3Q27A

Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (mbp)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
396
structure length
390
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSVLYVGSKTKEGVVHGVATVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Maltose-binding periplasmic protein/alpha-synuclein chimeric
publication title Structures of segments of alpha-synuclein fused to maltose-binding protein suggest intermediate states during amyloid formation
pubmed doi rcsb
source organism Escherichia coli
molecule tags Sugar binding protein, protein fibril
total genus 126
structure length 390
sequence length 396
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q27A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q27A01
1O64A 3PMXA 1USYE 4GIZA 3SEWA 3S9MC 3CFXA 3C35A 3UN6A 1KWHA 3MVXA 3Q29A 3OENA 1JETA 2NVUB 2H5YA 4IO3A 1LFHA 5H8QA 4QSCA 4EQ9A 1UTBB 4HTGA 3JZJA 1MDQA 4YZZA 3PPQA 4Q0CA 3G3IA 3M3KA 3IJXB 1MXUA 2I3WA 1SW1A 1TXFA 5CBSA 1MQHA 4ZE8A 5EHMA 1N7XA 2QSXA 4OTEA 3AXFA 4F29A 1P1QA 3PUWE 3LSLA 4WEDA 4TLMB 4OFJA 3B6TA 3LBSA 4DDDA 1BLFA 1WDNA 4RPNA 4KPTA 3ILTB 1XC1A 1FQBA 2P1SA 1H44A 5AA4B 2Y7RA 1IXGA 1LGBC 2I48A 1TFAA 1FQFA 3KFMA 1LAFE 4THIA 2ZYKA 4HS7A 2ZNSA 5DVFA 4R2FA 2DYXA 2AIXA 4AB6A 2A5TB 3TTNA 4F1YA 1LFIA 2V93A 1NNPA 3OD7A 4I8CA 4G8MA 3QSLA 3K0VA 1ZU0A 5IAIA 4NMYA 5HPQA 2VP1A 1JVXA 1R1NA 1UIUA 3TAJA 4NF8B 4EQBA 2CMOA 5EHSA 1WVJA 2HCAA 2D21A 3QUFA 4IO6A 2ZYNA 4GL0A 2HFBA 4IGRA 4NWCA 1Y4TA 1UTHA 4F2OA 4RYAA 2ZYMA 4OQOA 2XXHA 2XX9A 5KCJA 1H76A 4I9DA 3V89B 3V5AA 1ELJA 2IA4A 3QK6A 3B6QA 5I2KA 3H6TA 3OEMA 3S9NC 2V3UA 3C9HA 2P0SA 5K2YA 4U2RA 3T9VA 4YKPA 4ELQA 3IJOB 4JWXA 3CVGA 4IO7A 4YB6A 1PBPA 1A8FA 3I6VA 5B7DA 4O3BA 2V25A 1DTGA 2XD3A 3EHUA 1B52A 2QRYA 4F19A 3MP8A 3N6UA 5FHMA 1GVCA 3IR1A 5KDTA 4PFTA 4MBPA 2UYEA 3UGWA 1RYOA 2XXPA 3MVYA 2WKYA 1B4ZA 4O3AA 3KN3A 1ZTYA 4PP0A 3A3UA 1VFEA 3SKPA 1HSLA 3HHFA 4QHQA 2O6AA 5LOMA 5DEXA 1FQAA 3FIRA 4KCDA 4GRKA 3KOSA 1NH8A 2I4CA 2DXYA 4GFRA 4IGTA 1N3WA 4ZEKA 2ZMBA 3QUJA 2DOJA 3KN8A 4XKRA 3W9WA 3G3FA 3S9LC 2DE4A 4WEPA 3KG2A 1ZJLA 3O2AA 1IQ7A 5I57A 1B3EA 4JWOA 1IXIA 2HZKA 3E4RA 3T93B 1B9JA 5K2XA 2NUVA 1LB8A 2QS4A 1FTJA 4IO4A 1US5A 4XKPA 3PUXE 3Q28A 3THIA 1S9TA 4QFKA 3IB2A 3R7XA 4ONYA 3E9XA 1Y4CA 2DWJA 2QS1A 4C1UA 1D9VA 2XX8A 2G29A 3HV1A 2I6EA 1LCTA 2O51A 3G3KA 3PMVA 3DP4A 1MY1A 1BTJA 2Y7WA 1MS7A 2F36A 4ZEIA 2Q88A 2OWTA 3RTWB 4E0XA 2F8DA 3K1PA 3USDA 1D9YA 4GXSB 4ELRA 1SD3A 2H4IA 4LQ5A 2VGQA 3OSRA 3H6VA 2XXXA 4OZ9A 1IITA 4IO5A 2R9JA 3CRBA 3TEPA 1OQHA 3PPOA 1VR5A 3MW0A 4GVOA 5H8HB 3RN8A 4G8HA 1MDP1 4FEBA 2V3TA 1NKXA 2H98A 2XXTA 3VFJA 3PV0E 3OEKA 3JV9A 2ONSA 3TYHA 2YPNA 3KOTA 4KYSA 2OCUA 1PB7A 1LBBA 1SDXA 1EH3A 3SERA 3QIMA 1EZOA 4LUBA 3IO6A 2OBGA 5H8HA 3IORA 1UIVA 1FW0A 3RY3A 3DM0A 2RC8A 5TPAB 1P1WA 2GHAA 4Z7EA 4LATA 2RKMA 1ZMGA 4FE8A 1M5CA 1IEJA 1JNFA 1F9BA 4RA1A 2Q9TA 4GF8A 3WAFA 1SI0A 4U21A 4UACA 1MY2A 4N6PA 1D3KA 1D4NA 3TQLA 4POXA 4U1OA 4YB7A 5CRYA 4YKIA 4NTLA 1P1NA 4OFLA 2DQVA 4ESWA 3TTLA 3B7DA 2VOZA 4G68C 5H8QB 4DE8A 2UVIA 2H99A 4MF3A 1VSOA 1IXCA 3C34A 3FZVA 4M4GA 1YAEA 3MZBA 4KFQA 1LFGA 1B1XA 4NF6B 5J1DA 3M8UA 1MY4A 4OENA 4XKQA 4RK2A 5AE4A 3CFZA 1MQJA 1I6AA 1SI1A 2O1LA 4TQUQ 4ESXA 2REGA 3VLUA 3RNNA 4JDFA 4LA9A 3O97A 3L6GA 4N07A 2M8CA 4R6YA 3TTKA 4OMBA 1A7LA 3N26A 5L9MA 5FTIA 4ZZEA 4NF6A 4OXVA 2GHBA 3C33A 1N04A 2DWAA 1GR2A 4IY5A 5I59A 1N7WA 2O7UA 3OELA 4JWYA 2UVJA 2ANJA 1FQCA 2ALUA 1MQGA 1QUIA 2Z23A 3H4ZA 2ONRA 3K1MA 4NF4A 4ISUA 1MPBA 2PBWA 4Q8RA 1DOTA 3T9UA 4TLLB 1OLAA 1XVYA 1AH5A 4X1DA 3IK6B 3PPNA 3LC8A 2UXAA 2X7QA 3CR9A 4P11A 5AA2B 3OO8A 4OFOA 2O69A 4R2BA 1Y3QA 3VXCA 3D4CA 2QL3A 2VHAA 2PVUA 3GZGA 4C0RA 3U94A 4DZ1A 4IB2A 4FEDA 1B0LA 5FHOA 2PYYA 5DVJA 1PDAA 1B5JA 4G8NA 1B1HA 3JYRA 1Y1MA 2E1SA 1OVTA 3DELB 4KI0E 3BKIB 1IIWA 4IY6A 4JB7A 1DPEA 1UTHB 1R9QA 1ZBMA 2O68A 1TT1A 5AA2A 2Q2CA 1SYHA 4HCWA 3TUSA 2PX1A 1POTA 2YJPA 5KCJB 1XS5A 1MY3A 2XXQA 2FA7A 4OEVA 2AYSA 2V84A 5I56A 2XXWA 1Z7ME 4XKNA 5I2KB 3KEIA 4ZECA 3UORA 1A8EA 1QKAA 4EUOA 2V3QA 1BKAA 3F11A 1LB9A 1FQDA 3I3VA 5M2VA 1URDA 2PT2A 4H1XA 2VD3A 3ZS6A 3FVGA 2ESNA 2UVGA 3E13X 1B3FA 4F39A 4KCCA 3OO7A 2F6PA 4OWDA 4QSEA 4NF5B 5BWJA 1YTVA 3OMBA 5HBCA 2D3IA 3MAMA 3TCFA 4BDLA 4ND9A 4FIMA 5KDTB 5F1QA 3SEYA 4DXBA 2GFEA 3RLFE 3UK4A 1B7ZA 2F78A 3Q26A 4X9TA 3PPPA 3M3LA 4O3CA 4OVJA 4F22A 2DE3A 5DYHA 2Q2AA 3TCHA 3UIFA 2B3BA 4KHZE 1JW4A 2ONKE 5EYFA 4NF5A 3VVDA 2F7CA 5DT6A 3QXMA 5CC2A 3H6UA 5DEXB 4YU0A 5AA3A 3U72A 4F31B 1L5TA 2DSFA 4BDQA 3G3GA 2HXWA 3U8QA 3TZAA 3FD3A 1ZIUA 1PC3A 4KYDA 4OHNA 3K02A 3MVZA 1II5A 3T9HB 3IOUA 3CSBA 3ZSFA 4ZEDA 3ZKKA 1B05A 4XIGQ 1SBPA 3K01A 3DP6A 3K6UA 1RKMA 5I57B 1ANFA 3RPWA 3QAXA 1B4HA 1P99A 4QFNA 1POY1 2ABHA 3PUZE 4QFLA 1JW1A 1I69A 4DLDA 3TFLA 3MP6A 4R73A 3PU5A 3FGSA 3T22A 1S50A 4FJPA 4PFWA 4H5GA 4LONB 4YB5A 3VXBA 1N76A 5JK4A 3TPAA 1Y3NA 1MXYA 4X1BA 4ZZAA 1YPNA 1DMBA 2OK2A 3RUMA 3V8XB 1FCKA 3U1OA 2DWIA 1B40A 3H7MA 4XTCQ 3MC2A 3IL1B 5CMBA 3UP9A 2DS9A 4ELPA 1B6HA 4K3FA 5F7VA 1FTOA 1Q1KA 4ZEFA 1CB6A 2F34A 2P2AA 2X26A 3TELA 5TP9A 5AA2D 2RC7A 1QJMA 1NMUA 4E0WA 4H65A 5H8NA 3SEXA 3FVOA 2XXIA 3BFUA 3TDJA 5I58B 1NL5A 1M5FA 1LSTA 1R6ZA 4KQPA 1M5DA 1J1NA 1QULA 2RF1A 1LAXA 2NXOA 2AL5A 3U92A 4G68A 4NEDA 4WKMA 4EQ7A 3PD9A 3A3CA 3EF7A 3SEVA 1SQYA 4JSDA 4DXCA 4H5FA 4KYEA 2IEEA 4YMBA 3HN0A 3QYTA 2XXVA 3FASA 3S4UA 3H06B 5I58A 3IX1A 4U1ZA 2O1MA 1LLSA 4BDMA 1N3XA 4XXUA 1ZLQA 4BDNA 4Z0IA 1Q35A 4F2QA 1B0HA 3TMGA 4PFYA 2Z22A 1I6QA 3KN7A 2F5XA 1AIVA 3CI8A 1WODA 4ZDMA 2DE2A 4LZ7A 4WXJA 3VDFA 4OEUA 1PBQA 4GXAA 2G93A 2XHDA 1VFDA 3O29A 3LR1A 3VVEA 4LZ5A 2I4BA 5BUUA 2OZZA 1B2HA 1H45A 5CBRA 4FECA 1VE4A 3GXAA 5B70A 1ZKBA 3RT6B 1OLCA 4PETA 5ITPA 2LAOA 3RT8A 3HO7A 3PPRA 4DCYA 1URSA 4DCXA 2ZNUA 1NFTA 2H9BA 2Z8DA 1URGA 4AQ4A 1JW5A 3CG3A 4QF9A 3IOTA 3HPIA 4PE5B 3EHTA 1GGGA 4F3PA 4YKKA 2QMXA 1LCFA 3N6TA 1JEUA 2O84X 4L17A 4YMAA 3BBRA 1ATGA 1TFDA 1JVYA 1Y3PA 3TTRA 5L8DA 3H6WA 3KBRA 5ICTA 5I59B 3H03A 5L9SA 4MLVA 2Z8EA 3CIJA 5I2NA 2Q89A 4GD5A 2UYFA 2Y7KA 3FV1A 3MZ9A 4NF4B 2HQ0A 4R6HA 4M1VA 2F7BA 1BIYA 2I49A 5H8FA 1Y9UA 4ZEBA 3C4MA 4IO2A 1N0TA 5FTHA 4U22A 5A5XB 4OERA 4RNSA 3IOWA 4H8IA 1MXXA 1FQEA 3VLVA 4Q30B 1M5EA 1QUJA 3KZGA 2QMWA 1B5IA 4BLAA 4G4PA 1MQDA 1FTKA 4OETA 3L6HA 4EXLA 2I0CA 3EPEA 1HSJA 4P0IA 4RY1A 1SW4A 3VVFA 1GTKA 4QRZA 1MG1A 3VE1B 3K6VA 1UQWA 2Q8JA 1CE2A 2F35A 5A5XA 3VV5A 3OO9A 1FTLA 1UTBA 3EHSA 1JEVA 5FHNA 4R9FA 3LUYA 2X7PA 4UA8A 3D4GA 1OMPA 4F3SA 1DPPA 1Y1ZA 3MJNA 1NNKA 2AL4A 5I56B 1MPDA 1AMFA 4ECFA 1NNTA 1P1OA 2QJEA 1N84A 2OWSA 3MUQA 1MXVA 1OQGA 1A54A 2F6GA 5HM4B 3RTFB 3IB0A 4MH5A 1YCJA 3RQTA 2XD2A 1A55A 3KGCA 4R72A 1TWYA 3MPLA 5ITOA 4QFOA 5ICQA 4JSOA 1Y20A 4KR5A 1LAGE 5AA4A 3IO4A 3Q25A 1EZPA 4FATA 3K2DA 3CG1A 3FXQA 4JBZA 3MBPA 1IZ1A 1DTZA 2VD2A 5ELVA 3B6WA 4AB5A 4EDPA 2Y7PA 2FNCA 5AA1A 3SETA 2A5TA 3TCGA 3E3KA 2A5SA 2GH9A 2KLFA 1P1UA 1XVXA 5H8SA 4BDRA 3N5LA 2DVCA 4OYVA 2NWJA 3R6UA 3FUZA 1T0KA 4ZE9A 2THIA 3TQWA 4RK9A 2QPQA 3FVKA 3C36A 1USYH 4U4SA 3M3FA 3T9XB 3ONMA 2FYIA 4NF8A 3T96B 3U93A 5TU0A 1B3HA 2UVHA 5I84A 2DVZA 1JQFA 3K6XA 3S9EA 2ZNTA 4LP2B 1R9LA 3PGFA 2XXRA 3PUYE 3R26A 2W7YA 1A40A 4FAJA 3K1NA 3LSWA 4F1VA 3MQ9A 5CMMA 4R9GA 4YAHX 2PMSA 3G3JA 2QS2A 1MY0A 4H0WA 5IKBA 4MLQA 1H43A 1LBCA 1B58A 3OOAA 3MPKA 3WAEA 2XXYA 2ZYOA 3G3HA 3IOVA 1SVXB 4TOZA 4GOTA 3FJGA 3CFLA 2XX7A 3OSQA 2R71A 1O7TA 1MXZA 2I3VA 4R75A 3FXUA 3OXNA 4ZS9A 1XOCA 5CI5A 2HZLA 3N94A 4HCYA 4F1UA 1US4A 4POWA 3C31A 1MM7A 3GLBA 1B32A 3OO6A 2HAVA 3DP8A 1XHYA 3I5OA 2XXUA 4MFIA 4YICA 4EF1A 3GBBA 3MWBA 2OLBA 1O63A 2PT1A 3VLWA 1B3GA 3EQ1A 3FV2A 2B65A 2RCAA 3BFTA 2Z8FA 3FXRA 3LSXA 3HHGA 1PEBA 5TP9B 4ELOA 2OJTA 4H6DA 4QSDA 3A09A 4EXKA 5H8NB 3O28A 4R6KA 1QW0A 2QS3A 1B46A 3ODBA 2RC9A 1AL3A 3G7WA 4G68B 2RCBA 3RGYA 3SESA 4LVQA 1MQIA 3SDFA 3KSXA 4HW8A 3O6HA 3W9VA 4DXUA 1B5HA 3LSFB 3PMWA 5CM6A 2I0BA 1RYXA 4EF2A 1QVSA 2R6GE 4Q5TA 4C1TA 3T66A 3UA8A 4KD5A 1SW5A 4YKJA 1BP5A 4U4XA 3V83A 1H3DA 2GRVA 1QKBA 5DTBA 5KZTA 2YLNA 3K00A 3PD8A 5ISUA 3O6GA 1I6BA 4GQOA 1HSEA 1OIBA 4H8JA 2E0SA 1M5BA 4I62A 4NE4A 1MRPA 1DSNA 1GV8A 3MZ1A 3FJMA 1MH4A 3W15C 1B7HA 2F7AA 2REJA 1XT8A 1PB8A 3KSJA 3TTMA 3EN3A 1Z7NE 1B7UA 4F3BA 3S2VA 2D5WA 4GWOA 3ILUB 2F97A 4H67A 3DLNA 5DVIA 3C32A 5JTYB 4OESA 4R74A 2DXRA 3TKDA 4F3GA 1FTMA 3FVNA 3FATA 1IUDA 1MXWA 1IXHA 4LQ2A 3HCQA 4PFUA 4LZ8A 4X48A 3K6WA 4RPOA 3P7IA 3O6IA 4G77A 5L9OA 4NWDA 5JEIA 2DWHA 3IB1A 2HAUA 2ZXTA 1S7YA 4GLIA 1NH7A 1QUKA 1MPCA 1LAHE 1SYIA 5JTYA 1MH3A 3GBAA 2RINA 3ECRA 4U23A 4PQJA 2CZLA 1PB9A 4P0GA 4DIGA 3KJ7A 1NNFA 3FJ7A 3PUVE 3Q27A 3K4UA 3CSGA 2O7IA 3TODA 2Y84A 2NOOA 5I2NB 4F18A 1AOVA 3O9PA 1SW2A 4I1DA 5TPAA 5H8FB 3O66A 4FORA 4G2ZA 2B3FA 5CMCA 3MVWA 2BJJX 2I58A 4JXIA 2Y7IA 4GL8A 2DP8A 3ZKLA 4BDOA 3KJTA 1MM6A 3SEUA 2HEUA 4N13A 1OVBA 1EZ9A 3MP1A 3H3GA 1A99A 4RJZA 3IAZA 4QFPA 2H25A 5CMKA 4RXLA 1B51A 1EU8A 3HSTA 1B3LA
chains in the Genus database with same CATH superfamily
1O64A 3PMXA 1USYE 4GIZA 3SEWA 3S9MC 3CFXA 3C35A 3UN6A 1KWHA 3MVXA 3Q29A 3OENA 1JETA 2NVUB 2H5YA 4IO3A 1LFHA 5H8QA 2ZZWA 4QSCA 4EQ9A 1UTBB 4HTGA 4OANA 2B4MA 4QBAA 3JZJA 1MDQA 4GX6A 4YZZA 3PPQA 4Q0CA 3G3IA 3M3KA 2FBPA 3IJXB 1MXUA 1NV4A 2I3WA 1SW1A 1TXFA 1K9YA 4QXDA 5CBSA 2HPGA 5EQAA 3T0JA 1RDZA 1MQHA 1FPLA 4ZE8A 5EHMA 1N7XA 2QSXA 4N17A 4OTEA 3AXFA 2F3BA 2QVUA 4F29A 1P1QA 3PUWE 3LSLA 4WEDA 1INPA 4TLMB 4OFJA 3B6TA 3LBSA 4DDDA 1BLFA 1WDNA 4RPNA 4KPTA 3ILTB 1XC1A 1FQBA 2P1SA 1H44A 4P9KA 5AA4B 2Y7RA 1IXGA 1LGBC 2I48A 4O7IA 1TFAA 1FQFA 3KFMA 1FPDA 3D1RA 1LAFE 4THIA 2ZYKA 2CZHA 4HS7A 2CEYA 2ZNSA 5DVFA 4R2FA 4PF8A 1FJ9A 4NGUA 2DYXA 5FBPA 2AIXA 4AB6A 1NV6A 2A5TB 3TTNA 4F1YA 4HE0A 1LFIA 1BK4A 2V93A 1NNPA 3OD7A 4I8CA 1EYIA 4G8MA 1AWBA 3QSLA 3K0VA 1ZU0A 5IAIA 4NF0A 4NMYA 5HPQA 2VP1A 1JVXA 1R1NA 1UIUA 1FJ6A 3TAJA 3U65A 4NF8B 3BIHA 4EQBA 2CMOA 5EHSA 1WVJA 4XEQA 2HCAA 2D21A 3QUFA 4IO6A 2ZYNA 4GL0A 2HFBA 4IGRA 4NWCA 1Y4TA 1UTHA 4F2OA 4RYAA 2ZYMA 4OQOA 4FBPA 2XXHA 4O8MA 2XX9A 5KCJA 4LN5A 2WBBA 1H76A 2XA5A 4I9DA 3V89B 3V5AA 1ELJA 2IA4A 4PCDA 3QK6A 3B6QA 4MCOA 5I2KA 3H6TA 3OEMA 3S9NC 2V3UA 3C9HA 2P0SA 5K2YA 4NQ8A 4U2RA 3T9VA 4YKPA 4ELQA 3IJOB 4KXPA 3HFUA 4JWXA 3CVGA 4IO7A 2PFYA 1D9QA 4YB6A 1PBPA 1A8FA 3I6VA 5B7DA 4O3BA 2V25A 5IM2A 1DTGA 2XD3A 3EHUA 1B52A 2QRYA 4PGNA 4F19A 3MP8A 3N6UA 5FHMA 1GVCA 3IR1A 5KDTA 4PFTA 4MBPA 2UYEA 2KQZA 3UGWA 4N91A 1RYOA 2XXPA 3MVYA 3MYUA 2WKYA 1B4ZA 1LBXA 4O3AA 3KN3A 1ZTYA 4PP0A 3A3UA 4PC9A 1VFEA 3SKPA 1HSLA 3HHFA 4QHQA 2O6AA 5LOMA 4OVTA 5DEXA 1FQAA 3FIRA 4KCDA 4GRKA 4GWWA 3KOSA 1NH8A 1FRPA 2I4CA 2DXYA 4GFRA 4IGTA 1N3WA 4PAIA 4ZEKA 1KA1A 2ZMBA 1DK4A 3QUJA 1FBHA 2DOJA 3FXBA 3KN8A 4XKRA 3W9WA 3G3FA 3S9LC 2DE4A 4WEPA 3KG2A 1ZJLA 3O2AA 4P3LA 1IQ7A 5I57A 1B3EA 4JWOA 2VPNA 1IXIA 1YXIA 4PBQA 2HZKA 3E4RA 3T93B 1B9JA 5K2XA 3RYDA 2NUVA 1LB8A 2QS4A 1FTJA 4IO4A 4GWZA 1US5A 4XKPA 3PUXE 3Q28A 2QVRA 3THIA 4GX3A 1S9TA 1JP4A 4OVQA 4QFKA 3IB2A 3R7XA 4ONYA 3E9XA 1Y4CA 2DWJA 2QS1A 1SPIA 4C1UA 4MAGA 1D9VA 2XX8A 2G29A 3HV1A 2I6EA 1LCTA 5I5PA 1VDWA 2O51A 3G3KA 4HXVA 3PMVA 1KA0A 3DP4A 1MY1A 1BTJA 2Y7WA 1MS7A 2PCRA 2F36A 4ZEIA 2Q88A 1FPKA 2OWTA 3RTWB 3ISPA 4E0XA 2F8DA 3K1PA 3USDA 1D9YA 4GXSB 4ELRA 1SD3A 2H4IA 4LQ5A 2VGQA 3OSRA 3H6VA 2HHMA 2XXXA 4OZ9A 1IITA 1K9ZA 4IO5A 2R9JA 1NUXA 3CRBA 3TEPA 1OQHA 3PPOA 1VR5A 3MW0A 4GVOA 5H8HB 3RN8A 4G8HA 4MMPA 1MDP1 4FEBA 2V3TA 1NKXA 2H98A 2XXTA 3VFJA 3PV0E 3OEKA 1IMDA 3JV9A 2ONSA 3TYHA 3NOHA 2YPNA 3KOTA 4PDDA 4KYSA 4DI4B 2OCUA 1PB7A 1LBBA 1SDXA 1EH3A 3E78A 3SERA 3QIMA 1EZOA 4LUBA 4P47A 3IO6A 2OBGA 5H8HA 3IORA 1UIVA 3SZPA 1FW0A 4NG7A 3RY3A 3DM0A 2RC8A 5TPAB 1P1WA 2GHAA 4Z7EA 5I7IA 4LATA 2RKMA 1ZMGA 4FE8A 4X04A 1M5CA 1IEJA 1JNFA 1FBDA 1F9BA 4RA1A 2Q9TA 4GF8A 3MSTA 3WAFA 1SI0A 2XWIA 4U21A 4UACA 1MY2A 4N6PA 1D3KA 2XXKA 1D4NA 4N8GA 3TQLA 4POXA 4U1OA 4YB7A 5CRYA 4YKIA 4NTLA 1FBPA 2XWOA 1P1NA 4OFLA 2DQVA 2FIXA 4ESWA 3TTLA 3B7DA 4PAKA 2VOZA 4G68C 5H8QB 4DE8A 2UVIA 4PFIA 2H99A 4MF3A 1VSOA 1IXCA 3C34A 3FZVA 4M4GA 1YAEA 1NI9A 3MZBA 4KFQA 2VPOA 3LV0A 4JVIA 1LFGA 1B1XA 4NF6B 5J1DA 3M8UA 1MY4A 4OENA 4OA4A 4XKQA 3IFCA 4RK2A 5AE4A 4GBWA 3CFZA 4IR8A 4MNPA 1MQJA 1YYZA 1I6AA 1SI1A 4NHBA 2O1LA 4TQUQ 4ESXA 2REGA 3VLUA 3RNNA 4JDFA 4LA9A 3O97A 3L6GA 4N07A 2M8CA 4R6YA 3TTKA 3IFAA 4OMBA 1A7LA 3N26A 5L9MA 5FTIA 4ZZEA 4NF6A 4OXVA 2GHBA 3C33A 1N04A 2DWAA 1GR2A 4IY5A 5I59A 1N7WA 2O7UA 4MEVA 3OELA 3BIGA 4JWYA 2UVJA 2ANJA 1FQCA 2ALUA 1MQGA 1QUIA 2Z23A 1IMEA 3H4ZA 4OVSA 2ONRA 3K1MA 4NF4A 4ISUA 1MPBA 5ET7A 2ZZXA 2PBWA 5A5LA 4Q8RA 1DOTA 3T9UA 5LTCA 4TLLB 1OLAA 1XVYA 1AH5A 4X1DA 3IK6B 3PPNA 3EKIA 2OWZA 3LC8A 2UXAA 2X7QA 3CR9A 4P11A 5AA2B 3OO8A 1NV7A 4PFRA 4OFOA 2O69A 4R2BA 1Y3QA 3VXCA 3D4CA 2QL3A 2VHAA 2PVUA 3GZGA 4C0RA 3U94A 4DZ1A 4IB2A 4FEDA 1B0LA 3KC1A 5FHOA 2PYYA 5DVJA 1PDAA 1B5JA 4G8NA 1B1HA 3JYRA 2XWVA 4MHFA 1Y1MA 2E1SA 1OVTA 3DELB 4KI0E 4H45A 3BKIB 1IIWA 4IY6A 4JB7A 1DPEA 1UTHB 1R9QA 1ZBMA 2O68A 1TT1A 5AA2A 2Q2CA 4MX6A 1SYHA 4HCWA 3TUSA 2PX1A 1POTA 2YJPA 5KCJB 1XS5A 1MY3A 2XXQA 2FA7A 4OEVA 2AYSA 2V84A 5I56A 4P1LA 2XXWA 2HXRA 1Z7ME 4XKNA 5I2KB 5IGAA 3KEIA 1FPBA 4ZECA 3UORA 1A8EA 1QKAA 4EUOA 1NUYA 2V3QA 1BKAA 3F11A 1LB9A 1FQDA 3I3VA 5M2VA 1URDA 2PT2A 4H1XA 2VD3A 3ZS6A 4P56A 3FVGA 2ESNA 3A29A 2UVGA 3E13X 1B3FA 4F39A 4KCCA 3OO7A 2F6PA 4I40A 4OWDA 4QSEA 4NF5B 5BWJA 1YTVA 3OMBA 5HBCA 2D3IA 3MAMA 3TCFA 4BDLA 1FSAA 4JVDA 4ND9A 4DI3D 4FIMA 5KDTB 5F1QA 3SEYA 4DXBA 2GFEA 3RLFE 3UK4A 1B7ZA 2F78A 3Q26A 4X9TA 4GWUA 3PPPA 4PAFA 3M3LA 4O3CA 4OVJA 4F22A 2R8TA 2DE3A 5DYHA 2Q2AA 3TCHA 3UIFA 2B3BA 4KHZE 1JW4A 2ONKE 5EYFA 4NF5A 3VVDA 2F7CA 1FPGA 1NV1A 5DT6A 4N8YA 3QXMA 5CC2A 1RDYA 3H6UA 5DEXB 1RDXA 4YU0A 5AA3A 4N4UA 3U72A 4F31B 1L5TA 2DSFA 4BDQA 2B4LA 1IMBA 3G3GA 2XWKA 2HXWA 3U8QA 3TZAA 3FD3A 1ZIUA 1PC3A 4KYDA 4OHNA 3K02A 3MVZA 4PE3A 1II5A 3T9HB 1NUZA 3IOUA 3CSBA 3ZSFA 4PF6A 5EYGA 4ZEDA 3ZKKA 1B05A 4XIGQ 1SBPA 3K01A 3DP6A 3K6UA 1RKMA 5I57B 1ANFA 3RPWA 3QAXA 1B4HA 4NAPA 1P99A 2CZKA 4QFNA 1POY1 2ABHA 3PUZE 4QFLA 1JW1A 1I69A 4O7MA 4DLDA 3TFLA 3MP6A 4R73A 3PU5A 3FGSA 3T22A 1S50A 4FJPA 4PFWA 4GBVA 4H5GA 4LONB 4YB5A 3VXBA 1FPEA 1N76A 5JK4A 3TPAA 1Y3NA 1MXYA 4X1BA 4ZZAA 1YPNA 1DMBA 2OK2A 5T3JA 3RUMA 3V8XB 1FCKA 4P8BA 3U1OA 2DWIA 1B40A 3H7MA 4XTCQ 3MC2A 3IL1B 1NV3A 5CMBA 2MKZA 3UP9A 2DS9A 4ELPA 1B6HA 3T1BA 4K3FA 5F7VA 1FTOA 1CNQA 1Q1KA 4ZEFA 1CB6A 2F34A 2P2AA 2X26A 3TELA 2ZZVA 5ET6A 5TP9A 2RC7A 5AA2D 1QJMA 1NMUA 1QGXA 4E0WA 4H65A 5H8NA 3SEXA 3FVOA 2XXIA 3BFUA 4JVCA 3TDJA 4P1EA 4AS5A 5I58B 1NL5A 1M5FA 1LSTA 1R6ZA 4KQPA 1M5DA 1J1NA 1QULA 4GX4A 2RF1A 1LAXA 2NXOA 4HE2A 2AL5A 3U92A 4G68A 4NEDA 4WKMA 4EQ7A 3PD9A 3A3CA 3EF7A 4N81A 3SEVA 1SQYA 4JSDA 4DXCA 4UABA 4H5FA 4KYEA 2IEEA 4YMBA 3HN0A 3QYTA 2XXVA 3FASA 3S4UA 3H06B 5I58A 3IX1A 4U1ZA 2O1MA 1LLSA 4BDMA 1N3XA 4XXUA 4GWSA 1ZLQA 4BDNA 4Z0IA 1Q35A 4F2QA 1B0HA 3TMGA 4PFYA 2Z22A 1I6QA 3KN7A 2F5XA 1AIVA 3CI8A 1WODA 4ZDMA 2DE2A 4LZ7A 4WXJA 3VDFA 4OEUA 1PBQA 4GXAA 2G93A 4PTKA 2XHDA 1VFDA 3O29A 3LR1A 3VVEA 4LZ5A 2I4BA 5BUUA 2OZZA 1B2HA 5ESYA 1H45A 4N15A 5CBRA 4FECA 1VE4A 3GXAA 5B70A 1ZKBA 3RT6B 1OLCA 4PETA 5ITPA 2LAOA 3RT8A 3HO7A 3GYYA 3PPRA 1NV5A 4DCYA 1URSA 4DCXA 5ET5A 2ZNUA 1NFTA 2H9BA 2Z8DA 1NV2A 1URGA 4AQ4A 1JW5A 3CG3A 4HE1A 4XF5A 4QF9A 3IOTA 4AS4A 3HPIA 1LEVA 4PE5B 3EHTA 1GGGA 4F3PA 4YKKA 2QMXA 1LCFA 1KZ8A 3N6TA 4MNCA 1JEUA 2O84X 4L17A 4YMAA 3BBRA 1ATGA 3KC0A 1TFDA 1JVYA 3PTYA 1Y3PA 5IZ3A 5DW8A 2DDKA 2WYPA 3TTRA 5L8DA 3H6WA 3KBRA 5ICTA 5I59B 3H03A 5L9SA 4MLVA 2Z8EA 3CIJA 5I2NA 2Q89A 4NN3A 2Q8MA 2F3DA 4GD5A 1FBFA 2UYFA 2Y7KA 3FV1A 3MZ9A 4NF4B 1IMFA 2HQ0A 4R6HA 4M1VA 2F7BA 1BIYA 2I49A 5H8FA 1Y9UA 2GQ1A 4ZEBA 3C4MA 4IO2A 1N0TA 5FTHA 4U22A 5A5XB 4OERA 4RNSA 3IOWA 4H8IA 1MXXA 3ROJA 1FQEA 4Q30B 1DBZA 1M5EA 1QUJA 3KZGA 3VLVA 2QMWA 1B5IA 4BLAA 4G4PA 1MQDA 1FTKA 4GWYA 4OETA 3L6HA 4EXLA 2I0CA 3EPEA 1HSJA 4P0IA 4RY1A 1SW4A 2BJIA 3VVFA 1GTKA 4QRZA 1MG1A 3VE1B 4MIJA 3K6VA 1UQWA 2Q8JA 1CE2A 2F35A 5A5XA 3VV5A 3OO9A 2P3NA 1FTLA 5EQ7A 1UTBA 3EHSA 2FHYA 1JEVA 5FHNA 4R9FA 3LUYA 2X7PA 4UA8A 3D4GA 4MJOA 1OMPA 4F3SA 2JJKA 3RPLB 1DPPA 1Y1ZA 3MJNA 1NNKA 2AL4A 5I56B 3CHGA 1MPDA 1AMFA 4ECFA 1NNTA 1P1OA 5EQ9A 2QJEA 3KBZA 1N84A 2OWSA 3MUQA 1MXVA 4PFBA 1OQGA 1A54A 2F6GA 5HM4B 3RQTA 3IB0A 4MH5A 1YCJA 3RTFB 2XD2A 1A55A 3KGCA 4R72A 1TWYA 5F24A 3MPLA 5ITOA 4QFOA 5ICQA 4MNIA 4JSOA 3RPLA 1Y20A 4KR5A 1LAGE 5AA4A 2P3VA 3IO4A 3Q25A 1EZPA 4FATA 3K2DA 3CG1A 3FXQA 5IZ1A 4JBZA 3MBPA 1IZ1A 1DTZA 2VD2A 4NX1A 5ELVA 3B6WA 4AB5A 4EDPA 2Y7PA 2FNCA 5AA1A 3SETA 2QVVA 4PDHA 2Q74A 2A5TA 3TCGA 3E3KA 2A5SA 2GH9A 2KLFA 1P1UA 1XVXA 5H8SA 4BDRA 3N5LA 2DVCA 4OYVA 1LBWA 2NWJA 3R6UA 3FUZA 1LBYA 1T0KA 4ZE9A 2THIA 3TQWA 4RK9A 2QPQA 3FVKA 3C36A 1USYH 1NUWA 4U4SA 3M3FA 3T9XB 4I3YA 3QMFA 3ONMA 2FYIA 4NF8A 1FPIA 3T96B 4O94A 4I3EA 3U93A 5TU0A 1B3HA 2UVHA 1FPFA 4N6KA 5I84A 3B50A 2DVZA 1JQFA 3K6XA 3S9EA 2ZNTA 4LP2B 1R9LA 3PGFA 2XXRA 3PUYE 3R26A 2W7YA 1A40A 4FAJA 3K1NA 3LSWA 4F1VA 3MQ9A 5CMMA 4R9GA 4YAHX 2PMSA 3G3JA 2QS2A 4GWXA 1MY0A 4H0WA 5IKBA 4MLQA 1H43A 1LBCA 1B58A 1FTAA 3OOAA 3MPKA 3WAEA 2XXYA 2ZYOA 3G3HA 3IOVA 1SVXB 1EYKA 4TOZA 4GOTA 3FJGA 3CFLA 2XX7A 3OSQA 2R71A 1O7TA 4XFEA 3LUZA 1MXZA 4PGPA 2I3VA 3B8BA 4R75A 3FXUA 3OXNA 4ZS9A 1XOCA 5CI5A 2HZLA 3N94A 1YZ0A 4HCYA 4F1UA 2FIEA 1US4A 4POWA 3C31A 1MM7A 3GLBA 2KR0A 1B32A 3OO6A 2HAVA 3DP8A 1XHYA 3I5OA 2Y5KA 2WEFA 2XXUA 4MFIA 4YICA 4EF1A 3GBBA 4PBHA 3MWBA 2OLBA 1O63A 2PT1A 3VLWA 1B3GA 3FBPA 1FBEA 3EQ1A 3FV2A 5J16A 2B65A 2RCAA 3BFTA 2Z8FA 2QFLA 3FXRA 3LSXA 3HHGA 1PEBA 5TP9B 4OVRA 4ELOA 2OJTA 4H6DA 4QSDA 3A09A 4EXKA 5H8NB 3O28A 4R6KA 1QW0A 2QS3A 1B46A 3ODBA 2RC9A 1AL3A 3G7WA 4G68B 1XI6A 2RCBA 3RGYA 3SESA 4LVQA 1MQIA 3SDFA 4OVPA 3KSXA 4HW8A 5EQ8A 3O6HA 3W9VA 4DXUA 1B5HA 3LSFB 3PMWA 5CM6A 2I0BA 1RYXA 4EF2A 1G0IA 1QVSA 2R6GE 4Q5TA 4C1TA 3T66A 3UA8A 4KD5A 1SW5A 1FBCA 4YKJA 1BP5A 4U4XA 3V83A 1G0HA 2Y5LA 2V4CA 1H3DA 2GRVA 1QKBA 5DTBA 5KZTA 2YLNA 3K00A 3PD8A 3E79A 5ISUA 3O6GA 1I6BA 4GQOA 1HSEA 1OIBA 4H8JA 2E0SA 1M5BA 4I62A 4NE4A 2CEXA 5IZZA 1MRPA 1DSNA 1GV8A 3MZ1A 3FJMA 1MH4A 3W15C 1B7HA 2F7AA 2REJA 1XT8A 1PB8A 3KSJA 3TTMA 5EYHA 3EN3A 1Z7NE 1B7UA 1Q9DA 4F3BA 1FBGA 3S2VA 2D5WA 4X8RA 4GWOA 3ILUB 2F97A 5ET8A 4H67A 2FVZA 4G61A 3DLNA 5DVIA 1IMAA 5I3SA 3C32A 5JTYB 4OESA 4R74A 2DXRA 1NV0A 3TKDA 4F3GA 1FTMA 3FVNA 3FATA 1IUDA 1MXWA 2L5VA 1IXHA 4LQ2A 3HCQA 4PFUA 4LZ8A 4X48A 3K6WA 2PFZA 4RPOA 3P7IA 3O6IA 4G77A 5L9OA 4NWDA 5JEIA 2DWHA 3IB1A 1LBZA 2HAUA 2ZXTA 1S7YA 4GLIA 1NH7A 1QUKA 1MPCA 1LAHE 2CZIA 1SYIA 5JTYA 1MH3A 2VT5A 5IZ3B 3GBAA 2RINA 3ECRA 4U23A 4PQJA 2CZLA 1PB9A 4P0GA 4DIGA 3KJ7A 1NNFA 3FJ7A 5LDZA 3PUVE 3Q27A 3K4UA 3CSGA 2O7IA 2WYKA 3TODA 1EYJA 4N6DA 2Y84A 2NOOA 5I2NB 4F18A 1AOVA 1FPJA 3O9PA 1SW2A 4I1DA 5TPAA 5H8FB 3O66A 4FORA 4G2ZA 2B3FA 5CMCA 3MVWA 2BJJX 2I58A 4JXIA 2Y7IA 4GL8A 2DP8A 3ZKLA 2WBDA 3KJTA 1MM6A 3SEUA 4BDOA 2HEUA 4N13A 1OVBA 1EZ9A 4H46A 1IMCA 3MP1A 2OX3A 1DCUA 3H3GA 1A99A 4RJZA 1LBVA 3IAZA 4QFPA 2H25A 5CMKA 4RXLA 1B51A 1EU8A 2WX9A 3HSTA 1B3LA
chains in the Genus database with same CATH topology
1O64A 3PMXA 1USYE 4GIZA 3SEWA 3S9MC 3CFXA 3C35A 3UN6A 1KWHA 3MVXA 3Q29A 3OENA 1JETA 2NVUB 2H5YA 4IO3A 1LFHA 5H8QA 4QSCA 4EQ9A 1UTBB 4HTGA 3JZJA 1MDQA 4YZZA 3PPQA 4Q0CA 3G3IA 3M3KA 3IJXB 1MXUA 2I3WA 1SW1A 1TXFA 5CBSA 1MQHA 4ZE8A 5EHMA 1N7XA 2QSXA 4OTEA 3AXFA 4F29A 1P1QA 3PUWE 3LSLA 4WEDA 4TLMB 4OFJA 3B6TA 3LBSA 4DDDA 1BLFA 1WDNA 4RPNA 4KPTA 3ILTB 1XC1A 1FQBA 2P1SA 1H44A 5AA4B 2Y7RA 1IXGA 1LGBC 2I48A 1TFAA 1FQFA 3KFMA 1LAFE 4THIA 2ZYKA 4HS7A 2ZNSA 5DVFA 4R2FA 2DYXA 2AIXA 4AB6A 2A5TB 3TTNA 4F1YA 1LFIA 2V93A 1NNPA 3OD7A 4I8CA 4G8MA 3QSLA 3K0VA 1ZU0A 5IAIA 4NMYA 5HPQA 2VP1A 1JVXA 1R1NA 1UIUA 3TAJA 4NF8B 4EQBA 2CMOA 5EHSA 1WVJA 2HCAA 2D21A 3QUFA 4IO6A 2ZYNA 4GL0A 2HFBA 4IGRA 4NWCA 1Y4TA 1UTHA 4F2OA 4RYAA 2ZYMA 4OQOA 2XXHA 2XX9A 5KCJA 1H76A 4I9DA 3V89B 3V5AA 1ELJA 2IA4A 3QK6A 3B6QA 5I2KA 3H6TA 3OEMA 3S9NC 2V3UA 3C9HA 2P0SA 5K2YA 4U2RA 3T9VA 4YKPA 4ELQA 3IJOB 4JWXA 3CVGA 4IO7A 4YB6A 1PBPA 1A8FA 3I6VA 5B7DA 4O3BA 2V25A 1DTGA 2XD3A 3EHUA 1B52A 2QRYA 4F19A 3MP8A 3N6UA 5FHMA 1GVCA 3IR1A 5KDTA 4PFTA 4MBPA 2UYEA 3UGWA 1RYOA 2XXPA 3MVYA 2WKYA 1B4ZA 4O3AA 3KN3A 1ZTYA 4PP0A 3A3UA 1VFEA 3SKPA 1HSLA 3HHFA 4QHQA 2O6AA 5LOMA 5DEXA 1FQAA 3FIRA 4KCDA 4GRKA 3KOSA 1NH8A 2I4CA 2DXYA 4GFRA 4IGTA 1N3WA 4ZEKA 2ZMBA 3QUJA 2DOJA 3KN8A 4XKRA 3W9WA 3G3FA 3S9LC 2DE4A 4WEPA 3KG2A 1ZJLA 3O2AA 1IQ7A 5I57A 1B3EA 4JWOA 1IXIA 2HZKA 3E4RA 3T93B 1B9JA 5K2XA 2NUVA 1LB8A 2QS4A 1FTJA 4IO4A 1US5A 4XKPA 3PUXE 3Q28A 3THIA 1S9TA 4QFKA 3IB2A 3R7XA 4ONYA 3E9XA 1Y4CA 2DWJA 2QS1A 4C1UA 1D9VA 2XX8A 2G29A 3HV1A 2I6EA 1LCTA 2O51A 3G3KA 3PMVA 3DP4A 1MY1A 1BTJA 2Y7WA 1MS7A 2F36A 4ZEIA 2Q88A 2OWTA 3RTWB 4E0XA 2F8DA 3K1PA 3USDA 1D9YA 4GXSB 4ELRA 1SD3A 2H4IA 4LQ5A 2VGQA 3OSRA 3H6VA 2XXXA 4OZ9A 1IITA 4IO5A 2R9JA 3CRBA 3TEPA 1OQHA 3PPOA 1VR5A 3MW0A 4GVOA 5H8HB 3RN8A 4G8HA 1MDP1 4FEBA 2V3TA 1NKXA 2H98A 2XXTA 3VFJA 3PV0E 3OEKA 3JV9A 2ONSA 3TYHA 2YPNA 3KOTA 4KYSA 2OCUA 1PB7A 1LBBA 1SDXA 1EH3A 3SERA 3QIMA 1EZOA 4LUBA 3IO6A 2OBGA 5H8HA 3IORA 1UIVA 1FW0A 3RY3A 3DM0A 2RC8A 5TPAB 1P1WA 2GHAA 4Z7EA 4LATA 2RKMA 1ZMGA 4FE8A 1M5CA 1IEJA 1JNFA 1F9BA 4RA1A 2Q9TA 4GF8A 3WAFA 1SI0A 4U21A 4UACA 1MY2A 4N6PA 1D3KA 1D4NA 3TQLA 4POXA 4U1OA 4YB7A 5CRYA 4YKIA 4NTLA 1P1NA 4OFLA 2DQVA 4ESWA 3TTLA 3B7DA 2VOZA 4G68C 5H8QB 4DE8A 2UVIA 2H99A 4MF3A 1VSOA 1IXCA 3C34A 3FZVA 4M4GA 1YAEA 3MZBA 4KFQA 1LFGA 1B1XA 4NF6B 5J1DA 3M8UA 1MY4A 4OENA 4XKQA 4RK2A 5AE4A 3CFZA 1MQJA 1I6AA 1SI1A 2O1LA 4TQUQ 4ESXA 2REGA 3VLUA 3RNNA 4JDFA 4LA9A 3O97A 3L6GA 4N07A 2M8CA 4R6YA 3TTKA 4OMBA 1A7LA 3N26A 5L9MA 5FTIA 4ZZEA 4NF6A 4OXVA 2GHBA 3C33A 1N04A 2DWAA 1GR2A 4IY5A 5I59A 1N7WA 2O7UA 3OELA 4JWYA 2UVJA 2ANJA 1FQCA 2ALUA 1MQGA 1QUIA 2Z23A 3H4ZA 2ONRA 3K1MA 4NF4A 4ISUA 1MPBA 2PBWA 4Q8RA 1DOTA 3T9UA 4TLLB 1OLAA 1XVYA 1AH5A 4X1DA 3IK6B 3PPNA 3LC8A 2UXAA 2X7QA 3CR9A 4P11A 5AA2B 3OO8A 4OFOA 2O69A 4R2BA 1Y3QA 3VXCA 3D4CA 2QL3A 2VHAA 2PVUA 3GZGA 4C0RA 3U94A 4DZ1A 4IB2A 4FEDA 1B0LA 5FHOA 2PYYA 5DVJA 1PDAA 1B5JA 4G8NA 1B1HA 3JYRA 1Y1MA 2E1SA 1OVTA 3DELB 4KI0E 3BKIB 1IIWA 4IY6A 4JB7A 1DPEA 1UTHB 1R9QA 1ZBMA 2O68A 1TT1A 5AA2A 2Q2CA 1SYHA 4HCWA 3TUSA 2PX1A 1POTA 2YJPA 5KCJB 1XS5A 1MY3A 2XXQA 2FA7A 4OEVA 2AYSA 2V84A 5I56A 2XXWA 1Z7ME 4XKNA 5I2KB 3KEIA 4ZECA 3UORA 1A8EA 1QKAA 4EUOA 2V3QA 1BKAA 3F11A 1LB9A 1FQDA 3I3VA 5M2VA 1URDA 2PT2A 4H1XA 2VD3A 3ZS6A 3FVGA 2ESNA 2UVGA 3E13X 1B3FA 4F39A 4KCCA 3OO7A 2F6PA 4OWDA 4QSEA 4NF5B 5BWJA 1YTVA 3OMBA 5HBCA 2D3IA 3MAMA 3TCFA 4BDLA 4ND9A 4FIMA 5KDTB 5F1QA 3SEYA 4DXBA 2GFEA 3RLFE 3UK4A 1B7ZA 2F78A 3Q26A 4X9TA 3PPPA 3M3LA 4O3CA 4OVJA 4F22A 2DE3A 5DYHA 2Q2AA 3TCHA 3UIFA 2B3BA 4KHZE 1JW4A 2ONKE 5EYFA 4NF5A 3VVDA 2F7CA 5DT6A 3QXMA 5CC2A 3H6UA 5DEXB 4YU0A 5AA3A 3U72A 4F31B 1L5TA 2DSFA 4BDQA 3G3GA 2HXWA 3U8QA 3TZAA 3FD3A 1ZIUA 1PC3A 4KYDA 4OHNA 3K02A 3MVZA 1II5A 3T9HB 3IOUA 3CSBA 3ZSFA 4ZEDA 3ZKKA 1B05A 4XIGQ 1SBPA 3K01A 3DP6A 3K6UA 1RKMA 5I57B 1ANFA 3RPWA 3QAXA 1B4HA 1P99A 4QFNA 1POY1 2ABHA 3PUZE 4QFLA 1JW1A 1I69A 4DLDA 3TFLA 3MP6A 4R73A 3PU5A 3FGSA 3T22A 1S50A 4FJPA 4PFWA 4H5GA 4LONB 4YB5A 3VXBA 1N76A 5JK4A 3TPAA 1Y3NA 1MXYA 4X1BA 4ZZAA 1YPNA 1DMBA 2OK2A 3RUMA 3V8XB 1FCKA 3U1OA 2DWIA 1B40A 3H7MA 4XTCQ 3MC2A 3IL1B 5CMBA 3UP9A 2DS9A 4ELPA 1B6HA 4K3FA 5F7VA 1FTOA 1Q1KA 4ZEFA 1CB6A 2F34A 2P2AA 2X26A 3TELA 5TP9A 5AA2D 2RC7A 1QJMA 1NMUA 4E0WA 4H65A 5H8NA 3SEXA 3FVOA 2XXIA 3BFUA 3TDJA 5I58B 1NL5A 1M5FA 1LSTA 1R6ZA 4KQPA 1M5DA 1J1NA 1QULA 2RF1A 1LAXA 2NXOA 2AL5A 3U92A 4G68A 4NEDA 4WKMA 4EQ7A 3PD9A 3A3CA 3EF7A 3SEVA 1SQYA 4JSDA 4DXCA 4H5FA 4KYEA 2IEEA 4YMBA 3HN0A 3QYTA 2XXVA 3FASA 3S4UA 3H06B 5I58A 3IX1A 4U1ZA 2O1MA 1LLSA 4BDMA 1N3XA 4XXUA 1ZLQA 4BDNA 4Z0IA 1Q35A 4F2QA 1B0HA 3TMGA 4PFYA 2Z22A 1I6QA 3KN7A 2F5XA 1AIVA 3CI8A 1WODA 4ZDMA 2DE2A 4LZ7A 4WXJA 3VDFA 4OEUA 1PBQA 4GXAA 2G93A 2XHDA 1VFDA 3O29A 3LR1A 3VVEA 4LZ5A 2I4BA 5BUUA 2OZZA 1B2HA 1H45A 5CBRA 4FECA 1VE4A 3GXAA 5B70A 1ZKBA 3RT6B 1OLCA 4PETA 5ITPA 2LAOA 3RT8A 3HO7A 3PPRA 4DCYA 1URSA 4DCXA 2ZNUA 1NFTA 2H9BA 2Z8DA 1URGA 4AQ4A 1JW5A 3CG3A 4QF9A 3IOTA 3HPIA 4PE5B 3EHTA 1GGGA 4F3PA 4YKKA 2QMXA 1LCFA 3N6TA 1JEUA 2O84X 4L17A 4YMAA 3BBRA 1ATGA 1TFDA 1JVYA 1Y3PA 3TTRA 5L8DA 3H6WA 3KBRA 5ICTA 5I59B 3H03A 5L9SA 4MLVA 2Z8EA 3CIJA 5I2NA 2Q89A 4GD5A 2UYFA 2Y7KA 3FV1A 3MZ9A 4NF4B 2HQ0A 4R6HA 4M1VA 2F7BA 1BIYA 2I49A 5H8FA 1Y9UA 4ZEBA 3C4MA 4IO2A 1N0TA 5FTHA 4U22A 5A5XB 4OERA 4RNSA 3IOWA 4H8IA 1MXXA 1FQEA 3VLVA 4Q30B 1M5EA 1QUJA 3KZGA 2QMWA 1B5IA 4BLAA 4G4PA 1MQDA 1FTKA 4OETA 3L6HA 4EXLA 2I0CA 3EPEA 1HSJA 4P0IA 4RY1A 1SW4A 3VVFA 1GTKA 4QRZA 1MG1A 3VE1B 3K6VA 1UQWA 2Q8JA 1CE2A 2F35A 5A5XA 3VV5A 3OO9A 1FTLA 1UTBA 3EHSA 1JEVA 5FHNA 4R9FA 3LUYA 2X7PA 4UA8A 3D4GA 1OMPA 4F3SA 1DPPA 1Y1ZA 3MJNA 1NNKA 2AL4A 5I56B 1MPDA 1AMFA 4ECFA 1NNTA 1P1OA 2QJEA 1N84A 2OWSA 3MUQA 1MXVA 1OQGA 1A54A 2F6GA 5HM4B 3RTFB 3IB0A 4MH5A 1YCJA 3RQTA 2XD2A 1A55A 3KGCA 4R72A 1TWYA 3MPLA 5ITOA 4QFOA 5ICQA 4JSOA 1Y20A 4KR5A 1LAGE 5AA4A 3IO4A 3Q25A 1EZPA 4FATA 3K2DA 3CG1A 3FXQA 4JBZA 3MBPA 1IZ1A 1DTZA 2VD2A 5ELVA 3B6WA 4AB5A 4EDPA 2Y7PA 2FNCA 5AA1A 3SETA 2A5TA 3TCGA 3E3KA 2A5SA 2GH9A 2KLFA 1P1UA 1XVXA 5H8SA 4BDRA 3N5LA 2DVCA 4OYVA 2NWJA 3R6UA 3FUZA 1T0KA 4ZE9A 2THIA 3TQWA 4RK9A 2QPQA 3FVKA 3C36A 1USYH 4U4SA 3M3FA 3T9XB 3ONMA 2FYIA 4NF8A 3T96B 3U93A 5TU0A 1B3HA 2UVHA 5I84A 2DVZA 1JQFA 3K6XA 3S9EA 2ZNTA 4LP2B 1R9LA 3PGFA 2XXRA 3PUYE 3R26A 2W7YA 1A40A 4FAJA 3K1NA 3LSWA 4F1VA 3MQ9A 5CMMA 4R9GA 4YAHX 2PMSA 3G3JA 2QS2A 1MY0A 4H0WA 5IKBA 4MLQA 1H43A 1LBCA 1B58A 3OOAA 3MPKA 3WAEA 2XXYA 2ZYOA 3G3HA 3IOVA 1SVXB 4TOZA 4GOTA 3FJGA 3CFLA 2XX7A 3OSQA 2R71A 1O7TA 1MXZA 2I3VA 4R75A 3FXUA 3OXNA 4ZS9A 1XOCA 5CI5A 2HZLA 3N94A 4HCYA 4F1UA 1US4A 4POWA 3C31A 1MM7A 3GLBA 1B32A 3OO6A 2HAVA 3DP8A 1XHYA 3I5OA 2XXUA 4MFIA 4YICA 4EF1A 3GBBA 3MWBA 2OLBA 1O63A 2PT1A 3VLWA 1B3GA 3EQ1A 3FV2A 2B65A 2RCAA 3BFTA 2Z8FA 3FXRA 3LSXA 3HHGA 1PEBA 5TP9B 4ELOA 2OJTA 4H6DA 4QSDA 3A09A 4EXKA 5H8NB 3O28A 4R6KA 1QW0A 2QS3A 1B46A 3ODBA 2RC9A 1AL3A 3G7WA 4G68B 2RCBA 3RGYA 3SESA 4LVQA 1MQIA 3SDFA 3KSXA 4HW8A 3O6HA 3W9VA 4DXUA 1B5HA 3LSFB 3PMWA 5CM6A 2I0BA 1RYXA 4EF2A 1QVSA 2R6GE 4Q5TA 4C1TA 3T66A 3UA8A 4KD5A 1SW5A 4YKJA 1BP5A 4U4XA 3V83A 1H3DA 2GRVA 1QKBA 5DTBA 5KZTA 2YLNA 3K00A 3PD8A 5ISUA 3O6GA 1I6BA 4GQOA 1HSEA 1OIBA 4H8JA 2E0SA 1M5BA 4I62A 4NE4A 1MRPA 1DSNA 1GV8A 3MZ1A 3FJMA 1MH4A 3W15C 1B7HA 2F7AA 2REJA 1XT8A 1PB8A 3KSJA 3TTMA 3EN3A 1Z7NE 1B7UA 4F3BA 3S2VA 2D5WA 4GWOA 3ILUB 2F97A 4H67A 3DLNA 5DVIA 3C32A 5JTYB 4OESA 4R74A 2DXRA 3TKDA 4F3GA 1FTMA 3FVNA 3FATA 1IUDA 1MXWA 1IXHA 4LQ2A 3HCQA 4PFUA 4LZ8A 4X48A 3K6WA 4RPOA 3P7IA 3O6IA 4G77A 5L9OA 4NWDA 5JEIA 2DWHA 3IB1A 2HAUA 2ZXTA 1S7YA 4GLIA 1NH7A 1QUKA 1MPCA 1LAHE 1SYIA 5JTYA 1MH3A 3GBAA 2RINA 3ECRA 4U23A 4PQJA 2CZLA 1PB9A 4P0GA 4DIGA 3KJ7A 1NNFA 3FJ7A 3PUVE 3Q27A 3K4UA 3CSGA 2O7IA 3TODA 2Y84A 2NOOA 5I2NB 4F18A 1AOVA 3O9PA 1SW2A 4I1DA 5TPAA 5H8FB 3O66A 4FORA 4G2ZA 2B3FA 5CMCA 3MVWA 2BJJX 2I58A 4JXIA 2Y7IA 4GL8A 2DP8A 3ZKLA 4BDOA 3KJTA 1MM6A 3SEUA 2HEUA 4N13A 1OVBA 1EZ9A 3MP1A 3H3GA 1A99A 4RJZA 3IAZA 4QFPA 2H25A 5CMKA 4RXLA 1B51A 1EU8A 3HSTA 1B3LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O64 A;  3PMX A;  1USY E;  4GIZ A;  3SEW A;  3S9M C;  3CFX A;  3C35 A;  3UN6 A;  1KWH A;  3MVX A;  3Q29 A;  3OEN A;  1JET A;  2NVU B;  2H5Y A;  4IO3 A;  1LFH A;  5H8Q A;  4QSC A;  4EQ9 A;  1UTB B;  4HTG A;  3JZJ A;  1MDQ A;  4YZZ A;  3PPQ A;  4Q0C A;  3G3I A;  3M3K A;  3IJX B;  1MXU A;  2I3W A;  1SW1 A;  1TXF A;  5CBS A;  1MQH A;  4ZE8 A;  5EHM A;  1N7X A;  2QSX A;  4OTE A;  3AXF A;  4F29 A;  1P1Q A;  3PUW E;  3LSL A;  4WED A;  4TLM B;  4OFJ A;  3B6T A;  3LBS A;  4DDD A;  1BLF A;  1WDN A;  4RPN A;  4KPT A;  3ILT B;  1XC1 A;  1FQB A;  2P1S A;  1H44 A;  5AA4 B;  2Y7R A;  1IXG A;  1LGB C;  2I48 A;  1TFA A;  1FQF A;  3KFM A;  1LAF E;  4THI A;  2ZYK A;  4HS7 A;  2ZNS A;  5DVF A;  4R2F A;  2DYX A;  2AIX A;  4AB6 A;  2A5T B;  3TTN A;  4F1Y A;  1LFI A;  2V93 A;  1NNP A;  3OD7 A;  4I8C A;  4G8M A;  3QSL A;  3K0V A;  1ZU0 A;  5IAI A;  4NMY A;  5HPQ A;  2VP1 A;  1JVX A;  1R1N A;  1UIU A;  3TAJ A;  4NF8 B;  4EQB A;  2CMO A;  5EHS A;  1WVJ A;  2HCA A;  2D21 A;  3QUF A;  4IO6 A;  2ZYN A;  4GL0 A;  2HFB A;  4IGR A;  4NWC A;  1Y4T A;  1UTH A;  4F2O A;  4RYA A;  2ZYM A;  4OQO A;  2XXH A;  2XX9 A;  5KCJ A;  1H76 A;  4I9D A;  3V89 B;  3V5A A;  1ELJ A;  2IA4 A;  3QK6 A;  3B6Q A;  5I2K A;  3H6T A;  3OEM A;  3S9N C;  2V3U A;  3C9H A;  2P0S A;  5K2Y A;  4U2R A;  3T9V A;  4YKP A;  4ELQ A;  3IJO B;  4JWX A;  3CVG A;  4IO7 A;  4YB6 A;  1PBP A;  1A8F A;  3I6V A;  5B7D A;  4O3B A;  2V25 A;  1DTG A;  2XD3 A;  3EHU A;  1B52 A;  2QRY A;  4F19 A;  3MP8 A;  3N6U A;  5FHM A;  1GVC A;  3IR1 A;  5KDT A;  4PFT A;  4MBP A;  2UYE A;  3UGW A;  1RYO A;  2XXP A;  3MVY A;  2WKY A;  1B4Z A;  4O3A A;  3KN3 A;  1ZTY A;  4PP0 A;  3A3U A;  1VFE A;  3SKP A;  1HSL A;  3HHF A;  4QHQ A;  2O6A A;  5LOM A;  5DEX A;  1FQA A;  3FIR A;  4KCD A;  4GRK A;  3KOS A;  1NH8 A;  2I4C A;  2DXY A;  4GFR A;  4IGT A;  1N3W A;  4ZEK A;  2ZMB A;  3QUJ A;  2DOJ A;  3KN8 A;  4XKR A;  3W9W A;  3G3F A;  3S9L C;  2DE4 A;  4WEP A;  3KG2 A;  1ZJL A;  3O2A A;  1IQ7 A;  5I57 A;  1B3E A;  4JWO A;  1IXI A;  2HZK A;  3E4R A;  3T93 B;  1B9J A;  5K2X A;  2NUV A;  1LB8 A;  2QS4 A;  1FTJ A;  4IO4 A;  1US5 A;  4XKP A;  3PUX E;  3Q28 A;  3THI A;  1S9T A;  4QFK A;  3IB2 A;  3R7X A;  4ONY A;  3E9X A;  1Y4C A;  2DWJ A;  2QS1 A;  4C1U A;  1D9V A;  2XX8 A;  2G29 A;  3HV1 A;  2I6E A;  1LCT A;  2O51 A;  3G3K A;  3PMV A;  3DP4 A;  1MY1 A;  1BTJ A;  2Y7W A;  1MS7 A;  2F36 A;  4ZEI A;  2Q88 A;  2OWT A;  3RTW B;  4E0X A;  2F8D A;  3K1P A;  3USD A;  1D9Y A;  4GXS B;  4ELR A;  1SD3 A;  2H4I A;  4LQ5 A;  2VGQ A;  3OSR A;  3H6V A;  2XXX A;  4OZ9 A;  1IIT A;  4IO5 A;  2R9J A;  3CRB A;  3TEP A;  1OQH A;  3PPO A;  1VR5 A;  3MW0 A;  4GVO A;  5H8H B;  3RN8 A;  4G8H A;  1MDP 1;  4FEB A;  2V3T A;  1NKX A;  2H98 A;  2XXT A;  3VFJ A;  3PV0 E;  3OEK A;  3JV9 A;  2ONS A;  3TYH A;  2YPN A;  3KOT A;  4KYS A;  2OCU A;  1PB7 A;  1LBB A;  1SDX A;  1EH3 A;  3SER A;  3QIM A;  1EZO A;  4LUB A;  3IO6 A;  2OBG A;  5H8H A;  3IOR A;  1UIV A;  1FW0 A;  3RY3 A;  3DM0 A;  2RC8 A;  5TPA B;  1P1W A;  2GHA A;  4Z7E A;  4LAT A;  2RKM A;  1ZMG A;  4FE8 A;  1M5C A;  1IEJ A;  1JNF A;  1F9B A;  4RA1 A;  2Q9T A;  4GF8 A;  3WAF A;  1SI0 A;  4U21 A;  4UAC A;  1MY2 A;  4N6P A;  1D3K A;  1D4N A;  3TQL A;  4POX A;  4U1O A;  4YB7 A;  5CRY A;  4YKI A;  4NTL A;  1P1N A;  4OFL A;  2DQV A;  4ESW A;  3TTL A;  3B7D A;  2VOZ A;  4G68 C;  5H8Q B;  4DE8 A;  2UVI A;  2H99 A;  4MF3 A;  1VSO A;  1IXC A;  3C34 A;  3FZV A;  4M4G A;  1YAE A;  3MZB A;  4KFQ A;  1LFG A;  1B1X A;  4NF6 B;  5J1D A;  3M8U A;  1MY4 A;  4OEN A;  4XKQ A;  4RK2 A;  5AE4 A;  3CFZ A;  1MQJ A;  1I6A A;  1SI1 A;  2O1L A;  4TQU Q;  4ESX A;  2REG A;  3VLU A;  3RNN A;  4JDF A;  4LA9 A;  3O97 A;  3L6G A;  4N07 A;  2M8C A;  4R6Y A;  3TTK A;  4OMB A;  1A7L A;  3N26 A;  5L9M A;  5FTI A;  4ZZE A;  4NF6 A;  4OXV A;  2GHB A;  3C33 A;  1N04 A;  2DWA A;  1GR2 A;  4IY5 A;  5I59 A;  1N7W A;  2O7U A;  3OEL A;  4JWY A;  2UVJ A;  2ANJ A;  1FQC A;  2ALU A;  1MQG A;  1QUI A;  2Z23 A;  3H4Z A;  2ONR A;  3K1M A;  4NF4 A;  4ISU A;  1MPB A;  2PBW A;  4Q8R A;  1DOT A;  3T9U A;  4TLL B;  1OLA A;  1XVY A;  1AH5 A;  4X1D A;  3IK6 B;  3PPN A;  3LC8 A;  2UXA A;  2X7Q A;  3CR9 A;  4P11 A;  5AA2 B;  3OO8 A;  4OFO A;  2O69 A;  4R2B A;  1Y3Q A;  3VXC A;  3D4C A;  2QL3 A;  2VHA A;  2PVU A;  3GZG A;  4C0R A;  3U94 A;  4DZ1 A;  4IB2 A;  4FED A;  1B0L A;  5FHO A;  2PYY A;  5DVJ A;  1PDA A;  1B5J A;  4G8N A;  1B1H A;  3JYR A;  1Y1M A;  2E1S A;  1OVT A;  3DEL B;  4KI0 E;  3BKI B;  1IIW A;  4IY6 A;  4JB7 A;  1DPE A;  1UTH B;  1R9Q A;  1ZBM A;  2O68 A;  1TT1 A;  5AA2 A;  2Q2C A;  1SYH A;  4HCW A;  3TUS A;  2PX1 A;  1POT A;  2YJP A;  5KCJ B;  1XS5 A;  1MY3 A;  2XXQ A;  2FA7 A;  4OEV A;  2AYS A;  2V84 A;  5I56 A;  2XXW A;  1Z7M E;  4XKN A;  5I2K B;  3KEI A;  4ZEC A;  3UOR A;  1A8E A;  1QKA A;  4EUO A;  2V3Q A;  1BKA A;  3F11 A;  1LB9 A;  1FQD A;  3I3V A;  5M2V A;  1URD A;  2PT2 A;  4H1X A;  2VD3 A;  3ZS6 A;  3FVG A;  2ESN A;  2UVG A;  3E13 X;  1B3F A;  4F39 A;  4KCC A;  3OO7 A;  2F6P A;  4OWD A;  4QSE A;  4NF5 B;  5BWJ A;  1YTV A;  3OMB A;  5HBC A;  2D3I A;  3MAM A;  3TCF A;  4BDL A;  4ND9 A;  4FIM A;  5KDT B;  5F1Q A;  3SEY A;  4DXB A;  2GFE A;  3RLF E;  3UK4 A;  1B7Z A;  2F78 A;  3Q26 A;  4X9T A;  3PPP A;  3M3L A;  4O3C A;  4OVJ A;  4F22 A;  2DE3 A;  5DYH A;  2Q2A A;  3TCH A;  3UIF A;  2B3B A;  4KHZ E;  1JW4 A;  2ONK E;  5EYF A;  4NF5 A;  3VVD A;  2F7C A;  5DT6 A;  3QXM A;  5CC2 A;  3H6U A;  5DEX B;  4YU0 A;  5AA3 A;  3U72 A;  4F31 B;  1L5T A;  2DSF A;  4BDQ A;  3G3G A;  2HXW A;  3U8Q A;  3TZA A;  3FD3 A;  1ZIU A;  1PC3 A;  4KYD A;  4OHN A;  3K02 A;  3MVZ A;  1II5 A;  3T9H B;  3IOU A;  3CSB A;  3ZSF A;  4ZED A;  3ZKK A;  1B05 A;  4XIG Q;  1SBP A;  3K01 A;  3DP6 A;  3K6U A;  1RKM A;  5I57 B;  1ANF A;  3RPW A;  3QAX A;  1B4H A;  1P99 A;  4QFN A;  1POY 1;  2ABH A;  3PUZ E;  4QFL A;  1JW1 A;  1I69 A;  4DLD A;  3TFL A;  3MP6 A;  4R73 A;  3PU5 A;  3FGS A;  3T22 A;  1S50 A;  4FJP A;  4PFW A;  4H5G A;  4LON B;  4YB5 A;  3VXB A;  1N76 A;  5JK4 A;  3TPA A;  1Y3N A;  1MXY A;  4X1B A;  4ZZA A;  1YPN A;  1DMB A;  2OK2 A;  3RUM A;  3V8X B;  1FCK A;  3U1O A;  2DWI A;  1B40 A;  3H7M A;  4XTC Q;  3MC2 A;  3IL1 B;  5CMB A;  3UP9 A;  2DS9 A;  4ELP A;  1B6H A;  4K3F A;  5F7V A;  1FTO A;  1Q1K A;  4ZEF A;  1CB6 A;  2F34 A;  2P2A A;  2X26 A;  3TEL A;  5TP9 A;  5AA2 D;  2RC7 A;  1QJM A;  1NMU A;  4E0W A;  4H65 A;  5H8N A;  3SEX A;  3FVO A;  2XXI A;  3BFU A;  3TDJ A;  5I58 B;  1NL5 A;  1M5F A;  1LST A;  1R6Z A;  4KQP A;  1M5D A;  1J1N A;  1QUL A;  2RF1 A;  1LAX A;  2NXO A;  2AL5 A;  3U92 A;  4G68 A;  4NED A;  4WKM A;  4EQ7 A;  3PD9 A;  3A3C A;  3EF7 A;  3SEV A;  1SQY A;  4JSD A;  4DXC A;  4H5F A;  4KYE A;  2IEE A;  4YMB A;  3HN0 A;  3QYT A;  2XXV A;  3FAS A;  3S4U A;  3H06 B;  5I58 A;  3IX1 A;  4U1Z A;  2O1M A;  1LLS A;  4BDM A;  1N3X A;  4XXU A;  1ZLQ A;  4BDN A;  4Z0I A;  1Q35 A;  4F2Q A;  1B0H A;  3TMG A;  4PFY A;  2Z22 A;  1I6Q A;  3KN7 A;  2F5X A;  1AIV A;  3CI8 A;  1WOD A;  4ZDM A;  2DE2 A;  4LZ7 A;  4WXJ A;  3VDF A;  4OEU A;  1PBQ A;  4GXA A;  2G93 A;  2XHD A;  1VFD A;  3O29 A;  3LR1 A;  3VVE A;  4LZ5 A;  2I4B A;  5BUU A;  2OZZ A;  1B2H A;  1H45 A;  5CBR A;  4FEC A;  1VE4 A;  3GXA A;  5B70 A;  1ZKB A;  3RT6 B;  1OLC A;  4PET A;  5ITP A;  2LAO A;  3RT8 A;  3HO7 A;  3PPR A;  4DCY A;  1URS A;  4DCX A;  2ZNU A;  1NFT A;  2H9B A;  2Z8D A;  1URG A;  4AQ4 A;  1JW5 A;  3CG3 A;  4QF9 A;  3IOT A;  3HPI A;  4PE5 B;  3EHT A;  1GGG A;  4F3P A;  4YKK A;  2QMX A;  1LCF A;  3N6T A;  1JEU A;  2O84 X;  4L17 A;  4YMA A;  3BBR A;  1ATG A;  1TFD A;  1JVY A;  1Y3P A;  3TTR A;  5L8D A;  3H6W A;  3KBR A;  5ICT A;  5I59 B;  3H03 A;  5L9S A;  4MLV A;  2Z8E A;  3CIJ A;  5I2N A;  2Q89 A;  4GD5 A;  2UYF A;  2Y7K A;  3FV1 A;  3MZ9 A;  4NF4 B;  2HQ0 A;  4R6H A;  4M1V A;  2F7B A;  1BIY A;  2I49 A;  5H8F A;  1Y9U A;  4ZEB A;  3C4M A;  4IO2 A;  1N0T A;  5FTH A;  4U22 A;  5A5X B;  4OER A;  4RNS A;  3IOW A;  4H8I A;  1MXX A;  1FQE A;  3VLV A;  4Q30 B;  1M5E A;  1QUJ A;  3KZG A;  2QMW A;  1B5I A;  4BLA A;  4G4P A;  1MQD A;  1FTK A;  4OET A;  3L6H A;  4EXL A;  2I0C A;  3EPE A;  1HSJ A;  4P0I A;  4RY1 A;  1SW4 A;  3VVF A;  1GTK A;  4QRZ A;  1MG1 A;  3VE1 B;  3K6V A;  1UQW A;  2Q8J A;  1CE2 A;  2F35 A;  5A5X A;  3VV5 A;  3OO9 A;  1FTL A;  1UTB A;  3EHS A;  1JEV A;  5FHN A;  4R9F A;  3LUY A;  2X7P A;  4UA8 A;  3D4G A;  1OMP A;  4F3S A;  1DPP A;  1Y1Z A;  3MJN A;  1NNK A;  2AL4 A;  5I56 B;  1MPD A;  1AMF A;  4ECF A;  1NNT A;  1P1O A;  2QJE A;  1N84 A;  2OWS A;  3MUQ A;  1MXV A;  1OQG A;  1A54 A;  2F6G A;  5HM4 B;  3RTF B;  3IB0 A;  4MH5 A;  1YCJ A;  3RQT A;  2XD2 A;  1A55 A;  3KGC A;  4R72 A;  1TWY A;  3MPL A;  5ITO A;  4QFO A;  5ICQ A;  4JSO A;  1Y20 A;  4KR5 A;  1LAG E;  5AA4 A;  3IO4 A;  3Q25 A;  1EZP A;  4FAT A;  3K2D A;  3CG1 A;  3FXQ A;  4JBZ A;  3MBP A;  1IZ1 A;  1DTZ A;  2VD2 A;  5ELV A;  3B6W A;  4AB5 A;  4EDP A;  2Y7P A;  2FNC A;  5AA1 A;  3SET A;  2A5T A;  3TCG A;  3E3K A;  2A5S A;  2GH9 A;  2KLF A;  1P1U A;  1XVX A;  5H8S A;  4BDR A;  3N5L A;  2DVC A;  4OYV A;  2NWJ A;  3R6U A;  3FUZ A;  1T0K A;  4ZE9 A;  2THI A;  3TQW A;  4RK9 A;  2QPQ A;  3FVK A;  3C36 A;  1USY H;  4U4S A;  3M3F A;  3T9X B;  3ONM A;  2FYI A;  4NF8 A;  3T96 B;  3U93 A;  5TU0 A;  1B3H A;  2UVH A;  5I84 A;  2DVZ A;  1JQF A;  3K6X A;  3S9E A;  2ZNT A;  4LP2 B;  1R9L A;  3PGF A;  2XXR A;  3PUY E;  3R26 A;  2W7Y A;  1A40 A;  4FAJ A;  3K1N A;  3LSW A;  4F1V A;  3MQ9 A;  5CMM A;  4R9G A;  4YAH X;  2PMS A;  3G3J A;  2QS2 A;  1MY0 A;  4H0W A;  5IKB A;  4MLQ A;  1H43 A;  1LBC A;  1B58 A;  3OOA A;  3MPK A;  3WAE A;  2XXY A;  2ZYO A;  3G3H A;  3IOV A;  1SVX B;  4TOZ A;  4GOT A;  3FJG A;  3CFL A;  2XX7 A;  3OSQ A;  2R71 A;  1O7T A;  1MXZ A;  2I3V A;  4R75 A;  3FXU A;  3OXN A;  4ZS9 A;  1XOC A;  5CI5 A;  2HZL A;  3N94 A;  4HCY A;  4F1U A;  1US4 A;  4POW A;  3C31 A;  1MM7 A;  3GLB A;  1B32 A;  3OO6 A;  2HAV A;  3DP8 A;  1XHY A;  3I5O A;  2XXU A;  4MFI A;  4YIC A;  4EF1 A;  3GBB A;  3MWB A;  2OLB A;  1O63 A;  2PT1 A;  3VLW A;  1B3G A;  3EQ1 A;  3FV2 A;  2B65 A;  2RCA A;  3BFT A;  2Z8F A;  3FXR A;  3LSX A;  3HHG A;  1PEB A;  5TP9 B;  4ELO A;  2OJT A;  4H6D A;  4QSD A;  3A09 A;  4EXK A;  5H8N B;  3O28 A;  4R6K A;  1QW0 A;  2QS3 A;  1B46 A;  3ODB A;  2RC9 A;  1AL3 A;  3G7W A;  4G68 B;  2RCB A;  3RGY A;  3SES A;  4LVQ A;  1MQI A;  3SDF A;  3KSX A;  4HW8 A;  3O6H A;  3W9V A;  4DXU A;  1B5H A;  3LSF B;  3PMW A;  5CM6 A;  2I0B A;  1RYX A;  4EF2 A;  1QVS A;  2R6G E;  4Q5T A;  4C1T A;  3T66 A;  3UA8 A;  4KD5 A;  1SW5 A;  4YKJ A;  1BP5 A;  4U4X A;  3V83 A;  1H3D A;  2GRV A;  1QKB A;  5DTB A;  5KZT A;  2YLN A;  3K00 A;  3PD8 A;  5ISU A;  3O6G A;  1I6B A;  4GQO A;  1HSE A;  1OIB A;  4H8J A;  2E0S A;  1M5B A;  4I62 A;  4NE4 A;  1MRP A;  1DSN A;  1GV8 A;  3MZ1 A;  3FJM A;  1MH4 A;  3W15 C;  1B7H A;  2F7A A;  2REJ A;  1XT8 A;  1PB8 A;  3KSJ A;  3TTM A;  3EN3 A;  1Z7N E;  1B7U A;  4F3B A;  3S2V A;  2D5W A;  4GWO A;  3ILU B;  2F97 A;  4H67 A;  3DLN A;  5DVI A;  3C32 A;  5JTY B;  4OES A;  4R74 A;  2DXR A;  3TKD A;  4F3G A;  1FTM A;  3FVN A;  3FAT A;  1IUD A;  1MXW A;  1IXH A;  4LQ2 A;  3HCQ A;  4PFU A;  4LZ8 A;  4X48 A;  3K6W A;  4RPO A;  3P7I A;  3O6I A;  4G77 A;  5L9O A;  4NWD A;  5JEI A;  2DWH A;  3IB1 A;  2HAU A;  2ZXT A;  1S7Y A;  4GLI A;  1NH7 A;  1QUK A;  1MPC A;  1LAH E;  1SYI A;  5JTY A;  1MH3 A;  3GBA A;  2RIN A;  3ECR A;  4U23 A;  4PQJ A;  2CZL A;  1PB9 A;  4P0G A;  4DIG A;  3KJ7 A;  1NNF A;  3FJ7 A;  3PUV E;  3Q27 A;  3K4U A;  3CSG A;  2O7I A;  3TOD A;  2Y84 A;  2NOO A;  5I2N B;  4F18 A;  1AOV A;  3O9P A;  1SW2 A;  4I1D A;  5TPA A;  5H8F B;  3O66 A;  4FOR A;  4G2Z A;  2B3F A;  5CMC A;  3MVW A;  2BJJ X;  2I58 A;  4JXI A;  2Y7I A;  4GL8 A;  2DP8 A;  3ZKL A;  4BDO A;  3KJT A;  1MM6 A;  3SEU A;  2HEU A;  4N13 A;  1OVB A;  1EZ9 A;  3MP1 A;  3H3G A;  1A99 A;  4RJZ A;  3IAZ A;  4QFP A;  2H25 A;  5CMK A;  4RXL A;  1B51 A;  1EU8 A;  3HST A;  1B3L A; 
#chains in the Genus database with same CATH topology
 1O64 A;  3PMX A;  1USY E;  4GIZ A;  3SEW A;  3S9M C;  3CFX A;  3C35 A;  3UN6 A;  1KWH A;  3MVX A;  3Q29 A;  3OEN A;  1JET A;  2NVU B;  2H5Y A;  4IO3 A;  1LFH A;  5H8Q A;  2ZZW A;  4QSC A;  4EQ9 A;  1UTB B;  4HTG A;  4OAN A;  2B4M A;  4QBA A;  3JZJ A;  1MDQ A;  4GX6 A;  4YZZ A;  3PPQ A;  4Q0C A;  3G3I A;  3M3K A;  2FBP A;  3IJX B;  1MXU A;  1NV4 A;  2I3W A;  1SW1 A;  1TXF A;  1K9Y A;  4QXD A;  5CBS A;  2HPG A;  5EQA A;  3T0J A;  1RDZ A;  1MQH A;  1FPL A;  4ZE8 A;  5EHM A;  1N7X A;  2QSX A;  4N17 A;  4OTE A;  3AXF A;  2F3B A;  2QVU A;  4F29 A;  1P1Q A;  3PUW E;  3LSL A;  4WED A;  1INP A;  4TLM B;  4OFJ A;  3B6T A;  3LBS A;  4DDD A;  1BLF A;  1WDN A;  4RPN A;  4KPT A;  3ILT B;  1XC1 A;  1FQB A;  2P1S A;  1H44 A;  4P9K A;  5AA4 B;  2Y7R A;  1IXG A;  1LGB C;  2I48 A;  4O7I A;  1TFA A;  1FQF A;  3KFM A;  1FPD A;  3D1R A;  1LAF E;  4THI A;  2ZYK A;  2CZH A;  4HS7 A;  2CEY A;  2ZNS A;  5DVF A;  4R2F A;  4PF8 A;  1FJ9 A;  4NGU A;  2DYX A;  5FBP A;  2AIX A;  4AB6 A;  1NV6 A;  2A5T B;  3TTN A;  4F1Y A;  4HE0 A;  1LFI A;  1BK4 A;  2V93 A;  1NNP A;  3OD7 A;  4I8C A;  1EYI A;  4G8M A;  1AWB A;  3QSL A;  3K0V A;  1ZU0 A;  5IAI A;  4NF0 A;  4NMY A;  5HPQ A;  2VP1 A;  1JVX A;  1R1N A;  1UIU A;  1FJ6 A;  3TAJ A;  3U65 A;  4NF8 B;  3BIH A;  4EQB A;  2CMO A;  5EHS A;  1WVJ A;  4XEQ A;  2HCA A;  2D21 A;  3QUF A;  4IO6 A;  2ZYN A;  4GL0 A;  2HFB A;  4IGR A;  4NWC A;  1Y4T A;  1UTH A;  4F2O A;  4RYA A;  2ZYM A;  4OQO A;  4FBP A;  2XXH A;  4O8M A;  2XX9 A;  5KCJ A;  4LN5 A;  2WBB A;  1H76 A;  2XA5 A;  4I9D A;  3V89 B;  3V5A A;  1ELJ A;  2IA4 A;  4PCD A;  3QK6 A;  3B6Q A;  4MCO A;  5I2K A;  3H6T A;  3OEM A;  3S9N C;  2V3U A;  3C9H A;  2P0S A;  5K2Y A;  4NQ8 A;  4U2R A;  3T9V A;  4YKP A;  4ELQ A;  3IJO B;  4KXP A;  3HFU A;  4JWX A;  3CVG A;  4IO7 A;  2PFY A;  1D9Q A;  4YB6 A;  1PBP A;  1A8F A;  3I6V A;  5B7D A;  4O3B A;  2V25 A;  5IM2 A;  1DTG A;  2XD3 A;  3EHU A;  1B52 A;  2QRY A;  4PGN A;  4F19 A;  3MP8 A;  3N6U A;  5FHM A;  1GVC A;  3IR1 A;  5KDT A;  4PFT A;  4MBP A;  2UYE A;  2KQZ A;  3UGW A;  4N91 A;  1RYO A;  2XXP A;  3MVY A;  3MYU A;  2WKY A;  1B4Z A;  1LBX A;  4O3A A;  3KN3 A;  1ZTY A;  4PP0 A;  3A3U A;  4PC9 A;  1VFE A;  3SKP A;  1HSL A;  3HHF A;  4QHQ A;  2O6A A;  5LOM A;  4OVT A;  5DEX A;  1FQA A;  3FIR A;  4KCD A;  4GRK A;  4GWW A;  3KOS A;  1NH8 A;  1FRP A;  2I4C A;  2DXY A;  4GFR A;  4IGT A;  1N3W A;  4PAI A;  4ZEK A;  1KA1 A;  2ZMB A;  1DK4 A;  3QUJ A;  1FBH A;  2DOJ A;  3FXB A;  3KN8 A;  4XKR A;  3W9W A;  3G3F A;  3S9L C;  2DE4 A;  4WEP A;  3KG2 A;  1ZJL A;  3O2A A;  4P3L A;  1IQ7 A;  5I57 A;  1B3E A;  4JWO A;  2VPN A;  1IXI A;  1YXI A;  4PBQ A;  2HZK A;  3E4R A;  3T93 B;  1B9J A;  5K2X A;  3RYD A;  2NUV A;  1LB8 A;  2QS4 A;  1FTJ A;  4IO4 A;  4GWZ A;  1US5 A;  4XKP A;  3PUX E;  3Q28 A;  2QVR A;  3THI A;  4GX3 A;  1S9T A;  1JP4 A;  4OVQ A;  4QFK A;  3IB2 A;  3R7X A;  4ONY A;  3E9X A;  1Y4C A;  2DWJ A;  2QS1 A;  1SPI A;  4C1U A;  4MAG A;  1D9V A;  2XX8 A;  2G29 A;  3HV1 A;  2I6E A;  1LCT A;  5I5P A;  1VDW A;  2O51 A;  3G3K A;  4HXV A;  3PMV A;  1KA0 A;  3DP4 A;  1MY1 A;  1BTJ A;  2Y7W A;  1MS7 A;  2PCR A;  2F36 A;  4ZEI A;  2Q88 A;  1FPK A;  2OWT A;  3RTW B;  3ISP A;  4E0X A;  2F8D A;  3K1P A;  3USD A;  1D9Y A;  4GXS B;  4ELR A;  1SD3 A;  2H4I A;  4LQ5 A;  2VGQ A;  3OSR A;  3H6V A;  2HHM A;  2XXX A;  4OZ9 A;  1IIT A;  1K9Z A;  4IO5 A;  2R9J A;  1NUX A;  3CRB A;  3TEP A;  1OQH A;  3PPO A;  1VR5 A;  3MW0 A;  4GVO A;  5H8H B;  3RN8 A;  4G8H A;  4MMP A;  1MDP 1;  4FEB A;  2V3T A;  1NKX A;  2H98 A;  2XXT A;  3VFJ A;  3PV0 E;  3OEK A;  1IMD A;  3JV9 A;  2ONS A;  3TYH A;  3NOH A;  2YPN A;  3KOT A;  4PDD A;  4KYS A;  4DI4 B;  2OCU A;  1PB7 A;  1LBB A;  1SDX A;  1EH3 A;  3E78 A;  3SER A;  3QIM A;  1EZO A;  4LUB A;  4P47 A;  3IO6 A;  2OBG A;  5H8H A;  3IOR A;  1UIV A;  3SZP A;  1FW0 A;  4NG7 A;  3RY3 A;  3DM0 A;  2RC8 A;  5TPA B;  1P1W A;  2GHA A;  4Z7E A;  5I7I A;  4LAT A;  2RKM A;  1ZMG A;  4FE8 A;  4X04 A;  1M5C A;  1IEJ A;  1JNF A;  1FBD A;  1F9B A;  4RA1 A;  2Q9T A;  4GF8 A;  3MST A;  3WAF A;  1SI0 A;  2XWI A;  4U21 A;  4UAC A;  1MY2 A;  4N6P A;  1D3K A;  2XXK A;  1D4N A;  4N8G A;  3TQL A;  4POX A;  4U1O A;  4YB7 A;  5CRY A;  4YKI A;  4NTL A;  1FBP A;  2XWO A;  1P1N A;  4OFL A;  2DQV A;  2FIX A;  4ESW A;  3TTL A;  3B7D A;  4PAK A;  2VOZ A;  4G68 C;  5H8Q B;  4DE8 A;  2UVI A;  4PFI A;  2H99 A;  4MF3 A;  1VSO A;  1IXC A;  3C34 A;  3FZV A;  4M4G A;  1YAE A;  1NI9 A;  3MZB A;  4KFQ A;  2VPO A;  3LV0 A;  4JVI A;  1LFG A;  1B1X A;  4NF6 B;  5J1D A;  3M8U A;  1MY4 A;  4OEN A;  4OA4 A;  4XKQ A;  3IFC A;  4RK2 A;  5AE4 A;  4GBW A;  3CFZ A;  4IR8 A;  4MNP A;  1MQJ A;  1YYZ A;  1I6A A;  1SI1 A;  4NHB A;  2O1L A;  4TQU Q;  4ESX A;  2REG A;  3VLU A;  3RNN A;  4JDF A;  4LA9 A;  3O97 A;  3L6G A;  4N07 A;  2M8C A;  4R6Y A;  3TTK A;  3IFA A;  4OMB A;  1A7L A;  3N26 A;  5L9M A;  5FTI A;  4ZZE A;  4NF6 A;  4OXV A;  2GHB A;  3C33 A;  1N04 A;  2DWA A;  1GR2 A;  4IY5 A;  5I59 A;  1N7W A;  2O7U A;  4MEV A;  3OEL A;  3BIG A;  4JWY A;  2UVJ A;  2ANJ A;  1FQC A;  2ALU A;  1MQG A;  1QUI A;  2Z23 A;  1IME A;  3H4Z A;  4OVS A;  2ONR A;  3K1M A;  4NF4 A;  4ISU A;  1MPB A;  5ET7 A;  2ZZX A;  2PBW A;  5A5L A;  4Q8R A;  1DOT A;  3T9U A;  5LTC A;  4TLL B;  1OLA A;  1XVY A;  1AH5 A;  4X1D A;  3IK6 B;  3PPN A;  3EKI A;  2OWZ A;  3LC8 A;  2UXA A;  2X7Q A;  3CR9 A;  4P11 A;  5AA2 B;  3OO8 A;  1NV7 A;  4PFR A;  4OFO A;  2O69 A;  4R2B A;  1Y3Q A;  3VXC A;  3D4C A;  2QL3 A;  2VHA A;  2PVU A;  3GZG A;  4C0R A;  3U94 A;  4DZ1 A;  4IB2 A;  4FED A;  1B0L A;  3KC1 A;  5FHO A;  2PYY A;  5DVJ A;  1PDA A;  1B5J A;  4G8N A;  1B1H A;  3JYR A;  2XWV A;  4MHF A;  1Y1M A;  2E1S A;  1OVT A;  3DEL B;  4KI0 E;  4H45 A;  3BKI B;  1IIW A;  4IY6 A;  4JB7 A;  1DPE A;  1UTH B;  1R9Q A;  1ZBM A;  2O68 A;  1TT1 A;  5AA2 A;  2Q2C A;  4MX6 A;  1SYH A;  4HCW A;  3TUS A;  2PX1 A;  1POT A;  2YJP A;  5KCJ B;  1XS5 A;  1MY3 A;  2XXQ A;  2FA7 A;  4OEV A;  2AYS A;  2V84 A;  5I56 A;  4P1L A;  2XXW A;  2HXR A;  1Z7M E;  4XKN A;  5I2K B;  5IGA A;  3KEI A;  1FPB A;  4ZEC A;  3UOR A;  1A8E A;  1QKA A;  4EUO A;  1NUY A;  2V3Q A;  1BKA A;  3F11 A;  1LB9 A;  1FQD A;  3I3V A;  5M2V A;  1URD A;  2PT2 A;  4H1X A;  2VD3 A;  3ZS6 A;  4P56 A;  3FVG A;  2ESN A;  3A29 A;  2UVG A;  3E13 X;  1B3F A;  4F39 A;  4KCC A;  3OO7 A;  2F6P A;  4I40 A;  4OWD A;  4QSE A;  4NF5 B;  5BWJ A;  1YTV A;  3OMB A;  5HBC A;  2D3I A;  3MAM A;  3TCF A;  4BDL A;  1FSA A;  4JVD A;  4ND9 A;  4DI3 D;  4FIM A;  5KDT B;  5F1Q A;  3SEY A;  4DXB A;  2GFE A;  3RLF E;  3UK4 A;  1B7Z A;  2F78 A;  3Q26 A;  4X9T A;  4GWU A;  3PPP A;  4PAF A;  3M3L A;  4O3C A;  4OVJ A;  4F22 A;  2R8T A;  2DE3 A;  5DYH A;  2Q2A A;  3TCH A;  3UIF A;  2B3B A;  4KHZ E;  1JW4 A;  2ONK E;  5EYF A;  4NF5 A;  3VVD A;  2F7C A;  1FPG A;  1NV1 A;  5DT6 A;  4N8Y A;  3QXM A;  5CC2 A;  1RDY A;  3H6U A;  5DEX B;  1RDX A;  4YU0 A;  5AA3 A;  4N4U A;  3U72 A;  4F31 B;  1L5T A;  2DSF A;  4BDQ A;  2B4L A;  1IMB A;  3G3G A;  2XWK A;  2HXW A;  3U8Q A;  3TZA A;  3FD3 A;  1ZIU A;  1PC3 A;  4KYD A;  4OHN A;  3K02 A;  3MVZ A;  4PE3 A;  1II5 A;  3T9H B;  1NUZ A;  3IOU A;  3CSB A;  3ZSF A;  4PF6 A;  5EYG A;  4ZED A;  3ZKK A;  1B05 A;  4XIG Q;  1SBP A;  3K01 A;  3DP6 A;  3K6U A;  1RKM A;  5I57 B;  1ANF A;  3RPW A;  3QAX A;  1B4H A;  4NAP A;  1P99 A;  2CZK A;  4QFN A;  1POY 1;  2ABH A;  3PUZ E;  4QFL A;  1JW1 A;  1I69 A;  4O7M A;  4DLD A;  3TFL A;  3MP6 A;  4R73 A;  3PU5 A;  3FGS A;  3T22 A;  1S50 A;  4FJP A;  4PFW A;  4GBV A;  4H5G A;  4LON B;  4YB5 A;  3VXB A;  1FPE A;  1N76 A;  5JK4 A;  3TPA A;  1Y3N A;  1MXY A;  4X1B A;  4ZZA A;  1YPN A;  1DMB A;  2OK2 A;  5T3J A;  3RUM A;  3V8X B;  1FCK A;  4P8B A;  3U1O A;  2DWI A;  1B40 A;  3H7M A;  4XTC Q;  3MC2 A;  3IL1 B;  1NV3 A;  5CMB A;  2MKZ A;  3UP9 A;  2DS9 A;  4ELP A;  1B6H A;  3T1B A;  4K3F A;  5F7V A;  1FTO A;  1CNQ A;  1Q1K A;  4ZEF A;  1CB6 A;  2F34 A;  2P2A A;  2X26 A;  3TEL A;  2ZZV A;  5ET6 A;  5TP9 A;  2RC7 A;  5AA2 D;  1QJM A;  1NMU A;  1QGX A;  4E0W A;  4H65 A;  5H8N A;  3SEX A;  3FVO A;  2XXI A;  3BFU A;  4JVC A;  3TDJ A;  4P1E A;  4AS5 A;  5I58 B;  1NL5 A;  1M5F A;  1LST A;  1R6Z A;  4KQP A;  1M5D A;  1J1N A;  1QUL A;  4GX4 A;  2RF1 A;  1LAX A;  2NXO A;  4HE2 A;  2AL5 A;  3U92 A;  4G68 A;  4NED A;  4WKM A;  4EQ7 A;  3PD9 A;  3A3C A;  3EF7 A;  4N81 A;  3SEV A;  1SQY A;  4JSD A;  4DXC A;  4UAB A;  4H5F A;  4KYE A;  2IEE A;  4YMB A;  3HN0 A;  3QYT A;  2XXV A;  3FAS A;  3S4U A;  3H06 B;  5I58 A;  3IX1 A;  4U1Z A;  2O1M A;  1LLS A;  4BDM A;  1N3X A;  4XXU A;  4GWS A;  1ZLQ A;  4BDN A;  4Z0I A;  1Q35 A;  4F2Q A;  1B0H A;  3TMG A;  4PFY A;  2Z22 A;  1I6Q A;  3KN7 A;  2F5X A;  1AIV A;  3CI8 A;  1WOD A;  4ZDM A;  2DE2 A;  4LZ7 A;  4WXJ A;  3VDF A;  4OEU A;  1PBQ A;  4GXA A;  2G93 A;  4PTK A;  2XHD A;  1VFD A;  3O29 A;  3LR1 A;  3VVE A;  4LZ5 A;  2I4B A;  5BUU A;  2OZZ A;  1B2H A;  5ESY A;  1H45 A;  4N15 A;  5CBR A;  4FEC A;  1VE4 A;  3GXA A;  5B70 A;  1ZKB A;  3RT6 B;  1OLC A;  4PET A;  5ITP A;  2LAO A;  3RT8 A;  3HO7 A;  3GYY A;  3PPR A;  1NV5 A;  4DCY A;  1URS A;  4DCX A;  5ET5 A;  2ZNU A;  1NFT A;  2H9B A;  2Z8D A;  1NV2 A;  1URG A;  4AQ4 A;  1JW5 A;  3CG3 A;  4HE1 A;  4XF5 A;  4QF9 A;  3IOT A;  4AS4 A;  3HPI A;  1LEV A;  4PE5 B;  3EHT A;  1GGG A;  4F3P A;  4YKK A;  2QMX A;  1LCF A;  1KZ8 A;  3N6T A;  4MNC A;  1JEU A;  2O84 X;  4L17 A;  4YMA A;  3BBR A;  1ATG A;  3KC0 A;  1TFD A;  1JVY A;  3PTY A;  1Y3P A;  5IZ3 A;  5DW8 A;  2DDK A;  2WYP A;  3TTR A;  5L8D A;  3H6W A;  3KBR A;  5ICT A;  5I59 B;  3H03 A;  5L9S A;  4MLV A;  2Z8E A;  3CIJ A;  5I2N A;  2Q89 A;  4NN3 A;  2Q8M A;  2F3D A;  4GD5 A;  1FBF A;  2UYF A;  2Y7K A;  3FV1 A;  3MZ9 A;  4NF4 B;  1IMF A;  2HQ0 A;  4R6H A;  4M1V A;  2F7B A;  1BIY A;  2I49 A;  5H8F A;  1Y9U A;  2GQ1 A;  4ZEB A;  3C4M A;  4IO2 A;  1N0T A;  5FTH A;  4U22 A;  5A5X B;  4OER A;  4RNS A;  3IOW A;  4H8I A;  1MXX A;  3ROJ A;  1FQE A;  4Q30 B;  1DBZ A;  1M5E A;  1QUJ A;  3KZG A;  3VLV A;  2QMW A;  1B5I A;  4BLA A;  4G4P A;  1MQD A;  1FTK A;  4GWY A;  4OET A;  3L6H A;  4EXL A;  2I0C A;  3EPE A;  1HSJ A;  4P0I A;  4RY1 A;  1SW4 A;  2BJI A;  3VVF A;  1GTK A;  4QRZ A;  1MG1 A;  3VE1 B;  4MIJ A;  3K6V A;  1UQW A;  2Q8J A;  1CE2 A;  2F35 A;  5A5X A;  3VV5 A;  3OO9 A;  2P3N A;  1FTL A;  5EQ7 A;  1UTB A;  3EHS A;  2FHY A;  1JEV A;  5FHN A;  4R9F A;  3LUY A;  2X7P A;  4UA8 A;  3D4G A;  4MJO A;  1OMP A;  4F3S A;  2JJK A;  3RPL B;  1DPP A;  1Y1Z A;  3MJN A;  1NNK A;  2AL4 A;  5I56 B;  3CHG A;  1MPD A;  1AMF A;  4ECF A;  1NNT A;  1P1O A;  5EQ9 A;  2QJE A;  3KBZ A;  1N84 A;  2OWS A;  3MUQ A;  1MXV A;  4PFB A;  1OQG A;  1A54 A;  2F6G A;  5HM4 B;  3RQT A;  3IB0 A;  4MH5 A;  1YCJ A;  3RTF B;  2XD2 A;  1A55 A;  3KGC A;  4R72 A;  1TWY A;  5F24 A;  3MPL A;  5ITO A;  4QFO A;  5ICQ A;  4MNI A;  4JSO A;  3RPL A;  1Y20 A;  4KR5 A;  1LAG E;  5AA4 A;  2P3V A;  3IO4 A;  3Q25 A;  1EZP A;  4FAT A;  3K2D A;  3CG1 A;  3FXQ A;  5IZ1 A;  4JBZ A;  3MBP A;  1IZ1 A;  1DTZ A;  2VD2 A;  4NX1 A;  5ELV A;  3B6W A;  4AB5 A;  4EDP A;  2Y7P A;  2FNC A;  5AA1 A;  3SET A;  2QVV A;  4PDH A;  2Q74 A;  2A5T A;  3TCG A;  3E3K A;  2A5S A;  2GH9 A;  2KLF A;  1P1U A;  1XVX A;  5H8S A;  4BDR A;  3N5L A;  2DVC A;  4OYV A;  1LBW A;  2NWJ A;  3R6U A;  3FUZ A;  1LBY A;  1T0K A;  4ZE9 A;  2THI A;  3TQW A;  4RK9 A;  2QPQ A;  3FVK A;  3C36 A;  1USY H;  1NUW A;  4U4S A;  3M3F A;  3T9X B;  4I3Y A;  3QMF A;  3ONM A;  2FYI A;  4NF8 A;  1FPI A;  3T96 B;  4O94 A;  4I3E A;  3U93 A;  5TU0 A;  1B3H A;  2UVH A;  1FPF A;  4N6K A;  5I84 A;  3B50 A;  2DVZ A;  1JQF A;  3K6X A;  3S9E A;  2ZNT A;  4LP2 B;  1R9L A;  3PGF A;  2XXR A;  3PUY E;  3R26 A;  2W7Y A;  1A40 A;  4FAJ A;  3K1N A;  3LSW A;  4F1V A;  3MQ9 A;  5CMM A;  4R9G A;  4YAH X;  2PMS A;  3G3J A;  2QS2 A;  4GWX A;  1MY0 A;  4H0W A;  5IKB A;  4MLQ A;  1H43 A;  1LBC A;  1B58 A;  1FTA A;  3OOA A;  3MPK A;  3WAE A;  2XXY A;  2ZYO A;  3G3H A;  3IOV A;  1SVX B;  1EYK A;  4TOZ A;  4GOT A;  3FJG A;  3CFL A;  2XX7 A;  3OSQ A;  2R71 A;  1O7T A;  4XFE A;  3LUZ A;  1MXZ A;  4PGP A;  2I3V A;  3B8B A;  4R75 A;  3FXU A;  3OXN A;  4ZS9 A;  1XOC A;  5CI5 A;  2HZL A;  3N94 A;  1YZ0 A;  4HCY A;  4F1U A;  2FIE A;  1US4 A;  4POW A;  3C31 A;  1MM7 A;  3GLB A;  2KR0 A;  1B32 A;  3OO6 A;  2HAV A;  3DP8 A;  1XHY A;  3I5O A;  2Y5K A;  2WEF A;  2XXU A;  4MFI A;  4YIC A;  4EF1 A;  3GBB A;  4PBH A;  3MWB A;  2OLB A;  1O63 A;  2PT1 A;  3VLW A;  1B3G A;  3FBP A;  1FBE A;  3EQ1 A;  3FV2 A;  5J16 A;  2B65 A;  2RCA A;  3BFT A;  2Z8F A;  2QFL A;  3FXR A;  3LSX A;  3HHG A;  1PEB A;  5TP9 B;  4OVR A;  4ELO A;  2OJT A;  4H6D A;  4QSD A;  3A09 A;  4EXK A;  5H8N B;  3O28 A;  4R6K A;  1QW0 A;  2QS3 A;  1B46 A;  3ODB A;  2RC9 A;  1AL3 A;  3G7W A;  4G68 B;  1XI6 A;  2RCB A;  3RGY A;  3SES A;  4LVQ A;  1MQI A;  3SDF A;  4OVP A;  3KSX A;  4HW8 A;  5EQ8 A;  3O6H A;  3W9V A;  4DXU A;  1B5H A;  3LSF B;  3PMW A;  5CM6 A;  2I0B A;  1RYX A;  4EF2 A;  1G0I A;  1QVS A;  2R6G E;  4Q5T A;  4C1T A;  3T66 A;  3UA8 A;  4KD5 A;  1SW5 A;  1FBC A;  4YKJ A;  1BP5 A;  4U4X A;  3V83 A;  1G0H A;  2Y5L A;  2V4C A;  1H3D A;  2GRV A;  1QKB A;  5DTB A;  5KZT A;  2YLN A;  3K00 A;  3PD8 A;  3E79 A;  5ISU A;  3O6G A;  1I6B A;  4GQO A;  1HSE A;  1OIB A;  4H8J A;  2E0S A;  1M5B A;  4I62 A;  4NE4 A;  2CEX A;  5IZZ A;  1MRP A;  1DSN A;  1GV8 A;  3MZ1 A;  3FJM A;  1MH4 A;  3W15 C;  1B7H A;  2F7A A;  2REJ A;  1XT8 A;  1PB8 A;  3KSJ A;  3TTM A;  5EYH A;  3EN3 A;  1Z7N E;  1B7U A;  1Q9D A;  4F3B A;  1FBG A;  3S2V A;  2D5W A;  4X8R A;  4GWO A;  3ILU B;  2F97 A;  5ET8 A;  4H67 A;  2FVZ A;  4G61 A;  3DLN A;  5DVI A;  1IMA A;  5I3S A;  3C32 A;  5JTY B;  4OES A;  4R74 A;  2DXR A;  1NV0 A;  3TKD A;  4F3G A;  1FTM A;  3FVN A;  3FAT A;  1IUD A;  1MXW A;  2L5V A;  1IXH A;  4LQ2 A;  3HCQ A;  4PFU A;  4LZ8 A;  4X48 A;  3K6W A;  2PFZ A;  4RPO A;  3P7I A;  3O6I A;  4G77 A;  5L9O A;  4NWD A;  5JEI A;  2DWH A;  3IB1 A;  1LBZ A;  2HAU A;  2ZXT A;  1S7Y A;  4GLI A;  1NH7 A;  1QUK A;  1MPC A;  1LAH E;  2CZI A;  1SYI A;  5JTY A;  1MH3 A;  2VT5 A;  5IZ3 B;  3GBA A;  2RIN A;  3ECR A;  4U23 A;  4PQJ A;  2CZL A;  1PB9 A;  4P0G A;  4DIG A;  3KJ7 A;  1NNF A;  3FJ7 A;  5LDZ A;  3PUV E;  3Q27 A;  3K4U A;  3CSG A;  2O7I A;  2WYK A;  3TOD A;  1EYJ A;  4N6D A;  2Y84 A;  2NOO A;  5I2N B;  4F18 A;  1AOV A;  1FPJ A;  3O9P A;  1SW2 A;  4I1D A;  5TPA A;  5H8F B;  3O66 A;  4FOR A;  4G2Z A;  2B3F A;  5CMC A;  3MVW A;  2BJJ X;  2I58 A;  4JXI A;  2Y7I A;  4GL8 A;  2DP8 A;  3ZKL A;  2WBD A;  3KJT A;  1MM6 A;  3SEU A;  4BDO A;  2HEU A;  4N13 A;  1OVB A;  1EZ9 A;  4H46 A;  1IMC A;  3MP1 A;  2OX3 A;  1DCU A;  3H3G A;  1A99 A;  4RJZ A;  1LBV A;  3IAZ A;  4QFP A;  2H25 A;  5CMK A;  4RXL A;  1B51 A;  1EU8 A;  2WX9 A;  3HST A;  1B3L A; 
#chains in the Genus database with same CATH homology
 1O64 A;  3PMX A;  1USY E;  4GIZ A;  3SEW A;  3S9M C;  3CFX A;  3C35 A;  3UN6 A;  1KWH A;  3MVX A;  3Q29 A;  3OEN A;  1JET A;  2NVU B;  2H5Y A;  4IO3 A;  1LFH A;  5H8Q A;  4QSC A;  4EQ9 A;  1UTB B;  4HTG A;  3JZJ A;  1MDQ A;  4YZZ A;  3PPQ A;  4Q0C A;  3G3I A;  3M3K A;  3IJX B;  1MXU A;  2I3W A;  1SW1 A;  1TXF A;  5CBS A;  1MQH A;  4ZE8 A;  5EHM A;  1N7X A;  2QSX A;  4OTE A;  3AXF A;  4F29 A;  1P1Q A;  3PUW E;  3LSL A;  4WED A;  4TLM B;  4OFJ A;  3B6T A;  3LBS A;  4DDD A;  1BLF A;  1WDN A;  4RPN A;  4KPT A;  3ILT B;  1XC1 A;  1FQB A;  2P1S A;  1H44 A;  5AA4 B;  2Y7R A;  1IXG A;  1LGB C;  2I48 A;  1TFA A;  1FQF A;  3KFM A;  1LAF E;  4THI A;  2ZYK A;  4HS7 A;  2ZNS A;  5DVF A;  4R2F A;  2DYX A;  2AIX A;  4AB6 A;  2A5T B;  3TTN A;  4F1Y A;  1LFI A;  2V93 A;  1NNP A;  3OD7 A;  4I8C A;  4G8M A;  3QSL A;  3K0V A;  1ZU0 A;  5IAI A;  4NMY A;  5HPQ A;  2VP1 A;  1JVX A;  1R1N A;  1UIU A;  3TAJ A;  4NF8 B;  4EQB A;  2CMO A;  5EHS A;  1WVJ A;  2HCA A;  2D21 A;  3QUF A;  4IO6 A;  2ZYN A;  4GL0 A;  2HFB A;  4IGR A;  4NWC A;  1Y4T A;  1UTH A;  4F2O A;  4RYA A;  2ZYM A;  4OQO A;  2XXH A;  2XX9 A;  5KCJ A;  1H76 A;  4I9D A;  3V89 B;  3V5A A;  1ELJ A;  2IA4 A;  3QK6 A;  3B6Q A;  5I2K A;  3H6T A;  3OEM A;  3S9N C;  2V3U A;  3C9H A;  2P0S A;  5K2Y A;  4U2R A;  3T9V A;  4YKP A;  4ELQ A;  3IJO B;  4JWX A;  3CVG A;  4IO7 A;  4YB6 A;  1PBP A;  1A8F A;  3I6V A;  5B7D A;  4O3B A;  2V25 A;  1DTG A;  2XD3 A;  3EHU A;  1B52 A;  2QRY A;  4F19 A;  3MP8 A;  3N6U A;  5FHM A;  1GVC A;  3IR1 A;  5KDT A;  4PFT A;  4MBP A;  2UYE A;  3UGW A;  1RYO A;  2XXP A;  3MVY A;  2WKY A;  1B4Z A;  4O3A A;  3KN3 A;  1ZTY A;  4PP0 A;  3A3U A;  1VFE A;  3SKP A;  1HSL A;  3HHF A;  4QHQ A;  2O6A A;  5LOM A;  5DEX A;  1FQA A;  3FIR A;  4KCD A;  4GRK A;  3KOS A;  1NH8 A;  2I4C A;  2DXY A;  4GFR A;  4IGT A;  1N3W A;  4ZEK A;  2ZMB A;  3QUJ A;  2DOJ A;  3KN8 A;  4XKR A;  3W9W A;  3G3F A;  3S9L C;  2DE4 A;  4WEP A;  3KG2 A;  1ZJL A;  3O2A A;  1IQ7 A;  5I57 A;  1B3E A;  4JWO A;  1IXI A;  2HZK A;  3E4R A;  3T93 B;  1B9J A;  5K2X A;  2NUV A;  1LB8 A;  2QS4 A;  1FTJ A;  4IO4 A;  1US5 A;  4XKP A;  3PUX E;  3Q28 A;  3THI A;  1S9T A;  4QFK A;  3IB2 A;  3R7X A;  4ONY A;  3E9X A;  1Y4C A;  2DWJ A;  2QS1 A;  4C1U A;  1D9V A;  2XX8 A;  2G29 A;  3HV1 A;  2I6E A;  1LCT A;  2O51 A;  3G3K A;  3PMV A;  3DP4 A;  1MY1 A;  1BTJ A;  2Y7W A;  1MS7 A;  2F36 A;  4ZEI A;  2Q88 A;  2OWT A;  3RTW B;  4E0X A;  2F8D A;  3K1P A;  3USD A;  1D9Y A;  4GXS B;  4ELR A;  1SD3 A;  2H4I A;  4LQ5 A;  2VGQ A;  3OSR A;  3H6V A;  2XXX A;  4OZ9 A;  1IIT A;  4IO5 A;  2R9J A;  3CRB A;  3TEP A;  1OQH A;  3PPO A;  1VR5 A;  3MW0 A;  4GVO A;  5H8H B;  3RN8 A;  4G8H A;  1MDP 1;  4FEB A;  2V3T A;  1NKX A;  2H98 A;  2XXT A;  3VFJ A;  3PV0 E;  3OEK A;  3JV9 A;  2ONS A;  3TYH A;  2YPN A;  3KOT A;  4KYS A;  2OCU A;  1PB7 A;  1LBB A;  1SDX A;  1EH3 A;  3SER A;  3QIM A;  1EZO A;  4LUB A;  3IO6 A;  2OBG A;  5H8H A;  3IOR A;  1UIV A;  1FW0 A;  3RY3 A;  3DM0 A;  2RC8 A;  5TPA B;  1P1W A;  2GHA A;  4Z7E A;  4LAT A;  2RKM A;  1ZMG A;  4FE8 A;  1M5C A;  1IEJ A;  1JNF A;  1F9B A;  4RA1 A;  2Q9T A;  4GF8 A;  3WAF A;  1SI0 A;  4U21 A;  4UAC A;  1MY2 A;  4N6P A;  1D3K A;  1D4N A;  3TQL A;  4POX A;  4U1O A;  4YB7 A;  5CRY A;  4YKI A;  4NTL A;  1P1N A;  4OFL A;  2DQV A;  4ESW A;  3TTL A;  3B7D A;  2VOZ A;  4G68 C;  5H8Q B;  4DE8 A;  2UVI A;  2H99 A;  4MF3 A;  1VSO A;  1IXC A;  3C34 A;  3FZV A;  4M4G A;  1YAE A;  3MZB A;  4KFQ A;  1LFG A;  1B1X A;  4NF6 B;  5J1D A;  3M8U A;  1MY4 A;  4OEN A;  4XKQ A;  4RK2 A;  5AE4 A;  3CFZ A;  1MQJ A;  1I6A A;  1SI1 A;  2O1L A;  4TQU Q;  4ESX A;  2REG A;  3VLU A;  3RNN A;  4JDF A;  4LA9 A;  3O97 A;  3L6G A;  4N07 A;  2M8C A;  4R6Y A;  3TTK A;  4OMB A;  1A7L A;  3N26 A;  5L9M A;  5FTI A;  4ZZE A;  4NF6 A;  4OXV A;  2GHB A;  3C33 A;  1N04 A;  2DWA A;  1GR2 A;  4IY5 A;  5I59 A;  1N7W A;  2O7U A;  3OEL A;  4JWY A;  2UVJ A;  2ANJ A;  1FQC A;  2ALU A;  1MQG A;  1QUI A;  2Z23 A;  3H4Z A;  2ONR A;  3K1M A;  4NF4 A;  4ISU A;  1MPB A;  2PBW A;  4Q8R A;  1DOT A;  3T9U A;  4TLL B;  1OLA A;  1XVY A;  1AH5 A;  4X1D A;  3IK6 B;  3PPN A;  3LC8 A;  2UXA A;  2X7Q A;  3CR9 A;  4P11 A;  5AA2 B;  3OO8 A;  4OFO A;  2O69 A;  4R2B A;  1Y3Q A;  3VXC A;  3D4C A;  2QL3 A;  2VHA A;  2PVU A;  3GZG A;  4C0R A;  3U94 A;  4DZ1 A;  4IB2 A;  4FED A;  1B0L A;  5FHO A;  2PYY A;  5DVJ A;  1PDA A;  1B5J A;  4G8N A;  1B1H A;  3JYR A;  1Y1M A;  2E1S A;  1OVT A;  3DEL B;  4KI0 E;  3BKI B;  1IIW A;  4IY6 A;  4JB7 A;  1DPE A;  1UTH B;  1R9Q A;  1ZBM A;  2O68 A;  1TT1 A;  5AA2 A;  2Q2C A;  1SYH A;  4HCW A;  3TUS A;  2PX1 A;  1POT A;  2YJP A;  5KCJ B;  1XS5 A;  1MY3 A;  2XXQ A;  2FA7 A;  4OEV A;  2AYS A;  2V84 A;  5I56 A;  2XXW A;  1Z7M E;  4XKN A;  5I2K B;  3KEI A;  4ZEC A;  3UOR A;  1A8E A;  1QKA A;  4EUO A;  2V3Q A;  1BKA A;  3F11 A;  1LB9 A;  1FQD A;  3I3V A;  5M2V A;  1URD A;  2PT2 A;  4H1X A;  2VD3 A;  3ZS6 A;  3FVG A;  2ESN A;  2UVG A;  3E13 X;  1B3F A;  4F39 A;  4KCC A;  3OO7 A;  2F6P A;  4OWD A;  4QSE A;  4NF5 B;  5BWJ A;  1YTV A;  3OMB A;  5HBC A;  2D3I A;  3MAM A;  3TCF A;  4BDL A;  4ND9 A;  4FIM A;  5KDT B;  5F1Q A;  3SEY A;  4DXB A;  2GFE A;  3RLF E;  3UK4 A;  1B7Z A;  2F78 A;  3Q26 A;  4X9T A;  3PPP A;  3M3L A;  4O3C A;  4OVJ A;  4F22 A;  2DE3 A;  5DYH A;  2Q2A A;  3TCH A;  3UIF A;  2B3B A;  4KHZ E;  1JW4 A;  2ONK E;  5EYF A;  4NF5 A;  3VVD A;  2F7C A;  5DT6 A;  3QXM A;  5CC2 A;  3H6U A;  5DEX B;  4YU0 A;  5AA3 A;  3U72 A;  4F31 B;  1L5T A;  2DSF A;  4BDQ A;  3G3G A;  2HXW A;  3U8Q A;  3TZA A;  3FD3 A;  1ZIU A;  1PC3 A;  4KYD A;  4OHN A;  3K02 A;  3MVZ A;  1II5 A;  3T9H B;  3IOU A;  3CSB A;  3ZSF A;  4ZED A;  3ZKK A;  1B05 A;  4XIG Q;  1SBP A;  3K01 A;  3DP6 A;  3K6U A;  1RKM A;  5I57 B;  1ANF A;  3RPW A;  3QAX A;  1B4H A;  1P99 A;  4QFN A;  1POY 1;  2ABH A;  3PUZ E;  4QFL A;  1JW1 A;  1I69 A;  4DLD A;  3TFL A;  3MP6 A;  4R73 A;  3PU5 A;  3FGS A;  3T22 A;  1S50 A;  4FJP A;  4PFW A;  4H5G A;  4LON B;  4YB5 A;  3VXB A;  1N76 A;  5JK4 A;  3TPA A;  1Y3N A;  1MXY A;  4X1B A;  4ZZA A;  1YPN A;  1DMB A;  2OK2 A;  3RUM A;  3V8X B;  1FCK A;  3U1O A;  2DWI A;  1B40 A;  3H7M A;  4XTC Q;  3MC2 A;  3IL1 B;  5CMB A;  3UP9 A;  2DS9 A;  4ELP A;  1B6H A;  4K3F A;  5F7V A;  1FTO A;  1Q1K A;  4ZEF A;  1CB6 A;  2F34 A;  2P2A A;  2X26 A;  3TEL A;  5TP9 A;  5AA2 D;  2RC7 A;  1QJM A;  1NMU A;  4E0W A;  4H65 A;  5H8N A;  3SEX A;  3FVO A;  2XXI A;  3BFU A;  3TDJ A;  5I58 B;  1NL5 A;  1M5F A;  1LST A;  1R6Z A;  4KQP A;  1M5D A;  1J1N A;  1QUL A;  2RF1 A;  1LAX A;  2NXO A;  2AL5 A;  3U92 A;  4G68 A;  4NED A;  4WKM A;  4EQ7 A;  3PD9 A;  3A3C A;  3EF7 A;  3SEV A;  1SQY A;  4JSD A;  4DXC A;  4H5F A;  4KYE A;  2IEE A;  4YMB A;  3HN0 A;  3QYT A;  2XXV A;  3FAS A;  3S4U A;  3H06 B;  5I58 A;  3IX1 A;  4U1Z A;  2O1M A;  1LLS A;  4BDM A;  1N3X A;  4XXU A;  1ZLQ A;  4BDN A;  4Z0I A;  1Q35 A;  4F2Q A;  1B0H A;  3TMG A;  4PFY A;  2Z22 A;  1I6Q A;  3KN7 A;  2F5X A;  1AIV A;  3CI8 A;  1WOD A;  4ZDM A;  2DE2 A;  4LZ7 A;  4WXJ A;  3VDF A;  4OEU A;  1PBQ A;  4GXA A;  2G93 A;  2XHD A;  1VFD A;  3O29 A;  3LR1 A;  3VVE A;  4LZ5 A;  2I4B A;  5BUU A;  2OZZ A;  1B2H A;  1H45 A;  5CBR A;  4FEC A;  1VE4 A;  3GXA A;  5B70 A;  1ZKB A;  3RT6 B;  1OLC A;  4PET A;  5ITP A;  2LAO A;  3RT8 A;  3HO7 A;  3PPR A;  4DCY A;  1URS A;  4DCX A;  2ZNU A;  1NFT A;  2H9B A;  2Z8D A;  1URG A;  4AQ4 A;  1JW5 A;  3CG3 A;  4QF9 A;  3IOT A;  3HPI A;  4PE5 B;  3EHT A;  1GGG A;  4F3P A;  4YKK A;  2QMX A;  1LCF A;  3N6T A;  1JEU A;  2O84 X;  4L17 A;  4YMA A;  3BBR A;  1ATG A;  1TFD A;  1JVY A;  1Y3P A;  3TTR A;  5L8D A;  3H6W A;  3KBR A;  5ICT A;  5I59 B;  3H03 A;  5L9S A;  4MLV A;  2Z8E A;  3CIJ A;  5I2N A;  2Q89 A;  4GD5 A;  2UYF A;  2Y7K A;  3FV1 A;  3MZ9 A;  4NF4 B;  2HQ0 A;  4R6H A;  4M1V A;  2F7B A;  1BIY A;  2I49 A;  5H8F A;  1Y9U A;  4ZEB A;  3C4M A;  4IO2 A;  1N0T A;  5FTH A;  4U22 A;  5A5X B;  4OER A;  4RNS A;  3IOW A;  4H8I A;  1MXX A;  1FQE A;  3VLV A;  4Q30 B;  1M5E A;  1QUJ A;  3KZG A;  2QMW A;  1B5I A;  4BLA A;  4G4P A;  1MQD A;  1FTK A;  4OET A;  3L6H A;  4EXL A;  2I0C A;  3EPE A;  1HSJ A;  4P0I A;  4RY1 A;  1SW4 A;  3VVF A;  1GTK A;  4QRZ A;  1MG1 A;  3VE1 B;  3K6V A;  1UQW A;  2Q8J A;  1CE2 A;  2F35 A;  5A5X A;  3VV5 A;  3OO9 A;  1FTL A;  1UTB A;  3EHS A;  1JEV A;  5FHN A;  4R9F A;  3LUY A;  2X7P A;  4UA8 A;  3D4G A;  1OMP A;  4F3S A;  1DPP A;  1Y1Z A;  3MJN A;  1NNK A;  2AL4 A;  5I56 B;  1MPD A;  1AMF A;  4ECF A;  1NNT A;  1P1O A;  2QJE A;  1N84 A;  2OWS A;  3MUQ A;  1MXV A;  1OQG A;  1A54 A;  2F6G A;  5HM4 B;  3RTF B;  3IB0 A;  4MH5 A;  1YCJ A;  3RQT A;  2XD2 A;  1A55 A;  3KGC A;  4R72 A;  1TWY A;  3MPL A;  5ITO A;  4QFO A;  5ICQ A;  4JSO A;  1Y20 A;  4KR5 A;  1LAG E;  5AA4 A;  3IO4 A;  3Q25 A;  1EZP A;  4FAT A;  3K2D A;  3CG1 A;  3FXQ A;  4JBZ A;  3MBP A;  1IZ1 A;  1DTZ A;  2VD2 A;  5ELV A;  3B6W A;  4AB5 A;  4EDP A;  2Y7P A;  2FNC A;  5AA1 A;  3SET A;  2A5T A;  3TCG A;  3E3K A;  2A5S A;  2GH9 A;  2KLF A;  1P1U A;  1XVX A;  5H8S A;  4BDR A;  3N5L A;  2DVC A;  4OYV A;  2NWJ A;  3R6U A;  3FUZ A;  1T0K A;  4ZE9 A;  2THI A;  3TQW A;  4RK9 A;  2QPQ A;  3FVK A;  3C36 A;  1USY H;  4U4S A;  3M3F A;  3T9X B;  3ONM A;  2FYI A;  4NF8 A;  3T96 B;  3U93 A;  5TU0 A;  1B3H A;  2UVH A;  5I84 A;  2DVZ A;  1JQF A;  3K6X A;  3S9E A;  2ZNT A;  4LP2 B;  1R9L A;  3PGF A;  2XXR A;  3PUY E;  3R26 A;  2W7Y A;  1A40 A;  4FAJ A;  3K1N A;  3LSW A;  4F1V A;  3MQ9 A;  5CMM A;  4R9G A;  4YAH X;  2PMS A;  3G3J A;  2QS2 A;  1MY0 A;  4H0W A;  5IKB A;  4MLQ A;  1H43 A;  1LBC A;  1B58 A;  3OOA A;  3MPK A;  3WAE A;  2XXY A;  2ZYO A;  3G3H A;  3IOV A;  1SVX B;  4TOZ A;  4GOT A;  3FJG A;  3CFL A;  2XX7 A;  3OSQ A;  2R71 A;  1O7T A;  1MXZ A;  2I3V A;  4R75 A;  3FXU A;  3OXN A;  4ZS9 A;  1XOC A;  5CI5 A;  2HZL A;  3N94 A;  4HCY A;  4F1U A;  1US4 A;  4POW A;  3C31 A;  1MM7 A;  3GLB A;  1B32 A;  3OO6 A;  2HAV A;  3DP8 A;  1XHY A;  3I5O A;  2XXU A;  4MFI A;  4YIC A;  4EF1 A;  3GBB A;  3MWB A;  2OLB A;  1O63 A;  2PT1 A;  3VLW A;  1B3G A;  3EQ1 A;  3FV2 A;  2B65 A;  2RCA A;  3BFT A;  2Z8F A;  3FXR A;  3LSX A;  3HHG A;  1PEB A;  5TP9 B;  4ELO A;  2OJT A;  4H6D A;  4QSD A;  3A09 A;  4EXK A;  5H8N B;  3O28 A;  4R6K A;  1QW0 A;  2QS3 A;  1B46 A;  3ODB A;  2RC9 A;  1AL3 A;  3G7W A;  4G68 B;  2RCB A;  3RGY A;  3SES A;  4LVQ A;  1MQI A;  3SDF A;  3KSX A;  4HW8 A;  3O6H A;  3W9V A;  4DXU A;  1B5H A;  3LSF B;  3PMW A;  5CM6 A;  2I0B A;  1RYX A;  4EF2 A;  1QVS A;  2R6G E;  4Q5T A;  4C1T A;  3T66 A;  3UA8 A;  4KD5 A;  1SW5 A;  4YKJ A;  1BP5 A;  4U4X A;  3V83 A;  1H3D A;  2GRV A;  1QKB A;  5DTB A;  5KZT A;  2YLN A;  3K00 A;  3PD8 A;  5ISU A;  3O6G A;  1I6B A;  4GQO A;  1HSE A;  1OIB A;  4H8J A;  2E0S A;  1M5B A;  4I62 A;  4NE4 A;  1MRP A;  1DSN A;  1GV8 A;  3MZ1 A;  3FJM A;  1MH4 A;  3W15 C;  1B7H A;  2F7A A;  2REJ A;  1XT8 A;  1PB8 A;  3KSJ A;  3TTM A;  3EN3 A;  1Z7N E;  1B7U A;  4F3B A;  3S2V A;  2D5W A;  4GWO A;  3ILU B;  2F97 A;  4H67 A;  3DLN A;  5DVI A;  3C32 A;  5JTY B;  4OES A;  4R74 A;  2DXR A;  3TKD A;  4F3G A;  1FTM A;  3FVN A;  3FAT A;  1IUD A;  1MXW A;  1IXH A;  4LQ2 A;  3HCQ A;  4PFU A;  4LZ8 A;  4X48 A;  3K6W A;  4RPO A;  3P7I A;  3O6I A;  4G77 A;  5L9O A;  4NWD A;  5JEI A;  2DWH A;  3IB1 A;  2HAU A;  2ZXT A;  1S7Y A;  4GLI A;  1NH7 A;  1QUK A;  1MPC A;  1LAH E;  1SYI A;  5JTY A;  1MH3 A;  3GBA A;  2RIN A;  3ECR A;  4U23 A;  4PQJ A;  2CZL A;  1PB9 A;  4P0G A;  4DIG A;  3KJ7 A;  1NNF A;  3FJ7 A;  3PUV E;  3Q27 A;  3K4U A;  3CSG A;  2O7I A;  3TOD A;  2Y84 A;  2NOO A;  5I2N B;  4F18 A;  1AOV A;  3O9P A;  1SW2 A;  4I1D A;  5TPA A;  5H8F B;  3O66 A;  4FOR A;  4G2Z A;  2B3F A;  5CMC A;  3MVW A;  2BJJ X;  2I58 A;  4JXI A;  2Y7I A;  4GL8 A;  2DP8 A;  3ZKL A;  4BDO A;  3KJT A;  1MM6 A;  3SEU A;  2HEU A;  4N13 A;  1OVB A;  1EZ9 A;  3MP1 A;  3H3G A;  1A99 A;  4RJZ A;  3IAZ A;  4QFP A;  2H25 A;  5CMK A;  4RXL A;  1B51 A;  1EU8 A;  3HST A;  1B3L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...