3Q27A

Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (mbp)
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
sequence length
396
structure length
390
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDEALKDAQTNSSVLYVGSKTKEGVVHGVATVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Sugar binding protein, protein fibril
molecule keywords Maltose-binding periplasmic protein/alpha-synuclein chimeric
publication title Structures of segments of alpha-synuclein fused to maltose-binding protein suggest intermediate states during amyloid formation
pubmed doi rcsb
source organism Escherichia coli
total genus 126
structure length 390
sequence length 396
ec nomenclature
pdb deposition date 2010-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q27A02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 3q27A01
3CFZA 3HPIA 2F35A 2OWTA 1B7ZA 2UYFA 2DVCA 4G68B 2FA7A 4FE8A 3RT8A 1B1XA 3HO7A 1AL3A 3RLFE 5I84A 4RK2A 3C4MA 4WXJA 5EYFA 4KQPA 2X26A 5AA4B 1B32A 1B3GA 2A5TA 4LUBA 5H8SA 2O7IA 2E1SA 1JQFA 2XXRA 4F39A 4YU0A 1MH3A 1IZ1A 3ILTB 1B3HA 1B4HA 2YPNA 1MQHA 1XVYA 4ESWA 3CI8A 1QW0A 3C35A 4OZ9A 4OFJA 5CI5A 1MY4A 3BFTA 1AH5A 1VFDA 5I2NA 2PX1A 3O6HA 3H06B 1JETA 3KGCA 3IB0A 4G4PA 3K00A 4UA8A 5ICTA 2B3BA 4JWOA 2ANJA 1JW1A 5I59A 2ALUA 1MXVA 3B6TA 3K6WA 3TUSA 3R26A 3B7DA 3OELA 3G7WA 2QMWA 4G68A 4U23A 3PGFA 3Q25A 3GBAA 1H44A 2I48A 2XXUA 3OO8A 3PPPA 5AA4A 3VE1B 3KN3A 2I49A 5L9MA 2CMOA 4P0IA 4ZDMA 1B0HA 1P1OA 1GR2A 1O7TA 2HCAA 2QMXA 4LONB 1T0KA 1IIWA 1B40A 4IO4A 5DVIA 3PUXE 4BDQA 2IA4A 3Q29A 4PQJA 3DP4A 4RPOA 4MH5A 1POTA 5ISUA 4FEBA 1Q35A 3K6XA 1FCKA 3FVOA 3PPQA 4Q8RA 2XXPA 1ZBMA 2V93A 3KOSA 3HCQA 4FATA 1Y3QA 4HS7A 1US4A 2XXVA 3T22A 3TTRA 4R6HA 3O28A 3FVKA 1NL5A 3T9XB 4OMBA 3KOTA 2O84X 4YKPA 3S9NC 2PT2A 1SD3A 3MUQA 4QSDA 4QRZA 4K3FA 4NTLA 4U4SA 3G3FA 3TCFA 3PUYE 2I3WA 2P1SA 2UYEA 3O29A 1IQ7A 1FW0A 4F3SA 2QS4A 4AQ4A 3KN7A 3USDA 1IEJA 4F1UA 1MQDA 3DLNA 4TOZA 1TT1A 1RYOA 3H03A 1OVBA 3RNNA 2NOOA 5DVFA 3MZ9A 5CBRA 5EHMA 3SESA 3KSXA 4OTEA 1P1QA 2PT1A 4ZECA 1URDA 2PVUA 2Q2AA 3IOUA 1B7HA 3G3JA 1CE2A 3Q26A 4DIGA 5I56B 3PUZE 3D4CA 1M5BA 2BJJX 4MLQA 4XTCQ 5CRYA 2RF1A 2OCUA 2RC9A 3PPOA 3MZ1A 5M2VA 3SEXA 5L9SA 1TXFA 2NUVA 3KSJA 1JVXA 1FTJA 3RPWA 1P99A 2HXWA 2XXIA 4WEPA 4BDNA 1M5DA 4NF4B 1ZMGA 3FUZA 2ONRA 1FQFA 3S9LC 1SYHA 2REJA 4F18A 3N6UA 2G93A 2AYSA 4GXAA 3RT6B 2XD3A 1MQIA 3L6GA 3HN0A 5H8FB 5IAIA 3TPAA 3N94A 4DXUA 2IEEA 2F7BA 2ESNA 4ZE8A 3VV5A 4WKMA 1LLSA 3FJ7A 1LFGA 2GHAA 1UIVA 2F34A 1A7LA 3K4UA 3IAZA 3VLVA 2P0SA 4P11A 4BDRA 4YZZA 4OHNA 1URGA 1N3WA 3VXBA 3QUJA 3UN6A 4GFRA 5CMCA 3EHTA 3D4GA 3T9VA 3FXQA 1A54A 3W9VA 2XXQA 4Z0IA 4MF3A 4XKNA 4IO3A 4ZEKA 3QYTA 2QS3A 5I56A 1MM6A 3QAXA 4YB6A 2NWJA 2Y7PA 3IORA 1DPPA 5IKBA 3O2AA 2GH9A 1N7XA 1ZJLA 4EUOA 1YTVA 2RKMA 4N13A 3KBRA 2ZYKA 4HTGA 1OQHA 1P1WA 3CSBA 4NF4A 2Q2CA 4GVOA 4IO6A 3TCHA 1XVXA 3MQ9A 1N76A 3IB1A 1PB7A 3TMGA 4FAJA 4OERA 5H8FA 1S7YA 3S9MC 3DELB 4YICA 3O6IA 4E0XA 3PV0E 1VE4A 1A55A 1A8FA 3EQ1A 1QVSA 4EQBA 4R72A 2F97A 1YPNA 4GF8A 4TLLB 2YLNA 1S9TA 4ZEBA 5F7VA 5KZTA 1I6BA 4YKJA 5DVJA 5H8QA 2DOJA 4R73A 2ZYMA 3F11A 3CFXA 2I4BA 3V89B 3OEKA 2QS2A 1LBCA 2H4IA 1D4NA 2I6EA 3TCGA 2O51A 1LB8A 1BLFA 3KZGA 5AE4A 1H45A 1DPEA 4U4XA 3LSWA 5TU0A 4EF2A 2Y84A 1DOTA 4QFLA 3ODBA 2HAUA 1ANFA 1N7WA 4KHZE 2B65A 1XHYA 3B6QA 1LFIA 4N07A 2Z23A 1SYIA 3C9HA 2QRYA 3QXMA 2KLFA 3E9XA 4KCCA 1MXWA 4OQOA 2H9BA 4BDOA 4OXVA 1FTOA 2HEUA 2Y7RA 2RC7A 1EH3A 1RYXA 3BFUA 4GLIA 4NF8B 1XC1A 4OETA 1I69A 4KYSA 1MXXA 3OO6A 4G8HA 3E13X 4H1XA 3C32A 4Q0CA 4LQ2A 1A99A 4GRKA 4XKRA 3U92A 2GFEA 4RPNA 1JW4A 2OWSA 3OSQA 1JEUA 2ZXTA 4QFNA 3ZKKA 1PDAA 4KFQA 3WAFA 2QPQA 3PU5A 4LP2B 1ZIUA 1Z7ME 1FQCA 4U2RA 1S50A 3K6UA 4OEVA 5TP9B 1B9JA 2P2AA 4ZEFA 3FASA 3U8QA 1PBQA 4JB7A 2XXHA 4U21A 3SEWA 3O66A 3M3KA 1DSNA 2DSFA 2ZNSA 3G3IA 4LZ7A 3RTWB 3RN8A 1UTHB 3HHGA 3SKPA 4RA1A 4DZ1A 2I0CA 4RY1A 4ELRA 3JZJA 3FV2A 4IO2A 1PB9A 4I62A 4ECFA 4NF8A 5H8HB 1SW5A 1H43A 1FQBA 4PETA 1FTLA 1AIVA 4KR5A 1PBPA 3FATA 2F7CA 3UP9A 4OENA 3SEVA 2UVJA 4JWXA 1ELJA 3N26A 3CIJA 4Z7EA 4OEUA 3SEYA 3TKDA 4PE5B 1A40A 2Z8EA 3IJXB 2DXYA 4OFLA 5AA2A 5BWJA 1MY3A 3HV1A 3KG2A 4GL0A 4KI0E 1OIBA 3C34A 5TP9A 3C36A 3H7MA 4GL8A 2OZZA 2RCBA 2F36A 1ZU0A 3N6TA 3ILUB 1SVXB 2CZLA 3K1PA 4QFKA 2ZMBA 3K1MA 4GOTA 3PMWA 4H8IA 3KJTA 4KD5A 3OO7A 3PPRA 3V5AA 2RCAA 5J1DA 4F3GA 4R75A 1UTHA 2XHDA 3KFMA 3R7XA 3K02A 2NVUB 1BIYA 3TTNA 1N84A 3K2DA 1D3KA 1DTGA 3IO4A 5H8HA 3PD9A 2R71A 1R1NA 2Z8DA 3IL1B 1B3EA 1ZKBA 3FJMA 3ZSFA 1YCJA 1IXHA 2VGQA 3O6GA 3T66A 3CSGA 1AOVA 4OESA 4JWYA 2FYIA 1WVJA 2DP8A 1L5TA 4PFTA 2X7QA 4MLVA 4YMAA 1XS5A 2DWJA 3MPLA 1BTJA 3MP8A 3RUMA 1N04A 3PMXA 3CG1A 3E3KA 4YB5A 1B1HA 1B0LA 3OXNA 1IITA 4JSOA 4RYAA 1NFTA 1FQEA 3TEPA 1GV8A 2AIXA 4Q30B 3L6HA 4H0WA 3H6UA 3S2VA 1HSLA 5AA1A 3U94A 4DXBA 5KDTB 3OENA 3RQTA 1OQGA 1EZ9A 4ND9A 4IY5A 2UVHA 1I6QA 2O6AA 3EHUA 1D9VA 3THIA 1B5JA 3RTFB 4ZEIA 3PMVA 4MFIA 3Q28A 1Y4TA 1QUJA 3QSLA 5CMMA 5K2XA 3HSTA 1FTMA 2GRVA 3TZAA 4EQ9A 1UTBB 4I9DA 1LGBC 3O97A 5ITPA 3VVEA 3OEMA 3I3VA 4PFWA 4LA9A 5I2KB 4O3AA 4C1TA 3H6WA 3PUWE 1NH7A 4KYDA 5A5XA 1QUKA 5H8QB 3MJNA 3AXFA 2V3TA 3GLBA 2UVIA 4O3CA 1Y1ZA 4HCWA 2Q88A 3G3HA 1UQWA 2DE2A 1B6HA 2XX9A 3K6VA 3MAMA 4KYEA 2PYYA 1QUIA 4TLMB 3IOVA 2F78A 4IB2A 2I3VA 4TQUQ 4RK9A 1B5IA 3B6WA 5B7DA 1J1NA 2V25A 1Y3NA 1GVCA 2QS1A 4R6YA 4UACA 4X9TA 1JW5A 1NMUA 2H25A 1NKXA 2Y7IA 3QK6A 3FD3A 4DE8A 1MXYA 3TDJA 3HHFA 5KDTA 3MC2A 1Y9UA 4OFOA 3CFLA 4QSEA 5ICQA 4KPTA 3KEIA 5CMKA 3DP6A 1MDP1 3E4RA 1DMBA 3VVFA 1UIUA 3JV9A 2OK2A 4POXA 4ELQA 2VOZA 1UTBA 3FIRA 4FJPA 4IO5A 1B51A 3LUYA 2FNCA 1NNTA 1LCFA 4O3BA 3FVGA 3OSRA 5I2KA 1MXUA 3IJOB 4LATA 1MH4A 4AB5A 2V3UA 1NNKA 4KCDA 3UK4A 1KWHA 4G68C 3DM0A 1R9QA 1PB8A 2REGA 4PFUA 2H99A 4RXLA 4GWOA 1NNPA 4RJZA 4LZ5A 3QIMA 3EPEA 3M8UA 4NWCA 4E0WA 3OO9A 3RGYA 1B3FA 2XXWA 3FVNA 1H76A 4F1VA 1YAEA 1B4ZA 5DYHA 5ITOA 3G3KA 4M4GA 1SQYA 4QHQA 1MDQA 1LB9A 3MVZA 1B52A 4G77A 4GXSB 4NWDA 1XT8A 4POWA 3S9EA 1JEVA 3PD8A 2Q8JA 4IGTA 3T9UA 1P1NA 4XKPA 4GQOA 5EHSA 3T96B 4OWDA 3FXUA 3GBBA 2PMSA 2X7PA 4EDPA 2VD2A 3A09A 1R9LA 2DQVA 4EXKA 2XXXA 1M5CA 5HBCA 1URSA 1OVTA 1MY2A 5HPQA 2HFBA 2Q9TA 2HZLA 2XD2A 3IO6A 1ZLQA 1LSTA 3FGSA 1SW1A 5TPAB 4JBZA 1QULA 4U1OA 2O1MA 3PUVE 4THIA 1FTKA 1QKAA 3H6VA 2GHBA 3FXRA 4L17A 4F3BA 1M5EA 3U72A 1N0TA 2D21A 3MVWA 3EHSA 3R6UA 4NEDA 1R6ZA 3V8XB 2F8DA 3IB2A 3V83A 4FIMA 3OMBA 1F9BA 5AA2B 4EQ7A 2E0SA 1HSEA 1QJMA 4YKKA 1EU8A 4EXLA 3LSFB 1OLCA 5JTYB 2VD3A 1NH8A 5L9OA 2HZKA 4FORA 1LAXA 1MPCA 2AL5A 1WODA 1ATGA 5CBSA 4JDFA 4R2BA 1MRPA 5FHMA 1LCTA 4LZ8A 1IXIA 5I57B 3BKIB 2O69A 3VXCA 1B05A 4NF5B 4PFYA 5CM6A 1MPDA 4F29A 4X1BA 5FTIA 2AL4A 3VLUA 1POY1 2VP1A 5FHNA 3EN3A 3K1NA 3M3LA 4XKQA 1LAFE 3KN8A 1Q1KA 1Z7NE 1Y4CA 1VFEA 1MQJA 5DEXB 2Y7WA 5TPAA 4ZEDA 3LC8A 1EZOA 1EZPA 4FECA 3T9HB 2LAOA 3ZKLA 4I1DA 4F22A 1IXGA 1TFAA 1FQDA 1TFDA 2DYXA 2Z8FA 5JEIA 4H67A 1LAHE 1FQAA 3O9PA 3ONMA 2HAVA 3UA8A 3FV1A 5FHOA 2OLBA 4C1UA 1MXZA 4AB6A 4DDDA 3H3GA 2D3IA 3K01A 5JTYA 3C31A 3Q27A 1USYE 3C33A 3OOAA 4P0GA 1QKBA 4QF9A 2THIA 2O1LA 1BP5A 4DCXA 4C0RA 2QJEA 3FZVA 5LOMA 4YAHX 4OVJA 5I57A 2R6GE 3T93B 4NF5A 4BLAA 1IUDA 2HQ0A 2ABHA 3VLWA 2ZYNA 3P7IA 4IGRA 2RC8A 3LBSA 3MWBA 4G8MA 1SI1A 1P1UA 5CMBA 4LQ5A 1OLAA 3CG3A 3UORA 3CVGA 1LAGE 5KCJB 5H8NB 1B58A 2XXTA 5DEXA 1Y1MA 4XIGQ 1H3DA 2DE4A 3MZBA 3IOTA 3FJGA 1MY1A 4FEDA 1SDXA 5A5XB 1D9YA 1B7UA 3N5LA 4JXIA 4X1DA 2ONKE 3VDFA 4H65A 3SEUA 5AA2D 2YJPA 4R9GA 1M5FA 4NE4A 1US5A 3CRBA 1MG1A 3LR1A 1SW2A 2XX8A 2DXRA 4LVQA 2H98A 1GGGA 1AMFA 4H5FA 3TELA 3H6TA 2V84A 2H5YA 4DXCA 5F1QA 2O7UA 2QL3A 4ESXA 4YB7A 1JVYA 4ISUA 1ZTYA 4ZS9A 3U93A 5I58B 4IY6A 1MQGA 3TAJA 3H4ZA 3BBRA 4R9FA 1LFHA 5BUUA 2A5SA 5HM4B 3W15C 1B2HA 4DLDA 3VVDA 2D5WA 2DVZA 1XOCA 2R9JA 4NF6B 2ZYOA 1B5HA 1CB6A 2M8CA 2UVGA 3LSLA 5DTBA 2OJTA 4F2QA 5KCJA 5H8NA 4M1VA 2W7YA 4I8CA 3SETA 4HCYA 3MP1A 3PPNA 3CR9A 2OBGA 3TTMA 1B46A 1Y20A 3A3UA 3IOWA 1Y3PA 3GZGA 2XX7A 4H8JA 3K0VA 1WDNA 2O68A 2DS9A 4ZE9A 2I58A 1MM7A 4EF1A 4ONYA 3JYRA 5FTHA 1HSJA 4H5GA 4ELOA 2RINA 1TWYA 4F1YA 1RKMA 2G29A 2PBWA 3A3CA 4RNSA 3TQWA 1VR5A 2DWAA 1OMPA 3MBPA 2ONSA 4F19A 3TQLA 3IR1A 1MPBA 4U1ZA 5I58A 1JNFA 2Q89A 1N3XA 3VFJA 1II5A 2UXAA 3GXAA 1IXCA 1A8EA 1MY0A 3I6VA 2VHAA 2F6PA 3TTKA 4QFOA 4NF6A 1PC3A 1I6AA 2F5XA 1VSOA 1LBBA 2Y7KA 1USYH 4N6PA 3TTLA 4YKIA 3S4UA 4ZZAA 1O64A 2DE3A 3IK6B 3UIFA 5B70A 2B3FA 4G8NA 4JSDA 4R6KA 4XXUA 4GD5A 3M3FA 1GTKA 1O63A 4OYVA 1DTZA 2F6GA 3U1OA 4ZZEA 3SDFA 5ELVA 2I4CA 4F31B 2A5TB 4BDMA 2F7AA 3ZS6A 4BDLA 3TYHA 2V3QA 3RY3A 3LSXA 2ZNTA 2DWHA 4PP0A 4YMBA 3SERA 3MP6A 4X48A 3UGWA 5AA3A 3EF7A 3MPKA 2QSXA 3DP8A 1BKAA 2WKYA 1SW4A 3OD7A 3QUFA 1NNFA 3MVXA 3W9WA 3KJ7A 3I5OA 3IX1A 4IO7A 5CC2A 2XXYA 4R2FA 4U22A 4HW8A 5I2NB 2ZNUA 2I0BA 2DWIA 4QSCA 4DCYA 2Z22A 1PEBA 4GIZA 4F2OA 4WEDA 3WAEA 2NXOA 1MS7A 1B3LA 5K2YA 1SBPA 5DT6A 3G3GA 4QFPA 4F3PA 5JK4A 3TFLA 4H6DA 4MBPA 3MW0A 5L8DA 4R74A 1SI0A 4NMYA 4Q5TA 5I59B 3ECRA 3MVYA 4G2ZA 3TODA 4ELPA
chains in the Genus database with same CATH superfamily
3CFZA 3HPIA 2F35A 2KR0A 2OWTA 1IMFA 1B7ZA 2UYFA 1FBFA 2DVCA 4G68B 2FA7A 1IMEA 4FE8A 3RT8A 1B1XA 3HO7A 1AL3A 3RLFE 5I84A 4RK2A 2B4LA 3C4MA 4OVRA 4WXJA 5EYFA 4KQPA 2X26A 5AA4B 1B32A 1B3GA 2A5TA 4LUBA 5H8SA 2O7IA 3LV0A 2E1SA 1JQFA 5EYGA 2XXRA 4F39A 4YU0A 1MH3A 1IZ1A 3RPLA 3ILTB 1B3HA 1B4HA 1FBGA 2YPNA 1MQHA 1NV2A 1IMCA 1BK4A 1XVYA 4ESWA 3CI8A 1QW0A 3C35A 4OZ9A 4OFJA 5CI5A 1MY4A 3BFTA 1AH5A 1VFDA 4HXVA 2HXRA 2FHYA 5I2NA 4PTKA 2PX1A 3O6HA 3H06B 1JETA 3KGCA 3IB0A 4MJOA 4G4PA 3K00A 4UA8A 3T0JA 5ICTA 2B3BA 4JWOA 2ANJA 1JW1A 4N91A 1NV7A 3FBPA 4O8MA 5I59A 2ALUA 1MXVA 3B6TA 3K6WA 3TUSA 3R26A 3B7DA 1FPFA 4N4UA 3OELA 3G7WA 2QMWA 4G68A 4U23A 1FPJA 3PGFA 3Q25A 2PCRA 4O7MA 4MHFA 3GBAA 1H44A 2F3BA 2I48A 2XXUA 3OO8A 3PPPA 5AA4A 3VE1B 3KN3A 2I49A 5L9MA 2CMOA 4P0IA 4ZDMA 1B0HA 1P1OA 1GR2A 1O7TA 2HCAA 2QMXA 4LONB 1SPIA 1T0KA 1IIWA 1B40A 4IO4A 5DVIA 3PUXE 4BDQA 2IA4A 3Q29A 4PQJA 3DP4A 4RPOA 4MH5A 1POTA 5ISUA 4FEBA 1Q35A 3K6XA 1FCKA 3FVOA 3PPQA 4Q8RA 2XXPA 1ZBMA 2XWIA 4GWYA 2V93A 3KOSA 3HCQA 4FATA 1Y3QA 4HS7A 1US4A 2XXVA 3T22A 3TTRA 5ESYA 4R6HA 3O28A 3FVKA 1NL5A 3T9XB 4OMBA 3KOTA 2O84X 4YKPA 3S9NC 2PT2A 1SD3A 3MUQA 4QSDA 4QRZA 4K3FA 4NTLA 4U4SA 3G3FA 3TCFA 3PUYE 2I3WA 2P1SA 2UYEA 3O29A 1IQ7A 1FW0A 4F3SA 2QS4A 4AQ4A 3KN7A 3USDA 1IEJA 4F1UA 1MQDA 3DLNA 4TOZA 1TT1A 4PC9A 1RYOA 2Y5LA 3H03A 1OVBA 3RNNA 2NOOA 5DVFA 3MZ9A 5CBRA 5EHMA 3SESA 3KSXA 4OTEA 1P1QA 2PT1A 1FBEA 1FBDA 4ZECA 1URDA 4LN5A 2WYKA 2PVUA 2Q2AA 4DI3D 3IOUA 1B7HA 3G3JA 4AS4A 1CE2A 3MYUA 3Q26A 4DIGA 5I56B 3PUZE 3D4CA 1M5BA 2BJJX 1RDYA 4MLQA 4XTCQ 5IM2A 5CRYA 3A29A 4NAPA 2RF1A 5IZ3B 2OCUA 2RC9A 3PPOA 3MZ1A 5M2VA 3SEXA 5L9SA 1TXFA 2NUVA 3KSJA 1JVXA 1FTJA 3BIHA 3RPWA 1P99A 2HXWA 2XXIA 4OANA 4WEPA 4BDNA 1M5DA 4NF4B 1ZMGA 2V4CA 3FUZA 2ONRA 1FQFA 3S9LC 3SZPA 1SYHA 2REJA 4F18A 3N6UA 5ET8A 2G93A 2AYSA 1YYZA 4GXAA 3RT6B 2XD3A 1MQIA 3L6GA 3HN0A 5H8FB 5IAIA 3TPAA 3N94A 4DXUA 2IEEA 4HE1A 2F7BA 2ESNA 1NV3A 4ZE8A 3VV5A 4WKMA 2R8TA 4I3EA 1LLSA 3FJ7A 1LFGA 1FJ9A 2GHAA 5EQ8A 1UIVA 4NF0A 2F34A 1A7LA 4IR8A 3K4UA 3IAZA 3VLVA 2P0SA 4P11A 4BDRA 4YZZA 4OHNA 1URGA 1N3WA 3VXBA 3QUJA 3UN6A 4GFRA 5CMCA 4O7IA 3EHTA 4N6DA 3D4GA 3T9VA 3FXQA 1A54A 3W9VA 2XXQA 4Z0IA 4MF3A 4PGNA 4XKNA 2JJKA 4XEQA 3B8BA 2VPNA 4IO3A 3QYTA 4ZEKA 2QS3A 5I56A 2QFLA 4JVCA 1MM6A 3QAXA 4NHBA 4YB6A 2NWJA 2Y7PA 3IORA 4OVQA 1DPPA 2DDKA 5IKBA 3O2AA 2GH9A 1N7XA 5IZ3A 1ZJLA 4EUOA 1YTVA 2RKMA 4N13A 3KBRA 2ZYKA 4HTGA 1OQHA 4X8RA 1P1WA 3CSBA 4NF4A 2Q2CA 4GVOA 4IO6A 3TCHA 1XVXA 3MQ9A 1N76A 3IB1A 1PB7A 3TMGA 4FAJA 3ISPA 4P1LA 4OERA 5H8FA 4I3YA 1S7YA 1LBZA 3B50A 3S9MC 3EKIA 3DELB 2B4MA 4YICA 3O6IA 4E0XA 3PV0E 1VE4A 1A55A 1A8FA 3EQ1A 5EYHA 1QVSA 4EQBA 4R72A 4MEVA 2F97A 4JVDA 4QXDA 1YPNA 4GF8A 4TLLB 2YLNA 1S9TA 4ZEBA 5F7VA 5KZTA 3QMFA 1I6BA 4YKJA 5DVJA 5H8QA 2DOJA 4R73A 2P3NA 2ZYMA 3F11A 3CFXA 2I4BA 3V89B 3OEKA 2QS2A 1NUWA 1LBCA 2H4IA 1D4NA 2I6EA 4PF8A 2O51A 3TCGA 1LB8A 1BLFA 3KZGA 5AE4A 1H45A 5IGAA 5ET6A 1DPEA 4U4XA 3LSWA 5TU0A 4EF2A 2Y84A 1DOTA 4QFLA 3ODBA 2HAUA 1ANFA 1N7WA 4KHZE 4PDDA 2B65A 1XHYA 3LUZA 3B6QA 5IZ1A 1LFIA 4N07A 2Z23A 1SYIA 3C9HA 2QRYA 3QXMA 2KLFA 2WYPA 3E9XA 4KCCA 4GX3A 1MXWA 4OQOA 2H9BA 4BDOA 4OXVA 1FTOA 2HEUA 2Y7RA 2RC7A 1EH3A 1RYXA 3BFUA 3BIGA 4GLIA 4NF8B 1XC1A 4OETA 1I69A 4KYSA 1MXXA 3OO6A 4G8HA 3E13X 4H1XA 3C32A 1NV4A 4Q0CA 4LQ2A 4PF6A 1A99A 4GRKA 4XKRA 3U92A 2GFEA 4RPNA 1JW4A 2OWSA 3OSQA 4GX6A 1JEUA 2ZXTA 4QFNA 3ZKKA 1PDAA 4KFQA 3WAFA 2QPQA 3PU5A 4LP2B 1ZIUA 1Z7ME 2PFZA 1FQCA 3FXBA 4U2RA 1S50A 3K6UA 4OEVA 5TP9B 1B9JA 2P2AA 4ZEFA 4P56A 3FASA 3U8QA 1PBQA 4JB7A 2XXHA 5I7IA 4XFEA 4U21A 4GBVA 3SEWA 3O66A 3M3KA 2L5VA 1DSNA 2DSFA 2ZNSA 3G3IA 4LZ7A 3RTWB 1RDZA 3RN8A 1UTHB 3HHGA 3SKPA 4RA1A 4DZ1A 2I0CA 4RY1A 4MAGA 4ELRA 3JZJA 3FV2A 4OVSA 5I5PA 4IO2A 1PB9A 4I62A 4ECFA 4NF8A 5H8HB 1INPA 1SW5A 1H43A 1FQBA 4PETA 1FTLA 1AIVA 1FSAA 4KR5A 1PBPA 5EQAA 3FATA 2F7CA 3UP9A 4OENA 3SEVA 2UVJA 4JWXA 1ELJA 3N26A 3CIJA 4Z7EA 4OEUA 3SEYA 3TKDA 4PE5B 1A40A 2Z8EA 3IJXB 2DXYA 4OFLA 5AA2A 5BWJA 1MY3A 3HV1A 4OVTA 3KG2A 4GL0A 4KI0E 1OIBA 4PFIA 3C34A 5TP9A 3C36A 3H7MA 4NGUA 4GL8A 2OZZA 2RCBA 2F36A 1ZU0A 3N6TA 3ILUB 1SVXB 1Q9DA 2CZLA 3K1PA 4QFKA 2ZMBA 3K1MA 4GOTA 3PMWA 4H8IA 3KJTA 4KD5A 3OO7A 3PPRA 3V5AA 2RCAA 5J1DA 1LBYA 4F3GA 4R75A 1UTHA 2XHDA 3KFMA 1FJ6A 2KQZA 3R7XA 3K02A 2NVUB 1BIYA 3TTNA 1KZ8A 1N84A 3K2DA 1D3KA 1DTGA 1DK4A 3U65A 1YZ0A 3IO4A 5H8HA 3PD9A 2R71A 1R1NA 2Z8DA 3IL1B 1B3EA 1ZKBA 3FJMA 3ZSFA 1YCJA 1IXHA 4GX4A 2VGQA 3O6GA 2BJIA 3T66A 1D9QA 3CSGA 2CZKA 1AOVA 4OESA 4JWYA 2FYIA 1WVJA 2DP8A 4PBHA 1L5TA 4PFTA 2X7QA 4MLVA 4YMAA 1VDWA 1XS5A 2DWJA 3MPLA 1BTJA 3MP8A 3RUMA 1NV1A 1N04A 3PMXA 3CG1A 3E3KA 4YB5A 1B1HA 1B0LA 4NG7A 3OXNA 1IITA 4JSOA 3CHGA 1RDXA 4RYAA 1NFTA 1FQEA 3TEPA 1FBCA 1GV8A 2XWKA 2AIXA 5EQ7A 4Q30B 2HPGA 3L6HA 4H0WA 3H6UA 3S2VA 5IZZA 1HSLA 5AA1A 4XF5A 3U94A 1NV0A 4DXBA 5KDTB 1NUZA 3OENA 3RQTA 1OQGA 1EZ9A 1CNQA 4ND9A 4IY5A 2UVHA 1I6QA 4GBWA 2O6AA 3EHUA 1D9VA 3THIA 1B5JA 4H45A 3RTFB 4ZEIA 3PMVA 4MFIA 3Q28A 1Y4TA 1QUJA 1FPLA 4MCOA 3QSLA 5CMMA 5K2XA 3KBZA 3HSTA 1FTMA 2GRVA 3TZAA 4EQ9A 1UTBB 4I9DA 1LGBC 3O97A 5ITPA 3E79A 3VVEA 3OEMA 3I3VA 4HE0A 4LA9A 4PFWA 4KXPA 5I2KB 4O3AA 4C1TA 3H6WA 4GWXA 3PUWE 4MIJA 1NH7A 4KYDA 1KA1A 5A5XA 1QUKA 5H8QB 3MJNA 1DCUA 1NUXA 3AXFA 2V3TA 3GLBA 2UVIA 4O3CA 1Y1ZA 4HCWA 2Q88A 3G3HA 4PFRA 5A5LA 1UQWA 2DE2A 1B6HA 2XX9A 3K6VA 3MAMA 4KYEA 2PYYA 1QUIA 4TLMB 3IOVA 2F78A 2P3VA 4IB2A 4P3LA 2I3VA 3T1BA 4TQUQ 2WX9A 4P9KA 4RK9A 1B5IA 3B6WA 5B7DA 1J1NA 2V25A 1Y3NA 1GVCA 2QS1A 4R6YA 4UACA 2F3DA 4X9TA 1JW5A 1NMUA 4OVPA 2H25A 1NKXA 4PDHA 2Y7IA 3QK6A 3FD3A 4DE8A 1MXYA 3TDJA 3HHFA 5KDTA 3MC2A 1Y9UA 2XXKA 4OFOA 3CFLA 4QSEA 5ICQA 4KPTA 3KEIA 5CMKA 4N15A 3DP6A 1MDP1 3E4RA 1DMBA 3VVFA 1UIUA 3JV9A 2OK2A 4POXA 2ZZVA 4ELQA 2VPOA 2VOZA 2WBBA 1UTBA 3FIRA 4X04A 4FJPA 4IO5A 1B51A 3LUYA 1KA0A 2FNCA 1NNTA 3KC1A 1IMBA 4O3BA 1LCFA 3FVGA 3OSRA 5I2KA 1MXUA 3IJOB 4LATA 1MH4A 4AB5A 2V3UA 4GWUA 1NNKA 4KCDA 3UK4A 1KWHA 4G68C 3DM0A 4N6KA 1R9QA 1PB8A 2REGA 4MNCA 4PFUA 4PBQA 2H99A 4RXLA 4GWOA 5ET5A 1NNPA 1LEVA 2CEYA 4RJZA 5FBPA 4LZ5A 3QIMA 3EPEA 3M8UA 4NWCA 4E0WA 3OO9A 3RGYA 1B3FA 2XXWA 3FVNA 1H76A 1NI9A 1QGXA 4F1VA 1YAEA 1B4ZA 3MSTA 5DYHA 5ITOA 3G3KA 4PAKA 1G0IA 4M4GA 1SQYA 4QHQA 1MDQA 1LB9A 3MVZA 1B52A 4G77A 4GXSB 4NWDA 1XT8A 4POWA 3S9EA 1JEVA 3PD8A 2Q8JA 2XA5A 4IGTA 3T9UA 1P1NA 4XKPA 4GQOA 5EHSA 3T96B 4OWDA 5LTCA 3FXUA 3IFCA 3GBBA 2PMSA 2X7PA 4EDPA 2VD2A 3A09A 2Y5KA 1R9LA 4N17A 2DQVA 4EXKA 2XXXA 1M5CA 5HBCA 1URSA 4N8GA 1OVTA 1MY2A 5HPQA 2HFBA 2Q9TA 4G61A 2HZLA 2XD2A 3IO6A 1ZLQA 4OA4A 1LSTA 3FGSA 4MNIA 1SW1A 2FIXA 4MMPA 2ZZWA 5TPAB 4JBZA 1QULA 4U1OA 1FTAA 2O1MA 3PUVE 4THIA 1FTKA 1QKAA 3H6VA 4UABA 2GHBA 3FXRA 4L17A 4F3BA 1M5EA 3U72A 1N0TA 2D21A 3MVWA 4PAFA 3EHSA 3R6UA 4NEDA 3KC0A 1R6ZA 3V8XB 1FPIA 2F8DA 1K9ZA 3IB2A 5I3SA 3V83A 4FIMA 3OMBA 1F9BA 5AA2B 4N81A 4EQ7A 2E0SA 1HSEA 1QJMA 4YKKA 1EU8A 1FBPA 4EXLA 1LBVA 3LSFB 1OLCA 5JTYB 2VD3A 1NH8A 5L9OA 1EYIA 2HZKA 4FORA 1LAXA 1MPCA 2WEFA 2AL5A 1WODA 1ATGA 5CBSA 4JDFA 4R2BA 1MRPA 1JP4A 1LCTA 4LZ8A 5FHMA 1IXIA 5I57B 3BKIB 2O69A 3VXCA 1B05A 4NF5B 5EQ9A 4PFYA 4JVIA 5CM6A 1MPDA 4F29A 4X1BA 1EYKA 5FTIA 2AL4A 3VLUA 5LDZA 1POY1 2GQ1A 2VP1A 5FHNA 3EN3A 3K1NA 3M3LA 4XKQA 4N8YA 1LAFE 3KN8A 1Q1KA 4P1EA 1Z7NE 3ROJA 1Y4CA 1VFEA 1MQJA 5DEXB 2Y7WA 5TPAA 4ZEDA 3LC8A 1EZOA 1EZPA 4FECA 3T9HB 2LAOA 1LBXA 3ZKLA 4I1DA 4F22A 1IXGA 1TFAA 5DW8A 1FQDA 1TFDA 2DYXA 1FPBA 2Z8FA 5JEIA 4H67A 4MNPA 1LAHE 1FQAA 3O9PA 3ONMA 1FBHA 1NV6A 2HAVA 3UA8A 3FV1A 5FHOA 2OLBA 4C1UA 1MXZA 4AB6A 4DDDA 3D1RA 1NV5A 3H3GA 2D3IA 3K01A 5JTYA 3C31A 3Q27A 1USYE 3C33A 3OOAA 4P0GA 1QKBA 4QF9A 2THIA 5ET7A 2O1LA 1BP5A 4H46A 4DCXA 4C0RA 2QJEA 3FZVA 2Q8MA 2VT5A 5LOMA 4YAHX 4OVJA 2OX3A 5I57A 2R6GE 3T93B 4NF5A 4BLAA 1IUDA 2HQ0A 2ABHA 5J16A 1YXIA 3VLWA 2ZYNA 3P7IA 4IGRA 2RC8A 2ZZXA 3LBSA 3MWBA 4G8MA 1SI1A 1P1UA 5CMBA 4LQ5A 1OLAA 3CG3A 3UORA 1FRPA 3CVGA 1LAGE 5KCJB 5H8NB 1B58A 2XXTA 5DEXA 1Y1MA 4XIGQ 1H3DA 2DE4A 4P8BA 3MZBA 3IOTA 3FJGA 1MY1A 4FEDA 1SDXA 5A5XB 1D9YA 1B7UA 3N5LA 4JXIA 4X1DA 2XWVA 2ONKE 3VDFA 4GWZA 4H65A 2CEXA 3SEUA 1G0HA 5AA2D 2YJPA 4R9GA 4NQ8A 3RYDA 1M5FA 4NE4A 1US5A 3CRBA 1MG1A 3LR1A 1SW2A 2XX8A 2WBDA 2DXRA 4GWWA 2H98A 4LVQA 1GGGA 2MKZA 1AMFA 4H5FA 3TELA 3H6TA 4PFBA 2V84A 2QVRA 2H5YA 4PE3A 4DXCA 5F1QA 2O7UA 2QL3A 4ESXA 4YB7A 1JVYA 4ISUA 1ZTYA 5T3JA 4ZS9A 1K9YA 3U93A 5I58B 4IY6A 1MQGA 3TAJA 3H4ZA 3BBRA 4O94A 4R9FA 1LFHA 1FPDA 5BUUA 2A5SA 1XI6A 4HE2A 5HM4B 3W15C 1B2HA 4DLDA 2D5WA 2DVZA 3VVDA 1XOCA 2R9JA 4PGPA 4NF6B 2ZYOA 1B5HA 1CB6A 2M8CA 2PFYA 2UVGA 3LSLA 5DTBA 2FBPA 2OJTA 2OWZA 4F2QA 5KCJA 5H8NA 4M1VA 2W7YA 4I8CA 3SETA 4HCYA 1FPEA 1NUYA 3MP1A 3PPNA 3CR9A 2OBGA 2XWOA 3TTMA 1FPGA 1B46A 1Y20A 3A3UA 3NOHA 3IOWA 1Y3PA 3GZGA 2XX7A 4H8JA 3K0VA 1WDNA 2O68A 2DS9A 4ZE9A 2I58A 1MM7A 4EF1A 4ONYA 3JYRA 2FVZA 5FTHA 1HSJA 4PCDA 4H5GA 4ELOA 2RINA 1TWYA 4F1YA 1RKMA 2G29A 2PBWA 3A3CA 2Q74A 4RNSA 3TQWA 1VR5A 1EYJA 2DWAA 1OMPA 3MBPA 2ONSA 4GWSA 4F19A 3TQLA 3IR1A 4I40A 1MPBA 4U1ZA 5I58A 1JNFA 2Q89A 1N3XA 3VFJA 5F24A 1II5A 2UXAA 3GXAA 1IMDA 3E78A 3PTYA 1IXCA 1A8EA 1MY0A 1IMAA 1FPKA 3I6VA 2VHAA 2F6PA 3TTKA 4QFOA 3HFUA 4NF6A 4MX6A 1PC3A 1I6AA 2F5XA 4NN3A 1VSOA 1LBBA 2Y7KA 1USYH 4N6PA 3TTLA 4YKIA 3S4UA 4ZZAA 1O64A 2DE3A 3IK6B 3UIFA 5B70A 2B3FA 4G8NA 4JSDA 3IFAA 4R6KA 4XXUA 4GD5A 3M3FA 1GTKA 1O63A 4OYVA 2QVVA 1DTZA 2F6GA 3U1OA 4ZZEA 3SDFA 5ELVA 2I4CA 4F31B 4PAIA 2A5TB 4BDMA 2F7AA 3ZS6A 4BDLA 3TYHA 2V3QA 2CZIA 3RY3A 3LSXA 4QBAA 2ZNTA 1DBZA 4P47A 2DWHA 4PP0A 4YMBA 3SERA 2CZHA 3MP6A 4X48A 3RPLB 2HHMA 3UGWA 5AA3A 3EF7A 3MPKA 2QSXA 3DP8A 1BKAA 2WKYA 1SW4A 3OD7A 3GYYA 3QUFA 1NNFA 3MVXA 3W9WA 3KJ7A 3I5OA 4FBPA 1LBWA 3IX1A 4IO7A 5CC2A 2XXYA 4R2FA 4U22A 1AWBA 4HW8A 5I2NB 2ZNUA 2I0BA 2DWIA 4QSCA 4DCYA 2Z22A 1PEBA 4AS5A 2QVUA 4GIZA 4F2OA 4WEDA 3WAEA 2NXOA 1MS7A 1B3LA 5K2YA 1SBPA 4DI4B 5DT6A 3G3GA 4QFPA 4F3PA 5JK4A 3TFLA 4H6DA 4MBPA 3MW0A 5L8DA 4R74A 1SI0A 4NMYA 4Q5TA 5I59B 3ECRA 3MVYA 4G2ZA 4NX1A 3TODA 2FIEA 4ELPA
chains in the Genus database with same CATH topology
3CFZA 3HPIA 2F35A 2OWTA 1B7ZA 2UYFA 2DVCA 4G68B 2FA7A 4FE8A 3RT8A 1B1XA 3HO7A 1AL3A 3RLFE 5I84A 4RK2A 3C4MA 4WXJA 5EYFA 4KQPA 2X26A 5AA4B 1B32A 1B3GA 2A5TA 4LUBA 5H8SA 2O7IA 2E1SA 1JQFA 2XXRA 4F39A 4YU0A 1MH3A 1IZ1A 3ILTB 1B3HA 1B4HA 2YPNA 1MQHA 1XVYA 4ESWA 3CI8A 1QW0A 3C35A 4OZ9A 4OFJA 5CI5A 1MY4A 3BFTA 1AH5A 1VFDA 5I2NA 2PX1A 3O6HA 3H06B 1JETA 3KGCA 3IB0A 4G4PA 3K00A 4UA8A 5ICTA 2B3BA 4JWOA 2ANJA 1JW1A 5I59A 2ALUA 1MXVA 3B6TA 3K6WA 3TUSA 3R26A 3B7DA 3OELA 3G7WA 2QMWA 4G68A 4U23A 3PGFA 3Q25A 3GBAA 1H44A 2I48A 2XXUA 3OO8A 3PPPA 5AA4A 3VE1B 3KN3A 2I49A 5L9MA 2CMOA 4P0IA 4ZDMA 1B0HA 1P1OA 1GR2A 1O7TA 2HCAA 2QMXA 4LONB 1T0KA 1IIWA 1B40A 4IO4A 5DVIA 3PUXE 4BDQA 2IA4A 3Q29A 4PQJA 3DP4A 4RPOA 4MH5A 1POTA 5ISUA 4FEBA 1Q35A 3K6XA 1FCKA 3FVOA 3PPQA 4Q8RA 2XXPA 1ZBMA 2V93A 3KOSA 3HCQA 4FATA 1Y3QA 4HS7A 1US4A 2XXVA 3T22A 3TTRA 4R6HA 3O28A 3FVKA 1NL5A 3T9XB 4OMBA 3KOTA 2O84X 4YKPA 3S9NC 2PT2A 1SD3A 3MUQA 4QSDA 4QRZA 4K3FA 4NTLA 4U4SA 3G3FA 3TCFA 3PUYE 2I3WA 2P1SA 2UYEA 3O29A 1IQ7A 1FW0A 4F3SA 2QS4A 4AQ4A 3KN7A 3USDA 1IEJA 4F1UA 1MQDA 3DLNA 4TOZA 1TT1A 1RYOA 3H03A 1OVBA 3RNNA 2NOOA 5DVFA 3MZ9A 5CBRA 5EHMA 3SESA 3KSXA 4OTEA 1P1QA 2PT1A 4ZECA 1URDA 2PVUA 2Q2AA 3IOUA 1B7HA 3G3JA 1CE2A 3Q26A 4DIGA 5I56B 3PUZE 3D4CA 1M5BA 2BJJX 4MLQA 4XTCQ 5CRYA 2RF1A 2OCUA 2RC9A 3PPOA 3MZ1A 5M2VA 3SEXA 5L9SA 1TXFA 2NUVA 3KSJA 1JVXA 1FTJA 3RPWA 1P99A 2HXWA 2XXIA 4WEPA 4BDNA 1M5DA 4NF4B 1ZMGA 3FUZA 2ONRA 1FQFA 3S9LC 1SYHA 2REJA 4F18A 3N6UA 2G93A 2AYSA 4GXAA 3RT6B 2XD3A 1MQIA 3L6GA 3HN0A 5H8FB 5IAIA 3TPAA 3N94A 4DXUA 2IEEA 2F7BA 2ESNA 4ZE8A 3VV5A 4WKMA 1LLSA 3FJ7A 1LFGA 2GHAA 1UIVA 2F34A 1A7LA 3K4UA 3IAZA 3VLVA 2P0SA 4P11A 4BDRA 4YZZA 4OHNA 1URGA 1N3WA 3VXBA 3QUJA 3UN6A 4GFRA 5CMCA 3EHTA 3D4GA 3T9VA 3FXQA 1A54A 3W9VA 2XXQA 4Z0IA 4MF3A 4XKNA 4IO3A 4ZEKA 3QYTA 2QS3A 5I56A 1MM6A 3QAXA 4YB6A 2NWJA 2Y7PA 3IORA 1DPPA 5IKBA 3O2AA 2GH9A 1N7XA 1ZJLA 4EUOA 1YTVA 2RKMA 4N13A 3KBRA 2ZYKA 4HTGA 1OQHA 1P1WA 3CSBA 4NF4A 2Q2CA 4GVOA 4IO6A 3TCHA 1XVXA 3MQ9A 1N76A 3IB1A 1PB7A 3TMGA 4FAJA 4OERA 5H8FA 1S7YA 3S9MC 3DELB 4YICA 3O6IA 4E0XA 3PV0E 1VE4A 1A55A 1A8FA 3EQ1A 1QVSA 4EQBA 4R72A 2F97A 1YPNA 4GF8A 4TLLB 2YLNA 1S9TA 4ZEBA 5F7VA 5KZTA 1I6BA 4YKJA 5DVJA 5H8QA 2DOJA 4R73A 2ZYMA 3F11A 3CFXA 2I4BA 3V89B 3OEKA 2QS2A 1LBCA 2H4IA 1D4NA 2I6EA 3TCGA 2O51A 1LB8A 1BLFA 3KZGA 5AE4A 1H45A 1DPEA 4U4XA 3LSWA 5TU0A 4EF2A 2Y84A 1DOTA 4QFLA 3ODBA 2HAUA 1ANFA 1N7WA 4KHZE 2B65A 1XHYA 3B6QA 1LFIA 4N07A 2Z23A 1SYIA 3C9HA 2QRYA 3QXMA 2KLFA 3E9XA 4KCCA 1MXWA 4OQOA 2H9BA 4BDOA 4OXVA 1FTOA 2HEUA 2Y7RA 2RC7A 1EH3A 1RYXA 3BFUA 4GLIA 4NF8B 1XC1A 4OETA 1I69A 4KYSA 1MXXA 3OO6A 4G8HA 3E13X 4H1XA 3C32A 4Q0CA 4LQ2A 1A99A 4GRKA 4XKRA 3U92A 2GFEA 4RPNA 1JW4A 2OWSA 3OSQA 1JEUA 2ZXTA 4QFNA 3ZKKA 1PDAA 4KFQA 3WAFA 2QPQA 3PU5A 4LP2B 1ZIUA 1Z7ME 1FQCA 4U2RA 1S50A 3K6UA 4OEVA 5TP9B 1B9JA 2P2AA 4ZEFA 3FASA 3U8QA 1PBQA 4JB7A 2XXHA 4U21A 3SEWA 3O66A 3M3KA 1DSNA 2DSFA 2ZNSA 3G3IA 4LZ7A 3RTWB 3RN8A 1UTHB 3HHGA 3SKPA 4RA1A 4DZ1A 2I0CA 4RY1A 4ELRA 3JZJA 3FV2A 4IO2A 1PB9A 4I62A 4ECFA 4NF8A 5H8HB 1SW5A 1H43A 1FQBA 4PETA 1FTLA 1AIVA 4KR5A 1PBPA 3FATA 2F7CA 3UP9A 4OENA 3SEVA 2UVJA 4JWXA 1ELJA 3N26A 3CIJA 4Z7EA 4OEUA 3SEYA 3TKDA 4PE5B 1A40A 2Z8EA 3IJXB 2DXYA 4OFLA 5AA2A 5BWJA 1MY3A 3HV1A 3KG2A 4GL0A 4KI0E 1OIBA 3C34A 5TP9A 3C36A 3H7MA 4GL8A 2OZZA 2RCBA 2F36A 1ZU0A 3N6TA 3ILUB 1SVXB 2CZLA 3K1PA 4QFKA 2ZMBA 3K1MA 4GOTA 3PMWA 4H8IA 3KJTA 4KD5A 3OO7A 3PPRA 3V5AA 2RCAA 5J1DA 4F3GA 4R75A 1UTHA 2XHDA 3KFMA 3R7XA 3K02A 2NVUB 1BIYA 3TTNA 1N84A 3K2DA 1D3KA 1DTGA 3IO4A 5H8HA 3PD9A 2R71A 1R1NA 2Z8DA 3IL1B 1B3EA 1ZKBA 3FJMA 3ZSFA 1YCJA 1IXHA 2VGQA 3O6GA 3T66A 3CSGA 1AOVA 4OESA 4JWYA 2FYIA 1WVJA 2DP8A 1L5TA 4PFTA 2X7QA 4MLVA 4YMAA 1XS5A 2DWJA 3MPLA 1BTJA 3MP8A 3RUMA 1N04A 3PMXA 3CG1A 3E3KA 4YB5A 1B1HA 1B0LA 3OXNA 1IITA 4JSOA 4RYAA 1NFTA 1FQEA 3TEPA 1GV8A 2AIXA 4Q30B 3L6HA 4H0WA 3H6UA 3S2VA 1HSLA 5AA1A 3U94A 4DXBA 5KDTB 3OENA 3RQTA 1OQGA 1EZ9A 4ND9A 4IY5A 2UVHA 1I6QA 2O6AA 3EHUA 1D9VA 3THIA 1B5JA 3RTFB 4ZEIA 3PMVA 4MFIA 3Q28A 1Y4TA 1QUJA 3QSLA 5CMMA 5K2XA 3HSTA 1FTMA 2GRVA 3TZAA 4EQ9A 1UTBB 4I9DA 1LGBC 3O97A 5ITPA 3VVEA 3OEMA 3I3VA 4PFWA 4LA9A 5I2KB 4O3AA 4C1TA 3H6WA 3PUWE 1NH7A 4KYDA 5A5XA 1QUKA 5H8QB 3MJNA 3AXFA 2V3TA 3GLBA 2UVIA 4O3CA 1Y1ZA 4HCWA 2Q88A 3G3HA 1UQWA 2DE2A 1B6HA 2XX9A 3K6VA 3MAMA 4KYEA 2PYYA 1QUIA 4TLMB 3IOVA 2F78A 4IB2A 2I3VA 4TQUQ 4RK9A 1B5IA 3B6WA 5B7DA 1J1NA 2V25A 1Y3NA 1GVCA 2QS1A 4R6YA 4UACA 4X9TA 1JW5A 1NMUA 2H25A 1NKXA 2Y7IA 3QK6A 3FD3A 4DE8A 1MXYA 3TDJA 3HHFA 5KDTA 3MC2A 1Y9UA 4OFOA 3CFLA 4QSEA 5ICQA 4KPTA 3KEIA 5CMKA 3DP6A 1MDP1 3E4RA 1DMBA 3VVFA 1UIUA 3JV9A 2OK2A 4POXA 4ELQA 2VOZA 1UTBA 3FIRA 4FJPA 4IO5A 1B51A 3LUYA 2FNCA 1NNTA 1LCFA 4O3BA 3FVGA 3OSRA 5I2KA 1MXUA 3IJOB 4LATA 1MH4A 4AB5A 2V3UA 1NNKA 4KCDA 3UK4A 1KWHA 4G68C 3DM0A 1R9QA 1PB8A 2REGA 4PFUA 2H99A 4RXLA 4GWOA 1NNPA 4RJZA 4LZ5A 3QIMA 3EPEA 3M8UA 4NWCA 4E0WA 3OO9A 3RGYA 1B3FA 2XXWA 3FVNA 1H76A 4F1VA 1YAEA 1B4ZA 5DYHA 5ITOA 3G3KA 4M4GA 1SQYA 4QHQA 1MDQA 1LB9A 3MVZA 1B52A 4G77A 4GXSB 4NWDA 1XT8A 4POWA 3S9EA 1JEVA 3PD8A 2Q8JA 4IGTA 3T9UA 1P1NA 4XKPA 4GQOA 5EHSA 3T96B 4OWDA 3FXUA 3GBBA 2PMSA 2X7PA 4EDPA 2VD2A 3A09A 1R9LA 2DQVA 4EXKA 2XXXA 1M5CA 5HBCA 1URSA 1OVTA 1MY2A 5HPQA 2HFBA 2Q9TA 2HZLA 2XD2A 3IO6A 1ZLQA 1LSTA 3FGSA 1SW1A 5TPAB 4JBZA 1QULA 4U1OA 2O1MA 3PUVE 4THIA 1FTKA 1QKAA 3H6VA 2GHBA 3FXRA 4L17A 4F3BA 1M5EA 3U72A 1N0TA 2D21A 3MVWA 3EHSA 3R6UA 4NEDA 1R6ZA 3V8XB 2F8DA 3IB2A 3V83A 4FIMA 3OMBA 1F9BA 5AA2B 4EQ7A 2E0SA 1HSEA 1QJMA 4YKKA 1EU8A 4EXLA 3LSFB 1OLCA 5JTYB 2VD3A 1NH8A 5L9OA 2HZKA 4FORA 1LAXA 1MPCA 2AL5A 1WODA 1ATGA 5CBSA 4JDFA 4R2BA 1MRPA 5FHMA 1LCTA 4LZ8A 1IXIA 5I57B 3BKIB 2O69A 3VXCA 1B05A 4NF5B 4PFYA 5CM6A 1MPDA 4F29A 4X1BA 5FTIA 2AL4A 3VLUA 1POY1 2VP1A 5FHNA 3EN3A 3K1NA 3M3LA 4XKQA 1LAFE 3KN8A 1Q1KA 1Z7NE 1Y4CA 1VFEA 1MQJA 5DEXB 2Y7WA 5TPAA 4ZEDA 3LC8A 1EZOA 1EZPA 4FECA 3T9HB 2LAOA 3ZKLA 4I1DA 4F22A 1IXGA 1TFAA 1FQDA 1TFDA 2DYXA 2Z8FA 5JEIA 4H67A 1LAHE 1FQAA 3O9PA 3ONMA 2HAVA 3UA8A 3FV1A 5FHOA 2OLBA 4C1UA 1MXZA 4AB6A 4DDDA 3H3GA 2D3IA 3K01A 5JTYA 3C31A 3Q27A 1USYE 3C33A 3OOAA 4P0GA 1QKBA 4QF9A 2THIA 2O1LA 1BP5A 4DCXA 4C0RA 2QJEA 3FZVA 5LOMA 4YAHX 4OVJA 5I57A 2R6GE 3T93B 4NF5A 4BLAA 1IUDA 2HQ0A 2ABHA 3VLWA 2ZYNA 3P7IA 4IGRA 2RC8A 3LBSA 3MWBA 4G8MA 1SI1A 1P1UA 5CMBA 4LQ5A 1OLAA 3CG3A 3UORA 3CVGA 1LAGE 5KCJB 5H8NB 1B58A 2XXTA 5DEXA 1Y1MA 4XIGQ 1H3DA 2DE4A 3MZBA 3IOTA 3FJGA 1MY1A 4FEDA 1SDXA 5A5XB 1D9YA 1B7UA 3N5LA 4JXIA 4X1DA 2ONKE 3VDFA 4H65A 3SEUA 5AA2D 2YJPA 4R9GA 1M5FA 4NE4A 1US5A 3CRBA 1MG1A 3LR1A 1SW2A 2XX8A 2DXRA 4LVQA 2H98A 1GGGA 1AMFA 4H5FA 3TELA 3H6TA 2V84A 2H5YA 4DXCA 5F1QA 2O7UA 2QL3A 4ESXA 4YB7A 1JVYA 4ISUA 1ZTYA 4ZS9A 3U93A 5I58B 4IY6A 1MQGA 3TAJA 3H4ZA 3BBRA 4R9FA 1LFHA 5BUUA 2A5SA 5HM4B 3W15C 1B2HA 4DLDA 3VVDA 2D5WA 2DVZA 1XOCA 2R9JA 4NF6B 2ZYOA 1B5HA 1CB6A 2M8CA 2UVGA 3LSLA 5DTBA 2OJTA 4F2QA 5KCJA 5H8NA 4M1VA 2W7YA 4I8CA 3SETA 4HCYA 3MP1A 3PPNA 3CR9A 2OBGA 3TTMA 1B46A 1Y20A 3A3UA 3IOWA 1Y3PA 3GZGA 2XX7A 4H8JA 3K0VA 1WDNA 2O68A 2DS9A 4ZE9A 2I58A 1MM7A 4EF1A 4ONYA 3JYRA 5FTHA 1HSJA 4H5GA 4ELOA 2RINA 1TWYA 4F1YA 1RKMA 2G29A 2PBWA 3A3CA 4RNSA 3TQWA 1VR5A 2DWAA 1OMPA 3MBPA 2ONSA 4F19A 3TQLA 3IR1A 1MPBA 4U1ZA 5I58A 1JNFA 2Q89A 1N3XA 3VFJA 1II5A 2UXAA 3GXAA 1IXCA 1A8EA 1MY0A 3I6VA 2VHAA 2F6PA 3TTKA 4QFOA 4NF6A 1PC3A 1I6AA 2F5XA 1VSOA 1LBBA 2Y7KA 1USYH 4N6PA 3TTLA 4YKIA 3S4UA 4ZZAA 1O64A 2DE3A 3IK6B 3UIFA 5B70A 2B3FA 4G8NA 4JSDA 4R6KA 4XXUA 4GD5A 3M3FA 1GTKA 1O63A 4OYVA 1DTZA 2F6GA 3U1OA 4ZZEA 3SDFA 5ELVA 2I4CA 4F31B 2A5TB 4BDMA 2F7AA 3ZS6A 4BDLA 3TYHA 2V3QA 3RY3A 3LSXA 2ZNTA 2DWHA 4PP0A 4YMBA 3SERA 3MP6A 4X48A 3UGWA 5AA3A 3EF7A 3MPKA 2QSXA 3DP8A 1BKAA 2WKYA 1SW4A 3OD7A 3QUFA 1NNFA 3MVXA 3W9WA 3KJ7A 3I5OA 3IX1A 4IO7A 5CC2A 2XXYA 4R2FA 4U22A 4HW8A 5I2NB 2ZNUA 2I0BA 2DWIA 4QSCA 4DCYA 2Z22A 1PEBA 4GIZA 4F2OA 4WEDA 3WAEA 2NXOA 1MS7A 1B3LA 5K2YA 1SBPA 5DT6A 3G3GA 4QFPA 4F3PA 5JK4A 3TFLA 4H6DA 4MBPA 3MW0A 5L8DA 4R74A 1SI0A 4NMYA 4Q5TA 5I59B 3ECRA 3MVYA 4G2ZA 3TODA 4ELPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CFZ A;  3HPI A;  2F35 A;  2OWT A;  1B7Z A;  2UYF A;  2DVC A;  4G68 B;  2FA7 A;  4FE8 A;  3RT8 A;  1B1X A;  3HO7 A;  1AL3 A;  3RLF E;  5I84 A;  4RK2 A;  3C4M A;  4WXJ A;  5EYF A;  4KQP A;  2X26 A;  5AA4 B;  1B32 A;  1B3G A;  2A5T A;  4LUB A;  5H8S A;  2O7I A;  2E1S A;  1JQF A;  2XXR A;  4F39 A;  4YU0 A;  1MH3 A;  1IZ1 A;  3ILT B;  1B3H A;  1B4H A;  2YPN A;  1MQH A;  1XVY A;  4ESW A;  3CI8 A;  1QW0 A;  3C35 A;  4OZ9 A;  4OFJ A;  5CI5 A;  1MY4 A;  3BFT A;  1AH5 A;  1VFD A;  5I2N A;  2PX1 A;  3O6H A;  3H06 B;  1JET A;  3KGC A;  3IB0 A;  4G4P A;  3K00 A;  4UA8 A;  5ICT A;  2B3B A;  4JWO A;  2ANJ A;  1JW1 A;  5I59 A;  2ALU A;  1MXV A;  3B6T A;  3K6W A;  3TUS A;  3R26 A;  3B7D A;  3OEL A;  3G7W A;  2QMW A;  4G68 A;  4U23 A;  3PGF A;  3Q25 A;  3GBA A;  1H44 A;  2I48 A;  2XXU A;  3OO8 A;  3PPP A;  5AA4 A;  3VE1 B;  3KN3 A;  2I49 A;  5L9M A;  2CMO A;  4P0I A;  4ZDM A;  1B0H A;  1P1O A;  1GR2 A;  1O7T A;  2HCA A;  2QMX A;  4LON B;  1T0K A;  1IIW A;  1B40 A;  4IO4 A;  5DVI A;  3PUX E;  4BDQ A;  2IA4 A;  3Q29 A;  4PQJ A;  3DP4 A;  4RPO A;  4MH5 A;  1POT A;  5ISU A;  4FEB A;  1Q35 A;  3K6X A;  1FCK A;  3FVO A;  3PPQ A;  4Q8R A;  2XXP A;  1ZBM A;  2V93 A;  3KOS A;  3HCQ A;  4FAT A;  1Y3Q A;  4HS7 A;  1US4 A;  2XXV A;  3T22 A;  3TTR A;  4R6H A;  3O28 A;  3FVK A;  1NL5 A;  3T9X B;  4OMB A;  3KOT A;  2O84 X;  4YKP A;  3S9N C;  2PT2 A;  1SD3 A;  3MUQ A;  4QSD A;  4QRZ A;  4K3F A;  4NTL A;  4U4S A;  3G3F A;  3TCF A;  3PUY E;  2I3W A;  2P1S A;  2UYE A;  3O29 A;  1IQ7 A;  1FW0 A;  4F3S A;  2QS4 A;  4AQ4 A;  3KN7 A;  3USD A;  1IEJ A;  4F1U A;  1MQD A;  3DLN A;  4TOZ A;  1TT1 A;  1RYO A;  3H03 A;  1OVB A;  3RNN A;  2NOO A;  5DVF A;  3MZ9 A;  5CBR A;  5EHM A;  3SES A;  3KSX A;  4OTE A;  1P1Q A;  2PT1 A;  4ZEC A;  1URD A;  2PVU A;  2Q2A A;  3IOU A;  1B7H A;  3G3J A;  1CE2 A;  3Q26 A;  4DIG A;  5I56 B;  3PUZ E;  3D4C A;  1M5B A;  2BJJ X;  4MLQ A;  4XTC Q;  5CRY A;  2RF1 A;  2OCU A;  2RC9 A;  3PPO A;  3MZ1 A;  5M2V A;  3SEX A;  5L9S A;  1TXF A;  2NUV A;  3KSJ A;  1JVX A;  1FTJ A;  3RPW A;  1P99 A;  2HXW A;  2XXI A;  4WEP A;  4BDN A;  1M5D A;  4NF4 B;  1ZMG A;  3FUZ A;  2ONR A;  1FQF A;  3S9L C;  1SYH A;  2REJ A;  4F18 A;  3N6U A;  2G93 A;  2AYS A;  4GXA A;  3RT6 B;  2XD3 A;  1MQI A;  3L6G A;  3HN0 A;  5H8F B;  5IAI A;  3TPA A;  3N94 A;  4DXU A;  2IEE A;  2F7B A;  2ESN A;  4ZE8 A;  3VV5 A;  4WKM A;  1LLS A;  3FJ7 A;  1LFG A;  2GHA A;  1UIV A;  2F34 A;  1A7L A;  3K4U A;  3IAZ A;  3VLV A;  2P0S A;  4P11 A;  4BDR A;  4YZZ A;  4OHN A;  1URG A;  1N3W A;  3VXB A;  3QUJ A;  3UN6 A;  4GFR A;  5CMC A;  3EHT A;  3D4G A;  3T9V A;  3FXQ A;  1A54 A;  3W9V A;  2XXQ A;  4Z0I A;  4MF3 A;  4XKN A;  4IO3 A;  4ZEK A;  3QYT A;  2QS3 A;  5I56 A;  1MM6 A;  3QAX A;  4YB6 A;  2NWJ A;  2Y7P A;  3IOR A;  1DPP A;  5IKB A;  3O2A A;  2GH9 A;  1N7X A;  1ZJL A;  4EUO A;  1YTV A;  2RKM A;  4N13 A;  3KBR A;  2ZYK A;  4HTG A;  1OQH A;  1P1W A;  3CSB A;  4NF4 A;  2Q2C A;  4GVO A;  4IO6 A;  3TCH A;  1XVX A;  3MQ9 A;  1N76 A;  3IB1 A;  1PB7 A;  3TMG A;  4FAJ A;  4OER A;  5H8F A;  1S7Y A;  3S9M C;  3DEL B;  4YIC A;  3O6I A;  4E0X A;  3PV0 E;  1VE4 A;  1A55 A;  1A8F A;  3EQ1 A;  1QVS A;  4EQB A;  4R72 A;  2F97 A;  1YPN A;  4GF8 A;  4TLL B;  2YLN A;  1S9T A;  4ZEB A;  5F7V A;  5KZT A;  1I6B A;  4YKJ A;  5DVJ A;  5H8Q A;  2DOJ A;  4R73 A;  2ZYM A;  3F11 A;  3CFX A;  2I4B A;  3V89 B;  3OEK A;  2QS2 A;  1LBC A;  2H4I A;  1D4N A;  2I6E A;  3TCG A;  2O51 A;  1LB8 A;  1BLF A;  3KZG A;  5AE4 A;  1H45 A;  1DPE A;  4U4X A;  3LSW A;  5TU0 A;  4EF2 A;  2Y84 A;  1DOT A;  4QFL A;  3ODB A;  2HAU A;  1ANF A;  1N7W A;  4KHZ E;  2B65 A;  1XHY A;  3B6Q A;  1LFI A;  4N07 A;  2Z23 A;  1SYI A;  3C9H A;  2QRY A;  3QXM A;  2KLF A;  3E9X A;  4KCC A;  1MXW A;  4OQO A;  2H9B A;  4BDO A;  4OXV A;  1FTO A;  2HEU A;  2Y7R A;  2RC7 A;  1EH3 A;  1RYX A;  3BFU A;  4GLI A;  4NF8 B;  1XC1 A;  4OET A;  1I69 A;  4KYS A;  1MXX A;  3OO6 A;  4G8H A;  3E13 X;  4H1X A;  3C32 A;  4Q0C A;  4LQ2 A;  1A99 A;  4GRK A;  4XKR A;  3U92 A;  2GFE A;  4RPN A;  1JW4 A;  2OWS A;  3OSQ A;  1JEU A;  2ZXT A;  4QFN A;  3ZKK A;  1PDA A;  4KFQ A;  3WAF A;  2QPQ A;  3PU5 A;  4LP2 B;  1ZIU A;  1Z7M E;  1FQC A;  4U2R A;  1S50 A;  3K6U A;  4OEV A;  5TP9 B;  1B9J A;  2P2A A;  4ZEF A;  3FAS A;  3U8Q A;  1PBQ A;  4JB7 A;  2XXH A;  4U21 A;  3SEW A;  3O66 A;  3M3K A;  1DSN A;  2DSF A;  2ZNS A;  3G3I A;  4LZ7 A;  3RTW B;  3RN8 A;  1UTH B;  3HHG A;  3SKP A;  4RA1 A;  4DZ1 A;  2I0C A;  4RY1 A;  4ELR A;  3JZJ A;  3FV2 A;  4IO2 A;  1PB9 A;  4I62 A;  4ECF A;  4NF8 A;  5H8H B;  1SW5 A;  1H43 A;  1FQB A;  4PET A;  1FTL A;  1AIV A;  4KR5 A;  1PBP A;  3FAT A;  2F7C A;  3UP9 A;  4OEN A;  3SEV A;  2UVJ A;  4JWX A;  1ELJ A;  3N26 A;  3CIJ A;  4Z7E A;  4OEU A;  3SEY A;  3TKD A;  4PE5 B;  1A40 A;  2Z8E A;  3IJX B;  2DXY A;  4OFL A;  5AA2 A;  5BWJ A;  1MY3 A;  3HV1 A;  3KG2 A;  4GL0 A;  4KI0 E;  1OIB A;  3C34 A;  5TP9 A;  3C36 A;  3H7M A;  4GL8 A;  2OZZ A;  2RCB A;  2F36 A;  1ZU0 A;  3N6T A;  3ILU B;  1SVX B;  2CZL A;  3K1P A;  4QFK A;  2ZMB A;  3K1M A;  4GOT A;  3PMW A;  4H8I A;  3KJT A;  4KD5 A;  3OO7 A;  3PPR A;  3V5A A;  2RCA A;  5J1D A;  4F3G A;  4R75 A;  1UTH A;  2XHD A;  3KFM A;  3R7X A;  3K02 A;  2NVU B;  1BIY A;  3TTN A;  1N84 A;  3K2D A;  1D3K A;  1DTG A;  3IO4 A;  5H8H A;  3PD9 A;  2R71 A;  1R1N A;  2Z8D A;  3IL1 B;  1B3E A;  1ZKB A;  3FJM A;  3ZSF A;  1YCJ A;  1IXH A;  2VGQ A;  3O6G A;  3T66 A;  3CSG A;  1AOV A;  4OES A;  4JWY A;  2FYI A;  1WVJ A;  2DP8 A;  1L5T A;  4PFT A;  2X7Q A;  4MLV A;  4YMA A;  1XS5 A;  2DWJ A;  3MPL A;  1BTJ A;  3MP8 A;  3RUM A;  1N04 A;  3PMX A;  3CG1 A;  3E3K A;  4YB5 A;  1B1H A;  1B0L A;  3OXN A;  1IIT A;  4JSO A;  4RYA A;  1NFT A;  1FQE A;  3TEP A;  1GV8 A;  2AIX A;  4Q30 B;  3L6H A;  4H0W A;  3H6U A;  3S2V A;  1HSL A;  5AA1 A;  3U94 A;  4DXB A;  5KDT B;  3OEN A;  3RQT A;  1OQG A;  1EZ9 A;  4ND9 A;  4IY5 A;  2UVH A;  1I6Q A;  2O6A A;  3EHU A;  1D9V A;  3THI A;  1B5J A;  3RTF B;  4ZEI A;  3PMV A;  4MFI A;  3Q28 A;  1Y4T A;  1QUJ A;  3QSL A;  5CMM A;  5K2X A;  3HST A;  1FTM A;  2GRV A;  3TZA A;  4EQ9 A;  1UTB B;  4I9D A;  1LGB C;  3O97 A;  5ITP A;  3VVE A;  3OEM A;  3I3V A;  4PFW A;  4LA9 A;  5I2K B;  4O3A A;  4C1T A;  3H6W A;  3PUW E;  1NH7 A;  4KYD A;  5A5X A;  1QUK A;  5H8Q B;  3MJN A;  3AXF A;  2V3T A;  3GLB A;  2UVI A;  4O3C A;  1Y1Z A;  4HCW A;  2Q88 A;  3G3H A;  1UQW A;  2DE2 A;  1B6H A;  2XX9 A;  3K6V A;  3MAM A;  4KYE A;  2PYY A;  1QUI A;  4TLM B;  3IOV A;  2F78 A;  4IB2 A;  2I3V A;  4TQU Q;  4RK9 A;  1B5I A;  3B6W A;  5B7D A;  1J1N A;  2V25 A;  1Y3N A;  1GVC A;  2QS1 A;  4R6Y A;  4UAC A;  4X9T A;  1JW5 A;  1NMU A;  2H25 A;  1NKX A;  2Y7I A;  3QK6 A;  3FD3 A;  4DE8 A;  1MXY A;  3TDJ A;  3HHF A;  5KDT A;  3MC2 A;  1Y9U A;  4OFO A;  3CFL A;  4QSE A;  5ICQ A;  4KPT A;  3KEI A;  5CMK A;  3DP6 A;  1MDP 1;  3E4R A;  1DMB A;  3VVF A;  1UIU A;  3JV9 A;  2OK2 A;  4POX A;  4ELQ A;  2VOZ A;  1UTB A;  3FIR A;  4FJP A;  4IO5 A;  1B51 A;  3LUY A;  2FNC A;  1NNT A;  1LCF A;  4O3B A;  3FVG A;  3OSR A;  5I2K A;  1MXU A;  3IJO B;  4LAT A;  1MH4 A;  4AB5 A;  2V3U A;  1NNK A;  4KCD A;  3UK4 A;  1KWH A;  4G68 C;  3DM0 A;  1R9Q A;  1PB8 A;  2REG A;  4PFU A;  2H99 A;  4RXL A;  4GWO A;  1NNP A;  4RJZ A;  4LZ5 A;  3QIM A;  3EPE A;  3M8U A;  4NWC A;  4E0W A;  3OO9 A;  3RGY A;  1B3F A;  2XXW A;  3FVN A;  1H76 A;  4F1V A;  1YAE A;  1B4Z A;  5DYH A;  5ITO A;  3G3K A;  4M4G A;  1SQY A;  4QHQ A;  1MDQ A;  1LB9 A;  3MVZ A;  1B52 A;  4G77 A;  4GXS B;  4NWD A;  1XT8 A;  4POW A;  3S9E A;  1JEV A;  3PD8 A;  2Q8J A;  4IGT A;  3T9U A;  1P1N A;  4XKP A;  4GQO A;  5EHS A;  3T96 B;  4OWD A;  3FXU A;  3GBB A;  2PMS A;  2X7P A;  4EDP A;  2VD2 A;  3A09 A;  1R9L A;  2DQV A;  4EXK A;  2XXX A;  1M5C A;  5HBC A;  1URS A;  1OVT A;  1MY2 A;  5HPQ A;  2HFB A;  2Q9T A;  2HZL A;  2XD2 A;  3IO6 A;  1ZLQ A;  1LST A;  3FGS A;  1SW1 A;  5TPA B;  4JBZ A;  1QUL A;  4U1O A;  2O1M A;  3PUV E;  4THI A;  1FTK A;  1QKA A;  3H6V A;  2GHB A;  3FXR A;  4L17 A;  4F3B A;  1M5E A;  3U72 A;  1N0T A;  2D21 A;  3MVW A;  3EHS A;  3R6U A;  4NED A;  1R6Z A;  3V8X B;  2F8D A;  3IB2 A;  3V83 A;  4FIM A;  3OMB A;  1F9B A;  5AA2 B;  4EQ7 A;  2E0S A;  1HSE A;  1QJM A;  4YKK A;  1EU8 A;  4EXL A;  3LSF B;  1OLC A;  5JTY B;  2VD3 A;  1NH8 A;  5L9O A;  2HZK A;  4FOR A;  1LAX A;  1MPC A;  2AL5 A;  1WOD A;  1ATG A;  5CBS A;  4JDF A;  4R2B A;  1MRP A;  5FHM A;  1LCT A;  4LZ8 A;  1IXI A;  5I57 B;  3BKI B;  2O69 A;  3VXC A;  1B05 A;  4NF5 B;  4PFY A;  5CM6 A;  1MPD A;  4F29 A;  4X1B A;  5FTI A;  2AL4 A;  3VLU A;  1POY 1;  2VP1 A;  5FHN A;  3EN3 A;  3K1N A;  3M3L A;  4XKQ A;  1LAF E;  3KN8 A;  1Q1K A;  1Z7N E;  1Y4C A;  1VFE A;  1MQJ A;  5DEX B;  2Y7W A;  5TPA A;  4ZED A;  3LC8 A;  1EZO A;  1EZP A;  4FEC A;  3T9H B;  2LAO A;  3ZKL A;  4I1D A;  4F22 A;  1IXG A;  1TFA A;  1FQD A;  1TFD A;  2DYX A;  2Z8F A;  5JEI A;  4H67 A;  1LAH E;  1FQA A;  3O9P A;  3ONM A;  2HAV A;  3UA8 A;  3FV1 A;  5FHO A;  2OLB A;  4C1U A;  1MXZ A;  4AB6 A;  4DDD A;  3H3G A;  2D3I A;  3K01 A;  5JTY A;  3C31 A;  3Q27 A;  1USY E;  3C33 A;  3OOA A;  4P0G A;  1QKB A;  4QF9 A;  2THI A;  2O1L A;  1BP5 A;  4DCX A;  4C0R A;  2QJE A;  3FZV A;  5LOM A;  4YAH X;  4OVJ A;  5I57 A;  2R6G E;  3T93 B;  4NF5 A;  4BLA A;  1IUD A;  2HQ0 A;  2ABH A;  3VLW A;  2ZYN A;  3P7I A;  4IGR A;  2RC8 A;  3LBS A;  3MWB A;  4G8M A;  1SI1 A;  1P1U A;  5CMB A;  4LQ5 A;  1OLA A;  3CG3 A;  3UOR A;  3CVG A;  1LAG E;  5KCJ B;  5H8N B;  1B58 A;  2XXT A;  5DEX A;  1Y1M A;  4XIG Q;  1H3D A;  2DE4 A;  3MZB A;  3IOT A;  3FJG A;  1MY1 A;  4FED A;  1SDX A;  5A5X B;  1D9Y A;  1B7U A;  3N5L A;  4JXI A;  4X1D A;  2ONK E;  3VDF A;  4H65 A;  3SEU A;  5AA2 D;  2YJP A;  4R9G A;  1M5F A;  4NE4 A;  1US5 A;  3CRB A;  1MG1 A;  3LR1 A;  1SW2 A;  2XX8 A;  2DXR A;  4LVQ A;  2H98 A;  1GGG A;  1AMF A;  4H5F A;  3TEL A;  3H6T A;  2V84 A;  2H5Y A;  4DXC A;  5F1Q A;  2O7U A;  2QL3 A;  4ESX A;  4YB7 A;  1JVY A;  4ISU A;  1ZTY A;  4ZS9 A;  3U93 A;  5I58 B;  4IY6 A;  1MQG A;  3TAJ A;  3H4Z A;  3BBR A;  4R9F A;  1LFH A;  5BUU A;  2A5S A;  5HM4 B;  3W15 C;  1B2H A;  4DLD A;  3VVD A;  2D5W A;  2DVZ A;  1XOC A;  2R9J A;  4NF6 B;  2ZYO A;  1B5H A;  1CB6 A;  2M8C A;  2UVG A;  3LSL A;  5DTB A;  2OJT A;  4F2Q A;  5KCJ A;  5H8N A;  4M1V A;  2W7Y A;  4I8C A;  3SET A;  4HCY A;  3MP1 A;  3PPN A;  3CR9 A;  2OBG A;  3TTM A;  1B46 A;  1Y20 A;  3A3U A;  3IOW A;  1Y3P A;  3GZG A;  2XX7 A;  4H8J A;  3K0V A;  1WDN A;  2O68 A;  2DS9 A;  4ZE9 A;  2I58 A;  1MM7 A;  4EF1 A;  4ONY A;  3JYR A;  5FTH A;  1HSJ A;  4H5G A;  4ELO A;  2RIN A;  1TWY A;  4F1Y A;  1RKM A;  2G29 A;  2PBW A;  3A3C A;  4RNS A;  3TQW A;  1VR5 A;  2DWA A;  1OMP A;  3MBP A;  2ONS A;  4F19 A;  3TQL A;  3IR1 A;  1MPB A;  4U1Z A;  5I58 A;  1JNF A;  2Q89 A;  1N3X A;  3VFJ A;  1II5 A;  2UXA A;  3GXA A;  1IXC A;  1A8E A;  1MY0 A;  3I6V A;  2VHA A;  2F6P A;  3TTK A;  4QFO A;  4NF6 A;  1PC3 A;  1I6A A;  2F5X A;  1VSO A;  1LBB A;  2Y7K A;  1USY H;  4N6P A;  3TTL A;  4YKI A;  3S4U A;  4ZZA A;  1O64 A;  2DE3 A;  3IK6 B;  3UIF A;  5B70 A;  2B3F A;  4G8N A;  4JSD A;  4R6K A;  4XXU A;  4GD5 A;  3M3F A;  1GTK A;  1O63 A;  4OYV A;  1DTZ A;  2F6G A;  3U1O A;  4ZZE A;  3SDF A;  5ELV A;  2I4C A;  4F31 B;  2A5T B;  4BDM A;  2F7A A;  3ZS6 A;  4BDL A;  3TYH A;  2V3Q A;  3RY3 A;  3LSX A;  2ZNT A;  2DWH A;  4PP0 A;  4YMB A;  3SER A;  3MP6 A;  4X48 A;  3UGW A;  5AA3 A;  3EF7 A;  3MPK A;  2QSX A;  3DP8 A;  1BKA A;  2WKY A;  1SW4 A;  3OD7 A;  3QUF A;  1NNF A;  3MVX A;  3W9W A;  3KJ7 A;  3I5O A;  3IX1 A;  4IO7 A;  5CC2 A;  2XXY A;  4R2F A;  4U22 A;  4HW8 A;  5I2N B;  2ZNU A;  2I0B A;  2DWI A;  4QSC A;  4DCY A;  2Z22 A;  1PEB A;  4GIZ A;  4F2O A;  4WED A;  3WAE A;  2NXO A;  1MS7 A;  1B3L A;  5K2Y A;  1SBP A;  5DT6 A;  3G3G A;  4QFP A;  4F3P A;  5JK4 A;  3TFL A;  4H6D A;  4MBP A;  3MW0 A;  5L8D A;  4R74 A;  1SI0 A;  4NMY A;  4Q5T A;  5I59 B;  3ECR A;  3MVY A;  4G2Z A;  3TOD A;  4ELP A; 
#chains in the Genus database with same CATH topology
 3CFZ A;  3HPI A;  2F35 A;  2KR0 A;  2OWT A;  1IMF A;  1B7Z A;  2UYF A;  1FBF A;  2DVC A;  4G68 B;  2FA7 A;  1IME A;  4FE8 A;  3RT8 A;  1B1X A;  3HO7 A;  1AL3 A;  3RLF E;  5I84 A;  4RK2 A;  2B4L A;  3C4M A;  4OVR A;  4WXJ A;  5EYF A;  4KQP A;  2X26 A;  5AA4 B;  1B32 A;  1B3G A;  2A5T A;  4LUB A;  5H8S A;  2O7I A;  3LV0 A;  2E1S A;  1JQF A;  5EYG A;  2XXR A;  4F39 A;  4YU0 A;  1MH3 A;  1IZ1 A;  3RPL A;  3ILT B;  1B3H A;  1B4H A;  1FBG A;  2YPN A;  1MQH A;  1NV2 A;  1IMC A;  1BK4 A;  1XVY A;  4ESW A;  3CI8 A;  1QW0 A;  3C35 A;  4OZ9 A;  4OFJ A;  5CI5 A;  1MY4 A;  3BFT A;  1AH5 A;  1VFD A;  4HXV A;  2HXR A;  2FHY A;  5I2N A;  4PTK A;  2PX1 A;  3O6H A;  3H06 B;  1JET A;  3KGC A;  3IB0 A;  4MJO A;  4G4P A;  3K00 A;  4UA8 A;  3T0J A;  5ICT A;  2B3B A;  4JWO A;  2ANJ A;  1JW1 A;  4N91 A;  1NV7 A;  3FBP A;  4O8M A;  5I59 A;  2ALU A;  1MXV A;  3B6T A;  3K6W A;  3TUS A;  3R26 A;  3B7D A;  1FPF A;  4N4U A;  3OEL A;  3G7W A;  2QMW A;  4G68 A;  4U23 A;  1FPJ A;  3PGF A;  3Q25 A;  2PCR A;  4O7M A;  4MHF A;  3GBA A;  1H44 A;  2F3B A;  2I48 A;  2XXU A;  3OO8 A;  3PPP A;  5AA4 A;  3VE1 B;  3KN3 A;  2I49 A;  5L9M A;  2CMO A;  4P0I A;  4ZDM A;  1B0H A;  1P1O A;  1GR2 A;  1O7T A;  2HCA A;  2QMX A;  4LON B;  1SPI A;  1T0K A;  1IIW A;  1B40 A;  4IO4 A;  5DVI A;  3PUX E;  4BDQ A;  2IA4 A;  3Q29 A;  4PQJ A;  3DP4 A;  4RPO A;  4MH5 A;  1POT A;  5ISU A;  4FEB A;  1Q35 A;  3K6X A;  1FCK A;  3FVO A;  3PPQ A;  4Q8R A;  2XXP A;  1ZBM A;  2XWI A;  4GWY A;  2V93 A;  3KOS A;  3HCQ A;  4FAT A;  1Y3Q A;  4HS7 A;  1US4 A;  2XXV A;  3T22 A;  3TTR A;  5ESY A;  4R6H A;  3O28 A;  3FVK A;  1NL5 A;  3T9X B;  4OMB A;  3KOT A;  2O84 X;  4YKP A;  3S9N C;  2PT2 A;  1SD3 A;  3MUQ A;  4QSD A;  4QRZ A;  4K3F A;  4NTL A;  4U4S A;  3G3F A;  3TCF A;  3PUY E;  2I3W A;  2P1S A;  2UYE A;  3O29 A;  1IQ7 A;  1FW0 A;  4F3S A;  2QS4 A;  4AQ4 A;  3KN7 A;  3USD A;  1IEJ A;  4F1U A;  1MQD A;  3DLN A;  4TOZ A;  1TT1 A;  4PC9 A;  1RYO A;  2Y5L A;  3H03 A;  1OVB A;  3RNN A;  2NOO A;  5DVF A;  3MZ9 A;  5CBR A;  5EHM A;  3SES A;  3KSX A;  4OTE A;  1P1Q A;  2PT1 A;  1FBE A;  1FBD A;  4ZEC A;  1URD A;  4LN5 A;  2WYK A;  2PVU A;  2Q2A A;  4DI3 D;  3IOU A;  1B7H A;  3G3J A;  4AS4 A;  1CE2 A;  3MYU A;  3Q26 A;  4DIG A;  5I56 B;  3PUZ E;  3D4C A;  1M5B A;  2BJJ X;  1RDY A;  4MLQ A;  4XTC Q;  5IM2 A;  5CRY A;  3A29 A;  4NAP A;  2RF1 A;  5IZ3 B;  2OCU A;  2RC9 A;  3PPO A;  3MZ1 A;  5M2V A;  3SEX A;  5L9S A;  1TXF A;  2NUV A;  3KSJ A;  1JVX A;  1FTJ A;  3BIH A;  3RPW A;  1P99 A;  2HXW A;  2XXI A;  4OAN A;  4WEP A;  4BDN A;  1M5D A;  4NF4 B;  1ZMG A;  2V4C A;  3FUZ A;  2ONR A;  1FQF A;  3S9L C;  3SZP A;  1SYH A;  2REJ A;  4F18 A;  3N6U A;  5ET8 A;  2G93 A;  2AYS A;  1YYZ A;  4GXA A;  3RT6 B;  2XD3 A;  1MQI A;  3L6G A;  3HN0 A;  5H8F B;  5IAI A;  3TPA A;  3N94 A;  4DXU A;  2IEE A;  4HE1 A;  2F7B A;  2ESN A;  1NV3 A;  4ZE8 A;  3VV5 A;  4WKM A;  2R8T A;  4I3E A;  1LLS A;  3FJ7 A;  1LFG A;  1FJ9 A;  2GHA A;  5EQ8 A;  1UIV A;  4NF0 A;  2F34 A;  1A7L A;  4IR8 A;  3K4U A;  3IAZ A;  3VLV A;  2P0S A;  4P11 A;  4BDR A;  4YZZ A;  4OHN A;  1URG A;  1N3W A;  3VXB A;  3QUJ A;  3UN6 A;  4GFR A;  5CMC A;  4O7I A;  3EHT A;  4N6D A;  3D4G A;  3T9V A;  3FXQ A;  1A54 A;  3W9V A;  2XXQ A;  4Z0I A;  4MF3 A;  4PGN A;  4XKN A;  2JJK A;  4XEQ A;  3B8B A;  2VPN A;  4IO3 A;  3QYT A;  4ZEK A;  2QS3 A;  5I56 A;  2QFL A;  4JVC A;  1MM6 A;  3QAX A;  4NHB A;  4YB6 A;  2NWJ A;  2Y7P A;  3IOR A;  4OVQ A;  1DPP A;  2DDK A;  5IKB A;  3O2A A;  2GH9 A;  1N7X A;  5IZ3 A;  1ZJL A;  4EUO A;  1YTV A;  2RKM A;  4N13 A;  3KBR A;  2ZYK A;  4HTG A;  1OQH A;  4X8R A;  1P1W A;  3CSB A;  4NF4 A;  2Q2C A;  4GVO A;  4IO6 A;  3TCH A;  1XVX A;  3MQ9 A;  1N76 A;  3IB1 A;  1PB7 A;  3TMG A;  4FAJ A;  3ISP A;  4P1L A;  4OER A;  5H8F A;  4I3Y A;  1S7Y A;  1LBZ A;  3B50 A;  3S9M C;  3EKI A;  3DEL B;  2B4M A;  4YIC A;  3O6I A;  4E0X A;  3PV0 E;  1VE4 A;  1A55 A;  1A8F A;  3EQ1 A;  5EYH A;  1QVS A;  4EQB A;  4R72 A;  4MEV A;  2F97 A;  4JVD A;  4QXD A;  1YPN A;  4GF8 A;  4TLL B;  2YLN A;  1S9T A;  4ZEB A;  5F7V A;  5KZT A;  3QMF A;  1I6B A;  4YKJ A;  5DVJ A;  5H8Q A;  2DOJ A;  4R73 A;  2P3N A;  2ZYM A;  3F11 A;  3CFX A;  2I4B A;  3V89 B;  3OEK A;  2QS2 A;  1NUW A;  1LBC A;  2H4I A;  1D4N A;  2I6E A;  4PF8 A;  2O51 A;  3TCG A;  1LB8 A;  1BLF A;  3KZG A;  5AE4 A;  1H45 A;  5IGA A;  5ET6 A;  1DPE A;  4U4X A;  3LSW A;  5TU0 A;  4EF2 A;  2Y84 A;  1DOT A;  4QFL A;  3ODB A;  2HAU A;  1ANF A;  1N7W A;  4KHZ E;  4PDD A;  2B65 A;  1XHY A;  3LUZ A;  3B6Q A;  5IZ1 A;  1LFI A;  4N07 A;  2Z23 A;  1SYI A;  3C9H A;  2QRY A;  3QXM A;  2KLF A;  2WYP A;  3E9X A;  4KCC A;  4GX3 A;  1MXW A;  4OQO A;  2H9B A;  4BDO A;  4OXV A;  1FTO A;  2HEU A;  2Y7R A;  2RC7 A;  1EH3 A;  1RYX A;  3BFU A;  3BIG A;  4GLI A;  4NF8 B;  1XC1 A;  4OET A;  1I69 A;  4KYS A;  1MXX A;  3OO6 A;  4G8H A;  3E13 X;  4H1X A;  3C32 A;  1NV4 A;  4Q0C A;  4LQ2 A;  4PF6 A;  1A99 A;  4GRK A;  4XKR A;  3U92 A;  2GFE A;  4RPN A;  1JW4 A;  2OWS A;  3OSQ A;  4GX6 A;  1JEU A;  2ZXT A;  4QFN A;  3ZKK A;  1PDA A;  4KFQ A;  3WAF A;  2QPQ A;  3PU5 A;  4LP2 B;  1ZIU A;  1Z7M E;  2PFZ A;  1FQC A;  3FXB A;  4U2R A;  1S50 A;  3K6U A;  4OEV A;  5TP9 B;  1B9J A;  2P2A A;  4ZEF A;  4P56 A;  3FAS A;  3U8Q A;  1PBQ A;  4JB7 A;  2XXH A;  5I7I A;  4XFE A;  4U21 A;  4GBV A;  3SEW A;  3O66 A;  3M3K A;  2L5V A;  1DSN A;  2DSF A;  2ZNS A;  3G3I A;  4LZ7 A;  3RTW B;  1RDZ A;  3RN8 A;  1UTH B;  3HHG A;  3SKP A;  4RA1 A;  4DZ1 A;  2I0C A;  4RY1 A;  4MAG A;  4ELR A;  3JZJ A;  3FV2 A;  4OVS A;  5I5P A;  4IO2 A;  1PB9 A;  4I62 A;  4ECF A;  4NF8 A;  5H8H B;  1INP A;  1SW5 A;  1H43 A;  1FQB A;  4PET A;  1FTL A;  1AIV A;  1FSA A;  4KR5 A;  1PBP A;  5EQA A;  3FAT A;  2F7C A;  3UP9 A;  4OEN A;  3SEV A;  2UVJ A;  4JWX A;  1ELJ A;  3N26 A;  3CIJ A;  4Z7E A;  4OEU A;  3SEY A;  3TKD A;  4PE5 B;  1A40 A;  2Z8E A;  3IJX B;  2DXY A;  4OFL A;  5AA2 A;  5BWJ A;  1MY3 A;  3HV1 A;  4OVT A;  3KG2 A;  4GL0 A;  4KI0 E;  1OIB A;  4PFI A;  3C34 A;  5TP9 A;  3C36 A;  3H7M A;  4NGU A;  4GL8 A;  2OZZ A;  2RCB A;  2F36 A;  1ZU0 A;  3N6T A;  3ILU B;  1SVX B;  1Q9D A;  2CZL A;  3K1P A;  4QFK A;  2ZMB A;  3K1M A;  4GOT A;  3PMW A;  4H8I A;  3KJT A;  4KD5 A;  3OO7 A;  3PPR A;  3V5A A;  2RCA A;  5J1D A;  1LBY A;  4F3G A;  4R75 A;  1UTH A;  2XHD A;  3KFM A;  1FJ6 A;  2KQZ A;  3R7X A;  3K02 A;  2NVU B;  1BIY A;  3TTN A;  1KZ8 A;  1N84 A;  3K2D A;  1D3K A;  1DTG A;  1DK4 A;  3U65 A;  1YZ0 A;  3IO4 A;  5H8H A;  3PD9 A;  2R71 A;  1R1N A;  2Z8D A;  3IL1 B;  1B3E A;  1ZKB A;  3FJM A;  3ZSF A;  1YCJ A;  1IXH A;  4GX4 A;  2VGQ A;  3O6G A;  2BJI A;  3T66 A;  1D9Q A;  3CSG A;  2CZK A;  1AOV A;  4OES A;  4JWY A;  2FYI A;  1WVJ A;  2DP8 A;  4PBH A;  1L5T A;  4PFT A;  2X7Q A;  4MLV A;  4YMA A;  1VDW A;  1XS5 A;  2DWJ A;  3MPL A;  1BTJ A;  3MP8 A;  3RUM A;  1NV1 A;  1N04 A;  3PMX A;  3CG1 A;  3E3K A;  4YB5 A;  1B1H A;  1B0L A;  4NG7 A;  3OXN A;  1IIT A;  4JSO A;  3CHG A;  1RDX A;  4RYA A;  1NFT A;  1FQE A;  3TEP A;  1FBC A;  1GV8 A;  2XWK A;  2AIX A;  5EQ7 A;  4Q30 B;  2HPG A;  3L6H A;  4H0W A;  3H6U A;  3S2V A;  5IZZ A;  1HSL A;  5AA1 A;  4XF5 A;  3U94 A;  1NV0 A;  4DXB A;  5KDT B;  1NUZ A;  3OEN A;  3RQT A;  1OQG A;  1EZ9 A;  1CNQ A;  4ND9 A;  4IY5 A;  2UVH A;  1I6Q A;  4GBW A;  2O6A A;  3EHU A;  1D9V A;  3THI A;  1B5J A;  4H45 A;  3RTF B;  4ZEI A;  3PMV A;  4MFI A;  3Q28 A;  1Y4T A;  1QUJ A;  1FPL A;  4MCO A;  3QSL A;  5CMM A;  5K2X A;  3KBZ A;  3HST A;  1FTM A;  2GRV A;  3TZA A;  4EQ9 A;  1UTB B;  4I9D A;  1LGB C;  3O97 A;  5ITP A;  3E79 A;  3VVE A;  3OEM A;  3I3V A;  4HE0 A;  4LA9 A;  4PFW A;  4KXP A;  5I2K B;  4O3A A;  4C1T A;  3H6W A;  4GWX A;  3PUW E;  4MIJ A;  1NH7 A;  4KYD A;  1KA1 A;  5A5X A;  1QUK A;  5H8Q B;  3MJN A;  1DCU A;  1NUX A;  3AXF A;  2V3T A;  3GLB A;  2UVI A;  4O3C A;  1Y1Z A;  4HCW A;  2Q88 A;  3G3H A;  4PFR A;  5A5L A;  1UQW A;  2DE2 A;  1B6H A;  2XX9 A;  3K6V A;  3MAM A;  4KYE A;  2PYY A;  1QUI A;  4TLM B;  3IOV A;  2F78 A;  2P3V A;  4IB2 A;  4P3L A;  2I3V A;  3T1B A;  4TQU Q;  2WX9 A;  4P9K A;  4RK9 A;  1B5I A;  3B6W A;  5B7D A;  1J1N A;  2V25 A;  1Y3N A;  1GVC A;  2QS1 A;  4R6Y A;  4UAC A;  2F3D A;  4X9T A;  1JW5 A;  1NMU A;  4OVP A;  2H25 A;  1NKX A;  4PDH A;  2Y7I A;  3QK6 A;  3FD3 A;  4DE8 A;  1MXY A;  3TDJ A;  3HHF A;  5KDT A;  3MC2 A;  1Y9U A;  2XXK A;  4OFO A;  3CFL A;  4QSE A;  5ICQ A;  4KPT A;  3KEI A;  5CMK A;  4N15 A;  3DP6 A;  1MDP 1;  3E4R A;  1DMB A;  3VVF A;  1UIU A;  3JV9 A;  2OK2 A;  4POX A;  2ZZV A;  4ELQ A;  2VPO A;  2VOZ A;  2WBB A;  1UTB A;  3FIR A;  4X04 A;  4FJP A;  4IO5 A;  1B51 A;  3LUY A;  1KA0 A;  2FNC A;  1NNT A;  3KC1 A;  1IMB A;  4O3B A;  1LCF A;  3FVG A;  3OSR A;  5I2K A;  1MXU A;  3IJO B;  4LAT A;  1MH4 A;  4AB5 A;  2V3U A;  4GWU A;  1NNK A;  4KCD A;  3UK4 A;  1KWH A;  4G68 C;  3DM0 A;  4N6K A;  1R9Q A;  1PB8 A;  2REG A;  4MNC A;  4PFU A;  4PBQ A;  2H99 A;  4RXL A;  4GWO A;  5ET5 A;  1NNP A;  1LEV A;  2CEY A;  4RJZ A;  5FBP A;  4LZ5 A;  3QIM A;  3EPE A;  3M8U A;  4NWC A;  4E0W A;  3OO9 A;  3RGY A;  1B3F A;  2XXW A;  3FVN A;  1H76 A;  1NI9 A;  1QGX A;  4F1V A;  1YAE A;  1B4Z A;  3MST A;  5DYH A;  5ITO A;  3G3K A;  4PAK A;  1G0I A;  4M4G A;  1SQY A;  4QHQ A;  1MDQ A;  1LB9 A;  3MVZ A;  1B52 A;  4G77 A;  4GXS B;  4NWD A;  1XT8 A;  4POW A;  3S9E A;  1JEV A;  3PD8 A;  2Q8J A;  2XA5 A;  4IGT A;  3T9U A;  1P1N A;  4XKP A;  4GQO A;  5EHS A;  3T96 B;  4OWD A;  5LTC A;  3FXU A;  3IFC A;  3GBB A;  2PMS A;  2X7P A;  4EDP A;  2VD2 A;  3A09 A;  2Y5K A;  1R9L A;  4N17 A;  2DQV A;  4EXK A;  2XXX A;  1M5C A;  5HBC A;  1URS A;  4N8G A;  1OVT A;  1MY2 A;  5HPQ A;  2HFB A;  2Q9T A;  4G61 A;  2HZL A;  2XD2 A;  3IO6 A;  1ZLQ A;  4OA4 A;  1LST A;  3FGS A;  4MNI A;  1SW1 A;  2FIX A;  4MMP A;  2ZZW A;  5TPA B;  4JBZ A;  1QUL A;  4U1O A;  1FTA A;  2O1M A;  3PUV E;  4THI A;  1FTK A;  1QKA A;  3H6V A;  4UAB A;  2GHB A;  3FXR A;  4L17 A;  4F3B A;  1M5E A;  3U72 A;  1N0T A;  2D21 A;  3MVW A;  4PAF A;  3EHS A;  3R6U A;  4NED A;  3KC0 A;  1R6Z A;  3V8X B;  1FPI A;  2F8D A;  1K9Z A;  3IB2 A;  5I3S A;  3V83 A;  4FIM A;  3OMB A;  1F9B A;  5AA2 B;  4N81 A;  4EQ7 A;  2E0S A;  1HSE A;  1QJM A;  4YKK A;  1EU8 A;  1FBP A;  4EXL A;  1LBV A;  3LSF B;  1OLC A;  5JTY B;  2VD3 A;  1NH8 A;  5L9O A;  1EYI A;  2HZK A;  4FOR A;  1LAX A;  1MPC A;  2WEF A;  2AL5 A;  1WOD A;  1ATG A;  5CBS A;  4JDF A;  4R2B A;  1MRP A;  1JP4 A;  1LCT A;  4LZ8 A;  5FHM A;  1IXI A;  5I57 B;  3BKI B;  2O69 A;  3VXC A;  1B05 A;  4NF5 B;  5EQ9 A;  4PFY A;  4JVI A;  5CM6 A;  1MPD A;  4F29 A;  4X1B A;  1EYK A;  5FTI A;  2AL4 A;  3VLU A;  5LDZ A;  1POY 1;  2GQ1 A;  2VP1 A;  5FHN A;  3EN3 A;  3K1N A;  3M3L A;  4XKQ A;  4N8Y A;  1LAF E;  3KN8 A;  1Q1K A;  4P1E A;  1Z7N E;  3ROJ A;  1Y4C A;  1VFE A;  1MQJ A;  5DEX B;  2Y7W A;  5TPA A;  4ZED A;  3LC8 A;  1EZO A;  1EZP A;  4FEC A;  3T9H B;  2LAO A;  1LBX A;  3ZKL A;  4I1D A;  4F22 A;  1IXG A;  1TFA A;  5DW8 A;  1FQD A;  1TFD A;  2DYX A;  1FPB A;  2Z8F A;  5JEI A;  4H67 A;  4MNP A;  1LAH E;  1FQA A;  3O9P A;  3ONM A;  1FBH A;  1NV6 A;  2HAV A;  3UA8 A;  3FV1 A;  5FHO A;  2OLB A;  4C1U A;  1MXZ A;  4AB6 A;  4DDD A;  3D1R A;  1NV5 A;  3H3G A;  2D3I A;  3K01 A;  5JTY A;  3C31 A;  3Q27 A;  1USY E;  3C33 A;  3OOA A;  4P0G A;  1QKB A;  4QF9 A;  2THI A;  5ET7 A;  2O1L A;  1BP5 A;  4H46 A;  4DCX A;  4C0R A;  2QJE A;  3FZV A;  2Q8M A;  2VT5 A;  5LOM A;  4YAH X;  4OVJ A;  2OX3 A;  5I57 A;  2R6G E;  3T93 B;  4NF5 A;  4BLA A;  1IUD A;  2HQ0 A;  2ABH A;  5J16 A;  1YXI A;  3VLW A;  2ZYN A;  3P7I A;  4IGR A;  2RC8 A;  2ZZX A;  3LBS A;  3MWB A;  4G8M A;  1SI1 A;  1P1U A;  5CMB A;  4LQ5 A;  1OLA A;  3CG3 A;  3UOR A;  1FRP A;  3CVG A;  1LAG E;  5KCJ B;  5H8N B;  1B58 A;  2XXT A;  5DEX A;  1Y1M A;  4XIG Q;  1H3D A;  2DE4 A;  4P8B A;  3MZB A;  3IOT A;  3FJG A;  1MY1 A;  4FED A;  1SDX A;  5A5X B;  1D9Y A;  1B7U A;  3N5L A;  4JXI A;  4X1D A;  2XWV A;  2ONK E;  3VDF A;  4GWZ A;  4H65 A;  2CEX A;  3SEU A;  1G0H A;  5AA2 D;  2YJP A;  4R9G A;  4NQ8 A;  3RYD A;  1M5F A;  4NE4 A;  1US5 A;  3CRB A;  1MG1 A;  3LR1 A;  1SW2 A;  2XX8 A;  2WBD A;  2DXR A;  4GWW A;  2H98 A;  4LVQ A;  1GGG A;  2MKZ A;  1AMF A;  4H5F A;  3TEL A;  3H6T A;  4PFB A;  2V84 A;  2QVR A;  2H5Y A;  4PE3 A;  4DXC A;  5F1Q A;  2O7U A;  2QL3 A;  4ESX A;  4YB7 A;  1JVY A;  4ISU A;  1ZTY A;  5T3J A;  4ZS9 A;  1K9Y A;  3U93 A;  5I58 B;  4IY6 A;  1MQG A;  3TAJ A;  3H4Z A;  3BBR A;  4O94 A;  4R9F A;  1LFH A;  1FPD A;  5BUU A;  2A5S A;  1XI6 A;  4HE2 A;  5HM4 B;  3W15 C;  1B2H A;  4DLD A;  2D5W A;  2DVZ A;  3VVD A;  1XOC A;  2R9J A;  4PGP A;  4NF6 B;  2ZYO A;  1B5H A;  1CB6 A;  2M8C A;  2PFY A;  2UVG A;  3LSL A;  5DTB A;  2FBP A;  2OJT A;  2OWZ A;  4F2Q A;  5KCJ A;  5H8N A;  4M1V A;  2W7Y A;  4I8C A;  3SET A;  4HCY A;  1FPE A;  1NUY A;  3MP1 A;  3PPN A;  3CR9 A;  2OBG A;  2XWO A;  3TTM A;  1FPG A;  1B46 A;  1Y20 A;  3A3U A;  3NOH A;  3IOW A;  1Y3P A;  3GZG A;  2XX7 A;  4H8J A;  3K0V A;  1WDN A;  2O68 A;  2DS9 A;  4ZE9 A;  2I58 A;  1MM7 A;  4EF1 A;  4ONY A;  3JYR A;  2FVZ A;  5FTH A;  1HSJ A;  4PCD A;  4H5G A;  4ELO A;  2RIN A;  1TWY A;  4F1Y A;  1RKM A;  2G29 A;  2PBW A;  3A3C A;  2Q74 A;  4RNS A;  3TQW A;  1VR5 A;  1EYJ A;  2DWA A;  1OMP A;  3MBP A;  2ONS A;  4GWS A;  4F19 A;  3TQL A;  3IR1 A;  4I40 A;  1MPB A;  4U1Z A;  5I58 A;  1JNF A;  2Q89 A;  1N3X A;  3VFJ A;  5F24 A;  1II5 A;  2UXA A;  3GXA A;  1IMD A;  3E78 A;  3PTY A;  1IXC A;  1A8E A;  1MY0 A;  1IMA A;  1FPK A;  3I6V A;  2VHA A;  2F6P A;  3TTK A;  4QFO A;  3HFU A;  4NF6 A;  4MX6 A;  1PC3 A;  1I6A A;  2F5X A;  4NN3 A;  1VSO A;  1LBB A;  2Y7K A;  1USY H;  4N6P A;  3TTL A;  4YKI A;  3S4U A;  4ZZA A;  1O64 A;  2DE3 A;  3IK6 B;  3UIF A;  5B70 A;  2B3F A;  4G8N A;  4JSD A;  3IFA A;  4R6K A;  4XXU A;  4GD5 A;  3M3F A;  1GTK A;  1O63 A;  4OYV A;  2QVV A;  1DTZ A;  2F6G A;  3U1O A;  4ZZE A;  3SDF A;  5ELV A;  2I4C A;  4F31 B;  4PAI A;  2A5T B;  4BDM A;  2F7A A;  3ZS6 A;  4BDL A;  3TYH A;  2V3Q A;  2CZI A;  3RY3 A;  3LSX A;  4QBA A;  2ZNT A;  1DBZ A;  4P47 A;  2DWH A;  4PP0 A;  4YMB A;  3SER A;  2CZH A;  3MP6 A;  4X48 A;  3RPL B;  2HHM A;  3UGW A;  5AA3 A;  3EF7 A;  3MPK A;  2QSX A;  3DP8 A;  1BKA A;  2WKY A;  1SW4 A;  3OD7 A;  3GYY A;  3QUF A;  1NNF A;  3MVX A;  3W9W A;  3KJ7 A;  3I5O A;  4FBP A;  1LBW A;  3IX1 A;  4IO7 A;  5CC2 A;  2XXY A;  4R2F A;  4U22 A;  1AWB A;  4HW8 A;  5I2N B;  2ZNU A;  2I0B A;  2DWI A;  4QSC A;  4DCY A;  2Z22 A;  1PEB A;  4AS5 A;  2QVU A;  4GIZ A;  4F2O A;  4WED A;  3WAE A;  2NXO A;  1MS7 A;  1B3L A;  5K2Y A;  1SBP A;  4DI4 B;  5DT6 A;  3G3G A;  4QFP A;  4F3P A;  5JK4 A;  3TFL A;  4H6D A;  4MBP A;  3MW0 A;  5L8D A;  4R74 A;  1SI0 A;  4NMY A;  4Q5T A;  5I59 B;  3ECR A;  3MVY A;  4G2Z A;  4NX1 A;  3TOD A;  2FIE A;  4ELP A; 
#chains in the Genus database with same CATH homology
 3CFZ A;  3HPI A;  2F35 A;  2OWT A;  1B7Z A;  2UYF A;  2DVC A;  4G68 B;  2FA7 A;  4FE8 A;  3RT8 A;  1B1X A;  3HO7 A;  1AL3 A;  3RLF E;  5I84 A;  4RK2 A;  3C4M A;  4WXJ A;  5EYF A;  4KQP A;  2X26 A;  5AA4 B;  1B32 A;  1B3G A;  2A5T A;  4LUB A;  5H8S A;  2O7I A;  2E1S A;  1JQF A;  2XXR A;  4F39 A;  4YU0 A;  1MH3 A;  1IZ1 A;  3ILT B;  1B3H A;  1B4H A;  2YPN A;  1MQH A;  1XVY A;  4ESW A;  3CI8 A;  1QW0 A;  3C35 A;  4OZ9 A;  4OFJ A;  5CI5 A;  1MY4 A;  3BFT A;  1AH5 A;  1VFD A;  5I2N A;  2PX1 A;  3O6H A;  3H06 B;  1JET A;  3KGC A;  3IB0 A;  4G4P A;  3K00 A;  4UA8 A;  5ICT A;  2B3B A;  4JWO A;  2ANJ A;  1JW1 A;  5I59 A;  2ALU A;  1MXV A;  3B6T A;  3K6W A;  3TUS A;  3R26 A;  3B7D A;  3OEL A;  3G7W A;  2QMW A;  4G68 A;  4U23 A;  3PGF A;  3Q25 A;  3GBA A;  1H44 A;  2I48 A;  2XXU A;  3OO8 A;  3PPP A;  5AA4 A;  3VE1 B;  3KN3 A;  2I49 A;  5L9M A;  2CMO A;  4P0I A;  4ZDM A;  1B0H A;  1P1O A;  1GR2 A;  1O7T A;  2HCA A;  2QMX A;  4LON B;  1T0K A;  1IIW A;  1B40 A;  4IO4 A;  5DVI A;  3PUX E;  4BDQ A;  2IA4 A;  3Q29 A;  4PQJ A;  3DP4 A;  4RPO A;  4MH5 A;  1POT A;  5ISU A;  4FEB A;  1Q35 A;  3K6X A;  1FCK A;  3FVO A;  3PPQ A;  4Q8R A;  2XXP A;  1ZBM A;  2V93 A;  3KOS A;  3HCQ A;  4FAT A;  1Y3Q A;  4HS7 A;  1US4 A;  2XXV A;  3T22 A;  3TTR A;  4R6H A;  3O28 A;  3FVK A;  1NL5 A;  3T9X B;  4OMB A;  3KOT A;  2O84 X;  4YKP A;  3S9N C;  2PT2 A;  1SD3 A;  3MUQ A;  4QSD A;  4QRZ A;  4K3F A;  4NTL A;  4U4S A;  3G3F A;  3TCF A;  3PUY E;  2I3W A;  2P1S A;  2UYE A;  3O29 A;  1IQ7 A;  1FW0 A;  4F3S A;  2QS4 A;  4AQ4 A;  3KN7 A;  3USD A;  1IEJ A;  4F1U A;  1MQD A;  3DLN A;  4TOZ A;  1TT1 A;  1RYO A;  3H03 A;  1OVB A;  3RNN A;  2NOO A;  5DVF A;  3MZ9 A;  5CBR A;  5EHM A;  3SES A;  3KSX A;  4OTE A;  1P1Q A;  2PT1 A;  4ZEC A;  1URD A;  2PVU A;  2Q2A A;  3IOU A;  1B7H A;  3G3J A;  1CE2 A;  3Q26 A;  4DIG A;  5I56 B;  3PUZ E;  3D4C A;  1M5B A;  2BJJ X;  4MLQ A;  4XTC Q;  5CRY A;  2RF1 A;  2OCU A;  2RC9 A;  3PPO A;  3MZ1 A;  5M2V A;  3SEX A;  5L9S A;  1TXF A;  2NUV A;  3KSJ A;  1JVX A;  1FTJ A;  3RPW A;  1P99 A;  2HXW A;  2XXI A;  4WEP A;  4BDN A;  1M5D A;  4NF4 B;  1ZMG A;  3FUZ A;  2ONR A;  1FQF A;  3S9L C;  1SYH A;  2REJ A;  4F18 A;  3N6U A;  2G93 A;  2AYS A;  4GXA A;  3RT6 B;  2XD3 A;  1MQI A;  3L6G A;  3HN0 A;  5H8F B;  5IAI A;  3TPA A;  3N94 A;  4DXU A;  2IEE A;  2F7B A;  2ESN A;  4ZE8 A;  3VV5 A;  4WKM A;  1LLS A;  3FJ7 A;  1LFG A;  2GHA A;  1UIV A;  2F34 A;  1A7L A;  3K4U A;  3IAZ A;  3VLV A;  2P0S A;  4P11 A;  4BDR A;  4YZZ A;  4OHN A;  1URG A;  1N3W A;  3VXB A;  3QUJ A;  3UN6 A;  4GFR A;  5CMC A;  3EHT A;  3D4G A;  3T9V A;  3FXQ A;  1A54 A;  3W9V A;  2XXQ A;  4Z0I A;  4MF3 A;  4XKN A;  4IO3 A;  4ZEK A;  3QYT A;  2QS3 A;  5I56 A;  1MM6 A;  3QAX A;  4YB6 A;  2NWJ A;  2Y7P A;  3IOR A;  1DPP A;  5IKB A;  3O2A A;  2GH9 A;  1N7X A;  1ZJL A;  4EUO A;  1YTV A;  2RKM A;  4N13 A;  3KBR A;  2ZYK A;  4HTG A;  1OQH A;  1P1W A;  3CSB A;  4NF4 A;  2Q2C A;  4GVO A;  4IO6 A;  3TCH A;  1XVX A;  3MQ9 A;  1N76 A;  3IB1 A;  1PB7 A;  3TMG A;  4FAJ A;  4OER A;  5H8F A;  1S7Y A;  3S9M C;  3DEL B;  4YIC A;  3O6I A;  4E0X A;  3PV0 E;  1VE4 A;  1A55 A;  1A8F A;  3EQ1 A;  1QVS A;  4EQB A;  4R72 A;  2F97 A;  1YPN A;  4GF8 A;  4TLL B;  2YLN A;  1S9T A;  4ZEB A;  5F7V A;  5KZT A;  1I6B A;  4YKJ A;  5DVJ A;  5H8Q A;  2DOJ A;  4R73 A;  2ZYM A;  3F11 A;  3CFX A;  2I4B A;  3V89 B;  3OEK A;  2QS2 A;  1LBC A;  2H4I A;  1D4N A;  2I6E A;  3TCG A;  2O51 A;  1LB8 A;  1BLF A;  3KZG A;  5AE4 A;  1H45 A;  1DPE A;  4U4X A;  3LSW A;  5TU0 A;  4EF2 A;  2Y84 A;  1DOT A;  4QFL A;  3ODB A;  2HAU A;  1ANF A;  1N7W A;  4KHZ E;  2B65 A;  1XHY A;  3B6Q A;  1LFI A;  4N07 A;  2Z23 A;  1SYI A;  3C9H A;  2QRY A;  3QXM A;  2KLF A;  3E9X A;  4KCC A;  1MXW A;  4OQO A;  2H9B A;  4BDO A;  4OXV A;  1FTO A;  2HEU A;  2Y7R A;  2RC7 A;  1EH3 A;  1RYX A;  3BFU A;  4GLI A;  4NF8 B;  1XC1 A;  4OET A;  1I69 A;  4KYS A;  1MXX A;  3OO6 A;  4G8H A;  3E13 X;  4H1X A;  3C32 A;  4Q0C A;  4LQ2 A;  1A99 A;  4GRK A;  4XKR A;  3U92 A;  2GFE A;  4RPN A;  1JW4 A;  2OWS A;  3OSQ A;  1JEU A;  2ZXT A;  4QFN A;  3ZKK A;  1PDA A;  4KFQ A;  3WAF A;  2QPQ A;  3PU5 A;  4LP2 B;  1ZIU A;  1Z7M E;  1FQC A;  4U2R A;  1S50 A;  3K6U A;  4OEV A;  5TP9 B;  1B9J A;  2P2A A;  4ZEF A;  3FAS A;  3U8Q A;  1PBQ A;  4JB7 A;  2XXH A;  4U21 A;  3SEW A;  3O66 A;  3M3K A;  1DSN A;  2DSF A;  2ZNS A;  3G3I A;  4LZ7 A;  3RTW B;  3RN8 A;  1UTH B;  3HHG A;  3SKP A;  4RA1 A;  4DZ1 A;  2I0C A;  4RY1 A;  4ELR A;  3JZJ A;  3FV2 A;  4IO2 A;  1PB9 A;  4I62 A;  4ECF A;  4NF8 A;  5H8H B;  1SW5 A;  1H43 A;  1FQB A;  4PET A;  1FTL A;  1AIV A;  4KR5 A;  1PBP A;  3FAT A;  2F7C A;  3UP9 A;  4OEN A;  3SEV A;  2UVJ A;  4JWX A;  1ELJ A;  3N26 A;  3CIJ A;  4Z7E A;  4OEU A;  3SEY A;  3TKD A;  4PE5 B;  1A40 A;  2Z8E A;  3IJX B;  2DXY A;  4OFL A;  5AA2 A;  5BWJ A;  1MY3 A;  3HV1 A;  3KG2 A;  4GL0 A;  4KI0 E;  1OIB A;  3C34 A;  5TP9 A;  3C36 A;  3H7M A;  4GL8 A;  2OZZ A;  2RCB A;  2F36 A;  1ZU0 A;  3N6T A;  3ILU B;  1SVX B;  2CZL A;  3K1P A;  4QFK A;  2ZMB A;  3K1M A;  4GOT A;  3PMW A;  4H8I A;  3KJT A;  4KD5 A;  3OO7 A;  3PPR A;  3V5A A;  2RCA A;  5J1D A;  4F3G A;  4R75 A;  1UTH A;  2XHD A;  3KFM A;  3R7X A;  3K02 A;  2NVU B;  1BIY A;  3TTN A;  1N84 A;  3K2D A;  1D3K A;  1DTG A;  3IO4 A;  5H8H A;  3PD9 A;  2R71 A;  1R1N A;  2Z8D A;  3IL1 B;  1B3E A;  1ZKB A;  3FJM A;  3ZSF A;  1YCJ A;  1IXH A;  2VGQ A;  3O6G A;  3T66 A;  3CSG A;  1AOV A;  4OES A;  4JWY A;  2FYI A;  1WVJ A;  2DP8 A;  1L5T A;  4PFT A;  2X7Q A;  4MLV A;  4YMA A;  1XS5 A;  2DWJ A;  3MPL A;  1BTJ A;  3MP8 A;  3RUM A;  1N04 A;  3PMX A;  3CG1 A;  3E3K A;  4YB5 A;  1B1H A;  1B0L A;  3OXN A;  1IIT A;  4JSO A;  4RYA A;  1NFT A;  1FQE A;  3TEP A;  1GV8 A;  2AIX A;  4Q30 B;  3L6H A;  4H0W A;  3H6U A;  3S2V A;  1HSL A;  5AA1 A;  3U94 A;  4DXB A;  5KDT B;  3OEN A;  3RQT A;  1OQG A;  1EZ9 A;  4ND9 A;  4IY5 A;  2UVH A;  1I6Q A;  2O6A A;  3EHU A;  1D9V A;  3THI A;  1B5J A;  3RTF B;  4ZEI A;  3PMV A;  4MFI A;  3Q28 A;  1Y4T A;  1QUJ A;  3QSL A;  5CMM A;  5K2X A;  3HST A;  1FTM A;  2GRV A;  3TZA A;  4EQ9 A;  1UTB B;  4I9D A;  1LGB C;  3O97 A;  5ITP A;  3VVE A;  3OEM A;  3I3V A;  4PFW A;  4LA9 A;  5I2K B;  4O3A A;  4C1T A;  3H6W A;  3PUW E;  1NH7 A;  4KYD A;  5A5X A;  1QUK A;  5H8Q B;  3MJN A;  3AXF A;  2V3T A;  3GLB A;  2UVI A;  4O3C A;  1Y1Z A;  4HCW A;  2Q88 A;  3G3H A;  1UQW A;  2DE2 A;  1B6H A;  2XX9 A;  3K6V A;  3MAM A;  4KYE A;  2PYY A;  1QUI A;  4TLM B;  3IOV A;  2F78 A;  4IB2 A;  2I3V A;  4TQU Q;  4RK9 A;  1B5I A;  3B6W A;  5B7D A;  1J1N A;  2V25 A;  1Y3N A;  1GVC A;  2QS1 A;  4R6Y A;  4UAC A;  4X9T A;  1JW5 A;  1NMU A;  2H25 A;  1NKX A;  2Y7I A;  3QK6 A;  3FD3 A;  4DE8 A;  1MXY A;  3TDJ A;  3HHF A;  5KDT A;  3MC2 A;  1Y9U A;  4OFO A;  3CFL A;  4QSE A;  5ICQ A;  4KPT A;  3KEI A;  5CMK A;  3DP6 A;  1MDP 1;  3E4R A;  1DMB A;  3VVF A;  1UIU A;  3JV9 A;  2OK2 A;  4POX A;  4ELQ A;  2VOZ A;  1UTB A;  3FIR A;  4FJP A;  4IO5 A;  1B51 A;  3LUY A;  2FNC A;  1NNT A;  1LCF A;  4O3B A;  3FVG A;  3OSR A;  5I2K A;  1MXU A;  3IJO B;  4LAT A;  1MH4 A;  4AB5 A;  2V3U A;  1NNK A;  4KCD A;  3UK4 A;  1KWH A;  4G68 C;  3DM0 A;  1R9Q A;  1PB8 A;  2REG A;  4PFU A;  2H99 A;  4RXL A;  4GWO A;  1NNP A;  4RJZ A;  4LZ5 A;  3QIM A;  3EPE A;  3M8U A;  4NWC A;  4E0W A;  3OO9 A;  3RGY A;  1B3F A;  2XXW A;  3FVN A;  1H76 A;  4F1V A;  1YAE A;  1B4Z A;  5DYH A;  5ITO A;  3G3K A;  4M4G A;  1SQY A;  4QHQ A;  1MDQ A;  1LB9 A;  3MVZ A;  1B52 A;  4G77 A;  4GXS B;  4NWD A;  1XT8 A;  4POW A;  3S9E A;  1JEV A;  3PD8 A;  2Q8J A;  4IGT A;  3T9U A;  1P1N A;  4XKP A;  4GQO A;  5EHS A;  3T96 B;  4OWD A;  3FXU A;  3GBB A;  2PMS A;  2X7P A;  4EDP A;  2VD2 A;  3A09 A;  1R9L A;  2DQV A;  4EXK A;  2XXX A;  1M5C A;  5HBC A;  1URS A;  1OVT A;  1MY2 A;  5HPQ A;  2HFB A;  2Q9T A;  2HZL A;  2XD2 A;  3IO6 A;  1ZLQ A;  1LST A;  3FGS A;  1SW1 A;  5TPA B;  4JBZ A;  1QUL A;  4U1O A;  2O1M A;  3PUV E;  4THI A;  1FTK A;  1QKA A;  3H6V A;  2GHB A;  3FXR A;  4L17 A;  4F3B A;  1M5E A;  3U72 A;  1N0T A;  2D21 A;  3MVW A;  3EHS A;  3R6U A;  4NED A;  1R6Z A;  3V8X B;  2F8D A;  3IB2 A;  3V83 A;  4FIM A;  3OMB A;  1F9B A;  5AA2 B;  4EQ7 A;  2E0S A;  1HSE A;  1QJM A;  4YKK A;  1EU8 A;  4EXL A;  3LSF B;  1OLC A;  5JTY B;  2VD3 A;  1NH8 A;  5L9O A;  2HZK A;  4FOR A;  1LAX A;  1MPC A;  2AL5 A;  1WOD A;  1ATG A;  5CBS A;  4JDF A;  4R2B A;  1MRP A;  5FHM A;  1LCT A;  4LZ8 A;  1IXI A;  5I57 B;  3BKI B;  2O69 A;  3VXC A;  1B05 A;  4NF5 B;  4PFY A;  5CM6 A;  1MPD A;  4F29 A;  4X1B A;  5FTI A;  2AL4 A;  3VLU A;  1POY 1;  2VP1 A;  5FHN A;  3EN3 A;  3K1N A;  3M3L A;  4XKQ A;  1LAF E;  3KN8 A;  1Q1K A;  1Z7N E;  1Y4C A;  1VFE A;  1MQJ A;  5DEX B;  2Y7W A;  5TPA A;  4ZED A;  3LC8 A;  1EZO A;  1EZP A;  4FEC A;  3T9H B;  2LAO A;  3ZKL A;  4I1D A;  4F22 A;  1IXG A;  1TFA A;  1FQD A;  1TFD A;  2DYX A;  2Z8F A;  5JEI A;  4H67 A;  1LAH E;  1FQA A;  3O9P A;  3ONM A;  2HAV A;  3UA8 A;  3FV1 A;  5FHO A;  2OLB A;  4C1U A;  1MXZ A;  4AB6 A;  4DDD A;  3H3G A;  2D3I A;  3K01 A;  5JTY A;  3C31 A;  3Q27 A;  1USY E;  3C33 A;  3OOA A;  4P0G A;  1QKB A;  4QF9 A;  2THI A;  2O1L A;  1BP5 A;  4DCX A;  4C0R A;  2QJE A;  3FZV A;  5LOM A;  4YAH X;  4OVJ A;  5I57 A;  2R6G E;  3T93 B;  4NF5 A;  4BLA A;  1IUD A;  2HQ0 A;  2ABH A;  3VLW A;  2ZYN A;  3P7I A;  4IGR A;  2RC8 A;  3LBS A;  3MWB A;  4G8M A;  1SI1 A;  1P1U A;  5CMB A;  4LQ5 A;  1OLA A;  3CG3 A;  3UOR A;  3CVG A;  1LAG E;  5KCJ B;  5H8N B;  1B58 A;  2XXT A;  5DEX A;  1Y1M A;  4XIG Q;  1H3D A;  2DE4 A;  3MZB A;  3IOT A;  3FJG A;  1MY1 A;  4FED A;  1SDX A;  5A5X B;  1D9Y A;  1B7U A;  3N5L A;  4JXI A;  4X1D A;  2ONK E;  3VDF A;  4H65 A;  3SEU A;  5AA2 D;  2YJP A;  4R9G A;  1M5F A;  4NE4 A;  1US5 A;  3CRB A;  1MG1 A;  3LR1 A;  1SW2 A;  2XX8 A;  2DXR A;  4LVQ A;  2H98 A;  1GGG A;  1AMF A;  4H5F A;  3TEL A;  3H6T A;  2V84 A;  2H5Y A;  4DXC A;  5F1Q A;  2O7U A;  2QL3 A;  4ESX A;  4YB7 A;  1JVY A;  4ISU A;  1ZTY A;  4ZS9 A;  3U93 A;  5I58 B;  4IY6 A;  1MQG A;  3TAJ A;  3H4Z A;  3BBR A;  4R9F A;  1LFH A;  5BUU A;  2A5S A;  5HM4 B;  3W15 C;  1B2H A;  4DLD A;  3VVD A;  2D5W A;  2DVZ A;  1XOC A;  2R9J A;  4NF6 B;  2ZYO A;  1B5H A;  1CB6 A;  2M8C A;  2UVG A;  3LSL A;  5DTB A;  2OJT A;  4F2Q A;  5KCJ A;  5H8N A;  4M1V A;  2W7Y A;  4I8C A;  3SET A;  4HCY A;  3MP1 A;  3PPN A;  3CR9 A;  2OBG A;  3TTM A;  1B46 A;  1Y20 A;  3A3U A;  3IOW A;  1Y3P A;  3GZG A;  2XX7 A;  4H8J A;  3K0V A;  1WDN A;  2O68 A;  2DS9 A;  4ZE9 A;  2I58 A;  1MM7 A;  4EF1 A;  4ONY A;  3JYR A;  5FTH A;  1HSJ A;  4H5G A;  4ELO A;  2RIN A;  1TWY A;  4F1Y A;  1RKM A;  2G29 A;  2PBW A;  3A3C A;  4RNS A;  3TQW A;  1VR5 A;  2DWA A;  1OMP A;  3MBP A;  2ONS A;  4F19 A;  3TQL A;  3IR1 A;  1MPB A;  4U1Z A;  5I58 A;  1JNF A;  2Q89 A;  1N3X A;  3VFJ A;  1II5 A;  2UXA A;  3GXA A;  1IXC A;  1A8E A;  1MY0 A;  3I6V A;  2VHA A;  2F6P A;  3TTK A;  4QFO A;  4NF6 A;  1PC3 A;  1I6A A;  2F5X A;  1VSO A;  1LBB A;  2Y7K A;  1USY H;  4N6P A;  3TTL A;  4YKI A;  3S4U A;  4ZZA A;  1O64 A;  2DE3 A;  3IK6 B;  3UIF A;  5B70 A;  2B3F A;  4G8N A;  4JSD A;  4R6K A;  4XXU A;  4GD5 A;  3M3F A;  1GTK A;  1O63 A;  4OYV A;  1DTZ A;  2F6G A;  3U1O A;  4ZZE A;  3SDF A;  5ELV A;  2I4C A;  4F31 B;  2A5T B;  4BDM A;  2F7A A;  3ZS6 A;  4BDL A;  3TYH A;  2V3Q A;  3RY3 A;  3LSX A;  2ZNT A;  2DWH A;  4PP0 A;  4YMB A;  3SER A;  3MP6 A;  4X48 A;  3UGW A;  5AA3 A;  3EF7 A;  3MPK A;  2QSX A;  3DP8 A;  1BKA A;  2WKY A;  1SW4 A;  3OD7 A;  3QUF A;  1NNF A;  3MVX A;  3W9W A;  3KJ7 A;  3I5O A;  3IX1 A;  4IO7 A;  5CC2 A;  2XXY A;  4R2F A;  4U22 A;  4HW8 A;  5I2N B;  2ZNU A;  2I0B A;  2DWI A;  4QSC A;  4DCY A;  2Z22 A;  1PEB A;  4GIZ A;  4F2O A;  4WED A;  3WAE A;  2NXO A;  1MS7 A;  1B3L A;  5K2Y A;  1SBP A;  5DT6 A;  3G3G A;  4QFP A;  4F3P A;  5JK4 A;  3TFL A;  4H6D A;  4MBP A;  3MW0 A;  5L8D A;  4R74 A;  1SI0 A;  4NMY A;  4Q5T A;  5I59 B;  3ECR A;  3MVY A;  4G2Z A;  3TOD A;  4ELP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...