3TCFA 4NF6B 3U92A 1R6ZA 2QS1A 3CR9A 3WAEA 4ECFA 5AA2A 1AMFA 5CBSA 1MQDA 4LZ5A 1NNTA 5JTYA 4P11A 5L9SA 3V89B 3ZKKA 5DEXB 4XKNA 5KDTA 2FA7A 3T9UA 3K02A 3PUZE 3IB2A 1PDAA 2KLFA 2P0SA 4MF3A 3VLWA 1QW0A 2PT1A 3FVKA 3VDFA 4GIZA 1D3KA 4U1OA 2CMOA 5K2XA 4F3BA 1PBQA 2RC7A 4OERA 1Z7ME 4I1DA 2IEEA 5JTYB 3U1OA 3TTRA 1FQBA 4FE8A 3QSLA 5KDTB 3AXFA 2AL4A 5FHMA 3GLBA 3IB0A 5CMKA 5TP9A 2Z23A 1QKBA 1YAEA 2O7UA 1BIYA 2DWHA 1OQHA 5I58A 3L6GA 1PC3A 4P0IA 3PU5A 2VHAA 2Q88A 4QHQA 2H5YA 1JVXA 3RTFB 5CM6A 4RNSA 4FEDA 5DVJA 4LA9A 4F19A 2FNCA 4R2BA 3TPAA 2QPQA 3RY3A 5TP9B 1XOCA 3PPQA 3D4GA 4HCWA 5I58B 1AL3A 1ZLQA 4GL0A 5IKBA 4YB5A 5I84A 5CBRA 1M5EA 1SDXA 3MQ9A 1EZOA 4I8CA 2O84X 5H8NB 1B3FA 4ELRA 2ZYOA 2H98A 4IO5A 4QSEA 3RT6B 2F6GA 4PQJA 3FIRA 1IXCA 1WDNA 3L6HA 1SW1A 2ESNA 4OFLA 1POTA 4G4PA 4KPTA 3Q29A 3KN8A 3QYTA 3C32A 1N7WA 5L9OA 4TLMB 2NVUB 1QUJA 1HSEA 2Q89A 2Y7IA 3RQTA 3CI8A 1B05A 3KSXA 1T0KA 4YMAA 3CSGA 4JWYA 1NH7A 2F7AA 4X9TA 2F7CA 3O2AA 5HPQA 3E3KA 2G29A 3C34A 1NNPA 5CMCA 2O68A 5DVFA 4KQPA 3FXUA 3UGWA 1UTBB 3C9HA 3MVYA 1RYOA 3TKDA 1LFGA 1B3EA 2HXWA 4OEUA 3T9HB 3PUWE 1LCFA 4O3AA 3TTNA 4N6PA 1LGBC 1XT8A 2DS9A 3MP8A 3C31A 5AE4A 4H0WA 4H8IA 4TLLB 1AIVA 3QK6A 3EF7A 3MC2A 1D4NA 1MY4A 2Y7WA 3TQLA 1S9TA 4JWXA 3K0VA 1ZMGA 3SKPA 1DMBA 2QL3A 1F9BA 3TYHA 2I4BA 4JSDA 2Y7PA 3VXCA 3OELA 3CFXA 4MLVA 3LR1A 4ELPA 2PT2A 1B9JA 3T9XB 3G3GA 1FW0A 3ZSFA 3KGCA 3VFJA 1AH5A 4TOZA 1PB9A 5ISUA 2F35A 4NE4A 4RY1A 3G3FA 1NH8A 4WEDA 2HZKA 1B40A 2QS3A 1I6BA 3G3JA 3WAFA 2GFEA 3C35A 2YPNA 3W9VA 4EF2A 1LLSA 2DE3A 2NXOA 3A3UA 3TEPA 4R2FA 4YKJA 3T22A 1OLCA 5M2VA 1QUKA 3H03A 2HEUA 2HQ0A 3MPKA 3VVDA 1Q1KA 2XXUA 3FJMA 3TAJA 4GQOA 1BTJA 3EQ1A 4GL8A 2DWAA 3KFMA 4G8NA 3MP6A 4RYAA 2OWSA 1ZJLA 2UVHA 2F8DA 5CMBA 4I9DA 3N6TA 3OEMA 1BKAA 1MH3A 4Q30B 3SEYA 4G2ZA 1NMUA 3IX1A 3LC8A 3EHUA 1POY1 2XXRA 2XXXA 1PBPA 2QJEA 4FECA 2UVJA 4QFOA 4X1DA 4G8MA 3ILUB 3H4ZA 3O29A 3IL1B 1ATGA 5CI5A 3SEWA 3HSTA 2XHDA 4FORA 2DXYA 4NF5A 4U22A 3MW0A 4ZE9A 1NNFA 4NF8A 1EZPA 1P1OA 1XC1A 4LZ7A 1B7ZA 2ZNSA 3PD8A 1IIWA 5EHSA 1N3XA 3H3GA 4KCCA 1EU8A 4KYSA 2X7QA 2OZZA 3OO8A 3FV2A 1Y4TA 2OBGA 3SEUA 2O6AA 2RCBA 1OLAA 1P1NA 4KR5A 4OYVA 4LZ8A 1A8EA 4NF5B 4YKIA 5EHMA 1LFHA 4NF8B 2GRVA 2LAOA 2YJPA 1I6AA 5I56A 3OMBA 2REGA 2AL5A 4ND9A 4JSOA 1A7LA 5IAIA 3RGYA 1ZIUA 1M5BA 2DWIA 3VV5A 3K1MA 3R7XA 3DP8A 1II5A 3Q26A 3TFLA 3UA8A 1JW1A 3IOVA 4AB5A 5TPAA 2NUVA 1LB9A 3U94A 5JK4A 1B4HA 5I56B 1XVXA 3HN0A 5AA2D 3HHGA 4IO2A 3PPPA 4RXLA 1GR2A 3PUYE 4YZZA 1DTGA 3D4CA 1QJMA 3RNNA 3CG1A 5I57A 2F97A 4RK9A 1IEJA 3FD3A 2VD3A 1NNKA 3UORA 4YU0A 3PGFA 2ZXTA 5TPAB 5I2NA 4M4GA 3CVGA 3IOWA 4X1BA 4YICA 1YPNA 2P2AA 2PBWA 1NFTA 3G7WA 4Q0CA 4OWDA 1EZ9A 1VFDA 4R6KA 3FZVA 3B6QA 4NEDA 1MM7A 1O7TA 1TFAA 1CE2A 3ODBA 3K6XA 5I2NB 3PUXE 2F78A 2I0CA 3G3KA 3U8QA 3I6VA 4IGRA 4Z7EA 5DTBA 2O7IA 4U21A 4M1VA 1OIBA 1LB8A 3O6HA 2HAVA 2D5WA 1IITA 4R6HA 5I59A 1B4ZA 1B1HA 3TTMA 5F7VA 1DPEA 4HTGA 3IO6A 2RF1A 3JZJA 2THIA 2YLNA 3DP4A 4R6YA 5AA2B 1B2HA 3RN8A 4RA1A 4ZEKA 1URSA 4PFWA 2QMWA 4KHZE 1EH3A 5EYFA 3IOTA 3K2DA 4ZEFA 3DELB 5I59B 1ZTYA 2E1SA 4E0WA 2XXTA 2VGQA 5HBCA 1USYH 2R71A 1Y1ZA 2X7PA 1URDA 3PV0E 3CSBA 1FTMA 4LQ2A 4YB6A 1ANFA 4OESA 3MVZA 2ALUA 4GXSB 4EDPA 2RC8A 4FEBA 3FGSA 4U1ZA 1B3GA 3T66A 2I58A 4EUOA 4R74A 4H5FA 4X48A 3QUJA 2B3FA 1R1NA 1VSOA 3O6GA 4JB7A 5ICQA 2ZMBA 1JNFA 1I6QA 1JEVA 4LONB 5K2YA 4QSCA 4GF8A 4C1TA 1BP5A 4OETA 2UXAA 1JEUA 4RJZA 4GFRA 3S2VA 2GHBA 5J1DA 2PYYA 2XD3A 2X26A 1D9VA 2XXHA 2H99A 2XXYA 1BLFA 4FAJA 3I5OA 4XIGQ 2E0SA 3FATA 4BDQA 1MXZA 4E0XA 3DP6A 1UQWA 5DVIA 3THIA 3QIMA 2RC9A 2DOJA 3IB1A 4JBZA 4GRKA 4HCYA 2I4CA 2HZLA 4C1UA 3MZBA 4PE5B 1SBPA 3ILTB 5ELVA 1RKMA 1B5IA 4QF9A 3PD9A 5BWJA 1A99A 4TQUQ 3KN3A 4ZS9A 1TWYA 4KFQA 1P99A 3TUSA 4F3SA 1MS7A 4RK2A 4BLAA 3FVNA 1ZKBA 1P1QA 3JV9A 3C33A 1MDQA 4PFUA 3HO7A 4WEPA 1LAXA 4OQOA 3O9PA 3TELA 4NF4A 4YMBA 3MPLA 3M3FA 4GOTA 1OMPA 5L8DA 1B5JA 3KSJA 4H6DA 3OD7A 1ELJA 4K3FA 4YB7A 2Q2CA 3S9LC 1SYIA 2O1MA 4KI0E 3TTLA 1UIVA 4U23A 2UVIA 4NF4B 4QFKA 4IO3A 3K1NA 4F1YA 4QFNA 4BDLA 2F34A 3K4UA 2QRYA 2R9JA 1IQ7A 2XXWA 1DSNA 3Q27A 1B3HA 4POXA 1H3DA 3IJOB 1SYHA 3BKIB 4XXUA 3RUMA 1SQYA 3LSFB 2CZLA 4ELOA 3SESA 1FTOA 5DT6A 3C4MA 3FXQA 1XVYA 4JDFA 1IZ1A 1Y3QA 3KJTA 2HCAA 3RLFE 5A5XA 4U2RA 2ANJA 1YCJA 5H8HA 3BBRA 2WKYA 3LSXA 4JWOA 4H5GA 4MLQA 4XKQA 2XXPA 4G68C 4DDDA 1Q35A 3LBSA 5FHNA 2NOOA 3OOAA 4GXAA 3IR1A 3B7DA 3MVWA 2DVCA 3V83A 5ITOA 5A5XB 1USYE 4PFYA 5CC2A 5H8HB 4UA8A 3VVEA 3HCQA 4THIA 1RYXA 2Z8EA 1J1NA 4R9GA 3MBPA 2PMSA 4DXCA 4BDNA 4R73A 1MXUA 2OCUA 3R6UA 3W15C 1P1WA 1DPPA 1US5A 3G3HA 2F5XA 1L5TA 2V3UA 4ESWA 5DYHA 4POWA 4RPNA 1PEBA 2I0BA 4Q8RA 3IOUA 2XXIA 4R72A 2PX1A 3OXNA 2GH9A 3KOTA 1OQGA 4MH5A 1Z7NE 2O51A 4H65A 2VP1A 1FTJA 1TFDA 3TODA 1MG1A 1R9LA 2XXQA 4BDMA 3UN6A 1R9QA 4KD5A 3SEVA 1GVCA 2F6PA 4ZEBA 4ZDMA 4LATA 1HSLA 1FQFA 3USDA 3LUYA 2OJTA 1H44A 4O3CA 3UP9A 3FJ7A 4I62A 1FTLA 2DP8A 1NL5A 1P1UA 1GV8A 1LSTA 2V25A 3LSWA 2AIXA 3FXRA 2Q8JA 4Z0IA 1SI1A 3B6TA 2DSFA 1ZU0A 3EPEA 1N7XA 1Y4CA 3QUFA 1H43A 3K1PA 1S7YA 3OO7A 5AA3A 1A40A 3CFLA 1HSJA 1MPBA 5B7DA 4XKPA 1QKAA 3FASA 4QFLA 4NWCA 1B3LA 3MAMA 2I3WA 1LBBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BFT A;  3PUV E;  4LUB A;  2Z8F A;  3TZA A;  4XTC Q;  3K6V A;  2I48 A;  2DQV A;  2F7B A;  4QFP A;  1MQI A;  5I57 B;  1B51 A;  4DCY A;  1M5C A;  3S9M C;  5CMM A;  2QS2 A;  3H6W A;  1B1X A;  3M3K A;  4C0R A;  1WOD A;  3IJX B;  4FIM A;  4GWO A;  3K01 A;  3I3V A;  5DEX A;  1Y20 A;  1N04 A;  3O66 A;  2Q9T A;  1MXW A;  4DE8 A;  1O64 A;  4OFO A;  1A8F A;  1PB7 A;  4DCX A;  2Y7R A;  1XHY A;  3T9V A;  4AQ4 A;  4OFJ A;  4ELQ A;  4YAH X;  3U93 A;  3GZG A;  4OZ9 A;  4GVO A;  3JYR A;  1FTK A;  2O69 A;  4IO4 A;  1LAF E;  2OK2 A;  3RT8 A;  4HS7 A;  3R26 A;  4IB2 A;  3OO9 A;  3UIF A;  2ABH A;  3T93 B;  4ZE8 A;  1MY0 A;  2H25 A;  4YKK A;  1MY1 A;  2D21 A;  2ZNT A;  1SW2 A;  1FCK A;  4AB6 A;  1MXV A;  4OEV A;  1FQC A;  4H67 A;  3H06 B;  4U4X A;  2QSX A;  3IOR A;  5H8Q A;  1DTZ A;  2A5T A;  1VR5 A;  3QAX A;  3FVG A;  3Q28 A;  4EF1 A;  3N26 A;  4GLI A;  4F29 A;  4F2O A;  4ZZE A;  1QVS A;  3VE1 B;  4DIG A;  1S50 A;  3CRB A;  2ZYM A;  5HM4 B;  4N07 A;  5H8N A;  3PMX A;  5H8Q B;  2A5T B;  1IXI A;  1TXF A;  4L17 A;  2XX8 A;  4QSD A;  2R6G E;  3C36 A;  3OEN A;  3EHS A;  4DXB A;  3VLU A;  3E9X A;  3PMW A;  3GXA A;  3PPR A;  3M3L A;  5I2K A;  3ECR A;  5L9M A;  4MFI A;  4ZEI A;  4LVQ A;  1GTK A;  4G68 A;  1JQF A;  4EXK A;  4F3P A;  3U72 A;  1MY3 A;  3K00 A;  3LSL A;  1WVJ A;  3TQW A;  3KJ7 A;  4EQ7 A;  1FQE A;  3F11 A;  4H1X A;  4ZZA A;  3ONM A;  5ITP A;  1MQJ A;  2AYS A;  3VLV A;  2BJJ X;  1D9Y A;  5I2K B;  4LQ5 A;  1QUL A;  4OMB A;  1UTB A;  4G68 B;  4OTE A;  4PP0 A;  3OSR A;  4GD5 A;  4OVJ A;  3TCH A;  2XXV A;  4WKM A;  3PPN A;  4OXV A;  3DLN A;  3KZG A;  3O97 A;  4Q5T A;  1QUI A;  1JW5 A;  2UYF A;  1GGG A;  1UTH A;  2B3B A;  1I69 A;  1TT1 A;  3HV1 A;  3KOS A;  2P1S A;  1MXX A;  1ZBM A;  2RIN A;  5BUU A;  2DXR A;  2ONS A;  1SVX B;  3KBR A;  1N76 A;  3BFU A;  3SDF A;  1MM6 A;  2QS4 A;  3OO6 A;  4N13 A;  3S9E A;  1Y3P A;  4ZED A;  3FUZ A;  1Y1M A;  2I6E A;  3MUQ A;  2FYI A;  3IK6 B;  3RTW B;  1UTH B;  3GBB A;  2DE4 A;  2H4I A;  3EN3 A;  3PMV A;  3UK4 A;  4ESX A;  5KCJ A;  4NTL A;  2ZYK A;  4NMY A;  4U4S A;  5ICT A;  2M8C A;  3CG3 A;  1LAH E;  3MZ1 A;  4KYE A;  3KG2 A;  4IY5 A;  3FVO A;  1O63 A;  3MVX A;  3OSQ A;  1LFI A;  1B5H A;  3CFZ A;  3W9W A;  4KYD A;  2Z8D A;  1Y3N A;  3M8U A;  4PET A;  2H9B A;  1OVB A;  5KCJ B;  1URG A;  1B0H A;  3SEX A;  4EQ9 A;  4IO7 A;  5JEI A;  3O6I A;  5AA1 A;  1H76 A;  4QRZ A;  1MPC A;  3VVF A;  1VFE A;  1IUD A;  3H6V A;  4F18 A;  1Y9U A;  3T96 B;  4UAC A;  3P7I A;  3A09 A;  2Y7K A;  3TDJ A;  1B6H A;  4ISU A;  1IXH A;  2Q2A A;  2IA4 A;  1SW4 A;  2V3T A;  4F1U A;  4IO6 A;  3HHF A;  2XX7 A;  2DVZ A;  2ZYN A;  2XD2 A;  1XS5 A;  1JVY A;  3O28 A;  2PVU A;  3GBA A;  3S4U A;  3EHT A;  3PPO A;  1LBC A;  1MDP 1;  3MP1 A;  4KCD A;  1B46 A;  1OVT A;  4BDO A;  4OEN A;  3TTK A;  4EXL A;  1H45 A;  4ONY A;  2B65 A;  3KEI A;  3V5A A;  1B52 A;  4G8H A;  2O1L A;  1YTV A;  4PFT A;  3N5L A;  3H7M A;  1B7U A;  2DWJ A;  1IXG A;  3TCG A;  4OHN A;  3RPW A;  5FTI A;  4JXI A;  1MRP A;  4IY6 A;  3IAZ A;  3SET A;  3E4R A;  4F3G A;  3VXB A;  4DZ1 A;  1MXY A;  4LP2 B;  3KN7 A;  4EQB A;  5KZT A;  1US4 A;  3A3C A;  1SI0 A;  1MQG A;  4RPO A;  2HFB A;  3K6W A;  5F1Q A;  5TU0 A;  4DXU A;  3MWB A;  2REJ A;  1DOT A;  1JW4 A;  1MH4 A;  1LAG E;  3H6T A;  3DM0 A;  2ONK E;  2ZNU A;  1SD3 A;  4DLD A;  4H8J A;  3ZS6 A;  1B7H A;  4P0G A;  3MJN A;  2NWJ A;  5AA4 A;  1LCT A;  1N84 A;  4IGT A;  1CB6 A;  5H8F A;  3OEK A;  2OLB A;  4XKR A;  2OWT A;  2RCA A;  4YKP A;  5B70 A;  3Q25 A;  2Z22 A;  2A5S A;  1N0T A;  3H6U A;  4O3B A;  2D3I A;  5LOM A;  1A54 A;  3S9N C;  4F2Q A;  3IO4 A;  2VD2 A;  4F31 B;  2V84 A;  2W7Y A;  1VE4 A;  1MY2 A;  1B58 A;  5FHO A;  2QMX A;  1NKX A;  2HAU A;  5AA4 B;  1M5D A;  5H8S A;  4NWD A;  5H8F B;  4F1V A;  3TMG A;  5FTH A;  2DE2 A;  1M5F A;  3ZKL A;  3CIJ A;  3SER A;  2GHA A;  3V8X B;  3FV1 A;  5CRY A;  1B32 A;  4R75 A;  3G3I A;  3E13 X;  4WXJ A;  3QXM A;  1JET A;  1KWH A;  1UIU A;  1MPD A;  3MZ9 A;  4F22 A;  4NF6 A;  3N94 A;  4FAT A;  4R9F A;  4HW8 A;  3B6W A;  4BDR A;  4ZEC A;  4MBP A;  2ONR A;  1MQH A;  1SW5 A;  2RKM A;  4FJP A;  1FQA A;  2V93 A;  3FJG A;  2UYE A;  1PB8 A;  2XX9 A;  2VOZ A;  1AOV A;  2F36 A;  2DYX A;  3N6U A;  2G93 A;  4F39 A;  1N3W A;  2I49 A;  1A55 A;  3HPI A;  2I3V A;  1B0L A;  2V3Q A;  1FQD A;  3K6U A;  2UVG A;  2Y84 A;  4G77 A;  3TCF A;  4NF6 B;  3U92 A;  1R6Z A;  2QS1 A;  3CR9 A;  3WAE A;  4ECF A;  5AA2 A;  1AMF A;  5CBS A;  1MQD A;  4LZ5 A;  1NNT A;  5JTY A;  4P11 A;  5L9S A;  3V89 B;  3ZKK A;  5DEX B;  4XKN A;  5KDT A;  2FA7 A;  3T9U A;  3K02 A;  3PUZ E;  3IB2 A;  1PDA A;  2KLF A;  2P0S A;  4MF3 A;  3VLW A;  1QW0 A;  2PT1 A;  3FVK A;  3VDF A;  4GIZ A;  1D3K A;  4U1O A;  2CMO A;  5K2X A;  4F3B A;  1PBQ A;  2RC7 A;  4OER A;  1Z7M E;  4I1D A;  2IEE A;  5JTY B;  3U1O A;  3TTR A;  1FQB A;  4FE8 A;  3QSL A;  5KDT B;  3AXF A;  2AL4 A;  5FHM A;  3GLB A;  3IB0 A;  5CMK A;  5TP9 A;  2Z23 A;  1QKB A;  1YAE A;  2O7U A;  1BIY A;  2DWH A;  1OQH A;  5I58 A;  3L6G A;  1PC3 A;  4P0I A;  3PU5 A;  2VHA A;  2Q88 A;  4QHQ A;  2H5Y A;  1JVX A;  3RTF B;  5CM6 A;  4RNS A;  4FED A;  5DVJ A;  4LA9 A;  4F19 A;  2FNC A;  4R2B A;  3TPA A;  2QPQ A;  3RY3 A;  5TP9 B;  1XOC A;  3PPQ A;  3D4G A;  4HCW A;  5I58 B;  1AL3 A;  1ZLQ A;  4GL0 A;  5IKB A;  4YB5 A;  5I84 A;  5CBR A;  1M5E A;  1SDX A;  3MQ9 A;  1EZO A;  4I8C A;  2O84 X;  5H8N B;  1B3F A;  4ELR A;  2ZYO A;  2H98 A;  4IO5 A;  4QSE A;  3RT6 B;  2F6G A;  4PQJ A;  3FIR A;  1IXC A;  1WDN A;  3L6H A;  1SW1 A;  2ESN A;  4OFL A;  1POT A;  4G4P A;  4KPT A;  3Q29 A;  3KN8 A;  3QYT A;  3C32 A;  1N7W A;  5L9O A;  4TLM B;  2NVU B;  1QUJ A;  1HSE A;  2Q89 A;  2Y7I A;  3RQT A;  3CI8 A;  1B05 A;  3KSX A;  1T0K A;  4YMA A;  3CSG A;  4JWY A;  1NH7 A;  2F7A A;  4X9T A;  2F7C A;  3O2A A;  5HPQ A;  3E3K A;  2G29 A;  3C34 A;  1NNP A;  5CMC A;  2O68 A;  5DVF A;  4KQP A;  3FXU A;  3UGW A;  1UTB B;  3C9H A;  3MVY A;  1RYO A;  3TKD A;  1LFG A;  1B3E A;  2HXW A;  4OEU A;  3T9H B;  3PUW E;  1LCF A;  4O3A A;  3TTN A;  4N6P A;  1LGB C;  1XT8 A;  2DS9 A;  3MP8 A;  3C31 A;  5AE4 A;  4H0W A;  4H8I A;  4TLL B;  1AIV A;  3QK6 A;  3EF7 A;  3MC2 A;  1D4N A;  1MY4 A;  2Y7W A;  3TQL A;  1S9T A;  4JWX A;  3K0V A;  1ZMG A;  3SKP A;  1DMB A;  2QL3 A;  1F9B A;  3TYH A;  2I4B A;  4JSD A;  2Y7P A;  3VXC A;  3OEL A;  3CFX A;  4MLV A;  3LR1 A;  4ELP A;  2PT2 A;  1B9J A;  3T9X B;  3G3G A;  1FW0 A;  3ZSF A;  3KGC A;  3VFJ A;  1AH5 A;  4TOZ A;  1PB9 A;  5ISU A;  2F35 A;  4NE4 A;  4RY1 A;  3G3F A;  1NH8 A;  4WED A;  2HZK A;  1B40 A;  2QS3 A;  1I6B A;  3G3J A;  3WAF A;  2GFE A;  3C35 A;  2YPN A;  3W9V A;  4EF2 A;  1LLS A;  2DE3 A;  2NXO A;  3A3U A;  3TEP A;  4R2F A;  4YKJ A;  3T22 A;  1OLC A;  5M2V A;  1QUK A;  3H03 A;  2HEU A;  2HQ0 A;  3MPK A;  3VVD A;  1Q1K A;  2XXU A;  3FJM A;  3TAJ A;  4GQO A;  1BTJ A;  3EQ1 A;  4GL8 A;  2DWA A;  3KFM A;  4G8N A;  3MP6 A;  4RYA A;  2OWS A;  1ZJL A;  2UVH A;  2F8D A;  5CMB A;  4I9D A;  3N6T A;  3OEM A;  1BKA A;  1MH3 A;  4Q30 B;  3SEY A;  4G2Z A;  1NMU A;  3IX1 A;  3LC8 A;  3EHU A;  1POY 1;  2XXR A;  2XXX A;  1PBP A;  2QJE A;  4FEC A;  2UVJ A;  4QFO A;  4X1D A;  4G8M A;  3ILU B;  3H4Z A;  3O29 A;  3IL1 B;  1ATG A;  5CI5 A;  3SEW A;  3HST A;  2XHD A;  4FOR A;  2DXY A;  4NF5 A;  4U22 A;  3MW0 A;  4ZE9 A;  1NNF A;  4NF8 A;  1EZP A;  1P1O A;  1XC1 A;  4LZ7 A;  1B7Z A;  2ZNS A;  3PD8 A;  1IIW A;  5EHS A;  1N3X A;  3H3G A;  4KCC A;  1EU8 A;  4KYS A;  2X7Q A;  2OZZ A;  3OO8 A;  3FV2 A;  1Y4T A;  2OBG A;  3SEU A;  2O6A A;  2RCB A;  1OLA A;  1P1N A;  4KR5 A;  4OYV A;  4LZ8 A;  1A8E A;  4NF5 B;  4YKI A;  5EHM A;  1LFH A;  4NF8 B;  2GRV A;  2LAO A;  2YJP A;  1I6A A;  5I56 A;  3OMB A;  2REG A;  2AL5 A;  4ND9 A;  4JSO A;  1A7L A;  5IAI A;  3RGY A;  1ZIU A;  1M5B A;  2DWI A;  3VV5 A;  3K1M A;  3R7X A;  3DP8 A;  1II5 A;  3Q26 A;  3TFL A;  3UA8 A;  1JW1 A;  3IOV A;  4AB5 A;  5TPA A;  2NUV A;  1LB9 A;  3U94 A;  5JK4 A;  1B4H A;  5I56 B;  1XVX A;  3HN0 A;  5AA2 D;  3HHG A;  4IO2 A;  3PPP A;  4RXL A;  1GR2 A;  3PUY E;  4YZZ A;  1DTG A;  3D4C A;  1QJM A;  3RNN A;  3CG1 A;  5I57 A;  2F97 A;  4RK9 A;  1IEJ A;  3FD3 A;  2VD3 A;  1NNK A;  3UOR A;  4YU0 A;  3PGF A;  2ZXT A;  5TPA B;  5I2N A;  4M4G A;  3CVG A;  3IOW A;  4X1B A;  4YIC A;  1YPN A;  2P2A A;  2PBW A;  1NFT A;  3G7W A;  4Q0C A;  4OWD A;  1EZ9 A;  1VFD A;  4R6K A;  3FZV A;  3B6Q A;  4NED A;  1MM7 A;  1O7T A;  1TFA A;  1CE2 A;  3ODB A;  3K6X A;  5I2N B;  3PUX E;  2F78 A;  2I0C A;  3G3K A;  3U8Q A;  3I6V A;  4IGR A;  4Z7E A;  5DTB A;  2O7I A;  4U21 A;  4M1V A;  1OIB A;  1LB8 A;  3O6H A;  2HAV A;  2D5W A;  1IIT A;  4R6H A;  5I59 A;  1B4Z A;  1B1H A;  3TTM A;  5F7V A;  1DPE A;  4HTG A;  3IO6 A;  2RF1 A;  3JZJ A;  2THI A;  2YLN A;  3DP4 A;  4R6Y A;  5AA2 B;  1B2H A;  3RN8 A;  4RA1 A;  4ZEK A;  1URS A;  4PFW A;  2QMW A;  4KHZ E;  1EH3 A;  5EYF A;  3IOT A;  3K2D A;  4ZEF A;  3DEL B;  5I59 B;  1ZTY A;  2E1S A;  4E0W A;  2XXT A;  2VGQ A;  5HBC A;  1USY H;  2R71 A;  1Y1Z A;  2X7P A;  1URD A;  3PV0 E;  3CSB A;  1FTM A;  4LQ2 A;  4YB6 A;  1ANF A;  4OES A;  3MVZ A;  2ALU A;  4GXS B;  4EDP A;  2RC8 A;  4FEB A;  3FGS A;  4U1Z A;  1B3G A;  3T66 A;  2I58 A;  4EUO A;  4R74 A;  4H5F A;  4X48 A;  3QUJ A;  2B3F A;  1R1N A;  1VSO A;  3O6G A;  4JB7 A;  5ICQ A;  2ZMB A;  1JNF A;  1I6Q A;  1JEV A;  4LON B;  5K2Y A;  4QSC A;  4GF8 A;  4C1T A;  1BP5 A;  4OET A;  2UXA A;  1JEU A;  4RJZ A;  4GFR A;  3S2V A;  2GHB A;  5J1D A;  2PYY A;  2XD3 A;  2X26 A;  1D9V A;  2XXH A;  2H99 A;  2XXY A;  1BLF A;  4FAJ A;  3I5O A;  4XIG Q;  2E0S A;  3FAT A;  4BDQ A;  1MXZ A;  4E0X A;  3DP6 A;  1UQW A;  5DVI A;  3THI A;  3QIM A;  2RC9 A;  2DOJ A;  3IB1 A;  4JBZ A;  4GRK A;  4HCY A;  2I4C A;  2HZL A;  4C1U A;  3MZB A;  4PE5 B;  1SBP A;  3ILT B;  5ELV A;  1RKM A;  1B5I A;  4QF9 A;  3PD9 A;  5BWJ A;  1A99 A;  4TQU Q;  3KN3 A;  4ZS9 A;  1TWY A;  4KFQ A;  1P99 A;  3TUS A;  4F3S A;  1MS7 A;  4RK2 A;  4BLA A;  3FVN A;  1ZKB A;  1P1Q A;  3JV9 A;  3C33 A;  1MDQ A;  4PFU A;  3HO7 A;  4WEP A;  1LAX A;  4OQO A;  3O9P A;  3TEL A;  4NF4 A;  4YMB A;  3MPL A;  3M3F A;  4GOT A;  1OMP A;  5L8D A;  1B5J A;  3KSJ A;  4H6D A;  3OD7 A;  1ELJ A;  4K3F A;  4YB7 A;  2Q2C A;  3S9L C;  1SYI A;  2O1M A;  4KI0 E;  3TTL A;  1UIV A;  4U23 A;  2UVI A;  4NF4 B;  4QFK A;  4IO3 A;  3K1N A;  4F1Y A;  4QFN A;  4BDL A;  2F34 A;  3K4U A;  2QRY A;  2R9J A;  1IQ7 A;  2XXW A;  1DSN A;  3Q27 A;  1B3H A;  4POX A;  1H3D A;  3IJO B;  1SYH A;  3BKI B;  4XXU A;  3RUM A;  1SQY A;  3LSF B;  2CZL A;  4ELO A;  3SES A;  1FTO A;  5DT6 A;  3C4M A;  3FXQ A;  1XVY A;  4JDF A;  1IZ1 A;  1Y3Q A;  3KJT A;  2HCA A;  3RLF E;  5A5X A;  4U2R A;  2ANJ A;  1YCJ A;  5H8H A;  3BBR A;  2WKY A;  3LSX A;  4JWO A;  4H5G A;  4MLQ A;  4XKQ A;  2XXP A;  4G68 C;  4DDD A;  1Q35 A;  3LBS A;  5FHN A;  2NOO A;  3OOA A;  4GXA A;  3IR1 A;  3B7D A;  3MVW A;  2DVC A;  3V83 A;  5ITO A;  5A5X B;  1USY E;  4PFY A;  5CC2 A;  5H8H B;  4UA8 A;  3VVE A;  3HCQ A;  4THI A;  1RYX A;  2Z8E A;  1J1N A;  4R9G A;  3MBP A;  2PMS A;  4DXC A;  4BDN A;  4R73 A;  1MXU A;  2OCU A;  3R6U A;  3W15 C;  1P1W A;  1DPP A;  1US5 A;  3G3H A;  2F5X A;  1L5T A;  2V3U A;  4ESW A;  5DYH A;  4POW A;  4RPN A;  1PEB A;  2I0B A;  4Q8R A;  3IOU A;  2XXI A;  4R72 A;  2PX1 A;  3OXN A;  2GH9 A;  3KOT A;  1OQG A;  4MH5 A;  1Z7N E;  2O51 A;  4H65 A;  2VP1 A;  1FTJ A;  1TFD A;  3TOD A;  1MG1 A;  1R9L A;  2XXQ A;  4BDM A;  3UN6 A;  1R9Q A;  4KD5 A;  3SEV A;  1GVC A;  2F6P A;  4ZEB A;  4ZDM A;  4LAT A;  1HSL A;  1FQF A;  3USD A;  3LUY A;  2OJT A;  1H44 A;  4O3C A;  3UP9 A;  3FJ7 A;  4I62 A;  1FTL A;  2DP8 A;  1NL5 A;  1P1U A;  1GV8 A;  1LST A;  2V25 A;  3LSW A;  2AIX A;  3FXR A;  2Q8J A;  4Z0I A;  1SI1 A;  3B6T A;  2DSF A;  1ZU0 A;  3EPE A;  1N7X A;  1Y4C A;  3QUF A;  1H43 A;  3K1P A;  1S7Y A;  3OO7 A;  5AA3 A;  1A40 A;  3CFL A;  1HSJ A;  1MPB A;  5B7D A;  4XKP A;  1QKA A;  3FAS A;  4QFL A;  4NWC A;  1B3L A;  3MAM A;  2I3W A;  1LBB A; 
#chains in the Genus database with same CATH topology
 3BFT A;  3PUV E;  4LUB A;  2Z8F A;  3E79 A;  4MAG A;  3TZA A;  4XTC Q;  3K6V A;  2I48 A;  2DQV A;  2P3V A;  4N91 A;  2F7B A;  4QFP A;  1MQI A;  5I57 B;  3EKI A;  1B51 A;  4DCY A;  1M5C A;  3S9M C;  5CMM A;  2QS2 A;  3H6W A;  1B1X A;  3M3K A;  4C0R A;  1WOD A;  3IJX B;  4FIM A;  4GWO A;  3K01 A;  3I3V A;  5DEX A;  1Y20 A;  1CNQ A;  1N04 A;  3O66 A;  2Q9T A;  1MXW A;  4DE8 A;  1KA1 A;  1O64 A;  4OFO A;  5LTC A;  1A8F A;  1PB7 A;  4DCX A;  2Y7R A;  1XHY A;  3T9V A;  4AQ4 A;  4OFJ A;  4ELQ A;  4YAH X;  3U93 A;  2R8T A;  3GZG A;  4OZ9 A;  5A5L A;  4GVO A;  2CEX A;  3JYR A;  1FTK A;  2O69 A;  4IO4 A;  4FBP A;  1LAF E;  2OK2 A;  3RT8 A;  4HS7 A;  3R26 A;  4N8G A;  2OX3 A;  4IB2 A;  4MNP A;  3OO9 A;  3UIF A;  2ABH A;  3T93 B;  4ZE8 A;  1MY0 A;  2H25 A;  4YKK A;  1MY1 A;  2D21 A;  2ZNT A;  1SW2 A;  1FCK A;  4GWU A;  3IFA A;  4AB6 A;  1MXV A;  1QGX A;  3T0J A;  4OEV A;  1FQC A;  4H67 A;  3H06 B;  1FBC A;  4U4X A;  3MYU A;  4P8B A;  2QSX A;  3IOR A;  5H8Q A;  1DTZ A;  2A5T A;  1VR5 A;  3QAX A;  3FVG A;  3Q28 A;  4EF1 A;  3N26 A;  4GLI A;  4F29 A;  4O7I A;  4F2O A;  2Y5L A;  4ZZE A;  1QVS A;  2FIE A;  3VE1 B;  4DIG A;  1S50 A;  3CRB A;  2ZYM A;  5IZZ A;  5HM4 B;  4N07 A;  5H8N A;  3PMX A;  5H8Q B;  2A5T B;  1IXI A;  1TXF A;  4L17 A;  2XX8 A;  4XEQ A;  4QSD A;  2R6G E;  3C36 A;  3OEN A;  5FBP A;  3EHS A;  4DXB A;  3VLU A;  3E9X A;  3PMW A;  2PCR A;  3GXA A;  1FTA A;  3PPR A;  1NV5 A;  3M3L A;  5I2K A;  3ECR A;  1VDW A;  5L9M A;  4MFI A;  4ZEI A;  4LVQ A;  1GTK A;  4HE1 A;  4G68 A;  1JQF A;  4EXK A;  4F3P A;  3U72 A;  1NV4 A;  2VT5 A;  1MY3 A;  3K00 A;  3LSL A;  1WVJ A;  3TQW A;  3T1B A;  3KJ7 A;  4EQ7 A;  1FQE A;  2FHY A;  3F11 A;  2V4C A;  4H1X A;  4ZZA A;  4X8R A;  3ONM A;  5ITP A;  1MQJ A;  2AYS A;  3VLV A;  2BJJ X;  4LN5 A;  1D9Y A;  5I2K B;  4LQ5 A;  1QUL A;  4OMB A;  1UTB A;  4G68 B;  4OTE A;  4PP0 A;  3OSR A;  4GD5 A;  4OVJ A;  3TCH A;  2XXV A;  4WKM A;  4OAN A;  3PPN A;  4OXV A;  3DLN A;  3KZG A;  3O97 A;  4Q5T A;  1QUI A;  1JW5 A;  2UYF A;  1GGG A;  1UTH A;  2B3B A;  1I69 A;  2KR0 A;  1TT1 A;  3HV1 A;  2VPN A;  3BIG A;  3KOS A;  2KQZ A;  4MNC A;  1FRP A;  2P1S A;  1MXX A;  1ZBM A;  2RIN A;  5BUU A;  2DXR A;  2ONS A;  1SVX B;  3KBR A;  1N76 A;  4QBA A;  3BFU A;  3SDF A;  1MM6 A;  2QS4 A;  3OO6 A;  4N13 A;  3S9E A;  1Y3P A;  3FUZ A;  4ZED A;  1Y1M A;  2I6E A;  3MUQ A;  4NN3 A;  2FYI A;  3IK6 B;  3RTW B;  1UTH B;  3GBB A;  2DE4 A;  2H4I A;  5LDZ A;  1IMF A;  3EN3 A;  3PMV A;  3UK4 A;  4ESX A;  5I5P A;  5KCJ A;  3RYD A;  4MHF A;  4NTL A;  2ZYK A;  4NMY A;  4U4S A;  5ICT A;  2M8C A;  3CG3 A;  1LAH E;  3MZ1 A;  4KYE A;  3KG2 A;  3MST A;  1RDY A;  4IY5 A;  2ZZW A;  2F3D A;  3FVO A;  4PF6 A;  1O63 A;  4AS4 A;  3MVX A;  3OSQ A;  1LFI A;  1B5H A;  3CFZ A;  3W9W A;  4KYD A;  2Z8D A;  1Y3N A;  3M8U A;  4PET A;  4N6K A;  2H9B A;  1OVB A;  5KCJ B;  1URG A;  1B0H A;  3ROJ A;  3SEX A;  4EQ9 A;  5ET5 A;  4IO7 A;  5EYH A;  5JEI A;  3O6I A;  2XA5 A;  5AA1 A;  1H76 A;  4QRZ A;  1MPC A;  1YXI A;  3VVF A;  1VFE A;  1IUD A;  3H6V A;  1FPF A;  4F18 A;  1Y9U A;  5I3S A;  3T96 B;  2WBD A;  1NUX A;  4UAC A;  3P7I A;  1EYI A;  3A09 A;  4PCD A;  2Y7K A;  3TDJ A;  1B6H A;  4ISU A;  1IXH A;  2Q2A A;  2Q74 A;  2IA4 A;  1SW4 A;  5EQ9 A;  2V3T A;  4F1U A;  4IO6 A;  3HHF A;  2XX7 A;  1FJ9 A;  2DVZ A;  2ZYN A;  2XD2 A;  1XS5 A;  1JVY A;  3O28 A;  2PVU A;  3GBA A;  3S4U A;  2QFL A;  3EHT A;  3PPO A;  4H46 A;  1LBC A;  1MDP 1;  3MP1 A;  4KCD A;  1B46 A;  1OVT A;  4PC9 A;  4BDO A;  4OEN A;  3TTK A;  4EXL A;  1H45 A;  4GBW A;  4ONY A;  2B65 A;  4UAB A;  3KEI A;  4PAF A;  3V5A A;  1B52 A;  4JVC A;  4G8H A;  2O1L A;  1YTV A;  4PFT A;  3N5L A;  3H7M A;  1B7U A;  2DWJ A;  2BJI A;  4PGN A;  1IME A;  1IXG A;  3TCG A;  4OHN A;  3RPW A;  4N17 A;  5FTI A;  4DI3 D;  3LV0 A;  4JXI A;  1MRP A;  4IY6 A;  3IAZ A;  3SET A;  2L5V A;  3E4R A;  4F3G A;  3VXB A;  4DZ1 A;  1MXY A;  4LP2 B;  3KN7 A;  4NX1 A;  4EQB A;  5KZT A;  1US4 A;  3A3C A;  1SI0 A;  4I3E A;  1MQG A;  4RPO A;  2HFB A;  3K6W A;  1LBW A;  5F1Q A;  5TU0 A;  4GWY A;  4DXU A;  3MWB A;  3FBP A;  2REJ A;  3B50 A;  1DOT A;  1JW4 A;  1MH4 A;  5ET6 A;  1LAG E;  3H6T A;  2B4L A;  3DM0 A;  2ONK E;  2ZNU A;  1SD3 A;  2PFZ A;  4H8J A;  3ZS6 A;  4DLD A;  1B7H A;  4P0G A;  3MJN A;  2NWJ A;  5AA4 A;  1LCT A;  1N84 A;  4IGT A;  1CB6 A;  5H8F A;  3OEK A;  2OLB A;  4XKR A;  2OWT A;  2RCA A;  4G61 A;  4YKP A;  5B70 A;  3Q25 A;  2Z22 A;  1FPE A;  2A5S A;  4JVD A;  1LBY A;  1N0T A;  3H6U A;  4O3B A;  2D3I A;  5LOM A;  1A54 A;  4PF8 A;  3S9N C;  4F2Q A;  3IO4 A;  2VD2 A;  4F31 B;  2V84 A;  2W7Y A;  1VE4 A;  1MY2 A;  1B58 A;  5FHO A;  2QMX A;  1NKX A;  2HAU A;  4PFR A;  5AA4 B;  1M5D A;  5H8S A;  4NWD A;  1LBX A;  5H8F B;  4F1V A;  3TMG A;  5FTH A;  2DE2 A;  4PTK A;  1M5F A;  1FBD A;  3ZKL A;  3CIJ A;  4N4U A;  2GHA A;  3SER A;  3FV1 A;  3V8X B;  1EYJ A;  5CRY A;  1B32 A;  4R75 A;  3G3I A;  3QMF A;  3E13 X;  4WXJ A;  3QXM A;  1JET A;  1KWH A;  1UIU A;  1NV6 A;  1MPD A;  3MZ9 A;  1K9Z A;  1LBV A;  4P1E A;  4NGU A;  4F22 A;  4NF6 A;  3N94 A;  4FAT A;  4R9F A;  4HW8 A;  3B6W A;  4BDR A;  4ZEC A;  3IFC A;  4MBP A;  2ONR A;  1MQH A;  1SW5 A;  2RKM A;  4FJP A;  5IZ3 A;  1FQA A;  2V93 A;  3FJG A;  2UYE A;  1PB8 A;  2XX9 A;  2VOZ A;  1AOV A;  2F36 A;  2DYX A;  3N6U A;  2G93 A;  4F39 A;  1N3W A;  2I49 A;  1A55 A;  3HPI A;  2WYP A;  2B4M A;  2HHM A;  2I3V A;  1B0L A;  2V3Q A;  1FQD A;  3K6U A;  2UVG A;  2Y84 A;  4G77 A;  2QVU A;  2HXR A;  3TCF A;  4NF6 B;  3U92 A;  1R6Z A;  2QS1 A;  3CR9 A;  3WAE A;  4ECF A;  5AA2 A;  5ET8 A;  1AMF A;  3ISP A;  5CBS A;  1MQD A;  4LZ5 A;  5IZ3 B;  1NNT A;  1FPI A;  5JTY A;  4P11 A;  5L9S A;  3V89 B;  3ZKK A;  4NHB A;  5DEX B;  2XWO A;  4XKN A;  5KDT A;  2FA7 A;  1YZ0 A;  2CZH A;  1EYK A;  3T9U A;  3K02 A;  3PUZ E;  3IB2 A;  1PDA A;  2KLF A;  2P0S A;  4MF3 A;  3VLW A;  1QW0 A;  2PT1 A;  3FVK A;  3VDF A;  4GIZ A;  1D3K A;  4U1O A;  2CMO A;  5K2X A;  4F3B A;  1PBQ A;  2RC7 A;  4OER A;  1Z7M E;  4I1D A;  2IEE A;  2CZI A;  5JTY B;  3U1O A;  3TTR A;  4P3L A;  1FQB A;  4FE8 A;  3QSL A;  4GBV A;  3AXF A;  5KDT B;  4OVT A;  2AL4 A;  5FHM A;  3GLB A;  3IB0 A;  5CMK A;  5TP9 A;  2Z23 A;  1QKB A;  1YAE A;  2O7U A;  1BIY A;  1YYZ A;  2DWH A;  1OQH A;  5I58 A;  3L6G A;  1PC3 A;  4P0I A;  2PFY A;  3PU5 A;  2VHA A;  1FJ6 A;  2Q88 A;  4QHQ A;  2H5Y A;  1JVX A;  3RTF B;  5CM6 A;  4RNS A;  4FED A;  5DVJ A;  1G0I A;  2ZZV A;  4LA9 A;  4F19 A;  4P1L A;  2FNC A;  1FSA A;  4R2B A;  4NQ8 A;  3TPA A;  2QPQ A;  4JVI A;  3RY3 A;  5TP9 B;  1XOC A;  3PPQ A;  3D4G A;  4HCW A;  2XWI A;  5I58 B;  1AL3 A;  1ZLQ A;  4X04 A;  4GL0 A;  5IKB A;  1NV2 A;  4YB5 A;  5I84 A;  5CBR A;  1M5E A;  1SDX A;  3MQ9 A;  1EZO A;  4I8C A;  2O84 X;  5H8N B;  1B3F A;  4ELR A;  2ZYO A;  2H98 A;  1KZ8 A;  4IO5 A;  4QSE A;  1NV0 A;  5ESY A;  1FPL A;  2Y5K A;  3RT6 B;  2F6G A;  4PQJ A;  3FIR A;  1IXC A;  1WDN A;  3L6H A;  1Q9D A;  1SW1 A;  2ESN A;  4OFL A;  1POT A;  4PBH A;  4G4P A;  4KPT A;  3Q29 A;  3KN8 A;  3QYT A;  3C32 A;  1N7W A;  5L9O A;  4TLM B;  2NVU B;  4PFI A;  1QUJ A;  1HSE A;  4AS5 A;  2Q89 A;  2OWZ A;  2Y7I A;  3RQT A;  3CI8 A;  4NF0 A;  1B05 A;  3KSX A;  1T0K A;  4YMA A;  3CSG A;  4JWY A;  1NH7 A;  2F7A A;  4X9T A;  2F7C A;  3O2A A;  5HPQ A;  4IR8 A;  3E3K A;  2G29 A;  3C34 A;  1NNP A;  5CMC A;  2O68 A;  5DVF A;  4KQP A;  3FXU A;  4MIJ A;  3UGW A;  1UTB B;  3C9H A;  3MVY A;  1RYO A;  3TKD A;  1FPB A;  1LFG A;  1B3E A;  2HXW A;  4GX3 A;  4OEU A;  3T9H B;  3PUW E;  1LCF A;  4O3A A;  3TTN A;  4N6P A;  1LGB C;  1XT8 A;  4DI4 B;  2DS9 A;  3MP8 A;  3C31 A;  5AE4 A;  4H0W A;  4H8I A;  4TLL B;  1AIV A;  3QK6 A;  3EF7 A;  3MC2 A;  1D4N A;  1MY4 A;  2Y7W A;  3TQL A;  1S9T A;  4JWX A;  3K0V A;  1ZMG A;  4PAK A;  3SKP A;  1DMB A;  2QL3 A;  5EQ7 A;  1F9B A;  3TYH A;  2I4B A;  4JSD A;  2Y7P A;  3VXC A;  1NI9 A;  3OEL A;  1FBE A;  3CFX A;  4MLV A;  3LR1 A;  1INP A;  4ELP A;  2PT2 A;  1B9J A;  3T9X B;  3G3G A;  1FW0 A;  3ZSF A;  3KGC A;  3VFJ A;  1AH5 A;  4TOZ A;  1BK4 A;  1PB9 A;  5ISU A;  2F35 A;  4NG7 A;  4NE4 A;  4RY1 A;  3G3F A;  1NH8 A;  4WED A;  2HZK A;  1B40 A;  1NUW A;  2QS3 A;  1I6B A;  4QXD A;  3G3J A;  3WAF A;  5IM2 A;  2GFE A;  3C35 A;  2YPN A;  3W9V A;  4EF2 A;  1LLS A;  2DE3 A;  3KC1 A;  2NXO A;  3A3U A;  4XFE A;  3TEP A;  4R2F A;  4YKJ A;  3T22 A;  1OLC A;  5IZ1 A;  4PE3 A;  5M2V A;  4I40 A;  1QUK A;  3H03 A;  2HEU A;  2HQ0 A;  4NAP A;  3MPK A;  3LUZ A;  5EQ8 A;  3VVD A;  1Q1K A;  2XXU A;  3FJM A;  4PGP A;  3TAJ A;  4GQO A;  1BTJ A;  3EQ1 A;  4GL8 A;  1NV3 A;  2DWA A;  3KFM A;  4G8N A;  3MP6 A;  4RYA A;  2OWS A;  4MNI A;  1ZJL A;  4P47 A;  2UVH A;  4OVR A;  2F8D A;  5CMB A;  4I9D A;  3N6T A;  3OEM A;  1BKA A;  1MH3 A;  4Q30 B;  3SEY A;  4GX4 A;  3B8B A;  4G2Z A;  1NMU A;  3IX1 A;  3LC8 A;  3EHU A;  1POY 1;  2XXR A;  2XXX A;  1PBP A;  1LBZ A;  2QJE A;  3GYY A;  4FEC A;  2UVJ A;  4QFO A;  4X1D A;  4G8M A;  3ILU B;  3H4Z A;  4OVS A;  3O29 A;  3IL1 B;  1ATG A;  5CI5 A;  3SEW A;  3HST A;  5J16 A;  2XHD A;  4HE0 A;  4FOR A;  2DXY A;  4NF5 A;  4GWW A;  4U22 A;  3MW0 A;  4ZE9 A;  1NNF A;  4NF8 A;  1EZP A;  4GWS A;  1P1O A;  1XC1 A;  4LZ7 A;  3KBZ A;  1B7Z A;  2DDK A;  1DCU A;  2ZNS A;  3PD8 A;  2WX9 A;  3RPL A;  1IIW A;  5EHS A;  1N3X A;  3H3G A;  4KCC A;  1EU8 A;  4KYS A;  2X7Q A;  2OZZ A;  3OO8 A;  3FV2 A;  1FPG A;  1Y4T A;  5EQA A;  2OBG A;  3SEU A;  4OA4 A;  2O6A A;  2RCB A;  2CEY A;  1OLA A;  1P1N A;  4KR5 A;  4OYV A;  4LZ8 A;  1A8E A;  4NF5 B;  4YKI A;  5EHM A;  1LFH A;  4NF8 B;  2GRV A;  2LAO A;  2VPO A;  2YJP A;  1JP4 A;  1I6A A;  5I56 A;  2F3B A;  3RPL B;  3OMB A;  2REG A;  2AL5 A;  4ND9 A;  4JSO A;  1A7L A;  5IAI A;  3RGY A;  1ZIU A;  1M5B A;  2DWI A;  3VV5 A;  2WYK A;  3K1M A;  3R7X A;  5EYG A;  3DP8 A;  1II5 A;  3Q26 A;  3TFL A;  4MMP A;  3UA8 A;  1JW1 A;  3IOV A;  4AB5 A;  5TPA A;  2NUV A;  4N81 A;  1LB9 A;  4O7M A;  3SZP A;  3U94 A;  5JK4 A;  1B4H A;  2FIX A;  5I56 B;  1XVX A;  3HN0 A;  5AA2 D;  3HHG A;  4IO2 A;  3PPP A;  4RXL A;  2FBP A;  1GR2 A;  3PUY E;  4YZZ A;  1DTG A;  4PDD A;  5T3J A;  3D4C A;  1QJM A;  3RNN A;  3CG1 A;  5I57 A;  2F97 A;  1IMC A;  4RK9 A;  1IEJ A;  3FD3 A;  2VD3 A;  1NNK A;  3UOR A;  4YU0 A;  1SPI A;  3PGF A;  2ZXT A;  5TPA B;  5I2N A;  4M4G A;  3CVG A;  3IOW A;  4X1B A;  4YIC A;  1YPN A;  2P2A A;  2PBW A;  1K9Y A;  1NFT A;  3G7W A;  4Q0C A;  4OWD A;  1EZ9 A;  1VFD A;  4R6K A;  3FZV A;  1IMB A;  3B6Q A;  1FBP A;  4O8M A;  4NED A;  1MM7 A;  1O7T A;  1TFA A;  1CE2 A;  3ODB A;  3K6X A;  4XF5 A;  5I2N B;  2MKZ A;  3PUX E;  2F78 A;  2I0C A;  3G3K A;  3U8Q A;  3I6V A;  3U65 A;  4IGR A;  2XXK A;  4HXV A;  4Z7E A;  5DTB A;  2O7I A;  4U21 A;  4M1V A;  1OIB A;  1LB8 A;  3O6H A;  2HAV A;  2D5W A;  1IIT A;  4R6H A;  5I59 A;  1B4Z A;  1B1H A;  3TTM A;  1FBF A;  5F7V A;  1DPE A;  4HTG A;  3IO6 A;  2RF1 A;  3JZJ A;  2THI A;  2YLN A;  3DP4 A;  4R6Y A;  5AA2 B;  1B2H A;  3RN8 A;  2WEF A;  4RA1 A;  4ZEK A;  1URS A;  4PAI A;  4MEV A;  4PFW A;  2QMW A;  4KHZ E;  1EH3 A;  5EYF A;  3IOT A;  3K2D A;  4ZEF A;  3DEL B;  5I59 B;  1ZTY A;  2E1S A;  4E0W A;  2XXT A;  2VGQ A;  5HBC A;  1USY H;  2R71 A;  1Y1Z A;  2X7P A;  1URD A;  3PV0 E;  3CSB A;  1FTM A;  4I3Y A;  1KA0 A;  4LQ2 A;  1XI6 A;  4YB6 A;  1ANF A;  1FPD A;  4OES A;  3A29 A;  3MVZ A;  3HFU A;  2ALU A;  4GXS B;  4PBQ A;  4EDP A;  2RC8 A;  2XWK A;  4FEB A;  3FGS A;  4U1Z A;  1B3G A;  3T66 A;  2I58 A;  5F24 A;  4EUO A;  4R74 A;  4H5F A;  4X48 A;  3QUJ A;  2B3F A;  1R1N A;  1VSO A;  3O6G A;  4KXP A;  4JB7 A;  1IMD A;  5ICQ A;  2ZMB A;  1JNF A;  1I6Q A;  1JEV A;  4LON B;  5K2Y A;  4QSC A;  1G0H A;  4GF8 A;  4C1T A;  1BP5 A;  4OET A;  1NUY A;  2UXA A;  1JEU A;  4PDH A;  4RJZ A;  4GFR A;  3S2V A;  2GHB A;  5J1D A;  2PYY A;  2XD3 A;  2X26 A;  1D9V A;  2XXH A;  2H99 A;  2XXY A;  1AWB A;  1BLF A;  4FAJ A;  3I5O A;  4XIG Q;  2E0S A;  3FAT A;  4BDQ A;  1MXZ A;  4E0X A;  3DP6 A;  1UQW A;  5DVI A;  2GQ1 A;  3THI A;  4P9K A;  3QIM A;  2RC9 A;  2WBB A;  2DOJ A;  3IB1 A;  4JBZ A;  1FBH A;  4GRK A;  4HCY A;  2I4C A;  2HZL A;  4C1U A;  3MZB A;  4PE5 B;  4OVQ A;  1SBP A;  3ILT B;  4N8Y A;  1FPJ A;  5ELV A;  4P56 A;  5I7I A;  1RKM A;  4MJO A;  1B5I A;  4QF9 A;  3PD9 A;  5BWJ A;  1A99 A;  2ZZX A;  4TQU Q;  2QVR A;  3KN3 A;  1TWY A;  4ZS9 A;  4KFQ A;  1P99 A;  1RDZ A;  3KC0 A;  3TUS A;  4F3S A;  1MS7 A;  4RK2 A;  4BLA A;  4GX6 A;  3FVN A;  1ZKB A;  1P1Q A;  2JJK A;  3JV9 A;  3C33 A;  1MDQ A;  4PFU A;  3HO7 A;  4WEP A;  1LAX A;  4GWX A;  4OQO A;  3O9P A;  3TEL A;  4NF4 A;  3CHG A;  1DK4 A;  4YMB A;  3MPL A;  3M3F A;  4GOT A;  2QVV A;  1OMP A;  5L8D A;  4GWZ A;  1B5J A;  4MCO A;  3KSJ A;  4H6D A;  1NV7 A;  3OD7 A;  1ELJ A;  4K3F A;  4YB7 A;  2Q2C A;  3S9L C;  1SYI A;  2O1M A;  4KI0 E;  3TTL A;  2Q8M A;  1UIV A;  4U23 A;  2UVI A;  4NF4 B;  4QFK A;  4IO3 A;  3K1N A;  4F1Y A;  3PTY A;  4QFN A;  4BDL A;  2F34 A;  3K4U A;  2XWV A;  2QRY A;  2R9J A;  1IQ7 A;  2XXW A;  1DSN A;  3Q27 A;  1B3H A;  4POX A;  1H3D A;  3IJO B;  1SYH A;  3BKI B;  4XXU A;  3RUM A;  1SQY A;  3LSF B;  2CZL A;  4ELO A;  3SES A;  4N15 A;  1FTO A;  5DT6 A;  3C4M A;  3FXQ A;  1XVY A;  4JDF A;  1IZ1 A;  1Y3Q A;  3KJT A;  2HCA A;  3RLF E;  5A5X A;  4U2R A;  2ANJ A;  1YCJ A;  5H8H A;  3BBR A;  2WKY A;  3D1R A;  3LSX A;  4JWO A;  4H5G A;  4MLQ A;  4XKQ A;  2XXP A;  4G68 C;  4DDD A;  1Q35 A;  3LBS A;  5FHN A;  2NOO A;  3OOA A;  4GXA A;  3IR1 A;  3B7D A;  3MVW A;  2DVC A;  3V83 A;  5ITO A;  5A5X B;  1USY E;  4PFY A;  5CC2 A;  5H8H B;  4UA8 A;  3VVE A;  2P3N A;  3HCQ A;  3E78 A;  4THI A;  1RYX A;  2Z8E A;  1J1N A;  1FBG A;  4R9G A;  3MBP A;  2PMS A;  4DXC A;  4BDN A;  4R73 A;  1MXU A;  2OCU A;  3R6U A;  3W15 C;  1P1W A;  1DPP A;  1US5 A;  3G3H A;  2F5X A;  1IMA A;  1L5T A;  2V3U A;  4ESW A;  5DYH A;  1FPK A;  4POW A;  5ET7 A;  4RPN A;  1PEB A;  3FXB A;  2I0B A;  3BIH A;  4Q8R A;  4HE2 A;  3IOU A;  2XXI A;  4R72 A;  2PX1 A;  3OXN A;  2GH9 A;  4OVP A;  3KOT A;  1OQG A;  4MX6 A;  2CZK A;  4MH5 A;  3NOH A;  1Z7N E;  2O51 A;  4O94 A;  4H65 A;  2VP1 A;  1FTJ A;  1TFD A;  3TOD A;  1MG1 A;  1R9L A;  2XXQ A;  3UN6 A;  4BDM A;  1R9Q A;  4KD5 A;  3SEV A;  1GVC A;  2F6P A;  4ZEB A;  5IGA A;  4ZDM A;  4LAT A;  1HSL A;  1FQF A;  3USD A;  3LUY A;  2OJT A;  4H45 A;  1H44 A;  4O3C A;  3UP9 A;  3FJ7 A;  4I62 A;  1D9Q A;  1FTL A;  2DP8 A;  4PFB A;  1NL5 A;  1P1U A;  1GV8 A;  2HPG A;  5DW8 A;  1LST A;  2V25 A;  3LSW A;  2AIX A;  3FXR A;  2Q8J A;  4Z0I A;  1SI1 A;  3B6T A;  2DSF A;  1ZU0 A;  1RDX A;  1NV1 A;  3EPE A;  4N6D A;  1N7X A;  1Y4C A;  3QUF A;  1DBZ A;  1H43 A;  3K1P A;  1S7Y A;  3OO7 A;  5AA3 A;  1A40 A;  3CFL A;  1HSJ A;  1MPB A;  5B7D A;  4XKP A;  1NUZ A;  1QKA A;  1LEV A;  3FAS A;  4QFL A;  4NWC A;  1B3L A;  3MAM A;  2FVZ A;  2I3W A;  1LBB A; 
#chains in the Genus database with same CATH homology
 3BFT A;  3PUV E;  4LUB A;  2Z8F A;  3TZA A;  4XTC Q;  3K6V A;  2I48 A;  2DQV A;  2F7B A;  4QFP A;  1MQI A;  5I57 B;  1B51 A;  4DCY A;  1M5C A;  3S9M C;  5CMM A;  2QS2 A;  3H6W A;  1B1X A;  3M3K A;  4C0R A;  1WOD A;  3IJX B;  4FIM A;  4GWO A;  3K01 A;  3I3V A;  5DEX A;  1Y20 A;  1N04 A;  3O66 A;  2Q9T A;  1MXW A;  4DE8 A;  1O64 A;  4OFO A;  1A8F A;  1PB7 A;  4DCX A;  2Y7R A;  1XHY A;  3T9V A;  4AQ4 A;  4OFJ A;  4ELQ A;  4YAH X;  3U93 A;  3GZG A;  4OZ9 A;  4GVO A;  3JYR A;  1FTK A;  2O69 A;  4IO4 A;  1LAF E;  2OK2 A;  3RT8 A;  4HS7 A;  3R26 A;  4IB2 A;  3OO9 A;  3UIF A;  2ABH A;  3T93 B;  4ZE8 A;  1MY0 A;  2H25 A;  4YKK A;  1MY1 A;  2D21 A;  2ZNT A;  1SW2 A;  1FCK A;  4AB6 A;  1MXV A;  4OEV A;  1FQC A;  4H67 A;  3H06 B;  4U4X A;  2QSX A;  3IOR A;  5H8Q A;  1DTZ A;  2A5T A;  1VR5 A;  3QAX A;  3FVG A;  3Q28 A;  4EF1 A;  3N26 A;  4GLI A;  4F29 A;  4F2O A;  4ZZE A;  1QVS A;  3VE1 B;  4DIG A;  1S50 A;  3CRB A;  2ZYM A;  5HM4 B;  4N07 A;  5H8N A;  3PMX A;  5H8Q B;  2A5T B;  1IXI A;  1TXF A;  4L17 A;  2XX8 A;  4QSD A;  2R6G E;  3C36 A;  3OEN A;  3EHS A;  4DXB A;  3VLU A;  3E9X A;  3PMW A;  3GXA A;  3PPR A;  3M3L A;  5I2K A;  3ECR A;  5L9M A;  4MFI A;  4ZEI A;  4LVQ A;  1GTK A;  4G68 A;  1JQF A;  4EXK A;  4F3P A;  3U72 A;  1MY3 A;  3K00 A;  3LSL A;  1WVJ A;  3TQW A;  3KJ7 A;  4EQ7 A;  1FQE A;  3F11 A;  4H1X A;  4ZZA A;  3ONM A;  5ITP A;  1MQJ A;  2AYS A;  3VLV A;  2BJJ X;  1D9Y A;  5I2K B;  4LQ5 A;  1QUL A;  4OMB A;  1UTB A;  4G68 B;  4OTE A;  4PP0 A;  3OSR A;  4GD5 A;  4OVJ A;  3TCH A;  2XXV A;  4WKM A;  3PPN A;  4OXV A;  3DLN A;  3KZG A;  3O97 A;  4Q5T A;  1QUI A;  1JW5 A;  2UYF A;  1GGG A;  1UTH A;  2B3B A;  1I69 A;  1TT1 A;  3HV1 A;  3KOS A;  2P1S A;  1MXX A;  1ZBM A;  2RIN A;  5BUU A;  2DXR A;  2ONS A;  1SVX B;  3KBR A;  1N76 A;  3BFU A;  3SDF A;  1MM6 A;  2QS4 A;  3OO6 A;  4N13 A;  3S9E A;  1Y3P A;  4ZED A;  3FUZ A;  1Y1M A;  2I6E A;  3MUQ A;  2FYI A;  3IK6 B;  3RTW B;  1UTH B;  3GBB A;  2DE4 A;  2H4I A;  3EN3 A;  3PMV A;  3UK4 A;  4ESX A;  5KCJ A;  4NTL A;  2ZYK A;  4NMY A;  4U4S A;  5ICT A;  2M8C A;  3CG3 A;  1LAH E;  3MZ1 A;  4KYE A;  3KG2 A;  4IY5 A;  3FVO A;  1O63 A;  3MVX A;  3OSQ A;  1LFI A;  1B5H A;  3CFZ A;  3W9W A;  4KYD A;  2Z8D A;  1Y3N A;  3M8U A;  4PET A;  2H9B A;  1OVB A;  5KCJ B;  1URG A;  1B0H A;  3SEX A;  4EQ9 A;  4IO7 A;  5JEI A;  3O6I A;  5AA1 A;  1H76 A;  4QRZ A;  1MPC A;  3VVF A;  1VFE A;  1IUD A;  3H6V A;  4F18 A;  1Y9U A;  3T96 B;  4UAC A;  3P7I A;  3A09 A;  2Y7K A;  3TDJ A;  1B6H A;  4ISU A;  1IXH A;  2Q2A A;  2IA4 A;  1SW4 A;  2V3T A;  4F1U A;  4IO6 A;  3HHF A;  2XX7 A;  2DVZ A;  2ZYN A;  2XD2 A;  1XS5 A;  1JVY A;  3O28 A;  2PVU A;  3GBA A;  3S4U A;  3EHT A;  3PPO A;  1LBC A;  1MDP 1;  3MP1 A;  4KCD A;  1B46 A;  1OVT A;  4BDO A;  4OEN A;  3TTK A;  4EXL A;  1H45 A;  4ONY A;  2B65 A;  3KEI A;  3V5A A;  1B52 A;  4G8H A;  2O1L A;  1YTV A;  4PFT A;  3N5L A;  3H7M A;  1B7U A;  2DWJ A;  1IXG A;  3TCG A;  4OHN A;  3RPW A;  5FTI A;  4JXI A;  1MRP A;  4IY6 A;  3IAZ A;  3SET A;  3E4R A;  4F3G A;  3VXB A;  4DZ1 A;  1MXY A;  4LP2 B;  3KN7 A;  4EQB A;  5KZT A;  1US4 A;  3A3C A;  1SI0 A;  1MQG A;  4RPO A;  2HFB A;  3K6W A;  5F1Q A;  5TU0 A;  4DXU A;  3MWB A;  2REJ A;  1DOT A;  1JW4 A;  1MH4 A;  1LAG E;  3H6T A;  3DM0 A;  2ONK E;  2ZNU A;  1SD3 A;  4DLD A;  4H8J A;  3ZS6 A;  1B7H A;  4P0G A;  3MJN A;  2NWJ A;  5AA4 A;  1LCT A;  1N84 A;  4IGT A;  1CB6 A;  5H8F A;  3OEK A;  2OLB A;  4XKR A;  2OWT A;  2RCA A;  4YKP A;  5B70 A;  3Q25 A;  2Z22 A;  2A5S A;  1N0T A;  3H6U A;  4O3B A;  2D3I A;  5LOM A;  1A54 A;  3S9N C;  4F2Q A;  3IO4 A;  2VD2 A;  4F31 B;  2V84 A;  2W7Y A;  1VE4 A;  1MY2 A;  1B58 A;  5FHO A;  2QMX A;  1NKX A;  2HAU A;  5AA4 B;  1M5D A;  5H8S A;  4NWD A;  5H8F B;  4F1V A;  3TMG A;  5FTH A;  2DE2 A;  1M5F A;  3ZKL A;  3CIJ A;  3SER A;  2GHA A;  3V8X B;  3FV1 A;  5CRY A;  1B32 A;  4R75 A;  3G3I A;  3E13 X;  4WXJ A;  3QXM A;  1JET A;  1KWH A;  1UIU A;  1MPD A;  3MZ9 A;  4F22 A;  4NF6 A;  3N94 A;  4FAT A;  4R9F A;  4HW8 A;  3B6W A;  4BDR A;  4ZEC A;  4MBP A;  2ONR A;  1MQH A;  1SW5 A;  2RKM A;  4FJP A;  1FQA A;  2V93 A;  3FJG A;  2UYE A;  1PB8 A;  2XX9 A;  2VOZ A;  1AOV A;  2F36 A;  2DYX A;  3N6U A;  2G93 A;  4F39 A;  1N3W A;  2I49 A;  1A55 A;  3HPI A;  2I3V A;  1B0L A;  2V3Q A;  1FQD A;  3K6U A;  2UVG A;  2Y84 A;  4G77 A;  3TCF A;  4NF6 B;  3U92 A;  1R6Z A;  2QS1 A;  3CR9 A;  3WAE A;  4ECF A;  5AA2 A;  1AMF A;  5CBS A;  1MQD A;  4LZ5 A;  1NNT A;  5JTY A;  4P11 A;  5L9S A;  3V89 B;  3ZKK A;  5DEX B;  4XKN A;  5KDT A;  2FA7 A;  3T9U A;  3K02 A;  3PUZ E;  3IB2 A;  1PDA A;  2KLF A;  2P0S A;  4MF3 A;  3VLW A;  1QW0 A;  2PT1 A;  3FVK A;  3VDF A;  4GIZ A;  1D3K A;  4U1O A;  2CMO A;  5K2X A;  4F3B A;  1PBQ A;  2RC7 A;  4OER A;  1Z7M E;  4I1D A;  2IEE A;  5JTY B;  3U1O A;  3TTR A;  1FQB A;  4FE8 A;  3QSL A;  5KDT B;  3AXF A;  2AL4 A;  5FHM A;  3GLB A;  3IB0 A;  5CMK A;  5TP9 A;  2Z23 A;  1QKB A;  1YAE A;  2O7U A;  1BIY A;  2DWH A;  1OQH A;  5I58 A;  3L6G A;  1PC3 A;  4P0I A;  3PU5 A;  2VHA A;  2Q88 A;  4QHQ A;  2H5Y A;  1JVX A;  3RTF B;  5CM6 A;  4RNS A;  4FED A;  5DVJ A;  4LA9 A;  4F19 A;  2FNC A;  4R2B A;  3TPA A;  2QPQ A;  3RY3 A;  5TP9 B;  1XOC A;  3PPQ A;  3D4G A;  4HCW A;  5I58 B;  1AL3 A;  1ZLQ A;  4GL0 A;  5IKB A;  4YB5 A;  5I84 A;  5CBR A;  1M5E A;  1SDX A;  3MQ9 A;  1EZO A;  4I8C A;  2O84 X;  5H8N B;  1B3F A;  4ELR A;  2ZYO A;  2H98 A;  4IO5 A;  4QSE A;  3RT6 B;  2F6G A;  4PQJ A;  3FIR A;  1IXC A;  1WDN A;  3L6H A;  1SW1 A;  2ESN A;  4OFL A;  1POT A;  4G4P A;  4KPT A;  3Q29 A;  3KN8 A;  3QYT A;  3C32 A;  1N7W A;  5L9O A;  4TLM B;  2NVU B;  1QUJ A;  1HSE A;  2Q89 A;  2Y7I A;  3RQT A;  3CI8 A;  1B05 A;  3KSX A;  1T0K A;  4YMA A;  3CSG A;  4JWY A;  1NH7 A;  2F7A A;  4X9T A;  2F7C A;  3O2A A;  5HPQ A;  3E3K A;  2G29 A;  3C34 A;  1NNP A;  5CMC A;  2O68 A;  5DVF A;  4KQP A;  3FXU A;  3UGW A;  1UTB B;  3C9H A;  3MVY A;  1RYO A;  3TKD A;  1LFG A;  1B3E A;  2HXW A;  4OEU A;  3T9H B;  3PUW E;  1LCF A;  4O3A A;  3TTN A;  4N6P A;  1LGB C;  1XT8 A;  2DS9 A;  3MP8 A;  3C31 A;  5AE4 A;  4H0W A;  4H8I A;  4TLL B;  1AIV A;  3QK6 A;  3EF7 A;  3MC2 A;  1D4N A;  1MY4 A;  2Y7W A;  3TQL A;  1S9T A;  4JWX A;  3K0V A;  1ZMG A;  3SKP A;  1DMB A;  2QL3 A;  1F9B A;  3TYH A;  2I4B A;  4JSD A;  2Y7P A;  3VXC A;  3OEL A;  3CFX A;  4MLV A;  3LR1 A;  4ELP A;  2PT2 A;  1B9J A;  3T9X B;  3G3G A;  1FW0 A;  3ZSF A;  3KGC A;  3VFJ A;  1AH5 A;  4TOZ A;  1PB9 A;  5ISU A;  2F35 A;  4NE4 A;  4RY1 A;  3G3F A;  1NH8 A;  4WED A;  2HZK A;  1B40 A;  2QS3 A;  1I6B A;  3G3J A;  3WAF A;  2GFE A;  3C35 A;  2YPN A;  3W9V A;  4EF2 A;  1LLS A;  2DE3 A;  2NXO A;  3A3U A;  3TEP A;  4R2F A;  4YKJ A;  3T22 A;  1OLC A;  5M2V A;  1QUK A;  3H03 A;  2HEU A;  2HQ0 A;  3MPK A;  3VVD A;  1Q1K A;  2XXU A;  3FJM A;  3TAJ A;  4GQO A;  1BTJ A;  3EQ1 A;  4GL8 A;  2DWA A;  3KFM A;  4G8N A;  3MP6 A;  4RYA A;  2OWS A;  1ZJL A;  2UVH A;  2F8D A;  5CMB A;  4I9D A;  3N6T A;  3OEM A;  1BKA A;  1MH3 A;  4Q30 B;  3SEY A;  4G2Z A;  1NMU A;  3IX1 A;  3LC8 A;  3EHU A;  1POY 1;  2XXR A;  2XXX A;  1PBP A;  2QJE A;  4FEC A;  2UVJ A;  4QFO A;  4X1D A;  4G8M A;  3ILU B;  3H4Z A;  3O29 A;  3IL1 B;  1ATG A;  5CI5 A;  3SEW A;  3HST A;  2XHD A;  4FOR A;  2DXY A;  4NF5 A;  4U22 A;  3MW0 A;  4ZE9 A;  1NNF A;  4NF8 A;  1EZP A;  1P1O A;  1XC1 A;  4LZ7 A;  1B7Z A;  2ZNS A;  3PD8 A;  1IIW A;  5EHS A;  1N3X A;  3H3G A;  4KCC A;  1EU8 A;  4KYS A;  2X7Q A;  2OZZ A;  3OO8 A;  3FV2 A;  1Y4T A;  2OBG A;  3SEU A;  2O6A A;  2RCB A;  1OLA A;  1P1N A;  4KR5 A;  4OYV A;  4LZ8 A;  1A8E A;  4NF5 B;  4YKI A;  5EHM A;  1LFH A;  4NF8 B;  2GRV A;  2LAO A;  2YJP A;  1I6A A;  5I56 A;  3OMB A;  2REG A;  2AL5 A;  4ND9 A;  4JSO A;  1A7L A;  5IAI A;  3RGY A;  1ZIU A;  1M5B A;  2DWI A;  3VV5 A;  3K1M A;  3R7X A;  3DP8 A;  1II5 A;  3Q26 A;  3TFL A;  3UA8 A;  1JW1 A;  3IOV A;  4AB5 A;  5TPA A;  2NUV A;  1LB9 A;  3U94 A;  5JK4 A;  1B4H A;  5I56 B;  1XVX A;  3HN0 A;  5AA2 D;  3HHG A;  4IO2 A;  3PPP A;  4RXL A;  1GR2 A;  3PUY E;  4YZZ A;  1DTG A;  3D4C A;  1QJM A;  3RNN A;  3CG1 A;  5I57 A;  2F97 A;  4RK9 A;  1IEJ A;  3FD3 A;  2VD3 A;  1NNK A;  3UOR A;  4YU0 A;  3PGF A;  2ZXT A;  5TPA B;  5I2N A;  4M4G A;  3CVG A;  3IOW A;  4X1B A;  4YIC A;  1YPN A;  2P2A A;  2PBW A;  1NFT A;  3G7W A;  4Q0C A;  4OWD A;  1EZ9 A;  1VFD A;  4R6K A;  3FZV A;  3B6Q A;  4NED A;  1MM7 A;  1O7T A;  1TFA A;  1CE2 A;  3ODB A;  3K6X A;  5I2N B;  3PUX E;  2F78 A;  2I0C A;  3G3K A;  3U8Q A;  3I6V A;  4IGR A;  4Z7E A;  5DTB A;  2O7I A;  4U21 A;  4M1V A;  1OIB A;  1LB8 A;  3O6H A;  2HAV A;  2D5W A;  1IIT A;  4R6H A;  5I59 A;  1B4Z A;  1B1H A;  3TTM A;  5F7V A;  1DPE A;  4HTG A;  3IO6 A;  2RF1 A;  3JZJ A;  2THI A;  2YLN A;  3DP4 A;  4R6Y A;  5AA2 B;  1B2H A;  3RN8 A;  4RA1 A;  4ZEK A;  1URS A;  4PFW A;  2QMW A;  4KHZ E;  1EH3 A;  5EYF A;  3IOT A;  3K2D A;  4ZEF A;  3DEL B;  5I59 B;  1ZTY A;  2E1S A;  4E0W A;  2XXT A;  2VGQ A;  5HBC A;  1USY H;  2R71 A;  1Y1Z A;  2X7P A;  1URD A;  3PV0 E;  3CSB A;  1FTM A;  4LQ2 A;  4YB6 A;  1ANF A;  4OES A;  3MVZ A;  2ALU A;  4GXS B;  4EDP A;  2RC8 A;  4FEB A;  3FGS A;  4U1Z A;  1B3G A;  3T66 A;  2I58 A;  4EUO A;  4R74 A;  4H5F A;  4X48 A;  3QUJ A;  2B3F A;  1R1N A;  1VSO A;  3O6G A;  4JB7 A;  5ICQ A;  2ZMB A;  1JNF A;  1I6Q A;  1JEV A;  4LON B;  5K2Y A;  4QSC A;  4GF8 A;  4C1T A;  1BP5 A;  4OET A;  2UXA A;  1JEU A;  4RJZ A;  4GFR A;  3S2V A;  2GHB A;  5J1D A;  2PYY A;  2XD3 A;  2X26 A;  1D9V A;  2XXH A;  2H99 A;  2XXY A;  1BLF A;  4FAJ A;  3I5O A;  4XIG Q;  2E0S A;  3FAT A;  4BDQ A;  1MXZ A;  4E0X A;  3DP6 A;  1UQW A;  5DVI A;  3THI A;  3QIM A;  2RC9 A;  2DOJ A;  3IB1 A;  4JBZ A;  4GRK A;  4HCY A;  2I4C A;  2HZL A;  4C1U A;  3MZB A;  4PE5 B;  1SBP A;  3ILT B;  5ELV A;  1RKM A;  1B5I A;  4QF9 A;  3PD9 A;  5BWJ A;  1A99 A;  4TQU Q;  3KN3 A;  4ZS9 A;  1TWY A;  4KFQ A;  1P99 A;  3TUS A;  4F3S A;  1MS7 A;  4RK2 A;  4BLA A;  3FVN A;  1ZKB A;  1P1Q A;  3JV9 A;  3C33 A;  1MDQ A;  4PFU A;  3HO7 A;  4WEP A;  1LAX A;  4OQO A;  3O9P A;  3TEL A;  4NF4 A;  4YMB A;  3MPL A;  3M3F A;  4GOT A;  1OMP A;  5L8D A;  1B5J A;  3KSJ A;  4H6D A;  3OD7 A;  1ELJ A;  4K3F A;  4YB7 A;  2Q2C A;  3S9L C;  1SYI A;  2O1M A;  4KI0 E;  3TTL A;  1UIV A;  4U23 A;  2UVI A;  4NF4 B;  4QFK A;  4IO3 A;  3K1N A;  4F1Y A;  4QFN A;  4BDL A;  2F34 A;  3K4U A;  2QRY A;  2R9J A;  1IQ7 A;  2XXW A;  1DSN A;  3Q27 A;  1B3H A;  4POX A;  1H3D A;  3IJO B;  1SYH A;  3BKI B;  4XXU A;  3RUM A;  1SQY A;  3LSF B;  2CZL A;  4ELO A;  3SES A;  1FTO A;  5DT6 A;  3C4M A;  3FXQ A;  1XVY A;  4JDF A;  1IZ1 A;  1Y3Q A;  3KJT A;  2HCA A;  3RLF E;  5A5X A;  4U2R A;  2ANJ A;  1YCJ A;  5H8H A;  3BBR A;  2WKY A;  3LSX A;  4JWO A;  4H5G A;  4MLQ A;  4XKQ A;  2XXP A;  4G68 C;  4DDD A;  1Q35 A;  3LBS A;  5FHN A;  2NOO A;  3OOA A;  4GXA A;  3IR1 A;  3B7D A;  3MVW A;  2DVC A;  3V83 A;  5ITO A;  5A5X B;  1USY E;  4PFY A;  5CC2 A;  5H8H B;  4UA8 A;  3VVE A;  3HCQ A;  4THI A;  1RYX A;  2Z8E A;  1J1N A;  4R9G A;  3MBP A;  2PMS A;  4DXC A;  4BDN A;  4R73 A;  1MXU A;  2OCU A;  3R6U A;  3W15 C;  1P1W A;  1DPP A;  1US5 A;  3G3H A;  2F5X A;  1L5T A;  2V3U A;  4ESW A;  5DYH A;  4POW A;  4RPN A;  1PEB A;  2I0B A;  4Q8R A;  3IOU A;  2XXI A;  4R72 A;  2PX1 A;  3OXN A;  2GH9 A;  3KOT A;  1OQG A;  4MH5 A;  1Z7N E;  2O51 A;  4H65 A;  2VP1 A;  1FTJ A;  1TFD A;  3TOD A;  1MG1 A;  1R9L A;  2XXQ A;  4BDM A;  3UN6 A;  1R9Q A;  4KD5 A;  3SEV A;  1GVC A;  2F6P A;  4ZEB A;  4ZDM A;  4LAT A;  1HSL A;  1FQF A;  3USD A;  3LUY A;  2OJT A;  1H44 A;  4O3C A;  3UP9 A;  3FJ7 A;  4I62 A;  1FTL A;  2DP8 A;  1NL5 A;  1P1U A;  1GV8 A;  1LST A;  2V25 A;  3LSW A;  2AIX A;  3FXR A;  2Q8J A;  4Z0I A;  1SI1 A;  3B6T A;  2DSF A;  1ZU0 A;  3EPE A;  1N7X A;  1Y4C A;  3QUF A;  1H43 A;  3K1P A;  1S7Y A;  3OO7 A;  5AA3 A;  1A40 A;  3CFL A;  1HSJ A;  1MPB A;  5B7D A;  4XKP A;  1QKA A;  3FAS A;  4QFL A;  4NWC A;  1B3L A;  3MAM A;  2I3W A;  1LBB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...